data_5DKB
# 
_entry.id   5DKB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DKB         
WWPDB D_1000213344 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5DL4 PDB . 
unspecified 5DKS PDB . 
unspecified 5DKG PDB . 
unspecified 5DKE PDB . 
unspecified 5DK9 PDB . 
unspecified 5DIG PDB . 
unspecified 5DIE PDB . 
unspecified 5DID PDB . 
unspecified 5DI7 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DKB 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nwachukwu, J.C.'        1  
'Srinivasan, S.'         2  
'Zheng, Y.'              3  
'Wang, S.'               4  
'Min, J.'                5  
'Dong, C.'               6  
'Liao, Z.'               7  
'Cavett, V.'             8  
'Nowak, J.'              9  
'Houtman, R.'            10 
'Carlson, K.E.'          11 
'Josan, J.S.'            12 
'Elemento, O.'           13 
'Katzenellenbogen, J.A.' 14 
'Zhou, H.B.'             15 
'Nettles, K.W.'          16 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Syst.Biol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1744-4292 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            12 
_citation.language                  ? 
_citation.page_first                864 
_citation.page_last                 864 
_citation.title                     'Predictive features of ligand-specific signaling through the estrogen receptor.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/msb.20156701 
_citation.pdbx_database_id_PubMed   27107013 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nwachukwu, J.C.'        1  
primary 'Srinivasan, S.'         2  
primary 'Zheng, Y.'              3  
primary 'Wang, S.'               4  
primary 'Min, J.'                5  
primary 'Dong, C.'               6  
primary 'Liao, Z.'               7  
primary 'Nowak, J.'              8  
primary 'Wright, N.J.'           9  
primary 'Houtman, R.'            10 
primary 'Carlson, K.E.'          11 
primary 'Josan, J.S.'            12 
primary 'Elemento, O.'           13 
primary 'Katzenellenbogen, J.A.' 14 
primary 'Zhou, H.B.'             15 
primary 'Nettles, K.W.'          16 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   111.320 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5DKB 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     56.347 
_cell.length_a_esd                 ? 
_cell.length_b                     82.844 
_cell.length_b_esd                 ? 
_cell.length_c                     58.458 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5DKB 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Estrogen receptor'                                                    29299.535 2   ? Y537S 
'ligand-binding domain'                ? 
2 polymer     syn 'Nuclear receptor coactivator 2'                                       1666.943  2   ? ?     
'Nuclear receptor-interacting peptide' ? 
3 non-polymer syn "4,4'-(2-{3-[(3-methylphenyl)amino]phenyl}but-1-ene-1,1-diyl)diphenol" 421.530   3   ? ?     ? ? 
4 water       nat water                                                                  18.015    109 ? ?     ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ER,ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1'                         
2 'NCoA-2,Class E basic helix-loop-helix protein 75,bHLHe75,Transcriptional intermediary factor 2,hTIF2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVH
LLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSG
VYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLS
DLLLEMLDAHRLHAPTS
;
;IKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVH
LLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSG
VYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLS
DLLLEMLDAHRLHAPTS
;
A,B ? 
2 'polypeptide(L)' no no KHKILHRLLQDSSS KHKILHRLLQDSSS C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   LYS n 
1 3   ARG n 
1 4   SER n 
1 5   LYS n 
1 6   LYS n 
1 7   ASN n 
1 8   SER n 
1 9   LEU n 
1 10  ALA n 
1 11  LEU n 
1 12  SER n 
1 13  LEU n 
1 14  THR n 
1 15  ALA n 
1 16  ASP n 
1 17  GLN n 
1 18  MET n 
1 19  VAL n 
1 20  SER n 
1 21  ALA n 
1 22  LEU n 
1 23  LEU n 
1 24  ASP n 
1 25  ALA n 
1 26  GLU n 
1 27  PRO n 
1 28  PRO n 
1 29  ILE n 
1 30  LEU n 
1 31  TYR n 
1 32  SER n 
1 33  GLU n 
1 34  TYR n 
1 35  ASP n 
1 36  PRO n 
1 37  THR n 
1 38  ARG n 
1 39  PRO n 
1 40  PHE n 
1 41  SER n 
1 42  GLU n 
1 43  ALA n 
1 44  SER n 
1 45  MET n 
1 46  MET n 
1 47  GLY n 
1 48  LEU n 
1 49  LEU n 
1 50  THR n 
1 51  ASN n 
1 52  LEU n 
1 53  ALA n 
1 54  ASP n 
1 55  ARG n 
1 56  GLU n 
1 57  LEU n 
1 58  VAL n 
1 59  HIS n 
1 60  MET n 
1 61  ILE n 
1 62  ASN n 
1 63  TRP n 
1 64  ALA n 
1 65  LYS n 
1 66  ARG n 
1 67  VAL n 
1 68  PRO n 
1 69  GLY n 
1 70  PHE n 
1 71  VAL n 
1 72  ASP n 
1 73  LEU n 
1 74  THR n 
1 75  LEU n 
1 76  HIS n 
1 77  ASP n 
1 78  GLN n 
1 79  VAL n 
1 80  HIS n 
1 81  LEU n 
1 82  LEU n 
1 83  GLU n 
1 84  CYS n 
1 85  ALA n 
1 86  TRP n 
1 87  LEU n 
1 88  GLU n 
1 89  ILE n 
1 90  LEU n 
1 91  MET n 
1 92  ILE n 
1 93  GLY n 
1 94  LEU n 
1 95  VAL n 
1 96  TRP n 
1 97  ARG n 
1 98  SER n 
1 99  MET n 
1 100 GLU n 
1 101 HIS n 
1 102 PRO n 
1 103 GLY n 
1 104 LYS n 
1 105 LEU n 
1 106 LEU n 
1 107 PHE n 
1 108 ALA n 
1 109 PRO n 
1 110 ASN n 
1 111 LEU n 
1 112 LEU n 
1 113 LEU n 
1 114 ASP n 
1 115 ARG n 
1 116 ASN n 
1 117 GLN n 
1 118 GLY n 
1 119 LYS n 
1 120 CYS n 
1 121 VAL n 
1 122 GLU n 
1 123 GLY n 
1 124 MET n 
1 125 VAL n 
1 126 GLU n 
1 127 ILE n 
1 128 PHE n 
1 129 ASP n 
1 130 MET n 
1 131 LEU n 
1 132 LEU n 
1 133 ALA n 
1 134 THR n 
1 135 SER n 
1 136 SER n 
1 137 ARG n 
1 138 PHE n 
1 139 ARG n 
1 140 MET n 
1 141 MET n 
1 142 ASN n 
1 143 LEU n 
1 144 GLN n 
1 145 GLY n 
1 146 GLU n 
1 147 GLU n 
1 148 PHE n 
1 149 VAL n 
1 150 CYS n 
1 151 LEU n 
1 152 LYS n 
1 153 SER n 
1 154 ILE n 
1 155 ILE n 
1 156 LEU n 
1 157 LEU n 
1 158 ASN n 
1 159 SER n 
1 160 GLY n 
1 161 VAL n 
1 162 TYR n 
1 163 THR n 
1 164 PHE n 
1 165 LEU n 
1 166 SER n 
1 167 SER n 
1 168 THR n 
1 169 LEU n 
1 170 LYS n 
1 171 SER n 
1 172 LEU n 
1 173 GLU n 
1 174 GLU n 
1 175 LYS n 
1 176 ASP n 
1 177 HIS n 
1 178 ILE n 
1 179 HIS n 
1 180 ARG n 
1 181 VAL n 
1 182 LEU n 
1 183 ASP n 
1 184 LYS n 
1 185 ILE n 
1 186 THR n 
1 187 ASP n 
1 188 THR n 
1 189 LEU n 
1 190 ILE n 
1 191 HIS n 
1 192 LEU n 
1 193 MET n 
1 194 ALA n 
1 195 LYS n 
1 196 ALA n 
1 197 GLY n 
1 198 LEU n 
1 199 THR n 
1 200 LEU n 
1 201 GLN n 
1 202 GLN n 
1 203 GLN n 
1 204 HIS n 
1 205 GLN n 
1 206 ARG n 
1 207 LEU n 
1 208 ALA n 
1 209 GLN n 
1 210 LEU n 
1 211 LEU n 
1 212 LEU n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 HIS n 
1 217 ILE n 
1 218 ARG n 
1 219 HIS n 
1 220 MET n 
1 221 SER n 
1 222 ASN n 
1 223 LYS n 
1 224 GLY n 
1 225 MET n 
1 226 GLU n 
1 227 HIS n 
1 228 LEU n 
1 229 TYR n 
1 230 SER n 
1 231 MET n 
1 232 LYS n 
1 233 CYS n 
1 234 LYS n 
1 235 ASN n 
1 236 VAL n 
1 237 VAL n 
1 238 PRO n 
1 239 LEU n 
1 240 SER n 
1 241 ASP n 
1 242 LEU n 
1 243 LEU n 
1 244 LEU n 
1 245 GLU n 
1 246 MET n 
1 247 LEU n 
1 248 ASP n 
1 249 ALA n 
1 250 HIS n 
1 251 ARG n 
1 252 LEU n 
1 253 HIS n 
1 254 ALA n 
1 255 PRO n 
1 256 THR n 
1 257 SER n 
2 1   LYS n 
2 2   HIS n 
2 3   LYS n 
2 4   ILE n 
2 5   LEU n 
2 6   HIS n 
2 7   ARG n 
2 8   LEU n 
2 9   LEU n 
2 10  GLN n 
2 11  ASP n 
2 12  SER n 
2 13  SER n 
2 14  SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   257 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ESR1, ESR, NR3A1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       14 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ESR1_HUMAN  P03372 ? 1 
;IKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVH
LLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSG
VYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLY
DLLLEMLDAHRLHAPTS
;
298 
2 UNP NCOA2_HUMAN Q15596 ? 2 KHKILHRLLQDSSS 686 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DKB A 1 ? 257 ? P03372 298 ? 554 ? 298 554 
2 1 5DKB B 1 ? 257 ? P03372 298 ? 554 ? 298 554 
3 2 5DKB C 1 ? 14  ? Q15596 686 ? 699 ? 686 699 
4 2 5DKB D 1 ? 14  ? Q15596 686 ? 699 ? 686 699 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DKB SER A 240 ? UNP P03372 TYR 537 'engineered mutation' 537 1 
2 5DKB SER B 240 ? UNP P03372 TYR 537 'engineered mutation' 537 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5C9 non-polymer         . "4,4'-(2-{3-[(3-methylphenyl)amino]phenyl}but-1-ene-1,1-diyl)diphenol" ? 'C29 H27 N O2'   421.530 
ALA 'L-peptide linking' y ALANINE                                                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                             ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DKB 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.18 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.66 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.3 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15% PEG 3350, 0.05M MgCl2, 0.067M NaCl, 0.1M Tris' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-07-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Side scattering bent cube i-beam single crystal asymmetric cut 4.965 degs' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DKB 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.190 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       25440 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.900 
_reflns.pdbx_Rmerge_I_obs                0.057 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         22.571 
_reflns.pdbx_netI_over_sigmaI            6.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.475 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         175970 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.190 2.230  ? ? ? ? ? 1257 ? 99.500 ? ? ? ? 0.663 ? ? ? ? ? ? ? ? 6.800 ? 0.458 ? ? ? ? 0 1  1 ? ? 
2.230 2.270  ? ? ? ? ? 1273 ? 99.500 ? ? ? ? 0.500 ? ? ? ? ? ? ? ? 7.000 ? 0.459 ? ? ? ? 0 2  1 ? ? 
2.270 2.310  ? ? ? ? ? 1285 ? 99.900 ? ? ? ? 0.470 ? ? ? ? ? ? ? ? 7.000 ? 0.461 ? ? ? ? 0 3  1 ? ? 
2.310 2.360  ? ? ? ? ? 1266 ? 99.900 ? ? ? ? 0.392 ? ? ? ? ? ? ? ? 7.000 ? 0.455 ? ? ? ? 0 4  1 ? ? 
2.360 2.410  ? ? ? ? ? 1283 ? 99.800 ? ? ? ? 0.374 ? ? ? ? ? ? ? ? 6.900 ? 0.456 ? ? ? ? 0 5  1 ? ? 
2.410 2.470  ? ? ? ? ? 1270 ? 99.800 ? ? ? ? 0.307 ? ? ? ? ? ? ? ? 7.000 ? 0.453 ? ? ? ? 0 6  1 ? ? 
2.470 2.530  ? ? ? ? ? 1275 ? 99.900 ? ? ? ? 0.259 ? ? ? ? ? ? ? ? 7.000 ? 0.454 ? ? ? ? 0 7  1 ? ? 
2.530 2.600  ? ? ? ? ? 1277 ? 99.400 ? ? ? ? 0.223 ? ? ? ? ? ? ? ? 6.900 ? 0.471 ? ? ? ? 0 8  1 ? ? 
2.600 2.670  ? ? ? ? ? 1283 ? 99.100 ? ? ? ? 0.198 ? ? ? ? ? ? ? ? 6.800 ? 0.470 ? ? ? ? 0 9  1 ? ? 
2.670 2.760  ? ? ? ? ? 1241 ? 98.500 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? 6.500 ? 0.463 ? ? ? ? 0 10 1 ? ? 
2.760 2.860  ? ? ? ? ? 1230 ? 94.700 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 6.300 ? 0.492 ? ? ? ? 0 11 1 ? ? 
2.860 2.970  ? ? ? ? ? 1270 ? 99.600 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 7.200 ? 0.474 ? ? ? ? 0 12 1 ? ? 
2.970 3.110  ? ? ? ? ? 1269 ? 99.600 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 7.200 ? 0.477 ? ? ? ? 0 13 1 ? ? 
3.110 3.270  ? ? ? ? ? 1299 ? 99.600 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 7.100 ? 0.491 ? ? ? ? 0 14 1 ? ? 
3.270 3.480  ? ? ? ? ? 1262 ? 99.500 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 7.100 ? 0.488 ? ? ? ? 0 15 1 ? ? 
3.480 3.740  ? ? ? ? ? 1284 ? 98.800 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 6.900 ? 0.499 ? ? ? ? 0 16 1 ? ? 
3.740 4.120  ? ? ? ? ? 1234 ? 96.100 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? 6.300 ? 0.507 ? ? ? ? 0 17 1 ? ? 
4.120 4.720  ? ? ? ? ? 1276 ? 99.200 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 7.100 ? 0.542 ? ? ? ? 0 18 1 ? ? 
4.720 5.940  ? ? ? ? ? 1302 ? 99.200 ? ? ? ? 0.033 ? ? ? ? ? ? ? ? 7.100 ? 0.510 ? ? ? ? 0 19 1 ? ? 
5.940 50.000 ? ? ? ? ? 1304 ? 98.000 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 6.700 ? 0.420 ? ? ? ? 0 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                147.690 
_refine.B_iso_mean                               54.7762 
_refine.B_iso_min                                16.840 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5DKB 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4000 
_refine.ls_d_res_low                             47.3640 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18819 
_refine.ls_number_reflns_R_free                  1495 
_refine.ls_number_reflns_R_work                  17324 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.5800 
_refine.ls_percent_reflns_R_free                 7.9400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1868 
_refine.ls_R_factor_R_free                       0.2261 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1834 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.9900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4000 
_refine_hist.d_res_low                        47.3640 
_refine_hist.pdbx_number_atoms_ligand         96 
_refine_hist.number_atoms_solvent             109 
_refine_hist.number_atoms_total               3975 
_refine_hist.pdbx_number_residues_total       482 
_refine_hist.pdbx_B_iso_mean_ligand           40.16 
_refine_hist.pdbx_B_iso_mean_solvent          42.95 
_refine_hist.pdbx_number_atoms_protein        3770 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 3956 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.720  ? 5351 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.050  ? 622  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 661  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.266 ? 1489 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4000 2.4775  1621 . 139 1482 90.0000  . . . 0.2845 . 0.2199 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 2.4775 2.5660  1656 . 117 1539 93.0000  . . . 0.3059 . 0.2135 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 2.5660 2.6687  1631 . 125 1506 92.0000  . . . 0.2393 . 0.1975 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 2.6687 2.7902  1649 . 136 1513 93.0000  . . . 0.2368 . 0.2069 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 2.7902 2.9373  1696 . 136 1560 94.0000  . . . 0.2812 . 0.2056 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 2.9373 3.1213  1730 . 137 1593 98.0000  . . . 0.2475 . 0.1931 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 3.1213 3.3622  1753 . 138 1615 98.0000  . . . 0.2303 . 0.1884 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 3.3622 3.7004  1766 . 142 1624 99.0000  . . . 0.2353 . 0.1811 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 3.7004 4.2356  1730 . 139 1591 96.0000  . . . 0.1799 . 0.1571 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 4.2356 5.3352  1795 . 138 1657 100.0000 . . . 0.1934 . 0.1608 . . . . . . 11 . . . 
'X-RAY DIFFRACTION' 5.3352 47.3735 1792 . 148 1644 98.0000  . . . 0.2336 . 0.1924 . . . . . . 11 . . . 
# 
_struct.entry_id                     5DKB 
_struct.title                        
;Crystal Structure of the ER-alpha Ligand-binding Domain in complex with a 3-methylphenylamino-substituted ethyl triaryl-ethylene derivative 4,4'-(2-{3-[(3-methylphenyl)amino]phenyl}but-1-ene-1,1-diyl)diphenol
;
_struct.pdbx_descriptor              'Estrogen receptor, Nuclear receptor coactivator 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DKB 
_struct_keywords.text            'Nuclear receptor, transcription factor, ligand binding, protein-ligand complex, transcription' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 14  ? GLU A 26  ? THR A 311 GLU A 323 1 ? 13 
HELX_P HELX_P2  AA2 SER A 41  ? VAL A 67  ? SER A 338 VAL A 364 1 ? 27 
HELX_P HELX_P3  AA3 THR A 74  ? SER A 98  ? THR A 371 SER A 395 1 ? 25 
HELX_P HELX_P4  AA4 ASN A 116 ? VAL A 121 ? ASN A 413 VAL A 418 5 ? 6  
HELX_P HELX_P5  AA5 GLY A 123 ? ASN A 142 ? GLY A 420 ASN A 439 1 ? 20 
HELX_P HELX_P6  AA6 GLN A 144 ? SER A 159 ? GLN A 441 SER A 456 1 ? 16 
HELX_P HELX_P7  AA7 ASP A 176 ? ALA A 196 ? ASP A 473 ALA A 493 1 ? 21 
HELX_P HELX_P8  AA8 THR A 199 ? TYR A 229 ? THR A 496 TYR A 526 1 ? 31 
HELX_P HELX_P9  AA9 SER A 240 ? ALA A 249 ? SER A 537 ALA A 546 1 ? 10 
HELX_P HELX_P10 AB1 HIS A 250 ? ARG A 251 ? HIS A 547 ARG A 548 5 ? 2  
HELX_P HELX_P11 AB2 LEU B 9   ? LEU B 13  ? LEU B 306 LEU B 310 5 ? 5  
HELX_P HELX_P12 AB3 THR B 14  ? ALA B 25  ? THR B 311 ALA B 322 1 ? 12 
HELX_P HELX_P13 AB4 SER B 41  ? ARG B 66  ? SER B 338 ARG B 363 1 ? 26 
HELX_P HELX_P14 AB5 THR B 74  ? SER B 98  ? THR B 371 SER B 395 1 ? 25 
HELX_P HELX_P15 AB6 ARG B 115 ? LYS B 119 ? ARG B 412 LYS B 416 1 ? 5  
HELX_P HELX_P16 AB7 GLY B 123 ? ASN B 142 ? GLY B 420 ASN B 439 1 ? 20 
HELX_P HELX_P17 AB8 GLN B 144 ? SER B 159 ? GLN B 441 SER B 456 1 ? 16 
HELX_P HELX_P18 AB9 ASP B 176 ? ALA B 196 ? ASP B 473 ALA B 493 1 ? 21 
HELX_P HELX_P19 AC1 THR B 199 ? LYS B 234 ? THR B 496 LYS B 531 1 ? 36 
HELX_P HELX_P20 AC2 SER B 240 ? ALA B 249 ? SER B 537 ALA B 546 1 ? 10 
HELX_P HELX_P21 AC3 LYS C 3   ? ASP C 11  ? LYS C 688 ASP C 696 1 ? 9  
HELX_P HELX_P22 AC4 LYS D 3   ? ASP D 11  ? LYS D 688 ASP D 696 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 104 ? ALA A 108 ? LYS A 401 ALA A 405 
AA1 2 LEU A 111 ? ASP A 114 ? LEU A 408 ASP A 411 
AA2 1 LYS B 104 ? ALA B 108 ? LYS B 401 ALA B 405 
AA2 2 LEU B 111 ? ASP B 114 ? LEU B 408 ASP B 411 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 105 ? N LEU A 402 O LEU A 113 ? O LEU A 410 
AA2 1 2 N LEU B 105 ? N LEU B 402 O LEU B 113 ? O LEU B 410 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 5C9 601 ? 18 'binding site for residue 5C9 A 601' 
AC2 Software A 5C9 602 ? 17 'binding site for residue 5C9 A 602' 
AC3 Software B 5C9 601 ? 12 'binding site for residue 5C9 B 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 MET A 46  ? MET A 343 . ? 1_555 ? 
2  AC1 18 LEU A 49  ? LEU A 346 . ? 1_555 ? 
3  AC1 18 THR A 50  ? THR A 347 . ? 1_555 ? 
4  AC1 18 ALA A 53  ? ALA A 350 . ? 1_555 ? 
5  AC1 18 GLU A 56  ? GLU A 353 . ? 1_555 ? 
6  AC1 18 LEU A 90  ? LEU A 387 . ? 1_555 ? 
7  AC1 18 ARG A 97  ? ARG A 394 . ? 1_555 ? 
8  AC1 18 PHE A 107 ? PHE A 404 . ? 1_555 ? 
9  AC1 18 GLY A 123 ? GLY A 420 . ? 1_555 ? 
10 AC1 18 MET A 124 ? MET A 421 . ? 1_555 ? 
11 AC1 18 LEU A 131 ? LEU A 428 . ? 1_555 ? 
12 AC1 18 GLY A 224 ? GLY A 521 . ? 1_555 ? 
13 AC1 18 HIS A 227 ? HIS A 524 . ? 1_555 ? 
14 AC1 18 LEU A 228 ? LEU A 525 . ? 1_555 ? 
15 AC1 18 MET A 231 ? MET A 528 . ? 1_555 ? 
16 AC1 18 LEU A 243 ? LEU A 540 . ? 1_555 ? 
17 AC1 18 5C9 F .   ? 5C9 A 602 . ? 1_555 ? 
18 AC1 18 HOH H .   ? HOH A 723 . ? 1_555 ? 
19 AC2 17 MET A 46  ? MET A 343 . ? 1_555 ? 
20 AC2 17 LEU A 49  ? LEU A 346 . ? 1_555 ? 
21 AC2 17 THR A 50  ? THR A 347 . ? 1_555 ? 
22 AC2 17 GLU A 56  ? GLU A 353 . ? 1_555 ? 
23 AC2 17 LEU A 90  ? LEU A 387 . ? 1_555 ? 
24 AC2 17 ARG A 97  ? ARG A 394 . ? 1_555 ? 
25 AC2 17 PHE A 107 ? PHE A 404 . ? 1_555 ? 
26 AC2 17 GLU A 122 ? GLU A 419 . ? 1_555 ? 
27 AC2 17 MET A 124 ? MET A 421 . ? 1_555 ? 
28 AC2 17 LEU A 131 ? LEU A 428 . ? 1_555 ? 
29 AC2 17 GLY A 224 ? GLY A 521 . ? 1_555 ? 
30 AC2 17 HIS A 227 ? HIS A 524 . ? 1_555 ? 
31 AC2 17 LEU A 228 ? LEU A 525 . ? 1_555 ? 
32 AC2 17 MET A 231 ? MET A 528 . ? 1_555 ? 
33 AC2 17 LEU A 243 ? LEU A 540 . ? 1_555 ? 
34 AC2 17 5C9 E .   ? 5C9 A 601 . ? 1_555 ? 
35 AC2 17 HOH H .   ? HOH A 723 . ? 1_555 ? 
36 AC3 12 LEU B 49  ? LEU B 346 . ? 1_555 ? 
37 AC3 12 THR B 50  ? THR B 347 . ? 1_555 ? 
38 AC3 12 ALA B 53  ? ALA B 350 . ? 1_555 ? 
39 AC3 12 GLU B 56  ? GLU B 353 . ? 1_555 ? 
40 AC3 12 LEU B 90  ? LEU B 387 . ? 1_555 ? 
41 AC3 12 ARG B 97  ? ARG B 394 . ? 1_555 ? 
42 AC3 12 LEU B 131 ? LEU B 428 . ? 1_555 ? 
43 AC3 12 GLY B 224 ? GLY B 521 . ? 1_555 ? 
44 AC3 12 HIS B 227 ? HIS B 524 . ? 1_555 ? 
45 AC3 12 LEU B 228 ? LEU B 525 . ? 1_555 ? 
46 AC3 12 MET B 231 ? MET B 528 . ? 1_555 ? 
47 AC3 12 LEU B 243 ? LEU B 540 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DKB 
_atom_sites.fract_transf_matrix[1][1]   0.017747 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006926 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012071 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018363 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 8   ? -5.574  5.955   -1.400  1.00 72.81  ? 305 SER A N   1 
ATOM   2    C CA  . SER A 1 8   ? -5.733  4.600   -0.876  1.00 69.18  ? 305 SER A CA  1 
ATOM   3    C C   . SER A 1 8   ? -4.652  4.285   0.162   1.00 70.23  ? 305 SER A C   1 
ATOM   4    O O   . SER A 1 8   ? -3.452  4.360   -0.131  1.00 70.74  ? 305 SER A O   1 
ATOM   5    C CB  . SER A 1 8   ? -5.676  3.578   -2.013  1.00 65.76  ? 305 SER A CB  1 
ATOM   6    O OG  . SER A 1 8   ? -5.905  2.264   -1.533  1.00 64.77  ? 305 SER A OG  1 
ATOM   7    N N   . LEU A 1 9   ? -5.081  3.929   1.371   1.00 71.89  ? 306 LEU A N   1 
ATOM   8    C CA  . LEU A 1 9   ? -4.157  3.650   2.467   1.00 74.12  ? 306 LEU A CA  1 
ATOM   9    C C   . LEU A 1 9   ? -3.462  2.298   2.318   1.00 70.87  ? 306 LEU A C   1 
ATOM   10   O O   . LEU A 1 9   ? -2.514  1.997   3.042   1.00 72.67  ? 306 LEU A O   1 
ATOM   11   C CB  . LEU A 1 9   ? -4.894  3.715   3.807   1.00 74.98  ? 306 LEU A CB  1 
ATOM   12   N N   . ALA A 1 10  ? -3.932  1.490   1.374   1.00 68.44  ? 307 ALA A N   1 
ATOM   13   C CA  . ALA A 1 10  ? -3.386  0.152   1.160   1.00 64.40  ? 307 ALA A CA  1 
ATOM   14   C C   . ALA A 1 10  ? -1.968  0.170   0.587   1.00 62.03  ? 307 ALA A C   1 
ATOM   15   O O   . ALA A 1 10  ? -1.225  -0.800  0.726   1.00 60.38  ? 307 ALA A O   1 
ATOM   16   C CB  . ALA A 1 10  ? -4.308  -0.652  0.259   1.00 61.45  ? 307 ALA A CB  1 
ATOM   17   N N   . LEU A 1 11  ? -1.598  1.271   -0.057  1.00 60.88  ? 308 LEU A N   1 
ATOM   18   C CA  . LEU A 1 11  ? -0.286  1.373   -0.685  1.00 62.08  ? 308 LEU A CA  1 
ATOM   19   C C   . LEU A 1 11  ? 0.778   1.823   0.306   1.00 67.68  ? 308 LEU A C   1 
ATOM   20   O O   . LEU A 1 11  ? 1.968   1.576   0.110   1.00 70.16  ? 308 LEU A O   1 
ATOM   21   C CB  . LEU A 1 11  ? -0.338  2.335   -1.871  1.00 59.35  ? 308 LEU A CB  1 
ATOM   22   C CG  . LEU A 1 11  ? -1.359  1.986   -2.952  1.00 54.76  ? 308 LEU A CG  1 
ATOM   23   C CD1 . LEU A 1 11  ? -1.417  3.079   -4.002  1.00 53.45  ? 308 LEU A CD1 1 
ATOM   24   C CD2 . LEU A 1 11  ? -1.026  0.639   -3.583  1.00 52.47  ? 308 LEU A CD2 1 
ATOM   25   N N   . SER A 1 12  ? 0.336   2.479   1.374   1.00 69.42  ? 309 SER A N   1 
ATOM   26   C CA  . SER A 1 12  ? 1.238   3.019   2.384   1.00 73.93  ? 309 SER A CA  1 
ATOM   27   C C   . SER A 1 12  ? 1.669   1.929   3.364   1.00 72.40  ? 309 SER A C   1 
ATOM   28   O O   . SER A 1 12  ? 2.552   2.139   4.199   1.00 74.75  ? 309 SER A O   1 
ATOM   29   C CB  . SER A 1 12  ? 0.557   4.167   3.132   1.00 77.15  ? 309 SER A CB  1 
ATOM   30   O OG  . SER A 1 12  ? 0.076   5.147   2.226   1.00 76.96  ? 309 SER A OG  1 
ATOM   31   N N   . LEU A 1 13  ? 1.043   0.761   3.243   1.00 70.38  ? 310 LEU A N   1 
ATOM   32   C CA  . LEU A 1 13  ? 1.286   -0.351  4.157   1.00 68.70  ? 310 LEU A CA  1 
ATOM   33   C C   . LEU A 1 13  ? 2.643   -1.029  3.902   1.00 68.36  ? 310 LEU A C   1 
ATOM   34   O O   . LEU A 1 13  ? 3.166   -0.996  2.783   1.00 71.92  ? 310 LEU A O   1 
ATOM   35   C CB  . LEU A 1 13  ? 0.146   -1.378  4.062   1.00 64.74  ? 310 LEU A CB  1 
ATOM   36   C CG  . LEU A 1 13  ? -1.291  -0.915  4.359   1.00 64.59  ? 310 LEU A CG  1 
ATOM   37   C CD1 . LEU A 1 13  ? -2.328  -2.028  4.142   1.00 60.76  ? 310 LEU A CD1 1 
ATOM   38   C CD2 . LEU A 1 13  ? -1.407  -0.364  5.772   1.00 67.31  ? 310 LEU A CD2 1 
ATOM   39   N N   . THR A 1 14  ? 3.212   -1.623  4.950   1.00 65.42  ? 311 THR A N   1 
ATOM   40   C CA  . THR A 1 14  ? 4.418   -2.434  4.817   1.00 65.66  ? 311 THR A CA  1 
ATOM   41   C C   . THR A 1 14  ? 4.007   -3.867  4.490   1.00 61.91  ? 311 THR A C   1 
ATOM   42   O O   . THR A 1 14  ? 2.818   -4.188  4.490   1.00 56.45  ? 311 THR A O   1 
ATOM   43   C CB  . THR A 1 14  ? 5.257   -2.441  6.110   1.00 71.25  ? 311 THR A CB  1 
ATOM   44   O OG1 . THR A 1 14  ? 4.549   -3.143  7.139   1.00 70.91  ? 311 THR A OG1 1 
ATOM   45   C CG2 . THR A 1 14  ? 5.559   -1.017  6.576   1.00 75.07  ? 311 THR A CG2 1 
ATOM   46   N N   . ALA A 1 15  ? 4.984   -4.730  4.227   1.00 63.10  ? 312 ALA A N   1 
ATOM   47   C CA  . ALA A 1 15  ? 4.698   -6.113  3.858   1.00 60.68  ? 312 ALA A CA  1 
ATOM   48   C C   . ALA A 1 15  ? 4.104   -6.887  5.026   1.00 61.32  ? 312 ALA A C   1 
ATOM   49   O O   . ALA A 1 15  ? 3.130   -7.624  4.865   1.00 56.43  ? 312 ALA A O   1 
ATOM   50   C CB  . ALA A 1 15  ? 5.956   -6.800  3.357   1.00 56.39  ? 312 ALA A CB  1 
ATOM   51   N N   . ASP A 1 16  ? 4.701   -6.712  6.200   1.00 66.12  ? 313 ASP A N   1 
ATOM   52   C CA  . ASP A 1 16  ? 4.250   -7.398  7.402   1.00 67.35  ? 313 ASP A CA  1 
ATOM   53   C C   . ASP A 1 16  ? 2.820   -7.023  7.773   1.00 64.00  ? 313 ASP A C   1 
ATOM   54   O O   . ASP A 1 16  ? 2.018   -7.893  8.111   1.00 63.83  ? 313 ASP A O   1 
ATOM   55   C CB  . ASP A 1 16  ? 5.199   -7.120  8.570   1.00 76.21  ? 313 ASP A CB  1 
ATOM   56   C CG  . ASP A 1 16  ? 6.483   -7.921  8.480   1.00 80.91  ? 313 ASP A CG  1 
ATOM   57   O OD1 . ASP A 1 16  ? 6.449   -9.034  7.913   1.00 80.55  ? 313 ASP A OD1 1 
ATOM   58   O OD2 . ASP A 1 16  ? 7.524   -7.443  8.978   1.00 84.69  ? 313 ASP A OD2 1 
ATOM   59   N N   . GLN A 1 17  ? 2.491   -5.738  7.698   1.00 63.43  ? 314 GLN A N   1 
ATOM   60   C CA  . GLN A 1 17  ? 1.147   -5.303  8.064   1.00 65.51  ? 314 GLN A CA  1 
ATOM   61   C C   . GLN A 1 17  ? 0.133   -5.538  6.946   1.00 63.42  ? 314 GLN A C   1 
ATOM   62   O O   . GLN A 1 17  ? -1.074  -5.435  7.165   1.00 63.34  ? 314 GLN A O   1 
ATOM   63   C CB  . GLN A 1 17  ? 1.133   -3.847  8.544   1.00 72.44  ? 314 GLN A CB  1 
ATOM   64   C CG  . GLN A 1 17  ? 1.385   -2.799  7.480   1.00 73.81  ? 314 GLN A CG  1 
ATOM   65   C CD  . GLN A 1 17  ? 1.807   -1.470  8.085   1.00 80.64  ? 314 GLN A CD  1 
ATOM   66   O OE1 . GLN A 1 17  ? 1.328   -0.410  7.685   1.00 82.20  ? 314 GLN A OE1 1 
ATOM   67   N NE2 . GLN A 1 17  ? 2.709   -1.524  9.058   1.00 84.21  ? 314 GLN A NE2 1 
ATOM   68   N N   . MET A 1 18  ? 0.628   -5.860  5.753   1.00 60.12  ? 315 MET A N   1 
ATOM   69   C CA  . MET A 1 18  ? -0.232  -6.327  4.673   1.00 54.09  ? 315 MET A CA  1 
ATOM   70   C C   . MET A 1 18  ? -0.623  -7.774  4.965   1.00 51.66  ? 315 MET A C   1 
ATOM   71   O O   . MET A 1 18  ? -1.799  -8.138  4.889   1.00 41.67  ? 315 MET A O   1 
ATOM   72   C CB  . MET A 1 18  ? 0.484   -6.223  3.324   1.00 55.17  ? 315 MET A CB  1 
ATOM   73   C CG  . MET A 1 18  ? -0.214  -6.946  2.177   1.00 52.79  ? 315 MET A CG  1 
ATOM   74   S SD  . MET A 1 18  ? -1.760  -6.178  1.648   1.00 61.61  ? 315 MET A SD  1 
ATOM   75   C CE  . MET A 1 18  ? -1.198  -4.525  1.257   1.00 49.38  ? 315 MET A CE  1 
ATOM   76   N N   . VAL A 1 19  ? 0.375   -8.587  5.312   1.00 52.10  ? 316 VAL A N   1 
ATOM   77   C CA  . VAL A 1 19  ? 0.163   -9.969  5.741   1.00 51.60  ? 316 VAL A CA  1 
ATOM   78   C C   . VAL A 1 19  ? -0.806  -10.052 6.914   1.00 50.83  ? 316 VAL A C   1 
ATOM   79   O O   . VAL A 1 19  ? -1.775  -10.807 6.879   1.00 48.34  ? 316 VAL A O   1 
ATOM   80   C CB  . VAL A 1 19  ? 1.494   -10.642 6.162   1.00 53.74  ? 316 VAL A CB  1 
ATOM   81   C CG1 . VAL A 1 19  ? 1.233   -11.980 6.829   1.00 45.51  ? 316 VAL A CG1 1 
ATOM   82   C CG2 . VAL A 1 19  ? 2.413   -10.817 4.968   1.00 53.99  ? 316 VAL A CG2 1 
ATOM   83   N N   . SER A 1 20  ? -0.538  -9.270  7.956   1.00 52.73  ? 317 SER A N   1 
ATOM   84   C CA  . SER A 1 20  ? -1.354  -9.294  9.169   1.00 53.40  ? 317 SER A CA  1 
ATOM   85   C C   . SER A 1 20  ? -2.785  -8.850  8.889   1.00 53.11  ? 317 SER A C   1 
ATOM   86   O O   . SER A 1 20  ? -3.732  -9.415  9.433   1.00 55.62  ? 317 SER A O   1 
ATOM   87   C CB  . SER A 1 20  ? -0.728  -8.414  10.251  1.00 60.98  ? 317 SER A CB  1 
ATOM   88   O OG  . SER A 1 20  ? -1.154  -7.069  10.119  1.00 65.85  ? 317 SER A OG  1 
ATOM   89   N N   . ALA A 1 21  ? -2.936  -7.842  8.034   1.00 53.06  ? 318 ALA A N   1 
ATOM   90   C CA  . ALA A 1 21  ? -4.263  -7.373  7.653   1.00 52.13  ? 318 ALA A CA  1 
ATOM   91   C C   . ALA A 1 21  ? -5.047  -8.475  6.936   1.00 49.69  ? 318 ALA A C   1 
ATOM   92   O O   . ALA A 1 21  ? -6.253  -8.620  7.137   1.00 52.46  ? 318 ALA A O   1 
ATOM   93   C CB  . ALA A 1 21  ? -4.166  -6.139  6.780   1.00 51.31  ? 318 ALA A CB  1 
ATOM   94   N N   . LEU A 1 22  ? -4.354  -9.253  6.107   1.00 46.70  ? 319 LEU A N   1 
ATOM   95   C CA  . LEU A 1 22  ? -4.985  -10.338 5.352   1.00 44.70  ? 319 LEU A CA  1 
ATOM   96   C C   . LEU A 1 22  ? -5.308  -11.551 6.232   1.00 44.23  ? 319 LEU A C   1 
ATOM   97   O O   . LEU A 1 22  ? -6.373  -12.151 6.100   1.00 46.14  ? 319 LEU A O   1 
ATOM   98   C CB  . LEU A 1 22  ? -4.106  -10.754 4.168   1.00 41.99  ? 319 LEU A CB  1 
ATOM   99   C CG  . LEU A 1 22  ? -3.974  -9.759  3.009   1.00 45.13  ? 319 LEU A CG  1 
ATOM   100  C CD1 . LEU A 1 22  ? -3.032  -10.294 1.940   1.00 43.50  ? 319 LEU A CD1 1 
ATOM   101  C CD2 . LEU A 1 22  ? -5.335  -9.446  2.413   1.00 43.58  ? 319 LEU A CD2 1 
ATOM   102  N N   . LEU A 1 23  ? -4.381  -11.913 7.113   1.00 39.28  ? 320 LEU A N   1 
ATOM   103  C CA  . LEU A 1 23  ? -4.616  -12.984 8.074   1.00 44.34  ? 320 LEU A CA  1 
ATOM   104  C C   . LEU A 1 23  ? -5.790  -12.642 8.986   1.00 48.42  ? 320 LEU A C   1 
ATOM   105  O O   . LEU A 1 23  ? -6.624  -13.495 9.287   1.00 45.58  ? 320 LEU A O   1 
ATOM   106  C CB  . LEU A 1 23  ? -3.362  -13.233 8.917   1.00 45.77  ? 320 LEU A CB  1 
ATOM   107  C CG  . LEU A 1 23  ? -2.216  -13.967 8.221   1.00 44.49  ? 320 LEU A CG  1 
ATOM   108  C CD1 . LEU A 1 23  ? -0.991  -14.043 9.120   1.00 43.44  ? 320 LEU A CD1 1 
ATOM   109  C CD2 . LEU A 1 23  ? -2.671  -15.358 7.814   1.00 41.36  ? 320 LEU A CD2 1 
ATOM   110  N N   . ASP A 1 24  ? -5.846  -11.386 9.419   1.00 52.27  ? 321 ASP A N   1 
ATOM   111  C CA  . ASP A 1 24  ? -6.910  -10.912 10.297  1.00 54.35  ? 321 ASP A CA  1 
ATOM   112  C C   . ASP A 1 24  ? -8.262  -10.895 9.587   1.00 51.70  ? 321 ASP A C   1 
ATOM   113  O O   . ASP A 1 24  ? -9.306  -11.034 10.223  1.00 52.20  ? 321 ASP A O   1 
ATOM   114  C CB  . ASP A 1 24  ? -6.580  -9.511  10.814  1.00 63.15  ? 321 ASP A CB  1 
ATOM   115  C CG  . ASP A 1 24  ? -7.584  -9.014  11.835  1.00 71.15  ? 321 ASP A CG  1 
ATOM   116  O OD1 . ASP A 1 24  ? -7.837  -9.734  12.827  1.00 70.50  ? 321 ASP A OD1 1 
ATOM   117  O OD2 . ASP A 1 24  ? -8.124  -7.904  11.641  1.00 75.20  ? 321 ASP A OD2 1 
ATOM   118  N N   . ALA A 1 25  ? -8.234  -10.729 8.267   1.00 47.64  ? 322 ALA A N   1 
ATOM   119  C CA  . ALA A 1 25  ? -9.457  -10.630 7.474   1.00 46.75  ? 322 ALA A CA  1 
ATOM   120  C C   . ALA A 1 25  ? -10.069 -11.997 7.169   1.00 42.56  ? 322 ALA A C   1 
ATOM   121  O O   . ALA A 1 25  ? -11.225 -12.090 6.762   1.00 40.89  ? 322 ALA A O   1 
ATOM   122  C CB  . ALA A 1 25  ? -9.181  -9.880  6.180   1.00 45.74  ? 322 ALA A CB  1 
ATOM   123  N N   . GLU A 1 26  ? -9.281  -13.046 7.371   1.00 38.02  ? 323 GLU A N   1 
ATOM   124  C CA  . GLU A 1 26  ? -9.666  -14.411 7.013   1.00 42.51  ? 323 GLU A CA  1 
ATOM   125  C C   . GLU A 1 26  ? -11.035 -14.829 7.564   1.00 41.87  ? 323 GLU A C   1 
ATOM   126  O O   . GLU A 1 26  ? -11.317 -14.640 8.747   1.00 41.61  ? 323 GLU A O   1 
ATOM   127  C CB  . GLU A 1 26  ? -8.578  -15.388 7.472   1.00 41.11  ? 323 GLU A CB  1 
ATOM   128  C CG  . GLU A 1 26  ? -8.700  -16.794 6.913   1.00 46.08  ? 323 GLU A CG  1 
ATOM   129  C CD  . GLU A 1 26  ? -8.363  -16.886 5.432   1.00 43.11  ? 323 GLU A CD  1 
ATOM   130  O OE1 . GLU A 1 26  ? -8.050  -15.849 4.808   1.00 43.29  ? 323 GLU A OE1 1 
ATOM   131  O OE2 . GLU A 1 26  ? -8.415  -18.009 4.891   1.00 39.99  ? 323 GLU A OE2 1 
ATOM   132  N N   . PRO A 1 27  ? -11.894 -15.389 6.693   1.00 38.91  ? 324 PRO A N   1 
ATOM   133  C CA  . PRO A 1 27  ? -13.236 -15.833 7.082   1.00 38.27  ? 324 PRO A CA  1 
ATOM   134  C C   . PRO A 1 27  ? -13.166 -17.104 7.915   1.00 40.41  ? 324 PRO A C   1 
ATOM   135  O O   . PRO A 1 27  ? -12.180 -17.833 7.824   1.00 48.33  ? 324 PRO A O   1 
ATOM   136  C CB  . PRO A 1 27  ? -13.904 -16.125 5.735   1.00 38.20  ? 324 PRO A CB  1 
ATOM   137  C CG  . PRO A 1 27  ? -12.786 -16.512 4.849   1.00 35.96  ? 324 PRO A CG  1 
ATOM   138  C CD  . PRO A 1 27  ? -11.628 -15.645 5.266   1.00 39.96  ? 324 PRO A CD  1 
ATOM   139  N N   . PRO A 1 28  ? -14.202 -17.370 8.722   1.00 36.77  ? 325 PRO A N   1 
ATOM   140  C CA  . PRO A 1 28  ? -14.206 -18.563 9.571   1.00 38.65  ? 325 PRO A CA  1 
ATOM   141  C C   . PRO A 1 28  ? -14.541 -19.819 8.783   1.00 44.67  ? 325 PRO A C   1 
ATOM   142  O O   . PRO A 1 28  ? -15.162 -19.736 7.722   1.00 45.82  ? 325 PRO A O   1 
ATOM   143  C CB  . PRO A 1 28  ? -15.331 -18.271 10.555  1.00 38.95  ? 325 PRO A CB  1 
ATOM   144  C CG  . PRO A 1 28  ? -16.283 -17.433 9.778   1.00 38.85  ? 325 PRO A CG  1 
ATOM   145  C CD  . PRO A 1 28  ? -15.430 -16.572 8.889   1.00 36.08  ? 325 PRO A CD  1 
ATOM   146  N N   . ILE A 1 29  ? -14.128 -20.970 9.299   1.00 49.74  ? 326 ILE A N   1 
ATOM   147  C CA  . ILE A 1 29  ? -14.488 -22.244 8.694   1.00 52.49  ? 326 ILE A CA  1 
ATOM   148  C C   . ILE A 1 29  ? -15.893 -22.628 9.144   1.00 51.63  ? 326 ILE A C   1 
ATOM   149  O O   . ILE A 1 29  ? -16.147 -22.797 10.333  1.00 50.83  ? 326 ILE A O   1 
ATOM   150  C CB  . ILE A 1 29  ? -13.487 -23.350 9.071   1.00 57.61  ? 326 ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 29  ? -12.091 -22.999 8.545   1.00 59.74  ? 326 ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 29  ? -13.941 -24.691 8.521   1.00 60.55  ? 326 ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 29  ? -11.058 -24.084 8.767   1.00 63.49  ? 326 ILE A CD1 1 
ATOM   154  N N   . LEU A 1 30  ? -16.809 -22.743 8.189   1.00 45.18  ? 327 LEU A N   1 
ATOM   155  C CA  . LEU A 1 30  ? -18.197 -23.050 8.504   1.00 46.67  ? 327 LEU A CA  1 
ATOM   156  C C   . LEU A 1 30  ? -18.452 -24.554 8.492   1.00 49.43  ? 327 LEU A C   1 
ATOM   157  O O   . LEU A 1 30  ? -17.682 -25.318 7.918   1.00 50.24  ? 327 LEU A O   1 
ATOM   158  C CB  . LEU A 1 30  ? -19.139 -22.341 7.530   1.00 46.40  ? 327 LEU A CB  1 
ATOM   159  C CG  . LEU A 1 30  ? -19.032 -20.815 7.481   1.00 44.08  ? 327 LEU A CG  1 
ATOM   160  C CD1 . LEU A 1 30  ? -20.093 -20.233 6.562   1.00 45.65  ? 327 LEU A CD1 1 
ATOM   161  C CD2 . LEU A 1 30  ? -19.148 -20.224 8.873   1.00 43.18  ? 327 LEU A CD2 1 
ATOM   162  N N   . TYR A 1 31  ? -19.530 -24.976 9.144   1.00 55.25  ? 328 TYR A N   1 
ATOM   163  C CA  . TYR A 1 31  ? -19.897 -26.384 9.169   1.00 54.04  ? 328 TYR A CA  1 
ATOM   164  C C   . TYR A 1 31  ? -21.024 -26.676 8.189   1.00 58.59  ? 328 TYR A C   1 
ATOM   165  O O   . TYR A 1 31  ? -21.810 -25.794 7.845   1.00 57.74  ? 328 TYR A O   1 
ATOM   166  C CB  . TYR A 1 31  ? -20.298 -26.819 10.580  1.00 55.75  ? 328 TYR A CB  1 
ATOM   167  C CG  . TYR A 1 31  ? -19.128 -27.041 11.513  1.00 55.60  ? 328 TYR A CG  1 
ATOM   168  C CD1 . TYR A 1 31  ? -18.532 -25.977 12.177  1.00 57.83  ? 328 TYR A CD1 1 
ATOM   169  C CD2 . TYR A 1 31  ? -18.623 -28.318 11.736  1.00 58.39  ? 328 TYR A CD2 1 
ATOM   170  C CE1 . TYR A 1 31  ? -17.464 -26.173 13.033  1.00 56.37  ? 328 TYR A CE1 1 
ATOM   171  C CE2 . TYR A 1 31  ? -17.553 -28.524 12.591  1.00 59.60  ? 328 TYR A CE2 1 
ATOM   172  C CZ  . TYR A 1 31  ? -16.978 -27.447 13.236  1.00 58.85  ? 328 TYR A CZ  1 
ATOM   173  O OH  . TYR A 1 31  ? -15.914 -27.639 14.087  1.00 60.41  ? 328 TYR A OH  1 
ATOM   174  N N   . SER A 1 32  ? -21.091 -27.919 7.732   1.00 62.11  ? 329 SER A N   1 
ATOM   175  C CA  . SER A 1 32  ? -22.157 -28.344 6.839   1.00 65.38  ? 329 SER A CA  1 
ATOM   176  C C   . SER A 1 32  ? -23.369 -28.793 7.641   1.00 71.91  ? 329 SER A C   1 
ATOM   177  O O   . SER A 1 32  ? -23.264 -29.086 8.833   1.00 62.43  ? 329 SER A O   1 
ATOM   178  C CB  . SER A 1 32  ? -21.678 -29.487 5.943   1.00 64.68  ? 329 SER A CB  1 
ATOM   179  O OG  . SER A 1 32  ? -22.749 -30.017 5.183   1.00 62.68  ? 329 SER A OG  1 
ATOM   180  N N   . GLU A 1 33  ? -24.519 -28.854 6.976   1.00 77.50  ? 330 GLU A N   1 
ATOM   181  C CA  . GLU A 1 33  ? -25.721 -29.415 7.577   1.00 83.56  ? 330 GLU A CA  1 
ATOM   182  C C   . GLU A 1 33  ? -25.627 -30.933 7.577   1.00 84.24  ? 330 GLU A C   1 
ATOM   183  O O   . GLU A 1 33  ? -26.571 -31.611 7.979   1.00 87.58  ? 330 GLU A O   1 
ATOM   184  C CB  . GLU A 1 33  ? -26.964 -29.000 6.788   1.00 89.48  ? 330 GLU A CB  1 
ATOM   185  C CG  . GLU A 1 33  ? -27.179 -27.509 6.622   1.00 91.31  ? 330 GLU A CG  1 
ATOM   186  C CD  . GLU A 1 33  ? -28.441 -27.213 5.831   1.00 95.83  ? 330 GLU A CD  1 
ATOM   187  O OE1 . GLU A 1 33  ? -28.728 -27.966 4.876   1.00 97.86  ? 330 GLU A OE1 1 
ATOM   188  O OE2 . GLU A 1 33  ? -29.153 -26.244 6.170   1.00 97.37  ? 330 GLU A OE2 1 
ATOM   189  N N   . TYR A 1 34  ? -24.483 -31.444 7.118   1.00 84.08  ? 331 TYR A N   1 
ATOM   190  C CA  . TYR A 1 34  ? -24.261 -32.870 6.861   1.00 88.30  ? 331 TYR A CA  1 
ATOM   191  C C   . TYR A 1 34  ? -24.914 -33.825 7.854   1.00 93.23  ? 331 TYR A C   1 
ATOM   192  O O   . TYR A 1 34  ? -24.837 -33.639 9.072   1.00 94.48  ? 331 TYR A O   1 
ATOM   193  C CB  . TYR A 1 34  ? -22.765 -33.175 6.766   1.00 87.13  ? 331 TYR A CB  1 
ATOM   194  C CG  . TYR A 1 34  ? -22.469 -34.653 6.626   1.00 91.06  ? 331 TYR A CG  1 
ATOM   195  C CD1 . TYR A 1 34  ? -22.859 -35.350 5.497   1.00 93.97  ? 331 TYR A CD1 1 
ATOM   196  C CD2 . TYR A 1 34  ? -21.801 -35.348 7.621   1.00 94.47  ? 331 TYR A CD2 1 
ATOM   197  C CE1 . TYR A 1 34  ? -22.596 -36.695 5.360   1.00 97.25  ? 331 TYR A CE1 1 
ATOM   198  C CE2 . TYR A 1 34  ? -21.526 -36.694 7.492   1.00 98.69  ? 331 TYR A CE2 1 
ATOM   199  C CZ  . TYR A 1 34  ? -21.929 -37.362 6.356   1.00 99.77  ? 331 TYR A CZ  1 
ATOM   200  O OH  . TYR A 1 34  ? -21.667 -38.703 6.212   1.00 102.88 ? 331 TYR A OH  1 
ATOM   201  N N   . ASP A 1 35  ? -25.554 -34.852 7.304   1.00 94.06  ? 332 ASP A N   1 
ATOM   202  C CA  . ASP A 1 35  ? -26.316 -35.814 8.084   1.00 95.50  ? 332 ASP A CA  1 
ATOM   203  C C   . ASP A 1 35  ? -25.886 -37.235 7.732   1.00 97.50  ? 332 ASP A C   1 
ATOM   204  O O   . ASP A 1 35  ? -26.267 -37.765 6.687   1.00 94.56  ? 332 ASP A O   1 
ATOM   205  C CB  . ASP A 1 35  ? -27.808 -35.637 7.803   1.00 95.59  ? 332 ASP A CB  1 
ATOM   206  C CG  . ASP A 1 35  ? -28.673 -36.460 8.723   1.00 98.03  ? 332 ASP A CG  1 
ATOM   207  O OD1 . ASP A 1 35  ? -28.231 -36.740 9.856   1.00 99.56  ? 332 ASP A OD1 1 
ATOM   208  O OD2 . ASP A 1 35  ? -29.796 -36.823 8.315   1.00 99.29  ? 332 ASP A OD2 1 
ATOM   209  N N   . PRO A 1 36  ? -25.096 -37.863 8.615   1.00 101.43 ? 333 PRO A N   1 
ATOM   210  C CA  . PRO A 1 36  ? -24.514 -39.187 8.369   1.00 103.83 ? 333 PRO A CA  1 
ATOM   211  C C   . PRO A 1 36  ? -25.544 -40.313 8.395   1.00 106.08 ? 333 PRO A C   1 
ATOM   212  O O   . PRO A 1 36  ? -25.297 -41.368 7.811   1.00 109.95 ? 333 PRO A O   1 
ATOM   213  C CB  . PRO A 1 36  ? -23.532 -39.352 9.529   1.00 105.70 ? 333 PRO A CB  1 
ATOM   214  C CG  . PRO A 1 36  ? -24.123 -38.540 10.621  1.00 105.87 ? 333 PRO A CG  1 
ATOM   215  C CD  . PRO A 1 36  ? -24.746 -37.349 9.950   1.00 101.94 ? 333 PRO A CD  1 
ATOM   216  N N   . THR A 1 37  ? -26.676 -40.099 9.060   1.00 104.86 ? 334 THR A N   1 
ATOM   217  C CA  . THR A 1 37  ? -27.720 -41.117 9.108   1.00 106.81 ? 334 THR A CA  1 
ATOM   218  C C   . THR A 1 37  ? -28.413 -41.245 7.752   1.00 105.78 ? 334 THR A C   1 
ATOM   219  O O   . THR A 1 37  ? -29.034 -42.263 7.453   1.00 111.48 ? 334 THR A O   1 
ATOM   220  C CB  . THR A 1 37  ? -28.753 -40.847 10.227  1.00 108.72 ? 334 THR A CB  1 
ATOM   221  O OG1 . THR A 1 37  ? -29.669 -41.946 10.312  1.00 114.22 ? 334 THR A OG1 1 
ATOM   222  C CG2 . THR A 1 37  ? -29.525 -39.571 9.959   1.00 104.74 ? 334 THR A CG2 1 
ATOM   223  N N   . ARG A 1 38  ? -28.291 -40.206 6.932   1.00 99.27  ? 335 ARG A N   1 
ATOM   224  C CA  . ARG A 1 38  ? -28.806 -40.238 5.571   1.00 97.19  ? 335 ARG A CA  1 
ATOM   225  C C   . ARG A 1 38  ? -27.656 -40.397 4.583   1.00 96.07  ? 335 ARG A C   1 
ATOM   226  O O   . ARG A 1 38  ? -26.584 -39.821 4.772   1.00 87.25  ? 335 ARG A O   1 
ATOM   227  C CB  . ARG A 1 38  ? -29.592 -38.962 5.260   1.00 94.10  ? 335 ARG A CB  1 
ATOM   228  N N   . PRO A 1 39  ? -27.873 -41.193 3.526   1.00 98.08  ? 336 PRO A N   1 
ATOM   229  C CA  . PRO A 1 39  ? -26.823 -41.406 2.525   1.00 96.57  ? 336 PRO A CA  1 
ATOM   230  C C   . PRO A 1 39  ? -26.873 -40.338 1.444   1.00 93.57  ? 336 PRO A C   1 
ATOM   231  O O   . PRO A 1 39  ? -27.716 -39.438 1.508   1.00 86.06  ? 336 PRO A O   1 
ATOM   232  C CB  . PRO A 1 39  ? -27.183 -42.770 1.942   1.00 100.31 ? 336 PRO A CB  1 
ATOM   233  C CG  . PRO A 1 39  ? -28.675 -42.808 2.029   1.00 102.94 ? 336 PRO A CG  1 
ATOM   234  C CD  . PRO A 1 39  ? -29.080 -41.987 3.238   1.00 102.05 ? 336 PRO A CD  1 
ATOM   235  N N   . PHE A 1 40  ? -25.980 -40.436 0.467   1.00 93.70  ? 337 PHE A N   1 
ATOM   236  C CA  . PHE A 1 40  ? -25.870 -39.398 -0.544  1.00 84.23  ? 337 PHE A CA  1 
ATOM   237  C C   . PHE A 1 40  ? -26.643 -39.709 -1.824  1.00 92.80  ? 337 PHE A C   1 
ATOM   238  O O   . PHE A 1 40  ? -26.488 -40.781 -2.417  1.00 87.92  ? 337 PHE A O   1 
ATOM   239  C CB  . PHE A 1 40  ? -24.398 -39.122 -0.859  1.00 85.15  ? 337 PHE A CB  1 
ATOM   240  C CG  . PHE A 1 40  ? -23.702 -38.284 0.178   1.00 83.26  ? 337 PHE A CG  1 
ATOM   241  C CD1 . PHE A 1 40  ? -24.274 -37.106 0.637   1.00 80.09  ? 337 PHE A CD1 1 
ATOM   242  C CD2 . PHE A 1 40  ? -22.480 -38.674 0.697   1.00 84.34  ? 337 PHE A CD2 1 
ATOM   243  C CE1 . PHE A 1 40  ? -23.631 -36.331 1.590   1.00 75.96  ? 337 PHE A CE1 1 
ATOM   244  C CE2 . PHE A 1 40  ? -21.836 -37.905 1.650   1.00 82.01  ? 337 PHE A CE2 1 
ATOM   245  C CZ  . PHE A 1 40  ? -22.410 -36.733 2.093   1.00 76.14  ? 337 PHE A CZ  1 
ATOM   246  N N   . SER A 1 41  ? -27.490 -38.764 -2.223  1.00 92.44  ? 338 SER A N   1 
ATOM   247  C CA  . SER A 1 41  ? -28.060 -38.741 -3.560  1.00 94.79  ? 338 SER A CA  1 
ATOM   248  C C   . SER A 1 41  ? -27.484 -37.518 -4.248  1.00 93.92  ? 338 SER A C   1 
ATOM   249  O O   . SER A 1 41  ? -26.941 -36.627 -3.585  1.00 80.22  ? 338 SER A O   1 
ATOM   250  C CB  . SER A 1 41  ? -29.587 -38.645 -3.508  1.00 86.38  ? 338 SER A CB  1 
ATOM   251  O OG  . SER A 1 41  ? -30.007 -37.378 -3.035  1.00 84.37  ? 338 SER A OG  1 
ATOM   252  N N   . GLU A 1 42  ? -27.607 -37.476 -5.571  1.00 67.02  ? 339 GLU A N   1 
ATOM   253  C CA  . GLU A 1 42  ? -27.138 -36.341 -6.364  1.00 67.87  ? 339 GLU A CA  1 
ATOM   254  C C   . GLU A 1 42  ? -27.758 -35.025 -5.904  1.00 65.88  ? 339 GLU A C   1 
ATOM   255  O O   . GLU A 1 42  ? -27.081 -33.997 -5.832  1.00 62.08  ? 339 GLU A O   1 
ATOM   256  C CB  . GLU A 1 42  ? -27.446 -36.572 -7.846  1.00 74.82  ? 339 GLU A CB  1 
ATOM   257  C CG  . GLU A 1 42  ? -27.378 -35.315 -8.698  1.00 77.25  ? 339 GLU A CG  1 
ATOM   258  C CD  . GLU A 1 42  ? -27.221 -35.618 -10.176 1.00 84.15  ? 339 GLU A CD  1 
ATOM   259  O OE1 . GLU A 1 42  ? -26.092 -35.954 -10.593 1.00 86.90  ? 339 GLU A OE1 1 
ATOM   260  O OE2 . GLU A 1 42  ? -28.219 -35.513 -10.922 1.00 87.68  ? 339 GLU A OE2 1 
ATOM   261  N N   . ALA A 1 43  ? -29.048 -35.073 -5.586  1.00 68.09  ? 340 ALA A N   1 
ATOM   262  C CA  . ALA A 1 43  ? -29.785 -33.888 -5.165  1.00 66.55  ? 340 ALA A CA  1 
ATOM   263  C C   . ALA A 1 43  ? -29.367 -33.404 -3.773  1.00 64.84  ? 340 ALA A C   1 
ATOM   264  O O   . ALA A 1 43  ? -29.178 -32.205 -3.557  1.00 64.67  ? 340 ALA A O   1 
ATOM   265  C CB  . ALA A 1 43  ? -31.281 -34.154 -5.204  1.00 67.14  ? 340 ALA A CB  1 
ATOM   266  N N   . SER A 1 44  ? -29.225 -34.332 -2.830  1.00 63.33  ? 341 SER A N   1 
ATOM   267  C CA  . SER A 1 44  ? -28.889 -33.967 -1.456  1.00 59.17  ? 341 SER A CA  1 
ATOM   268  C C   . SER A 1 44  ? -27.431 -33.534 -1.337  1.00 57.36  ? 341 SER A C   1 
ATOM   269  O O   . SER A 1 44  ? -27.087 -32.711 -0.491  1.00 51.81  ? 341 SER A O   1 
ATOM   270  C CB  . SER A 1 44  ? -29.183 -35.120 -0.493  1.00 54.99  ? 341 SER A CB  1 
ATOM   271  O OG  . SER A 1 44  ? -28.165 -36.103 -0.540  1.00 54.24  ? 341 SER A OG  1 
ATOM   272  N N   . MET A 1 45  ? -26.578 -34.094 -2.190  1.00 60.29  ? 342 MET A N   1 
ATOM   273  C CA  . MET A 1 45  ? -25.171 -33.720 -2.211  1.00 54.35  ? 342 MET A CA  1 
ATOM   274  C C   . MET A 1 45  ? -25.012 -32.280 -2.677  1.00 52.29  ? 342 MET A C   1 
ATOM   275  O O   . MET A 1 45  ? -24.327 -31.483 -2.037  1.00 52.34  ? 342 MET A O   1 
ATOM   276  C CB  . MET A 1 45  ? -24.380 -34.646 -3.131  1.00 52.56  ? 342 MET A CB  1 
ATOM   277  C CG  . MET A 1 45  ? -22.974 -34.154 -3.420  1.00 48.99  ? 342 MET A CG  1 
ATOM   278  S SD  . MET A 1 45  ? -21.816 -34.515 -2.094  1.00 85.44  ? 342 MET A SD  1 
ATOM   279  C CE  . MET A 1 45  ? -21.530 -36.260 -2.381  1.00 61.63  ? 342 MET A CE  1 
ATOM   280  N N   . MET A 1 46  ? -25.650 -31.954 -3.797  1.00 52.34  ? 343 MET A N   1 
ATOM   281  C CA  . MET A 1 46  ? -25.604 -30.600 -4.338  1.00 49.20  ? 343 MET A CA  1 
ATOM   282  C C   . MET A 1 46  ? -26.328 -29.627 -3.420  1.00 47.16  ? 343 MET A C   1 
ATOM   283  O O   . MET A 1 46  ? -25.986 -28.450 -3.365  1.00 48.45  ? 343 MET A O   1 
ATOM   284  C CB  . MET A 1 46  ? -26.210 -30.550 -5.744  1.00 52.83  ? 343 MET A CB  1 
ATOM   285  C CG  . MET A 1 46  ? -25.396 -31.272 -6.811  1.00 50.82  ? 343 MET A CG  1 
ATOM   286  S SD  . MET A 1 46  ? -23.693 -30.683 -6.936  1.00 56.06  ? 343 MET A SD  1 
ATOM   287  C CE  . MET A 1 46  ? -23.938 -28.917 -7.091  1.00 44.86  ? 343 MET A CE  1 
ATOM   288  N N   . GLY A 1 47  ? -27.331 -30.127 -2.702  1.00 47.69  ? 344 GLY A N   1 
ATOM   289  C CA  . GLY A 1 47  ? -28.035 -29.329 -1.716  1.00 44.29  ? 344 GLY A CA  1 
ATOM   290  C C   . GLY A 1 47  ? -27.120 -28.921 -0.576  1.00 40.33  ? 344 GLY A C   1 
ATOM   291  O O   . GLY A 1 47  ? -27.104 -27.762 -0.169  1.00 39.85  ? 344 GLY A O   1 
ATOM   292  N N   . LEU A 1 48  ? -26.352 -29.879 -0.064  1.00 41.23  ? 345 LEU A N   1 
ATOM   293  C CA  . LEU A 1 48  ? -25.396 -29.620 1.010   1.00 42.47  ? 345 LEU A CA  1 
ATOM   294  C C   . LEU A 1 48  ? -24.339 -28.606 0.584   1.00 44.79  ? 345 LEU A C   1 
ATOM   295  O O   . LEU A 1 48  ? -24.029 -27.669 1.321   1.00 44.50  ? 345 LEU A O   1 
ATOM   296  C CB  . LEU A 1 48  ? -24.715 -30.919 1.442   1.00 41.35  ? 345 LEU A CB  1 
ATOM   297  C CG  . LEU A 1 48  ? -25.229 -31.611 2.704   1.00 51.41  ? 345 LEU A CG  1 
ATOM   298  C CD1 . LEU A 1 48  ? -26.750 -31.671 2.717   1.00 56.84  ? 345 LEU A CD1 1 
ATOM   299  C CD2 . LEU A 1 48  ? -24.632 -33.007 2.810   1.00 51.44  ? 345 LEU A CD2 1 
ATOM   300  N N   . LEU A 1 49  ? -23.791 -28.802 -0.610  1.00 42.98  ? 346 LEU A N   1 
ATOM   301  C CA  . LEU A 1 49  ? -22.748 -27.924 -1.125  1.00 41.58  ? 346 LEU A CA  1 
ATOM   302  C C   . LEU A 1 49  ? -23.278 -26.519 -1.392  1.00 43.01  ? 346 LEU A C   1 
ATOM   303  O O   . LEU A 1 49  ? -22.595 -25.532 -1.125  1.00 45.39  ? 346 LEU A O   1 
ATOM   304  C CB  . LEU A 1 49  ? -22.138 -28.508 -2.400  1.00 41.47  ? 346 LEU A CB  1 
ATOM   305  C CG  . LEU A 1 49  ? -21.403 -29.840 -2.252  1.00 40.71  ? 346 LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 49  ? -20.699 -30.216 -3.551  1.00 42.12  ? 346 LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 49  ? -20.417 -29.778 -1.102  1.00 38.62  ? 346 LEU A CD2 1 
ATOM   308  N N   . THR A 1 50  ? -24.494 -26.436 -1.922  1.00 43.09  ? 347 THR A N   1 
ATOM   309  C CA  . THR A 1 50  ? -25.126 -25.151 -2.194  1.00 44.25  ? 347 THR A CA  1 
ATOM   310  C C   . THR A 1 50  ? -25.384 -24.379 -0.904  1.00 42.67  ? 347 THR A C   1 
ATOM   311  O O   . THR A 1 50  ? -25.098 -23.183 -0.820  1.00 42.30  ? 347 THR A O   1 
ATOM   312  C CB  . THR A 1 50  ? -26.451 -25.322 -2.959  1.00 48.65  ? 347 THR A CB  1 
ATOM   313  O OG1 . THR A 1 50  ? -26.179 -25.821 -4.274  1.00 48.62  ? 347 THR A OG1 1 
ATOM   314  C CG2 . THR A 1 50  ? -27.184 -23.993 -3.073  1.00 49.50  ? 347 THR A CG2 1 
ATOM   315  N N   . ASN A 1 51  ? -25.920 -25.069 0.099   1.00 40.66  ? 348 ASN A N   1 
ATOM   316  C CA  . ASN A 1 51  ? -26.200 -24.449 1.390   1.00 41.15  ? 348 ASN A CA  1 
ATOM   317  C C   . ASN A 1 51  ? -24.923 -23.940 2.047   1.00 37.64  ? 348 ASN A C   1 
ATOM   318  O O   . ASN A 1 51  ? -24.905 -22.854 2.629   1.00 36.14  ? 348 ASN A O   1 
ATOM   319  C CB  . ASN A 1 51  ? -26.922 -25.430 2.322   1.00 46.60  ? 348 ASN A CB  1 
ATOM   320  C CG  . ASN A 1 51  ? -27.165 -24.852 3.708   1.00 50.46  ? 348 ASN A CG  1 
ATOM   321  O OD1 . ASN A 1 51  ? -26.262 -24.814 4.546   1.00 50.46  ? 348 ASN A OD1 1 
ATOM   322  N ND2 . ASN A 1 51  ? -28.394 -24.409 3.959   1.00 52.20  ? 348 ASN A ND2 1 
ATOM   323  N N   . LEU A 1 52  ? -23.862 -24.736 1.952   1.00 28.45  ? 349 LEU A N   1 
ATOM   324  C CA  . LEU A 1 52  ? -22.566 -24.363 2.502   1.00 27.75  ? 349 LEU A CA  1 
ATOM   325  C C   . LEU A 1 52  ? -21.998 -23.141 1.785   1.00 30.99  ? 349 LEU A C   1 
ATOM   326  O O   . LEU A 1 52  ? -21.533 -22.194 2.425   1.00 33.95  ? 349 LEU A O   1 
ATOM   327  C CB  . LEU A 1 52  ? -21.585 -25.532 2.397   1.00 29.80  ? 349 LEU A CB  1 
ATOM   328  C CG  . LEU A 1 52  ? -20.152 -25.278 2.874   1.00 31.95  ? 349 LEU A CG  1 
ATOM   329  C CD1 . LEU A 1 52  ? -20.139 -24.841 4.333   1.00 26.86  ? 349 LEU A CD1 1 
ATOM   330  C CD2 . LEU A 1 52  ? -19.276 -26.515 2.671   1.00 32.22  ? 349 LEU A CD2 1 
ATOM   331  N N   . ALA A 1 53  ? -22.045 -23.164 0.457   1.00 27.18  ? 350 ALA A N   1 
ATOM   332  C CA  . ALA A 1 53  ? -21.492 -22.078 -0.343  1.00 29.13  ? 350 ALA A CA  1 
ATOM   333  C C   . ALA A 1 53  ? -22.240 -20.779 -0.083  1.00 33.80  ? 350 ALA A C   1 
ATOM   334  O O   . ALA A 1 53  ? -21.638 -19.708 -0.006  1.00 33.85  ? 350 ALA A O   1 
ATOM   335  C CB  . ALA A 1 53  ? -21.541 -22.428 -1.817  1.00 28.86  ? 350 ALA A CB  1 
ATOM   336  N N   . ASP A 1 54  ? -23.555 -20.887 0.060   1.00 35.30  ? 351 ASP A N   1 
ATOM   337  C CA  . ASP A 1 54  ? -24.397 -19.723 0.285   1.00 38.66  ? 351 ASP A CA  1 
ATOM   338  C C   . ASP A 1 54  ? -24.025 -19.010 1.581   1.00 35.64  ? 351 ASP A C   1 
ATOM   339  O O   . ASP A 1 54  ? -23.958 -17.782 1.628   1.00 35.41  ? 351 ASP A O   1 
ATOM   340  C CB  . ASP A 1 54  ? -25.869 -20.127 0.300   1.00 47.83  ? 351 ASP A CB  1 
ATOM   341  C CG  . ASP A 1 54  ? -26.787 -18.950 0.527   1.00 59.32  ? 351 ASP A CG  1 
ATOM   342  O OD1 . ASP A 1 54  ? -26.916 -18.112 -0.391  1.00 64.73  ? 351 ASP A OD1 1 
ATOM   343  O OD2 . ASP A 1 54  ? -27.379 -18.861 1.622   1.00 62.80  ? 351 ASP A OD2 1 
ATOM   344  N N   . ARG A 1 55  ? -23.767 -19.784 2.627   1.00 33.20  ? 352 ARG A N   1 
ATOM   345  C CA  . ARG A 1 55  ? -23.382 -19.207 3.907   1.00 35.69  ? 352 ARG A CA  1 
ATOM   346  C C   . ARG A 1 55  ? -21.956 -18.666 3.868   1.00 31.35  ? 352 ARG A C   1 
ATOM   347  O O   . ARG A 1 55  ? -21.681 -17.596 4.403   1.00 31.73  ? 352 ARG A O   1 
ATOM   348  C CB  . ARG A 1 55  ? -23.574 -20.221 5.041   1.00 38.16  ? 352 ARG A CB  1 
ATOM   349  C CG  . ARG A 1 55  ? -25.021 -20.326 5.519   1.00 37.26  ? 352 ARG A CG  1 
ATOM   350  C CD  . ARG A 1 55  ? -25.370 -21.741 5.950   1.00 41.65  ? 352 ARG A CD  1 
ATOM   351  N NE  . ARG A 1 55  ? -24.409 -22.266 6.913   1.00 45.83  ? 352 ARG A NE  1 
ATOM   352  C CZ  . ARG A 1 55  ? -23.949 -23.512 6.906   1.00 44.73  ? 352 ARG A CZ  1 
ATOM   353  N NH1 . ARG A 1 55  ? -24.362 -24.373 5.986   1.00 40.87  ? 352 ARG A NH1 1 
ATOM   354  N NH2 . ARG A 1 55  ? -23.073 -23.895 7.822   1.00 47.44  ? 352 ARG A NH2 1 
ATOM   355  N N   . GLU A 1 56  ? -21.059 -19.401 3.218   1.00 34.38  ? 353 GLU A N   1 
ATOM   356  C CA  . GLU A 1 56  ? -19.682 -18.947 3.024   1.00 36.01  ? 353 GLU A CA  1 
ATOM   357  C C   . GLU A 1 56  ? -19.603 -17.613 2.287   1.00 34.78  ? 353 GLU A C   1 
ATOM   358  O O   . GLU A 1 56  ? -18.727 -16.793 2.567   1.00 36.28  ? 353 GLU A O   1 
ATOM   359  C CB  . GLU A 1 56  ? -18.878 -19.988 2.248   1.00 34.42  ? 353 GLU A CB  1 
ATOM   360  C CG  . GLU A 1 56  ? -18.411 -21.174 3.068   1.00 30.04  ? 353 GLU A CG  1 
ATOM   361  C CD  . GLU A 1 56  ? -17.482 -22.072 2.275   1.00 32.73  ? 353 GLU A CD  1 
ATOM   362  O OE1 . GLU A 1 56  ? -17.969 -22.782 1.371   1.00 32.95  ? 353 GLU A OE1 1 
ATOM   363  O OE2 . GLU A 1 56  ? -16.264 -22.052 2.539   1.00 34.36  ? 353 GLU A OE2 1 
ATOM   364  N N   . LEU A 1 57  ? -20.519 -17.405 1.347   1.00 32.87  ? 354 LEU A N   1 
ATOM   365  C CA  . LEU A 1 57  ? -20.540 -16.181 0.553   1.00 38.11  ? 354 LEU A CA  1 
ATOM   366  C C   . LEU A 1 57  ? -20.715 -14.928 1.407   1.00 34.57  ? 354 LEU A C   1 
ATOM   367  O O   . LEU A 1 57  ? -20.072 -13.909 1.162   1.00 32.54  ? 354 LEU A O   1 
ATOM   368  C CB  . LEU A 1 57  ? -21.637 -16.242 -0.513  1.00 44.26  ? 354 LEU A CB  1 
ATOM   369  C CG  . LEU A 1 57  ? -21.266 -16.923 -1.829  1.00 48.81  ? 354 LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 57  ? -22.455 -16.923 -2.768  1.00 53.67  ? 354 LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 57  ? -20.078 -16.223 -2.473  1.00 48.22  ? 354 LEU A CD2 1 
ATOM   372  N N   . VAL A 1 58  ? -21.591 -15.008 2.402   1.00 35.83  ? 355 VAL A N   1 
ATOM   373  C CA  . VAL A 1 58  ? -21.836 -13.876 3.288   1.00 39.31  ? 355 VAL A CA  1 
ATOM   374  C C   . VAL A 1 58  ? -20.541 -13.443 3.976   1.00 38.41  ? 355 VAL A C   1 
ATOM   375  O O   . VAL A 1 58  ? -20.244 -12.252 4.065   1.00 37.44  ? 355 VAL A O   1 
ATOM   376  C CB  . VAL A 1 58  ? -22.919 -14.203 4.335   1.00 39.77  ? 355 VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 58  ? -23.191 -12.994 5.208   1.00 35.38  ? 355 VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 58  ? -24.194 -14.654 3.642   1.00 38.60  ? 355 VAL A CG2 1 
ATOM   379  N N   . HIS A 1 59  ? -19.759 -14.417 4.434   1.00 36.23  ? 356 HIS A N   1 
ATOM   380  C CA  . HIS A 1 59  ? -18.472 -14.131 5.059   1.00 37.13  ? 356 HIS A CA  1 
ATOM   381  C C   . HIS A 1 59  ? -17.413 -13.680 4.053   1.00 37.00  ? 356 HIS A C   1 
ATOM   382  O O   . HIS A 1 59  ? -16.516 -12.907 4.397   1.00 40.32  ? 356 HIS A O   1 
ATOM   383  C CB  . HIS A 1 59  ? -17.974 -15.338 5.857   1.00 35.68  ? 356 HIS A CB  1 
ATOM   384  C CG  . HIS A 1 59  ? -18.799 -15.634 7.070   1.00 36.54  ? 356 HIS A CG  1 
ATOM   385  N ND1 . HIS A 1 59  ? -19.720 -16.660 7.115   1.00 38.10  ? 356 HIS A ND1 1 
ATOM   386  C CD2 . HIS A 1 59  ? -18.856 -15.025 8.277   1.00 36.94  ? 356 HIS A CD2 1 
ATOM   387  C CE1 . HIS A 1 59  ? -20.300 -16.675 8.301   1.00 41.35  ? 356 HIS A CE1 1 
ATOM   388  N NE2 . HIS A 1 59  ? -19.795 -15.693 9.025   1.00 42.39  ? 356 HIS A NE2 1 
ATOM   389  N N   . MET A 1 60  ? -17.518 -14.160 2.815   1.00 33.68  ? 357 MET A N   1 
ATOM   390  C CA  . MET A 1 60  ? -16.583 -13.766 1.761   1.00 32.02  ? 357 MET A CA  1 
ATOM   391  C C   . MET A 1 60  ? -16.665 -12.260 1.533   1.00 32.43  ? 357 MET A C   1 
ATOM   392  O O   . MET A 1 60  ? -15.657 -11.593 1.311   1.00 33.69  ? 357 MET A O   1 
ATOM   393  C CB  . MET A 1 60  ? -16.875 -14.523 0.456   1.00 29.60  ? 357 MET A CB  1 
ATOM   394  C CG  . MET A 1 60  ? -15.895 -14.211 -0.676  1.00 30.32  ? 357 MET A CG  1 
ATOM   395  S SD  . MET A 1 60  ? -16.375 -14.879 -2.291  1.00 26.43  ? 357 MET A SD  1 
ATOM   396  C CE  . MET A 1 60  ? -16.414 -16.636 -1.953  1.00 21.35  ? 357 MET A CE  1 
ATOM   397  N N   . ILE A 1 61  ? -17.879 -11.732 1.612   1.00 35.86  ? 358 ILE A N   1 
ATOM   398  C CA  . ILE A 1 61  ? -18.118 -10.303 1.450   1.00 39.74  ? 358 ILE A CA  1 
ATOM   399  C C   . ILE A 1 61  ? -17.486 -9.470  2.570   1.00 41.38  ? 358 ILE A C   1 
ATOM   400  O O   . ILE A 1 61  ? -16.914 -8.413  2.312   1.00 44.66  ? 358 ILE A O   1 
ATOM   401  C CB  . ILE A 1 61  ? -19.625 -10.021 1.320   1.00 40.92  ? 358 ILE A CB  1 
ATOM   402  C CG1 . ILE A 1 61  ? -20.139 -10.627 0.011   1.00 42.10  ? 358 ILE A CG1 1 
ATOM   403  C CG2 . ILE A 1 61  ? -19.909 -8.531  1.374   1.00 44.06  ? 358 ILE A CG2 1 
ATOM   404  C CD1 . ILE A 1 61  ? -21.600 -10.976 0.027   1.00 46.50  ? 358 ILE A CD1 1 
ATOM   405  N N   . ASN A 1 62  ? -17.573 -9.947  3.808   1.00 41.57  ? 359 ASN A N   1 
ATOM   406  C CA  . ASN A 1 62  ? -16.876 -9.289  4.910   1.00 40.61  ? 359 ASN A CA  1 
ATOM   407  C C   . ASN A 1 62  ? -15.363 -9.358  4.725   1.00 37.16  ? 359 ASN A C   1 
ATOM   408  O O   . ASN A 1 62  ? -14.644 -8.414  5.051   1.00 39.89  ? 359 ASN A O   1 
ATOM   409  C CB  . ASN A 1 62  ? -17.255 -9.903  6.258   1.00 38.67  ? 359 ASN A CB  1 
ATOM   410  C CG  . ASN A 1 62  ? -18.688 -9.616  6.650   1.00 44.70  ? 359 ASN A CG  1 
ATOM   411  O OD1 . ASN A 1 62  ? -19.292 -8.648  6.184   1.00 44.68  ? 359 ASN A OD1 1 
ATOM   412  N ND2 . ASN A 1 62  ? -19.242 -10.456 7.521   1.00 46.67  ? 359 ASN A ND2 1 
ATOM   413  N N   . TRP A 1 63  ? -14.885 -10.482 4.203   1.00 33.13  ? 360 TRP A N   1 
ATOM   414  C CA  . TRP A 1 63  ? -13.458 -10.657 3.962   1.00 35.38  ? 360 TRP A CA  1 
ATOM   415  C C   . TRP A 1 63  ? -12.961 -9.722  2.860   1.00 40.07  ? 360 TRP A C   1 
ATOM   416  O O   . TRP A 1 63  ? -11.889 -9.127  2.981   1.00 31.33  ? 360 TRP A O   1 
ATOM   417  C CB  . TRP A 1 63  ? -13.138 -12.115 3.623   1.00 33.53  ? 360 TRP A CB  1 
ATOM   418  C CG  . TRP A 1 63  ? -11.840 -12.284 2.899   1.00 34.44  ? 360 TRP A CG  1 
ATOM   419  C CD1 . TRP A 1 63  ? -10.594 -12.354 3.452   1.00 31.88  ? 360 TRP A CD1 1 
ATOM   420  C CD2 . TRP A 1 63  ? -11.660 -12.401 1.483   1.00 33.08  ? 360 TRP A CD2 1 
ATOM   421  N NE1 . TRP A 1 63  ? -9.648  -12.507 2.466   1.00 28.40  ? 360 TRP A NE1 1 
ATOM   422  C CE2 . TRP A 1 63  ? -10.276 -12.539 1.248   1.00 30.51  ? 360 TRP A CE2 1 
ATOM   423  C CE3 . TRP A 1 63  ? -12.534 -12.401 0.389   1.00 34.40  ? 360 TRP A CE3 1 
ATOM   424  C CZ2 . TRP A 1 63  ? -9.747  -12.676 -0.034  1.00 30.04  ? 360 TRP A CZ2 1 
ATOM   425  C CZ3 . TRP A 1 63  ? -12.008 -12.541 -0.884  1.00 31.47  ? 360 TRP A CZ3 1 
ATOM   426  C CH2 . TRP A 1 63  ? -10.627 -12.676 -1.085  1.00 30.48  ? 360 TRP A CH2 1 
ATOM   427  N N   . ALA A 1 64  ? -13.748 -9.591  1.794   1.00 39.48  ? 361 ALA A N   1 
ATOM   428  C CA  . ALA A 1 64  ? -13.402 -8.708  0.684   1.00 38.82  ? 361 ALA A CA  1 
ATOM   429  C C   . ALA A 1 64  ? -13.251 -7.259  1.142   1.00 42.16  ? 361 ALA A C   1 
ATOM   430  O O   . ALA A 1 64  ? -12.319 -6.569  0.735   1.00 44.15  ? 361 ALA A O   1 
ATOM   431  C CB  . ALA A 1 64  ? -14.441 -8.809  -0.427  1.00 35.93  ? 361 ALA A CB  1 
ATOM   432  N N   . LYS A 1 65  ? -14.162 -6.805  1.996   1.00 43.09  ? 362 LYS A N   1 
ATOM   433  C CA  . LYS A 1 65  ? -14.125 -5.429  2.482   1.00 49.63  ? 362 LYS A CA  1 
ATOM   434  C C   . LYS A 1 65  ? -12.840 -5.140  3.249   1.00 51.86  ? 362 LYS A C   1 
ATOM   435  O O   . LYS A 1 65  ? -12.358 -4.010  3.266   1.00 54.96  ? 362 LYS A O   1 
ATOM   436  C CB  . LYS A 1 65  ? -15.339 -5.141  3.363   1.00 48.07  ? 362 LYS A CB  1 
ATOM   437  C CG  . LYS A 1 65  ? -16.659 -5.254  2.629   1.00 49.29  ? 362 LYS A CG  1 
ATOM   438  C CD  . LYS A 1 65  ? -16.827 -4.133  1.621   1.00 53.96  ? 362 LYS A CD  1 
ATOM   439  C CE  . LYS A 1 65  ? -16.862 -2.780  2.315   1.00 60.39  ? 362 LYS A CE  1 
ATOM   440  N NZ  . LYS A 1 65  ? -17.564 -1.749  1.504   1.00 62.04  ? 362 LYS A NZ  1 
ATOM   441  N N   . ARG A 1 66  ? -12.283 -6.175  3.870   1.00 52.68  ? 363 ARG A N   1 
ATOM   442  C CA  . ARG A 1 66  ? -11.072 -6.027  4.667   1.00 52.46  ? 363 ARG A CA  1 
ATOM   443  C C   . ARG A 1 66  ? -9.786  -6.272  3.870   1.00 48.87  ? 363 ARG A C   1 
ATOM   444  O O   . ARG A 1 66  ? -8.688  -6.072  4.387   1.00 52.71  ? 363 ARG A O   1 
ATOM   445  C CB  . ARG A 1 66  ? -11.132 -6.932  5.899   1.00 51.53  ? 363 ARG A CB  1 
ATOM   446  C CG  . ARG A 1 66  ? -12.221 -6.543  6.892   1.00 57.12  ? 363 ARG A CG  1 
ATOM   447  C CD  . ARG A 1 66  ? -12.261 -7.486  8.087   1.00 60.61  ? 363 ARG A CD  1 
ATOM   448  N NE  . ARG A 1 66  ? -13.242 -7.064  9.083   1.00 67.62  ? 363 ARG A NE  1 
ATOM   449  C CZ  . ARG A 1 66  ? -14.543 -7.329  9.014   1.00 69.48  ? 363 ARG A CZ  1 
ATOM   450  N NH1 . ARG A 1 66  ? -15.029 -8.014  7.988   1.00 66.40  ? 363 ARG A NH1 1 
ATOM   451  N NH2 . ARG A 1 66  ? -15.362 -6.903  9.967   1.00 72.96  ? 363 ARG A NH2 1 
ATOM   452  N N   . VAL A 1 67  ? -9.922  -6.705  2.618   1.00 39.42  ? 364 VAL A N   1 
ATOM   453  C CA  . VAL A 1 67  ? -8.773  -6.801  1.724   1.00 38.28  ? 364 VAL A CA  1 
ATOM   454  C C   . VAL A 1 67  ? -8.302  -5.388  1.396   1.00 47.11  ? 364 VAL A C   1 
ATOM   455  O O   . VAL A 1 67  ? -9.056  -4.602  0.821   1.00 53.88  ? 364 VAL A O   1 
ATOM   456  C CB  . VAL A 1 67  ? -9.120  -7.539  0.411   1.00 37.51  ? 364 VAL A CB  1 
ATOM   457  C CG1 . VAL A 1 67  ? -7.955  -7.463  -0.568  1.00 39.33  ? 364 VAL A CG1 1 
ATOM   458  C CG2 . VAL A 1 67  ? -9.494  -8.988  0.687   1.00 32.17  ? 364 VAL A CG2 1 
ATOM   459  N N   . PRO A 1 68  ? -7.058  -5.054  1.774   1.00 47.39  ? 365 PRO A N   1 
ATOM   460  C CA  . PRO A 1 68  ? -6.527  -3.700  1.582   1.00 51.03  ? 365 PRO A CA  1 
ATOM   461  C C   . PRO A 1 68  ? -6.643  -3.232  0.136   1.00 53.52  ? 365 PRO A C   1 
ATOM   462  O O   . PRO A 1 68  ? -6.110  -3.874  -0.769  1.00 52.54  ? 365 PRO A O   1 
ATOM   463  C CB  . PRO A 1 68  ? -5.056  -3.845  1.980   1.00 51.36  ? 365 PRO A CB  1 
ATOM   464  C CG  . PRO A 1 68  ? -5.048  -4.976  2.948   1.00 49.97  ? 365 PRO A CG  1 
ATOM   465  C CD  . PRO A 1 68  ? -6.080  -5.939  2.428   1.00 46.50  ? 365 PRO A CD  1 
ATOM   466  N N   . GLY A 1 69  ? -7.358  -2.129  -0.067  1.00 58.66  ? 366 GLY A N   1 
ATOM   467  C CA  . GLY A 1 69  ? -7.533  -1.555  -1.388  1.00 58.61  ? 366 GLY A CA  1 
ATOM   468  C C   . GLY A 1 69  ? -8.913  -1.794  -1.969  1.00 54.43  ? 366 GLY A C   1 
ATOM   469  O O   . GLY A 1 69  ? -9.361  -1.061  -2.850  1.00 58.37  ? 366 GLY A O   1 
ATOM   470  N N   . PHE A 1 70  ? -9.593  -2.821  -1.473  1.00 47.41  ? 367 PHE A N   1 
ATOM   471  C CA  . PHE A 1 70  ? -10.887 -3.207  -2.023  1.00 47.53  ? 367 PHE A CA  1 
ATOM   472  C C   . PHE A 1 70  ? -11.967 -2.173  -1.713  1.00 52.36  ? 367 PHE A C   1 
ATOM   473  O O   . PHE A 1 70  ? -12.809 -1.874  -2.559  1.00 53.46  ? 367 PHE A O   1 
ATOM   474  C CB  . PHE A 1 70  ? -11.295 -4.589  -1.506  1.00 42.36  ? 367 PHE A CB  1 
ATOM   475  C CG  . PHE A 1 70  ? -12.514 -5.157  -2.179  1.00 41.02  ? 367 PHE A CG  1 
ATOM   476  C CD1 . PHE A 1 70  ? -12.406 -5.831  -3.385  1.00 40.12  ? 367 PHE A CD1 1 
ATOM   477  C CD2 . PHE A 1 70  ? -13.766 -5.025  -1.600  1.00 41.58  ? 367 PHE A CD2 1 
ATOM   478  C CE1 . PHE A 1 70  ? -13.524 -6.358  -4.006  1.00 38.12  ? 367 PHE A CE1 1 
ATOM   479  C CE2 . PHE A 1 70  ? -14.889 -5.554  -2.215  1.00 42.28  ? 367 PHE A CE2 1 
ATOM   480  C CZ  . PHE A 1 70  ? -14.767 -6.220  -3.420  1.00 39.86  ? 367 PHE A CZ  1 
ATOM   481  N N   . VAL A 1 71  ? -11.933 -1.624  -0.504  1.00 56.61  ? 368 VAL A N   1 
ATOM   482  C CA  . VAL A 1 71  ? -12.936 -0.652  -0.079  1.00 61.56  ? 368 VAL A CA  1 
ATOM   483  C C   . VAL A 1 71  ? -12.788 0.681   -0.820  1.00 65.63  ? 368 VAL A C   1 
ATOM   484  O O   . VAL A 1 71  ? -13.733 1.469   -0.892  1.00 71.78  ? 368 VAL A O   1 
ATOM   485  C CB  . VAL A 1 71  ? -12.891 -0.423  1.450   1.00 66.64  ? 368 VAL A CB  1 
ATOM   486  C CG1 . VAL A 1 71  ? -11.654 0.374   1.839   1.00 69.93  ? 368 VAL A CG1 1 
ATOM   487  C CG2 . VAL A 1 71  ? -14.158 0.274   1.927   1.00 70.86  ? 368 VAL A CG2 1 
ATOM   488  N N   . ASP A 1 72  ? -11.607 0.919   -1.386  1.00 61.65  ? 369 ASP A N   1 
ATOM   489  C CA  . ASP A 1 72  ? -11.346 2.142   -2.144  1.00 60.79  ? 369 ASP A CA  1 
ATOM   490  C C   . ASP A 1 72  ? -12.006 2.092   -3.516  1.00 58.48  ? 369 ASP A C   1 
ATOM   491  O O   . ASP A 1 72  ? -11.990 3.072   -4.258  1.00 58.44  ? 369 ASP A O   1 
ATOM   492  C CB  . ASP A 1 72  ? -9.844  2.360   -2.316  1.00 61.05  ? 369 ASP A CB  1 
ATOM   493  C CG  . ASP A 1 72  ? -9.109  2.416   -0.997  1.00 64.64  ? 369 ASP A CG  1 
ATOM   494  O OD1 . ASP A 1 72  ? -9.545  3.171   -0.103  1.00 69.43  ? 369 ASP A OD1 1 
ATOM   495  O OD2 . ASP A 1 72  ? -8.099  1.696   -0.855  1.00 62.95  ? 369 ASP A OD2 1 
ATOM   496  N N   . LEU A 1 73  ? -12.577 0.941   -3.850  1.00 57.30  ? 370 LEU A N   1 
ATOM   497  C CA  . LEU A 1 73  ? -13.214 0.747   -5.144  1.00 54.60  ? 370 LEU A CA  1 
ATOM   498  C C   . LEU A 1 73  ? -14.659 1.232   -5.147  1.00 59.36  ? 370 LEU A C   1 
ATOM   499  O O   . LEU A 1 73  ? -15.303 1.318   -4.099  1.00 62.70  ? 370 LEU A O   1 
ATOM   500  C CB  . LEU A 1 73  ? -13.168 -0.732  -5.532  1.00 46.62  ? 370 LEU A CB  1 
ATOM   501  C CG  . LEU A 1 73  ? -11.784 -1.346  -5.747  1.00 44.64  ? 370 LEU A CG  1 
ATOM   502  C CD1 . LEU A 1 73  ? -11.905 -2.849  -5.935  1.00 39.39  ? 370 LEU A CD1 1 
ATOM   503  C CD2 . LEU A 1 73  ? -11.094 -0.710  -6.946  1.00 44.49  ? 370 LEU A CD2 1 
ATOM   504  N N   . THR A 1 74  ? -15.157 1.561   -6.334  1.00 60.04  ? 371 THR A N   1 
ATOM   505  C CA  . THR A 1 74  ? -16.578 1.820   -6.533  1.00 63.10  ? 371 THR A CA  1 
ATOM   506  C C   . THR A 1 74  ? -17.374 0.578   -6.118  1.00 63.50  ? 371 THR A C   1 
ATOM   507  O O   . THR A 1 74  ? -16.919 -0.557  -6.321  1.00 60.97  ? 371 THR A O   1 
ATOM   508  C CB  . THR A 1 74  ? -16.862 2.199   -8.010  1.00 73.43  ? 371 THR A CB  1 
ATOM   509  O OG1 . THR A 1 74  ? -16.614 3.598   -8.198  1.00 77.51  ? 371 THR A OG1 1 
ATOM   510  C CG2 . THR A 1 74  ? -18.304 1.908   -8.395  1.00 74.80  ? 371 THR A CG2 1 
ATOM   511  N N   . LEU A 1 75  ? -18.535 0.797   -5.504  1.00 64.13  ? 372 LEU A N   1 
ATOM   512  C CA  . LEU A 1 75  ? -19.412 -0.293  -5.089  1.00 65.55  ? 372 LEU A CA  1 
ATOM   513  C C   . LEU A 1 75  ? -19.710 -1.257  -6.240  1.00 65.98  ? 372 LEU A C   1 
ATOM   514  O O   . LEU A 1 75  ? -19.742 -2.473  -6.054  1.00 62.90  ? 372 LEU A O   1 
ATOM   515  C CB  . LEU A 1 75  ? -20.707 0.277   -4.503  1.00 68.99  ? 372 LEU A CB  1 
ATOM   516  C CG  . LEU A 1 75  ? -21.928 -0.628  -4.378  1.00 70.30  ? 372 LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 75  ? -22.638 -0.380  -3.062  1.00 74.92  ? 372 LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 75  ? -22.882 -0.387  -5.534  1.00 73.44  ? 372 LEU A CD2 1 
ATOM   519  N N   . HIS A 1 76  ? -19.913 -0.704  -7.431  1.00 68.75  ? 373 HIS A N   1 
ATOM   520  C CA  . HIS A 1 76  ? -20.200 -1.509  -8.611  1.00 66.18  ? 373 HIS A CA  1 
ATOM   521  C C   . HIS A 1 76  ? -18.972 -2.282  -9.075  1.00 58.05  ? 373 HIS A C   1 
ATOM   522  O O   . HIS A 1 76  ? -19.091 -3.370  -9.639  1.00 57.42  ? 373 HIS A O   1 
ATOM   523  C CB  . HIS A 1 76  ? -20.736 -0.626  -9.736  1.00 71.75  ? 373 HIS A CB  1 
ATOM   524  C CG  . HIS A 1 76  ? -21.969 0.127   -9.365  1.00 78.14  ? 373 HIS A CG  1 
ATOM   525  N ND1 . HIS A 1 76  ? -23.136 -0.502  -8.968  1.00 78.79  ? 373 HIS A ND1 1 
ATOM   526  C CD2 . HIS A 1 76  ? -22.232 1.454   -9.314  1.00 83.55  ? 373 HIS A CD2 1 
ATOM   527  C CE1 . HIS A 1 76  ? -24.051 0.401   -8.696  1.00 83.17  ? 373 HIS A CE1 1 
ATOM   528  N NE2 . HIS A 1 76  ? -23.530 1.603   -8.899  1.00 87.16  ? 373 HIS A NE2 1 
ATOM   529  N N   . ASP A 1 77  ? -17.795 -1.714  -8.837  1.00 52.74  ? 374 ASP A N   1 
ATOM   530  C CA  . ASP A 1 77  ? -16.548 -2.400  -9.147  1.00 49.79  ? 374 ASP A CA  1 
ATOM   531  C C   . ASP A 1 77  ? -16.306 -3.524  -8.152  1.00 49.93  ? 374 ASP A C   1 
ATOM   532  O O   . ASP A 1 77  ? -15.773 -4.573  -8.506  1.00 55.84  ? 374 ASP A O   1 
ATOM   533  C CB  . ASP A 1 77  ? -15.377 -1.419  -9.153  1.00 51.13  ? 374 ASP A CB  1 
ATOM   534  C CG  . ASP A 1 77  ? -15.341 -0.571  -10.406 1.00 57.27  ? 374 ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 77  ? -16.313 -0.634  -11.189 1.00 56.43  ? 374 ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 77  ? -14.349 0.161   -10.607 1.00 62.45  ? 374 ASP A OD2 1 
ATOM   537  N N   . GLN A 1 78  ? -16.706 -3.300  -6.905  1.00 48.43  ? 375 GLN A N   1 
ATOM   538  C CA  . GLN A 1 78  ? -16.644 -4.339  -5.887  1.00 46.69  ? 375 GLN A CA  1 
ATOM   539  C C   . GLN A 1 78  ? -17.574 -5.488  -6.264  1.00 37.71  ? 375 GLN A C   1 
ATOM   540  O O   . GLN A 1 78  ? -17.199 -6.653  -6.173  1.00 34.99  ? 375 GLN A O   1 
ATOM   541  C CB  . GLN A 1 78  ? -17.037 -3.775  -4.519  1.00 49.00  ? 375 GLN A CB  1 
ATOM   542  C CG  . GLN A 1 78  ? -16.051 -2.773  -3.933  1.00 52.20  ? 375 GLN A CG  1 
ATOM   543  C CD  . GLN A 1 78  ? -16.572 -2.126  -2.657  1.00 54.06  ? 375 GLN A CD  1 
ATOM   544  O OE1 . GLN A 1 78  ? -17.763 -2.190  -2.360  1.00 52.23  ? 375 GLN A OE1 1 
ATOM   545  N NE2 . GLN A 1 78  ? -15.679 -1.499  -1.900  1.00 56.04  ? 375 GLN A NE2 1 
ATOM   546  N N   . VAL A 1 79  ? -18.787 -5.143  -6.688  1.00 40.03  ? 376 VAL A N   1 
ATOM   547  C CA  . VAL A 1 79  ? -19.788 -6.120  -7.102  1.00 41.24  ? 376 VAL A CA  1 
ATOM   548  C C   . VAL A 1 79  ? -19.271 -6.950  -8.264  1.00 44.10  ? 376 VAL A C   1 
ATOM   549  O O   . VAL A 1 79  ? -19.369 -8.180  -8.264  1.00 45.55  ? 376 VAL A O   1 
ATOM   550  C CB  . VAL A 1 79  ? -21.098 -5.427  -7.535  1.00 45.57  ? 376 VAL A CB  1 
ATOM   551  C CG1 . VAL A 1 79  ? -21.985 -6.381  -8.325  1.00 43.66  ? 376 VAL A CG1 1 
ATOM   552  C CG2 . VAL A 1 79  ? -21.834 -4.886  -6.324  1.00 48.03  ? 376 VAL A CG2 1 
ATOM   553  N N   . HIS A 1 80  ? -18.713 -6.263  -9.252  1.00 43.22  ? 377 HIS A N   1 
ATOM   554  C CA  . HIS A 1 80  ? -18.193 -6.922  -10.433 1.00 43.55  ? 377 HIS A CA  1 
ATOM   555  C C   . HIS A 1 80  ? -17.098 -7.931  -10.089 1.00 38.72  ? 377 HIS A C   1 
ATOM   556  O O   . HIS A 1 80  ? -17.141 -9.077  -10.540 1.00 39.93  ? 377 HIS A O   1 
ATOM   557  C CB  . HIS A 1 80  ? -17.662 -5.894  -11.428 1.00 49.62  ? 377 HIS A CB  1 
ATOM   558  C CG  . HIS A 1 80  ? -17.050 -6.509  -12.643 1.00 52.40  ? 377 HIS A CG  1 
ATOM   559  N ND1 . HIS A 1 80  ? -17.799 -6.930  -13.721 1.00 56.35  ? 377 HIS A ND1 1 
ATOM   560  C CD2 . HIS A 1 80  ? -15.763 -6.804  -12.939 1.00 50.62  ? 377 HIS A CD2 1 
ATOM   561  C CE1 . HIS A 1 80  ? -16.997 -7.442  -14.636 1.00 54.90  ? 377 HIS A CE1 1 
ATOM   562  N NE2 . HIS A 1 80  ? -15.757 -7.379  -14.186 1.00 51.53  ? 377 HIS A NE2 1 
ATOM   563  N N   . LEU A 1 81  ? -16.123 -7.505  -9.290  1.00 34.73  ? 378 LEU A N   1 
ATOM   564  C CA  . LEU A 1 81  ? -15.014 -8.376  -8.905  1.00 33.15  ? 378 LEU A CA  1 
ATOM   565  C C   . LEU A 1 81  ? -15.495 -9.628  -8.186  1.00 32.63  ? 378 LEU A C   1 
ATOM   566  O O   . LEU A 1 81  ? -15.027 -10.730 -8.471  1.00 33.59  ? 378 LEU A O   1 
ATOM   567  C CB  . LEU A 1 81  ? -14.005 -7.627  -8.031  1.00 36.76  ? 378 LEU A CB  1 
ATOM   568  C CG  . LEU A 1 81  ? -13.186 -6.538  -8.725  1.00 42.07  ? 378 LEU A CG  1 
ATOM   569  C CD1 . LEU A 1 81  ? -12.153 -5.971  -7.775  1.00 33.29  ? 378 LEU A CD1 1 
ATOM   570  C CD2 . LEU A 1 81  ? -12.522 -7.086  -9.987  1.00 45.10  ? 378 LEU A CD2 1 
ATOM   571  N N   . LEU A 1 82  ? -16.431 -9.456  -7.256  1.00 35.20  ? 379 LEU A N   1 
ATOM   572  C CA  . LEU A 1 82  ? -16.976 -10.580 -6.502  1.00 32.77  ? 379 LEU A CA  1 
ATOM   573  C C   . LEU A 1 82  ? -17.780 -11.529 -7.391  1.00 34.50  ? 379 LEU A C   1 
ATOM   574  O O   . LEU A 1 82  ? -17.672 -12.754 -7.250  1.00 27.07  ? 379 LEU A O   1 
ATOM   575  C CB  . LEU A 1 82  ? -17.825 -10.085 -5.330  1.00 32.73  ? 379 LEU A CB  1 
ATOM   576  C CG  . LEU A 1 82  ? -17.043 -9.759  -4.058  1.00 33.50  ? 379 LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 82  ? -17.942 -9.125  -3.010  1.00 34.30  ? 379 LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 82  ? -16.377 -11.015 -3.505  1.00 30.90  ? 379 LEU A CD2 1 
ATOM   579  N N   . GLU A 1 83  ? -18.580 -10.969 -8.299  1.00 30.89  ? 380 GLU A N   1 
ATOM   580  C CA  . GLU A 1 83  ? -19.347 -11.776 -9.247  1.00 36.72  ? 380 GLU A CA  1 
ATOM   581  C C   . GLU A 1 83  ? -18.432 -12.623 -10.122 1.00 35.46  ? 380 GLU A C   1 
ATOM   582  O O   . GLU A 1 83  ? -18.753 -13.764 -10.448 1.00 36.19  ? 380 GLU A O   1 
ATOM   583  C CB  . GLU A 1 83  ? -20.240 -10.883 -10.124 1.00 37.75  ? 380 GLU A CB  1 
ATOM   584  C CG  . GLU A 1 83  ? -21.468 -10.315 -9.441  1.00 44.65  ? 380 GLU A CG  1 
ATOM   585  C CD  . GLU A 1 83  ? -22.265 -9.392  -10.351 1.00 53.72  ? 380 GLU A CD  1 
ATOM   586  O OE1 . GLU A 1 83  ? -23.453 -9.138  -10.055 1.00 58.12  ? 380 GLU A OE1 1 
ATOM   587  O OE2 . GLU A 1 83  ? -21.703 -8.917  -11.363 1.00 54.88  ? 380 GLU A OE2 1 
ATOM   588  N N   . CYS A 1 84  ? -17.295 -12.053 -10.505 1.00 32.36  ? 381 CYS A N   1 
ATOM   589  C CA  . CYS A 1 84  ? -16.347 -12.764 -11.350 1.00 29.84  ? 381 CYS A CA  1 
ATOM   590  C C   . CYS A 1 84  ? -15.576 -13.845 -10.600 1.00 29.90  ? 381 CYS A C   1 
ATOM   591  O O   . CYS A 1 84  ? -15.304 -14.919 -11.140 1.00 29.12  ? 381 CYS A O   1 
ATOM   592  C CB  . CYS A 1 84  ? -15.342 -11.787 -11.970 1.00 33.74  ? 381 CYS A CB  1 
ATOM   593  S SG  . CYS A 1 84  ? -16.018 -10.743 -13.286 1.00 84.02  ? 381 CYS A SG  1 
ATOM   594  N N   . ALA A 1 85  ? -15.236 -13.569 -9.346  1.00 30.57  ? 382 ALA A N   1 
ATOM   595  C CA  . ALA A 1 85  ? -14.250 -14.384 -8.645  1.00 29.43  ? 382 ALA A CA  1 
ATOM   596  C C   . ALA A 1 85  ? -14.791 -15.301 -7.550  1.00 26.11  ? 382 ALA A C   1 
ATOM   597  O O   . ALA A 1 85  ? -14.023 -16.066 -6.970  1.00 22.26  ? 382 ALA A O   1 
ATOM   598  C CB  . ALA A 1 85  ? -13.148 -13.489 -8.078  1.00 31.36  ? 382 ALA A CB  1 
ATOM   599  N N   . TRP A 1 86  ? -16.093 -15.244 -7.272  1.00 29.37  ? 383 TRP A N   1 
ATOM   600  C CA  . TRP A 1 86  ? -16.631 -15.920 -6.081  1.00 30.93  ? 383 TRP A CA  1 
ATOM   601  C C   . TRP A 1 86  ? -16.375 -17.426 -6.027  1.00 30.80  ? 383 TRP A C   1 
ATOM   602  O O   . TRP A 1 86  ? -16.040 -17.955 -4.970  1.00 30.30  ? 383 TRP A O   1 
ATOM   603  C CB  . TRP A 1 86  ? -18.121 -15.626 -5.872  1.00 31.61  ? 383 TRP A CB  1 
ATOM   604  C CG  . TRP A 1 86  ? -19.041 -16.275 -6.867  1.00 33.35  ? 383 TRP A CG  1 
ATOM   605  C CD1 . TRP A 1 86  ? -19.468 -15.748 -8.050  1.00 36.06  ? 383 TRP A CD1 1 
ATOM   606  C CD2 . TRP A 1 86  ? -19.667 -17.560 -6.750  1.00 31.43  ? 383 TRP A CD2 1 
ATOM   607  N NE1 . TRP A 1 86  ? -20.313 -16.627 -8.684  1.00 38.98  ? 383 TRP A NE1 1 
ATOM   608  C CE2 . TRP A 1 86  ? -20.454 -17.747 -7.907  1.00 35.89  ? 383 TRP A CE2 1 
ATOM   609  C CE3 . TRP A 1 86  ? -19.638 -18.572 -5.785  1.00 29.01  ? 383 TRP A CE3 1 
ATOM   610  C CZ2 . TRP A 1 86  ? -21.204 -18.904 -8.123  1.00 33.39  ? 383 TRP A CZ2 1 
ATOM   611  C CZ3 . TRP A 1 86  ? -20.383 -19.723 -6.003  1.00 29.02  ? 383 TRP A CZ3 1 
ATOM   612  C CH2 . TRP A 1 86  ? -21.155 -19.877 -7.162  1.00 31.13  ? 383 TRP A CH2 1 
ATOM   613  N N   . LEU A 1 87  ? -16.518 -18.113 -7.157  1.00 28.85  ? 384 LEU A N   1 
ATOM   614  C CA  . LEU A 1 87  ? -16.306 -19.557 -7.167  1.00 27.38  ? 384 LEU A CA  1 
ATOM   615  C C   . LEU A 1 87  ? -14.818 -19.908 -7.089  1.00 30.18  ? 384 LEU A C   1 
ATOM   616  O O   . LEU A 1 87  ? -14.442 -20.877 -6.430  1.00 32.39  ? 384 LEU A O   1 
ATOM   617  C CB  . LEU A 1 87  ? -16.975 -20.214 -8.377  1.00 27.46  ? 384 LEU A CB  1 
ATOM   618  C CG  . LEU A 1 87  ? -17.000 -21.746 -8.386  1.00 27.73  ? 384 LEU A CG  1 
ATOM   619  C CD1 . LEU A 1 87  ? -17.591 -22.291 -7.083  1.00 27.05  ? 384 LEU A CD1 1 
ATOM   620  C CD2 . LEU A 1 87  ? -17.778 -22.275 -9.592  1.00 25.74  ? 384 LEU A CD2 1 
ATOM   621  N N   . GLU A 1 88  ? -13.976 -19.113 -7.745  1.00 20.97  ? 385 GLU A N   1 
ATOM   622  C CA  . GLU A 1 88  ? -12.529 -19.276 -7.619  1.00 25.97  ? 385 GLU A CA  1 
ATOM   623  C C   . GLU A 1 88  ? -12.114 -19.158 -6.160  1.00 25.69  ? 385 GLU A C   1 
ATOM   624  O O   . GLU A 1 88  ? -11.302 -19.941 -5.665  1.00 24.39  ? 385 GLU A O   1 
ATOM   625  C CB  . GLU A 1 88  ? -11.775 -18.225 -8.444  1.00 31.42  ? 385 GLU A CB  1 
ATOM   626  C CG  . GLU A 1 88  ? -11.815 -18.440 -9.950  1.00 33.35  ? 385 GLU A CG  1 
ATOM   627  C CD  . GLU A 1 88  ? -10.954 -17.443 -10.712 1.00 33.70  ? 385 GLU A CD  1 
ATOM   628  O OE1 . GLU A 1 88  ? -11.524 -16.576 -11.403 1.00 34.41  ? 385 GLU A OE1 1 
ATOM   629  O OE2 . GLU A 1 88  ? -9.709  -17.529 -10.629 1.00 31.44  ? 385 GLU A OE2 1 
ATOM   630  N N   . ILE A 1 89  ? -12.687 -18.175 -5.475  1.00 25.21  ? 386 ILE A N   1 
ATOM   631  C CA  . ILE A 1 89  ? -12.352 -17.922 -4.082  1.00 22.68  ? 386 ILE A CA  1 
ATOM   632  C C   . ILE A 1 89  ? -12.801 -19.075 -3.177  1.00 25.21  ? 386 ILE A C   1 
ATOM   633  O O   . ILE A 1 89  ? -12.073 -19.465 -2.263  1.00 25.05  ? 386 ILE A O   1 
ATOM   634  C CB  . ILE A 1 89  ? -12.914 -16.558 -3.604  1.00 26.30  ? 386 ILE A CB  1 
ATOM   635  C CG1 . ILE A 1 89  ? -12.233 -15.418 -4.371  1.00 24.43  ? 386 ILE A CG1 1 
ATOM   636  C CG2 . ILE A 1 89  ? -12.707 -16.377 -2.101  1.00 28.40  ? 386 ILE A CG2 1 
ATOM   637  C CD1 . ILE A 1 89  ? -12.957 -14.090 -4.280  1.00 27.80  ? 386 ILE A CD1 1 
ATOM   638  N N   . LEU A 1 90  ? -13.982 -19.632 -3.439  1.00 24.75  ? 387 LEU A N   1 
ATOM   639  C CA  . LEU A 1 90  ? -14.455 -20.784 -2.667  1.00 25.63  ? 387 LEU A CA  1 
ATOM   640  C C   . LEU A 1 90  ? -13.553 -21.984 -2.913  1.00 29.61  ? 387 LEU A C   1 
ATOM   641  O O   . LEU A 1 90  ? -13.194 -22.713 -1.983  1.00 26.93  ? 387 LEU A O   1 
ATOM   642  C CB  . LEU A 1 90  ? -15.897 -21.148 -3.030  1.00 22.21  ? 387 LEU A CB  1 
ATOM   643  C CG  . LEU A 1 90  ? -17.028 -20.233 -2.562  1.00 24.32  ? 387 LEU A CG  1 
ATOM   644  C CD1 . LEU A 1 90  ? -18.370 -20.811 -2.991  1.00 23.91  ? 387 LEU A CD1 1 
ATOM   645  C CD2 . LEU A 1 90  ? -16.981 -20.038 -1.051  1.00 21.94  ? 387 LEU A CD2 1 
ATOM   646  N N   . MET A 1 91  ? -13.185 -22.172 -4.178  1.00 31.52  ? 388 MET A N   1 
ATOM   647  C CA  . MET A 1 91  ? -12.359 -23.300 -4.583  1.00 27.39  ? 388 MET A CA  1 
ATOM   648  C C   . MET A 1 91  ? -10.964 -23.250 -3.979  1.00 26.79  ? 388 MET A C   1 
ATOM   649  O O   . MET A 1 91  ? -10.463 -24.265 -3.495  1.00 28.76  ? 388 MET A O   1 
ATOM   650  C CB  . MET A 1 91  ? -12.291 -23.405 -6.112  1.00 27.10  ? 388 MET A CB  1 
ATOM   651  C CG  . MET A 1 91  ? -13.569 -23.970 -6.718  1.00 30.11  ? 388 MET A CG  1 
ATOM   652  S SD  . MET A 1 91  ? -13.602 -24.025 -8.514  1.00 32.38  ? 388 MET A SD  1 
ATOM   653  C CE  . MET A 1 91  ? -15.156 -24.869 -8.780  1.00 45.66  ? 388 MET A CE  1 
ATOM   654  N N   . ILE A 1 92  ? -10.333 -22.081 -3.993  1.00 19.21  ? 389 ILE A N   1 
ATOM   655  C CA  . ILE A 1 92  ? -8.990  -21.993 -3.434  1.00 25.27  ? 389 ILE A CA  1 
ATOM   656  C C   . ILE A 1 92  ? -9.049  -22.187 -1.915  1.00 24.79  ? 389 ILE A C   1 
ATOM   657  O O   . ILE A 1 92  ? -8.112  -22.705 -1.309  1.00 29.05  ? 389 ILE A O   1 
ATOM   658  C CB  . ILE A 1 92  ? -8.249  -20.692 -3.839  1.00 22.00  ? 389 ILE A CB  1 
ATOM   659  C CG1 . ILE A 1 92  ? -6.766  -20.788 -3.473  1.00 24.97  ? 389 ILE A CG1 1 
ATOM   660  C CG2 . ILE A 1 92  ? -8.899  -19.457 -3.214  1.00 19.44  ? 389 ILE A CG2 1 
ATOM   661  C CD1 . ILE A 1 92  ? -5.957  -19.566 -3.878  1.00 27.45  ? 389 ILE A CD1 1 
ATOM   662  N N   . GLY A 1 93  ? -10.171 -21.797 -1.316  1.00 24.44  ? 390 GLY A N   1 
ATOM   663  C CA  . GLY A 1 93  ? -10.427 -22.082 0.084   1.00 28.45  ? 390 GLY A CA  1 
ATOM   664  C C   . GLY A 1 93  ? -10.551 -23.577 0.328   1.00 30.76  ? 390 GLY A C   1 
ATOM   665  O O   . GLY A 1 93  ? -9.914  -24.122 1.233   1.00 32.14  ? 390 GLY A O   1 
ATOM   666  N N   . LEU A 1 94  ? -11.367 -24.242 -0.490  1.00 28.95  ? 391 LEU A N   1 
ATOM   667  C CA  . LEU A 1 94  ? -11.568 -25.686 -0.383  1.00 31.62  ? 391 LEU A CA  1 
ATOM   668  C C   . LEU A 1 94  ? -10.258 -26.451 -0.554  1.00 34.54  ? 391 LEU A C   1 
ATOM   669  O O   . LEU A 1 94  ? -9.960  -27.381 0.200   1.00 35.33  ? 391 LEU A O   1 
ATOM   670  C CB  . LEU A 1 94  ? -12.575 -26.161 -1.429  1.00 28.84  ? 391 LEU A CB  1 
ATOM   671  C CG  . LEU A 1 94  ? -12.716 -27.675 -1.584  1.00 27.74  ? 391 LEU A CG  1 
ATOM   672  C CD1 . LEU A 1 94  ? -13.261 -28.304 -0.309  1.00 31.15  ? 391 LEU A CD1 1 
ATOM   673  C CD2 . LEU A 1 94  ? -13.603 -28.003 -2.769  1.00 27.00  ? 391 LEU A CD2 1 
ATOM   674  N N   . VAL A 1 95  ? -9.483  -26.046 -1.553  1.00 29.80  ? 392 VAL A N   1 
ATOM   675  C CA  . VAL A 1 95  ? -8.187  -26.649 -1.832  1.00 31.77  ? 392 VAL A CA  1 
ATOM   676  C C   . VAL A 1 95  ? -7.219  -26.477 -0.660  1.00 35.49  ? 392 VAL A C   1 
ATOM   677  O O   . VAL A 1 95  ? -6.533  -27.425 -0.266  1.00 36.28  ? 392 VAL A O   1 
ATOM   678  C CB  . VAL A 1 95  ? -7.570  -26.047 -3.114  1.00 32.62  ? 392 VAL A CB  1 
ATOM   679  C CG1 . VAL A 1 95  ? -6.106  -26.406 -3.223  1.00 35.65  ? 392 VAL A CG1 1 
ATOM   680  C CG2 . VAL A 1 95  ? -8.334  -26.519 -4.343  1.00 31.39  ? 392 VAL A CG2 1 
ATOM   681  N N   . TRP A 1 96  ? -7.178  -25.270 -0.099  1.00 34.96  ? 393 TRP A N   1 
ATOM   682  C CA  . TRP A 1 96  ? -6.261  -24.954 0.995   1.00 31.91  ? 393 TRP A CA  1 
ATOM   683  C C   . TRP A 1 96  ? -6.509  -25.791 2.245   1.00 32.42  ? 393 TRP A C   1 
ATOM   684  O O   . TRP A 1 96  ? -5.577  -26.362 2.810   1.00 36.49  ? 393 TRP A O   1 
ATOM   685  C CB  . TRP A 1 96  ? -6.315  -23.462 1.333   1.00 29.97  ? 393 TRP A CB  1 
ATOM   686  C CG  . TRP A 1 96  ? -5.801  -23.117 2.708   1.00 30.00  ? 393 TRP A CG  1 
ATOM   687  C CD1 . TRP A 1 96  ? -6.545  -22.728 3.784   1.00 28.55  ? 393 TRP A CD1 1 
ATOM   688  C CD2 . TRP A 1 96  ? -4.435  -23.131 3.146   1.00 31.62  ? 393 TRP A CD2 1 
ATOM   689  N NE1 . TRP A 1 96  ? -5.727  -22.498 4.865   1.00 34.57  ? 393 TRP A NE1 1 
ATOM   690  C CE2 . TRP A 1 96  ? -4.432  -22.737 4.502   1.00 33.08  ? 393 TRP A CE2 1 
ATOM   691  C CE3 . TRP A 1 96  ? -3.221  -23.436 2.528   1.00 31.80  ? 393 TRP A CE3 1 
ATOM   692  C CZ2 . TRP A 1 96  ? -3.256  -22.643 5.246   1.00 31.25  ? 393 TRP A CZ2 1 
ATOM   693  C CZ3 . TRP A 1 96  ? -2.057  -23.344 3.268   1.00 36.61  ? 393 TRP A CZ3 1 
ATOM   694  C CH2 . TRP A 1 96  ? -2.083  -22.952 4.615   1.00 41.67  ? 393 TRP A CH2 1 
ATOM   695  N N   . ARG A 1 97  ? -7.761  -25.873 2.681   1.00 32.24  ? 394 ARG A N   1 
ATOM   696  C CA  . ARG A 1 97  ? -8.059  -26.636 3.891   1.00 39.39  ? 394 ARG A CA  1 
ATOM   697  C C   . ARG A 1 97  ? -8.074  -28.147 3.640   1.00 41.60  ? 394 ARG A C   1 
ATOM   698  O O   . ARG A 1 97  ? -8.166  -28.935 4.578   1.00 45.19  ? 394 ARG A O   1 
ATOM   699  C CB  . ARG A 1 97  ? -9.355  -26.154 4.564   1.00 38.53  ? 394 ARG A CB  1 
ATOM   700  C CG  . ARG A 1 97  ? -10.615 -26.312 3.738   1.00 38.71  ? 394 ARG A CG  1 
ATOM   701  C CD  . ARG A 1 97  ? -11.820 -25.693 4.443   1.00 37.02  ? 394 ARG A CD  1 
ATOM   702  N NE  . ARG A 1 97  ? -13.048 -25.892 3.679   1.00 37.67  ? 394 ARG A NE  1 
ATOM   703  C CZ  . ARG A 1 97  ? -13.545 -25.012 2.815   1.00 37.06  ? 394 ARG A CZ  1 
ATOM   704  N NH1 . ARG A 1 97  ? -12.925 -23.858 2.611   1.00 37.72  ? 394 ARG A NH1 1 
ATOM   705  N NH2 . ARG A 1 97  ? -14.667 -25.283 2.161   1.00 33.43  ? 394 ARG A NH2 1 
ATOM   706  N N   . SER A 1 98  ? -7.957  -28.546 2.375   1.00 41.26  ? 395 SER A N   1 
ATOM   707  C CA  . SER A 1 98  ? -7.888  -29.964 2.023   1.00 41.93  ? 395 SER A CA  1 
ATOM   708  C C   . SER A 1 98  ? -6.449  -30.462 1.904   1.00 42.77  ? 395 SER A C   1 
ATOM   709  O O   . SER A 1 98  ? -6.218  -31.641 1.646   1.00 45.18  ? 395 SER A O   1 
ATOM   710  C CB  . SER A 1 98  ? -8.637  -30.237 0.717   1.00 40.78  ? 395 SER A CB  1 
ATOM   711  O OG  . SER A 1 98  ? -10.017 -29.946 0.850   1.00 42.52  ? 395 SER A OG  1 
ATOM   712  N N   . MET A 1 99  ? -5.491  -29.559 2.089   1.00 43.35  ? 396 MET A N   1 
ATOM   713  C CA  . MET A 1 99  ? -4.074  -29.898 1.977   1.00 45.81  ? 396 MET A CA  1 
ATOM   714  C C   . MET A 1 99  ? -3.662  -31.044 2.891   1.00 50.72  ? 396 MET A C   1 
ATOM   715  O O   . MET A 1 99  ? -2.950  -31.954 2.473   1.00 55.08  ? 396 MET A O   1 
ATOM   716  C CB  . MET A 1 99  ? -3.199  -28.679 2.271   1.00 44.65  ? 396 MET A CB  1 
ATOM   717  C CG  . MET A 1 99  ? -2.972  -27.765 1.086   1.00 38.49  ? 396 MET A CG  1 
ATOM   718  S SD  . MET A 1 99  ? -1.824  -26.435 1.480   1.00 63.08  ? 396 MET A SD  1 
ATOM   719  C CE  . MET A 1 99  ? -0.361  -27.354 1.925   1.00 35.39  ? 396 MET A CE  1 
ATOM   720  N N   . GLU A 1 100 ? -4.113  -31.000 4.139   1.00 51.27  ? 397 GLU A N   1 
ATOM   721  C CA  . GLU A 1 100 ? -3.715  -32.005 5.117   1.00 53.98  ? 397 GLU A CA  1 
ATOM   722  C C   . GLU A 1 100 ? -4.565  -33.271 5.030   1.00 50.85  ? 397 GLU A C   1 
ATOM   723  O O   . GLU A 1 100 ? -4.485  -34.147 5.896   1.00 48.59  ? 397 GLU A O   1 
ATOM   724  C CB  . GLU A 1 100 ? -3.745  -31.426 6.534   1.00 58.54  ? 397 GLU A CB  1 
ATOM   725  C CG  . GLU A 1 100 ? -2.852  -30.204 6.723   1.00 65.11  ? 397 GLU A CG  1 
ATOM   726  C CD  . GLU A 1 100 ? -1.398  -30.463 6.355   1.00 73.61  ? 397 GLU A CD  1 
ATOM   727  O OE1 . GLU A 1 100 ? -0.920  -31.602 6.546   1.00 80.84  ? 397 GLU A OE1 1 
ATOM   728  O OE2 . GLU A 1 100 ? -0.729  -29.524 5.872   1.00 73.21  ? 397 GLU A OE2 1 
ATOM   729  N N   . HIS A 1 101 ? -5.373  -33.362 3.979   1.00 47.41  ? 398 HIS A N   1 
ATOM   730  C CA  . HIS A 1 101 ? -6.171  -34.557 3.730   1.00 50.47  ? 398 HIS A CA  1 
ATOM   731  C C   . HIS A 1 101 ? -5.993  -35.040 2.294   1.00 52.15  ? 398 HIS A C   1 
ATOM   732  O O   . HIS A 1 101 ? -6.871  -34.835 1.452   1.00 51.59  ? 398 HIS A O   1 
ATOM   733  C CB  . HIS A 1 101 ? -7.647  -34.284 4.017   1.00 47.80  ? 398 HIS A CB  1 
ATOM   734  C CG  . HIS A 1 101 ? -7.910  -33.815 5.412   1.00 49.34  ? 398 HIS A CG  1 
ATOM   735  N ND1 . HIS A 1 101 ? -8.226  -34.676 6.441   1.00 54.32  ? 398 HIS A ND1 1 
ATOM   736  C CD2 . HIS A 1 101 ? -7.899  -32.573 5.952   1.00 49.03  ? 398 HIS A CD2 1 
ATOM   737  C CE1 . HIS A 1 101 ? -8.402  -33.986 7.552   1.00 54.12  ? 398 HIS A CE1 1 
ATOM   738  N NE2 . HIS A 1 101 ? -8.210  -32.706 7.283   1.00 52.24  ? 398 HIS A NE2 1 
ATOM   739  N N   . PRO A 1 102 ? -4.849  -35.685 2.011   1.00 51.95  ? 399 PRO A N   1 
ATOM   740  C CA  . PRO A 1 102 ? -4.531  -36.174 0.665   1.00 50.31  ? 399 PRO A CA  1 
ATOM   741  C C   . PRO A 1 102 ? -5.574  -37.170 0.176   1.00 49.67  ? 399 PRO A C   1 
ATOM   742  O O   . PRO A 1 102 ? -5.907  -38.112 0.895   1.00 44.22  ? 399 PRO A O   1 
ATOM   743  C CB  . PRO A 1 102 ? -3.187  -36.884 0.859   1.00 55.80  ? 399 PRO A CB  1 
ATOM   744  C CG  . PRO A 1 102 ? -2.615  -36.301 2.107   1.00 56.51  ? 399 PRO A CG  1 
ATOM   745  C CD  . PRO A 1 102 ? -3.792  -36.018 2.981   1.00 53.92  ? 399 PRO A CD  1 
ATOM   746  N N   . GLY A 1 103 ? -6.084  -36.954 -1.032  1.00 47.52  ? 400 GLY A N   1 
ATOM   747  C CA  . GLY A 1 103 ? -7.082  -37.834 -1.607  1.00 46.95  ? 400 GLY A CA  1 
ATOM   748  C C   . GLY A 1 103 ? -8.492  -37.447 -1.211  1.00 48.26  ? 400 GLY A C   1 
ATOM   749  O O   . GLY A 1 103 ? -9.460  -38.059 -1.660  1.00 53.27  ? 400 GLY A O   1 
ATOM   750  N N   . LYS A 1 104 ? -8.611  -36.427 -0.366  1.00 45.24  ? 401 LYS A N   1 
ATOM   751  C CA  . LYS A 1 104 ? -9.915  -35.996 0.127   1.00 44.11  ? 401 LYS A CA  1 
ATOM   752  C C   . LYS A 1 104 ? -10.120 -34.491 0.009   1.00 44.99  ? 401 LYS A C   1 
ATOM   753  O O   . LYS A 1 104 ? -9.160  -33.726 -0.094  1.00 45.37  ? 401 LYS A O   1 
ATOM   754  C CB  . LYS A 1 104 ? -10.109 -36.432 1.580   1.00 43.18  ? 401 LYS A CB  1 
ATOM   755  C CG  . LYS A 1 104 ? -10.124 -37.937 1.773   1.00 44.94  ? 401 LYS A CG  1 
ATOM   756  C CD  . LYS A 1 104 ? -10.330 -38.295 3.224   1.00 48.44  ? 401 LYS A CD  1 
ATOM   757  C CE  . LYS A 1 104 ? -10.389 -39.799 3.411   1.00 50.19  ? 401 LYS A CE  1 
ATOM   758  N NZ  . LYS A 1 104 ? -10.636 -40.142 4.830   1.00 51.04  ? 401 LYS A NZ  1 
ATOM   759  N N   . LEU A 1 105 ? -11.384 -34.077 0.019   1.00 44.97  ? 402 LEU A N   1 
ATOM   760  C CA  . LEU A 1 105 ? -11.734 -32.663 0.004   1.00 40.18  ? 402 LEU A CA  1 
ATOM   761  C C   . LEU A 1 105 ? -12.501 -32.289 1.271   1.00 39.50  ? 402 LEU A C   1 
ATOM   762  O O   . LEU A 1 105 ? -13.573 -32.828 1.544   1.00 38.68  ? 402 LEU A O   1 
ATOM   763  C CB  . LEU A 1 105 ? -12.549 -32.316 -1.245  1.00 40.31  ? 402 LEU A CB  1 
ATOM   764  C CG  . LEU A 1 105 ? -11.809 -32.398 -2.588  1.00 39.42  ? 402 LEU A CG  1 
ATOM   765  C CD1 . LEU A 1 105 ? -12.751 -32.150 -3.760  1.00 33.37  ? 402 LEU A CD1 1 
ATOM   766  C CD2 . LEU A 1 105 ? -10.646 -31.420 -2.620  1.00 35.21  ? 402 LEU A CD2 1 
ATOM   767  N N   . LEU A 1 106 ? -11.933 -31.368 2.044   1.00 39.28  ? 403 LEU A N   1 
ATOM   768  C CA  . LEU A 1 106 ? -12.547 -30.913 3.285   1.00 36.04  ? 403 LEU A CA  1 
ATOM   769  C C   . LEU A 1 106 ? -13.468 -29.726 3.020   1.00 34.45  ? 403 LEU A C   1 
ATOM   770  O O   . LEU A 1 106 ? -13.064 -28.571 3.168   1.00 28.62  ? 403 LEU A O   1 
ATOM   771  C CB  . LEU A 1 106 ? -11.463 -30.523 4.294   1.00 35.87  ? 403 LEU A CB  1 
ATOM   772  C CG  . LEU A 1 106 ? -11.887 -30.271 5.747   1.00 37.99  ? 403 LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 106 ? -12.330 -31.567 6.405   1.00 42.85  ? 403 LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 106 ? -10.756 -29.632 6.539   1.00 34.16  ? 403 LEU A CD2 1 
ATOM   775  N N   . PHE A 1 107 ? -14.701 -30.010 2.611   1.00 37.68  ? 404 PHE A N   1 
ATOM   776  C CA  . PHE A 1 107 ? -15.685 -28.956 2.387   1.00 39.20  ? 404 PHE A CA  1 
ATOM   777  C C   . PHE A 1 107 ? -16.029 -28.288 3.709   1.00 39.12  ? 404 PHE A C   1 
ATOM   778  O O   . PHE A 1 107 ? -16.233 -27.078 3.774   1.00 40.80  ? 404 PHE A O   1 
ATOM   779  C CB  . PHE A 1 107 ? -16.948 -29.518 1.734   1.00 40.93  ? 404 PHE A CB  1 
ATOM   780  C CG  . PHE A 1 107 ? -16.756 -29.938 0.307   1.00 44.82  ? 404 PHE A CG  1 
ATOM   781  C CD1 . PHE A 1 107 ? -16.971 -29.041 -0.727  1.00 46.33  ? 404 PHE A CD1 1 
ATOM   782  C CD2 . PHE A 1 107 ? -16.357 -31.227 -0.003  1.00 44.53  ? 404 PHE A CD2 1 
ATOM   783  C CE1 . PHE A 1 107 ? -16.796 -29.423 -2.040  1.00 44.83  ? 404 PHE A CE1 1 
ATOM   784  C CE2 . PHE A 1 107 ? -16.177 -31.612 -1.316  1.00 45.74  ? 404 PHE A CE2 1 
ATOM   785  C CZ  . PHE A 1 107 ? -16.397 -30.709 -2.335  1.00 44.83  ? 404 PHE A CZ  1 
ATOM   786  N N   . ALA A 1 108 ? -16.087 -29.099 4.759   1.00 43.24  ? 405 ALA A N   1 
ATOM   787  C CA  . ALA A 1 108 ? -16.304 -28.625 6.122   1.00 42.79  ? 405 ALA A CA  1 
ATOM   788  C C   . ALA A 1 108 ? -15.699 -29.666 7.055   1.00 44.33  ? 405 ALA A C   1 
ATOM   789  O O   . ALA A 1 108 ? -15.479 -30.801 6.638   1.00 47.31  ? 405 ALA A O   1 
ATOM   790  C CB  . ALA A 1 108 ? -17.794 -28.450 6.393   1.00 40.31  ? 405 ALA A CB  1 
ATOM   791  N N   . PRO A 1 109 ? -15.414 -29.289 8.314   1.00 43.49  ? 406 PRO A N   1 
ATOM   792  C CA  . PRO A 1 109 ? -14.837 -30.254 9.259   1.00 43.84  ? 406 PRO A CA  1 
ATOM   793  C C   . PRO A 1 109 ? -15.706 -31.500 9.436   1.00 48.67  ? 406 PRO A C   1 
ATOM   794  O O   . PRO A 1 109 ? -15.192 -32.566 9.784   1.00 51.84  ? 406 PRO A O   1 
ATOM   795  C CB  . PRO A 1 109 ? -14.773 -29.460 10.565  1.00 44.80  ? 406 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 109 ? -14.638 -28.051 10.133  1.00 41.63  ? 406 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 109 ? -15.473 -27.934 8.888   1.00 41.80  ? 406 PRO A CD  1 
ATOM   798  N N   . ASN A 1 110 ? -17.006 -31.366 9.197   1.00 46.47  ? 407 ASN A N   1 
ATOM   799  C CA  . ASN A 1 110 ? -17.910 -32.507 9.255   1.00 47.26  ? 407 ASN A CA  1 
ATOM   800  C C   . ASN A 1 110 ? -18.333 -32.966 7.864   1.00 50.32  ? 407 ASN A C   1 
ATOM   801  O O   . ASN A 1 110 ? -19.305 -33.703 7.717   1.00 55.47  ? 407 ASN A O   1 
ATOM   802  C CB  . ASN A 1 110 ? -19.143 -32.188 10.106  1.00 44.60  ? 407 ASN A CB  1 
ATOM   803  C CG  . ASN A 1 110 ? -19.871 -30.941 9.636   1.00 45.95  ? 407 ASN A CG  1 
ATOM   804  O OD1 . ASN A 1 110 ? -19.506 -30.334 8.629   1.00 43.69  ? 407 ASN A OD1 1 
ATOM   805  N ND2 . ASN A 1 110 ? -20.911 -30.555 10.364  1.00 48.04  ? 407 ASN A ND2 1 
ATOM   806  N N   . LEU A 1 111 ? -17.603 -32.520 6.847   1.00 57.35  ? 408 LEU A N   1 
ATOM   807  C CA  . LEU A 1 111 ? -17.885 -32.919 5.472   1.00 54.09  ? 408 LEU A CA  1 
ATOM   808  C C   . LEU A 1 111 ? -16.589 -33.155 4.700   1.00 47.64  ? 408 LEU A C   1 
ATOM   809  O O   . LEU A 1 111 ? -16.123 -32.289 3.966   1.00 39.62  ? 408 LEU A O   1 
ATOM   810  C CB  . LEU A 1 111 ? -18.748 -31.868 4.766   1.00 52.78  ? 408 LEU A CB  1 
ATOM   811  C CG  . LEU A 1 111 ? -19.309 -32.250 3.394   1.00 50.86  ? 408 LEU A CG  1 
ATOM   812  C CD1 . LEU A 1 111 ? -20.104 -33.543 3.487   1.00 54.90  ? 408 LEU A CD1 1 
ATOM   813  C CD2 . LEU A 1 111 ? -20.175 -31.128 2.832   1.00 44.83  ? 408 LEU A CD2 1 
ATOM   814  N N   . LEU A 1 112 ? -16.014 -34.338 4.887   1.00 49.27  ? 409 LEU A N   1 
ATOM   815  C CA  . LEU A 1 112 ? -14.775 -34.721 4.224   1.00 50.34  ? 409 LEU A CA  1 
ATOM   816  C C   . LEU A 1 112 ? -15.075 -35.806 3.196   1.00 53.71  ? 409 LEU A C   1 
ATOM   817  O O   . LEU A 1 112 ? -15.556 -36.882 3.545   1.00 57.43  ? 409 LEU A O   1 
ATOM   818  C CB  . LEU A 1 112 ? -13.767 -35.227 5.258   1.00 52.50  ? 409 LEU A CB  1 
ATOM   819  C CG  . LEU A 1 112 ? -12.358 -35.578 4.780   1.00 52.23  ? 409 LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 112 ? -11.698 -34.375 4.124   1.00 48.23  ? 409 LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 112 ? -11.522 -36.081 5.946   1.00 54.27  ? 409 LEU A CD2 1 
ATOM   822  N N   . LEU A 1 113 ? -14.794 -35.523 1.928   1.00 55.07  ? 410 LEU A N   1 
ATOM   823  C CA  . LEU A 1 113 ? -15.186 -36.425 0.848   1.00 58.90  ? 410 LEU A CA  1 
ATOM   824  C C   . LEU A 1 113 ? -14.010 -36.857 -0.028  1.00 58.39  ? 410 LEU A C   1 
ATOM   825  O O   . LEU A 1 113 ? -13.144 -36.044 -0.360  1.00 52.71  ? 410 LEU A O   1 
ATOM   826  C CB  . LEU A 1 113 ? -16.254 -35.760 -0.028  1.00 56.81  ? 410 LEU A CB  1 
ATOM   827  C CG  . LEU A 1 113 ? -17.479 -35.170 0.677   1.00 53.99  ? 410 LEU A CG  1 
ATOM   828  C CD1 . LEU A 1 113 ? -18.391 -34.466 -0.319  1.00 51.58  ? 410 LEU A CD1 1 
ATOM   829  C CD2 . LEU A 1 113 ? -18.239 -36.246 1.433   1.00 56.10  ? 410 LEU A CD2 1 
ATOM   830  N N   . ASP A 1 114 ? -13.987 -38.136 -0.405  1.00 62.63  ? 411 ASP A N   1 
ATOM   831  C CA  . ASP A 1 114 ? -13.027 -38.615 -1.399  1.00 66.51  ? 411 ASP A CA  1 
ATOM   832  C C   . ASP A 1 114 ? -13.627 -38.559 -2.803  1.00 65.17  ? 411 ASP A C   1 
ATOM   833  O O   . ASP A 1 114 ? -14.799 -38.213 -2.967  1.00 62.54  ? 411 ASP A O   1 
ATOM   834  C CB  . ASP A 1 114 ? -12.514 -40.025 -1.069  1.00 75.19  ? 411 ASP A CB  1 
ATOM   835  C CG  . ASP A 1 114 ? -13.621 -41.072 -1.024  1.00 83.38  ? 411 ASP A CG  1 
ATOM   836  O OD1 . ASP A 1 114 ? -14.754 -40.794 -1.469  1.00 84.76  ? 411 ASP A OD1 1 
ATOM   837  O OD2 . ASP A 1 114 ? -13.348 -42.194 -0.547  1.00 87.67  ? 411 ASP A OD2 1 
ATOM   838  N N   . ARG A 1 115 ? -12.831 -38.910 -3.810  1.00 65.79  ? 412 ARG A N   1 
ATOM   839  C CA  . ARG A 1 115 ? -13.279 -38.792 -5.193  1.00 65.53  ? 412 ARG A CA  1 
ATOM   840  C C   . ARG A 1 115 ? -14.381 -39.787 -5.523  1.00 65.93  ? 412 ARG A C   1 
ATOM   841  O O   . ARG A 1 115 ? -15.160 -39.582 -6.453  1.00 67.65  ? 412 ARG A O   1 
ATOM   842  C CB  . ARG A 1 115 ? -12.113 -38.946 -6.169  1.00 70.03  ? 412 ARG A CB  1 
ATOM   843  C CG  . ARG A 1 115 ? -11.457 -40.309 -6.158  1.00 75.90  ? 412 ARG A CG  1 
ATOM   844  C CD  . ARG A 1 115 ? -10.745 -40.555 -7.472  1.00 79.31  ? 412 ARG A CD  1 
ATOM   845  N NE  . ARG A 1 115 ? -11.677 -40.518 -8.595  1.00 82.68  ? 412 ARG A NE  1 
ATOM   846  C CZ  . ARG A 1 115 ? -11.342 -40.776 -9.854  1.00 86.53  ? 412 ARG A CZ  1 
ATOM   847  N NH1 . ARG A 1 115 ? -10.091 -41.092 -10.155 1.00 89.74  ? 412 ARG A NH1 1 
ATOM   848  N NH2 . ARG A 1 115 ? -12.255 -40.720 -10.812 1.00 87.21  ? 412 ARG A NH2 1 
ATOM   849  N N   . ASN A 1 116 ? -14.444 -40.863 -4.750  1.00 65.28  ? 413 ASN A N   1 
ATOM   850  C CA  . ASN A 1 116 ? -15.461 -41.879 -4.957  1.00 70.63  ? 413 ASN A CA  1 
ATOM   851  C C   . ASN A 1 116 ? -16.853 -41.338 -4.666  1.00 68.32  ? 413 ASN A C   1 
ATOM   852  O O   . ASN A 1 116 ? -17.830 -41.726 -5.305  1.00 68.82  ? 413 ASN A O   1 
ATOM   853  C CB  . ASN A 1 116 ? -15.180 -43.101 -4.089  1.00 77.36  ? 413 ASN A CB  1 
ATOM   854  C CG  . ASN A 1 116 ? -15.932 -44.321 -4.558  1.00 87.08  ? 413 ASN A CG  1 
ATOM   855  O OD1 . ASN A 1 116 ? -16.434 -44.356 -5.682  1.00 90.89  ? 413 ASN A OD1 1 
ATOM   856  N ND2 . ASN A 1 116 ? -16.013 -45.335 -3.704  1.00 91.13  ? 413 ASN A ND2 1 
ATOM   857  N N   . GLN A 1 117 ? -16.931 -40.434 -3.696  1.00 68.12  ? 414 GLN A N   1 
ATOM   858  C CA  . GLN A 1 117 ? -18.191 -39.799 -3.336  1.00 69.73  ? 414 GLN A CA  1 
ATOM   859  C C   . GLN A 1 117 ? -18.530 -38.675 -4.311  1.00 68.39  ? 414 GLN A C   1 
ATOM   860  O O   . GLN A 1 117 ? -19.666 -38.206 -4.364  1.00 71.31  ? 414 GLN A O   1 
ATOM   861  C CB  . GLN A 1 117 ? -18.132 -39.270 -1.902  1.00 69.85  ? 414 GLN A CB  1 
ATOM   862  C CG  . GLN A 1 117 ? -17.897 -40.357 -0.865  1.00 74.13  ? 414 GLN A CG  1 
ATOM   863  C CD  . GLN A 1 117 ? -17.818 -39.811 0.546   1.00 74.53  ? 414 GLN A CD  1 
ATOM   864  O OE1 . GLN A 1 117 ? -16.753 -39.396 1.005   1.00 73.42  ? 414 GLN A OE1 1 
ATOM   865  N NE2 . GLN A 1 117 ? -18.948 -39.814 1.246   1.00 75.48  ? 414 GLN A NE2 1 
ATOM   866  N N   . GLY A 1 118 ? -17.539 -38.248 -5.086  1.00 64.95  ? 415 GLY A N   1 
ATOM   867  C CA  . GLY A 1 118 ? -17.762 -37.263 -6.127  1.00 63.93  ? 415 GLY A CA  1 
ATOM   868  C C   . GLY A 1 118 ? -18.606 -37.824 -7.257  1.00 66.40  ? 415 GLY A C   1 
ATOM   869  O O   . GLY A 1 118 ? -19.183 -37.078 -8.047  1.00 65.44  ? 415 GLY A O   1 
ATOM   870  N N   . LYS A 1 119 ? -18.682 -39.149 -7.332  1.00 71.48  ? 416 LYS A N   1 
ATOM   871  C CA  . LYS A 1 119 ? -19.467 -39.816 -8.363  1.00 76.18  ? 416 LYS A CA  1 
ATOM   872  C C   . LYS A 1 119 ? -20.962 -39.787 -8.054  1.00 78.30  ? 416 LYS A C   1 
ATOM   873  O O   . LYS A 1 119 ? -21.783 -40.084 -8.920  1.00 80.19  ? 416 LYS A O   1 
ATOM   874  C CB  . LYS A 1 119 ? -19.002 -41.263 -8.538  1.00 79.82  ? 416 LYS A CB  1 
ATOM   875  C CG  . LYS A 1 119 ? -17.567 -41.409 -9.018  1.00 80.53  ? 416 LYS A CG  1 
ATOM   876  C CD  . LYS A 1 119 ? -17.124 -42.864 -8.974  1.00 85.12  ? 416 LYS A CD  1 
ATOM   877  C CE  . LYS A 1 119 ? -15.672 -43.015 -9.396  1.00 84.95  ? 416 LYS A CE  1 
ATOM   878  N NZ  . LYS A 1 119 ? -15.188 -44.411 -9.205  1.00 89.27  ? 416 LYS A NZ  1 
ATOM   879  N N   . CYS A 1 120 ? -21.306 -39.426 -6.820  1.00 78.29  ? 417 CYS A N   1 
ATOM   880  C CA  . CYS A 1 120 ? -22.702 -39.378 -6.386  1.00 79.97  ? 417 CYS A CA  1 
ATOM   881  C C   . CYS A 1 120 ? -23.523 -38.356 -7.171  1.00 81.53  ? 417 CYS A C   1 
ATOM   882  O O   . CYS A 1 120 ? -24.749 -38.455 -7.239  1.00 86.72  ? 417 CYS A O   1 
ATOM   883  C CB  . CYS A 1 120 ? -22.802 -39.115 -4.880  1.00 75.37  ? 417 CYS A CB  1 
ATOM   884  S SG  . CYS A 1 120 ? -22.990 -40.611 -3.878  1.00 104.84 ? 417 CYS A SG  1 
ATOM   885  N N   . VAL A 1 121 ? -22.843 -37.377 -7.757  1.00 78.20  ? 418 VAL A N   1 
ATOM   886  C CA  . VAL A 1 121 ? -23.482 -36.440 -8.678  1.00 79.00  ? 418 VAL A CA  1 
ATOM   887  C C   . VAL A 1 121 ? -22.813 -36.493 -10.057 1.00 79.06  ? 418 VAL A C   1 
ATOM   888  O O   . VAL A 1 121 ? -21.584 -36.445 -10.165 1.00 75.15  ? 418 VAL A O   1 
ATOM   889  C CB  . VAL A 1 121 ? -23.521 -34.996 -8.106  1.00 58.79  ? 418 VAL A CB  1 
ATOM   890  C CG1 . VAL A 1 121 ? -22.459 -34.800 -7.050  1.00 55.40  ? 418 VAL A CG1 1 
ATOM   891  C CG2 . VAL A 1 121 ? -23.365 -33.964 -9.205  1.00 56.94  ? 418 VAL A CG2 1 
ATOM   892  N N   . GLU A 1 122 ? -23.638 -36.611 -11.097 1.00 83.37  ? 419 GLU A N   1 
ATOM   893  C CA  . GLU A 1 122 ? -23.178 -36.863 -12.469 1.00 85.66  ? 419 GLU A CA  1 
ATOM   894  C C   . GLU A 1 122 ? -22.052 -35.954 -12.978 1.00 79.41  ? 419 GLU A C   1 
ATOM   895  O O   . GLU A 1 122 ? -22.271 -34.773 -13.279 1.00 76.27  ? 419 GLU A O   1 
ATOM   896  C CB  . GLU A 1 122 ? -24.359 -36.788 -13.446 1.00 92.13  ? 419 GLU A CB  1 
ATOM   897  C CG  . GLU A 1 122 ? -23.997 -37.053 -14.904 1.00 99.13  ? 419 GLU A CG  1 
ATOM   898  C CD  . GLU A 1 122 ? -23.826 -38.532 -15.208 1.00 107.09 ? 419 GLU A CD  1 
ATOM   899  O OE1 . GLU A 1 122 ? -23.968 -39.351 -14.276 1.00 110.67 ? 419 GLU A OE1 1 
ATOM   900  O OE2 . GLU A 1 122 ? -23.557 -38.879 -16.380 1.00 109.63 ? 419 GLU A OE2 1 
ATOM   901  N N   . GLY A 1 123 ? -20.850 -36.519 -13.077 1.00 77.88  ? 420 GLY A N   1 
ATOM   902  C CA  . GLY A 1 123 ? -19.736 -35.846 -13.721 1.00 74.94  ? 420 GLY A CA  1 
ATOM   903  C C   . GLY A 1 123 ? -18.848 -35.039 -12.795 1.00 73.58  ? 420 GLY A C   1 
ATOM   904  O O   . GLY A 1 123 ? -17.814 -34.523 -13.219 1.00 73.12  ? 420 GLY A O   1 
ATOM   905  N N   . MET A 1 124 ? -19.243 -34.923 -11.531 1.00 69.41  ? 421 MET A N   1 
ATOM   906  C CA  . MET A 1 124 ? -18.514 -34.074 -10.595 1.00 62.90  ? 421 MET A CA  1 
ATOM   907  C C   . MET A 1 124 ? -17.116 -34.607 -10.294 1.00 62.10  ? 421 MET A C   1 
ATOM   908  O O   . MET A 1 124 ? -16.245 -33.867 -9.836  1.00 59.77  ? 421 MET A O   1 
ATOM   909  C CB  . MET A 1 124 ? -19.298 -33.881 -9.296  1.00 60.33  ? 421 MET A CB  1 
ATOM   910  C CG  . MET A 1 124 ? -18.746 -32.759 -8.429  1.00 55.63  ? 421 MET A CG  1 
ATOM   911  S SD  . MET A 1 124 ? -19.826 -32.306 -7.071  1.00 55.57  ? 421 MET A SD  1 
ATOM   912  C CE  . MET A 1 124 ? -19.382 -33.544 -5.852  1.00 50.49  ? 421 MET A CE  1 
ATOM   913  N N   . VAL A 1 125 ? -16.902 -35.888 -10.571 1.00 64.79  ? 422 VAL A N   1 
ATOM   914  C CA  . VAL A 1 125 ? -15.612 -36.515 -10.316 1.00 64.38  ? 422 VAL A CA  1 
ATOM   915  C C   . VAL A 1 125 ? -14.488 -35.851 -11.123 1.00 62.61  ? 422 VAL A C   1 
ATOM   916  O O   . VAL A 1 125 ? -13.320 -35.904 -10.735 1.00 60.85  ? 422 VAL A O   1 
ATOM   917  C CB  . VAL A 1 125 ? -15.662 -38.040 -10.586 1.00 64.46  ? 422 VAL A CB  1 
ATOM   918  C CG1 . VAL A 1 125 ? -15.475 -38.337 -12.064 1.00 64.14  ? 422 VAL A CG1 1 
ATOM   919  C CG2 . VAL A 1 125 ? -14.619 -38.761 -9.757  1.00 65.52  ? 422 VAL A CG2 1 
ATOM   920  N N   . GLU A 1 126 ? -14.852 -35.206 -12.230 1.00 61.33  ? 423 GLU A N   1 
ATOM   921  C CA  . GLU A 1 126 ? -13.880 -34.527 -13.082 1.00 59.65  ? 423 GLU A CA  1 
ATOM   922  C C   . GLU A 1 126 ? -13.293 -33.308 -12.383 1.00 55.40  ? 423 GLU A C   1 
ATOM   923  O O   . GLU A 1 126 ? -12.076 -33.181 -12.249 1.00 52.38  ? 423 GLU A O   1 
ATOM   924  C CB  . GLU A 1 126 ? -14.523 -34.105 -14.403 1.00 59.61  ? 423 GLU A CB  1 
ATOM   925  N N   . ILE A 1 127 ? -14.164 -32.413 -11.935 1.00 55.93  ? 424 ILE A N   1 
ATOM   926  C CA  . ILE A 1 127 ? -13.722 -31.216 -11.235 1.00 56.23  ? 424 ILE A CA  1 
ATOM   927  C C   . ILE A 1 127 ? -13.175 -31.602 -9.866  1.00 53.23  ? 424 ILE A C   1 
ATOM   928  O O   . ILE A 1 127 ? -12.395 -30.870 -9.268  1.00 51.96  ? 424 ILE A O   1 
ATOM   929  C CB  . ILE A 1 127 ? -14.867 -30.190 -11.096 1.00 59.33  ? 424 ILE A CB  1 
ATOM   930  C CG1 . ILE A 1 127 ? -14.318 -28.774 -10.922 1.00 59.15  ? 424 ILE A CG1 1 
ATOM   931  C CG2 . ILE A 1 127 ? -15.792 -30.562 -9.950  1.00 61.92  ? 424 ILE A CG2 1 
ATOM   932  C CD1 . ILE A 1 127 ? -15.391 -27.714 -10.949 1.00 59.92  ? 424 ILE A CD1 1 
ATOM   933  N N   . PHE A 1 128 ? -13.578 -32.772 -9.386  1.00 51.31  ? 425 PHE A N   1 
ATOM   934  C CA  . PHE A 1 128 ? -13.089 -33.296 -8.121  1.00 49.73  ? 425 PHE A CA  1 
ATOM   935  C C   . PHE A 1 128 ? -11.607 -33.630 -8.243  1.00 45.33  ? 425 PHE A C   1 
ATOM   936  O O   . PHE A 1 128 ? -10.801 -33.213 -7.416  1.00 45.64  ? 425 PHE A O   1 
ATOM   937  C CB  . PHE A 1 128 ? -13.856 -34.563 -7.783  1.00 58.19  ? 425 PHE A CB  1 
ATOM   938  C CG  . PHE A 1 128 ? -14.216 -34.697 -6.339  1.00 62.62  ? 425 PHE A CG  1 
ATOM   939  C CD1 . PHE A 1 128 ? -15.424 -34.207 -5.871  1.00 66.17  ? 425 PHE A CD1 1 
ATOM   940  C CD2 . PHE A 1 128 ? -13.369 -35.342 -5.451  1.00 66.13  ? 425 PHE A CD2 1 
ATOM   941  C CE1 . PHE A 1 128 ? -15.777 -34.343 -4.541  1.00 67.18  ? 425 PHE A CE1 1 
ATOM   942  C CE2 . PHE A 1 128 ? -13.718 -35.482 -4.119  1.00 68.65  ? 425 PHE A CE2 1 
ATOM   943  C CZ  . PHE A 1 128 ? -14.922 -34.982 -3.664  1.00 68.76  ? 425 PHE A CZ  1 
ATOM   944  N N   . ASP A 1 129 ? -11.259 -34.395 -9.275  1.00 45.61  ? 426 ASP A N   1 
ATOM   945  C CA  . ASP A 1 129 ? -9.870  -34.768 -9.526  1.00 45.51  ? 426 ASP A CA  1 
ATOM   946  C C   . ASP A 1 129 ? -8.980  -33.553 -9.756  1.00 45.01  ? 426 ASP A C   1 
ATOM   947  O O   . ASP A 1 129 ? -7.806  -33.555 -9.394  1.00 46.59  ? 426 ASP A O   1 
ATOM   948  C CB  . ASP A 1 129 ? -9.778  -35.719 -10.717 1.00 47.57  ? 426 ASP A CB  1 
ATOM   949  C CG  . ASP A 1 129 ? -10.341 -37.087 -10.405 1.00 56.20  ? 426 ASP A CG  1 
ATOM   950  O OD1 . ASP A 1 129 ? -10.319 -37.477 -9.216  1.00 58.93  ? 426 ASP A OD1 1 
ATOM   951  O OD2 . ASP A 1 129 ? -10.799 -37.778 -11.340 1.00 62.61  ? 426 ASP A OD2 1 
ATOM   952  N N   . MET A 1 130 ? -9.541  -32.517 -10.367 1.00 36.32  ? 427 MET A N   1 
ATOM   953  C CA  . MET A 1 130 ? -8.808  -31.277 -10.587 1.00 42.54  ? 427 MET A CA  1 
ATOM   954  C C   . MET A 1 130 ? -8.480  -30.598 -9.260  1.00 39.73  ? 427 MET A C   1 
ATOM   955  O O   . MET A 1 130 ? -7.357  -30.143 -9.045  1.00 39.20  ? 427 MET A O   1 
ATOM   956  C CB  . MET A 1 130 ? -9.605  -30.330 -11.489 1.00 40.44  ? 427 MET A CB  1 
ATOM   957  C CG  . MET A 1 130 ? -9.693  -30.782 -12.939 1.00 37.15  ? 427 MET A CG  1 
ATOM   958  S SD  . MET A 1 130 ? -10.315 -29.480 -14.018 1.00 62.61  ? 427 MET A SD  1 
ATOM   959  C CE  . MET A 1 130 ? -12.073 -29.791 -14.014 1.00 54.65  ? 427 MET A CE  1 
ATOM   960  N N   . LEU A 1 131 ? -9.463  -30.544 -8.367  1.00 38.58  ? 428 LEU A N   1 
ATOM   961  C CA  . LEU A 1 131 ? -9.266  -29.931 -7.059  1.00 35.07  ? 428 LEU A CA  1 
ATOM   962  C C   . LEU A 1 131 ? -8.255  -30.713 -6.238  1.00 34.41  ? 428 LEU A C   1 
ATOM   963  O O   . LEU A 1 131 ? -7.367  -30.128 -5.620  1.00 34.26  ? 428 LEU A O   1 
ATOM   964  C CB  . LEU A 1 131 ? -10.588 -29.838 -6.310  1.00 36.59  ? 428 LEU A CB  1 
ATOM   965  C CG  . LEU A 1 131 ? -11.618 -28.921 -6.961  1.00 38.38  ? 428 LEU A CG  1 
ATOM   966  C CD1 . LEU A 1 131 ? -12.993 -29.341 -6.508  1.00 42.33  ? 428 LEU A CD1 1 
ATOM   967  C CD2 . LEU A 1 131 ? -11.349 -27.463 -6.611  1.00 38.59  ? 428 LEU A CD2 1 
ATOM   968  N N   . LEU A 1 132 ? -8.394  -32.035 -6.241  1.00 36.66  ? 429 LEU A N   1 
ATOM   969  C CA  . LEU A 1 132 ? -7.455  -32.908 -5.548  1.00 40.90  ? 429 LEU A CA  1 
ATOM   970  C C   . LEU A 1 132 ? -6.032  -32.688 -6.048  1.00 41.68  ? 429 LEU A C   1 
ATOM   971  O O   . LEU A 1 132 ? -5.087  -32.661 -5.259  1.00 41.92  ? 429 LEU A O   1 
ATOM   972  C CB  . LEU A 1 132 ? -7.858  -34.374 -5.719  1.00 45.34  ? 429 LEU A CB  1 
ATOM   973  C CG  . LEU A 1 132 ? -9.124  -34.791 -4.968  1.00 47.26  ? 429 LEU A CG  1 
ATOM   974  C CD1 . LEU A 1 132 ? -9.555  -36.185 -5.373  1.00 49.75  ? 429 LEU A CD1 1 
ATOM   975  C CD2 . LEU A 1 132 ? -8.895  -34.713 -3.464  1.00 48.15  ? 429 LEU A CD2 1 
ATOM   976  N N   . ALA A 1 133 ? -5.890  -32.515 -7.359  1.00 41.75  ? 430 ALA A N   1 
ATOM   977  C CA  . ALA A 1 133 ? -4.587  -32.257 -7.963  1.00 43.40  ? 430 ALA A CA  1 
ATOM   978  C C   . ALA A 1 133 ? -4.004  -30.930 -7.479  1.00 41.31  ? 430 ALA A C   1 
ATOM   979  O O   . ALA A 1 133 ? -2.825  -30.852 -7.130  1.00 43.08  ? 430 ALA A O   1 
ATOM   980  C CB  . ALA A 1 133 ? -4.687  -32.278 -9.484  1.00 39.43  ? 430 ALA A CB  1 
ATOM   981  N N   . THR A 1 134 ? -4.833  -29.891 -7.452  1.00 36.25  ? 431 THR A N   1 
ATOM   982  C CA  . THR A 1 134 ? -4.391  -28.584 -6.971  1.00 37.01  ? 431 THR A CA  1 
ATOM   983  C C   . THR A 1 134 ? -3.971  -28.660 -5.504  1.00 37.36  ? 431 THR A C   1 
ATOM   984  O O   . THR A 1 134 ? -2.973  -28.062 -5.098  1.00 37.91  ? 431 THR A O   1 
ATOM   985  C CB  . THR A 1 134 ? -5.487  -27.516 -7.129  1.00 34.38  ? 431 THR A CB  1 
ATOM   986  O OG1 . THR A 1 134 ? -6.005  -27.553 -8.464  1.00 35.11  ? 431 THR A OG1 1 
ATOM   987  C CG2 . THR A 1 134 ? -4.927  -26.130 -6.847  1.00 33.06  ? 431 THR A CG2 1 
ATOM   988  N N   . SER A 1 135 ? -4.735  -29.406 -4.714  1.00 37.43  ? 432 SER A N   1 
ATOM   989  C CA  . SER A 1 135 ? -4.420  -29.590 -3.304  1.00 41.50  ? 432 SER A CA  1 
ATOM   990  C C   . SER A 1 135 ? -3.072  -30.289 -3.138  1.00 43.03  ? 432 SER A C   1 
ATOM   991  O O   . SER A 1 135 ? -2.215  -29.822 -2.386  1.00 45.44  ? 432 SER A O   1 
ATOM   992  C CB  . SER A 1 135 ? -5.527  -30.381 -2.603  1.00 45.57  ? 432 SER A CB  1 
ATOM   993  O OG  . SER A 1 135 ? -5.301  -30.444 -1.207  1.00 48.15  ? 432 SER A OG  1 
ATOM   994  N N   . SER A 1 136 ? -2.892  -31.400 -3.849  1.00 41.77  ? 433 SER A N   1 
ATOM   995  C CA  . SER A 1 136 ? -1.623  -32.125 -3.854  1.00 46.03  ? 433 SER A CA  1 
ATOM   996  C C   . SER A 1 136 ? -0.477  -31.213 -4.278  1.00 47.42  ? 433 SER A C   1 
ATOM   997  O O   . SER A 1 136 ? 0.625   -31.288 -3.735  1.00 51.52  ? 433 SER A O   1 
ATOM   998  C CB  . SER A 1 136 ? -1.691  -33.321 -4.809  1.00 51.32  ? 433 SER A CB  1 
ATOM   999  O OG  . SER A 1 136 ? -2.781  -34.170 -4.502  1.00 55.40  ? 433 SER A OG  1 
ATOM   1000 N N   . ARG A 1 137 ? -0.747  -30.357 -5.259  1.00 40.95  ? 434 ARG A N   1 
ATOM   1001 C CA  . ARG A 1 137 ? 0.237   -29.395 -5.732  1.00 40.38  ? 434 ARG A CA  1 
ATOM   1002 C C   . ARG A 1 137 ? 0.656   -28.437 -4.616  1.00 39.31  ? 434 ARG A C   1 
ATOM   1003 O O   . ARG A 1 137 ? 1.848   -28.203 -4.408  1.00 38.89  ? 434 ARG A O   1 
ATOM   1004 C CB  . ARG A 1 137 ? -0.316  -28.620 -6.927  1.00 40.74  ? 434 ARG A CB  1 
ATOM   1005 C CG  . ARG A 1 137 ? 0.655   -27.626 -7.534  1.00 44.82  ? 434 ARG A CG  1 
ATOM   1006 C CD  . ARG A 1 137 ? 1.851   -28.311 -8.170  1.00 50.84  ? 434 ARG A CD  1 
ATOM   1007 N NE  . ARG A 1 137 ? 2.704   -27.342 -8.852  1.00 55.02  ? 434 ARG A NE  1 
ATOM   1008 C CZ  . ARG A 1 137 ? 4.012   -27.215 -8.649  1.00 59.95  ? 434 ARG A CZ  1 
ATOM   1009 N NH1 . ARG A 1 137 ? 4.632   -28.008 -7.785  1.00 62.87  ? 434 ARG A NH1 1 
ATOM   1010 N NH2 . ARG A 1 137 ? 4.700   -26.298 -9.316  1.00 60.12  ? 434 ARG A NH2 1 
ATOM   1011 N N   . PHE A 1 138 ? -0.325  -27.893 -3.898  1.00 37.03  ? 435 PHE A N   1 
ATOM   1012 C CA  . PHE A 1 138 ? -0.050  -27.012 -2.762  1.00 38.31  ? 435 PHE A CA  1 
ATOM   1013 C C   . PHE A 1 138 ? 0.732   -27.731 -1.670  1.00 40.72  ? 435 PHE A C   1 
ATOM   1014 O O   . PHE A 1 138 ? 1.660   -27.170 -1.086  1.00 40.61  ? 435 PHE A O   1 
ATOM   1015 C CB  . PHE A 1 138 ? -1.350  -26.457 -2.169  1.00 38.50  ? 435 PHE A CB  1 
ATOM   1016 C CG  . PHE A 1 138 ? -1.917  -25.289 -2.927  1.00 41.63  ? 435 PHE A CG  1 
ATOM   1017 C CD1 . PHE A 1 138 ? -1.192  -24.681 -3.937  1.00 43.72  ? 435 PHE A CD1 1 
ATOM   1018 C CD2 . PHE A 1 138 ? -3.169  -24.792 -2.616  1.00 43.72  ? 435 PHE A CD2 1 
ATOM   1019 C CE1 . PHE A 1 138 ? -1.713  -23.604 -4.630  1.00 41.55  ? 435 PHE A CE1 1 
ATOM   1020 C CE2 . PHE A 1 138 ? -3.694  -23.718 -3.307  1.00 42.27  ? 435 PHE A CE2 1 
ATOM   1021 C CZ  . PHE A 1 138 ? -2.966  -23.125 -4.317  1.00 38.29  ? 435 PHE A CZ  1 
ATOM   1022 N N   . ARG A 1 139 ? 0.347   -28.973 -1.400  1.00 42.74  ? 436 ARG A N   1 
ATOM   1023 C CA  . ARG A 1 139 ? 0.984   -29.770 -0.358  1.00 47.20  ? 436 ARG A CA  1 
ATOM   1024 C C   . ARG A 1 139 ? 2.449   -30.049 -0.679  1.00 48.33  ? 436 ARG A C   1 
ATOM   1025 O O   . ARG A 1 139 ? 3.317   -29.913 0.182   1.00 52.25  ? 436 ARG A O   1 
ATOM   1026 C CB  . ARG A 1 139 ? 0.212   -31.074 -0.132  1.00 52.63  ? 436 ARG A CB  1 
ATOM   1027 C CG  . ARG A 1 139 ? 0.781   -31.965 0.962   1.00 61.50  ? 436 ARG A CG  1 
ATOM   1028 C CD  . ARG A 1 139 ? -0.172  -33.102 1.330   1.00 69.28  ? 436 ARG A CD  1 
ATOM   1029 N NE  . ARG A 1 139 ? -0.568  -33.909 0.177   1.00 74.78  ? 436 ARG A NE  1 
ATOM   1030 C CZ  . ARG A 1 139 ? -1.733  -33.794 -0.455  1.00 73.53  ? 436 ARG A CZ  1 
ATOM   1031 N NH1 . ARG A 1 139 ? -2.627  -32.902 -0.047  1.00 69.92  ? 436 ARG A NH1 1 
ATOM   1032 N NH2 . ARG A 1 139 ? -2.006  -34.571 -1.495  1.00 74.17  ? 436 ARG A NH2 1 
ATOM   1033 N N   . MET A 1 140 ? 2.724   -30.425 -1.921  1.00 47.78  ? 437 MET A N   1 
ATOM   1034 C CA  . MET A 1 140 ? 4.096   -30.670 -2.345  1.00 50.98  ? 437 MET A CA  1 
ATOM   1035 C C   . MET A 1 140 ? 4.906   -29.375 -2.391  1.00 51.95  ? 437 MET A C   1 
ATOM   1036 O O   . MET A 1 140 ? 6.133   -29.401 -2.328  1.00 55.86  ? 437 MET A O   1 
ATOM   1037 C CB  . MET A 1 140 ? 4.127   -31.379 -3.700  1.00 54.37  ? 437 MET A CB  1 
ATOM   1038 C CG  . MET A 1 140 ? 3.525   -32.777 -3.673  1.00 56.61  ? 437 MET A CG  1 
ATOM   1039 S SD  . MET A 1 140 ? 4.293   -33.833 -2.427  1.00 74.77  ? 437 MET A SD  1 
ATOM   1040 C CE  . MET A 1 140 ? 5.992   -33.836 -2.989  1.00 59.54  ? 437 MET A CE  1 
ATOM   1041 N N   . MET A 1 141 ? 4.217   -28.244 -2.492  1.00 49.28  ? 438 MET A N   1 
ATOM   1042 C CA  . MET A 1 141 ? 4.886   -26.949 -2.516  1.00 49.72  ? 438 MET A CA  1 
ATOM   1043 C C   . MET A 1 141 ? 5.076   -26.391 -1.118  1.00 50.72  ? 438 MET A C   1 
ATOM   1044 O O   . MET A 1 141 ? 5.840   -25.440 -0.928  1.00 47.55  ? 438 MET A O   1 
ATOM   1045 C CB  . MET A 1 141 ? 4.109   -25.943 -3.371  1.00 47.01  ? 438 MET A CB  1 
ATOM   1046 C CG  . MET A 1 141 ? 4.240   -26.160 -4.867  1.00 49.97  ? 438 MET A CG  1 
ATOM   1047 S SD  . MET A 1 141 ? 3.588   -24.773 -5.816  1.00 60.78  ? 438 MET A SD  1 
ATOM   1048 C CE  . MET A 1 141 ? 4.740   -23.483 -5.356  1.00 50.72  ? 438 MET A CE  1 
ATOM   1049 N N   . ASN A 1 142 ? 4.385   -26.987 -0.150  1.00 55.12  ? 439 ASN A N   1 
ATOM   1050 C CA  . ASN A 1 142 ? 4.375   -26.461 1.205   1.00 60.50  ? 439 ASN A CA  1 
ATOM   1051 C C   . ASN A 1 142 ? 3.864   -25.028 1.160   1.00 56.38  ? 439 ASN A C   1 
ATOM   1052 O O   . ASN A 1 142 ? 4.573   -24.086 1.519   1.00 58.34  ? 439 ASN A O   1 
ATOM   1053 C CB  . ASN A 1 142 ? 5.772   -26.529 1.829   1.00 70.99  ? 439 ASN A CB  1 
ATOM   1054 C CG  . ASN A 1 142 ? 5.784   -26.094 3.282   1.00 80.82  ? 439 ASN A CG  1 
ATOM   1055 O OD1 . ASN A 1 142 ? 4.734   -25.870 3.881   1.00 84.50  ? 439 ASN A OD1 1 
ATOM   1056 N ND2 . ASN A 1 142 ? 6.970   -25.988 3.860   1.00 85.61  ? 439 ASN A ND2 1 
ATOM   1057 N N   . LEU A 1 143 ? 2.635   -24.872 0.673   1.00 51.07  ? 440 LEU A N   1 
ATOM   1058 C CA  . LEU A 1 143 ? 1.990   -23.566 0.614   1.00 44.20  ? 440 LEU A CA  1 
ATOM   1059 C C   . LEU A 1 143 ? 1.712   -23.099 2.024   1.00 44.33  ? 440 LEU A C   1 
ATOM   1060 O O   . LEU A 1 143 ? 0.993   -23.762 2.773   1.00 44.26  ? 440 LEU A O   1 
ATOM   1061 C CB  . LEU A 1 143 ? 0.670   -23.623 -0.164  1.00 39.62  ? 440 LEU A CB  1 
ATOM   1062 C CG  . LEU A 1 143 ? -0.049  -22.265 -0.272  1.00 40.21  ? 440 LEU A CG  1 
ATOM   1063 C CD1 . LEU A 1 143 ? 0.717   -21.321 -1.189  1.00 40.38  ? 440 LEU A CD1 1 
ATOM   1064 C CD2 . LEU A 1 143 ? -1.512  -22.363 -0.713  1.00 37.45  ? 440 LEU A CD2 1 
ATOM   1065 N N   . GLN A 1 144 ? 2.284   -21.955 2.380   1.00 44.56  ? 441 GLN A N   1 
ATOM   1066 C CA  . GLN A 1 144 ? 2.082   -21.378 3.699   1.00 43.18  ? 441 GLN A CA  1 
ATOM   1067 C C   . GLN A 1 144 ? 0.808   -20.553 3.712   1.00 41.76  ? 441 GLN A C   1 
ATOM   1068 O O   . GLN A 1 144 ? 0.404   -20.005 2.684   1.00 38.35  ? 441 GLN A O   1 
ATOM   1069 C CB  . GLN A 1 144 ? 3.264   -20.488 4.082   1.00 47.87  ? 441 GLN A CB  1 
ATOM   1070 C CG  . GLN A 1 144 ? 4.597   -21.211 4.200   1.00 53.74  ? 441 GLN A CG  1 
ATOM   1071 C CD  . GLN A 1 144 ? 4.619   -22.228 5.324   1.00 58.15  ? 441 GLN A CD  1 
ATOM   1072 O OE1 . GLN A 1 144 ? 4.269   -21.922 6.465   1.00 62.69  ? 441 GLN A OE1 1 
ATOM   1073 N NE2 . GLN A 1 144 ? 5.030   -23.448 5.005   1.00 59.51  ? 441 GLN A NE2 1 
ATOM   1074 N N   . GLY A 1 145 ? 0.184   -20.464 4.883   1.00 44.28  ? 442 GLY A N   1 
ATOM   1075 C CA  . GLY A 1 145 ? -1.016  -19.667 5.063   1.00 41.61  ? 442 GLY A CA  1 
ATOM   1076 C C   . GLY A 1 145 ? -0.817  -18.211 4.688   1.00 41.80  ? 442 GLY A C   1 
ATOM   1077 O O   . GLY A 1 145 ? -1.720  -17.580 4.141   1.00 40.78  ? 442 GLY A O   1 
ATOM   1078 N N   . GLU A 1 146 ? 0.367   -17.680 4.982   1.00 43.88  ? 443 GLU A N   1 
ATOM   1079 C CA  . GLU A 1 146 ? 0.711   -16.313 4.604   1.00 44.98  ? 443 GLU A CA  1 
ATOM   1080 C C   . GLU A 1 146 ? 0.699   -16.142 3.086   1.00 41.62  ? 443 GLU A C   1 
ATOM   1081 O O   . GLU A 1 146 ? 0.362   -15.074 2.577   1.00 41.76  ? 443 GLU A O   1 
ATOM   1082 C CB  . GLU A 1 146 ? 2.078   -15.918 5.171   1.00 51.21  ? 443 GLU A CB  1 
ATOM   1083 C CG  . GLU A 1 146 ? 2.149   -15.859 6.698   1.00 56.27  ? 443 GLU A CG  1 
ATOM   1084 C CD  . GLU A 1 146 ? 2.393   -17.216 7.335   1.00 62.73  ? 443 GLU A CD  1 
ATOM   1085 O OE1 . GLU A 1 146 ? 2.451   -18.223 6.598   1.00 60.94  ? 443 GLU A OE1 1 
ATOM   1086 O OE2 . GLU A 1 146 ? 2.531   -17.276 8.577   1.00 70.13  ? 443 GLU A OE2 1 
ATOM   1087 N N   . GLU A 1 147 ? 1.068   -17.199 2.367   1.00 40.22  ? 444 GLU A N   1 
ATOM   1088 C CA  . GLU A 1 147 ? 1.056   -17.179 0.905   1.00 37.22  ? 444 GLU A CA  1 
ATOM   1089 C C   . GLU A 1 147 ? -0.361  -17.361 0.364   1.00 32.50  ? 444 GLU A C   1 
ATOM   1090 O O   . GLU A 1 147 ? -0.777  -16.660 -0.557  1.00 31.38  ? 444 GLU A O   1 
ATOM   1091 C CB  . GLU A 1 147 ? 1.973   -18.267 0.343   1.00 35.65  ? 444 GLU A CB  1 
ATOM   1092 C CG  . GLU A 1 147 ? 3.434   -18.102 0.713   1.00 40.39  ? 444 GLU A CG  1 
ATOM   1093 C CD  . GLU A 1 147 ? 4.285   -19.265 0.242   1.00 46.56  ? 444 GLU A CD  1 
ATOM   1094 O OE1 . GLU A 1 147 ? 3.833   -20.423 0.368   1.00 46.48  ? 444 GLU A OE1 1 
ATOM   1095 O OE2 . GLU A 1 147 ? 5.402   -19.021 -0.261  1.00 50.58  ? 444 GLU A OE2 1 
ATOM   1096 N N   . PHE A 1 148 ? -1.089  -18.310 0.944   1.00 30.82  ? 445 PHE A N   1 
ATOM   1097 C CA  . PHE A 1 148 ? -2.482  -18.561 0.587   1.00 31.94  ? 445 PHE A CA  1 
ATOM   1098 C C   . PHE A 1 148 ? -3.351  -17.300 0.602   1.00 34.05  ? 445 PHE A C   1 
ATOM   1099 O O   . PHE A 1 148 ? -4.082  -17.037 -0.356  1.00 31.13  ? 445 PHE A O   1 
ATOM   1100 C CB  . PHE A 1 148 ? -3.084  -19.619 1.515   1.00 33.85  ? 445 PHE A CB  1 
ATOM   1101 C CG  . PHE A 1 148 ? -4.584  -19.651 1.503   1.00 33.14  ? 445 PHE A CG  1 
ATOM   1102 C CD1 . PHE A 1 148 ? -5.273  -20.158 0.413   1.00 29.06  ? 445 PHE A CD1 1 
ATOM   1103 C CD2 . PHE A 1 148 ? -5.307  -19.180 2.587   1.00 36.64  ? 445 PHE A CD2 1 
ATOM   1104 C CE1 . PHE A 1 148 ? -6.656  -20.186 0.399   1.00 26.27  ? 445 PHE A CE1 1 
ATOM   1105 C CE2 . PHE A 1 148 ? -6.689  -19.209 2.579   1.00 36.42  ? 445 PHE A CE2 1 
ATOM   1106 C CZ  . PHE A 1 148 ? -7.363  -19.712 1.483   1.00 31.75  ? 445 PHE A CZ  1 
ATOM   1107 N N   . VAL A 1 149 ? -3.274  -16.527 1.684   1.00 36.51  ? 446 VAL A N   1 
ATOM   1108 C CA  . VAL A 1 149 ? -4.082  -15.313 1.803   1.00 34.86  ? 446 VAL A CA  1 
ATOM   1109 C C   . VAL A 1 149 ? -3.738  -14.292 0.721   1.00 34.57  ? 446 VAL A C   1 
ATOM   1110 O O   . VAL A 1 149 ? -4.611  -13.571 0.240   1.00 34.93  ? 446 VAL A O   1 
ATOM   1111 C CB  . VAL A 1 149 ? -3.992  -14.659 3.211   1.00 35.04  ? 446 VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 149 ? -4.709  -15.515 4.246   1.00 26.62  ? 446 VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 149 ? -2.548  -14.416 3.612   1.00 34.68  ? 446 VAL A CG2 1 
ATOM   1114 N N   . CYS A 1 150 ? -2.469  -14.241 0.331   1.00 35.46  ? 447 CYS A N   1 
ATOM   1115 C CA  . CYS A 1 150 ? -2.054  -13.367 -0.760  1.00 34.33  ? 447 CYS A CA  1 
ATOM   1116 C C   . CYS A 1 150 ? -2.659  -13.832 -2.081  1.00 34.28  ? 447 CYS A C   1 
ATOM   1117 O O   . CYS A 1 150 ? -3.172  -13.023 -2.854  1.00 32.91  ? 447 CYS A O   1 
ATOM   1118 C CB  . CYS A 1 150 ? -0.529  -13.313 -0.867  1.00 34.60  ? 447 CYS A CB  1 
ATOM   1119 S SG  . CYS A 1 150 ? 0.297   -12.438 0.484   1.00 44.64  ? 447 CYS A SG  1 
ATOM   1120 N N   . LEU A 1 151 ? -2.603  -15.138 -2.329  1.00 34.13  ? 448 LEU A N   1 
ATOM   1121 C CA  . LEU A 1 151 ? -3.145  -15.710 -3.559  1.00 33.23  ? 448 LEU A CA  1 
ATOM   1122 C C   . LEU A 1 151 ? -4.640  -15.453 -3.691  1.00 29.23  ? 448 LEU A C   1 
ATOM   1123 O O   . LEU A 1 151 ? -5.127  -15.118 -4.769  1.00 30.32  ? 448 LEU A O   1 
ATOM   1124 C CB  . LEU A 1 151 ? -2.879  -17.215 -3.621  1.00 35.31  ? 448 LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 151 ? -1.438  -17.650 -3.883  1.00 36.51  ? 448 LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 151 ? -1.351  -19.167 -3.962  1.00 35.61  ? 448 LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 151 ? -0.915  -17.007 -5.162  1.00 35.15  ? 448 LEU A CD2 1 
ATOM   1128 N N   . LYS A 1 152 ? -5.361  -15.610 -2.588  1.00 30.56  ? 449 LYS A N   1 
ATOM   1129 C CA  . LYS A 1 152 ? -6.809  -15.446 -2.593  1.00 29.96  ? 449 LYS A CA  1 
ATOM   1130 C C   . LYS A 1 152 ? -7.211  -13.990 -2.836  1.00 32.10  ? 449 LYS A C   1 
ATOM   1131 O O   . LYS A 1 152 ? -8.196  -13.715 -3.523  1.00 34.05  ? 449 LYS A O   1 
ATOM   1132 C CB  . LYS A 1 152 ? -7.408  -15.972 -1.288  1.00 23.71  ? 449 LYS A CB  1 
ATOM   1133 C CG  . LYS A 1 152 ? -8.919  -15.996 -1.271  1.00 21.64  ? 449 LYS A CG  1 
ATOM   1134 C CD  . LYS A 1 152 ? -9.446  -16.837 -0.113  1.00 23.52  ? 449 LYS A CD  1 
ATOM   1135 C CE  . LYS A 1 152 ? -8.990  -16.289 1.232   1.00 25.34  ? 449 LYS A CE  1 
ATOM   1136 N NZ  . LYS A 1 152 ? -9.765  -16.895 2.356   1.00 26.79  ? 449 LYS A NZ  1 
ATOM   1137 N N   . SER A 1 153 ? -6.438  -13.063 -2.280  1.00 29.78  ? 450 SER A N   1 
ATOM   1138 C CA  . SER A 1 153 ? -6.654  -11.642 -2.527  1.00 29.47  ? 450 SER A CA  1 
ATOM   1139 C C   . SER A 1 153 ? -6.361  -11.295 -3.987  1.00 27.92  ? 450 SER A C   1 
ATOM   1140 O O   . SER A 1 153 ? -7.059  -10.485 -4.600  1.00 23.64  ? 450 SER A O   1 
ATOM   1141 C CB  . SER A 1 153 ? -5.773  -10.801 -1.605  1.00 34.92  ? 450 SER A CB  1 
ATOM   1142 O OG  . SER A 1 153 ? -6.145  -10.981 -0.252  1.00 45.14  ? 450 SER A OG  1 
ATOM   1143 N N   . ILE A 1 154 ? -5.321  -11.910 -4.538  1.00 27.61  ? 451 ILE A N   1 
ATOM   1144 C CA  . ILE A 1 154 ? -4.967  -11.695 -5.934  1.00 30.07  ? 451 ILE A CA  1 
ATOM   1145 C C   . ILE A 1 154 ? -6.118  -12.091 -6.858  1.00 32.36  ? 451 ILE A C   1 
ATOM   1146 O O   . ILE A 1 154 ? -6.479  -11.341 -7.766  1.00 31.90  ? 451 ILE A O   1 
ATOM   1147 C CB  . ILE A 1 154 ? -3.688  -12.459 -6.314  1.00 26.52  ? 451 ILE A CB  1 
ATOM   1148 C CG1 . ILE A 1 154 ? -2.469  -11.788 -5.673  1.00 26.26  ? 451 ILE A CG1 1 
ATOM   1149 C CG2 . ILE A 1 154 ? -3.526  -12.513 -7.815  1.00 24.95  ? 451 ILE A CG2 1 
ATOM   1150 C CD1 . ILE A 1 154 ? -1.170  -12.551 -5.859  1.00 26.94  ? 451 ILE A CD1 1 
ATOM   1151 N N   . ILE A 1 155 ? -6.704  -13.259 -6.603  1.00 31.98  ? 452 ILE A N   1 
ATOM   1152 C CA  . ILE A 1 155 ? -7.834  -13.744 -7.390  1.00 30.27  ? 452 ILE A CA  1 
ATOM   1153 C C   . ILE A 1 155 ? -8.980  -12.742 -7.380  1.00 32.05  ? 452 ILE A C   1 
ATOM   1154 O O   . ILE A 1 155 ? -9.573  -12.453 -8.415  1.00 31.19  ? 452 ILE A O   1 
ATOM   1155 C CB  . ILE A 1 155 ? -8.357  -15.088 -6.853  1.00 30.93  ? 452 ILE A CB  1 
ATOM   1156 C CG1 . ILE A 1 155 ? -7.300  -16.184 -7.017  1.00 32.90  ? 452 ILE A CG1 1 
ATOM   1157 C CG2 . ILE A 1 155 ? -9.637  -15.480 -7.565  1.00 29.25  ? 452 ILE A CG2 1 
ATOM   1158 C CD1 . ILE A 1 155 ? -7.704  -17.514 -6.413  1.00 34.83  ? 452 ILE A CD1 1 
ATOM   1159 N N   . LEU A 1 156 ? -9.280  -12.217 -6.196  1.00 32.85  ? 453 LEU A N   1 
ATOM   1160 C CA  . LEU A 1 156 ? -10.348 -11.242 -6.024  1.00 31.07  ? 453 LEU A CA  1 
ATOM   1161 C C   . LEU A 1 156 ? -10.141 -10.022 -6.921  1.00 30.36  ? 453 LEU A C   1 
ATOM   1162 O O   . LEU A 1 156 ? -11.033 -9.639  -7.676  1.00 29.90  ? 453 LEU A O   1 
ATOM   1163 C CB  . LEU A 1 156 ? -10.422 -10.811 -4.557  1.00 32.12  ? 453 LEU A CB  1 
ATOM   1164 C CG  . LEU A 1 156 ? -11.411 -9.713  -4.164  1.00 28.86  ? 453 LEU A CG  1 
ATOM   1165 C CD1 . LEU A 1 156 ? -12.845 -10.173 -4.355  1.00 27.52  ? 453 LEU A CD1 1 
ATOM   1166 C CD2 . LEU A 1 156 ? -11.170 -9.292  -2.727  1.00 33.15  ? 453 LEU A CD2 1 
ATOM   1167 N N   . LEU A 1 157 ? -8.954  -9.429  -6.842  1.00 28.85  ? 454 LEU A N   1 
ATOM   1168 C CA  . LEU A 1 157 ? -8.652  -8.206  -7.577  1.00 35.13  ? 454 LEU A CA  1 
ATOM   1169 C C   . LEU A 1 157 ? -8.364  -8.435  -9.060  1.00 35.19  ? 454 LEU A C   1 
ATOM   1170 O O   . LEU A 1 157 ? -8.647  -7.570  -9.888  1.00 35.67  ? 454 LEU A O   1 
ATOM   1171 C CB  . LEU A 1 157 ? -7.473  -7.478  -6.929  1.00 38.91  ? 454 LEU A CB  1 
ATOM   1172 C CG  . LEU A 1 157 ? -7.698  -7.016  -5.490  1.00 40.54  ? 454 LEU A CG  1 
ATOM   1173 C CD1 . LEU A 1 157 ? -6.404  -6.505  -4.890  1.00 41.34  ? 454 LEU A CD1 1 
ATOM   1174 C CD2 . LEU A 1 157 ? -8.776  -5.945  -5.440  1.00 42.36  ? 454 LEU A CD2 1 
ATOM   1175 N N   . ASN A 1 158 ? -7.802  -9.592  -9.398  1.00 34.49  ? 455 ASN A N   1 
ATOM   1176 C CA  . ASN A 1 158 ? -7.388  -9.837  -10.773 1.00 32.54  ? 455 ASN A CA  1 
ATOM   1177 C C   . ASN A 1 158 ? -8.475  -10.379 -11.691 1.00 33.65  ? 455 ASN A C   1 
ATOM   1178 O O   . ASN A 1 158 ? -8.560  -9.966  -12.843 1.00 37.67  ? 455 ASN A O   1 
ATOM   1179 C CB  . ASN A 1 158 ? -6.156  -10.746 -10.841 1.00 34.19  ? 455 ASN A CB  1 
ATOM   1180 C CG  . ASN A 1 158 ? -5.709  -11.012 -12.279 1.00 37.61  ? 455 ASN A CG  1 
ATOM   1181 O OD1 . ASN A 1 158 ? -5.230  -10.113 -12.965 1.00 36.52  ? 455 ASN A OD1 1 
ATOM   1182 N ND2 . ASN A 1 158 ? -5.872  -12.248 -12.735 1.00 37.24  ? 455 ASN A ND2 1 
ATOM   1183 N N   . SER A 1 159 ? -9.302  -11.288 -11.186 1.00 54.63  ? 456 SER A N   1 
ATOM   1184 C CA  . SER A 1 159 ? -10.208 -12.056 -12.044 1.00 53.18  ? 456 SER A CA  1 
ATOM   1185 C C   . SER A 1 159 ? -11.155 -11.236 -12.924 1.00 55.30  ? 456 SER A C   1 
ATOM   1186 O O   . SER A 1 159 ? -11.452 -11.633 -14.051 1.00 53.56  ? 456 SER A O   1 
ATOM   1187 C CB  . SER A 1 159 ? -10.984 -13.098 -11.234 1.00 47.04  ? 456 SER A CB  1 
ATOM   1188 O OG  . SER A 1 159 ? -10.135 -14.170 -10.860 1.00 51.64  ? 456 SER A OG  1 
ATOM   1189 N N   . GLY A 1 160 ? -11.615 -10.096 -12.422 1.00 51.98  ? 457 GLY A N   1 
ATOM   1190 C CA  . GLY A 1 160 ? -12.535 -9.266  -13.178 1.00 54.47  ? 457 GLY A CA  1 
ATOM   1191 C C   . GLY A 1 160 ? -11.988 -7.899  -13.547 1.00 85.52  ? 457 GLY A C   1 
ATOM   1192 O O   . GLY A 1 160 ? -12.746 -7.005  -13.920 1.00 59.84  ? 457 GLY A O   1 
ATOM   1193 N N   . VAL A 1 161 ? -10.672 -7.737  -13.457 1.00 57.57  ? 458 VAL A N   1 
ATOM   1194 C CA  . VAL A 1 161 ? -10.044 -6.438  -13.682 1.00 72.70  ? 458 VAL A CA  1 
ATOM   1195 C C   . VAL A 1 161 ? -10.062 -6.002  -15.158 1.00 75.64  ? 458 VAL A C   1 
ATOM   1196 O O   . VAL A 1 161 ? -9.945  -4.813  -15.464 1.00 67.22  ? 458 VAL A O   1 
ATOM   1197 C CB  . VAL A 1 161 ? -8.597  -6.410  -13.127 1.00 59.49  ? 458 VAL A CB  1 
ATOM   1198 C CG1 . VAL A 1 161 ? -7.637  -7.127  -14.073 1.00 60.53  ? 458 VAL A CG1 1 
ATOM   1199 C CG2 . VAL A 1 161 ? -8.145  -4.976  -12.877 1.00 61.69  ? 458 VAL A CG2 1 
ATOM   1200 N N   . TYR A 1 162 ? -10.222 -6.960  -16.066 1.00 74.06  ? 459 TYR A N   1 
ATOM   1201 C CA  . TYR A 1 162 ? -10.227 -6.658  -17.495 1.00 78.67  ? 459 TYR A CA  1 
ATOM   1202 C C   . TYR A 1 162 ? -11.626 -6.712  -18.096 1.00 80.76  ? 459 TYR A C   1 
ATOM   1203 O O   . TYR A 1 162 ? -11.788 -6.690  -19.317 1.00 81.42  ? 459 TYR A O   1 
ATOM   1204 C CB  . TYR A 1 162 ? -9.292  -7.608  -18.248 1.00 80.48  ? 459 TYR A CB  1 
ATOM   1205 C CG  . TYR A 1 162 ? -7.849  -7.481  -17.826 1.00 83.57  ? 459 TYR A CG  1 
ATOM   1206 C CD1 . TYR A 1 162 ? -7.029  -8.596  -17.740 1.00 83.55  ? 459 TYR A CD1 1 
ATOM   1207 C CD2 . TYR A 1 162 ? -7.305  -6.242  -17.511 1.00 87.83  ? 459 TYR A CD2 1 
ATOM   1208 C CE1 . TYR A 1 162 ? -5.709  -8.484  -17.348 1.00 86.18  ? 459 TYR A CE1 1 
ATOM   1209 C CE2 . TYR A 1 162 ? -5.986  -6.119  -17.119 1.00 89.20  ? 459 TYR A CE2 1 
ATOM   1210 C CZ  . TYR A 1 162 ? -5.192  -7.244  -17.039 1.00 88.64  ? 459 TYR A CZ  1 
ATOM   1211 O OH  . TYR A 1 162 ? -3.877  -7.130  -16.650 1.00 89.50  ? 459 TYR A OH  1 
ATOM   1212 N N   . THR A 1 163 ? -12.636 -6.774  -17.236 1.00 81.05  ? 460 THR A N   1 
ATOM   1213 C CA  . THR A 1 163 ? -14.016 -6.829  -17.701 1.00 85.78  ? 460 THR A CA  1 
ATOM   1214 C C   . THR A 1 163 ? -14.794 -5.554  -17.379 1.00 92.47  ? 460 THR A C   1 
ATOM   1215 O O   . THR A 1 163 ? -16.026 -5.546  -17.393 1.00 94.46  ? 460 THR A O   1 
ATOM   1216 C CB  . THR A 1 163 ? -14.754 -8.069  -17.161 1.00 79.22  ? 460 THR A CB  1 
ATOM   1217 O OG1 . THR A 1 163 ? -14.245 -8.403  -15.865 1.00 72.31  ? 460 THR A OG1 1 
ATOM   1218 C CG2 . THR A 1 163 ? -14.548 -9.252  -18.090 1.00 79.96  ? 460 THR A CG2 1 
ATOM   1219 N N   . PHE A 1 164 ? -14.066 -4.480  -17.088 1.00 95.83  ? 461 PHE A N   1 
ATOM   1220 C CA  . PHE A 1 164 ? -14.666 -3.151  -16.997 1.00 100.83 ? 461 PHE A CA  1 
ATOM   1221 C C   . PHE A 1 164 ? -13.725 -2.069  -17.528 1.00 105.20 ? 461 PHE A C   1 
ATOM   1222 O O   . PHE A 1 164 ? -12.514 -2.276  -17.625 1.00 104.39 ? 461 PHE A O   1 
ATOM   1223 C CB  . PHE A 1 164 ? -15.139 -2.828  -15.570 1.00 98.58  ? 461 PHE A CB  1 
ATOM   1224 C CG  . PHE A 1 164 ? -14.046 -2.847  -14.531 1.00 94.84  ? 461 PHE A CG  1 
ATOM   1225 C CD1 . PHE A 1 164 ? -13.192 -1.766  -14.378 1.00 96.48  ? 461 PHE A CD1 1 
ATOM   1226 C CD2 . PHE A 1 164 ? -13.898 -3.934  -13.684 1.00 89.46  ? 461 PHE A CD2 1 
ATOM   1227 C CE1 . PHE A 1 164 ? -12.197 -1.780  -13.418 1.00 93.44  ? 461 PHE A CE1 1 
ATOM   1228 C CE2 . PHE A 1 164 ? -12.907 -3.951  -12.721 1.00 86.22  ? 461 PHE A CE2 1 
ATOM   1229 C CZ  . PHE A 1 164 ? -12.056 -2.874  -12.588 1.00 88.24  ? 461 PHE A CZ  1 
ATOM   1230 N N   . LYS A 1 175 ? -8.883  0.901   -12.173 1.00 93.49  ? 472 LYS A N   1 
ATOM   1231 C CA  . LYS A 1 175 ? -8.111  -0.145  -12.841 1.00 92.65  ? 472 LYS A CA  1 
ATOM   1232 C C   . LYS A 1 175 ? -6.630  -0.021  -12.515 1.00 92.32  ? 472 LYS A C   1 
ATOM   1233 O O   . LYS A 1 175 ? -5.979  -1.015  -12.182 1.00 86.72  ? 472 LYS A O   1 
ATOM   1234 C CB  . LYS A 1 175 ? -8.311  -0.066  -14.357 1.00 96.61  ? 472 LYS A CB  1 
ATOM   1235 C CG  . LYS A 1 175 ? -7.450  -1.042  -15.146 1.00 96.17  ? 472 LYS A CG  1 
ATOM   1236 C CD  . LYS A 1 175 ? -7.442  -0.666  -16.621 1.00 102.10 ? 472 LYS A CD  1 
ATOM   1237 C CE  . LYS A 1 175 ? -6.919  -1.799  -17.498 1.00 103.94 ? 472 LYS A CE  1 
ATOM   1238 N NZ  . LYS A 1 175 ? -5.470  -2.077  -17.312 1.00 104.27 ? 472 LYS A NZ  1 
ATOM   1239 N N   A ASP A 1 176 ? -6.110  1.197   -12.612 0.51 66.22  ? 473 ASP A N   1 
ATOM   1240 N N   B ASP A 1 176 ? -6.099  1.191   -12.622 0.49 66.19  ? 473 ASP A N   1 
ATOM   1241 C CA  A ASP A 1 176 ? -4.711  1.461   -12.304 0.51 66.25  ? 473 ASP A CA  1 
ATOM   1242 C CA  B ASP A 1 176 ? -4.697  1.430   -12.302 0.49 66.21  ? 473 ASP A CA  1 
ATOM   1243 C C   A ASP A 1 176 ? -4.461  1.204   -10.822 0.51 65.01  ? 473 ASP A C   1 
ATOM   1244 C C   B ASP A 1 176 ? -4.449  1.214   -10.813 0.49 65.03  ? 473 ASP A C   1 
ATOM   1245 O O   A ASP A 1 176 ? -3.425  0.661   -10.438 0.51 63.20  ? 473 ASP A O   1 
ATOM   1246 O O   B ASP A 1 176 ? -3.399  0.712   -10.414 0.49 63.41  ? 473 ASP A O   1 
ATOM   1247 C CB  A ASP A 1 176 ? -4.357  2.907   -12.660 0.51 70.16  ? 473 ASP A CB  1 
ATOM   1248 C CB  B ASP A 1 176 ? -4.274  2.839   -12.721 0.49 70.20  ? 473 ASP A CB  1 
ATOM   1249 C CG  A ASP A 1 176 ? -2.871  3.108   -12.900 0.51 71.13  ? 473 ASP A CG  1 
ATOM   1250 C CG  B ASP A 1 176 ? -4.133  2.982   -14.228 0.49 71.43  ? 473 ASP A CG  1 
ATOM   1251 O OD1 A ASP A 1 176 ? -2.060  2.373   -12.300 0.51 68.92  ? 473 ASP A OD1 1 
ATOM   1252 O OD1 B ASP A 1 176 ? -3.904  1.956   -14.906 0.49 70.08  ? 473 ASP A OD1 1 
ATOM   1253 O OD2 A ASP A 1 176 ? -2.515  4.008   -13.690 0.51 74.94  ? 473 ASP A OD2 1 
ATOM   1254 O OD2 B ASP A 1 176 ? -4.243  4.118   -14.733 0.49 73.71  ? 473 ASP A OD2 1 
ATOM   1255 N N   . HIS A 1 177 ? -5.430  1.592   -9.999  1.00 65.25  ? 474 HIS A N   1 
ATOM   1256 C CA  . HIS A 1 177 ? -5.356  1.399   -8.557  1.00 59.87  ? 474 HIS A CA  1 
ATOM   1257 C C   . HIS A 1 177 ? -5.293  -0.083  -8.206  1.00 52.80  ? 474 HIS A C   1 
ATOM   1258 O O   . HIS A 1 177 ? -4.525  -0.492  -7.337  1.00 50.09  ? 474 HIS A O   1 
ATOM   1259 C CB  . HIS A 1 177 ? -6.571  2.035   -7.880  1.00 62.61  ? 474 HIS A CB  1 
ATOM   1260 C CG  . HIS A 1 177 ? -6.867  1.474   -6.527  1.00 63.10  ? 474 HIS A CG  1 
ATOM   1261 N ND1 . HIS A 1 177 ? -6.150  1.822   -5.400  1.00 64.07  ? 474 HIS A ND1 1 
ATOM   1262 C CD2 . HIS A 1 177 ? -7.795  0.577   -6.116  1.00 61.48  ? 474 HIS A CD2 1 
ATOM   1263 C CE1 . HIS A 1 177 ? -6.626  1.169   -4.358  1.00 62.39  ? 474 HIS A CE1 1 
ATOM   1264 N NE2 . HIS A 1 177 ? -7.628  0.407   -4.764  1.00 59.78  ? 474 HIS A NE2 1 
ATOM   1265 N N   . ILE A 1 178 ? -6.108  -0.879  -8.891  1.00 49.53  ? 475 ILE A N   1 
ATOM   1266 C CA  . ILE A 1 178 ? -6.142  -2.322  -8.686  1.00 46.71  ? 475 ILE A CA  1 
ATOM   1267 C C   . ILE A 1 178 ? -4.791  -2.956  -9.021  1.00 48.71  ? 475 ILE A C   1 
ATOM   1268 O O   . ILE A 1 178 ? -4.284  -3.788  -8.264  1.00 49.83  ? 475 ILE A O   1 
ATOM   1269 C CB  . ILE A 1 178 ? -7.259  -2.973  -9.528  1.00 46.13  ? 475 ILE A CB  1 
ATOM   1270 C CG1 . ILE A 1 178 ? -8.627  -2.440  -9.092  1.00 50.21  ? 475 ILE A CG1 1 
ATOM   1271 C CG2 . ILE A 1 178 ? -7.212  -4.490  -9.420  1.00 40.25  ? 475 ILE A CG2 1 
ATOM   1272 C CD1 . ILE A 1 178 ? -9.798  -3.048  -9.839  1.00 49.92  ? 475 ILE A CD1 1 
ATOM   1273 N N   . HIS A 1 179 ? -4.207  -2.549  -10.146 1.00 50.02  ? 476 HIS A N   1 
ATOM   1274 C CA  . HIS A 1 179 ? -2.899  -3.047  -10.565 1.00 48.97  ? 476 HIS A CA  1 
ATOM   1275 C C   . HIS A 1 179 ? -1.793  -2.650  -9.593  1.00 47.13  ? 476 HIS A C   1 
ATOM   1276 O O   . HIS A 1 179 ? -0.846  -3.412  -9.380  1.00 43.34  ? 476 HIS A O   1 
ATOM   1277 C CB  . HIS A 1 179 ? -2.561  -2.571  -11.981 1.00 53.71  ? 476 HIS A CB  1 
ATOM   1278 C CG  . HIS A 1 179 ? -3.316  -3.293  -13.053 1.00 57.11  ? 476 HIS A CG  1 
ATOM   1279 N ND1 . HIS A 1 179 ? -4.176  -2.653  -13.919 1.00 60.86  ? 476 HIS A ND1 1 
ATOM   1280 C CD2 . HIS A 1 179 ? -3.348  -4.604  -13.391 1.00 56.18  ? 476 HIS A CD2 1 
ATOM   1281 C CE1 . HIS A 1 179 ? -4.700  -3.537  -14.748 1.00 60.77  ? 476 HIS A CE1 1 
ATOM   1282 N NE2 . HIS A 1 179 ? -4.214  -4.728  -14.449 1.00 58.77  ? 476 HIS A NE2 1 
ATOM   1283 N N   . ARG A 1 180 ? -1.910  -1.461  -9.005  1.00 48.73  ? 477 ARG A N   1 
ATOM   1284 C CA  . ARG A 1 180 ? -0.955  -1.036  -7.987  1.00 52.46  ? 477 ARG A CA  1 
ATOM   1285 C C   . ARG A 1 180 ? -1.084  -1.841  -6.696  1.00 48.30  ? 477 ARG A C   1 
ATOM   1286 O O   . ARG A 1 180 ? -0.091  -2.050  -5.996  1.00 50.40  ? 477 ARG A O   1 
ATOM   1287 C CB  . ARG A 1 180 ? -1.070  0.466   -7.704  1.00 60.91  ? 477 ARG A CB  1 
ATOM   1288 C CG  . ARG A 1 180 ? -0.410  1.346   -8.749  1.00 67.33  ? 477 ARG A CG  1 
ATOM   1289 C CD  . ARG A 1 180 ? -0.263  2.769   -8.242  1.00 77.13  ? 477 ARG A CD  1 
ATOM   1290 N NE  . ARG A 1 180 ? -1.562  3.373   -7.971  1.00 84.84  ? 477 ARG A NE  1 
ATOM   1291 C CZ  . ARG A 1 180 ? -2.305  3.978   -8.890  1.00 90.41  ? 477 ARG A CZ  1 
ATOM   1292 N NH1 . ARG A 1 180 ? -1.872  4.060   -10.140 1.00 92.26  ? 477 ARG A NH1 1 
ATOM   1293 N NH2 . ARG A 1 180 ? -3.478  4.500   -8.561  1.00 92.37  ? 477 ARG A NH2 1 
ATOM   1294 N N   . VAL A 1 181 ? -2.298  -2.285  -6.376  1.00 44.99  ? 478 VAL A N   1 
ATOM   1295 C CA  . VAL A 1 181 ? -2.488  -3.131  -5.197  1.00 47.95  ? 478 VAL A CA  1 
ATOM   1296 C C   . VAL A 1 181 ? -1.970  -4.536  -5.496  1.00 42.92  ? 478 VAL A C   1 
ATOM   1297 O O   . VAL A 1 181 ? -1.392  -5.198  -4.632  1.00 43.18  ? 478 VAL A O   1 
ATOM   1298 C CB  . VAL A 1 181 ? -3.967  -3.201  -4.742  1.00 50.20  ? 478 VAL A CB  1 
ATOM   1299 C CG1 . VAL A 1 181 ? -4.120  -4.091  -3.525  1.00 52.00  ? 478 VAL A CG1 1 
ATOM   1300 C CG2 . VAL A 1 181 ? -4.488  -1.804  -4.436  1.00 50.79  ? 478 VAL A CG2 1 
ATOM   1301 N N   . LEU A 1 182 ? -2.172  -4.977  -6.733  1.00 40.36  ? 479 LEU A N   1 
ATOM   1302 C CA  . LEU A 1 182 ? -1.666  -6.269  -7.187  1.00 36.19  ? 479 LEU A CA  1 
ATOM   1303 C C   . LEU A 1 182 ? -0.138  -6.306  -7.144  1.00 37.84  ? 479 LEU A C   1 
ATOM   1304 O O   . LEU A 1 182 ? 0.449   -7.312  -6.750  1.00 39.41  ? 479 LEU A O   1 
ATOM   1305 C CB  . LEU A 1 182 ? -2.190  -6.589  -8.593  1.00 30.77  ? 479 LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 182 ? -3.637  -7.093  -8.655  1.00 31.21  ? 479 LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 182 ? -4.114  -7.240  -10.089 1.00 26.31  ? 479 LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 182 ? -3.782  -8.423  -7.906  1.00 27.82  ? 479 LEU A CD2 1 
ATOM   1309 N N   . ASP A 1 183 ? 0.499   -5.206  -7.540  1.00 37.62  ? 480 ASP A N   1 
ATOM   1310 C CA  . ASP A 1 183 ? 1.948   -5.074  -7.409  1.00 39.06  ? 480 ASP A CA  1 
ATOM   1311 C C   . ASP A 1 183 ? 2.348   -5.161  -5.939  1.00 45.01  ? 480 ASP A C   1 
ATOM   1312 O O   . ASP A 1 183 ? 3.323   -5.825  -5.584  1.00 47.03  ? 480 ASP A O   1 
ATOM   1313 C CB  . ASP A 1 183 ? 2.433   -3.743  -7.991  1.00 35.93  ? 480 ASP A CB  1 
ATOM   1314 C CG  . ASP A 1 183 ? 2.448   -3.732  -9.511  1.00 40.62  ? 480 ASP A CG  1 
ATOM   1315 O OD1 . ASP A 1 183 ? 2.408   -4.822  -10.129 1.00 35.52  ? 480 ASP A OD1 1 
ATOM   1316 O OD2 . ASP A 1 183 ? 2.513   -2.626  -10.088 1.00 41.35  ? 480 ASP A OD2 1 
ATOM   1317 N N   . LYS A 1 184 ? 1.579   -4.482  -5.093  1.00 46.69  ? 481 LYS A N   1 
ATOM   1318 C CA  . LYS A 1 184 ? 1.832   -4.450  -3.658  1.00 50.60  ? 481 LYS A CA  1 
ATOM   1319 C C   . LYS A 1 184 ? 1.784   -5.849  -3.050  1.00 45.91  ? 481 LYS A C   1 
ATOM   1320 O O   . LYS A 1 184 ? 2.643   -6.216  -2.249  1.00 47.69  ? 481 LYS A O   1 
ATOM   1321 C CB  . LYS A 1 184 ? 0.817   -3.540  -2.967  1.00 57.40  ? 481 LYS A CB  1 
ATOM   1322 C CG  . LYS A 1 184 ? 1.046   -3.377  -1.482  1.00 65.73  ? 481 LYS A CG  1 
ATOM   1323 C CD  . LYS A 1 184 ? 2.407   -2.768  -1.207  1.00 72.98  ? 481 LYS A CD  1 
ATOM   1324 C CE  . LYS A 1 184 ? 2.712   -2.789  0.276   1.00 76.98  ? 481 LYS A CE  1 
ATOM   1325 N NZ  . LYS A 1 184 ? 1.689   -2.034  1.049   1.00 80.34  ? 481 LYS A NZ  1 
ATOM   1326 N N   . ILE A 1 185 ? 0.777   -6.625  -3.442  1.00 37.18  ? 482 ILE A N   1 
ATOM   1327 C CA  . ILE A 1 185 ? 0.629   -8.000  -2.971  1.00 35.87  ? 482 ILE A CA  1 
ATOM   1328 C C   . ILE A 1 185 ? 1.761   -8.889  -3.489  1.00 39.02  ? 482 ILE A C   1 
ATOM   1329 O O   . ILE A 1 185 ? 2.231   -9.781  -2.782  1.00 41.39  ? 482 ILE A O   1 
ATOM   1330 C CB  . ILE A 1 185 ? -0.738  -8.587  -3.377  1.00 35.96  ? 482 ILE A CB  1 
ATOM   1331 C CG1 . ILE A 1 185 ? -1.869  -7.772  -2.748  1.00 35.24  ? 482 ILE A CG1 1 
ATOM   1332 C CG2 . ILE A 1 185 ? -0.848  -10.046 -2.965  1.00 35.55  ? 482 ILE A CG2 1 
ATOM   1333 C CD1 . ILE A 1 185 ? -3.249  -8.269  -3.110  1.00 38.40  ? 482 ILE A CD1 1 
ATOM   1334 N N   . THR A 1 186 ? 2.201   -8.641  -4.720  1.00 36.90  ? 483 THR A N   1 
ATOM   1335 C CA  . THR A 1 186 ? 3.374   -9.332  -5.248  1.00 40.73  ? 483 THR A CA  1 
ATOM   1336 C C   . THR A 1 186 ? 4.591   -9.077  -4.358  1.00 45.48  ? 483 THR A C   1 
ATOM   1337 O O   . THR A 1 186 ? 5.301   -10.014 -3.987  1.00 48.46  ? 483 THR A O   1 
ATOM   1338 C CB  . THR A 1 186 ? 3.711   -8.909  -6.699  1.00 39.07  ? 483 THR A CB  1 
ATOM   1339 O OG1 . THR A 1 186 ? 2.594   -9.171  -7.556  1.00 38.28  ? 483 THR A OG1 1 
ATOM   1340 C CG2 . THR A 1 186 ? 4.918   -9.681  -7.207  1.00 37.28  ? 483 THR A CG2 1 
ATOM   1341 N N   . ASP A 1 187 ? 4.819   -7.810  -4.011  1.00 42.98  ? 484 ASP A N   1 
ATOM   1342 C CA  . ASP A 1 187 ? 5.932   -7.436  -3.140  1.00 44.74  ? 484 ASP A CA  1 
ATOM   1343 C C   . ASP A 1 187 ? 5.842   -8.186  -1.821  1.00 46.85  ? 484 ASP A C   1 
ATOM   1344 O O   . ASP A 1 187 ? 6.855   -8.558  -1.228  1.00 48.89  ? 484 ASP A O   1 
ATOM   1345 C CB  . ASP A 1 187 ? 5.928   -5.932  -2.857  1.00 48.27  ? 484 ASP A CB  1 
ATOM   1346 C CG  . ASP A 1 187 ? 6.185   -5.098  -4.095  1.00 53.46  ? 484 ASP A CG  1 
ATOM   1347 O OD1 . ASP A 1 187 ? 6.735   -5.635  -5.082  1.00 54.63  ? 484 ASP A OD1 1 
ATOM   1348 O OD2 . ASP A 1 187 ? 5.846   -3.894  -4.074  1.00 56.37  ? 484 ASP A OD2 1 
ATOM   1349 N N   . THR A 1 188 ? 4.612   -8.402  -1.370  1.00 43.72  ? 485 THR A N   1 
ATOM   1350 C CA  . THR A 1 188 ? 4.362   -9.080  -0.110  1.00 45.39  ? 485 THR A CA  1 
ATOM   1351 C C   . THR A 1 188 ? 4.718   -10.562 -0.208  1.00 46.74  ? 485 THR A C   1 
ATOM   1352 O O   . THR A 1 188 ? 5.349   -11.114 0.695   1.00 48.39  ? 485 THR A O   1 
ATOM   1353 C CB  . THR A 1 188 ? 2.895   -8.921  0.317   1.00 43.08  ? 485 THR A CB  1 
ATOM   1354 O OG1 . THR A 1 188 ? 2.533   -7.535  0.271   1.00 37.64  ? 485 THR A OG1 1 
ATOM   1355 C CG2 . THR A 1 188 ? 2.695   -9.444  1.725   1.00 43.85  ? 485 THR A CG2 1 
ATOM   1356 N N   . LEU A 1 189 ? 4.316   -11.195 -1.309  1.00 45.32  ? 486 LEU A N   1 
ATOM   1357 C CA  . LEU A 1 189 ? 4.642   -12.596 -1.564  1.00 45.49  ? 486 LEU A CA  1 
ATOM   1358 C C   . LEU A 1 189 ? 6.150   -12.825 -1.585  1.00 48.84  ? 486 LEU A C   1 
ATOM   1359 O O   . LEU A 1 189 ? 6.658   -13.730 -0.920  1.00 52.89  ? 486 LEU A O   1 
ATOM   1360 C CB  . LEU A 1 189 ? 4.034   -13.060 -2.888  1.00 42.36  ? 486 LEU A CB  1 
ATOM   1361 C CG  . LEU A 1 189 ? 2.594   -13.573 -2.869  1.00 40.66  ? 486 LEU A CG  1 
ATOM   1362 C CD1 . LEU A 1 189 ? 2.113   -13.831 -4.291  1.00 42.72  ? 486 LEU A CD1 1 
ATOM   1363 C CD2 . LEU A 1 189 ? 2.494   -14.838 -2.030  1.00 37.66  ? 486 LEU A CD2 1 
ATOM   1364 N N   . ILE A 1 190 ? 6.854   -12.000 -2.355  1.00 44.15  ? 487 ILE A N   1 
ATOM   1365 C CA  . ILE A 1 190 ? 8.311   -12.054 -2.422  1.00 45.89  ? 487 ILE A CA  1 
ATOM   1366 C C   . ILE A 1 190 ? 8.942   -11.837 -1.046  1.00 47.51  ? 487 ILE A C   1 
ATOM   1367 O O   . ILE A 1 190 ? 9.907   -12.509 -0.680  1.00 45.92  ? 487 ILE A O   1 
ATOM   1368 C CB  . ILE A 1 190 ? 8.861   -11.009 -3.413  1.00 47.46  ? 487 ILE A CB  1 
ATOM   1369 C CG1 . ILE A 1 190 ? 8.413   -11.342 -4.836  1.00 44.79  ? 487 ILE A CG1 1 
ATOM   1370 C CG2 . ILE A 1 190 ? 10.380  -10.945 -3.346  1.00 50.08  ? 487 ILE A CG2 1 
ATOM   1371 C CD1 . ILE A 1 190 ? 8.937   -12.670 -5.336  1.00 46.09  ? 487 ILE A CD1 1 
ATOM   1372 N N   . HIS A 1 191 ? 8.382   -10.902 -0.286  1.00 50.45  ? 488 HIS A N   1 
ATOM   1373 C CA  . HIS A 1 191 ? 8.855   -10.628 1.066   1.00 56.47  ? 488 HIS A CA  1 
ATOM   1374 C C   . HIS A 1 191 ? 8.707   -11.852 1.966   1.00 55.58  ? 488 HIS A C   1 
ATOM   1375 O O   . HIS A 1 191 ? 9.546   -12.100 2.834   1.00 54.79  ? 488 HIS A O   1 
ATOM   1376 C CB  . HIS A 1 191 ? 8.100   -9.441  1.668   1.00 59.23  ? 488 HIS A CB  1 
ATOM   1377 C CG  . HIS A 1 191 ? 8.422   -9.187  3.108   1.00 64.01  ? 488 HIS A CG  1 
ATOM   1378 N ND1 . HIS A 1 191 ? 7.694   -9.739  4.141   1.00 63.65  ? 488 HIS A ND1 1 
ATOM   1379 C CD2 . HIS A 1 191 ? 9.389   -8.437  3.687   1.00 68.39  ? 488 HIS A CD2 1 
ATOM   1380 C CE1 . HIS A 1 191 ? 8.201   -9.341  5.295   1.00 67.14  ? 488 HIS A CE1 1 
ATOM   1381 N NE2 . HIS A 1 191 ? 9.230   -8.551  5.048   1.00 71.34  ? 488 HIS A NE2 1 
ATOM   1382 N N   . LEU A 1 192 ? 7.637   -12.612 1.753   1.00 53.30  ? 489 LEU A N   1 
ATOM   1383 C CA  . LEU A 1 192 ? 7.391   -13.821 2.532   1.00 54.24  ? 489 LEU A CA  1 
ATOM   1384 C C   . LEU A 1 192 ? 8.401   -14.909 2.188   1.00 56.46  ? 489 LEU A C   1 
ATOM   1385 O O   . LEU A 1 192 ? 8.898   -15.609 3.069   1.00 60.60  ? 489 LEU A O   1 
ATOM   1386 C CB  . LEU A 1 192 ? 5.965   -14.331 2.301   1.00 49.93  ? 489 LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 192 ? 4.825   -13.504 2.903   1.00 47.59  ? 489 LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 192 ? 3.478   -13.991 2.388   1.00 37.17  ? 489 LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 192 ? 4.870   -13.554 4.426   1.00 42.69  ? 489 LEU A CD2 1 
ATOM   1390 N N   . MET A 1 193 ? 8.704   -15.039 0.900   1.00 54.75  ? 490 MET A N   1 
ATOM   1391 C CA  . MET A 1 193 ? 9.640   -16.052 0.424   1.00 54.71  ? 490 MET A CA  1 
ATOM   1392 C C   . MET A 1 193 ? 11.076  -15.727 0.827   1.00 56.15  ? 490 MET A C   1 
ATOM   1393 O O   . MET A 1 193 ? 11.857  -16.622 1.148   1.00 60.49  ? 490 MET A O   1 
ATOM   1394 C CB  . MET A 1 193 ? 9.540   -16.191 -1.096  1.00 53.48  ? 490 MET A CB  1 
ATOM   1395 C CG  . MET A 1 193 ? 8.158   -16.591 -1.586  1.00 51.72  ? 490 MET A CG  1 
ATOM   1396 S SD  . MET A 1 193 ? 8.020   -16.544 -3.383  1.00 46.65  ? 490 MET A SD  1 
ATOM   1397 C CE  . MET A 1 193 ? 6.277   -16.893 -3.590  1.00 62.05  ? 490 MET A CE  1 
ATOM   1398 N N   . ALA A 1 194 ? 11.418  -14.444 0.801   1.00 51.86  ? 491 ALA A N   1 
ATOM   1399 C CA  . ALA A 1 194 ? 12.749  -14.007 1.193   1.00 54.65  ? 491 ALA A CA  1 
ATOM   1400 C C   . ALA A 1 194 ? 12.976  -14.253 2.684   1.00 59.94  ? 491 ALA A C   1 
ATOM   1401 O O   . ALA A 1 194 ? 14.080  -14.601 3.101   1.00 63.06  ? 491 ALA A O   1 
ATOM   1402 C CB  . ALA A 1 194 ? 12.948  -12.540 0.853   1.00 51.58  ? 491 ALA A CB  1 
ATOM   1403 N N   . LYS A 1 195 ? 11.924  -14.078 3.478   1.00 60.85  ? 492 LYS A N   1 
ATOM   1404 C CA  . LYS A 1 195 ? 12.001  -14.316 4.917   1.00 65.63  ? 492 LYS A CA  1 
ATOM   1405 C C   . LYS A 1 195 ? 12.194  -15.802 5.211   1.00 65.79  ? 492 LYS A C   1 
ATOM   1406 O O   . LYS A 1 195 ? 12.874  -16.173 6.168   1.00 69.68  ? 492 LYS A O   1 
ATOM   1407 C CB  . LYS A 1 195 ? 10.744  -13.793 5.620   1.00 67.07  ? 492 LYS A CB  1 
ATOM   1408 C CG  . LYS A 1 195 ? 10.705  -14.080 7.113   1.00 74.01  ? 492 LYS A CG  1 
ATOM   1409 C CD  . LYS A 1 195 ? 9.412   -13.604 7.756   1.00 75.35  ? 492 LYS A CD  1 
ATOM   1410 C CE  . LYS A 1 195 ? 9.359   -12.089 7.853   1.00 77.26  ? 492 LYS A CE  1 
ATOM   1411 N NZ  . LYS A 1 195 ? 8.229   -11.634 8.712   1.00 78.36  ? 492 LYS A NZ  1 
ATOM   1412 N N   . ALA A 1 196 ? 11.606  -16.646 4.368   1.00 61.66  ? 493 ALA A N   1 
ATOM   1413 C CA  . ALA A 1 196 ? 11.707  -18.094 4.528   1.00 59.17  ? 493 ALA A CA  1 
ATOM   1414 C C   . ALA A 1 196 ? 13.081  -18.641 4.131   1.00 61.45  ? 493 ALA A C   1 
ATOM   1415 O O   . ALA A 1 196 ? 13.333  -19.840 4.245   1.00 62.55  ? 493 ALA A O   1 
ATOM   1416 C CB  . ALA A 1 196 ? 10.608  -18.794 3.740   1.00 52.33  ? 493 ALA A CB  1 
ATOM   1417 N N   . GLY A 1 197 ? 13.962  -17.765 3.658   1.00 62.95  ? 494 GLY A N   1 
ATOM   1418 C CA  . GLY A 1 197 ? 15.330  -18.150 3.359   1.00 66.56  ? 494 GLY A CA  1 
ATOM   1419 C C   . GLY A 1 197 ? 15.585  -18.541 1.914   1.00 64.40  ? 494 GLY A C   1 
ATOM   1420 O O   . GLY A 1 197 ? 16.723  -18.817 1.534   1.00 63.20  ? 494 GLY A O   1 
ATOM   1421 N N   . LEU A 1 198 ? 14.527  -18.569 1.110   1.00 61.27  ? 495 LEU A N   1 
ATOM   1422 C CA  . LEU A 1 198 ? 14.650  -18.913 -0.303  1.00 63.16  ? 495 LEU A CA  1 
ATOM   1423 C C   . LEU A 1 198 ? 15.542  -17.912 -1.030  1.00 63.74  ? 495 LEU A C   1 
ATOM   1424 O O   . LEU A 1 198 ? 15.460  -16.706 -0.789  1.00 63.04  ? 495 LEU A O   1 
ATOM   1425 C CB  . LEU A 1 198 ? 13.274  -18.950 -0.967  1.00 61.93  ? 495 LEU A CB  1 
ATOM   1426 C CG  . LEU A 1 198 ? 12.204  -19.828 -0.318  1.00 65.07  ? 495 LEU A CG  1 
ATOM   1427 C CD1 . LEU A 1 198 ? 10.924  -19.760 -1.130  1.00 64.02  ? 495 LEU A CD1 1 
ATOM   1428 C CD2 . LEU A 1 198 ? 12.680  -21.266 -0.183  1.00 67.80  ? 495 LEU A CD2 1 
ATOM   1429 N N   . THR A 1 199 ? 16.394  -18.413 -1.919  1.00 65.63  ? 496 THR A N   1 
ATOM   1430 C CA  . THR A 1 199 ? 17.281  -17.545 -2.684  1.00 67.92  ? 496 THR A CA  1 
ATOM   1431 C C   . THR A 1 199 ? 16.487  -16.739 -3.698  1.00 67.01  ? 496 THR A C   1 
ATOM   1432 O O   . THR A 1 199 ? 15.295  -16.976 -3.897  1.00 65.83  ? 496 THR A O   1 
ATOM   1433 C CB  . THR A 1 199 ? 18.373  -18.335 -3.424  1.00 70.63  ? 496 THR A CB  1 
ATOM   1434 O OG1 . THR A 1 199 ? 19.365  -17.427 -3.920  1.00 77.61  ? 496 THR A OG1 1 
ATOM   1435 C CG2 . THR A 1 199 ? 17.777  -19.108 -4.589  1.00 62.83  ? 496 THR A CG2 1 
ATOM   1436 N N   . LEU A 1 200 ? 17.158  -15.792 -4.343  1.00 67.93  ? 497 LEU A N   1 
ATOM   1437 C CA  . LEU A 1 200 ? 16.504  -14.904 -5.291  1.00 65.47  ? 497 LEU A CA  1 
ATOM   1438 C C   . LEU A 1 200 ? 15.892  -15.685 -6.453  1.00 61.24  ? 497 LEU A C   1 
ATOM   1439 O O   . LEU A 1 200 ? 14.808  -15.351 -6.929  1.00 58.34  ? 497 LEU A O   1 
ATOM   1440 C CB  . LEU A 1 200 ? 17.496  -13.860 -5.803  1.00 69.33  ? 497 LEU A CB  1 
ATOM   1441 C CG  . LEU A 1 200 ? 16.904  -12.599 -6.428  1.00 70.03  ? 497 LEU A CG  1 
ATOM   1442 C CD1 . LEU A 1 200 ? 15.949  -11.916 -5.462  1.00 67.77  ? 497 LEU A CD1 1 
ATOM   1443 C CD2 . LEU A 1 200 ? 18.022  -11.660 -6.830  1.00 75.38  ? 497 LEU A CD2 1 
ATOM   1444 N N   . GLN A 1 201 ? 16.583  -16.731 -6.895  1.00 63.44  ? 498 GLN A N   1 
ATOM   1445 C CA  . GLN A 1 201 ? 16.082  -17.560 -7.986  1.00 60.35  ? 498 GLN A CA  1 
ATOM   1446 C C   . GLN A 1 201 ? 14.863  -18.354 -7.535  1.00 57.91  ? 498 GLN A C   1 
ATOM   1447 O O   . GLN A 1 201 ? 13.889  -18.491 -8.276  1.00 56.13  ? 498 GLN A O   1 
ATOM   1448 C CB  . GLN A 1 201 ? 17.166  -18.510 -8.495  1.00 61.08  ? 498 GLN A CB  1 
ATOM   1449 C CG  . GLN A 1 201 ? 16.764  -19.275 -9.746  1.00 62.15  ? 498 GLN A CG  1 
ATOM   1450 C CD  . GLN A 1 201 ? 17.773  -20.338 -10.135 1.00 68.15  ? 498 GLN A CD  1 
ATOM   1451 O OE1 . GLN A 1 201 ? 18.520  -20.840 -9.295  1.00 75.68  ? 498 GLN A OE1 1 
ATOM   1452 N NE2 . GLN A 1 201 ? 17.798  -20.688 -11.415 1.00 65.30  ? 498 GLN A NE2 1 
ATOM   1453 N N   . GLN A 1 202 ? 14.924  -18.872 -6.313  1.00 55.51  ? 499 GLN A N   1 
ATOM   1454 C CA  . GLN A 1 202 ? 13.813  -19.620 -5.739  1.00 54.96  ? 499 GLN A CA  1 
ATOM   1455 C C   . GLN A 1 202 ? 12.592  -18.737 -5.517  1.00 52.15  ? 499 GLN A C   1 
ATOM   1456 O O   . GLN A 1 202 ? 11.459  -19.211 -5.558  1.00 51.51  ? 499 GLN A O   1 
ATOM   1457 C CB  . GLN A 1 202 ? 14.241  -20.280 -4.428  1.00 56.11  ? 499 GLN A CB  1 
ATOM   1458 C CG  . GLN A 1 202 ? 15.096  -21.511 -4.638  1.00 59.40  ? 499 GLN A CG  1 
ATOM   1459 C CD  . GLN A 1 202 ? 15.809  -21.953 -3.383  1.00 64.36  ? 499 GLN A CD  1 
ATOM   1460 O OE1 . GLN A 1 202 ? 16.014  -21.166 -2.460  1.00 66.80  ? 499 GLN A OE1 1 
ATOM   1461 N NE2 . GLN A 1 202 ? 16.196  -23.223 -3.341  1.00 60.75  ? 499 GLN A NE2 1 
ATOM   1462 N N   . GLN A 1 203 ? 12.834  -17.451 -5.290  1.00 53.26  ? 500 GLN A N   1 
ATOM   1463 C CA  . GLN A 1 203 ? 11.758  -16.488 -5.079  1.00 49.59  ? 500 GLN A CA  1 
ATOM   1464 C C   . GLN A 1 203 ? 10.907  -16.290 -6.332  1.00 46.29  ? 500 GLN A C   1 
ATOM   1465 O O   . GLN A 1 203 ? 9.679   -16.384 -6.276  1.00 40.85  ? 500 GLN A O   1 
ATOM   1466 C CB  . GLN A 1 203 ? 12.319  -15.144 -4.605  1.00 50.46  ? 500 GLN A CB  1 
ATOM   1467 C CG  . GLN A 1 203 ? 12.838  -15.161 -3.176  1.00 53.82  ? 500 GLN A CG  1 
ATOM   1468 C CD  . GLN A 1 203 ? 13.478  -13.849 -2.767  1.00 54.61  ? 500 GLN A CD  1 
ATOM   1469 O OE1 . GLN A 1 203 ? 13.038  -12.775 -3.176  1.00 52.67  ? 500 GLN A OE1 1 
ATOM   1470 N NE2 . GLN A 1 203 ? 14.527  -13.932 -1.955  1.00 56.36  ? 500 GLN A NE2 1 
ATOM   1471 N N   . HIS A 1 204 ? 11.552  -16.016 -7.463  1.00 47.38  ? 501 HIS A N   1 
ATOM   1472 C CA  . HIS A 1 204 ? 10.793  -15.787 -8.689  1.00 46.80  ? 501 HIS A CA  1 
ATOM   1473 C C   . HIS A 1 204 ? 10.195  -17.082 -9.240  1.00 40.93  ? 501 HIS A C   1 
ATOM   1474 O O   . HIS A 1 204 ? 9.100   -17.078 -9.804  1.00 35.72  ? 501 HIS A O   1 
ATOM   1475 C CB  . HIS A 1 204 ? 11.598  -15.004 -9.744  1.00 52.60  ? 501 HIS A CB  1 
ATOM   1476 C CG  . HIS A 1 204 ? 12.766  -15.746 -10.321 1.00 63.96  ? 501 HIS A CG  1 
ATOM   1477 N ND1 . HIS A 1 204 ? 14.059  -15.274 -10.234 1.00 69.74  ? 501 HIS A ND1 1 
ATOM   1478 C CD2 . HIS A 1 204 ? 12.835  -16.898 -11.032 1.00 66.87  ? 501 HIS A CD2 1 
ATOM   1479 C CE1 . HIS A 1 204 ? 14.875  -16.112 -10.849 1.00 72.10  ? 501 HIS A CE1 1 
ATOM   1480 N NE2 . HIS A 1 204 ? 14.158  -17.107 -11.339 1.00 70.71  ? 501 HIS A NE2 1 
ATOM   1481 N N   . GLN A 1 205 ? 10.903  -18.189 -9.044  1.00 40.37  ? 502 GLN A N   1 
ATOM   1482 C CA  . GLN A 1 205 ? 10.411  -19.489 -9.480  1.00 40.15  ? 502 GLN A CA  1 
ATOM   1483 C C   . GLN A 1 205 ? 9.146   -19.885 -8.726  1.00 40.77  ? 502 GLN A C   1 
ATOM   1484 O O   . GLN A 1 205 ? 8.157   -20.291 -9.335  1.00 40.90  ? 502 GLN A O   1 
ATOM   1485 C CB  . GLN A 1 205 ? 11.490  -20.561 -9.323  1.00 43.39  ? 502 GLN A CB  1 
ATOM   1486 C CG  . GLN A 1 205 ? 12.573  -20.498 -10.384 1.00 48.80  ? 502 GLN A CG  1 
ATOM   1487 C CD  . GLN A 1 205 ? 13.593  -21.607 -10.248 1.00 55.35  ? 502 GLN A CD  1 
ATOM   1488 O OE1 . GLN A 1 205 ? 13.552  -22.392 -9.301  1.00 61.98  ? 502 GLN A OE1 1 
ATOM   1489 N NE2 . GLN A 1 205 ? 14.517  -21.679 -11.197 1.00 56.01  ? 502 GLN A NE2 1 
ATOM   1490 N N   . ARG A 1 206 ? 9.182   -19.757 -7.402  1.00 41.32  ? 503 ARG A N   1 
ATOM   1491 C CA  . ARG A 1 206 ? 8.025   -20.072 -6.571  1.00 39.97  ? 503 ARG A CA  1 
ATOM   1492 C C   . ARG A 1 206 ? 6.858   -19.138 -6.875  1.00 37.66  ? 503 ARG A C   1 
ATOM   1493 O O   . ARG A 1 206 ? 5.711   -19.577 -6.972  1.00 37.62  ? 503 ARG A O   1 
ATOM   1494 C CB  . ARG A 1 206 ? 8.391   -19.999 -5.087  1.00 41.81  ? 503 ARG A CB  1 
ATOM   1495 C CG  . ARG A 1 206 ? 7.262   -20.385 -4.144  1.00 40.35  ? 503 ARG A CG  1 
ATOM   1496 C CD  . ARG A 1 206 ? 7.762   -20.498 -2.708  1.00 40.61  ? 503 ARG A CD  1 
ATOM   1497 N NE  . ARG A 1 206 ? 6.705   -20.891 -1.782  1.00 38.30  ? 503 ARG A NE  1 
ATOM   1498 C CZ  . ARG A 1 206 ? 6.328   -22.147 -1.570  1.00 44.67  ? 503 ARG A CZ  1 
ATOM   1499 N NH1 . ARG A 1 206 ? 6.918   -23.138 -2.225  1.00 43.12  ? 503 ARG A NH1 1 
ATOM   1500 N NH2 . ARG A 1 206 ? 5.358   -22.415 -0.703  1.00 44.21  ? 503 ARG A NH2 1 
ATOM   1501 N N   . LEU A 1 207 ? 7.161   -17.850 -7.022  1.00 37.63  ? 504 LEU A N   1 
ATOM   1502 C CA  . LEU A 1 207 ? 6.162   -16.853 -7.392  1.00 37.24  ? 504 LEU A CA  1 
ATOM   1503 C C   . LEU A 1 207 ? 5.427   -17.269 -8.660  1.00 38.63  ? 504 LEU A C   1 
ATOM   1504 O O   . LEU A 1 207 ? 4.196   -17.250 -8.712  1.00 36.85  ? 504 LEU A O   1 
ATOM   1505 C CB  . LEU A 1 207 ? 6.821   -15.491 -7.609  1.00 40.12  ? 504 LEU A CB  1 
ATOM   1506 C CG  . LEU A 1 207 ? 5.906   -14.396 -8.167  1.00 37.95  ? 504 LEU A CG  1 
ATOM   1507 C CD1 . LEU A 1 207 ? 4.851   -14.013 -7.142  1.00 34.96  ? 504 LEU A CD1 1 
ATOM   1508 C CD2 . LEU A 1 207 ? 6.709   -13.177 -8.611  1.00 37.85  ? 504 LEU A CD2 1 
ATOM   1509 N N   . ALA A 1 208 ? 6.197   -17.652 -9.674  1.00 37.82  ? 505 ALA A N   1 
ATOM   1510 C CA  . ALA A 1 208 ? 5.648   -18.108 -10.946 1.00 36.52  ? 505 ALA A CA  1 
ATOM   1511 C C   . ALA A 1 208 ? 4.806   -19.368 -10.778 1.00 36.28  ? 505 ALA A C   1 
ATOM   1512 O O   . ALA A 1 208 ? 3.700   -19.462 -11.313 1.00 26.62  ? 505 ALA A O   1 
ATOM   1513 C CB  . ALA A 1 208 ? 6.771   -18.352 -11.952 1.00 35.19  ? 505 ALA A CB  1 
ATOM   1514 N N   . GLN A 1 209 ? 5.339   -20.334 -10.037 1.00 37.24  ? 506 GLN A N   1 
ATOM   1515 C CA  . GLN A 1 209 ? 4.634   -21.587 -9.791  1.00 36.59  ? 506 GLN A CA  1 
ATOM   1516 C C   . GLN A 1 209 ? 3.267   -21.338 -9.162  1.00 34.20  ? 506 GLN A C   1 
ATOM   1517 O O   . GLN A 1 209 ? 2.268   -21.922 -9.583  1.00 34.85  ? 506 GLN A O   1 
ATOM   1518 C CB  . GLN A 1 209 ? 5.470   -22.507 -8.900  1.00 38.42  ? 506 GLN A CB  1 
ATOM   1519 C CG  . GLN A 1 209 ? 6.713   -23.062 -9.572  1.00 39.48  ? 506 GLN A CG  1 
ATOM   1520 C CD  . GLN A 1 209 ? 7.725   -23.586 -8.572  1.00 46.26  ? 506 GLN A CD  1 
ATOM   1521 O OE1 . GLN A 1 209 ? 7.485   -23.571 -7.364  1.00 49.72  ? 506 GLN A OE1 1 
ATOM   1522 N NE2 . GLN A 1 209 ? 8.867   -24.047 -9.070  1.00 48.00  ? 506 GLN A NE2 1 
ATOM   1523 N N   . LEU A 1 210 ? 3.225   -20.456 -8.168  1.00 32.41  ? 507 LEU A N   1 
ATOM   1524 C CA  . LEU A 1 210 ? 1.978   -20.148 -7.476  1.00 33.60  ? 507 LEU A CA  1 
ATOM   1525 C C   . LEU A 1 210 ? 0.970   -19.453 -8.387  1.00 33.41  ? 507 LEU A C   1 
ATOM   1526 O O   . LEU A 1 210 ? -0.214  -19.789 -8.385  1.00 32.60  ? 507 LEU A O   1 
ATOM   1527 C CB  . LEU A 1 210 ? 2.244   -19.285 -6.239  1.00 35.83  ? 507 LEU A CB  1 
ATOM   1528 C CG  . LEU A 1 210 ? 2.977   -19.953 -5.075  1.00 40.22  ? 507 LEU A CG  1 
ATOM   1529 C CD1 . LEU A 1 210 ? 3.274   -18.944 -3.978  1.00 40.91  ? 507 LEU A CD1 1 
ATOM   1530 C CD2 . LEU A 1 210 ? 2.158   -21.108 -4.527  1.00 40.79  ? 507 LEU A CD2 1 
ATOM   1531 N N   . LEU A 1 211 ? 1.438   -18.479 -9.161  1.00 31.64  ? 508 LEU A N   1 
ATOM   1532 C CA  . LEU A 1 211 ? 0.541   -17.712 -10.016 1.00 29.84  ? 508 LEU A CA  1 
ATOM   1533 C C   . LEU A 1 211 ? 0.004   -18.547 -11.176 1.00 27.32  ? 508 LEU A C   1 
ATOM   1534 O O   . LEU A 1 211 ? -1.121  -18.339 -11.625 1.00 24.95  ? 508 LEU A O   1 
ATOM   1535 C CB  . LEU A 1 211 ? 1.225   -16.448 -10.533 1.00 31.63  ? 508 LEU A CB  1 
ATOM   1536 C CG  . LEU A 1 211 ? 1.659   -15.433 -9.473  1.00 32.75  ? 508 LEU A CG  1 
ATOM   1537 C CD1 . LEU A 1 211 ? 2.286   -14.229 -10.144 1.00 32.01  ? 508 LEU A CD1 1 
ATOM   1538 C CD2 . LEU A 1 211 ? 0.498   -15.013 -8.573  1.00 29.73  ? 508 LEU A CD2 1 
ATOM   1539 N N   . LEU A 1 212 ? 0.805   -19.495 -11.654 1.00 26.15  ? 509 LEU A N   1 
ATOM   1540 C CA  . LEU A 1 212 ? 0.352   -20.397 -12.710 1.00 28.95  ? 509 LEU A CA  1 
ATOM   1541 C C   . LEU A 1 212 ? -0.801  -21.285 -12.241 1.00 31.94  ? 509 LEU A C   1 
ATOM   1542 O O   . LEU A 1 212 ? -1.644  -21.687 -13.040 1.00 29.26  ? 509 LEU A O   1 
ATOM   1543 C CB  . LEU A 1 212 ? 1.510   -21.245 -13.247 1.00 30.01  ? 509 LEU A CB  1 
ATOM   1544 C CG  . LEU A 1 212 ? 2.498   -20.498 -14.148 1.00 33.03  ? 509 LEU A CG  1 
ATOM   1545 C CD1 . LEU A 1 212 ? 3.480   -21.461 -14.803 1.00 36.68  ? 509 LEU A CD1 1 
ATOM   1546 C CD2 . LEU A 1 212 ? 1.757   -19.682 -15.198 1.00 25.21  ? 509 LEU A CD2 1 
ATOM   1547 N N   . ILE A 1 213 ? -0.837  -21.575 -10.943 1.00 33.71  ? 510 ILE A N   1 
ATOM   1548 C CA  . ILE A 1 213 ? -1.906  -22.380 -10.359 1.00 33.86  ? 510 ILE A CA  1 
ATOM   1549 C C   . ILE A 1 213 ? -3.240  -21.630 -10.406 1.00 32.95  ? 510 ILE A C   1 
ATOM   1550 O O   . ILE A 1 213 ? -4.309  -22.244 -10.506 1.00 31.75  ? 510 ILE A O   1 
ATOM   1551 C CB  . ILE A 1 213 ? -1.550  -22.810 -8.915  1.00 39.47  ? 510 ILE A CB  1 
ATOM   1552 C CG1 . ILE A 1 213 ? -0.316  -23.716 -8.933  1.00 40.86  ? 510 ILE A CG1 1 
ATOM   1553 C CG2 . ILE A 1 213 ? -2.710  -23.535 -8.249  1.00 41.94  ? 510 ILE A CG2 1 
ATOM   1554 C CD1 . ILE A 1 213 ? 0.254   -24.010 -7.568  1.00 42.16  ? 510 ILE A CD1 1 
ATOM   1555 N N   . LEU A 1 214 ? -3.168  -20.299 -10.365 1.00 30.49  ? 511 LEU A N   1 
ATOM   1556 C CA  . LEU A 1 214 ? -4.359  -19.457 -10.483 1.00 29.38  ? 511 LEU A CA  1 
ATOM   1557 C C   . LEU A 1 214 ? -5.068  -19.649 -11.823 1.00 28.97  ? 511 LEU A C   1 
ATOM   1558 O O   . LEU A 1 214 ? -6.278  -19.445 -11.928 1.00 29.51  ? 511 LEU A O   1 
ATOM   1559 C CB  . LEU A 1 214 ? -4.012  -17.979 -10.292 1.00 26.94  ? 511 LEU A CB  1 
ATOM   1560 C CG  . LEU A 1 214 ? -3.393  -17.569 -8.952  1.00 33.42  ? 511 LEU A CG  1 
ATOM   1561 C CD1 . LEU A 1 214 ? -3.419  -16.054 -8.804  1.00 33.33  ? 511 LEU A CD1 1 
ATOM   1562 C CD2 . LEU A 1 214 ? -4.090  -18.256 -7.770  1.00 25.46  ? 511 LEU A CD2 1 
ATOM   1563 N N   . SER A 1 215 ? -4.313  -20.036 -12.846 1.00 23.49  ? 512 SER A N   1 
ATOM   1564 C CA  . SER A 1 215 ? -4.900  -20.300 -14.153 1.00 30.72  ? 512 SER A CA  1 
ATOM   1565 C C   . SER A 1 215 ? -5.763  -21.554 -14.109 1.00 29.57  ? 512 SER A C   1 
ATOM   1566 O O   . SER A 1 215 ? -6.810  -21.620 -14.753 1.00 30.57  ? 512 SER A O   1 
ATOM   1567 C CB  . SER A 1 215 ? -3.816  -20.440 -15.225 1.00 33.73  ? 512 SER A CB  1 
ATOM   1568 O OG  . SER A 1 215 ? -4.368  -20.948 -16.425 1.00 41.70  ? 512 SER A OG  1 
ATOM   1569 N N   . HIS A 1 216 ? -5.316  -22.543 -13.343 1.00 28.64  ? 513 HIS A N   1 
ATOM   1570 C CA  A HIS A 1 216 ? -6.060  -23.785 -13.188 0.53 30.73  ? 513 HIS A CA  1 
ATOM   1571 C CA  B HIS A 1 216 ? -6.054  -23.791 -13.187 0.47 30.70  ? 513 HIS A CA  1 
ATOM   1572 C C   . HIS A 1 216 ? -7.298  -23.573 -12.330 1.00 30.03  ? 513 HIS A C   1 
ATOM   1573 O O   . HIS A 1 216 ? -8.354  -24.153 -12.591 1.00 34.21  ? 513 HIS A O   1 
ATOM   1574 C CB  A HIS A 1 216 ? -5.166  -24.865 -12.587 0.53 31.77  ? 513 HIS A CB  1 
ATOM   1575 C CB  B HIS A 1 216 ? -5.161  -24.875 -12.574 0.47 31.81  ? 513 HIS A CB  1 
ATOM   1576 C CG  A HIS A 1 216 ? -3.944  -25.142 -13.401 0.53 34.34  ? 513 HIS A CG  1 
ATOM   1577 C CG  B HIS A 1 216 ? -5.830  -26.207 -12.438 0.47 33.62  ? 513 HIS A CG  1 
ATOM   1578 N ND1 A HIS A 1 216 ? -3.947  -26.012 -14.469 0.53 40.28  ? 513 HIS A ND1 1 
ATOM   1579 N ND1 B HIS A 1 216 ? -5.962  -26.855 -11.227 0.47 34.16  ? 513 HIS A ND1 1 
ATOM   1580 C CD2 A HIS A 1 216 ? -2.689  -24.642 -13.325 0.53 34.80  ? 513 HIS A CD2 1 
ATOM   1581 C CD2 B HIS A 1 216 ? -6.408  -27.014 -13.360 0.47 35.84  ? 513 HIS A CD2 1 
ATOM   1582 C CE1 A HIS A 1 216 ? -2.743  -26.047 -15.007 0.53 39.36  ? 513 HIS A CE1 1 
ATOM   1583 C CE1 B HIS A 1 216 ? -6.588  -28.004 -11.411 0.47 34.88  ? 513 HIS A CE1 1 
ATOM   1584 N NE2 A HIS A 1 216 ? -1.959  -25.227 -14.330 0.53 37.88  ? 513 HIS A NE2 1 
ATOM   1585 N NE2 B HIS A 1 216 ? -6.871  -28.124 -12.695 0.47 36.80  ? 513 HIS A NE2 1 
ATOM   1586 N N   . ILE A 1 217 ? -7.166  -22.735 -11.310 1.00 27.95  ? 514 ILE A N   1 
ATOM   1587 C CA  . ILE A 1 217 ? -8.299  -22.394 -10.462 1.00 31.97  ? 514 ILE A CA  1 
ATOM   1588 C C   . ILE A 1 217 ? -9.374  -21.709 -11.304 1.00 31.35  ? 514 ILE A C   1 
ATOM   1589 O O   . ILE A 1 217 ? -10.561 -22.008 -11.171 1.00 33.16  ? 514 ILE A O   1 
ATOM   1590 C CB  . ILE A 1 217 ? -7.868  -21.517 -9.268  1.00 33.59  ? 514 ILE A CB  1 
ATOM   1591 C CG1 . ILE A 1 217 ? -7.005  -22.343 -8.307  1.00 37.74  ? 514 ILE A CG1 1 
ATOM   1592 C CG2 . ILE A 1 217 ? -9.079  -20.963 -8.537  1.00 30.77  ? 514 ILE A CG2 1 
ATOM   1593 C CD1 . ILE A 1 217 ? -6.414  -21.548 -7.170  1.00 38.46  ? 514 ILE A CD1 1 
ATOM   1594 N N   . ARG A 1 218 ? -8.946  -20.815 -12.193 1.00 30.88  ? 515 ARG A N   1 
ATOM   1595 C CA  . ARG A 1 218 ? -9.854  -20.166 -13.135 1.00 31.60  ? 515 ARG A CA  1 
ATOM   1596 C C   . ARG A 1 218 ? -10.587 -21.198 -13.991 1.00 30.92  ? 515 ARG A C   1 
ATOM   1597 O O   . ARG A 1 218 ? -11.806 -21.134 -14.156 1.00 33.09  ? 515 ARG A O   1 
ATOM   1598 C CB  . ARG A 1 218 ? -9.088  -19.212 -14.051 1.00 34.20  ? 515 ARG A CB  1 
ATOM   1599 C CG  . ARG A 1 218 ? -9.977  -18.496 -15.054 1.00 35.05  ? 515 ARG A CG  1 
ATOM   1600 C CD  . ARG A 1 218 ? -10.687 -17.319 -14.400 1.00 37.92  ? 515 ARG A CD  1 
ATOM   1601 N NE  . ARG A 1 218 ? -9.820  -16.146 -14.357 1.00 38.59  ? 515 ARG A NE  1 
ATOM   1602 C CZ  . ARG A 1 218 ? -10.230 -14.907 -14.599 1.00 37.66  ? 515 ARG A CZ  1 
ATOM   1603 N NH1 . ARG A 1 218 ? -11.503 -14.672 -14.884 1.00 31.37  ? 515 ARG A NH1 1 
ATOM   1604 N NH2 . ARG A 1 218 ? -9.366  -13.903 -14.553 1.00 43.38  ? 515 ARG A NH2 1 
ATOM   1605 N N   . HIS A 1 219 ? -9.828  -22.146 -14.531 1.00 24.41  ? 516 HIS A N   1 
ATOM   1606 C CA  . HIS A 1 219 ? -10.386 -23.209 -15.362 1.00 28.34  ? 516 HIS A CA  1 
ATOM   1607 C C   . HIS A 1 219 ? -11.422 -24.024 -14.586 1.00 29.31  ? 516 HIS A C   1 
ATOM   1608 O O   . HIS A 1 219 ? -12.537 -24.241 -15.065 1.00 27.08  ? 516 HIS A O   1 
ATOM   1609 C CB  . HIS A 1 219 ? -9.266  -24.113 -15.884 1.00 24.39  ? 516 HIS A CB  1 
ATOM   1610 C CG  . HIS A 1 219 ? -9.739  -25.207 -16.788 1.00 43.55  ? 516 HIS A CG  1 
ATOM   1611 N ND1 . HIS A 1 219 ? -10.160 -24.977 -18.081 1.00 42.18  ? 516 HIS A ND1 1 
ATOM   1612 C CD2 . HIS A 1 219 ? -9.850  -26.542 -16.590 1.00 48.16  ? 516 HIS A CD2 1 
ATOM   1613 C CE1 . HIS A 1 219 ? -10.512 -26.120 -18.638 1.00 42.93  ? 516 HIS A CE1 1 
ATOM   1614 N NE2 . HIS A 1 219 ? -10.334 -27.088 -17.755 1.00 48.12  ? 516 HIS A NE2 1 
ATOM   1615 N N   . MET A 1 220 ? -11.057 -24.453 -13.380 1.00 29.21  ? 517 MET A N   1 
ATOM   1616 C CA  . MET A 1 220 ? -11.979 -25.202 -12.533 1.00 31.71  ? 517 MET A CA  1 
ATOM   1617 C C   . MET A 1 220 ? -13.263 -24.413 -12.274 1.00 28.77  ? 517 MET A C   1 
ATOM   1618 O O   . MET A 1 220 ? -14.362 -24.959 -12.364 1.00 28.74  ? 517 MET A O   1 
ATOM   1619 C CB  . MET A 1 220 ? -11.313 -25.595 -11.212 1.00 31.06  ? 517 MET A CB  1 
ATOM   1620 C CG  . MET A 1 220 ? -10.182 -26.597 -11.365 1.00 27.04  ? 517 MET A CG  1 
ATOM   1621 S SD  . MET A 1 220 ? -9.566  -27.216 -9.785  1.00 37.44  ? 517 MET A SD  1 
ATOM   1622 C CE  . MET A 1 220 ? -8.687  -25.782 -9.168  1.00 27.09  ? 517 MET A CE  1 
ATOM   1623 N N   . SER A 1 221 ? -13.121 -23.126 -11.976 1.00 25.91  ? 518 SER A N   1 
ATOM   1624 C CA  . SER A 1 221 ? -14.285 -22.276 -11.743 1.00 28.03  ? 518 SER A CA  1 
ATOM   1625 C C   . SER A 1 221 ? -15.200 -22.231 -12.963 1.00 29.55  ? 518 SER A C   1 
ATOM   1626 O O   . SER A 1 221 ? -16.413 -22.385 -12.834 1.00 31.57  ? 518 SER A O   1 
ATOM   1627 C CB  . SER A 1 221 ? -13.863 -20.861 -11.353 1.00 28.64  ? 518 SER A CB  1 
ATOM   1628 O OG  . SER A 1 221 ? -14.986 -19.998 -11.261 1.00 31.24  ? 518 SER A OG  1 
ATOM   1629 N N   . ASN A 1 222 ? -14.615 -22.026 -14.141 1.00 27.99  ? 519 ASN A N   1 
ATOM   1630 C CA  . ASN A 1 222 ? -15.383 -22.007 -15.383 1.00 32.77  ? 519 ASN A CA  1 
ATOM   1631 C C   . ASN A 1 222 ? -16.166 -23.295 -15.614 1.00 33.00  ? 519 ASN A C   1 
ATOM   1632 O O   . ASN A 1 222 ? -17.358 -23.255 -15.910 1.00 36.46  ? 519 ASN A O   1 
ATOM   1633 C CB  . ASN A 1 222 ? -14.482 -21.721 -16.590 1.00 32.93  ? 519 ASN A CB  1 
ATOM   1634 C CG  . ASN A 1 222 ? -13.940 -20.308 -16.588 1.00 38.63  ? 519 ASN A CG  1 
ATOM   1635 O OD1 . ASN A 1 222 ? -14.533 -19.403 -15.998 1.00 39.88  ? 519 ASN A OD1 1 
ATOM   1636 N ND2 . ASN A 1 222 ? -12.806 -20.110 -17.250 1.00 39.94  ? 519 ASN A ND2 1 
ATOM   1637 N N   . LYS A 1 223 ? -15.491 -24.433 -15.479 1.00 33.90  ? 520 LYS A N   1 
ATOM   1638 C CA  . LYS A 1 223 ? -16.141 -25.729 -15.637 1.00 37.36  ? 520 LYS A CA  1 
ATOM   1639 C C   . LYS A 1 223 ? -17.259 -25.898 -14.616 1.00 37.25  ? 520 LYS A C   1 
ATOM   1640 O O   . LYS A 1 223 ? -18.354 -26.346 -14.950 1.00 42.79  ? 520 LYS A O   1 
ATOM   1641 C CB  . LYS A 1 223 ? -15.126 -26.869 -15.510 1.00 39.86  ? 520 LYS A CB  1 
ATOM   1642 C CG  . LYS A 1 223 ? -14.138 -26.955 -16.664 1.00 46.24  ? 520 LYS A CG  1 
ATOM   1643 C CD  . LYS A 1 223 ? -14.834 -27.368 -17.957 1.00 55.11  ? 520 LYS A CD  1 
ATOM   1644 C CE  . LYS A 1 223 ? -13.842 -27.531 -19.097 1.00 60.77  ? 520 LYS A CE  1 
ATOM   1645 N NZ  . LYS A 1 223 ? -14.476 -28.116 -20.316 1.00 67.10  ? 520 LYS A NZ  1 
ATOM   1646 N N   . GLY A 1 224 ? -16.980 -25.524 -13.373 1.00 33.69  ? 521 GLY A N   1 
ATOM   1647 C CA  . GLY A 1 224 ? -17.968 -25.616 -12.314 1.00 36.22  ? 521 GLY A CA  1 
ATOM   1648 C C   . GLY A 1 224 ? -19.147 -24.695 -12.551 1.00 33.85  ? 521 GLY A C   1 
ATOM   1649 O O   . GLY A 1 224 ? -20.301 -25.094 -12.393 1.00 35.30  ? 521 GLY A O   1 
ATOM   1650 N N   . MET A 1 225 ? -18.852 -23.458 -12.936 1.00 31.49  ? 522 MET A N   1 
ATOM   1651 C CA  . MET A 1 225 ? -19.888 -22.472 -13.208 1.00 38.52  ? 522 MET A CA  1 
ATOM   1652 C C   . MET A 1 225 ? -20.802 -22.957 -14.323 1.00 42.21  ? 522 MET A C   1 
ATOM   1653 O O   . MET A 1 225 ? -22.025 -22.834 -14.233 1.00 43.53  ? 522 MET A O   1 
ATOM   1654 C CB  . MET A 1 225 ? -19.265 -21.138 -13.609 1.00 40.26  ? 522 MET A CB  1 
ATOM   1655 C CG  . MET A 1 225 ? -20.209 -19.967 -13.469 1.00 45.04  ? 522 MET A CG  1 
ATOM   1656 S SD  . MET A 1 225 ? -20.417 -19.523 -11.740 1.00 55.70  ? 522 MET A SD  1 
ATOM   1657 C CE  . MET A 1 225 ? -18.760 -18.967 -11.354 1.00 32.43  ? 522 MET A CE  1 
ATOM   1658 N N   . GLU A 1 226 ? -20.194 -23.510 -15.369 1.00 41.28  ? 523 GLU A N   1 
ATOM   1659 C CA  . GLU A 1 226 ? -20.927 -24.030 -16.517 1.00 47.09  ? 523 GLU A CA  1 
ATOM   1660 C C   . GLU A 1 226 ? -21.948 -25.061 -16.065 1.00 50.63  ? 523 GLU A C   1 
ATOM   1661 O O   . GLU A 1 226 ? -23.095 -25.054 -16.510 1.00 52.21  ? 523 GLU A O   1 
ATOM   1662 C CB  . GLU A 1 226 ? -19.964 -24.652 -17.536 1.00 48.01  ? 523 GLU A CB  1 
ATOM   1663 C CG  . GLU A 1 226 ? -20.640 -25.229 -18.771 1.00 51.31  ? 523 GLU A CG  1 
ATOM   1664 C CD  . GLU A 1 226 ? -19.659 -25.902 -19.723 1.00 56.84  ? 523 GLU A CD  1 
ATOM   1665 O OE1 . GLU A 1 226 ? -20.063 -26.243 -20.859 1.00 55.12  ? 523 GLU A OE1 1 
ATOM   1666 O OE2 . GLU A 1 226 ? -18.485 -26.094 -19.334 1.00 57.15  ? 523 GLU A OE2 1 
ATOM   1667 N N   . HIS A 1 227 ? -21.522 -25.941 -15.166 1.00 52.20  ? 524 HIS A N   1 
ATOM   1668 C CA  . HIS A 1 227 ? -22.405 -26.967 -14.637 1.00 54.78  ? 524 HIS A CA  1 
ATOM   1669 C C   . HIS A 1 227 ? -23.494 -26.344 -13.773 1.00 56.82  ? 524 HIS A C   1 
ATOM   1670 O O   . HIS A 1 227 ? -24.650 -26.756 -13.836 1.00 60.59  ? 524 HIS A O   1 
ATOM   1671 C CB  . HIS A 1 227 ? -21.612 -27.997 -13.832 1.00 53.80  ? 524 HIS A CB  1 
ATOM   1672 N N   . LEU A 1 228 ? -23.128 -25.342 -12.980 1.00 53.69  ? 525 LEU A N   1 
ATOM   1673 C CA  . LEU A 1 228 ? -24.078 -24.717 -12.060 1.00 52.57  ? 525 LEU A CA  1 
ATOM   1674 C C   . LEU A 1 228 ? -25.258 -24.037 -12.755 1.00 58.58  ? 525 LEU A C   1 
ATOM   1675 O O   . LEU A 1 228 ? -26.402 -24.223 -12.344 1.00 61.16  ? 525 LEU A O   1 
ATOM   1676 C CB  . LEU A 1 228 ? -23.379 -23.750 -11.104 1.00 47.06  ? 525 LEU A CB  1 
ATOM   1677 C CG  . LEU A 1 228 ? -22.664 -24.420 -9.931  1.00 47.88  ? 525 LEU A CG  1 
ATOM   1678 C CD1 . LEU A 1 228 ? -22.169 -23.387 -8.927  1.00 48.29  ? 525 LEU A CD1 1 
ATOM   1679 C CD2 . LEU A 1 228 ? -23.579 -25.432 -9.255  1.00 48.64  ? 525 LEU A CD2 1 
ATOM   1680 N N   . TYR A 1 229 ? -25.002 -23.261 -13.806 1.00 63.87  ? 526 TYR A N   1 
ATOM   1681 C CA  . TYR A 1 229 ? -26.122 -22.680 -14.548 1.00 71.22  ? 526 TYR A CA  1 
ATOM   1682 C C   . TYR A 1 229 ? -26.768 -23.669 -15.520 1.00 72.91  ? 526 TYR A C   1 
ATOM   1683 O O   . TYR A 1 229 ? -27.553 -23.284 -16.386 1.00 77.91  ? 526 TYR A O   1 
ATOM   1684 C CB  . TYR A 1 229 ? -25.788 -21.328 -15.209 1.00 74.82  ? 526 TYR A CB  1 
ATOM   1685 C CG  . TYR A 1 229 ? -24.551 -21.260 -16.084 1.00 76.75  ? 526 TYR A CG  1 
ATOM   1686 C CD1 . TYR A 1 229 ? -23.458 -20.485 -15.709 1.00 75.22  ? 526 TYR A CD1 1 
ATOM   1687 C CD2 . TYR A 1 229 ? -24.490 -21.928 -17.301 1.00 80.36  ? 526 TYR A CD2 1 
ATOM   1688 C CE1 . TYR A 1 229 ? -22.330 -20.397 -16.507 1.00 74.15  ? 526 TYR A CE1 1 
ATOM   1689 C CE2 . TYR A 1 229 ? -23.363 -21.846 -18.108 1.00 80.49  ? 526 TYR A CE2 1 
ATOM   1690 C CZ  . TYR A 1 229 ? -22.287 -21.078 -17.705 1.00 77.33  ? 526 TYR A CZ  1 
ATOM   1691 O OH  . TYR A 1 229 ? -21.166 -20.993 -18.499 1.00 76.16  ? 526 TYR A OH  1 
ATOM   1692 N N   . SER A 1 230 ? -26.443 -24.948 -15.348 1.00 70.64  ? 527 SER A N   1 
ATOM   1693 C CA  . SER A 1 230 ? -27.106 -26.022 -16.077 1.00 70.84  ? 527 SER A CA  1 
ATOM   1694 C C   . SER A 1 230 ? -28.204 -26.671 -15.233 1.00 74.83  ? 527 SER A C   1 
ATOM   1695 O O   . SER A 1 230 ? -29.232 -27.082 -15.765 1.00 76.48  ? 527 SER A O   1 
ATOM   1696 C CB  . SER A 1 230 ? -26.098 -27.079 -16.530 1.00 65.98  ? 527 SER A CB  1 
ATOM   1697 O OG  . SER A 1 230 ? -26.528 -28.378 -16.165 1.00 65.99  ? 527 SER A OG  1 
ATOM   1698 N N   . MET A 1 231 ? -27.988 -26.766 -13.923 1.00 78.00  ? 528 MET A N   1 
ATOM   1699 C CA  . MET A 1 231 ? -28.986 -27.374 -13.039 1.00 80.80  ? 528 MET A CA  1 
ATOM   1700 C C   . MET A 1 231 ? -29.946 -26.345 -12.468 1.00 80.18  ? 528 MET A C   1 
ATOM   1701 O O   . MET A 1 231 ? -30.833 -26.678 -11.682 1.00 82.31  ? 528 MET A O   1 
ATOM   1702 C CB  . MET A 1 231 ? -28.338 -28.159 -11.906 1.00 80.96  ? 528 MET A CB  1 
ATOM   1703 C CG  . MET A 1 231 ? -27.670 -27.306 -10.852 1.00 79.22  ? 528 MET A CG  1 
ATOM   1704 S SD  . MET A 1 231 ? -26.251 -28.215 -10.249 1.00 132.08 ? 528 MET A SD  1 
ATOM   1705 C CE  . MET A 1 231 ? -25.671 -28.835 -11.819 1.00 86.95  ? 528 MET A CE  1 
ATOM   1706 N N   . LYS A 1 232 ? -29.759 -25.091 -12.860 1.00 103.31 ? 529 LYS A N   1 
ATOM   1707 C CA  . LYS A 1 232 ? -30.793 -24.093 -12.659 1.00 104.25 ? 529 LYS A CA  1 
ATOM   1708 C C   . LYS A 1 232 ? -31.887 -24.430 -13.665 1.00 111.42 ? 529 LYS A C   1 
ATOM   1709 O O   . LYS A 1 232 ? -33.042 -24.029 -13.512 1.00 115.68 ? 529 LYS A O   1 
ATOM   1710 C CB  . LYS A 1 232 ? -30.247 -22.686 -12.889 1.00 98.64  ? 529 LYS A CB  1 
ATOM   1711 N N   . CYS A 1 233 ? -31.500 -25.180 -14.696 1.00 112.05 ? 530 CYS A N   1 
ATOM   1712 C CA  . CYS A 1 233 ? -32.436 -25.743 -15.660 1.00 116.68 ? 530 CYS A CA  1 
ATOM   1713 C C   . CYS A 1 233 ? -32.741 -27.186 -15.277 1.00 118.96 ? 530 CYS A C   1 
ATOM   1714 O O   . CYS A 1 233 ? -31.839 -28.025 -15.203 1.00 116.57 ? 530 CYS A O   1 
ATOM   1715 C CB  . CYS A 1 233 ? -31.847 -25.705 -17.070 1.00 116.30 ? 530 CYS A CB  1 
ATOM   1716 S SG  . CYS A 1 233 ? -30.582 -24.434 -17.336 1.00 146.56 ? 530 CYS A SG  1 
ATOM   1717 N N   . PRO A 1 238 ? -31.854 -26.414 -6.119  1.00 102.88 ? 535 PRO A N   1 
ATOM   1718 C CA  . PRO A 1 238 ? -32.644 -25.467 -5.323  1.00 102.86 ? 535 PRO A CA  1 
ATOM   1719 C C   . PRO A 1 238 ? -32.118 -24.035 -5.438  1.00 96.51  ? 535 PRO A C   1 
ATOM   1720 O O   . PRO A 1 238 ? -32.829 -23.195 -5.988  1.00 98.14  ? 535 PRO A O   1 
ATOM   1721 C CB  . PRO A 1 238 ? -32.480 -26.001 -3.901  1.00 101.75 ? 535 PRO A CB  1 
ATOM   1722 C CG  . PRO A 1 238 ? -32.340 -27.474 -4.095  1.00 103.89 ? 535 PRO A CG  1 
ATOM   1723 C CD  . PRO A 1 238 ? -31.544 -27.642 -5.365  1.00 102.82 ? 535 PRO A CD  1 
ATOM   1724 N N   . LEU A 1 239 ? -30.914 -23.778 -4.924  1.00 89.81  ? 536 LEU A N   1 
ATOM   1725 C CA  . LEU A 1 239 ? -30.223 -22.488 -5.073  1.00 84.46  ? 536 LEU A CA  1 
ATOM   1726 C C   . LEU A 1 239 ? -30.914 -21.298 -4.383  1.00 84.16  ? 536 LEU A C   1 
ATOM   1727 O O   . LEU A 1 239 ? -32.089 -21.014 -4.627  1.00 90.04  ? 536 LEU A O   1 
ATOM   1728 C CB  . LEU A 1 239 ? -29.953 -22.171 -6.557  1.00 83.87  ? 536 LEU A CB  1 
ATOM   1729 C CG  . LEU A 1 239 ? -29.300 -23.282 -7.396  1.00 84.80  ? 536 LEU A CG  1 
ATOM   1730 C CD1 . LEU A 1 239 ? -29.052 -22.834 -8.834  1.00 83.38  ? 536 LEU A CD1 1 
ATOM   1731 C CD2 . LEU A 1 239 ? -28.004 -23.776 -6.769  1.00 81.75  ? 536 LEU A CD2 1 
ATOM   1732 N N   . SER A 1 240 ? -30.171 -20.603 -3.524  1.00 75.76  ? 537 SER A N   1 
ATOM   1733 C CA  . SER A 1 240 ? -30.679 -19.402 -2.868  1.00 73.14  ? 537 SER A CA  1 
ATOM   1734 C C   . SER A 1 240 ? -30.726 -18.245 -3.861  1.00 73.17  ? 537 SER A C   1 
ATOM   1735 O O   . SER A 1 240 ? -30.115 -18.312 -4.927  1.00 71.34  ? 537 SER A O   1 
ATOM   1736 C CB  . SER A 1 240 ? -29.802 -19.029 -1.673  1.00 68.07  ? 537 SER A CB  1 
ATOM   1737 O OG  . SER A 1 240 ? -28.490 -18.689 -2.091  1.00 62.95  ? 537 SER A OG  1 
ATOM   1738 N N   . ASP A 1 241 ? -31.449 -17.186 -3.506  1.00 73.37  ? 538 ASP A N   1 
ATOM   1739 C CA  . ASP A 1 241 ? -31.581 -16.020 -4.377  1.00 71.56  ? 538 ASP A CA  1 
ATOM   1740 C C   . ASP A 1 241 ? -30.244 -15.326 -4.628  1.00 64.05  ? 538 ASP A C   1 
ATOM   1741 O O   . ASP A 1 241 ? -30.015 -14.788 -5.710  1.00 62.06  ? 538 ASP A O   1 
ATOM   1742 C CB  . ASP A 1 241 ? -32.592 -15.022 -3.803  1.00 75.33  ? 538 ASP A CB  1 
ATOM   1743 C CG  . ASP A 1 241 ? -34.031 -15.411 -4.099  1.00 82.94  ? 538 ASP A CG  1 
ATOM   1744 O OD1 . ASP A 1 241 ? -34.289 -16.604 -4.361  1.00 86.72  ? 538 ASP A OD1 1 
ATOM   1745 O OD2 . ASP A 1 241 ? -34.908 -14.521 -4.067  1.00 84.12  ? 538 ASP A OD2 1 
ATOM   1746 N N   . LEU A 1 242 ? -29.369 -15.337 -3.627  1.00 56.68  ? 539 LEU A N   1 
ATOM   1747 C CA  . LEU A 1 242 ? -28.051 -14.726 -3.756  1.00 51.70  ? 539 LEU A CA  1 
ATOM   1748 C C   . LEU A 1 242 ? -27.219 -15.461 -4.802  1.00 57.15  ? 539 LEU A C   1 
ATOM   1749 O O   . LEU A 1 242 ? -26.596 -14.837 -5.664  1.00 50.03  ? 539 LEU A O   1 
ATOM   1750 C CB  . LEU A 1 242 ? -27.323 -14.707 -2.410  1.00 48.67  ? 539 LEU A CB  1 
ATOM   1751 C CG  . LEU A 1 242 ? -25.880 -14.190 -2.419  1.00 43.62  ? 539 LEU A CG  1 
ATOM   1752 C CD1 . LEU A 1 242 ? -25.800 -12.773 -2.970  1.00 42.72  ? 539 LEU A CD1 1 
ATOM   1753 C CD2 . LEU A 1 242 ? -25.269 -14.258 -1.027  1.00 45.45  ? 539 LEU A CD2 1 
ATOM   1754 N N   . LEU A 1 243 ? -27.222 -16.788 -4.728  1.00 60.24  ? 540 LEU A N   1 
ATOM   1755 C CA  . LEU A 1 243 ? -26.517 -17.607 -5.708  1.00 59.87  ? 540 LEU A CA  1 
ATOM   1756 C C   . LEU A 1 243 ? -27.081 -17.410 -7.105  1.00 62.72  ? 540 LEU A C   1 
ATOM   1757 O O   . LEU A 1 243 ? -26.328 -17.260 -8.065  1.00 63.86  ? 540 LEU A O   1 
ATOM   1758 C CB  . LEU A 1 243 ? -26.581 -19.086 -5.334  1.00 62.18  ? 540 LEU A CB  1 
ATOM   1759 C CG  . LEU A 1 243 ? -25.373 -19.629 -4.575  1.00 61.57  ? 540 LEU A CG  1 
ATOM   1760 C CD1 . LEU A 1 243 ? -25.298 -19.023 -3.192  1.00 63.24  ? 540 LEU A CD1 1 
ATOM   1761 C CD2 . LEU A 1 243 ? -25.450 -21.133 -4.488  1.00 64.53  ? 540 LEU A CD2 1 
ATOM   1762 N N   . LEU A 1 244 ? -28.407 -17.413 -7.211  1.00 65.37  ? 541 LEU A N   1 
ATOM   1763 C CA  . LEU A 1 244 ? -29.073 -17.215 -8.492  1.00 67.16  ? 541 LEU A CA  1 
ATOM   1764 C C   . LEU A 1 244 ? -28.623 -15.920 -9.154  1.00 64.99  ? 541 LEU A C   1 
ATOM   1765 O O   . LEU A 1 244 ? -28.504 -15.850 -10.376 1.00 67.96  ? 541 LEU A O   1 
ATOM   1766 C CB  . LEU A 1 244 ? -30.593 -17.227 -8.323  1.00 71.04  ? 541 LEU A CB  1 
ATOM   1767 C CG  . LEU A 1 244 ? -31.215 -18.600 -8.067  1.00 74.53  ? 541 LEU A CG  1 
ATOM   1768 C CD1 . LEU A 1 244 ? -32.726 -18.491 -7.950  1.00 79.87  ? 541 LEU A CD1 1 
ATOM   1769 C CD2 . LEU A 1 244 ? -30.825 -19.578 -9.167  1.00 74.49  ? 541 LEU A CD2 1 
ATOM   1770 N N   . GLU A 1 245 ? -28.362 -14.902 -8.341  1.00 60.25  ? 542 GLU A N   1 
ATOM   1771 C CA  . GLU A 1 245 ? -27.856 -13.634 -8.850  1.00 58.74  ? 542 GLU A CA  1 
ATOM   1772 C C   . GLU A 1 245 ? -26.361 -13.722 -9.157  1.00 53.26  ? 542 GLU A C   1 
ATOM   1773 O O   . GLU A 1 245 ? -25.897 -13.175 -10.153 1.00 48.22  ? 542 GLU A O   1 
ATOM   1774 C CB  . GLU A 1 245 ? -28.155 -12.495 -7.869  1.00 58.39  ? 542 GLU A CB  1 
ATOM   1775 C CG  . GLU A 1 245 ? -29.645 -12.235 -7.670  1.00 65.71  ? 542 GLU A CG  1 
ATOM   1776 C CD  . GLU A 1 245 ? -29.931 -10.971 -6.878  1.00 67.61  ? 542 GLU A CD  1 
ATOM   1777 O OE1 . GLU A 1 245 ? -29.012 -10.473 -6.194  1.00 66.00  ? 542 GLU A OE1 1 
ATOM   1778 O OE2 . GLU A 1 245 ? -31.076 -10.471 -6.947  1.00 69.13  ? 542 GLU A OE2 1 
ATOM   1779 N N   . MET A 1 246 ? -25.616 -14.421 -8.303  1.00 52.85  ? 543 MET A N   1 
ATOM   1780 C CA  . MET A 1 246 ? -24.194 -14.666 -8.538  1.00 51.72  ? 543 MET A CA  1 
ATOM   1781 C C   . MET A 1 246 ? -23.993 -15.462 -9.823  1.00 53.65  ? 543 MET A C   1 
ATOM   1782 O O   . MET A 1 246 ? -23.081 -15.189 -10.604 1.00 51.68  ? 543 MET A O   1 
ATOM   1783 C CB  . MET A 1 246 ? -23.573 -15.446 -7.373  1.00 51.68  ? 543 MET A CB  1 
ATOM   1784 C CG  . MET A 1 246 ? -23.527 -14.713 -6.039  1.00 49.84  ? 543 MET A CG  1 
ATOM   1785 S SD  . MET A 1 246 ? -22.620 -13.160 -6.096  1.00 51.96  ? 543 MET A SD  1 
ATOM   1786 C CE  . MET A 1 246 ? -22.302 -12.887 -4.357  1.00 74.61  ? 543 MET A CE  1 
ATOM   1787 N N   . LEU A 1 247 ? -24.854 -16.453 -10.027 1.00 58.33  ? 544 LEU A N   1 
ATOM   1788 C CA  . LEU A 1 247 ? -24.764 -17.338 -11.179 1.00 63.44  ? 544 LEU A CA  1 
ATOM   1789 C C   . LEU A 1 247 ? -25.189 -16.618 -12.456 1.00 65.52  ? 544 LEU A C   1 
ATOM   1790 O O   . LEU A 1 247 ? -24.621 -16.843 -13.524 1.00 65.80  ? 544 LEU A O   1 
ATOM   1791 C CB  . LEU A 1 247 ? -25.634 -18.576 -10.950 1.00 69.50  ? 544 LEU A CB  1 
ATOM   1792 C CG  . LEU A 1 247 ? -25.377 -19.806 -11.817 1.00 74.28  ? 544 LEU A CG  1 
ATOM   1793 C CD1 . LEU A 1 247 ? -23.934 -20.252 -11.678 1.00 72.18  ? 544 LEU A CD1 1 
ATOM   1794 C CD2 . LEU A 1 247 ? -26.328 -20.925 -11.424 1.00 78.31  ? 544 LEU A CD2 1 
ATOM   1795 N N   . ASP A 1 248 ? -26.187 -15.749 -12.333 1.00 69.52  ? 545 ASP A N   1 
ATOM   1796 C CA  . ASP A 1 248 ? -26.714 -15.002 -13.471 1.00 74.61  ? 545 ASP A CA  1 
ATOM   1797 C C   . ASP A 1 248 ? -25.692 -14.017 -14.022 1.00 71.82  ? 545 ASP A C   1 
ATOM   1798 O O   . ASP A 1 248 ? -25.730 -13.664 -15.201 1.00 73.78  ? 545 ASP A O   1 
ATOM   1799 C CB  . ASP A 1 248 ? -27.986 -14.255 -13.071 1.00 79.85  ? 545 ASP A CB  1 
ATOM   1800 C CG  . ASP A 1 248 ? -29.153 -14.567 -13.980 1.00 88.47  ? 545 ASP A CG  1 
ATOM   1801 O OD1 . ASP A 1 248 ? -29.275 -13.914 -15.038 1.00 90.74  ? 545 ASP A OD1 1 
ATOM   1802 O OD2 . ASP A 1 248 ? -29.947 -15.467 -13.636 1.00 93.27  ? 545 ASP A OD2 1 
ATOM   1803 N N   . ALA A 1 249 ? -24.783 -13.573 -13.160 1.00 67.49  ? 546 ALA A N   1 
ATOM   1804 C CA  . ALA A 1 249 ? -23.715 -12.668 -13.564 1.00 64.78  ? 546 ALA A CA  1 
ATOM   1805 C C   . ALA A 1 249 ? -22.791 -13.325 -14.586 1.00 66.78  ? 546 ALA A C   1 
ATOM   1806 O O   . ALA A 1 249 ? -22.130 -12.643 -15.368 1.00 67.62  ? 546 ALA A O   1 
ATOM   1807 C CB  . ALA A 1 249 ? -22.930 -12.202 -12.346 1.00 59.74  ? 546 ALA A CB  1 
ATOM   1808 N N   . HIS A 1 250 ? -22.753 -14.653 -14.574 1.00 69.70  ? 547 HIS A N   1 
ATOM   1809 C CA  . HIS A 1 250 ? -21.981 -15.410 -15.555 1.00 70.40  ? 547 HIS A CA  1 
ATOM   1810 C C   . HIS A 1 250 ? -22.874 -15.908 -16.692 1.00 79.69  ? 547 HIS A C   1 
ATOM   1811 O O   . HIS A 1 250 ? -22.815 -17.085 -17.065 1.00 83.54  ? 547 HIS A O   1 
ATOM   1812 C CB  . HIS A 1 250 ? -21.269 -16.589 -14.882 1.00 64.24  ? 547 HIS A CB  1 
ATOM   1813 C CG  . HIS A 1 250 ? -20.060 -16.197 -14.085 1.00 57.96  ? 547 HIS A CG  1 
ATOM   1814 N ND1 . HIS A 1 250 ? -18.776 -16.478 -14.499 1.00 54.90  ? 547 HIS A ND1 1 
ATOM   1815 C CD2 . HIS A 1 250 ? -19.937 -15.546 -12.903 1.00 56.40  ? 547 HIS A CD2 1 
ATOM   1816 C CE1 . HIS A 1 250 ? -17.915 -16.023 -13.607 1.00 51.59  ? 547 HIS A CE1 1 
ATOM   1817 N NE2 . HIS A 1 250 ? -18.594 -15.452 -12.628 1.00 52.20  ? 547 HIS A NE2 1 
ATOM   1818 N N   . ARG A 1 251 ? -23.697 -15.010 -17.236 1.00 83.82  ? 548 ARG A N   1 
ATOM   1819 C CA  . ARG A 1 251 ? -24.579 -15.338 -18.358 1.00 87.48  ? 548 ARG A CA  1 
ATOM   1820 C C   . ARG A 1 251 ? -24.837 -14.119 -19.240 1.00 89.40  ? 548 ARG A C   1 
ATOM   1821 O O   . ARG A 1 251 ? -25.242 -14.243 -20.398 1.00 95.09  ? 548 ARG A O   1 
ATOM   1822 C CB  . ARG A 1 251 ? -25.908 -15.907 -17.861 1.00 90.75  ? 548 ARG A CB  1 
ATOM   1823 N N   . LEU B 1 9   ? 18.412  -32.215 -22.018 1.00 91.38  ? 306 LEU B N   1 
ATOM   1824 C CA  . LEU B 1 9   ? 18.984  -31.358 -23.051 1.00 92.75  ? 306 LEU B CA  1 
ATOM   1825 C C   . LEU B 1 9   ? 18.361  -29.964 -23.033 1.00 88.47  ? 306 LEU B C   1 
ATOM   1826 O O   . LEU B 1 9   ? 19.045  -28.966 -23.263 1.00 89.12  ? 306 LEU B O   1 
ATOM   1827 C CB  . LEU B 1 9   ? 18.813  -31.993 -24.432 1.00 94.17  ? 306 LEU B CB  1 
ATOM   1828 N N   . ALA B 1 10  ? 17.061  -29.903 -22.757 1.00 83.27  ? 307 ALA B N   1 
ATOM   1829 C CA  . ALA B 1 10  ? 16.347  -28.633 -22.686 1.00 76.41  ? 307 ALA B CA  1 
ATOM   1830 C C   . ALA B 1 10  ? 16.708  -27.872 -21.415 1.00 76.22  ? 307 ALA B C   1 
ATOM   1831 O O   . ALA B 1 10  ? 16.544  -26.654 -21.339 1.00 73.42  ? 307 ALA B O   1 
ATOM   1832 C CB  . ALA B 1 10  ? 14.847  -28.867 -22.753 1.00 71.19  ? 307 ALA B CB  1 
ATOM   1833 N N   . LEU B 1 11  ? 17.198  -28.601 -20.419 1.00 78.37  ? 308 LEU B N   1 
ATOM   1834 C CA  . LEU B 1 11  ? 17.578  -28.003 -19.146 1.00 77.67  ? 308 LEU B CA  1 
ATOM   1835 C C   . LEU B 1 11  ? 19.008  -27.474 -19.197 1.00 80.36  ? 308 LEU B C   1 
ATOM   1836 O O   . LEU B 1 11  ? 19.446  -26.756 -18.299 1.00 81.29  ? 308 LEU B O   1 
ATOM   1837 C CB  . LEU B 1 11  ? 17.425  -29.013 -18.003 1.00 80.26  ? 308 LEU B CB  1 
ATOM   1838 C CG  . LEU B 1 11  ? 16.015  -29.311 -17.479 1.00 80.03  ? 308 LEU B CG  1 
ATOM   1839 C CD1 . LEU B 1 11  ? 15.179  -30.103 -18.479 1.00 79.89  ? 308 LEU B CD1 1 
ATOM   1840 C CD2 . LEU B 1 11  ? 16.084  -30.041 -16.144 1.00 83.64  ? 308 LEU B CD2 1 
ATOM   1841 N N   . SER B 1 12  ? 19.729  -27.832 -20.255 1.00 82.08  ? 309 SER B N   1 
ATOM   1842 C CA  . SER B 1 12  ? 21.111  -27.395 -20.429 1.00 84.91  ? 309 SER B CA  1 
ATOM   1843 C C   . SER B 1 12  ? 21.182  -26.105 -21.237 1.00 81.02  ? 309 SER B C   1 
ATOM   1844 O O   . SER B 1 12  ? 22.267  -25.596 -21.523 1.00 80.61  ? 309 SER B O   1 
ATOM   1845 C CB  . SER B 1 12  ? 21.937  -28.488 -21.108 1.00 89.02  ? 309 SER B CB  1 
ATOM   1846 O OG  . SER B 1 12  ? 21.950  -29.672 -20.331 1.00 92.57  ? 309 SER B OG  1 
ATOM   1847 N N   . LEU B 1 13  ? 20.017  -25.583 -21.605 1.00 78.17  ? 310 LEU B N   1 
ATOM   1848 C CA  . LEU B 1 13  ? 19.935  -24.340 -22.362 1.00 75.79  ? 310 LEU B CA  1 
ATOM   1849 C C   . LEU B 1 13  ? 20.007  -23.127 -21.447 1.00 74.05  ? 310 LEU B C   1 
ATOM   1850 O O   . LEU B 1 13  ? 19.279  -23.038 -20.459 1.00 74.33  ? 310 LEU B O   1 
ATOM   1851 C CB  . LEU B 1 13  ? 18.637  -24.290 -23.170 1.00 71.44  ? 310 LEU B CB  1 
ATOM   1852 C CG  . LEU B 1 13  ? 18.567  -25.165 -24.421 1.00 72.67  ? 310 LEU B CG  1 
ATOM   1853 C CD1 . LEU B 1 13  ? 17.199  -25.051 -25.074 1.00 69.94  ? 310 LEU B CD1 1 
ATOM   1854 C CD2 . LEU B 1 13  ? 19.663  -24.772 -25.394 1.00 73.19  ? 310 LEU B CD2 1 
ATOM   1855 N N   . THR B 1 14  ? 20.885  -22.190 -21.783 1.00 72.76  ? 311 THR B N   1 
ATOM   1856 C CA  . THR B 1 14  ? 20.956  -20.934 -21.056 1.00 70.73  ? 311 THR B CA  1 
ATOM   1857 C C   . THR B 1 14  ? 19.760  -20.066 -21.431 1.00 67.28  ? 311 THR B C   1 
ATOM   1858 O O   . THR B 1 14  ? 18.950  -20.446 -22.279 1.00 66.51  ? 311 THR B O   1 
ATOM   1859 C CB  . THR B 1 14  ? 22.249  -20.173 -21.374 1.00 71.89  ? 311 THR B CB  1 
ATOM   1860 O OG1 . THR B 1 14  ? 22.223  -19.738 -22.738 1.00 70.96  ? 311 THR B OG1 1 
ATOM   1861 C CG2 . THR B 1 14  ? 23.459  -21.067 -21.149 1.00 74.94  ? 311 THR B CG2 1 
ATOM   1862 N N   . ALA B 1 15  ? 19.652  -18.902 -20.800 1.00 64.14  ? 312 ALA B N   1 
ATOM   1863 C CA  . ALA B 1 15  ? 18.539  -17.997 -21.057 1.00 57.30  ? 312 ALA B CA  1 
ATOM   1864 C C   . ALA B 1 15  ? 18.508  -17.529 -22.513 1.00 55.73  ? 312 ALA B C   1 
ATOM   1865 O O   . ALA B 1 15  ? 17.467  -17.588 -23.169 1.00 52.46  ? 312 ALA B O   1 
ATOM   1866 C CB  . ALA B 1 15  ? 18.595  -16.810 -20.115 1.00 55.26  ? 312 ALA B CB  1 
ATOM   1867 N N   . ASP B 1 16  ? 19.652  -17.073 -23.014 1.00 56.67  ? 313 ASP B N   1 
ATOM   1868 C CA  . ASP B 1 16  ? 19.741  -16.581 -24.387 1.00 60.14  ? 313 ASP B CA  1 
ATOM   1869 C C   . ASP B 1 16  ? 19.418  -17.667 -25.411 1.00 57.69  ? 313 ASP B C   1 
ATOM   1870 O O   . ASP B 1 16  ? 18.677  -17.431 -26.364 1.00 54.08  ? 313 ASP B O   1 
ATOM   1871 C CB  . ASP B 1 16  ? 21.122  -15.978 -24.660 1.00 66.60  ? 313 ASP B CB  1 
ATOM   1872 C CG  . ASP B 1 16  ? 21.315  -14.636 -23.981 1.00 72.24  ? 313 ASP B CG  1 
ATOM   1873 O OD1 . ASP B 1 16  ? 20.507  -14.299 -23.089 1.00 73.15  ? 313 ASP B OD1 1 
ATOM   1874 O OD2 . ASP B 1 16  ? 22.275  -13.919 -24.335 1.00 75.89  ? 313 ASP B OD2 1 
ATOM   1875 N N   . GLN B 1 17  ? 19.970  -18.858 -25.204 1.00 60.53  ? 314 GLN B N   1 
ATOM   1876 C CA  . GLN B 1 17  ? 19.709  -19.985 -26.092 1.00 59.82  ? 314 GLN B CA  1 
ATOM   1877 C C   . GLN B 1 17  ? 18.235  -20.376 -26.076 1.00 58.29  ? 314 GLN B C   1 
ATOM   1878 O O   . GLN B 1 17  ? 17.692  -20.810 -27.091 1.00 58.48  ? 314 GLN B O   1 
ATOM   1879 C CB  . GLN B 1 17  ? 20.580  -21.180 -25.711 1.00 63.58  ? 314 GLN B CB  1 
ATOM   1880 C CG  . GLN B 1 17  ? 22.068  -20.917 -25.842 1.00 69.46  ? 314 GLN B CG  1 
ATOM   1881 C CD  . GLN B 1 17  ? 22.904  -22.140 -25.535 1.00 77.50  ? 314 GLN B CD  1 
ATOM   1882 O OE1 . GLN B 1 17  ? 22.505  -22.998 -24.748 1.00 78.71  ? 314 GLN B OE1 1 
ATOM   1883 N NE2 . GLN B 1 17  ? 24.071  -22.232 -26.162 1.00 84.31  ? 314 GLN B NE2 1 
ATOM   1884 N N   . MET B 1 18  ? 17.595  -20.220 -24.921 1.00 55.19  ? 315 MET B N   1 
ATOM   1885 C CA  . MET B 1 18  ? 16.164  -20.467 -24.801 1.00 50.08  ? 315 MET B CA  1 
ATOM   1886 C C   . MET B 1 18  ? 15.375  -19.478 -25.652 1.00 47.88  ? 315 MET B C   1 
ATOM   1887 O O   . MET B 1 18  ? 14.452  -19.863 -26.370 1.00 42.75  ? 315 MET B O   1 
ATOM   1888 C CB  . MET B 1 18  ? 15.718  -20.358 -23.343 1.00 49.45  ? 315 MET B CB  1 
ATOM   1889 C CG  . MET B 1 18  ? 14.207  -20.343 -23.161 1.00 45.97  ? 315 MET B CG  1 
ATOM   1890 S SD  . MET B 1 18  ? 13.458  -21.972 -23.347 1.00 75.84  ? 315 MET B SD  1 
ATOM   1891 C CE  . MET B 1 18  ? 14.030  -22.778 -21.852 1.00 45.61  ? 315 MET B CE  1 
ATOM   1892 N N   . VAL B 1 19  ? 15.746  -18.204 -25.562 1.00 52.93  ? 316 VAL B N   1 
ATOM   1893 C CA  . VAL B 1 19  ? 15.074  -17.144 -26.306 1.00 54.46  ? 316 VAL B CA  1 
ATOM   1894 C C   . VAL B 1 19  ? 15.192  -17.348 -27.813 1.00 56.63  ? 316 VAL B C   1 
ATOM   1895 O O   . VAL B 1 19  ? 14.192  -17.314 -28.532 1.00 54.72  ? 316 VAL B O   1 
ATOM   1896 C CB  . VAL B 1 19  ? 15.635  -15.752 -25.946 1.00 55.77  ? 316 VAL B CB  1 
ATOM   1897 C CG1 . VAL B 1 19  ? 14.990  -14.678 -26.808 1.00 54.23  ? 316 VAL B CG1 1 
ATOM   1898 C CG2 . VAL B 1 19  ? 15.410  -15.453 -24.476 1.00 54.35  ? 316 VAL B CG2 1 
ATOM   1899 N N   . SER B 1 20  ? 16.415  -17.563 -28.286 1.00 58.65  ? 317 SER B N   1 
ATOM   1900 C CA  . SER B 1 20  ? 16.651  -17.743 -29.714 1.00 63.32  ? 317 SER B CA  1 
ATOM   1901 C C   . SER B 1 20  ? 15.929  -18.980 -30.239 1.00 61.19  ? 317 SER B C   1 
ATOM   1902 O O   . SER B 1 20  ? 15.444  -18.993 -31.370 1.00 60.40  ? 317 SER B O   1 
ATOM   1903 C CB  . SER B 1 20  ? 18.150  -17.825 -30.018 1.00 69.59  ? 317 SER B CB  1 
ATOM   1904 O OG  . SER B 1 20  ? 18.730  -18.991 -29.460 1.00 74.17  ? 317 SER B OG  1 
ATOM   1905 N N   . ALA B 1 21  ? 15.850  -20.013 -29.406 1.00 57.62  ? 318 ALA B N   1 
ATOM   1906 C CA  . ALA B 1 21  ? 15.152  -21.237 -29.777 1.00 54.06  ? 318 ALA B CA  1 
ATOM   1907 C C   . ALA B 1 21  ? 13.668  -20.966 -30.001 1.00 48.61  ? 318 ALA B C   1 
ATOM   1908 O O   . ALA B 1 21  ? 13.100  -21.373 -31.014 1.00 47.59  ? 318 ALA B O   1 
ATOM   1909 C CB  . ALA B 1 21  ? 15.343  -22.302 -28.710 1.00 53.91  ? 318 ALA B CB  1 
ATOM   1910 N N   . LEU B 1 22  ? 13.049  -20.271 -29.052 1.00 47.41  ? 319 LEU B N   1 
ATOM   1911 C CA  . LEU B 1 22  ? 11.628  -19.948 -29.136 1.00 44.18  ? 319 LEU B CA  1 
ATOM   1912 C C   . LEU B 1 22  ? 11.330  -18.999 -30.293 1.00 45.38  ? 319 LEU B C   1 
ATOM   1913 O O   . LEU B 1 22  ? 10.315  -19.139 -30.972 1.00 46.17  ? 319 LEU B O   1 
ATOM   1914 C CB  . LEU B 1 22  ? 11.133  -19.349 -27.820 1.00 39.77  ? 319 LEU B CB  1 
ATOM   1915 C CG  . LEU B 1 22  ? 11.171  -20.285 -26.610 1.00 40.50  ? 319 LEU B CG  1 
ATOM   1916 C CD1 . LEU B 1 22  ? 10.599  -19.597 -25.382 1.00 38.15  ? 319 LEU B CD1 1 
ATOM   1917 C CD2 . LEU B 1 22  ? 10.422  -21.574 -26.905 1.00 38.93  ? 319 LEU B CD2 1 
ATOM   1918 N N   . LEU B 1 23  ? 12.221  -18.037 -30.514 1.00 46.79  ? 320 LEU B N   1 
ATOM   1919 C CA  . LEU B 1 23  ? 12.065  -17.090 -31.612 1.00 47.71  ? 320 LEU B CA  1 
ATOM   1920 C C   . LEU B 1 23  ? 12.145  -17.778 -32.972 1.00 50.90  ? 320 LEU B C   1 
ATOM   1921 O O   . LEU B 1 23  ? 11.336  -17.506 -33.855 1.00 50.37  ? 320 LEU B O   1 
ATOM   1922 C CB  . LEU B 1 23  ? 13.111  -15.976 -31.521 1.00 49.54  ? 320 LEU B CB  1 
ATOM   1923 C CG  . LEU B 1 23  ? 12.935  -14.987 -30.366 1.00 48.32  ? 320 LEU B CG  1 
ATOM   1924 C CD1 . LEU B 1 23  ? 14.070  -13.976 -30.353 1.00 50.93  ? 320 LEU B CD1 1 
ATOM   1925 C CD2 . LEU B 1 23  ? 11.586  -14.287 -30.454 1.00 42.66  ? 320 LEU B CD2 1 
ATOM   1926 N N   . ASP B 1 24  ? 13.115  -18.674 -33.132 1.00 54.85  ? 321 ASP B N   1 
ATOM   1927 C CA  . ASP B 1 24  ? 13.298  -19.384 -34.397 1.00 57.59  ? 321 ASP B CA  1 
ATOM   1928 C C   . ASP B 1 24  ? 12.133  -20.318 -34.716 1.00 54.14  ? 321 ASP B C   1 
ATOM   1929 O O   . ASP B 1 24  ? 11.876  -20.627 -35.880 1.00 53.09  ? 321 ASP B O   1 
ATOM   1930 C CB  . ASP B 1 24  ? 14.607  -20.177 -34.392 1.00 66.26  ? 321 ASP B CB  1 
ATOM   1931 C CG  . ASP B 1 24  ? 15.830  -19.284 -34.392 1.00 75.49  ? 321 ASP B CG  1 
ATOM   1932 O OD1 . ASP B 1 24  ? 15.739  -18.150 -34.907 1.00 78.94  ? 321 ASP B OD1 1 
ATOM   1933 O OD2 . ASP B 1 24  ? 16.883  -19.718 -33.880 1.00 80.21  ? 321 ASP B OD2 1 
ATOM   1934 N N   . ALA B 1 25  ? 11.432  -20.766 -33.680 1.00 49.71  ? 322 ALA B N   1 
ATOM   1935 C CA  . ALA B 1 25  ? 10.338  -21.716 -33.853 1.00 49.09  ? 322 ALA B CA  1 
ATOM   1936 C C   . ALA B 1 25  ? 9.009   -21.014 -34.105 1.00 44.57  ? 322 ALA B C   1 
ATOM   1937 O O   . ALA B 1 25  ? 7.982   -21.662 -34.302 1.00 44.63  ? 322 ALA B O   1 
ATOM   1938 C CB  . ALA B 1 25  ? 10.232  -22.614 -32.637 1.00 52.34  ? 322 ALA B CB  1 
ATOM   1939 N N   . GLU B 1 26  ? 9.034   -19.686 -34.097 1.00 41.14  ? 323 GLU B N   1 
ATOM   1940 C CA  . GLU B 1 26  ? 7.814   -18.899 -34.217 1.00 38.28  ? 323 GLU B CA  1 
ATOM   1941 C C   . GLU B 1 26  ? 7.106   -19.130 -35.553 1.00 37.93  ? 323 GLU B C   1 
ATOM   1942 O O   . GLU B 1 26  ? 7.712   -18.998 -36.612 1.00 43.08  ? 323 GLU B O   1 
ATOM   1943 C CB  . GLU B 1 26  ? 8.126   -17.412 -34.020 1.00 37.84  ? 323 GLU B CB  1 
ATOM   1944 C CG  . GLU B 1 26  ? 6.909   -16.507 -33.920 1.00 37.61  ? 323 GLU B CG  1 
ATOM   1945 C CD  . GLU B 1 26  ? 6.198   -16.598 -32.576 1.00 37.56  ? 323 GLU B CD  1 
ATOM   1946 O OE1 . GLU B 1 26  ? 6.527   -17.489 -31.761 1.00 32.74  ? 323 GLU B OE1 1 
ATOM   1947 O OE2 . GLU B 1 26  ? 5.299   -15.767 -32.337 1.00 38.51  ? 323 GLU B OE2 1 
ATOM   1948 N N   . PRO B 1 27  ? 5.816   -19.488 -35.499 1.00 36.33  ? 324 PRO B N   1 
ATOM   1949 C CA  . PRO B 1 27  ? 5.017   -19.707 -36.707 1.00 37.86  ? 324 PRO B CA  1 
ATOM   1950 C C   . PRO B 1 27  ? 4.755   -18.389 -37.429 1.00 39.47  ? 324 PRO B C   1 
ATOM   1951 O O   . PRO B 1 27  ? 4.821   -17.337 -36.803 1.00 41.94  ? 324 PRO B O   1 
ATOM   1952 C CB  . PRO B 1 27  ? 3.709   -20.276 -36.153 1.00 36.37  ? 324 PRO B CB  1 
ATOM   1953 C CG  . PRO B 1 27  ? 3.605   -19.693 -34.785 1.00 35.15  ? 324 PRO B CG  1 
ATOM   1954 C CD  . PRO B 1 27  ? 5.016   -19.650 -34.271 1.00 35.39  ? 324 PRO B CD  1 
ATOM   1955 N N   . PRO B 1 28  ? 4.473   -18.441 -38.740 1.00 43.55  ? 325 PRO B N   1 
ATOM   1956 C CA  . PRO B 1 28  ? 4.188   -17.228 -39.515 1.00 40.41  ? 325 PRO B CA  1 
ATOM   1957 C C   . PRO B 1 28  ? 2.794   -16.673 -39.245 1.00 39.81  ? 325 PRO B C   1 
ATOM   1958 O O   . PRO B 1 28  ? 1.977   -17.341 -38.611 1.00 39.80  ? 325 PRO B O   1 
ATOM   1959 C CB  . PRO B 1 28  ? 4.259   -17.723 -40.954 1.00 42.28  ? 325 PRO B CB  1 
ATOM   1960 C CG  . PRO B 1 28  ? 3.896   -19.160 -40.871 1.00 43.52  ? 325 PRO B CG  1 
ATOM   1961 C CD  . PRO B 1 28  ? 4.498   -19.643 -39.592 1.00 42.90  ? 325 PRO B CD  1 
ATOM   1962 N N   . ILE B 1 29  ? 2.535   -15.457 -39.717 1.00 43.02  ? 326 ILE B N   1 
ATOM   1963 C CA  . ILE B 1 29  ? 1.196   -14.878 -39.644 1.00 46.43  ? 326 ILE B CA  1 
ATOM   1964 C C   . ILE B 1 29  ? 0.430   -15.253 -40.907 1.00 44.98  ? 326 ILE B C   1 
ATOM   1965 O O   . ILE B 1 29  ? 0.768   -14.807 -42.003 1.00 49.50  ? 326 ILE B O   1 
ATOM   1966 C CB  . ILE B 1 29  ? 1.234   -13.338 -39.512 1.00 51.24  ? 326 ILE B CB  1 
ATOM   1967 C CG1 . ILE B 1 29  ? 2.070   -12.920 -38.301 1.00 50.09  ? 326 ILE B CG1 1 
ATOM   1968 C CG2 . ILE B 1 29  ? -0.176  -12.775 -39.402 1.00 51.89  ? 326 ILE B CG2 1 
ATOM   1969 C CD1 . ILE B 1 29  ? 1.573   -13.492 -37.000 1.00 48.09  ? 326 ILE B CD1 1 
ATOM   1970 N N   . LEU B 1 30  ? -0.596  -16.081 -40.751 1.00 37.79  ? 327 LEU B N   1 
ATOM   1971 C CA  . LEU B 1 30  ? -1.346  -16.585 -41.894 1.00 36.47  ? 327 LEU B CA  1 
ATOM   1972 C C   . LEU B 1 30  ? -2.439  -15.614 -42.327 1.00 39.98  ? 327 LEU B C   1 
ATOM   1973 O O   . LEU B 1 30  ? -2.968  -14.855 -41.515 1.00 37.80  ? 327 LEU B O   1 
ATOM   1974 C CB  . LEU B 1 30  ? -1.954  -17.951 -41.569 1.00 36.11  ? 327 LEU B CB  1 
ATOM   1975 C CG  . LEU B 1 30  ? -0.972  -18.999 -41.040 1.00 36.44  ? 327 LEU B CG  1 
ATOM   1976 C CD1 . LEU B 1 30  ? -1.663  -20.338 -40.841 1.00 34.83  ? 327 LEU B CD1 1 
ATOM   1977 C CD2 . LEU B 1 30  ? 0.218   -19.135 -41.982 1.00 36.55  ? 327 LEU B CD2 1 
ATOM   1978 N N   . TYR B 1 31  ? -2.769  -15.644 -43.613 1.00 43.77  ? 328 TYR B N   1 
ATOM   1979 C CA  . TYR B 1 31  ? -3.847  -14.822 -44.146 1.00 43.95  ? 328 TYR B CA  1 
ATOM   1980 C C   . TYR B 1 31  ? -5.164  -15.579 -44.082 1.00 47.49  ? 328 TYR B C   1 
ATOM   1981 O O   . TYR B 1 31  ? -5.182  -16.808 -44.121 1.00 51.28  ? 328 TYR B O   1 
ATOM   1982 C CB  . TYR B 1 31  ? -3.548  -14.415 -45.591 1.00 44.11  ? 328 TYR B CB  1 
ATOM   1983 C CG  . TYR B 1 31  ? -2.640  -13.213 -45.714 1.00 42.47  ? 328 TYR B CG  1 
ATOM   1984 C CD1 . TYR B 1 31  ? -1.296  -13.295 -45.374 1.00 42.29  ? 328 TYR B CD1 1 
ATOM   1985 C CD2 . TYR B 1 31  ? -3.128  -11.996 -46.170 1.00 46.32  ? 328 TYR B CD2 1 
ATOM   1986 C CE1 . TYR B 1 31  ? -0.465  -12.198 -45.482 1.00 44.39  ? 328 TYR B CE1 1 
ATOM   1987 C CE2 . TYR B 1 31  ? -2.305  -10.895 -46.286 1.00 48.19  ? 328 TYR B CE2 1 
ATOM   1988 C CZ  . TYR B 1 31  ? -0.974  -11.000 -45.939 1.00 49.91  ? 328 TYR B CZ  1 
ATOM   1989 O OH  . TYR B 1 31  ? -0.151  -9.902  -46.052 1.00 55.35  ? 328 TYR B OH  1 
ATOM   1990 N N   . SER B 1 32  ? -6.266  -14.845 -43.971 1.00 47.49  ? 329 SER B N   1 
ATOM   1991 C CA  . SER B 1 32  ? -7.588  -15.450 -44.053 1.00 47.59  ? 329 SER B CA  1 
ATOM   1992 C C   . SER B 1 32  ? -8.021  -15.499 -45.514 1.00 50.10  ? 329 SER B C   1 
ATOM   1993 O O   . SER B 1 32  ? -7.313  -15.009 -46.394 1.00 50.17  ? 329 SER B O   1 
ATOM   1994 C CB  . SER B 1 32  ? -8.603  -14.656 -43.229 1.00 45.02  ? 329 SER B CB  1 
ATOM   1995 O OG  . SER B 1 32  ? -8.804  -13.363 -43.771 1.00 46.31  ? 329 SER B OG  1 
ATOM   1996 N N   . GLU B 1 33  ? -9.179  -16.095 -45.773 1.00 52.50  ? 330 GLU B N   1 
ATOM   1997 C CA  . GLU B 1 33  ? -9.724  -16.130 -47.125 1.00 61.89  ? 330 GLU B CA  1 
ATOM   1998 C C   . GLU B 1 33  ? -10.806 -15.069 -47.271 1.00 62.67  ? 330 GLU B C   1 
ATOM   1999 O O   . GLU B 1 33  ? -11.768 -15.240 -48.017 1.00 68.48  ? 330 GLU B O   1 
ATOM   2000 C CB  . GLU B 1 33  ? -10.272 -17.521 -47.451 1.00 69.14  ? 330 GLU B CB  1 
ATOM   2001 C CG  . GLU B 1 33  ? -9.206  -18.607 -47.432 1.00 73.34  ? 330 GLU B CG  1 
ATOM   2002 C CD  . GLU B 1 33  ? -9.786  -20.007 -47.488 1.00 78.03  ? 330 GLU B CD  1 
ATOM   2003 O OE1 . GLU B 1 33  ? -11.028 -20.142 -47.490 1.00 78.59  ? 330 GLU B OE1 1 
ATOM   2004 O OE2 . GLU B 1 33  ? -8.994  -20.973 -47.528 1.00 81.31  ? 330 GLU B OE2 1 
ATOM   2005 N N   . TYR B 1 34  ? -10.627 -13.971 -46.542 1.00 57.92  ? 331 TYR B N   1 
ATOM   2006 C CA  . TYR B 1 34  ? -11.560 -12.851 -46.548 1.00 56.50  ? 331 TYR B CA  1 
ATOM   2007 C C   . TYR B 1 34  ? -11.739 -12.261 -47.940 1.00 60.78  ? 331 TYR B C   1 
ATOM   2008 O O   . TYR B 1 34  ? -10.770 -11.867 -48.587 1.00 55.58  ? 331 TYR B O   1 
ATOM   2009 C CB  . TYR B 1 34  ? -11.078 -11.763 -45.583 1.00 53.36  ? 331 TYR B CB  1 
ATOM   2010 C CG  . TYR B 1 34  ? -11.929 -10.512 -45.568 1.00 54.84  ? 331 TYR B CG  1 
ATOM   2011 C CD1 . TYR B 1 34  ? -13.221 -10.533 -45.062 1.00 58.83  ? 331 TYR B CD1 1 
ATOM   2012 C CD2 . TYR B 1 34  ? -11.432 -9.305  -46.040 1.00 59.27  ? 331 TYR B CD2 1 
ATOM   2013 C CE1 . TYR B 1 34  ? -14.002 -9.391  -45.039 1.00 61.84  ? 331 TYR B CE1 1 
ATOM   2014 C CE2 . TYR B 1 34  ? -12.205 -8.156  -46.022 1.00 65.40  ? 331 TYR B CE2 1 
ATOM   2015 C CZ  . TYR B 1 34  ? -13.489 -8.206  -45.519 1.00 65.65  ? 331 TYR B CZ  1 
ATOM   2016 O OH  . TYR B 1 34  ? -14.262 -7.066  -45.498 1.00 69.19  ? 331 TYR B OH  1 
ATOM   2017 N N   . ASP B 1 35  ? -12.988 -12.210 -48.389 1.00 65.05  ? 332 ASP B N   1 
ATOM   2018 C CA  . ASP B 1 35  ? -13.334 -11.583 -49.656 1.00 69.88  ? 332 ASP B CA  1 
ATOM   2019 C C   . ASP B 1 35  ? -14.067 -10.275 -49.374 1.00 72.23  ? 332 ASP B C   1 
ATOM   2020 O O   . ASP B 1 35  ? -15.236 -10.287 -48.992 1.00 72.85  ? 332 ASP B O   1 
ATOM   2021 C CB  . ASP B 1 35  ? -14.220 -12.521 -50.479 1.00 75.91  ? 332 ASP B CB  1 
ATOM   2022 C CG  . ASP B 1 35  ? -14.313 -12.114 -51.941 1.00 81.47  ? 332 ASP B CG  1 
ATOM   2023 O OD1 . ASP B 1 35  ? -14.133 -10.917 -52.253 1.00 82.15  ? 332 ASP B OD1 1 
ATOM   2024 O OD2 . ASP B 1 35  ? -14.574 -12.999 -52.781 1.00 85.05  ? 332 ASP B OD2 1 
ATOM   2025 N N   . PRO B 1 36  ? -13.381 -9.137  -49.572 1.00 76.60  ? 333 PRO B N   1 
ATOM   2026 C CA  . PRO B 1 36  ? -13.926 -7.802  -49.290 1.00 79.22  ? 333 PRO B CA  1 
ATOM   2027 C C   . PRO B 1 36  ? -15.130 -7.442  -50.162 1.00 83.15  ? 333 PRO B C   1 
ATOM   2028 O O   . PRO B 1 36  ? -15.786 -6.429  -49.914 1.00 83.55  ? 333 PRO B O   1 
ATOM   2029 C CB  . PRO B 1 36  ? -12.751 -6.872  -49.608 1.00 81.00  ? 333 PRO B CB  1 
ATOM   2030 C CG  . PRO B 1 36  ? -11.920 -7.637  -50.579 1.00 81.01  ? 333 PRO B CG  1 
ATOM   2031 C CD  . PRO B 1 36  ? -12.021 -9.065  -50.134 1.00 77.85  ? 333 PRO B CD  1 
ATOM   2032 N N   . THR B 1 37  ? -15.411 -8.257  -51.172 1.00 84.75  ? 334 THR B N   1 
ATOM   2033 C CA  . THR B 1 37  ? -16.578 -8.045  -52.015 1.00 89.00  ? 334 THR B CA  1 
ATOM   2034 C C   . THR B 1 37  ? -17.776 -8.801  -51.455 1.00 89.67  ? 334 THR B C   1 
ATOM   2035 O O   . THR B 1 37  ? -18.899 -8.293  -51.452 1.00 93.30  ? 334 THR B O   1 
ATOM   2036 C CB  . THR B 1 37  ? -16.324 -8.516  -53.454 1.00 92.86  ? 334 THR B CB  1 
ATOM   2037 O OG1 . THR B 1 37  ? -16.404 -9.945  -53.515 1.00 91.60  ? 334 THR B OG1 1 
ATOM   2038 C CG2 . THR B 1 37  ? -14.951 -8.064  -53.924 1.00 93.14  ? 334 THR B CG2 1 
ATOM   2039 N N   . ARG B 1 38  ? -17.528 -10.019 -50.982 1.00 85.39  ? 335 ARG B N   1 
ATOM   2040 C CA  . ARG B 1 38  ? -18.582 -10.863 -50.431 1.00 84.00  ? 335 ARG B CA  1 
ATOM   2041 C C   . ARG B 1 38  ? -19.137 -10.290 -49.131 1.00 82.20  ? 335 ARG B C   1 
ATOM   2042 O O   . ARG B 1 38  ? -18.379 -9.993  -48.206 1.00 76.79  ? 335 ARG B O   1 
ATOM   2043 C CB  . ARG B 1 38  ? -18.067 -12.285 -50.197 1.00 79.52  ? 335 ARG B CB  1 
ATOM   2044 N N   . PRO B 1 39  ? -20.469 -10.128 -49.065 1.00 87.02  ? 336 PRO B N   1 
ATOM   2045 C CA  . PRO B 1 39  ? -21.138 -9.573  -47.883 1.00 87.16  ? 336 PRO B CA  1 
ATOM   2046 C C   . PRO B 1 39  ? -20.948 -10.452 -46.649 1.00 85.42  ? 336 PRO B C   1 
ATOM   2047 O O   . PRO B 1 39  ? -20.896 -11.682 -46.758 1.00 83.76  ? 336 PRO B O   1 
ATOM   2048 C CB  . PRO B 1 39  ? -22.613 -9.543  -48.297 1.00 91.49  ? 336 PRO B CB  1 
ATOM   2049 C CG  . PRO B 1 39  ? -22.728 -10.553 -49.391 1.00 93.52  ? 336 PRO B CG  1 
ATOM   2050 C CD  . PRO B 1 39  ? -21.427 -10.482 -50.129 1.00 92.13  ? 336 PRO B CD  1 
ATOM   2051 N N   . PHE B 1 40  ? -20.848 -9.817  -45.486 1.00 85.97  ? 337 PHE B N   1 
ATOM   2052 C CA  . PHE B 1 40  ? -20.609 -10.542 -44.245 1.00 84.13  ? 337 PHE B CA  1 
ATOM   2053 C C   . PHE B 1 40  ? -21.848 -11.294 -43.776 1.00 84.52  ? 337 PHE B C   1 
ATOM   2054 O O   . PHE B 1 40  ? -22.982 -10.862 -43.994 1.00 85.58  ? 337 PHE B O   1 
ATOM   2055 C CB  . PHE B 1 40  ? -20.122 -9.593  -43.149 1.00 83.39  ? 337 PHE B CB  1 
ATOM   2056 N N   . SER B 1 41  ? -21.613 -12.432 -43.134 1.00 81.62  ? 338 SER B N   1 
ATOM   2057 C CA  . SER B 1 41  ? -22.674 -13.207 -42.514 1.00 81.26  ? 338 SER B CA  1 
ATOM   2058 C C   . SER B 1 41  ? -22.087 -13.958 -41.326 1.00 77.26  ? 338 SER B C   1 
ATOM   2059 O O   . SER B 1 41  ? -20.877 -14.195 -41.276 1.00 73.91  ? 338 SER B O   1 
ATOM   2060 C CB  . SER B 1 41  ? -23.310 -14.173 -43.516 1.00 84.40  ? 338 SER B CB  1 
ATOM   2061 O OG  . SER B 1 41  ? -22.434 -15.220 -43.862 1.00 83.24  ? 338 SER B OG  1 
ATOM   2062 N N   . GLU B 1 42  ? -22.937 -14.309 -40.365 1.00 87.94  ? 339 GLU B N   1 
ATOM   2063 C CA  . GLU B 1 42  ? -22.492 -15.006 -39.163 1.00 83.45  ? 339 GLU B CA  1 
ATOM   2064 C C   . GLU B 1 42  ? -21.770 -16.301 -39.518 1.00 79.25  ? 339 GLU B C   1 
ATOM   2065 O O   . GLU B 1 42  ? -20.728 -16.622 -38.947 1.00 75.06  ? 339 GLU B O   1 
ATOM   2066 C CB  . GLU B 1 42  ? -23.685 -15.304 -38.255 1.00 89.88  ? 339 GLU B CB  1 
ATOM   2067 C CG  . GLU B 1 42  ? -23.334 -16.070 -36.991 1.00 88.75  ? 339 GLU B CG  1 
ATOM   2068 C CD  . GLU B 1 42  ? -24.540 -16.318 -36.108 1.00 96.01  ? 339 GLU B CD  1 
ATOM   2069 O OE1 . GLU B 1 42  ? -25.544 -16.870 -36.608 1.00 102.51 ? 339 GLU B OE1 1 
ATOM   2070 O OE2 . GLU B 1 42  ? -24.488 -15.952 -34.915 1.00 95.82  ? 339 GLU B OE2 1 
ATOM   2071 N N   . ALA B 1 43  ? -22.329 -17.031 -40.477 1.00 82.07  ? 340 ALA B N   1 
ATOM   2072 C CA  . ALA B 1 43  ? -21.762 -18.303 -40.900 1.00 81.88  ? 340 ALA B CA  1 
ATOM   2073 C C   . ALA B 1 43  ? -20.419 -18.126 -41.604 1.00 79.28  ? 340 ALA B C   1 
ATOM   2074 O O   . ALA B 1 43  ? -19.517 -18.946 -41.440 1.00 78.81  ? 340 ALA B O   1 
ATOM   2075 C CB  . ALA B 1 43  ? -22.741 -19.045 -41.797 1.00 87.58  ? 340 ALA B CB  1 
ATOM   2076 N N   . SER B 1 44  ? -20.286 -17.051 -42.378 1.00 76.51  ? 341 SER B N   1 
ATOM   2077 C CA  . SER B 1 44  ? -19.072 -16.827 -43.159 1.00 69.95  ? 341 SER B CA  1 
ATOM   2078 C C   . SER B 1 44  ? -17.896 -16.362 -42.303 1.00 64.79  ? 341 SER B C   1 
ATOM   2079 O O   . SER B 1 44  ? -16.783 -16.862 -42.459 1.00 62.05  ? 341 SER B O   1 
ATOM   2080 C CB  . SER B 1 44  ? -19.322 -15.844 -44.309 1.00 67.87  ? 341 SER B CB  1 
ATOM   2081 O OG  . SER B 1 44  ? -19.619 -14.546 -43.827 1.00 65.69  ? 341 SER B OG  1 
ATOM   2082 N N   . MET B 1 45  ? -18.138 -15.410 -41.405 1.00 64.13  ? 342 MET B N   1 
ATOM   2083 C CA  . MET B 1 45  ? -17.067 -14.905 -40.548 1.00 59.31  ? 342 MET B CA  1 
ATOM   2084 C C   . MET B 1 45  ? -16.542 -15.985 -39.614 1.00 57.29  ? 342 MET B C   1 
ATOM   2085 O O   . MET B 1 45  ? -15.331 -16.137 -39.447 1.00 56.48  ? 342 MET B O   1 
ATOM   2086 C CB  . MET B 1 45  ? -17.508 -13.686 -39.738 1.00 59.73  ? 342 MET B CB  1 
ATOM   2087 C CG  . MET B 1 45  ? -16.416 -13.187 -38.801 1.00 55.97  ? 342 MET B CG  1 
ATOM   2088 S SD  . MET B 1 45  ? -16.576 -11.459 -38.326 1.00 137.11 ? 342 MET B SD  1 
ATOM   2089 C CE  . MET B 1 45  ? -17.956 -11.549 -37.197 1.00 57.91  ? 342 MET B CE  1 
ATOM   2090 N N   . MET B 1 46  ? -17.456 -16.730 -39.001 1.00 55.47  ? 343 MET B N   1 
ATOM   2091 C CA  . MET B 1 46  ? -17.062 -17.872 -38.190 1.00 53.44  ? 343 MET B CA  1 
ATOM   2092 C C   . MET B 1 46  ? -16.354 -18.897 -39.066 1.00 55.25  ? 343 MET B C   1 
ATOM   2093 O O   . MET B 1 46  ? -15.405 -19.547 -38.628 1.00 53.64  ? 343 MET B O   1 
ATOM   2094 C CB  . MET B 1 46  ? -18.271 -18.492 -37.486 1.00 55.24  ? 343 MET B CB  1 
ATOM   2095 C CG  . MET B 1 46  ? -18.767 -17.676 -36.300 1.00 54.04  ? 343 MET B CG  1 
ATOM   2096 S SD  . MET B 1 46  ? -17.449 -17.315 -35.114 1.00 59.94  ? 343 MET B SD  1 
ATOM   2097 C CE  . MET B 1 46  ? -16.985 -18.971 -34.613 1.00 44.88  ? 343 MET B CE  1 
ATOM   2098 N N   . GLY B 1 47  ? -16.809 -19.018 -40.311 1.00 56.28  ? 344 GLY B N   1 
ATOM   2099 C CA  . GLY B 1 47  ? -16.160 -19.877 -41.284 1.00 51.72  ? 344 GLY B CA  1 
ATOM   2100 C C   . GLY B 1 47  ? -14.749 -19.408 -41.590 1.00 52.04  ? 344 GLY B C   1 
ATOM   2101 O O   . GLY B 1 47  ? -13.830 -20.219 -41.700 1.00 50.33  ? 344 GLY B O   1 
ATOM   2102 N N   . LEU B 1 48  ? -14.578 -18.095 -41.728 1.00 46.81  ? 345 LEU B N   1 
ATOM   2103 C CA  . LEU B 1 48  ? -13.256 -17.511 -41.941 1.00 46.27  ? 345 LEU B CA  1 
ATOM   2104 C C   . LEU B 1 48  ? -12.341 -17.798 -40.754 1.00 45.05  ? 345 LEU B C   1 
ATOM   2105 O O   . LEU B 1 48  ? -11.192 -18.207 -40.927 1.00 44.87  ? 345 LEU B O   1 
ATOM   2106 C CB  . LEU B 1 48  ? -13.357 -15.999 -42.155 1.00 44.78  ? 345 LEU B CB  1 
ATOM   2107 C CG  . LEU B 1 48  ? -14.029 -15.494 -43.432 1.00 53.56  ? 345 LEU B CG  1 
ATOM   2108 C CD1 . LEU B 1 48  ? -14.161 -13.981 -43.390 1.00 55.68  ? 345 LEU B CD1 1 
ATOM   2109 C CD2 . LEU B 1 48  ? -13.253 -15.933 -44.666 1.00 55.54  ? 345 LEU B CD2 1 
ATOM   2110 N N   . LEU B 1 49  ? -12.856 -17.583 -39.548 1.00 43.02  ? 346 LEU B N   1 
ATOM   2111 C CA  . LEU B 1 49  ? -12.078 -17.822 -38.339 1.00 42.08  ? 346 LEU B CA  1 
ATOM   2112 C C   . LEU B 1 49  ? -11.778 -19.310 -38.163 1.00 41.08  ? 346 LEU B C   1 
ATOM   2113 O O   . LEU B 1 49  ? -10.661 -19.684 -37.802 1.00 37.08  ? 346 LEU B O   1 
ATOM   2114 C CB  . LEU B 1 49  ? -12.800 -17.259 -37.112 1.00 41.83  ? 346 LEU B CB  1 
ATOM   2115 C CG  . LEU B 1 49  ? -13.062 -15.751 -37.138 1.00 39.37  ? 346 LEU B CG  1 
ATOM   2116 C CD1 . LEU B 1 49  ? -13.714 -15.290 -35.844 1.00 38.26  ? 346 LEU B CD1 1 
ATOM   2117 C CD2 . LEU B 1 49  ? -11.774 -14.987 -37.396 1.00 37.34  ? 346 LEU B CD2 1 
ATOM   2118 N N   . THR B 1 50  ? -12.772 -20.153 -38.434 1.00 44.60  ? 347 THR B N   1 
ATOM   2119 C CA  . THR B 1 50  ? -12.591 -21.602 -38.382 1.00 45.02  ? 347 THR B CA  1 
ATOM   2120 C C   . THR B 1 50  ? -11.542 -22.072 -39.395 1.00 43.92  ? 347 THR B C   1 
ATOM   2121 O O   . THR B 1 50  ? -10.663 -22.868 -39.060 1.00 43.87  ? 347 THR B O   1 
ATOM   2122 C CB  . THR B 1 50  ? -13.920 -22.350 -38.620 1.00 47.71  ? 347 THR B CB  1 
ATOM   2123 O OG1 . THR B 1 50  ? -14.815 -22.095 -37.530 1.00 46.07  ? 347 THR B OG1 1 
ATOM   2124 C CG2 . THR B 1 50  ? -13.687 -23.849 -38.724 1.00 49.37  ? 347 THR B CG2 1 
ATOM   2125 N N   . ASN B 1 51  ? -11.635 -21.573 -40.626 1.00 46.07  ? 348 ASN B N   1 
ATOM   2126 C CA  . ASN B 1 51  ? -10.672 -21.909 -41.672 1.00 47.61  ? 348 ASN B CA  1 
ATOM   2127 C C   . ASN B 1 51  ? -9.257  -21.481 -41.289 1.00 43.19  ? 348 ASN B C   1 
ATOM   2128 O O   . ASN B 1 51  ? -8.298  -22.232 -41.477 1.00 39.93  ? 348 ASN B O   1 
ATOM   2129 C CB  . ASN B 1 51  ? -11.078 -21.272 -43.003 1.00 56.17  ? 348 ASN B CB  1 
ATOM   2130 C CG  . ASN B 1 51  ? -10.118 -21.605 -44.133 1.00 68.16  ? 348 ASN B CG  1 
ATOM   2131 O OD1 . ASN B 1 51  ? -9.118  -20.910 -44.344 1.00 70.39  ? 348 ASN B OD1 1 
ATOM   2132 N ND2 . ASN B 1 51  ? -10.429 -22.664 -44.880 1.00 73.55  ? 348 ASN B ND2 1 
ATOM   2133 N N   . LEU B 1 52  ? -9.140  -20.272 -40.747 1.00 36.13  ? 349 LEU B N   1 
ATOM   2134 C CA  . LEU B 1 52  ? -7.854  -19.737 -40.317 1.00 37.13  ? 349 LEU B CA  1 
ATOM   2135 C C   . LEU B 1 52  ? -7.270  -20.539 -39.153 1.00 38.07  ? 349 LEU B C   1 
ATOM   2136 O O   . LEU B 1 52  ? -6.083  -20.869 -39.147 1.00 37.53  ? 349 LEU B O   1 
ATOM   2137 C CB  . LEU B 1 52  ? -8.006  -18.269 -39.916 1.00 35.18  ? 349 LEU B CB  1 
ATOM   2138 C CG  . LEU B 1 52  ? -6.760  -17.506 -39.458 1.00 34.70  ? 349 LEU B CG  1 
ATOM   2139 C CD1 . LEU B 1 52  ? -5.749  -17.378 -40.587 1.00 34.49  ? 349 LEU B CD1 1 
ATOM   2140 C CD2 . LEU B 1 52  ? -7.148  -16.134 -38.928 1.00 33.86  ? 349 LEU B CD2 1 
ATOM   2141 N N   . ALA B 1 53  ? -8.110  -20.852 -38.172 1.00 34.73  ? 350 ALA B N   1 
ATOM   2142 C CA  . ALA B 1 53  ? -7.656  -21.587 -36.999 1.00 36.71  ? 350 ALA B CA  1 
ATOM   2143 C C   . ALA B 1 53  ? -7.146  -22.968 -37.395 1.00 39.22  ? 350 ALA B C   1 
ATOM   2144 O O   . ALA B 1 53  ? -6.140  -23.444 -36.868 1.00 39.96  ? 350 ALA B O   1 
ATOM   2145 C CB  . ALA B 1 53  ? -8.776  -21.696 -35.963 1.00 30.57  ? 350 ALA B CB  1 
ATOM   2146 N N   . ASP B 1 54  ? -7.835  -23.604 -38.335 1.00 40.64  ? 351 ASP B N   1 
ATOM   2147 C CA  . ASP B 1 54  ? -7.452  -24.940 -38.768 1.00 41.50  ? 351 ASP B CA  1 
ATOM   2148 C C   . ASP B 1 54  ? -6.061  -24.966 -39.413 1.00 42.95  ? 351 ASP B C   1 
ATOM   2149 O O   . ASP B 1 54  ? -5.307  -25.919 -39.233 1.00 47.14  ? 351 ASP B O   1 
ATOM   2150 C CB  . ASP B 1 54  ? -8.497  -25.519 -39.716 1.00 48.71  ? 351 ASP B CB  1 
ATOM   2151 C CG  . ASP B 1 54  ? -8.126  -26.900 -40.207 1.00 56.12  ? 351 ASP B CG  1 
ATOM   2152 O OD1 . ASP B 1 54  ? -8.303  -27.866 -39.436 1.00 59.94  ? 351 ASP B OD1 1 
ATOM   2153 O OD2 . ASP B 1 54  ? -7.657  -27.021 -41.357 1.00 57.41  ? 351 ASP B OD2 1 
ATOM   2154 N N   . ARG B 1 55  ? -5.723  -23.916 -40.156 1.00 40.43  ? 352 ARG B N   1 
ATOM   2155 C CA  . ARG B 1 55  ? -4.401  -23.813 -40.766 1.00 41.50  ? 352 ARG B CA  1 
ATOM   2156 C C   . ARG B 1 55  ? -3.328  -23.426 -39.745 1.00 39.44  ? 352 ARG B C   1 
ATOM   2157 O O   . ARG B 1 55  ? -2.186  -23.879 -39.832 1.00 34.12  ? 352 ARG B O   1 
ATOM   2158 C CB  . ARG B 1 55  ? -4.421  -22.835 -41.947 1.00 44.25  ? 352 ARG B CB  1 
ATOM   2159 C CG  . ARG B 1 55  ? -4.952  -23.451 -43.236 1.00 50.27  ? 352 ARG B CG  1 
ATOM   2160 C CD  . ARG B 1 55  ? -5.616  -22.419 -44.133 1.00 53.46  ? 352 ARG B CD  1 
ATOM   2161 N NE  . ARG B 1 55  ? -4.753  -21.270 -44.376 1.00 57.62  ? 352 ARG B NE  1 
ATOM   2162 C CZ  . ARG B 1 55  ? -5.134  -20.005 -44.232 1.00 53.44  ? 352 ARG B CZ  1 
ATOM   2163 N NH1 . ARG B 1 55  ? -6.374  -19.720 -43.852 1.00 47.34  ? 352 ARG B NH1 1 
ATOM   2164 N NH2 . ARG B 1 55  ? -4.275  -19.025 -44.476 1.00 52.30  ? 352 ARG B NH2 1 
ATOM   2165 N N   . GLU B 1 56  ? -3.697  -22.597 -38.774 1.00 36.88  ? 353 GLU B N   1 
ATOM   2166 C CA  . GLU B 1 56  ? -2.772  -22.229 -37.707 1.00 36.95  ? 353 GLU B CA  1 
ATOM   2167 C C   . GLU B 1 56  ? -2.432  -23.428 -36.826 1.00 35.16  ? 353 GLU B C   1 
ATOM   2168 O O   . GLU B 1 56  ? -1.324  -23.524 -36.296 1.00 33.29  ? 353 GLU B O   1 
ATOM   2169 C CB  . GLU B 1 56  ? -3.351  -21.114 -36.844 1.00 37.10  ? 353 GLU B CB  1 
ATOM   2170 C CG  . GLU B 1 56  ? -3.402  -19.757 -37.511 1.00 36.25  ? 353 GLU B CG  1 
ATOM   2171 C CD  . GLU B 1 56  ? -3.926  -18.691 -36.569 1.00 39.64  ? 353 GLU B CD  1 
ATOM   2172 O OE1 . GLU B 1 56  ? -5.161  -18.584 -36.423 1.00 42.29  ? 353 GLU B OE1 1 
ATOM   2173 O OE2 . GLU B 1 56  ? -3.102  -17.973 -35.962 1.00 38.66  ? 353 GLU B OE2 1 
ATOM   2174 N N   . LEU B 1 57  ? -3.393  -24.334 -36.675 1.00 33.14  ? 354 LEU B N   1 
ATOM   2175 C CA  . LEU B 1 57  ? -3.205  -25.531 -35.865 1.00 33.07  ? 354 LEU B CA  1 
ATOM   2176 C C   . LEU B 1 57  ? -2.058  -26.391 -36.375 1.00 37.42  ? 354 LEU B C   1 
ATOM   2177 O O   . LEU B 1 57  ? -1.309  -26.965 -35.588 1.00 33.35  ? 354 LEU B O   1 
ATOM   2178 C CB  . LEU B 1 57  ? -4.487  -26.362 -35.822 1.00 36.53  ? 354 LEU B CB  1 
ATOM   2179 C CG  . LEU B 1 57  ? -5.471  -26.026 -34.705 1.00 36.87  ? 354 LEU B CG  1 
ATOM   2180 C CD1 . LEU B 1 57  ? -6.647  -26.984 -34.750 1.00 39.47  ? 354 LEU B CD1 1 
ATOM   2181 C CD2 . LEU B 1 57  ? -4.772  -26.091 -33.355 1.00 35.61  ? 354 LEU B CD2 1 
ATOM   2182 N N   . VAL B 1 58  ? -1.928  -26.480 -37.696 1.00 40.94  ? 355 VAL B N   1 
ATOM   2183 C CA  . VAL B 1 58  ? -0.863  -27.269 -38.297 1.00 43.50  ? 355 VAL B CA  1 
ATOM   2184 C C   . VAL B 1 58  ? 0.502   -26.682 -37.944 1.00 40.67  ? 355 VAL B C   1 
ATOM   2185 O O   . VAL B 1 58  ? 1.434   -27.411 -37.614 1.00 37.93  ? 355 VAL B O   1 
ATOM   2186 C CB  . VAL B 1 58  ? -1.020  -27.360 -39.826 1.00 48.35  ? 355 VAL B CB  1 
ATOM   2187 C CG1 . VAL B 1 58  ? 0.000   -28.326 -40.407 1.00 45.47  ? 355 VAL B CG1 1 
ATOM   2188 C CG2 . VAL B 1 58  ? -2.433  -27.800 -40.182 1.00 52.70  ? 355 VAL B CG2 1 
ATOM   2189 N N   . HIS B 1 59  ? 0.609   -25.360 -38.001 1.00 34.63  ? 356 HIS B N   1 
ATOM   2190 C CA  . HIS B 1 59  ? 1.845   -24.684 -37.618 1.00 38.41  ? 356 HIS B CA  1 
ATOM   2191 C C   . HIS B 1 59  ? 2.122   -24.811 -36.121 1.00 36.15  ? 356 HIS B C   1 
ATOM   2192 O O   . HIS B 1 59  ? 3.268   -24.997 -35.709 1.00 37.21  ? 356 HIS B O   1 
ATOM   2193 C CB  . HIS B 1 59  ? 1.808   -23.209 -38.030 1.00 33.12  ? 356 HIS B CB  1 
ATOM   2194 C CG  . HIS B 1 59  ? 1.957   -22.990 -39.505 1.00 36.24  ? 356 HIS B CG  1 
ATOM   2195 N ND1 . HIS B 1 59  ? 3.184   -22.840 -40.115 1.00 40.18  ? 356 HIS B ND1 1 
ATOM   2196 C CD2 . HIS B 1 59  ? 1.034   -22.901 -40.492 1.00 38.04  ? 356 HIS B CD2 1 
ATOM   2197 C CE1 . HIS B 1 59  ? 3.010   -22.663 -41.413 1.00 42.89  ? 356 HIS B CE1 1 
ATOM   2198 N NE2 . HIS B 1 59  ? 1.715   -22.697 -41.667 1.00 42.48  ? 356 HIS B NE2 1 
ATOM   2199 N N   . MET B 1 60  ? 1.070   -24.716 -35.314 1.00 34.66  ? 357 MET B N   1 
ATOM   2200 C CA  . MET B 1 60  ? 1.205   -24.770 -33.862 1.00 32.11  ? 357 MET B CA  1 
ATOM   2201 C C   . MET B 1 60  ? 1.761   -26.118 -33.400 1.00 36.72  ? 357 MET B C   1 
ATOM   2202 O O   . MET B 1 60  ? 2.595   -26.179 -32.495 1.00 38.51  ? 357 MET B O   1 
ATOM   2203 C CB  . MET B 1 60  ? -0.142  -24.495 -33.189 1.00 30.12  ? 357 MET B CB  1 
ATOM   2204 C CG  . MET B 1 60  ? -0.072  -24.407 -31.671 1.00 29.55  ? 357 MET B CG  1 
ATOM   2205 S SD  . MET B 1 60  ? -1.682  -24.634 -30.892 1.00 27.46  ? 357 MET B SD  1 
ATOM   2206 C CE  . MET B 1 60  ? -2.578  -23.224 -31.531 1.00 25.44  ? 357 MET B CE  1 
ATOM   2207 N N   . ILE B 1 61  ? 1.295   -27.192 -34.029 1.00 35.02  ? 358 ILE B N   1 
ATOM   2208 C CA  . ILE B 1 61  ? 1.757   -28.533 -33.700 1.00 40.40  ? 358 ILE B CA  1 
ATOM   2209 C C   . ILE B 1 61  ? 3.260   -28.672 -33.930 1.00 47.14  ? 358 ILE B C   1 
ATOM   2210 O O   . ILE B 1 61  ? 3.988   -29.153 -33.060 1.00 47.80  ? 358 ILE B O   1 
ATOM   2211 C CB  . ILE B 1 61  ? 1.002   -29.592 -34.517 1.00 45.62  ? 358 ILE B CB  1 
ATOM   2212 C CG1 . ILE B 1 61  ? -0.470  -29.617 -34.100 1.00 44.98  ? 358 ILE B CG1 1 
ATOM   2213 C CG2 . ILE B 1 61  ? 1.637   -30.962 -34.339 1.00 48.11  ? 358 ILE B CG2 1 
ATOM   2214 C CD1 . ILE B 1 61  ? -1.362  -30.360 -35.064 1.00 49.71  ? 358 ILE B CD1 1 
ATOM   2215 N N   . ASN B 1 62  ? 3.719   -28.236 -35.100 1.00 46.08  ? 359 ASN B N   1 
ATOM   2216 C CA  . ASN B 1 62  ? 5.142   -28.261 -35.413 1.00 48.26  ? 359 ASN B CA  1 
ATOM   2217 C C   . ASN B 1 62  ? 5.941   -27.260 -34.582 1.00 40.77  ? 359 ASN B C   1 
ATOM   2218 O O   . ASN B 1 62  ? 7.112   -27.486 -34.281 1.00 43.38  ? 359 ASN B O   1 
ATOM   2219 C CB  . ASN B 1 62  ? 5.371   -28.043 -36.909 1.00 54.93  ? 359 ASN B CB  1 
ATOM   2220 C CG  . ASN B 1 62  ? 4.977   -29.250 -37.735 1.00 61.40  ? 359 ASN B CG  1 
ATOM   2221 O OD1 . ASN B 1 62  ? 5.792   -30.139 -37.980 1.00 66.94  ? 359 ASN B OD1 1 
ATOM   2222 N ND2 . ASN B 1 62  ? 3.717   -29.295 -38.159 1.00 60.42  ? 359 ASN B ND2 1 
ATOM   2223 N N   . TRP B 1 63  ? 5.303   -26.155 -34.211 1.00 38.28  ? 360 TRP B N   1 
ATOM   2224 C CA  . TRP B 1 63  ? 5.907   -25.202 -33.285 1.00 38.39  ? 360 TRP B CA  1 
ATOM   2225 C C   . TRP B 1 63  ? 6.075   -25.835 -31.903 1.00 42.21  ? 360 TRP B C   1 
ATOM   2226 O O   . TRP B 1 63  ? 7.103   -25.649 -31.247 1.00 46.15  ? 360 TRP B O   1 
ATOM   2227 C CB  . TRP B 1 63  ? 5.059   -23.933 -33.190 1.00 33.96  ? 360 TRP B CB  1 
ATOM   2228 C CG  . TRP B 1 63  ? 5.311   -23.123 -31.953 1.00 39.25  ? 360 TRP B CG  1 
ATOM   2229 C CD1 . TRP B 1 63  ? 6.279   -22.179 -31.772 1.00 38.31  ? 360 TRP B CD1 1 
ATOM   2230 C CD2 . TRP B 1 63  ? 4.573   -23.182 -30.725 1.00 37.31  ? 360 TRP B CD2 1 
ATOM   2231 N NE1 . TRP B 1 63  ? 6.192   -21.648 -30.507 1.00 35.19  ? 360 TRP B NE1 1 
ATOM   2232 C CE2 . TRP B 1 63  ? 5.155   -22.249 -29.843 1.00 36.25  ? 360 TRP B CE2 1 
ATOM   2233 C CE3 . TRP B 1 63  ? 3.481   -23.937 -30.284 1.00 37.70  ? 360 TRP B CE3 1 
ATOM   2234 C CZ2 . TRP B 1 63  ? 4.680   -22.049 -28.545 1.00 34.99  ? 360 TRP B CZ2 1 
ATOM   2235 C CZ3 . TRP B 1 63  ? 3.011   -23.737 -28.996 1.00 34.94  ? 360 TRP B CZ3 1 
ATOM   2236 C CH2 . TRP B 1 63  ? 3.609   -22.799 -28.143 1.00 33.32  ? 360 TRP B CH2 1 
ATOM   2237 N N   . ALA B 1 64  ? 5.065   -26.587 -31.474 1.00 38.89  ? 361 ALA B N   1 
ATOM   2238 C CA  . ALA B 1 64  ? 5.100   -27.273 -30.183 1.00 38.15  ? 361 ALA B CA  1 
ATOM   2239 C C   . ALA B 1 64  ? 6.293   -28.219 -30.060 1.00 40.79  ? 361 ALA B C   1 
ATOM   2240 O O   . ALA B 1 64  ? 6.898   -28.322 -28.995 1.00 42.11  ? 361 ALA B O   1 
ATOM   2241 C CB  . ALA B 1 64  ? 3.799   -28.030 -29.945 1.00 36.26  ? 361 ALA B CB  1 
ATOM   2242 N N   . LYS B 1 65  ? 6.632   -28.900 -31.152 1.00 42.86  ? 362 LYS B N   1 
ATOM   2243 C CA  . LYS B 1 65  ? 7.750   -29.843 -31.152 1.00 46.93  ? 362 LYS B CA  1 
ATOM   2244 C C   . LYS B 1 65  ? 9.089   -29.145 -30.917 1.00 53.44  ? 362 LYS B C   1 
ATOM   2245 O O   . LYS B 1 65  ? 10.018  -29.737 -30.365 1.00 55.92  ? 362 LYS B O   1 
ATOM   2246 C CB  . LYS B 1 65  ? 7.806   -30.620 -32.470 1.00 49.09  ? 362 LYS B CB  1 
ATOM   2247 C CG  . LYS B 1 65  ? 6.542   -31.389 -32.807 1.00 54.35  ? 362 LYS B CG  1 
ATOM   2248 C CD  . LYS B 1 65  ? 6.720   -32.184 -34.098 1.00 56.43  ? 362 LYS B CD  1 
ATOM   2249 C CE  . LYS B 1 65  ? 5.481   -33.005 -34.415 1.00 55.56  ? 362 LYS B CE  1 
ATOM   2250 N NZ  . LYS B 1 65  ? 5.702   -33.963 -35.528 1.00 58.04  ? 362 LYS B NZ  1 
ATOM   2251 N N   . ARG B 1 66  ? 9.182   -27.887 -31.341 1.00 51.55  ? 363 ARG B N   1 
ATOM   2252 C CA  . ARG B 1 66  ? 10.422  -27.123 -31.227 1.00 55.84  ? 363 ARG B CA  1 
ATOM   2253 C C   . ARG B 1 66  ? 10.518  -26.343 -29.912 1.00 55.01  ? 363 ARG B C   1 
ATOM   2254 O O   . ARG B 1 66  ? 11.510  -25.658 -29.663 1.00 56.39  ? 363 ARG B O   1 
ATOM   2255 C CB  . ARG B 1 66  ? 10.582  -26.183 -32.424 1.00 58.11  ? 363 ARG B CB  1 
ATOM   2256 C CG  . ARG B 1 66  ? 10.813  -26.897 -33.752 1.00 64.08  ? 363 ARG B CG  1 
ATOM   2257 C CD  . ARG B 1 66  ? 10.526  -25.987 -34.938 1.00 67.45  ? 363 ARG B CD  1 
ATOM   2258 N NE  . ARG B 1 66  ? 11.377  -24.800 -34.951 1.00 72.56  ? 363 ARG B NE  1 
ATOM   2259 C CZ  . ARG B 1 66  ? 12.464  -24.664 -35.703 1.00 77.15  ? 363 ARG B CZ  1 
ATOM   2260 N NH1 . ARG B 1 66  ? 12.839  -25.645 -36.514 1.00 82.82  ? 363 ARG B NH1 1 
ATOM   2261 N NH2 . ARG B 1 66  ? 13.176  -23.547 -35.647 1.00 77.29  ? 363 ARG B NH2 1 
ATOM   2262 N N   . VAL B 1 67  ? 9.486   -26.444 -29.079 1.00 45.21  ? 364 VAL B N   1 
ATOM   2263 C CA  . VAL B 1 67  ? 9.524   -25.867 -27.738 1.00 44.11  ? 364 VAL B CA  1 
ATOM   2264 C C   . VAL B 1 67  ? 10.304  -26.804 -26.823 1.00 47.49  ? 364 VAL B C   1 
ATOM   2265 O O   . VAL B 1 67  ? 9.920   -27.959 -26.651 1.00 47.35  ? 364 VAL B O   1 
ATOM   2266 C CB  . VAL B 1 67  ? 8.108   -25.648 -27.167 1.00 42.86  ? 364 VAL B CB  1 
ATOM   2267 C CG1 . VAL B 1 67  ? 8.179   -25.248 -25.703 1.00 44.52  ? 364 VAL B CG1 1 
ATOM   2268 C CG2 . VAL B 1 67  ? 7.366   -24.593 -27.972 1.00 41.10  ? 364 VAL B CG2 1 
ATOM   2269 N N   . PRO B 1 68  ? 11.411  -26.308 -26.245 1.00 53.71  ? 365 PRO B N   1 
ATOM   2270 C CA  . PRO B 1 68  ? 12.348  -27.111 -25.447 1.00 58.95  ? 365 PRO B CA  1 
ATOM   2271 C C   . PRO B 1 68  ? 11.671  -27.915 -24.340 1.00 59.40  ? 365 PRO B C   1 
ATOM   2272 O O   . PRO B 1 68  ? 11.001  -27.345 -23.483 1.00 62.41  ? 365 PRO B O   1 
ATOM   2273 C CB  . PRO B 1 68  ? 13.276  -26.057 -24.837 1.00 59.66  ? 365 PRO B CB  1 
ATOM   2274 C CG  . PRO B 1 68  ? 13.242  -24.931 -25.807 1.00 58.54  ? 365 PRO B CG  1 
ATOM   2275 C CD  . PRO B 1 68  ? 11.837  -24.900 -26.339 1.00 54.29  ? 365 PRO B CD  1 
ATOM   2276 N N   . GLY B 1 69  ? 11.846  -29.231 -24.375 1.00 60.77  ? 366 GLY B N   1 
ATOM   2277 C CA  . GLY B 1 69  ? 11.305  -30.102 -23.349 1.00 63.44  ? 366 GLY B CA  1 
ATOM   2278 C C   . GLY B 1 69  ? 10.023  -30.798 -23.760 1.00 61.39  ? 366 GLY B C   1 
ATOM   2279 O O   . GLY B 1 69  ? 9.658   -31.826 -23.188 1.00 63.62  ? 366 GLY B O   1 
ATOM   2280 N N   . PHE B 1 70  ? 9.340   -30.244 -24.758 1.00 54.25  ? 367 PHE B N   1 
ATOM   2281 C CA  . PHE B 1 70  ? 8.050   -30.776 -25.188 1.00 52.39  ? 367 PHE B CA  1 
ATOM   2282 C C   . PHE B 1 70  ? 8.159   -32.160 -25.828 1.00 54.92  ? 367 PHE B C   1 
ATOM   2283 O O   . PHE B 1 70  ? 7.323   -33.031 -25.588 1.00 56.19  ? 367 PHE B O   1 
ATOM   2284 C CB  . PHE B 1 70  ? 7.357   -29.809 -26.151 1.00 48.09  ? 367 PHE B CB  1 
ATOM   2285 C CG  . PHE B 1 70  ? 5.953   -30.210 -26.507 1.00 45.39  ? 367 PHE B CG  1 
ATOM   2286 C CD1 . PHE B 1 70  ? 4.895   -29.884 -25.675 1.00 42.99  ? 367 PHE B CD1 1 
ATOM   2287 C CD2 . PHE B 1 70  ? 5.691   -30.916 -27.669 1.00 48.27  ? 367 PHE B CD2 1 
ATOM   2288 C CE1 . PHE B 1 70  ? 3.603   -30.254 -25.996 1.00 41.38  ? 367 PHE B CE1 1 
ATOM   2289 C CE2 . PHE B 1 70  ? 4.399   -31.288 -27.995 1.00 48.00  ? 367 PHE B CE2 1 
ATOM   2290 C CZ  . PHE B 1 70  ? 3.355   -30.956 -27.157 1.00 42.70  ? 367 PHE B CZ  1 
ATOM   2291 N N   . VAL B 1 71  ? 9.190   -32.356 -26.642 1.00 56.33  ? 368 VAL B N   1 
ATOM   2292 C CA  . VAL B 1 71  ? 9.362   -33.616 -27.356 1.00 59.05  ? 368 VAL B CA  1 
ATOM   2293 C C   . VAL B 1 71  ? 9.901   -34.712 -26.430 1.00 61.46  ? 368 VAL B C   1 
ATOM   2294 O O   . VAL B 1 71  ? 9.827   -35.902 -26.746 1.00 60.67  ? 368 VAL B O   1 
ATOM   2295 C CB  . VAL B 1 71  ? 10.262  -33.440 -28.606 1.00 64.44  ? 368 VAL B CB  1 
ATOM   2296 C CG1 . VAL B 1 71  ? 11.684  -33.909 -28.331 1.00 66.64  ? 368 VAL B CG1 1 
ATOM   2297 C CG2 . VAL B 1 71  ? 9.666   -34.174 -29.797 1.00 67.13  ? 368 VAL B CG2 1 
ATOM   2298 N N   . ASP B 1 72  ? 10.424  -34.301 -25.277 1.00 63.29  ? 369 ASP B N   1 
ATOM   2299 C CA  . ASP B 1 72  ? 10.875  -35.245 -24.257 1.00 65.70  ? 369 ASP B CA  1 
ATOM   2300 C C   . ASP B 1 72  ? 9.681   -35.950 -23.625 1.00 64.75  ? 369 ASP B C   1 
ATOM   2301 O O   . ASP B 1 72  ? 9.824   -37.002 -23.004 1.00 71.35  ? 369 ASP B O   1 
ATOM   2302 C CB  . ASP B 1 72  ? 11.671  -34.527 -23.165 1.00 67.06  ? 369 ASP B CB  1 
ATOM   2303 C CG  . ASP B 1 72  ? 12.950  -33.903 -23.683 1.00 70.51  ? 369 ASP B CG  1 
ATOM   2304 O OD1 . ASP B 1 72  ? 13.564  -34.474 -24.608 1.00 71.90  ? 369 ASP B OD1 1 
ATOM   2305 O OD2 . ASP B 1 72  ? 13.341  -32.838 -23.159 1.00 73.03  ? 369 ASP B OD2 1 
ATOM   2306 N N   . LEU B 1 73  ? 8.501   -35.361 -23.782 1.00 59.19  ? 370 LEU B N   1 
ATOM   2307 C CA  . LEU B 1 73  ? 7.296   -35.899 -23.169 1.00 58.34  ? 370 LEU B CA  1 
ATOM   2308 C C   . LEU B 1 73  ? 6.723   -37.087 -23.928 1.00 59.96  ? 370 LEU B C   1 
ATOM   2309 O O   . LEU B 1 73  ? 7.027   -37.306 -25.098 1.00 56.62  ? 370 LEU B O   1 
ATOM   2310 C CB  . LEU B 1 73  ? 6.227   -34.814 -23.041 1.00 53.72  ? 370 LEU B CB  1 
ATOM   2311 C CG  . LEU B 1 73  ? 6.544   -33.650 -22.104 1.00 53.21  ? 370 LEU B CG  1 
ATOM   2312 C CD1 . LEU B 1 73  ? 5.408   -32.648 -22.126 1.00 52.03  ? 370 LEU B CD1 1 
ATOM   2313 C CD2 . LEU B 1 73  ? 6.794   -34.149 -20.690 1.00 57.22  ? 370 LEU B CD2 1 
ATOM   2314 N N   . THR B 1 74  ? 5.888   -37.848 -23.233 1.00 63.29  ? 371 THR B N   1 
ATOM   2315 C CA  . THR B 1 74  ? 5.140   -38.943 -23.826 1.00 65.36  ? 371 THR B CA  1 
ATOM   2316 C C   . THR B 1 74  ? 4.235   -38.409 -24.938 1.00 63.03  ? 371 THR B C   1 
ATOM   2317 O O   . THR B 1 74  ? 3.742   -37.284 -24.854 1.00 59.32  ? 371 THR B O   1 
ATOM   2318 C CB  . THR B 1 74  ? 4.329   -39.684 -22.733 1.00 66.59  ? 371 THR B CB  1 
ATOM   2319 O OG1 . THR B 1 74  ? 5.150   -40.698 -22.141 1.00 69.41  ? 371 THR B OG1 1 
ATOM   2320 C CG2 . THR B 1 74  ? 3.074   -40.330 -23.293 1.00 69.15  ? 371 THR B CG2 1 
ATOM   2321 N N   . LEU B 1 75  ? 4.055   -39.205 -25.989 1.00 58.60  ? 372 LEU B N   1 
ATOM   2322 C CA  . LEU B 1 75  ? 3.187   -38.838 -27.102 1.00 68.21  ? 372 LEU B CA  1 
ATOM   2323 C C   . LEU B 1 75  ? 1.777   -38.495 -26.623 1.00 65.89  ? 372 LEU B C   1 
ATOM   2324 O O   . LEU B 1 75  ? 1.205   -37.486 -27.036 1.00 61.01  ? 372 LEU B O   1 
ATOM   2325 C CB  . LEU B 1 75  ? 3.138   -39.969 -28.133 1.00 71.17  ? 372 LEU B CB  1 
ATOM   2326 C CG  . LEU B 1 75  ? 3.123   -39.583 -29.615 1.00 74.22  ? 372 LEU B CG  1 
ATOM   2327 C CD1 . LEU B 1 75  ? 3.297   -40.818 -30.485 1.00 78.69  ? 372 LEU B CD1 1 
ATOM   2328 C CD2 . LEU B 1 75  ? 1.846   -38.846 -29.989 1.00 74.68  ? 372 LEU B CD2 1 
ATOM   2329 N N   . HIS B 1 76  ? 1.225   -39.333 -25.749 1.00 69.17  ? 373 HIS B N   1 
ATOM   2330 C CA  . HIS B 1 76  ? -0.103  -39.088 -25.187 1.00 66.86  ? 373 HIS B CA  1 
ATOM   2331 C C   . HIS B 1 76  ? -0.162  -37.797 -24.375 1.00 59.78  ? 373 HIS B C   1 
ATOM   2332 O O   . HIS B 1 76  ? -1.189  -37.123 -24.352 1.00 51.72  ? 373 HIS B O   1 
ATOM   2333 C CB  . HIS B 1 76  ? -0.568  -40.272 -24.334 1.00 72.29  ? 373 HIS B CB  1 
ATOM   2334 C CG  . HIS B 1 76  ? -1.198  -41.376 -25.125 1.00 79.15  ? 373 HIS B CG  1 
ATOM   2335 N ND1 . HIS B 1 76  ? -0.464  -42.273 -25.870 1.00 83.70  ? 373 HIS B ND1 1 
ATOM   2336 C CD2 . HIS B 1 76  ? -2.497  -41.724 -25.291 1.00 81.92  ? 373 HIS B CD2 1 
ATOM   2337 C CE1 . HIS B 1 76  ? -1.282  -43.129 -26.458 1.00 86.73  ? 373 HIS B CE1 1 
ATOM   2338 N NE2 . HIS B 1 76  ? -2.521  -42.817 -26.123 1.00 85.62  ? 373 HIS B NE2 1 
ATOM   2339 N N   . ASP B 1 77  ? 0.939   -37.458 -23.712 1.00 58.62  ? 374 ASP B N   1 
ATOM   2340 C CA  . ASP B 1 77  ? 1.009   -36.224 -22.934 1.00 55.42  ? 374 ASP B CA  1 
ATOM   2341 C C   . ASP B 1 77  ? 1.094   -35.000 -23.842 1.00 51.32  ? 374 ASP B C   1 
ATOM   2342 O O   . ASP B 1 77  ? 0.476   -33.973 -23.564 1.00 52.71  ? 374 ASP B O   1 
ATOM   2343 C CB  . ASP B 1 77  ? 2.187   -36.259 -21.957 1.00 57.75  ? 374 ASP B CB  1 
ATOM   2344 C CG  . ASP B 1 77  ? 1.925   -37.157 -20.760 1.00 63.13  ? 374 ASP B CG  1 
ATOM   2345 O OD1 . ASP B 1 77  ? 0.925   -37.905 -20.782 1.00 56.38  ? 374 ASP B OD1 1 
ATOM   2346 O OD2 . ASP B 1 77  ? 2.719   -37.117 -19.797 1.00 66.60  ? 374 ASP B OD2 1 
ATOM   2347 N N   . GLN B 1 78  ? 1.858   -35.115 -24.926 1.00 48.90  ? 375 GLN B N   1 
ATOM   2348 C CA  . GLN B 1 78  ? 1.929   -34.057 -25.925 1.00 45.75  ? 375 GLN B CA  1 
ATOM   2349 C C   . GLN B 1 78  ? 0.532   -33.769 -26.464 1.00 44.51  ? 375 GLN B C   1 
ATOM   2350 O O   . GLN B 1 78  ? 0.119   -32.613 -26.563 1.00 40.53  ? 375 GLN B O   1 
ATOM   2351 C CB  . GLN B 1 78  ? 2.850   -34.457 -27.081 1.00 45.67  ? 375 GLN B CB  1 
ATOM   2352 C CG  . GLN B 1 78  ? 4.310   -34.681 -26.707 1.00 49.80  ? 375 GLN B CG  1 
ATOM   2353 C CD  . GLN B 1 78  ? 5.166   -35.053 -27.916 1.00 53.45  ? 375 GLN B CD  1 
ATOM   2354 O OE1 . GLN B 1 78  ? 4.811   -34.757 -29.056 1.00 47.64  ? 375 GLN B OE1 1 
ATOM   2355 N NE2 . GLN B 1 78  ? 6.294   -35.709 -27.667 1.00 51.32  ? 375 GLN B NE2 1 
ATOM   2356 N N   . VAL B 1 79  ? -0.186  -34.836 -26.805 1.00 48.42  ? 376 VAL B N   1 
ATOM   2357 C CA  . VAL B 1 79  ? -1.554  -34.740 -27.304 1.00 49.77  ? 376 VAL B CA  1 
ATOM   2358 C C   . VAL B 1 79  ? -2.443  -33.995 -26.315 1.00 52.13  ? 376 VAL B C   1 
ATOM   2359 O O   . VAL B 1 79  ? -3.183  -33.085 -26.695 1.00 51.20  ? 376 VAL B O   1 
ATOM   2360 C CB  . VAL B 1 79  ? -2.151  -36.142 -27.568 1.00 53.46  ? 376 VAL B CB  1 
ATOM   2361 C CG1 . VAL B 1 79  ? -3.658  -36.064 -27.763 1.00 54.37  ? 376 VAL B CG1 1 
ATOM   2362 C CG2 . VAL B 1 79  ? -1.484  -36.789 -28.770 1.00 50.07  ? 376 VAL B CG2 1 
ATOM   2363 N N   . HIS B 1 80  ? -2.346  -34.379 -25.044 1.00 49.08  ? 377 HIS B N   1 
ATOM   2364 C CA  . HIS B 1 80  ? -3.155  -33.782 -23.989 1.00 43.99  ? 377 HIS B CA  1 
ATOM   2365 C C   . HIS B 1 80  ? -2.913  -32.280 -23.844 1.00 40.77  ? 377 HIS B C   1 
ATOM   2366 O O   . HIS B 1 80  ? -3.860  -31.494 -23.853 1.00 39.40  ? 377 HIS B O   1 
ATOM   2367 C CB  . HIS B 1 80  ? -2.905  -34.490 -22.655 1.00 50.95  ? 377 HIS B CB  1 
ATOM   2368 C CG  . HIS B 1 80  ? -3.693  -33.925 -21.516 1.00 52.56  ? 377 HIS B CG  1 
ATOM   2369 N ND1 . HIS B 1 80  ? -5.033  -34.191 -21.332 1.00 53.68  ? 377 HIS B ND1 1 
ATOM   2370 C CD2 . HIS B 1 80  ? -3.332  -33.101 -20.503 1.00 50.76  ? 377 HIS B CD2 1 
ATOM   2371 C CE1 . HIS B 1 80  ? -5.462  -33.559 -20.254 1.00 51.05  ? 377 HIS B CE1 1 
ATOM   2372 N NE2 . HIS B 1 80  ? -4.449  -32.891 -19.732 1.00 49.22  ? 377 HIS B NE2 1 
ATOM   2373 N N   . LEU B 1 81  ? -1.647  -31.888 -23.715 1.00 39.95  ? 378 LEU B N   1 
ATOM   2374 C CA  . LEU B 1 81  ? -1.291  -30.477 -23.553 1.00 38.72  ? 378 LEU B CA  1 
ATOM   2375 C C   . LEU B 1 81  ? -1.807  -29.604 -24.696 1.00 36.22  ? 378 LEU B C   1 
ATOM   2376 O O   . LEU B 1 81  ? -2.333  -28.518 -24.463 1.00 34.90  ? 378 LEU B O   1 
ATOM   2377 C CB  . LEU B 1 81  ? 0.223   -30.305 -23.407 1.00 38.69  ? 378 LEU B CB  1 
ATOM   2378 C CG  . LEU B 1 81  ? 0.866   -30.901 -22.153 1.00 42.64  ? 378 LEU B CG  1 
ATOM   2379 C CD1 . LEU B 1 81  ? 2.360   -30.625 -22.145 1.00 41.08  ? 378 LEU B CD1 1 
ATOM   2380 C CD2 . LEU B 1 81  ? 0.209   -30.346 -20.892 1.00 39.52  ? 378 LEU B CD2 1 
ATOM   2381 N N   . LEU B 1 82  ? -1.663  -30.083 -25.926 1.00 38.58  ? 379 LEU B N   1 
ATOM   2382 C CA  . LEU B 1 82  ? -2.133  -29.332 -27.088 1.00 39.16  ? 379 LEU B CA  1 
ATOM   2383 C C   . LEU B 1 82  ? -3.655  -29.234 -27.131 1.00 39.32  ? 379 LEU B C   1 
ATOM   2384 O O   . LEU B 1 82  ? -4.202  -28.168 -27.402 1.00 37.24  ? 379 LEU B O   1 
ATOM   2385 C CB  . LEU B 1 82  ? -1.598  -29.938 -28.383 1.00 36.79  ? 379 LEU B CB  1 
ATOM   2386 C CG  . LEU B 1 82  ? -0.176  -29.512 -28.744 1.00 38.55  ? 379 LEU B CG  1 
ATOM   2387 C CD1 . LEU B 1 82  ? 0.343   -30.324 -29.921 1.00 43.11  ? 379 LEU B CD1 1 
ATOM   2388 C CD2 . LEU B 1 82  ? -0.140  -28.025 -29.060 1.00 31.91  ? 379 LEU B CD2 1 
ATOM   2389 N N   . GLU B 1 83  ? -4.329  -30.349 -26.861 1.00 44.16  ? 380 GLU B N   1 
ATOM   2390 C CA  . GLU B 1 83  ? -5.788  -30.373 -26.812 1.00 47.07  ? 380 GLU B CA  1 
ATOM   2391 C C   . GLU B 1 83  ? -6.315  -29.375 -25.790 1.00 47.16  ? 380 GLU B C   1 
ATOM   2392 O O   . GLU B 1 83  ? -7.334  -28.721 -26.014 1.00 51.70  ? 380 GLU B O   1 
ATOM   2393 C CB  . GLU B 1 83  ? -6.293  -31.776 -26.471 1.00 50.27  ? 380 GLU B CB  1 
ATOM   2394 C CG  . GLU B 1 83  ? -6.252  -32.755 -27.628 1.00 52.11  ? 380 GLU B CG  1 
ATOM   2395 C CD  . GLU B 1 83  ? -6.694  -34.144 -27.220 1.00 57.66  ? 380 GLU B CD  1 
ATOM   2396 O OE1 . GLU B 1 83  ? -6.911  -34.992 -28.111 1.00 60.35  ? 380 GLU B OE1 1 
ATOM   2397 O OE2 . GLU B 1 83  ? -6.824  -34.386 -26.002 1.00 59.61  ? 380 GLU B OE2 1 
ATOM   2398 N N   . CYS B 1 84  ? -5.604  -29.258 -24.674 1.00 41.48  ? 381 CYS B N   1 
ATOM   2399 C CA  . CYS B 1 84  ? -5.978  -28.334 -23.609 1.00 41.70  ? 381 CYS B CA  1 
ATOM   2400 C C   . CYS B 1 84  ? -5.666  -26.867 -23.928 1.00 38.01  ? 381 CYS B C   1 
ATOM   2401 O O   . CYS B 1 84  ? -6.449  -25.979 -23.595 1.00 33.27  ? 381 CYS B O   1 
ATOM   2402 C CB  . CYS B 1 84  ? -5.276  -28.728 -22.308 1.00 48.58  ? 381 CYS B CB  1 
ATOM   2403 S SG  . CYS B 1 84  ? -5.623  -27.632 -20.915 1.00 111.55 ? 381 CYS B SG  1 
ATOM   2404 N N   . ALA B 1 85  ? -4.533  -26.624 -24.587 1.00 36.87  ? 382 ALA B N   1 
ATOM   2405 C CA  . ALA B 1 85  ? -3.986  -25.272 -24.717 1.00 32.15  ? 382 ALA B CA  1 
ATOM   2406 C C   . ALA B 1 85  ? -4.184  -24.579 -26.068 1.00 31.87  ? 382 ALA B C   1 
ATOM   2407 O O   . ALA B 1 85  ? -3.922  -23.380 -26.180 1.00 26.23  ? 382 ALA B O   1 
ATOM   2408 C CB  . ALA B 1 85  ? -2.500  -25.277 -24.361 1.00 32.17  ? 382 ALA B CB  1 
ATOM   2409 N N   . TRP B 1 86  ? -4.638  -25.316 -27.081 1.00 28.34  ? 383 TRP B N   1 
ATOM   2410 C CA  . TRP B 1 86  ? -4.650  -24.798 -28.452 1.00 31.58  ? 383 TRP B CA  1 
ATOM   2411 C C   . TRP B 1 86  ? -5.397  -23.474 -28.651 1.00 32.91  ? 383 TRP B C   1 
ATOM   2412 O O   . TRP B 1 86  ? -4.928  -22.603 -29.386 1.00 32.60  ? 383 TRP B O   1 
ATOM   2413 C CB  . TRP B 1 86  ? -5.141  -25.856 -29.451 1.00 33.74  ? 383 TRP B CB  1 
ATOM   2414 C CG  . TRP B 1 86  ? -6.604  -26.143 -29.381 1.00 34.04  ? 383 TRP B CG  1 
ATOM   2415 C CD1 . TRP B 1 86  ? -7.211  -27.118 -28.648 1.00 36.45  ? 383 TRP B CD1 1 
ATOM   2416 C CD2 . TRP B 1 86  ? -7.650  -25.455 -30.080 1.00 32.45  ? 383 TRP B CD2 1 
ATOM   2417 N NE1 . TRP B 1 86  ? -8.570  -27.080 -28.842 1.00 38.63  ? 383 TRP B NE1 1 
ATOM   2418 C CE2 . TRP B 1 86  ? -8.866  -26.067 -29.717 1.00 35.33  ? 383 TRP B CE2 1 
ATOM   2419 C CE3 . TRP B 1 86  ? -7.677  -24.385 -30.979 1.00 29.96  ? 383 TRP B CE3 1 
ATOM   2420 C CZ2 . TRP B 1 86  ? -10.097 -25.643 -30.218 1.00 34.41  ? 383 TRP B CZ2 1 
ATOM   2421 C CZ3 . TRP B 1 86  ? -8.899  -23.964 -31.474 1.00 31.98  ? 383 TRP B CZ3 1 
ATOM   2422 C CH2 . TRP B 1 86  ? -10.092 -24.591 -31.091 1.00 34.26  ? 383 TRP B CH2 1 
ATOM   2423 N N   . LEU B 1 87  ? -6.547  -23.311 -28.003 1.00 32.61  ? 384 LEU B N   1 
ATOM   2424 C CA  . LEU B 1 87  ? -7.298  -22.066 -28.156 1.00 27.62  ? 384 LEU B CA  1 
ATOM   2425 C C   . LEU B 1 87  ? -6.656  -20.920 -27.374 1.00 30.97  ? 384 LEU B C   1 
ATOM   2426 O O   . LEU B 1 87  ? -6.672  -19.773 -27.827 1.00 38.89  ? 384 LEU B O   1 
ATOM   2427 C CB  . LEU B 1 87  ? -8.773  -22.243 -27.781 1.00 28.22  ? 384 LEU B CB  1 
ATOM   2428 C CG  . LEU B 1 87  ? -9.687  -21.040 -28.043 1.00 30.64  ? 384 LEU B CG  1 
ATOM   2429 C CD1 . LEU B 1 87  ? -9.535  -20.532 -29.475 1.00 29.01  ? 384 LEU B CD1 1 
ATOM   2430 C CD2 . LEU B 1 87  ? -11.141 -21.391 -27.753 1.00 28.73  ? 384 LEU B CD2 1 
ATOM   2431 N N   . GLU B 1 88  ? -6.082  -21.227 -26.211 1.00 28.67  ? 385 GLU B N   1 
ATOM   2432 C CA  . GLU B 1 88  ? -5.319  -20.234 -25.453 1.00 29.03  ? 385 GLU B CA  1 
ATOM   2433 C C   . GLU B 1 88  ? -4.165  -19.690 -26.290 1.00 29.02  ? 385 GLU B C   1 
ATOM   2434 O O   . GLU B 1 88  ? -3.917  -18.485 -26.327 1.00 26.85  ? 385 GLU B O   1 
ATOM   2435 C CB  . GLU B 1 88  ? -4.759  -20.837 -24.163 1.00 33.66  ? 385 GLU B CB  1 
ATOM   2436 C CG  . GLU B 1 88  ? -5.734  -20.874 -22.997 1.00 34.86  ? 385 GLU B CG  1 
ATOM   2437 C CD  . GLU B 1 88  ? -5.070  -21.281 -21.697 1.00 38.20  ? 385 GLU B CD  1 
ATOM   2438 O OE1 . GLU B 1 88  ? -4.540  -20.396 -20.992 1.00 44.32  ? 385 GLU B OE1 1 
ATOM   2439 O OE2 . GLU B 1 88  ? -5.077  -22.485 -21.379 1.00 36.15  ? 385 GLU B OE2 1 
ATOM   2440 N N   . ILE B 1 89  ? -3.467  -20.596 -26.964 1.00 29.84  ? 386 ILE B N   1 
ATOM   2441 C CA  . ILE B 1 89  ? -2.324  -20.233 -27.788 1.00 29.35  ? 386 ILE B CA  1 
ATOM   2442 C C   . ILE B 1 89  ? -2.744  -19.386 -28.992 1.00 29.14  ? 386 ILE B C   1 
ATOM   2443 O O   . ILE B 1 89  ? -2.096  -18.387 -29.303 1.00 29.04  ? 386 ILE B O   1 
ATOM   2444 C CB  . ILE B 1 89  ? -1.534  -21.490 -28.216 1.00 30.42  ? 386 ILE B CB  1 
ATOM   2445 C CG1 . ILE B 1 89  ? -0.827  -22.087 -26.993 1.00 29.99  ? 386 ILE B CG1 1 
ATOM   2446 C CG2 . ILE B 1 89  ? -0.532  -21.159 -29.310 1.00 25.51  ? 386 ILE B CG2 1 
ATOM   2447 C CD1 . ILE B 1 89  ? -0.234  -23.449 -27.223 1.00 33.82  ? 386 ILE B CD1 1 
ATOM   2448 N N   . LEU B 1 90  ? -3.839  -19.770 -29.647 1.00 28.48  ? 387 LEU B N   1 
ATOM   2449 C CA  . LEU B 1 90  ? -4.385  -18.974 -30.746 1.00 28.67  ? 387 LEU B CA  1 
ATOM   2450 C C   . LEU B 1 90  ? -4.785  -17.576 -30.279 1.00 29.79  ? 387 LEU B C   1 
ATOM   2451 O O   . LEU B 1 90  ? -4.608  -16.598 -31.001 1.00 28.87  ? 387 LEU B O   1 
ATOM   2452 C CB  . LEU B 1 90  ? -5.602  -19.656 -31.377 1.00 27.50  ? 387 LEU B CB  1 
ATOM   2453 C CG  . LEU B 1 90  ? -5.404  -20.900 -32.240 1.00 30.15  ? 387 LEU B CG  1 
ATOM   2454 C CD1 . LEU B 1 90  ? -6.731  -21.327 -32.843 1.00 32.71  ? 387 LEU B CD1 1 
ATOM   2455 C CD2 . LEU B 1 90  ? -4.373  -20.656 -33.328 1.00 32.87  ? 387 LEU B CD2 1 
ATOM   2456 N N   . MET B 1 91  ? -5.325  -17.484 -29.068 1.00 29.41  ? 388 MET B N   1 
ATOM   2457 C CA  . MET B 1 91  ? -5.802  -16.205 -28.558 1.00 24.42  ? 388 MET B CA  1 
ATOM   2458 C C   . MET B 1 91  ? -4.665  -15.264 -28.173 1.00 27.55  ? 388 MET B C   1 
ATOM   2459 O O   . MET B 1 91  ? -4.712  -14.074 -28.488 1.00 32.57  ? 388 MET B O   1 
ATOM   2460 C CB  . MET B 1 91  ? -6.764  -16.407 -27.388 1.00 28.06  ? 388 MET B CB  1 
ATOM   2461 C CG  . MET B 1 91  ? -8.154  -16.859 -27.811 1.00 28.02  ? 388 MET B CG  1 
ATOM   2462 S SD  . MET B 1 91  ? -9.202  -17.232 -26.395 1.00 34.66  ? 388 MET B SD  1 
ATOM   2463 C CE  . MET B 1 91  ? -10.810 -17.300 -27.180 1.00 34.27  ? 388 MET B CE  1 
ATOM   2464 N N   . ILE B 1 92  ? -3.643  -15.783 -27.498 1.00 25.62  ? 389 ILE B N   1 
ATOM   2465 C CA  . ILE B 1 92  ? -2.512  -14.937 -27.128 1.00 24.63  ? 389 ILE B CA  1 
ATOM   2466 C C   . ILE B 1 92  ? -1.748  -14.503 -28.377 1.00 24.93  ? 389 ILE B C   1 
ATOM   2467 O O   . ILE B 1 92  ? -1.136  -13.434 -28.399 1.00 26.09  ? 389 ILE B O   1 
ATOM   2468 C CB  . ILE B 1 92  ? -1.565  -15.602 -26.093 1.00 29.64  ? 389 ILE B CB  1 
ATOM   2469 C CG1 . ILE B 1 92  ? -0.600  -14.560 -25.516 1.00 29.06  ? 389 ILE B CG1 1 
ATOM   2470 C CG2 . ILE B 1 92  ? -0.812  -16.779 -26.702 1.00 28.59  ? 389 ILE B CG2 1 
ATOM   2471 C CD1 . ILE B 1 92  ? 0.351   -15.098 -24.477 1.00 24.37  ? 389 ILE B CD1 1 
ATOM   2472 N N   . GLY B 1 93  ? -1.802  -15.327 -29.420 1.00 27.78  ? 390 GLY B N   1 
ATOM   2473 C CA  . GLY B 1 93  ? -1.221  -14.967 -30.701 1.00 30.19  ? 390 GLY B CA  1 
ATOM   2474 C C   . GLY B 1 93  ? -1.986  -13.804 -31.302 1.00 31.55  ? 390 GLY B C   1 
ATOM   2475 O O   . GLY B 1 93  ? -1.397  -12.789 -31.682 1.00 32.46  ? 390 GLY B O   1 
ATOM   2476 N N   . LEU B 1 94  ? -3.306  -13.958 -31.370 1.00 30.81  ? 391 LEU B N   1 
ATOM   2477 C CA  . LEU B 1 94  ? -4.200  -12.914 -31.861 1.00 33.84  ? 391 LEU B CA  1 
ATOM   2478 C C   . LEU B 1 94  ? -3.967  -11.600 -31.131 1.00 34.05  ? 391 LEU B C   1 
ATOM   2479 O O   . LEU B 1 94  ? -3.765  -10.556 -31.752 1.00 37.65  ? 391 LEU B O   1 
ATOM   2480 C CB  . LEU B 1 94  ? -5.657  -13.339 -31.673 1.00 31.55  ? 391 LEU B CB  1 
ATOM   2481 C CG  . LEU B 1 94  ? -6.690  -12.239 -31.908 1.00 27.41  ? 391 LEU B CG  1 
ATOM   2482 C CD1 . LEU B 1 94  ? -6.622  -11.768 -33.347 1.00 29.36  ? 391 LEU B CD1 1 
ATOM   2483 C CD2 . LEU B 1 94  ? -8.088  -12.721 -31.563 1.00 26.81  ? 391 LEU B CD2 1 
ATOM   2484 N N   . VAL B 1 95  ? -3.997  -11.676 -29.806 1.00 31.31  ? 392 VAL B N   1 
ATOM   2485 C CA  . VAL B 1 95  ? -3.806  -10.524 -28.934 1.00 32.65  ? 392 VAL B CA  1 
ATOM   2486 C C   . VAL B 1 95  ? -2.466  -9.822  -29.180 1.00 36.89  ? 392 VAL B C   1 
ATOM   2487 O O   . VAL B 1 95  ? -2.399  -8.594  -29.225 1.00 40.11  ? 392 VAL B O   1 
ATOM   2488 C CB  . VAL B 1 95  ? -3.927  -10.952 -27.451 1.00 33.43  ? 392 VAL B CB  1 
ATOM   2489 C CG1 . VAL B 1 95  ? -3.346  -9.909  -26.538 1.00 36.65  ? 392 VAL B CG1 1 
ATOM   2490 C CG2 . VAL B 1 95  ? -5.382  -11.228 -27.096 1.00 33.63  ? 392 VAL B CG2 1 
ATOM   2491 N N   . TRP B 1 96  ? -1.408  -10.610 -29.353 1.00 35.20  ? 393 TRP B N   1 
ATOM   2492 C CA  . TRP B 1 96  ? -0.072  -10.072 -29.594 1.00 32.00  ? 393 TRP B CA  1 
ATOM   2493 C C   . TRP B 1 96  ? 0.030   -9.284  -30.899 1.00 35.73  ? 393 TRP B C   1 
ATOM   2494 O O   . TRP B 1 96  ? 0.538   -8.159  -30.916 1.00 37.83  ? 393 TRP B O   1 
ATOM   2495 C CB  . TRP B 1 96  ? 0.963   -11.198 -29.571 1.00 30.52  ? 393 TRP B CB  1 
ATOM   2496 C CG  . TRP B 1 96  ? 2.248   -10.875 -30.281 1.00 37.54  ? 393 TRP B CG  1 
ATOM   2497 C CD1 . TRP B 1 96  ? 2.638   -11.318 -31.516 1.00 35.27  ? 393 TRP B CD1 1 
ATOM   2498 C CD2 . TRP B 1 96  ? 3.315   -10.046 -29.797 1.00 37.35  ? 393 TRP B CD2 1 
ATOM   2499 N NE1 . TRP B 1 96  ? 3.880   -10.815 -31.827 1.00 36.46  ? 393 TRP B NE1 1 
ATOM   2500 C CE2 . TRP B 1 96  ? 4.316   -10.033 -30.791 1.00 37.22  ? 393 TRP B CE2 1 
ATOM   2501 C CE3 . TRP B 1 96  ? 3.519   -9.315  -28.624 1.00 37.12  ? 393 TRP B CE3 1 
ATOM   2502 C CZ2 . TRP B 1 96  ? 5.501   -9.314  -30.644 1.00 39.69  ? 393 TRP B CZ2 1 
ATOM   2503 C CZ3 . TRP B 1 96  ? 4.697   -8.601  -28.480 1.00 40.07  ? 393 TRP B CZ3 1 
ATOM   2504 C CH2 . TRP B 1 96  ? 5.672   -8.606  -29.485 1.00 43.11  ? 393 TRP B CH2 1 
ATOM   2505 N N   . ARG B 1 97  ? -0.454  -9.863  -31.994 1.00 35.71  ? 394 ARG B N   1 
ATOM   2506 C CA  . ARG B 1 97  ? -0.372  -9.179  -33.284 1.00 34.70  ? 394 ARG B CA  1 
ATOM   2507 C C   . ARG B 1 97  ? -1.354  -8.012  -33.379 1.00 34.96  ? 394 ARG B C   1 
ATOM   2508 O O   . ARG B 1 97  ? -1.266  -7.193  -34.291 1.00 30.04  ? 394 ARG B O   1 
ATOM   2509 C CB  . ARG B 1 97  ? -0.539  -10.152 -34.462 1.00 33.10  ? 394 ARG B CB  1 
ATOM   2510 C CG  . ARG B 1 97  ? -1.834  -10.955 -34.494 1.00 34.33  ? 394 ARG B CG  1 
ATOM   2511 C CD  . ARG B 1 97  ? -1.839  -11.909 -35.692 1.00 38.78  ? 394 ARG B CD  1 
ATOM   2512 N NE  . ARG B 1 97  ? -3.089  -12.656 -35.828 1.00 38.00  ? 394 ARG B NE  1 
ATOM   2513 C CZ  . ARG B 1 97  ? -3.294  -13.873 -35.331 1.00 32.26  ? 394 ARG B CZ  1 
ATOM   2514 N NH1 . ARG B 1 97  ? -2.329  -14.490 -34.662 1.00 31.51  ? 394 ARG B NH1 1 
ATOM   2515 N NH2 . ARG B 1 97  ? -4.462  -14.476 -35.507 1.00 25.94  ? 394 ARG B NH2 1 
ATOM   2516 N N   . SER B 1 98  ? -2.271  -7.924  -32.419 1.00 37.59  ? 395 SER B N   1 
ATOM   2517 C CA  . SER B 1 98  ? -3.256  -6.849  -32.413 1.00 36.61  ? 395 SER B CA  1 
ATOM   2518 C C   . SER B 1 98  ? -2.819  -5.657  -31.565 1.00 36.99  ? 395 SER B C   1 
ATOM   2519 O O   . SER B 1 98  ? -3.530  -4.656  -31.491 1.00 38.94  ? 395 SER B O   1 
ATOM   2520 C CB  . SER B 1 98  ? -4.617  -7.366  -31.940 1.00 35.76  ? 395 SER B CB  1 
ATOM   2521 O OG  . SER B 1 98  ? -5.101  -8.382  -32.803 1.00 38.71  ? 395 SER B OG  1 
ATOM   2522 N N   . MET B 1 99  ? -1.649  -5.765  -30.938 1.00 36.20  ? 396 MET B N   1 
ATOM   2523 C CA  . MET B 1 99  ? -1.142  -4.719  -30.043 1.00 38.56  ? 396 MET B CA  1 
ATOM   2524 C C   . MET B 1 99  ? -1.079  -3.336  -30.681 1.00 46.07  ? 396 MET B C   1 
ATOM   2525 O O   . MET B 1 99  ? -1.521  -2.353  -30.088 1.00 50.91  ? 396 MET B O   1 
ATOM   2526 C CB  . MET B 1 99  ? 0.245   -5.085  -29.514 1.00 37.37  ? 396 MET B CB  1 
ATOM   2527 C CG  . MET B 1 99  ? 0.234   -5.951  -28.271 1.00 38.18  ? 396 MET B CG  1 
ATOM   2528 S SD  . MET B 1 99  ? 1.895   -6.466  -27.802 1.00 51.86  ? 396 MET B SD  1 
ATOM   2529 C CE  . MET B 1 99  ? 2.712   -4.892  -27.581 1.00 32.37  ? 396 MET B CE  1 
ATOM   2530 N N   . GLU B 1 100 ? -0.528  -3.268  -31.889 1.00 48.20  ? 397 GLU B N   1 
ATOM   2531 C CA  . GLU B 1 100 ? -0.344  -1.996  -32.583 1.00 53.47  ? 397 GLU B CA  1 
ATOM   2532 C C   . GLU B 1 100 ? -1.610  -1.547  -33.307 1.00 52.44  ? 397 GLU B C   1 
ATOM   2533 O O   . GLU B 1 100 ? -1.561  -0.678  -34.177 1.00 56.19  ? 397 GLU B O   1 
ATOM   2534 C CB  . GLU B 1 100 ? 0.814   -2.095  -33.580 1.00 60.84  ? 397 GLU B CB  1 
ATOM   2535 C CG  . GLU B 1 100 ? 2.151   -2.450  -32.951 1.00 67.24  ? 397 GLU B CG  1 
ATOM   2536 C CD  . GLU B 1 100 ? 2.642   -1.388  -31.987 1.00 75.40  ? 397 GLU B CD  1 
ATOM   2537 O OE1 . GLU B 1 100 ? 2.791   -0.222  -32.412 1.00 80.63  ? 397 GLU B OE1 1 
ATOM   2538 O OE2 . GLU B 1 100 ? 2.876   -1.720  -30.804 1.00 75.03  ? 397 GLU B OE2 1 
ATOM   2539 N N   . HIS B 1 101 ? -2.743  -2.144  -32.952 1.00 49.07  ? 398 HIS B N   1 
ATOM   2540 C CA  . HIS B 1 101 ? -4.015  -1.789  -33.572 1.00 48.93  ? 398 HIS B CA  1 
ATOM   2541 C C   . HIS B 1 101 ? -5.100  -1.563  -32.526 1.00 47.37  ? 398 HIS B C   1 
ATOM   2542 O O   . HIS B 1 101 ? -5.984  -2.404  -32.353 1.00 43.98  ? 398 HIS B O   1 
ATOM   2543 C CB  . HIS B 1 101 ? -4.449  -2.873  -34.559 1.00 48.11  ? 398 HIS B CB  1 
ATOM   2544 C CG  . HIS B 1 101 ? -3.470  -3.103  -35.668 1.00 50.14  ? 398 HIS B CG  1 
ATOM   2545 N ND1 . HIS B 1 101 ? -3.439  -2.325  -36.806 1.00 53.46  ? 398 HIS B ND1 1 
ATOM   2546 C CD2 . HIS B 1 101 ? -2.482  -4.017  -35.809 1.00 49.16  ? 398 HIS B CD2 1 
ATOM   2547 C CE1 . HIS B 1 101 ? -2.475  -2.753  -37.602 1.00 53.70  ? 398 HIS B CE1 1 
ATOM   2548 N NE2 . HIS B 1 101 ? -1.880  -3.779  -37.021 1.00 52.80  ? 398 HIS B NE2 1 
ATOM   2549 N N   . PRO B 1 102 ? -5.035  -0.417  -31.828 1.00 49.64  ? 399 PRO B N   1 
ATOM   2550 C CA  . PRO B 1 102 ? -5.964  -0.060  -30.750 1.00 50.31  ? 399 PRO B CA  1 
ATOM   2551 C C   . PRO B 1 102 ? -7.422  -0.129  -31.190 1.00 49.98  ? 399 PRO B C   1 
ATOM   2552 O O   . PRO B 1 102 ? -7.788  0.460   -32.209 1.00 51.70  ? 399 PRO B O   1 
ATOM   2553 C CB  . PRO B 1 102 ? -5.587  1.389   -30.435 1.00 53.07  ? 399 PRO B CB  1 
ATOM   2554 C CG  . PRO B 1 102 ? -4.167  1.507   -30.849 1.00 53.16  ? 399 PRO B CG  1 
ATOM   2555 C CD  . PRO B 1 102 ? -4.035  0.640   -32.060 1.00 52.44  ? 399 PRO B CD  1 
ATOM   2556 N N   . GLY B 1 103 ? -8.238  -0.853  -30.429 1.00 44.49  ? 400 GLY B N   1 
ATOM   2557 C CA  . GLY B 1 103 ? -9.655  -0.975  -30.718 1.00 44.10  ? 400 GLY B CA  1 
ATOM   2558 C C   . GLY B 1 103 ? -9.958  -1.978  -31.814 1.00 49.01  ? 400 GLY B C   1 
ATOM   2559 O O   . GLY B 1 103 ? -11.111 -2.145  -32.212 1.00 52.05  ? 400 GLY B O   1 
ATOM   2560 N N   . LYS B 1 104 ? -8.921  -2.651  -32.304 1.00 48.54  ? 401 LYS B N   1 
ATOM   2561 C CA  . LYS B 1 104 ? -9.078  -3.605  -33.394 1.00 45.96  ? 401 LYS B CA  1 
ATOM   2562 C C   . LYS B 1 104 ? -8.382  -4.929  -33.112 1.00 41.32  ? 401 LYS B C   1 
ATOM   2563 O O   . LYS B 1 104 ? -7.340  -4.975  -32.456 1.00 37.25  ? 401 LYS B O   1 
ATOM   2564 C CB  . LYS B 1 104 ? -8.543  -3.018  -34.703 1.00 49.79  ? 401 LYS B CB  1 
ATOM   2565 C CG  . LYS B 1 104 ? -9.328  -1.829  -35.231 1.00 52.58  ? 401 LYS B CG  1 
ATOM   2566 C CD  . LYS B 1 104 ? -8.684  -1.279  -36.490 1.00 55.21  ? 401 LYS B CD  1 
ATOM   2567 C CE  . LYS B 1 104 ? -9.478  -0.121  -37.070 1.00 60.27  ? 401 LYS B CE  1 
ATOM   2568 N NZ  . LYS B 1 104 ? -8.902  0.346   -38.362 1.00 63.12  ? 401 LYS B NZ  1 
ATOM   2569 N N   . LEU B 1 105 ? -8.968  -6.006  -33.621 1.00 39.37  ? 402 LEU B N   1 
ATOM   2570 C CA  . LEU B 1 105 ? -8.360  -7.324  -33.525 1.00 36.12  ? 402 LEU B CA  1 
ATOM   2571 C C   . LEU B 1 105 ? -7.861  -7.765  -34.902 1.00 38.15  ? 402 LEU B C   1 
ATOM   2572 O O   . LEU B 1 105 ? -8.637  -7.874  -35.851 1.00 36.40  ? 402 LEU B O   1 
ATOM   2573 C CB  . LEU B 1 105 ? -9.356  -8.334  -32.948 1.00 32.86  ? 402 LEU B CB  1 
ATOM   2574 C CG  . LEU B 1 105 ? -9.761  -8.098  -31.487 1.00 33.70  ? 402 LEU B CG  1 
ATOM   2575 C CD1 . LEU B 1 105 ? -10.777 -9.130  -31.018 1.00 30.63  ? 402 LEU B CD1 1 
ATOM   2576 C CD2 . LEU B 1 105 ? -8.537  -8.104  -30.581 1.00 31.42  ? 402 LEU B CD2 1 
ATOM   2577 N N   . LEU B 1 106 ? -6.557  -7.998  -35.009 1.00 40.63  ? 403 LEU B N   1 
ATOM   2578 C CA  . LEU B 1 106 ? -5.962  -8.423  -36.273 1.00 39.93  ? 403 LEU B CA  1 
ATOM   2579 C C   . LEU B 1 106 ? -5.931  -9.945  -36.356 1.00 36.21  ? 403 LEU B C   1 
ATOM   2580 O O   . LEU B 1 106 ? -4.925  -10.574 -36.024 1.00 30.95  ? 403 LEU B O   1 
ATOM   2581 C CB  . LEU B 1 106 ? -4.549  -7.845  -36.428 1.00 39.84  ? 403 LEU B CB  1 
ATOM   2582 C CG  . LEU B 1 106 ? -3.896  -7.914  -37.814 1.00 44.34  ? 403 LEU B CG  1 
ATOM   2583 C CD1 . LEU B 1 106 ? -3.127  -6.639  -38.095 1.00 47.42  ? 403 LEU B CD1 1 
ATOM   2584 C CD2 . LEU B 1 106 ? -2.970  -9.112  -37.941 1.00 46.48  ? 403 LEU B CD2 1 
ATOM   2585 N N   . PHE B 1 107 ? -7.043  -10.534 -36.784 1.00 38.28  ? 404 PHE B N   1 
ATOM   2586 C CA  . PHE B 1 107 ? -7.130  -11.982 -36.938 1.00 39.77  ? 404 PHE B CA  1 
ATOM   2587 C C   . PHE B 1 107 ? -6.176  -12.431 -38.040 1.00 39.15  ? 404 PHE B C   1 
ATOM   2588 O O   . PHE B 1 107 ? -5.582  -13.506 -37.976 1.00 40.52  ? 404 PHE B O   1 
ATOM   2589 C CB  . PHE B 1 107 ? -8.565  -12.402 -37.264 1.00 41.06  ? 404 PHE B CB  1 
ATOM   2590 C CG  . PHE B 1 107 ? -9.557  -12.083 -36.176 1.00 38.54  ? 404 PHE B CG  1 
ATOM   2591 C CD1 . PHE B 1 107 ? -9.778  -12.970 -35.136 1.00 39.85  ? 404 PHE B CD1 1 
ATOM   2592 C CD2 . PHE B 1 107 ? -10.278 -10.903 -36.202 1.00 39.23  ? 404 PHE B CD2 1 
ATOM   2593 C CE1 . PHE B 1 107 ? -10.694 -12.681 -34.139 1.00 39.27  ? 404 PHE B CE1 1 
ATOM   2594 C CE2 . PHE B 1 107 ? -11.196 -10.608 -35.209 1.00 39.70  ? 404 PHE B CE2 1 
ATOM   2595 C CZ  . PHE B 1 107 ? -11.404 -11.496 -34.177 1.00 38.44  ? 404 PHE B CZ  1 
ATOM   2596 N N   . ALA B 1 108 ? -6.031  -11.579 -39.044 1.00 36.88  ? 405 ALA B N   1 
ATOM   2597 C CA  . ALA B 1 108 ? -5.101  -11.801 -40.135 1.00 38.42  ? 405 ALA B CA  1 
ATOM   2598 C C   . ALA B 1 108 ? -4.781  -10.419 -40.691 1.00 40.95  ? 405 ALA B C   1 
ATOM   2599 O O   . ALA B 1 108 ? -5.514  -9.469  -40.412 1.00 40.29  ? 405 ALA B O   1 
ATOM   2600 C CB  . ALA B 1 108 ? -5.744  -12.683 -41.198 1.00 39.13  ? 405 ALA B CB  1 
ATOM   2601 N N   . PRO B 1 109 ? -3.681  -10.291 -41.458 1.00 39.14  ? 406 PRO B N   1 
ATOM   2602 C CA  . PRO B 1 109 ? -3.354  -9.002  -42.079 1.00 38.47  ? 406 PRO B CA  1 
ATOM   2603 C C   . PRO B 1 109 ? -4.511  -8.456  -42.907 1.00 38.40  ? 406 PRO B C   1 
ATOM   2604 O O   . PRO B 1 109 ? -4.699  -7.241  -42.963 1.00 38.18  ? 406 PRO B O   1 
ATOM   2605 C CB  . PRO B 1 109 ? -2.177  -9.348  -42.992 1.00 39.46  ? 406 PRO B CB  1 
ATOM   2606 C CG  . PRO B 1 109 ? -1.511  -10.491 -42.306 1.00 37.30  ? 406 PRO B CG  1 
ATOM   2607 C CD  . PRO B 1 109 ? -2.622  -11.293 -41.686 1.00 37.21  ? 406 PRO B CD  1 
ATOM   2608 N N   . ASN B 1 110 ? -5.281  -9.346  -43.526 1.00 39.98  ? 407 ASN B N   1 
ATOM   2609 C CA  . ASN B 1 110 ? -6.422  -8.933  -44.338 1.00 43.58  ? 407 ASN B CA  1 
ATOM   2610 C C   . ASN B 1 110 ? -7.760  -9.081  -43.609 1.00 46.26  ? 407 ASN B C   1 
ATOM   2611 O O   . ASN B 1 110 ? -8.824  -9.009  -44.226 1.00 52.31  ? 407 ASN B O   1 
ATOM   2612 C CB  . ASN B 1 110 ? -6.450  -9.695  -45.666 1.00 40.10  ? 407 ASN B CB  1 
ATOM   2613 C CG  . ASN B 1 110 ? -6.654  -11.191 -45.482 1.00 41.84  ? 407 ASN B CG  1 
ATOM   2614 O OD1 . ASN B 1 110 ? -6.435  -11.734 -44.397 1.00 40.07  ? 407 ASN B OD1 1 
ATOM   2615 N ND2 . ASN B 1 110 ? -7.068  -11.866 -46.550 1.00 43.23  ? 407 ASN B ND2 1 
ATOM   2616 N N   . LEU B 1 111 ? -7.701  -9.291  -42.299 1.00 48.20  ? 408 LEU B N   1 
ATOM   2617 C CA  . LEU B 1 111 ? -8.913  -9.389  -41.492 1.00 52.00  ? 408 LEU B CA  1 
ATOM   2618 C C   . LEU B 1 111 ? -8.752  -8.621  -40.181 1.00 51.99  ? 408 LEU B C   1 
ATOM   2619 O O   . LEU B 1 111 ? -8.483  -9.202  -39.129 1.00 51.25  ? 408 LEU B O   1 
ATOM   2620 C CB  . LEU B 1 111 ? -9.283  -10.853 -41.235 1.00 43.53  ? 408 LEU B CB  1 
ATOM   2621 C CG  . LEU B 1 111 ? -10.683 -11.119 -40.671 1.00 50.04  ? 408 LEU B CG  1 
ATOM   2622 C CD1 . LEU B 1 111 ? -11.754 -10.491 -41.552 1.00 52.86  ? 408 LEU B CD1 1 
ATOM   2623 C CD2 . LEU B 1 111 ? -10.934 -12.613 -40.504 1.00 48.60  ? 408 LEU B CD2 1 
ATOM   2624 N N   . LEU B 1 112 ? -8.915  -7.305  -40.266 1.00 53.41  ? 409 LEU B N   1 
ATOM   2625 C CA  . LEU B 1 112 ? -8.801  -6.422  -39.114 1.00 54.87  ? 409 LEU B CA  1 
ATOM   2626 C C   . LEU B 1 112 ? -10.186 -5.906  -38.747 1.00 60.94  ? 409 LEU B C   1 
ATOM   2627 O O   . LEU B 1 112 ? -10.843 -5.254  -39.557 1.00 53.83  ? 409 LEU B O   1 
ATOM   2628 C CB  . LEU B 1 112 ? -7.872  -5.255  -39.446 1.00 55.23  ? 409 LEU B CB  1 
ATOM   2629 C CG  . LEU B 1 112 ? -7.529  -4.265  -38.334 1.00 55.03  ? 409 LEU B CG  1 
ATOM   2630 C CD1 . LEU B 1 112 ? -6.697  -4.945  -37.258 1.00 53.19  ? 409 LEU B CD1 1 
ATOM   2631 C CD2 . LEU B 1 112 ? -6.795  -3.065  -38.911 1.00 48.31  ? 409 LEU B CD2 1 
ATOM   2632 N N   . LEU B 1 113 ? -10.630 -6.200  -37.527 1.00 63.72  ? 410 LEU B N   1 
ATOM   2633 C CA  . LEU B 1 113 ? -12.005 -5.904  -37.136 1.00 68.08  ? 410 LEU B CA  1 
ATOM   2634 C C   . LEU B 1 113 ? -12.114 -5.111  -35.840 1.00 67.74  ? 410 LEU B C   1 
ATOM   2635 O O   . LEU B 1 113 ? -11.382 -5.361  -34.876 1.00 61.97  ? 410 LEU B O   1 
ATOM   2636 C CB  . LEU B 1 113 ? -12.803 -7.202  -36.993 1.00 71.18  ? 410 LEU B CB  1 
ATOM   2637 C CG  . LEU B 1 113 ? -12.783 -8.160  -38.183 1.00 71.35  ? 410 LEU B CG  1 
ATOM   2638 C CD1 . LEU B 1 113 ? -13.587 -9.419  -37.889 1.00 73.42  ? 410 LEU B CD1 1 
ATOM   2639 C CD2 . LEU B 1 113 ? -13.305 -7.470  -39.430 1.00 72.97  ? 410 LEU B CD2 1 
ATOM   2640 N N   . ASP B 1 114 ? -13.034 -4.152  -35.822 1.00 72.92  ? 411 ASP B N   1 
ATOM   2641 C CA  . ASP B 1 114 ? -13.427 -3.506  -34.574 1.00 75.06  ? 411 ASP B CA  1 
ATOM   2642 C C   . ASP B 1 114 ? -14.635 -4.245  -33.999 1.00 76.59  ? 411 ASP B C   1 
ATOM   2643 O O   . ASP B 1 114 ? -15.178 -5.148  -34.642 1.00 76.15  ? 411 ASP B O   1 
ATOM   2644 C CB  . ASP B 1 114 ? -13.735 -2.018  -34.788 1.00 80.60  ? 411 ASP B CB  1 
ATOM   2645 C CG  . ASP B 1 114 ? -14.728 -1.773  -35.912 1.00 85.23  ? 411 ASP B CG  1 
ATOM   2646 O OD1 . ASP B 1 114 ? -15.709 -2.539  -36.049 1.00 87.50  ? 411 ASP B OD1 1 
ATOM   2647 O OD2 . ASP B 1 114 ? -14.535 -0.790  -36.661 1.00 87.46  ? 411 ASP B OD2 1 
ATOM   2648 N N   . ARG B 1 115 ? -15.046 -3.880  -32.789 1.00 78.63  ? 412 ARG B N   1 
ATOM   2649 C CA  . ARG B 1 115 ? -16.117 -4.603  -32.099 1.00 84.88  ? 412 ARG B CA  1 
ATOM   2650 C C   . ARG B 1 115 ? -17.472 -4.581  -32.816 1.00 89.60  ? 412 ARG B C   1 
ATOM   2651 O O   . ARG B 1 115 ? -18.255 -5.527  -32.700 1.00 90.33  ? 412 ARG B O   1 
ATOM   2652 C CB  . ARG B 1 115 ? -16.270 -4.089  -30.666 1.00 87.80  ? 412 ARG B CB  1 
ATOM   2653 C CG  . ARG B 1 115 ? -16.201 -2.567  -30.554 1.00 89.87  ? 412 ARG B CG  1 
ATOM   2654 C CD  . ARG B 1 115 ? -16.565 -2.101  -29.156 1.00 93.54  ? 412 ARG B CD  1 
ATOM   2655 N NE  . ARG B 1 115 ? -17.678 -2.870  -28.606 1.00 97.22  ? 412 ARG B NE  1 
ATOM   2656 C CZ  . ARG B 1 115 ? -18.255 -2.642  -27.429 1.00 99.36  ? 412 ARG B CZ  1 
ATOM   2657 N NH1 . ARG B 1 115 ? -17.839 -1.649  -26.654 1.00 100.61 ? 412 ARG B NH1 1 
ATOM   2658 N NH2 . ARG B 1 115 ? -19.257 -3.413  -27.031 1.00 101.56 ? 412 ARG B NH2 1 
ATOM   2659 N N   . ASN B 1 116 ? -17.740 -3.502  -33.548 1.00 92.23  ? 413 ASN B N   1 
ATOM   2660 C CA  . ASN B 1 116 ? -18.976 -3.369  -34.316 1.00 96.59  ? 413 ASN B CA  1 
ATOM   2661 C C   . ASN B 1 116 ? -19.188 -4.522  -35.295 1.00 93.52  ? 413 ASN B C   1 
ATOM   2662 O O   . ASN B 1 116 ? -20.313 -4.989  -35.495 1.00 95.27  ? 413 ASN B O   1 
ATOM   2663 C CB  . ASN B 1 116 ? -18.997 -2.040  -35.074 1.00 100.61 ? 413 ASN B CB  1 
ATOM   2664 C CG  . ASN B 1 116 ? -18.901 -0.841  -34.151 1.00 104.61 ? 413 ASN B CG  1 
ATOM   2665 O OD1 . ASN B 1 116 ? -19.296 -0.905  -32.986 1.00 107.13 ? 413 ASN B OD1 1 
ATOM   2666 N ND2 . ASN B 1 116 ? -18.380 0.264   -34.670 1.00 106.03 ? 413 ASN B ND2 1 
ATOM   2667 N N   . GLN B 1 117 ? -18.097 -4.975  -35.906 1.00 88.31  ? 414 GLN B N   1 
ATOM   2668 C CA  . GLN B 1 117 ? -18.145 -6.090  -36.845 1.00 87.03  ? 414 GLN B CA  1 
ATOM   2669 C C   . GLN B 1 117 ? -18.189 -7.420  -36.099 1.00 85.54  ? 414 GLN B C   1 
ATOM   2670 O O   . GLN B 1 117 ? -18.609 -8.435  -36.651 1.00 88.59  ? 414 GLN B O   1 
ATOM   2671 C CB  . GLN B 1 117 ? -16.936 -6.055  -37.777 1.00 82.56  ? 414 GLN B CB  1 
ATOM   2672 C CG  . GLN B 1 117 ? -16.606 -4.675  -38.306 1.00 85.66  ? 414 GLN B CG  1 
ATOM   2673 C CD  . GLN B 1 117 ? -15.453 -4.701  -39.286 1.00 86.35  ? 414 GLN B CD  1 
ATOM   2674 O OE1 . GLN B 1 117 ? -14.379 -4.162  -39.016 1.00 85.22  ? 414 GLN B OE1 1 
ATOM   2675 N NE2 . GLN B 1 117 ? -15.670 -5.330  -40.436 1.00 87.61  ? 414 GLN B NE2 1 
ATOM   2676 N N   . GLY B 1 118 ? -17.747 -7.410  -34.845 1.00 80.30  ? 415 GLY B N   1 
ATOM   2677 C CA  . GLY B 1 118 ? -17.842 -8.585  -33.999 1.00 80.81  ? 415 GLY B CA  1 
ATOM   2678 C C   . GLY B 1 118 ? -19.282 -8.896  -33.634 1.00 87.29  ? 415 GLY B C   1 
ATOM   2679 O O   . GLY B 1 118 ? -19.609 -10.020 -33.250 1.00 89.66  ? 415 GLY B O   1 
ATOM   2680 N N   . LYS B 1 119 ? -20.145 -7.891  -33.759 1.00 90.20  ? 416 LYS B N   1 
ATOM   2681 C CA  . LYS B 1 119 ? -21.566 -8.048  -33.469 1.00 94.40  ? 416 LYS B CA  1 
ATOM   2682 C C   . LYS B 1 119 ? -22.260 -8.884  -34.541 1.00 97.25  ? 416 LYS B C   1 
ATOM   2683 O O   . LYS B 1 119 ? -23.399 -9.317  -34.357 1.00 102.04 ? 416 LYS B O   1 
ATOM   2684 C CB  . LYS B 1 119 ? -22.244 -6.680  -33.355 1.00 96.38  ? 416 LYS B CB  1 
ATOM   2685 C CG  . LYS B 1 119 ? -21.768 -5.836  -32.183 1.00 94.34  ? 416 LYS B CG  1 
ATOM   2686 C CD  . LYS B 1 119 ? -22.424 -4.464  -32.190 1.00 98.28  ? 416 LYS B CD  1 
ATOM   2687 C CE  . LYS B 1 119 ? -23.940 -4.575  -32.178 1.00 105.59 ? 416 LYS B CE  1 
ATOM   2688 N NZ  . LYS B 1 119 ? -24.598 -3.240  -32.240 1.00 110.47 ? 416 LYS B NZ  1 
ATOM   2689 N N   . CYS B 1 120 ? -21.570 -9.096  -35.659 1.00 94.30  ? 417 CYS B N   1 
ATOM   2690 C CA  . CYS B 1 120 ? -22.081 -9.923  -36.750 1.00 94.56  ? 417 CYS B CA  1 
ATOM   2691 C C   . CYS B 1 120 ? -22.426 -11.329 -36.261 1.00 92.94  ? 417 CYS B C   1 
ATOM   2692 O O   . CYS B 1 120 ? -23.426 -11.911 -36.680 1.00 96.40  ? 417 CYS B O   1 
ATOM   2693 C CB  . CYS B 1 120 ? -21.065 -9.980  -37.896 1.00 90.91  ? 417 CYS B CB  1 
ATOM   2694 S SG  . CYS B 1 120 ? -21.355 -11.269 -39.133 1.00 127.66 ? 417 CYS B SG  1 
ATOM   2695 N N   . VAL B 1 121 ? -21.597 -11.864 -35.369 1.00 88.03  ? 418 VAL B N   1 
ATOM   2696 C CA  . VAL B 1 121 ? -21.895 -13.134 -34.714 1.00 88.67  ? 418 VAL B CA  1 
ATOM   2697 C C   . VAL B 1 121 ? -22.531 -12.872 -33.351 1.00 92.07  ? 418 VAL B C   1 
ATOM   2698 O O   . VAL B 1 121 ? -22.002 -12.100 -32.551 1.00 91.60  ? 418 VAL B O   1 
ATOM   2699 C CB  . VAL B 1 121 ? -20.632 -13.998 -34.534 1.00 81.39  ? 418 VAL B CB  1 
ATOM   2700 C CG1 . VAL B 1 121 ? -20.986 -15.325 -33.879 1.00 81.60  ? 418 VAL B CG1 1 
ATOM   2701 C CG2 . VAL B 1 121 ? -19.954 -14.231 -35.874 1.00 78.03  ? 418 VAL B CG2 1 
ATOM   2702 N N   . GLU B 1 122 ? -23.666 -13.515 -33.096 1.00 94.90  ? 419 GLU B N   1 
ATOM   2703 C CA  . GLU B 1 122 ? -24.425 -13.286 -31.870 1.00 97.42  ? 419 GLU B CA  1 
ATOM   2704 C C   . GLU B 1 122 ? -23.619 -13.599 -30.611 1.00 95.24  ? 419 GLU B C   1 
ATOM   2705 O O   . GLU B 1 122 ? -23.260 -14.750 -30.362 1.00 93.54  ? 419 GLU B O   1 
ATOM   2706 C CB  . GLU B 1 122 ? -25.721 -14.103 -31.882 1.00 101.58 ? 419 GLU B CB  1 
ATOM   2707 N N   . GLY B 1 123 ? -23.329 -12.563 -29.830 1.00 95.52  ? 420 GLY B N   1 
ATOM   2708 C CA  . GLY B 1 123 ? -22.666 -12.728 -28.549 1.00 94.26  ? 420 GLY B CA  1 
ATOM   2709 C C   . GLY B 1 123 ? -21.148 -12.718 -28.580 1.00 89.34  ? 420 GLY B C   1 
ATOM   2710 O O   . GLY B 1 123 ? -20.507 -12.947 -27.557 1.00 86.24  ? 420 GLY B O   1 
ATOM   2711 N N   . MET B 1 124 ? -20.566 -12.448 -29.745 1.00 88.18  ? 421 MET B N   1 
ATOM   2712 C CA  . MET B 1 124 ? -19.110 -12.425 -29.872 1.00 83.93  ? 421 MET B CA  1 
ATOM   2713 C C   . MET B 1 124 ? -18.509 -11.199 -29.208 1.00 84.38  ? 421 MET B C   1 
ATOM   2714 O O   . MET B 1 124 ? -17.343 -11.203 -28.808 1.00 78.40  ? 421 MET B O   1 
ATOM   2715 C CB  . MET B 1 124 ? -18.680 -12.541 -31.339 1.00 81.00  ? 421 MET B CB  1 
ATOM   2716 C CG  . MET B 1 124 ? -17.182 -12.711 -31.530 1.00 68.43  ? 421 MET B CG  1 
ATOM   2717 S SD  . MET B 1 124 ? -16.654 -12.953 -33.232 1.00 94.58  ? 421 MET B SD  1 
ATOM   2718 C CE  . MET B 1 124 ? -14.884 -12.751 -33.046 1.00 64.29  ? 421 MET B CE  1 
ATOM   2719 N N   . VAL B 1 125 ? -19.328 -10.161 -29.073 1.00 70.66  ? 422 VAL B N   1 
ATOM   2720 C CA  . VAL B 1 125 ? -18.888 -8.885  -28.524 1.00 72.63  ? 422 VAL B CA  1 
ATOM   2721 C C   . VAL B 1 125 ? -18.295 -8.999  -27.116 1.00 70.01  ? 422 VAL B C   1 
ATOM   2722 O O   . VAL B 1 125 ? -17.459 -8.181  -26.730 1.00 68.58  ? 422 VAL B O   1 
ATOM   2723 C CB  . VAL B 1 125 ? -20.028 -7.835  -28.568 1.00 68.58  ? 422 VAL B CB  1 
ATOM   2724 C CG1 . VAL B 1 125 ? -21.047 -8.214  -29.622 1.00 74.69  ? 422 VAL B CG1 1 
ATOM   2725 C CG2 . VAL B 1 125 ? -20.712 -7.706  -27.207 1.00 69.71  ? 422 VAL B CG2 1 
ATOM   2726 N N   . GLU B 1 126 ? -18.709 -10.018 -26.368 1.00 68.85  ? 423 GLU B N   1 
ATOM   2727 C CA  . GLU B 1 126 ? -18.208 -10.198 -25.014 1.00 65.81  ? 423 GLU B CA  1 
ATOM   2728 C C   . GLU B 1 126 ? -16.758 -10.669 -25.030 1.00 56.77  ? 423 GLU B C   1 
ATOM   2729 O O   . GLU B 1 126 ? -15.904 -10.118 -24.331 1.00 53.20  ? 423 GLU B O   1 
ATOM   2730 C CB  . GLU B 1 126 ? -19.079 -11.189 -24.234 1.00 71.57  ? 423 GLU B CB  1 
ATOM   2731 C CG  . GLU B 1 126 ? -18.710 -11.325 -22.763 1.00 72.38  ? 423 GLU B CG  1 
ATOM   2732 C CD  . GLU B 1 126 ? -19.538 -12.377 -22.048 1.00 78.16  ? 423 GLU B CD  1 
ATOM   2733 O OE1 . GLU B 1 126 ? -20.762 -12.445 -22.297 1.00 85.14  ? 423 GLU B OE1 1 
ATOM   2734 O OE2 . GLU B 1 126 ? -18.961 -13.142 -21.246 1.00 75.67  ? 423 GLU B OE2 1 
ATOM   2735 N N   . ILE B 1 127 ? -16.483 -11.691 -25.834 1.00 55.07  ? 424 ILE B N   1 
ATOM   2736 C CA  . ILE B 1 127 ? -15.132 -12.225 -25.943 1.00 49.99  ? 424 ILE B CA  1 
ATOM   2737 C C   . ILE B 1 127 ? -14.245 -11.270 -26.735 1.00 44.11  ? 424 ILE B C   1 
ATOM   2738 O O   . ILE B 1 127 ? -13.022 -11.276 -26.587 1.00 38.03  ? 424 ILE B O   1 
ATOM   2739 C CB  . ILE B 1 127 ? -15.125 -13.636 -26.574 1.00 54.63  ? 424 ILE B CB  1 
ATOM   2740 C CG1 . ILE B 1 127 ? -14.045 -14.504 -25.928 1.00 56.23  ? 424 ILE B CG1 1 
ATOM   2741 C CG2 . ILE B 1 127 ? -14.943 -13.567 -28.089 1.00 57.20  ? 424 ILE B CG2 1 
ATOM   2742 C CD1 . ILE B 1 127 ? -14.164 -15.969 -26.270 1.00 59.82  ? 424 ILE B CD1 1 
ATOM   2743 N N   . PHE B 1 128 ? -14.873 -10.441 -27.565 1.00 45.65  ? 425 PHE B N   1 
ATOM   2744 C CA  . PHE B 1 128 ? -14.157 -9.454  -28.362 1.00 48.57  ? 425 PHE B CA  1 
ATOM   2745 C C   . PHE B 1 128 ? -13.537 -8.416  -27.437 1.00 47.41  ? 425 PHE B C   1 
ATOM   2746 O O   . PHE B 1 128 ? -12.351 -8.100  -27.551 1.00 44.04  ? 425 PHE B O   1 
ATOM   2747 C CB  . PHE B 1 128 ? -15.115 -8.769  -29.340 1.00 56.69  ? 425 PHE B CB  1 
ATOM   2748 C CG  . PHE B 1 128 ? -14.428 -8.055  -30.470 1.00 60.53  ? 425 PHE B CG  1 
ATOM   2749 C CD1 . PHE B 1 128 ? -14.530 -8.533  -31.766 1.00 63.70  ? 425 PHE B CD1 1 
ATOM   2750 C CD2 . PHE B 1 128 ? -13.684 -6.906  -30.240 1.00 63.38  ? 425 PHE B CD2 1 
ATOM   2751 C CE1 . PHE B 1 128 ? -13.904 -7.879  -32.815 1.00 65.29  ? 425 PHE B CE1 1 
ATOM   2752 C CE2 . PHE B 1 128 ? -13.054 -6.250  -31.280 1.00 65.85  ? 425 PHE B CE2 1 
ATOM   2753 C CZ  . PHE B 1 128 ? -13.162 -6.739  -32.571 1.00 66.12  ? 425 PHE B CZ  1 
ATOM   2754 N N   . ASP B 1 129 ? -14.354 -7.889  -26.529 1.00 49.46  ? 426 ASP B N   1 
ATOM   2755 C CA  . ASP B 1 129 ? -13.913 -6.873  -25.581 1.00 47.23  ? 426 ASP B CA  1 
ATOM   2756 C C   . ASP B 1 129 ? -12.800 -7.377  -24.668 1.00 42.95  ? 426 ASP B C   1 
ATOM   2757 O O   . ASP B 1 129 ? -11.881 -6.632  -24.334 1.00 45.03  ? 426 ASP B O   1 
ATOM   2758 C CB  . ASP B 1 129 ? -15.093 -6.364  -24.750 1.00 49.36  ? 426 ASP B CB  1 
ATOM   2759 C CG  . ASP B 1 129 ? -16.024 -5.468  -25.547 1.00 56.94  ? 426 ASP B CG  1 
ATOM   2760 O OD1 . ASP B 1 129 ? -15.560 -4.856  -26.535 1.00 50.78  ? 426 ASP B OD1 1 
ATOM   2761 O OD2 . ASP B 1 129 ? -17.218 -5.371  -25.184 1.00 61.61  ? 426 ASP B OD2 1 
ATOM   2762 N N   . MET B 1 130 ? -12.884 -8.641  -24.269 1.00 39.17  ? 427 MET B N   1 
ATOM   2763 C CA  . MET B 1 130 ? -11.855 -9.236  -23.423 1.00 37.66  ? 427 MET B CA  1 
ATOM   2764 C C   . MET B 1 130 ? -10.523 -9.333  -24.163 1.00 36.76  ? 427 MET B C   1 
ATOM   2765 O O   . MET B 1 130 ? -9.462  -9.100  -23.584 1.00 37.49  ? 427 MET B O   1 
ATOM   2766 C CB  . MET B 1 130 ? -12.288 -10.617 -22.923 1.00 34.88  ? 427 MET B CB  1 
ATOM   2767 C CG  . MET B 1 130 ? -13.461 -10.592 -21.954 1.00 38.49  ? 427 MET B CG  1 
ATOM   2768 S SD  . MET B 1 130 ? -13.746 -12.193 -21.170 1.00 58.29  ? 427 MET B SD  1 
ATOM   2769 C CE  . MET B 1 130 ? -14.636 -13.063 -22.453 1.00 53.10  ? 427 MET B CE  1 
ATOM   2770 N N   . LEU B 1 131 ? -10.584 -9.675  -25.446 1.00 33.59  ? 428 LEU B N   1 
ATOM   2771 C CA  . LEU B 1 131 ? -9.379  -9.756  -26.263 1.00 30.29  ? 428 LEU B CA  1 
ATOM   2772 C C   . LEU B 1 131 ? -8.768  -8.368  -26.476 1.00 33.29  ? 428 LEU B C   1 
ATOM   2773 O O   . LEU B 1 131 ? -7.555  -8.193  -26.343 1.00 32.40  ? 428 LEU B O   1 
ATOM   2774 C CB  . LEU B 1 131 ? -9.679  -10.438 -27.600 1.00 31.38  ? 428 LEU B CB  1 
ATOM   2775 C CG  . LEU B 1 131 ? -10.018 -11.932 -27.546 1.00 28.53  ? 428 LEU B CG  1 
ATOM   2776 C CD1 . LEU B 1 131 ? -10.776 -12.342 -28.789 1.00 30.39  ? 428 LEU B CD1 1 
ATOM   2777 C CD2 . LEU B 1 131 ? -8.767  -12.786 -27.383 1.00 25.86  ? 428 LEU B CD2 1 
ATOM   2778 N N   . LEU B 1 132 ? -9.610  -7.387  -26.800 1.00 32.34  ? 429 LEU B N   1 
ATOM   2779 C CA  . LEU B 1 132 ? -9.179  -5.990  -26.886 1.00 37.53  ? 429 LEU B CA  1 
ATOM   2780 C C   . LEU B 1 132 ? -8.497  -5.531  -25.598 1.00 38.67  ? 429 LEU B C   1 
ATOM   2781 O O   . LEU B 1 132 ? -7.414  -4.946  -25.634 1.00 38.42  ? 429 LEU B O   1 
ATOM   2782 C CB  . LEU B 1 132 ? -10.369 -5.068  -27.160 1.00 37.89  ? 429 LEU B CB  1 
ATOM   2783 C CG  . LEU B 1 132 ? -11.012 -5.074  -28.544 1.00 40.37  ? 429 LEU B CG  1 
ATOM   2784 C CD1 . LEU B 1 132 ? -12.125 -4.039  -28.608 1.00 43.96  ? 429 LEU B CD1 1 
ATOM   2785 C CD2 . LEU B 1 132 ? -9.970  -4.809  -29.618 1.00 41.35  ? 429 LEU B CD2 1 
ATOM   2786 N N   . ALA B 1 133 ? -9.146  -5.794  -24.466 1.00 36.38  ? 430 ALA B N   1 
ATOM   2787 C CA  . ALA B 1 133 ? -8.617  -5.398  -23.166 1.00 38.88  ? 430 ALA B CA  1 
ATOM   2788 C C   . ALA B 1 133 ? -7.250  -6.025  -22.917 1.00 37.56  ? 430 ALA B C   1 
ATOM   2789 O O   . ALA B 1 133 ? -6.344  -5.375  -22.397 1.00 40.31  ? 430 ALA B O   1 
ATOM   2790 C CB  . ALA B 1 133 ? -9.591  -5.776  -22.054 1.00 40.73  ? 430 ALA B CB  1 
ATOM   2791 N N   . THR B 1 134 ? -7.106  -7.288  -23.303 1.00 36.58  ? 431 THR B N   1 
ATOM   2792 C CA  . THR B 1 134 ? -5.846  -7.998  -23.131 1.00 34.85  ? 431 THR B CA  1 
ATOM   2793 C C   . THR B 1 134 ? -4.753  -7.354  -23.972 1.00 37.83  ? 431 THR B C   1 
ATOM   2794 O O   . THR B 1 134 ? -3.646  -7.108  -23.490 1.00 38.69  ? 431 THR B O   1 
ATOM   2795 C CB  . THR B 1 134 ? -5.970  -9.472  -23.544 1.00 28.63  ? 431 THR B CB  1 
ATOM   2796 O OG1 . THR B 1 134 ? -7.108  -10.057 -22.904 1.00 33.59  ? 431 THR B OG1 1 
ATOM   2797 C CG2 . THR B 1 134 ? -4.717  -10.240 -23.156 1.00 25.22  ? 431 THR B CG2 1 
ATOM   2798 N N   . SER B 1 135 ? -5.078  -7.086  -25.233 1.00 35.69  ? 432 SER B N   1 
ATOM   2799 C CA  . SER B 1 135 ? -4.137  -6.475  -26.162 1.00 39.17  ? 432 SER B CA  1 
ATOM   2800 C C   . SER B 1 135 ? -3.757  -5.079  -25.691 1.00 42.20  ? 432 SER B C   1 
ATOM   2801 O O   . SER B 1 135 ? -2.594  -4.679  -25.767 1.00 43.90  ? 432 SER B O   1 
ATOM   2802 C CB  . SER B 1 135 ? -4.738  -6.419  -27.569 1.00 40.64  ? 432 SER B CB  1 
ATOM   2803 O OG  . SER B 1 135 ? -3.823  -5.853  -28.490 1.00 44.77  ? 432 SER B OG  1 
ATOM   2804 N N   . SER B 1 136 ? -4.749  -4.345  -25.202 1.00 43.26  ? 433 SER B N   1 
ATOM   2805 C CA  . SER B 1 136 ? -4.518  -3.036  -24.608 1.00 49.33  ? 433 SER B CA  1 
ATOM   2806 C C   . SER B 1 136 ? -3.577  -3.154  -23.413 1.00 45.98  ? 433 SER B C   1 
ATOM   2807 O O   . SER B 1 136 ? -2.681  -2.329  -23.233 1.00 48.60  ? 433 SER B O   1 
ATOM   2808 C CB  . SER B 1 136 ? -5.845  -2.405  -24.181 1.00 55.24  ? 433 SER B CB  1 
ATOM   2809 O OG  . SER B 1 136 ? -5.653  -1.483  -23.124 1.00 61.98  ? 433 SER B OG  1 
ATOM   2810 N N   . ARG B 1 137 ? -3.781  -4.191  -22.607 1.00 39.10  ? 434 ARG B N   1 
ATOM   2811 C CA  . ARG B 1 137 ? -2.928  -4.444  -21.452 1.00 43.22  ? 434 ARG B CA  1 
ATOM   2812 C C   . ARG B 1 137 ? -1.479  -4.711  -21.868 1.00 42.85  ? 434 ARG B C   1 
ATOM   2813 O O   . ARG B 1 137 ? -0.546  -4.181  -21.264 1.00 42.24  ? 434 ARG B O   1 
ATOM   2814 C CB  . ARG B 1 137 ? -3.480  -5.609  -20.627 1.00 45.92  ? 434 ARG B CB  1 
ATOM   2815 C CG  . ARG B 1 137 ? -2.615  -6.001  -19.447 1.00 49.84  ? 434 ARG B CG  1 
ATOM   2816 C CD  . ARG B 1 137 ? -2.462  -4.862  -18.455 1.00 56.30  ? 434 ARG B CD  1 
ATOM   2817 N NE  . ARG B 1 137 ? -1.478  -5.181  -17.424 1.00 60.51  ? 434 ARG B NE  1 
ATOM   2818 C CZ  . ARG B 1 137 ? -1.151  -4.368  -16.425 1.00 70.26  ? 434 ARG B CZ  1 
ATOM   2819 N NH1 . ARG B 1 137 ? -1.734  -3.183  -16.313 1.00 71.94  ? 434 ARG B NH1 1 
ATOM   2820 N NH2 . ARG B 1 137 ? -0.242  -4.743  -15.533 1.00 75.42  ? 434 ARG B NH2 1 
ATOM   2821 N N   . PHE B 1 138 ? -1.299  -5.526  -22.904 1.00 40.74  ? 435 PHE B N   1 
ATOM   2822 C CA  . PHE B 1 138 ? 0.030   -5.794  -23.454 1.00 42.10  ? 435 PHE B CA  1 
ATOM   2823 C C   . PHE B 1 138 ? 0.709   -4.529  -23.990 1.00 43.70  ? 435 PHE B C   1 
ATOM   2824 O O   . PHE B 1 138 ? 1.923   -4.364  -23.857 1.00 42.55  ? 435 PHE B O   1 
ATOM   2825 C CB  . PHE B 1 138 ? -0.044  -6.846  -24.567 1.00 41.84  ? 435 PHE B CB  1 
ATOM   2826 C CG  . PHE B 1 138 ? -0.039  -8.263  -24.068 1.00 44.88  ? 435 PHE B CG  1 
ATOM   2827 C CD1 . PHE B 1 138 ? 0.359   -8.558  -22.775 1.00 48.94  ? 435 PHE B CD1 1 
ATOM   2828 C CD2 . PHE B 1 138 ? -0.422  -9.302  -24.897 1.00 44.23  ? 435 PHE B CD2 1 
ATOM   2829 C CE1 . PHE B 1 138 ? 0.367   -9.865  -22.318 1.00 47.59  ? 435 PHE B CE1 1 
ATOM   2830 C CE2 . PHE B 1 138 ? -0.420  -10.609 -24.446 1.00 42.71  ? 435 PHE B CE2 1 
ATOM   2831 C CZ  . PHE B 1 138 ? -0.022  -10.891 -23.156 1.00 42.44  ? 435 PHE B CZ  1 
ATOM   2832 N N   . ARG B 1 139 ? -0.077  -3.644  -24.598 1.00 40.29  ? 436 ARG B N   1 
ATOM   2833 C CA  . ARG B 1 139 ? 0.466   -2.425  -25.185 1.00 45.48  ? 436 ARG B CA  1 
ATOM   2834 C C   . ARG B 1 139 ? 0.944   -1.465  -24.102 1.00 53.02  ? 436 ARG B C   1 
ATOM   2835 O O   . ARG B 1 139 ? 1.999   -0.840  -24.226 1.00 55.72  ? 436 ARG B O   1 
ATOM   2836 C CB  . ARG B 1 139 ? -0.578  -1.746  -26.079 1.00 47.59  ? 436 ARG B CB  1 
ATOM   2837 C CG  . ARG B 1 139 ? -0.067  -0.513  -26.808 1.00 51.34  ? 436 ARG B CG  1 
ATOM   2838 C CD  . ARG B 1 139 ? -1.007  -0.076  -27.930 1.00 55.57  ? 436 ARG B CD  1 
ATOM   2839 N NE  . ARG B 1 139 ? -2.349  0.252   -27.455 1.00 58.78  ? 436 ARG B NE  1 
ATOM   2840 C CZ  . ARG B 1 139 ? -3.402  -0.554  -27.560 1.00 57.60  ? 436 ARG B CZ  1 
ATOM   2841 N NH1 . ARG B 1 139 ? -4.583  -0.166  -27.097 1.00 62.05  ? 436 ARG B NH1 1 
ATOM   2842 N NH2 . ARG B 1 139 ? -3.278  -1.745  -28.131 1.00 51.56  ? 436 ARG B NH2 1 
ATOM   2843 N N   . MET B 1 140 ? 0.158   -1.362  -23.037 1.00 55.96  ? 437 MET B N   1 
ATOM   2844 C CA  . MET B 1 140 ? 0.489   -0.501  -21.912 1.00 58.74  ? 437 MET B CA  1 
ATOM   2845 C C   . MET B 1 140 ? 1.749   -0.995  -21.210 1.00 57.36  ? 437 MET B C   1 
ATOM   2846 O O   . MET B 1 140 ? 2.600   -0.201  -20.810 1.00 59.34  ? 437 MET B O   1 
ATOM   2847 C CB  . MET B 1 140 ? -0.685  -0.452  -20.937 1.00 62.97  ? 437 MET B CB  1 
ATOM   2848 C CG  . MET B 1 140 ? -0.387  0.255   -19.630 1.00 71.70  ? 437 MET B CG  1 
ATOM   2849 S SD  . MET B 1 140 ? -1.872  0.461   -18.631 1.00 141.66 ? 437 MET B SD  1 
ATOM   2850 C CE  . MET B 1 140 ? -2.574  -1.182  -18.743 1.00 65.32  ? 437 MET B CE  1 
ATOM   2851 N N   . MET B 1 141 ? 1.865   -2.313  -21.074 1.00 54.17  ? 438 MET B N   1 
ATOM   2852 C CA  . MET B 1 141 ? 3.052   -2.930  -20.490 1.00 52.36  ? 438 MET B CA  1 
ATOM   2853 C C   . MET B 1 141 ? 4.235   -2.898  -21.447 1.00 52.42  ? 438 MET B C   1 
ATOM   2854 O O   . MET B 1 141 ? 5.370   -3.163  -21.042 1.00 54.14  ? 438 MET B O   1 
ATOM   2855 C CB  . MET B 1 141 ? 2.775   -4.386  -20.112 1.00 51.45  ? 438 MET B CB  1 
ATOM   2856 C CG  . MET B 1 141 ? 1.713   -4.606  -19.048 1.00 53.23  ? 438 MET B CG  1 
ATOM   2857 S SD  . MET B 1 141 ? 1.664   -6.355  -18.612 1.00 52.06  ? 438 MET B SD  1 
ATOM   2858 C CE  . MET B 1 141 ? 3.314   -6.558  -17.942 1.00 55.59  ? 438 MET B CE  1 
ATOM   2859 N N   . ASN B 1 142 ? 3.965   -2.578  -22.713 1.00 50.79  ? 439 ASN B N   1 
ATOM   2860 C CA  . ASN B 1 142 ? 4.978   -2.631  -23.766 1.00 48.68  ? 439 ASN B CA  1 
ATOM   2861 C C   . ASN B 1 142 ? 5.625   -4.019  -23.817 1.00 46.40  ? 439 ASN B C   1 
ATOM   2862 O O   . ASN B 1 142 ? 6.840   -4.161  -23.647 1.00 46.82  ? 439 ASN B O   1 
ATOM   2863 C CB  . ASN B 1 142 ? 6.032   -1.532  -23.572 1.00 53.38  ? 439 ASN B CB  1 
ATOM   2864 C CG  . ASN B 1 142 ? 6.973   -1.412  -24.748 1.00 58.29  ? 439 ASN B CG  1 
ATOM   2865 O OD1 . ASN B 1 142 ? 6.589   -1.641  -25.900 1.00 60.34  ? 439 ASN B OD1 1 
ATOM   2866 N ND2 . ASN B 1 142 ? 8.222   -1.058  -24.463 1.00 61.77  ? 439 ASN B ND2 1 
ATOM   2867 N N   . LEU B 1 143 ? 4.800   -5.038  -24.052 1.00 43.56  ? 440 LEU B N   1 
ATOM   2868 C CA  . LEU B 1 143 ? 5.267   -6.418  -24.087 1.00 40.45  ? 440 LEU B CA  1 
ATOM   2869 C C   . LEU B 1 143 ? 6.277   -6.634  -25.212 1.00 43.50  ? 440 LEU B C   1 
ATOM   2870 O O   . LEU B 1 143 ? 6.087   -6.165  -26.332 1.00 46.76  ? 440 LEU B O   1 
ATOM   2871 C CB  . LEU B 1 143 ? 4.085   -7.374  -24.247 1.00 38.99  ? 440 LEU B CB  1 
ATOM   2872 C CG  . LEU B 1 143 ? 4.408   -8.870  -24.248 1.00 37.29  ? 440 LEU B CG  1 
ATOM   2873 C CD1 . LEU B 1 143 ? 4.876   -9.310  -22.875 1.00 39.50  ? 440 LEU B CD1 1 
ATOM   2874 C CD2 . LEU B 1 143 ? 3.211   -9.693  -24.699 1.00 32.91  ? 440 LEU B CD2 1 
ATOM   2875 N N   . GLN B 1 144 ? 7.355   -7.344  -24.904 1.00 44.22  ? 441 GLN B N   1 
ATOM   2876 C CA  . GLN B 1 144 ? 8.383   -7.636  -25.891 1.00 42.25  ? 441 GLN B CA  1 
ATOM   2877 C C   . GLN B 1 144 ? 8.145   -8.994  -26.537 1.00 41.67  ? 441 GLN B C   1 
ATOM   2878 O O   . GLN B 1 144 ? 7.564   -9.889  -25.922 1.00 36.21  ? 441 GLN B O   1 
ATOM   2879 C CB  . GLN B 1 144 ? 9.763   -7.607  -25.237 1.00 45.63  ? 441 GLN B CB  1 
ATOM   2880 C CG  . GLN B 1 144 ? 10.129  -6.264  -24.630 1.00 48.64  ? 441 GLN B CG  1 
ATOM   2881 C CD  . GLN B 1 144 ? 10.304  -5.187  -25.681 1.00 53.95  ? 441 GLN B CD  1 
ATOM   2882 O OE1 . GLN B 1 144 ? 9.436   -4.332  -25.864 1.00 56.29  ? 441 GLN B OE1 1 
ATOM   2883 N NE2 . GLN B 1 144 ? 11.431  -5.225  -26.383 1.00 53.98  ? 441 GLN B NE2 1 
ATOM   2884 N N   . GLY B 1 145 ? 8.598   -9.144  -27.779 1.00 45.78  ? 442 GLY B N   1 
ATOM   2885 C CA  . GLY B 1 145 ? 8.478   -10.405 -28.490 1.00 39.02  ? 442 GLY B CA  1 
ATOM   2886 C C   . GLY B 1 145 ? 9.175   -11.538 -27.763 1.00 40.35  ? 442 GLY B C   1 
ATOM   2887 O O   . GLY B 1 145 ? 8.721   -12.681 -27.800 1.00 42.46  ? 442 GLY B O   1 
ATOM   2888 N N   . GLU B 1 146 ? 10.280  -11.217 -27.096 1.00 40.29  ? 443 GLU B N   1 
ATOM   2889 C CA  . GLU B 1 146 ? 11.022  -12.201 -26.319 1.00 37.06  ? 443 GLU B CA  1 
ATOM   2890 C C   . GLU B 1 146 ? 10.193  -12.679 -25.131 1.00 39.29  ? 443 GLU B C   1 
ATOM   2891 O O   . GLU B 1 146 ? 10.264  -13.843 -24.742 1.00 42.24  ? 443 GLU B O   1 
ATOM   2892 C CB  . GLU B 1 146 ? 12.355  -11.622 -25.834 1.00 41.88  ? 443 GLU B CB  1 
ATOM   2893 C CG  . GLU B 1 146 ? 13.371  -11.330 -26.934 1.00 50.55  ? 443 GLU B CG  1 
ATOM   2894 C CD  . GLU B 1 146 ? 13.103  -10.026 -27.663 1.00 59.07  ? 443 GLU B CD  1 
ATOM   2895 O OE1 . GLU B 1 146 ? 12.076  -9.375  -27.373 1.00 59.02  ? 443 GLU B OE1 1 
ATOM   2896 O OE2 . GLU B 1 146 ? 13.923  -9.648  -28.527 1.00 67.15  ? 443 GLU B OE2 1 
ATOM   2897 N N   . GLU B 1 147 ? 9.407   -11.773 -24.559 1.00 38.57  ? 444 GLU B N   1 
ATOM   2898 C CA  . GLU B 1 147 ? 8.535   -12.121 -23.446 1.00 38.46  ? 444 GLU B CA  1 
ATOM   2899 C C   . GLU B 1 147 ? 7.303   -12.874 -23.937 1.00 36.14  ? 444 GLU B C   1 
ATOM   2900 O O   . GLU B 1 147 ? 6.826   -13.796 -23.277 1.00 37.64  ? 444 GLU B O   1 
ATOM   2901 C CB  . GLU B 1 147 ? 8.113   -10.868 -22.679 1.00 39.85  ? 444 GLU B CB  1 
ATOM   2902 C CG  . GLU B 1 147 ? 9.259   -10.124 -22.024 1.00 44.79  ? 444 GLU B CG  1 
ATOM   2903 C CD  . GLU B 1 147 ? 8.827   -8.786  -21.467 1.00 48.88  ? 444 GLU B CD  1 
ATOM   2904 O OE1 . GLU B 1 147 ? 8.006   -8.108  -22.121 1.00 48.18  ? 444 GLU B OE1 1 
ATOM   2905 O OE2 . GLU B 1 147 ? 9.301   -8.414  -20.373 1.00 52.55  ? 444 GLU B OE2 1 
ATOM   2906 N N   . PHE B 1 148 ? 6.794   -12.476 -25.098 1.00 38.22  ? 445 PHE B N   1 
ATOM   2907 C CA  . PHE B 1 148 ? 5.641   -13.139 -25.700 1.00 35.93  ? 445 PHE B CA  1 
ATOM   2908 C C   . PHE B 1 148 ? 5.883   -14.624 -25.946 1.00 35.50  ? 445 PHE B C   1 
ATOM   2909 O O   . PHE B 1 148 ? 5.049   -15.457 -25.595 1.00 33.49  ? 445 PHE B O   1 
ATOM   2910 C CB  . PHE B 1 148 ? 5.245   -12.459 -27.013 1.00 33.11  ? 445 PHE B CB  1 
ATOM   2911 C CG  . PHE B 1 148 ? 4.315   -13.283 -27.866 1.00 34.34  ? 445 PHE B CG  1 
ATOM   2912 C CD1 . PHE B 1 148 ? 2.978   -13.421 -27.525 1.00 34.10  ? 445 PHE B CD1 1 
ATOM   2913 C CD2 . PHE B 1 148 ? 4.777   -13.916 -29.009 1.00 35.51  ? 445 PHE B CD2 1 
ATOM   2914 C CE1 . PHE B 1 148 ? 2.119   -14.179 -28.305 1.00 30.23  ? 445 PHE B CE1 1 
ATOM   2915 C CE2 . PHE B 1 148 ? 3.922   -14.673 -29.795 1.00 35.91  ? 445 PHE B CE2 1 
ATOM   2916 C CZ  . PHE B 1 148 ? 2.591   -14.802 -29.442 1.00 34.59  ? 445 PHE B CZ  1 
ATOM   2917 N N   . VAL B 1 149 ? 7.018   -14.954 -26.555 1.00 35.28  ? 446 VAL B N   1 
ATOM   2918 C CA  . VAL B 1 149 ? 7.308   -16.346 -26.887 1.00 33.40  ? 446 VAL B CA  1 
ATOM   2919 C C   . VAL B 1 149 ? 7.493   -17.192 -25.630 1.00 37.03  ? 446 VAL B C   1 
ATOM   2920 O O   . VAL B 1 149 ? 7.251   -18.399 -25.646 1.00 39.98  ? 446 VAL B O   1 
ATOM   2921 C CB  . VAL B 1 149 ? 8.536   -16.484 -27.809 1.00 31.86  ? 446 VAL B CB  1 
ATOM   2922 C CG1 . VAL B 1 149 ? 8.305   -15.727 -29.107 1.00 27.52  ? 446 VAL B CG1 1 
ATOM   2923 C CG2 . VAL B 1 149 ? 9.795   -15.988 -27.111 1.00 35.46  ? 446 VAL B CG2 1 
ATOM   2924 N N   . CYS B 1 150 ? 7.916   -16.553 -24.543 1.00 33.93  ? 447 CYS B N   1 
ATOM   2925 C CA  . CYS B 1 150 ? 8.047   -17.243 -23.270 1.00 32.71  ? 447 CYS B CA  1 
ATOM   2926 C C   . CYS B 1 150 ? 6.666   -17.556 -22.707 1.00 30.43  ? 447 CYS B C   1 
ATOM   2927 O O   . CYS B 1 150 ? 6.404   -18.680 -22.274 1.00 31.23  ? 447 CYS B O   1 
ATOM   2928 C CB  . CYS B 1 150 ? 8.856   -16.405 -22.278 1.00 33.92  ? 447 CYS B CB  1 
ATOM   2929 S SG  . CYS B 1 150 ? 10.645  -16.407 -22.580 1.00 48.36  ? 447 CYS B SG  1 
ATOM   2930 N N   . LEU B 1 151 ? 5.786   -16.557 -22.731 1.00 25.59  ? 448 LEU B N   1 
ATOM   2931 C CA  . LEU B 1 151 ? 4.420   -16.707 -22.244 1.00 27.72  ? 448 LEU B CA  1 
ATOM   2932 C C   . LEU B 1 151 ? 3.676   -17.813 -22.978 1.00 32.86  ? 448 LEU B C   1 
ATOM   2933 O O   . LEU B 1 151 ? 3.003   -18.646 -22.362 1.00 36.00  ? 448 LEU B O   1 
ATOM   2934 C CB  . LEU B 1 151 ? 3.654   -15.391 -22.387 1.00 28.71  ? 448 LEU B CB  1 
ATOM   2935 C CG  . LEU B 1 151 ? 4.039   -14.301 -21.388 1.00 35.37  ? 448 LEU B CG  1 
ATOM   2936 C CD1 . LEU B 1 151 ? 3.185   -13.060 -21.588 1.00 35.65  ? 448 LEU B CD1 1 
ATOM   2937 C CD2 . LEU B 1 151 ? 3.906   -14.829 -19.964 1.00 37.26  ? 448 LEU B CD2 1 
ATOM   2938 N N   . LYS B 1 152 ? 3.806   -17.814 -24.300 1.00 31.82  ? 449 LYS B N   1 
ATOM   2939 C CA  . LYS B 1 152 ? 3.133   -18.794 -25.138 1.00 32.66  ? 449 LYS B CA  1 
ATOM   2940 C C   . LYS B 1 152 ? 3.617   -20.213 -24.834 1.00 34.24  ? 449 LYS B C   1 
ATOM   2941 O O   . LYS B 1 152 ? 2.822   -21.154 -24.817 1.00 33.31  ? 449 LYS B O   1 
ATOM   2942 C CB  . LYS B 1 152 ? 3.331   -18.450 -26.614 1.00 30.90  ? 449 LYS B CB  1 
ATOM   2943 C CG  . LYS B 1 152 ? 2.385   -19.169 -27.551 1.00 31.22  ? 449 LYS B CG  1 
ATOM   2944 C CD  . LYS B 1 152 ? 2.364   -18.515 -28.932 1.00 32.71  ? 449 LYS B CD  1 
ATOM   2945 C CE  . LYS B 1 152 ? 3.743   -18.526 -29.582 1.00 31.62  ? 449 LYS B CE  1 
ATOM   2946 N NZ  . LYS B 1 152 ? 3.670   -18.098 -31.007 1.00 32.19  ? 449 LYS B NZ  1 
ATOM   2947 N N   . SER B 1 153 ? 4.916   -20.361 -24.580 1.00 32.41  ? 450 SER B N   1 
ATOM   2948 C CA  . SER B 1 153 ? 5.472   -21.656 -24.203 1.00 35.57  ? 450 SER B CA  1 
ATOM   2949 C C   . SER B 1 153 ? 4.967   -22.090 -22.827 1.00 35.19  ? 450 SER B C   1 
ATOM   2950 O O   . SER B 1 153 ? 4.712   -23.273 -22.595 1.00 34.17  ? 450 SER B O   1 
ATOM   2951 C CB  . SER B 1 153 ? 7.000   -21.619 -24.213 1.00 38.63  ? 450 SER B CB  1 
ATOM   2952 O OG  . SER B 1 153 ? 7.489   -21.407 -25.523 1.00 48.65  ? 450 SER B OG  1 
ATOM   2953 N N   . ILE B 1 154 ? 4.822   -21.127 -21.919 1.00 32.70  ? 451 ILE B N   1 
ATOM   2954 C CA  . ILE B 1 154 ? 4.300   -21.410 -20.585 1.00 31.46  ? 451 ILE B CA  1 
ATOM   2955 C C   . ILE B 1 154 ? 2.876   -21.947 -20.668 1.00 28.28  ? 451 ILE B C   1 
ATOM   2956 O O   . ILE B 1 154 ? 2.550   -22.941 -20.031 1.00 31.51  ? 451 ILE B O   1 
ATOM   2957 C CB  . ILE B 1 154 ? 4.367   -20.174 -19.668 1.00 29.61  ? 451 ILE B CB  1 
ATOM   2958 C CG1 . ILE B 1 154 ? 5.822   -19.877 -19.299 1.00 30.05  ? 451 ILE B CG1 1 
ATOM   2959 C CG2 . ILE B 1 154 ? 3.543   -20.396 -18.407 1.00 25.20  ? 451 ILE B CG2 1 
ATOM   2960 C CD1 . ILE B 1 154 ? 6.034   -18.543 -18.620 1.00 29.83  ? 451 ILE B CD1 1 
ATOM   2961 N N   . ILE B 1 155 ? 2.046   -21.306 -21.484 1.00 29.06  ? 452 ILE B N   1 
ATOM   2962 C CA  . ILE B 1 155 ? 0.681   -21.769 -21.724 1.00 31.85  ? 452 ILE B CA  1 
ATOM   2963 C C   . ILE B 1 155 ? 0.638   -23.229 -22.179 1.00 35.36  ? 452 ILE B C   1 
ATOM   2964 O O   . ILE B 1 155 ? -0.113  -24.035 -21.625 1.00 34.02  ? 452 ILE B O   1 
ATOM   2965 C CB  . ILE B 1 155 ? -0.023  -20.892 -22.774 1.00 30.44  ? 452 ILE B CB  1 
ATOM   2966 C CG1 . ILE B 1 155 ? -0.253  -19.482 -22.216 1.00 30.26  ? 452 ILE B CG1 1 
ATOM   2967 C CG2 . ILE B 1 155 ? -1.339  -21.522 -23.200 1.00 29.97  ? 452 ILE B CG2 1 
ATOM   2968 C CD1 . ILE B 1 155 ? -0.808  -18.499 -23.232 1.00 25.20  ? 452 ILE B CD1 1 
ATOM   2969 N N   . LEU B 1 156 ? 1.455   -23.561 -23.178 1.00 33.86  ? 453 LEU B N   1 
ATOM   2970 C CA  . LEU B 1 156 ? 1.520   -24.916 -23.715 1.00 28.09  ? 453 LEU B CA  1 
ATOM   2971 C C   . LEU B 1 156 ? 1.831   -25.961 -22.646 1.00 31.88  ? 453 LEU B C   1 
ATOM   2972 O O   . LEU B 1 156 ? 1.184   -27.007 -22.580 1.00 33.90  ? 453 LEU B O   1 
ATOM   2973 C CB  . LEU B 1 156 ? 2.570   -24.999 -24.825 1.00 31.35  ? 453 LEU B CB  1 
ATOM   2974 C CG  . LEU B 1 156 ? 2.819   -26.412 -25.361 1.00 33.26  ? 453 LEU B CG  1 
ATOM   2975 C CD1 . LEU B 1 156 ? 1.536   -26.993 -25.932 1.00 33.39  ? 453 LEU B CD1 1 
ATOM   2976 C CD2 . LEU B 1 156 ? 3.930   -26.425 -26.401 1.00 36.05  ? 453 LEU B CD2 1 
ATOM   2977 N N   . LEU B 1 157 ? 2.824   -25.672 -21.812 1.00 30.44  ? 454 LEU B N   1 
ATOM   2978 C CA  . LEU B 1 157 ? 3.284   -26.620 -20.803 1.00 38.11  ? 454 LEU B CA  1 
ATOM   2979 C C   . LEU B 1 157 ? 2.436   -26.607 -19.531 1.00 39.33  ? 454 LEU B C   1 
ATOM   2980 O O   . LEU B 1 157 ? 2.348   -27.615 -18.828 1.00 41.99  ? 454 LEU B O   1 
ATOM   2981 C CB  . LEU B 1 157 ? 4.742   -26.338 -20.449 1.00 38.64  ? 454 LEU B CB  1 
ATOM   2982 C CG  . LEU B 1 157 ? 5.737   -26.588 -21.578 1.00 40.75  ? 454 LEU B CG  1 
ATOM   2983 C CD1 . LEU B 1 157 ? 7.113   -26.090 -21.184 1.00 43.49  ? 454 LEU B CD1 1 
ATOM   2984 C CD2 . LEU B 1 157 ? 5.772   -28.070 -21.913 1.00 44.26  ? 454 LEU B CD2 1 
ATOM   2985 N N   . ASN B 1 158 ? 1.814   -25.468 -19.240 1.00 37.41  ? 455 ASN B N   1 
ATOM   2986 C CA  . ASN B 1 158 ? 1.084   -25.311 -17.986 1.00 41.90  ? 455 ASN B CA  1 
ATOM   2987 C C   . ASN B 1 158 ? -0.379  -25.725 -18.022 1.00 44.01  ? 455 ASN B C   1 
ATOM   2988 O O   . ASN B 1 158 ? -0.860  -26.363 -17.090 1.00 49.17  ? 455 ASN B O   1 
ATOM   2989 C CB  . ASN B 1 158 ? 1.177   -23.876 -17.460 1.00 37.45  ? 455 ASN B CB  1 
ATOM   2990 C CG  . ASN B 1 158 ? 0.503   -23.713 -16.106 1.00 38.32  ? 455 ASN B CG  1 
ATOM   2991 O OD1 . ASN B 1 158 ? 0.933   -24.303 -15.119 1.00 36.82  ? 455 ASN B OD1 1 
ATOM   2992 N ND2 . ASN B 1 158 ? -0.558  -22.918 -16.058 1.00 37.37  ? 455 ASN B ND2 1 
ATOM   2993 N N   . SER B 1 159 ? -1.079  -25.361 -19.090 1.00 81.57  ? 456 SER B N   1 
ATOM   2994 C CA  . SER B 1 159 ? -2.534  -25.472 -19.120 1.00 77.77  ? 456 SER B CA  1 
ATOM   2995 C C   . SER B 1 159 ? -3.095  -26.867 -18.842 1.00 74.67  ? 456 SER B C   1 
ATOM   2996 O O   . SER B 1 159 ? -4.139  -27.000 -18.205 1.00 75.77  ? 456 SER B O   1 
ATOM   2997 C CB  . SER B 1 159 ? -3.101  -24.898 -20.420 1.00 74.42  ? 456 SER B CB  1 
ATOM   2998 O OG  . SER B 1 159 ? -3.111  -23.480 -20.372 1.00 72.50  ? 456 SER B OG  1 
ATOM   2999 N N   . GLY B 1 160 ? -2.401  -27.902 -19.300 1.00 74.12  ? 457 GLY B N   1 
ATOM   3000 C CA  . GLY B 1 160 ? -2.877  -29.260 -19.108 1.00 74.71  ? 457 GLY B CA  1 
ATOM   3001 C C   . GLY B 1 160 ? -2.030  -30.112 -18.181 1.00 93.38  ? 457 GLY B C   1 
ATOM   3002 O O   . GLY B 1 160 ? -2.103  -31.340 -18.224 1.00 78.26  ? 457 GLY B O   1 
ATOM   3003 N N   . VAL B 1 161 ? -1.239  -29.467 -17.328 1.00 79.62  ? 458 VAL B N   1 
ATOM   3004 C CA  . VAL B 1 161 ? -0.289  -30.186 -16.476 1.00 88.35  ? 458 VAL B CA  1 
ATOM   3005 C C   . VAL B 1 161 ? -0.926  -30.774 -15.204 1.00 92.71  ? 458 VAL B C   1 
ATOM   3006 O O   . VAL B 1 161 ? -0.256  -31.458 -14.423 1.00 95.69  ? 458 VAL B O   1 
ATOM   3007 C CB  . VAL B 1 161 ? 0.936   -29.301 -16.130 1.00 84.75  ? 458 VAL B CB  1 
ATOM   3008 C CG1 . VAL B 1 161 ? 0.655   -28.453 -14.899 1.00 87.40  ? 458 VAL B CG1 1 
ATOM   3009 C CG2 . VAL B 1 161 ? 2.169   -30.158 -15.920 1.00 86.30  ? 458 VAL B CG2 1 
ATOM   3010 N N   . TYR B 1 162 ? -2.219  -30.525 -15.008 1.00 93.03  ? 459 TYR B N   1 
ATOM   3011 C CA  . TYR B 1 162 ? -2.951  -31.158 -13.912 1.00 96.83  ? 459 TYR B CA  1 
ATOM   3012 C C   . TYR B 1 162 ? -4.160  -31.929 -14.427 1.00 96.40  ? 459 TYR B C   1 
ATOM   3013 O O   . TYR B 1 162 ? -4.746  -31.579 -15.451 1.00 93.06  ? 459 TYR B O   1 
ATOM   3014 C CB  . TYR B 1 162 ? -3.388  -30.130 -12.864 1.00 98.88  ? 459 TYR B CB  1 
ATOM   3015 C CG  . TYR B 1 162 ? -2.248  -29.305 -12.320 1.00 101.56 ? 459 TYR B CG  1 
ATOM   3016 C CD1 . TYR B 1 162 ? -2.262  -27.922 -12.417 1.00 101.21 ? 459 TYR B CD1 1 
ATOM   3017 C CD2 . TYR B 1 162 ? -1.148  -29.909 -11.728 1.00 104.43 ? 459 TYR B CD2 1 
ATOM   3018 C CE1 . TYR B 1 162 ? -1.220  -27.162 -11.932 1.00 96.27  ? 459 TYR B CE1 1 
ATOM   3019 C CE2 . TYR B 1 162 ? -0.097  -29.155 -11.239 1.00 107.29 ? 459 TYR B CE2 1 
ATOM   3020 C CZ  . TYR B 1 162 ? -0.140  -27.780 -11.345 1.00 107.56 ? 459 TYR B CZ  1 
ATOM   3021 O OH  . TYR B 1 162 ? 0.895   -27.011 -10.867 1.00 101.86 ? 459 TYR B OH  1 
ATOM   3022 N N   . GLU B 1 173 ? 3.863   -40.247 -14.527 1.00 119.14 ? 470 GLU B N   1 
ATOM   3023 C CA  . GLU B 1 173 ? 3.726   -39.402 -13.345 1.00 121.70 ? 470 GLU B CA  1 
ATOM   3024 C C   . GLU B 1 173 ? 5.027   -38.631 -13.102 1.00 122.58 ? 470 GLU B C   1 
ATOM   3025 O O   . GLU B 1 173 ? 5.341   -38.242 -11.977 1.00 124.06 ? 470 GLU B O   1 
ATOM   3026 C CB  . GLU B 1 173 ? 3.339   -40.259 -12.129 1.00 128.21 ? 470 GLU B CB  1 
ATOM   3027 C CG  . GLU B 1 173 ? 2.879   -39.493 -10.884 1.00 131.58 ? 470 GLU B CG  1 
ATOM   3028 C CD  . GLU B 1 173 ? 1.467   -38.946 -10.995 1.00 131.38 ? 470 GLU B CD  1 
ATOM   3029 O OE1 . GLU B 1 173 ? 0.614   -39.597 -11.635 1.00 132.58 ? 470 GLU B OE1 1 
ATOM   3030 O OE2 . GLU B 1 173 ? 1.209   -37.862 -10.428 1.00 130.29 ? 470 GLU B OE2 1 
ATOM   3031 N N   . GLU B 1 174 ? 5.789   -38.404 -14.167 1.00 124.04 ? 471 GLU B N   1 
ATOM   3032 C CA  . GLU B 1 174 ? 7.036   -37.653 -14.036 1.00 128.68 ? 471 GLU B CA  1 
ATOM   3033 C C   . GLU B 1 174 ? 6.851   -36.202 -14.422 1.00 128.50 ? 471 GLU B C   1 
ATOM   3034 O O   . GLU B 1 174 ? 7.686   -35.605 -15.109 1.00 128.91 ? 471 GLU B O   1 
ATOM   3035 C CB  . GLU B 1 174 ? 8.174   -38.308 -14.817 1.00 131.06 ? 471 GLU B CB  1 
ATOM   3036 C CG  . GLU B 1 174 ? 8.794   -39.479 -14.077 1.00 136.64 ? 471 GLU B CG  1 
ATOM   3037 C CD  . GLU B 1 174 ? 7.830   -40.640 -13.924 1.00 138.71 ? 471 GLU B CD  1 
ATOM   3038 O OE1 . GLU B 1 174 ? 6.821   -40.682 -14.664 1.00 135.75 ? 471 GLU B OE1 1 
ATOM   3039 O OE2 . GLU B 1 174 ? 8.077   -41.513 -13.068 1.00 142.99 ? 471 GLU B OE2 1 
ATOM   3040 N N   . LYS B 1 175 ? 5.718   -35.665 -13.983 1.00 127.03 ? 472 LYS B N   1 
ATOM   3041 C CA  . LYS B 1 175 ? 5.490   -34.235 -13.938 1.00 123.50 ? 472 LYS B CA  1 
ATOM   3042 C C   . LYS B 1 175 ? 6.476   -33.681 -12.925 1.00 127.76 ? 472 LYS B C   1 
ATOM   3043 O O   . LYS B 1 175 ? 6.289   -33.809 -11.713 1.00 131.84 ? 472 LYS B O   1 
ATOM   3044 C CB  . LYS B 1 175 ? 4.058   -33.944 -13.497 1.00 121.28 ? 472 LYS B CB  1 
ATOM   3045 N N   . ASP B 1 176 ? 7.535   -33.083 -13.448 1.00 79.54  ? 473 ASP B N   1 
ATOM   3046 C CA  . ASP B 1 176 ? 8.669   -32.626 -12.668 1.00 79.92  ? 473 ASP B CA  1 
ATOM   3047 C C   . ASP B 1 176 ? 9.611   -32.091 -13.716 1.00 75.02  ? 473 ASP B C   1 
ATOM   3048 O O   . ASP B 1 176 ? 10.210  -31.028 -13.564 1.00 72.37  ? 473 ASP B O   1 
ATOM   3049 C CB  . ASP B 1 176 ? 9.328   -33.796 -11.942 1.00 87.34  ? 473 ASP B CB  1 
ATOM   3050 C CG  . ASP B 1 176 ? 10.657  -33.423 -11.334 1.00 91.30  ? 473 ASP B CG  1 
ATOM   3051 O OD1 . ASP B 1 176 ? 10.661  -32.910 -10.195 1.00 91.37  ? 473 ASP B OD1 1 
ATOM   3052 O OD2 . ASP B 1 176 ? 11.695  -33.635 -11.996 1.00 94.18  ? 473 ASP B OD2 1 
ATOM   3053 N N   . HIS B 1 177 ? 9.718   -32.856 -14.795 1.00 72.71  ? 474 HIS B N   1 
ATOM   3054 C CA  . HIS B 1 177 ? 10.422  -32.422 -15.986 1.00 70.09  ? 474 HIS B CA  1 
ATOM   3055 C C   . HIS B 1 177 ? 9.773   -31.155 -16.542 1.00 62.93  ? 474 HIS B C   1 
ATOM   3056 O O   . HIS B 1 177 ? 10.454  -30.152 -16.765 1.00 59.39  ? 474 HIS B O   1 
ATOM   3057 C CB  . HIS B 1 177 ? 10.408  -33.530 -17.036 1.00 73.08  ? 474 HIS B CB  1 
ATOM   3058 C CG  . HIS B 1 177 ? 10.982  -33.113 -18.351 1.00 72.89  ? 474 HIS B CG  1 
ATOM   3059 N ND1 . HIS B 1 177 ? 12.330  -32.904 -18.539 1.00 76.96  ? 474 HIS B ND1 1 
ATOM   3060 C CD2 . HIS B 1 177 ? 10.387  -32.845 -19.537 1.00 70.22  ? 474 HIS B CD2 1 
ATOM   3061 C CE1 . HIS B 1 177 ? 12.544  -32.534 -19.790 1.00 77.59  ? 474 HIS B CE1 1 
ATOM   3062 N NE2 . HIS B 1 177 ? 11.382  -32.489 -20.415 1.00 73.67  ? 474 HIS B NE2 1 
ATOM   3063 N N   . ILE B 1 178 ? 8.457   -31.210 -16.753 1.00 59.52  ? 475 ILE B N   1 
ATOM   3064 C CA  . ILE B 1 178 ? 7.675   -30.059 -17.218 1.00 55.68  ? 475 ILE B CA  1 
ATOM   3065 C C   . ILE B 1 178 ? 7.841   -28.868 -16.273 1.00 57.76  ? 475 ILE B C   1 
ATOM   3066 O O   . ILE B 1 178 ? 8.093   -27.741 -16.714 1.00 58.42  ? 475 ILE B O   1 
ATOM   3067 C CB  . ILE B 1 178 ? 6.164   -30.400 -17.329 1.00 56.45  ? 475 ILE B CB  1 
ATOM   3068 C CG1 . ILE B 1 178 ? 5.928   -31.586 -18.274 1.00 59.44  ? 475 ILE B CG1 1 
ATOM   3069 C CG2 . ILE B 1 178 ? 5.382   -29.204 -17.829 1.00 54.23  ? 475 ILE B CG2 1 
ATOM   3070 C CD1 . ILE B 1 178 ? 4.447   -31.896 -18.521 1.00 57.43  ? 475 ILE B CD1 1 
ATOM   3071 N N   . HIS B 1 179 ? 7.694   -29.126 -14.976 1.00 57.96  ? 476 HIS B N   1 
ATOM   3072 C CA  . HIS B 1 179 ? 7.881   -28.095 -13.965 1.00 54.92  ? 476 HIS B CA  1 
ATOM   3073 C C   . HIS B 1 179 ? 9.315   -27.554 -13.982 1.00 51.59  ? 476 HIS B C   1 
ATOM   3074 O O   . HIS B 1 179 ? 9.538   -26.362 -13.774 1.00 51.09  ? 476 HIS B O   1 
ATOM   3075 C CB  . HIS B 1 179 ? 7.503   -28.620 -12.572 1.00 59.35  ? 476 HIS B CB  1 
ATOM   3076 C CG  . HIS B 1 179 ? 6.028   -28.747 -12.352 1.00 60.55  ? 476 HIS B CG  1 
ATOM   3077 N ND1 . HIS B 1 179 ? 5.424   -29.940 -12.016 1.00 62.92  ? 476 HIS B ND1 1 
ATOM   3078 C CD2 . HIS B 1 179 ? 5.038   -27.825 -12.404 1.00 56.99  ? 476 HIS B CD2 1 
ATOM   3079 C CE1 . HIS B 1 179 ? 4.124   -29.749 -11.881 1.00 60.94  ? 476 HIS B CE1 1 
ATOM   3080 N NE2 . HIS B 1 179 ? 3.864   -28.474 -12.110 1.00 58.02  ? 476 HIS B NE2 1 
ATOM   3081 N N   . ARG B 1 180 ? 10.282  -28.432 -14.240 1.00 50.19  ? 477 ARG B N   1 
ATOM   3082 C CA  . ARG B 1 180 ? 11.677  -28.015 -14.366 1.00 55.91  ? 477 ARG B CA  1 
ATOM   3083 C C   . ARG B 1 180 ? 11.863  -27.099 -15.571 1.00 58.30  ? 477 ARG B C   1 
ATOM   3084 O O   . ARG B 1 180 ? 12.636  -26.143 -15.521 1.00 59.64  ? 477 ARG B O   1 
ATOM   3085 C CB  . ARG B 1 180 ? 12.605  -29.227 -14.485 1.00 60.35  ? 477 ARG B CB  1 
ATOM   3086 N N   . VAL B 1 181 ? 11.151  -27.396 -16.653 1.00 59.09  ? 478 VAL B N   1 
ATOM   3087 C CA  . VAL B 1 181 ? 11.222  -26.576 -17.856 1.00 55.72  ? 478 VAL B CA  1 
ATOM   3088 C C   . VAL B 1 181 ? 10.529  -25.238 -17.623 1.00 53.52  ? 478 VAL B C   1 
ATOM   3089 O O   . VAL B 1 181 ? 11.034  -24.188 -18.027 1.00 53.69  ? 478 VAL B O   1 
ATOM   3090 C CB  . VAL B 1 181 ? 10.592  -27.286 -19.072 1.00 51.00  ? 478 VAL B CB  1 
ATOM   3091 C CG1 . VAL B 1 181 ? 10.620  -26.377 -20.292 1.00 49.19  ? 478 VAL B CG1 1 
ATOM   3092 C CG2 . VAL B 1 181 ? 11.323  -28.582 -19.361 1.00 52.04  ? 478 VAL B CG2 1 
ATOM   3093 N N   . LEU B 1 182 ? 9.375   -25.283 -16.965 1.00 50.93  ? 479 LEU B N   1 
ATOM   3094 C CA  . LEU B 1 182 ? 8.637   -24.070 -16.626 1.00 46.42  ? 479 LEU B CA  1 
ATOM   3095 C C   . LEU B 1 182 ? 9.481   -23.136 -15.764 1.00 47.30  ? 479 LEU B C   1 
ATOM   3096 O O   . LEU B 1 182 ? 9.467   -21.920 -15.958 1.00 50.29  ? 479 LEU B O   1 
ATOM   3097 C CB  . LEU B 1 182 ? 7.326   -24.414 -15.916 1.00 42.70  ? 479 LEU B CB  1 
ATOM   3098 C CG  . LEU B 1 182 ? 6.168   -24.848 -16.817 1.00 36.89  ? 479 LEU B CG  1 
ATOM   3099 C CD1 . LEU B 1 182 ? 5.039   -25.451 -15.994 1.00 34.55  ? 479 LEU B CD1 1 
ATOM   3100 C CD2 . LEU B 1 182 ? 5.665   -23.668 -17.629 1.00 30.91  ? 479 LEU B CD2 1 
ATOM   3101 N N   . ASP B 1 183 ? 10.219  -23.711 -14.819 1.00 45.37  ? 480 ASP B N   1 
ATOM   3102 C CA  . ASP B 1 183 ? 11.138  -22.937 -13.993 1.00 49.56  ? 480 ASP B CA  1 
ATOM   3103 C C   . ASP B 1 183 ? 12.232  -22.285 -14.841 1.00 54.89  ? 480 ASP B C   1 
ATOM   3104 O O   . ASP B 1 183 ? 12.638  -21.154 -14.579 1.00 59.07  ? 480 ASP B O   1 
ATOM   3105 C CB  . ASP B 1 183 ? 11.761  -23.809 -12.897 1.00 53.64  ? 480 ASP B CB  1 
ATOM   3106 C CG  . ASP B 1 183 ? 10.749  -24.244 -11.844 1.00 50.23  ? 480 ASP B CG  1 
ATOM   3107 O OD1 . ASP B 1 183 ? 9.656   -23.642 -11.771 1.00 44.85  ? 480 ASP B OD1 1 
ATOM   3108 O OD2 . ASP B 1 183 ? 11.050  -25.188 -11.084 1.00 52.17  ? 480 ASP B OD2 1 
ATOM   3109 N N   . LYS B 1 184 ? 12.701  -23.000 -15.861 1.00 55.32  ? 481 LYS B N   1 
ATOM   3110 C CA  . LYS B 1 184 ? 13.707  -22.462 -16.774 1.00 53.84  ? 481 LYS B CA  1 
ATOM   3111 C C   . LYS B 1 184 ? 13.163  -21.275 -17.570 1.00 46.98  ? 481 LYS B C   1 
ATOM   3112 O O   . LYS B 1 184 ? 13.875  -20.300 -17.811 1.00 46.03  ? 481 LYS B O   1 
ATOM   3113 C CB  . LYS B 1 184 ? 14.214  -23.548 -17.727 1.00 54.34  ? 481 LYS B CB  1 
ATOM   3114 N N   . ILE B 1 185 ? 11.899  -21.359 -17.973 1.00 42.30  ? 482 ILE B N   1 
ATOM   3115 C CA  . ILE B 1 185 ? 11.267  -20.268 -18.708 1.00 44.01  ? 482 ILE B CA  1 
ATOM   3116 C C   . ILE B 1 185 ? 11.089  -19.047 -17.809 1.00 44.56  ? 482 ILE B C   1 
ATOM   3117 O O   . ILE B 1 185 ? 11.234  -17.909 -18.254 1.00 45.18  ? 482 ILE B O   1 
ATOM   3118 C CB  . ILE B 1 185 ? 9.908   -20.689 -19.303 1.00 41.34  ? 482 ILE B CB  1 
ATOM   3119 C CG1 . ILE B 1 185 ? 10.073  -21.941 -20.164 1.00 38.93  ? 482 ILE B CG1 1 
ATOM   3120 C CG2 . ILE B 1 185 ? 9.312   -19.559 -20.134 1.00 38.81  ? 482 ILE B CG2 1 
ATOM   3121 C CD1 . ILE B 1 185 ? 8.791   -22.405 -20.809 1.00 37.79  ? 482 ILE B CD1 1 
ATOM   3122 N N   . THR B 1 186 ? 10.783  -19.294 -16.540 1.00 43.86  ? 483 THR B N   1 
ATOM   3123 C CA  . THR B 1 186 ? 10.698  -18.225 -15.555 1.00 41.61  ? 483 THR B CA  1 
ATOM   3124 C C   . THR B 1 186 ? 12.045  -17.523 -15.425 1.00 42.28  ? 483 THR B C   1 
ATOM   3125 O O   . THR B 1 186 ? 12.115  -16.295 -15.450 1.00 43.40  ? 483 THR B O   1 
ATOM   3126 C CB  . THR B 1 186 ? 10.257  -18.758 -14.178 1.00 43.02  ? 483 THR B CB  1 
ATOM   3127 O OG1 . THR B 1 186 ? 8.963   -19.365 -14.292 1.00 41.11  ? 483 THR B OG1 1 
ATOM   3128 C CG2 . THR B 1 186 ? 10.197  -17.626 -13.160 1.00 40.70  ? 483 THR B CG2 1 
ATOM   3129 N N   . ASP B 1 187 ? 13.111  -18.310 -15.301 1.00 45.67  ? 484 ASP B N   1 
ATOM   3130 C CA  . ASP B 1 187 ? 14.467  -17.769 -15.246 1.00 48.83  ? 484 ASP B CA  1 
ATOM   3131 C C   . ASP B 1 187 ? 14.776  -16.946 -16.498 1.00 49.04  ? 484 ASP B C   1 
ATOM   3132 O O   . ASP B 1 187 ? 15.474  -15.935 -16.430 1.00 49.53  ? 484 ASP B O   1 
ATOM   3133 C CB  . ASP B 1 187 ? 15.498  -18.895 -15.094 1.00 49.73  ? 484 ASP B CB  1 
ATOM   3134 C CG  . ASP B 1 187 ? 15.327  -19.684 -13.804 1.00 51.78  ? 484 ASP B CG  1 
ATOM   3135 O OD1 . ASP B 1 187 ? 14.721  -19.159 -12.845 1.00 48.28  ? 484 ASP B OD1 1 
ATOM   3136 O OD2 . ASP B 1 187 ? 15.811  -20.835 -13.748 1.00 56.03  ? 484 ASP B OD2 1 
ATOM   3137 N N   . THR B 1 188 ? 14.244  -17.385 -17.635 1.00 49.23  ? 485 THR B N   1 
ATOM   3138 C CA  . THR B 1 188 ? 14.463  -16.706 -18.910 1.00 51.28  ? 485 THR B CA  1 
ATOM   3139 C C   . THR B 1 188 ? 13.761  -15.349 -18.946 1.00 49.69  ? 485 THR B C   1 
ATOM   3140 O O   . THR B 1 188 ? 14.320  -14.362 -19.423 1.00 48.20  ? 485 THR B O   1 
ATOM   3141 C CB  . THR B 1 188 ? 13.980  -17.569 -20.094 1.00 50.45  ? 485 THR B CB  1 
ATOM   3142 O OG1 . THR B 1 188 ? 14.696  -18.810 -20.108 1.00 53.70  ? 485 THR B OG1 1 
ATOM   3143 C CG2 . THR B 1 188 ? 14.208  -16.851 -21.408 1.00 49.85  ? 485 THR B CG2 1 
ATOM   3144 N N   . LEU B 1 189 ? 12.536  -15.314 -18.433 1.00 49.15  ? 486 LEU B N   1 
ATOM   3145 C CA  . LEU B 1 189 ? 11.778  -14.074 -18.307 1.00 46.21  ? 486 LEU B CA  1 
ATOM   3146 C C   . LEU B 1 189 ? 12.496  -13.055 -17.426 1.00 49.66  ? 486 LEU B C   1 
ATOM   3147 O O   . LEU B 1 189 ? 12.624  -11.887 -17.792 1.00 52.04  ? 486 LEU B O   1 
ATOM   3148 C CB  . LEU B 1 189 ? 10.388  -14.359 -17.737 1.00 42.06  ? 486 LEU B CB  1 
ATOM   3149 C CG  . LEU B 1 189 ? 9.332   -14.845 -18.726 1.00 39.20  ? 486 LEU B CG  1 
ATOM   3150 C CD1 . LEU B 1 189 ? 8.061   -15.238 -17.990 1.00 39.54  ? 486 LEU B CD1 1 
ATOM   3151 C CD2 . LEU B 1 189 ? 9.047   -13.760 -19.752 1.00 36.42  ? 486 LEU B CD2 1 
ATOM   3152 N N   . ILE B 1 190 ? 12.954  -13.504 -16.261 1.00 50.78  ? 487 ILE B N   1 
ATOM   3153 C CA  . ILE B 1 190 ? 13.670  -12.636 -15.333 1.00 51.55  ? 487 ILE B CA  1 
ATOM   3154 C C   . ILE B 1 190 ? 14.952  -12.115 -15.973 1.00 54.45  ? 487 ILE B C   1 
ATOM   3155 O O   . ILE B 1 190 ? 15.306  -10.945 -15.820 1.00 58.95  ? 487 ILE B O   1 
ATOM   3156 C CB  . ILE B 1 190 ? 14.012  -13.372 -14.025 1.00 51.40  ? 487 ILE B CB  1 
ATOM   3157 C CG1 . ILE B 1 190 ? 12.732  -13.748 -13.278 1.00 50.31  ? 487 ILE B CG1 1 
ATOM   3158 C CG2 . ILE B 1 190 ? 14.897  -12.509 -13.138 1.00 53.05  ? 487 ILE B CG2 1 
ATOM   3159 C CD1 . ILE B 1 190 ? 11.947  -12.553 -12.774 1.00 49.41  ? 487 ILE B CD1 1 
ATOM   3160 N N   . HIS B 1 191 ? 15.633  -12.995 -16.700 1.00 50.96  ? 488 HIS B N   1 
ATOM   3161 C CA  . HIS B 1 191 ? 16.869  -12.642 -17.386 1.00 50.42  ? 488 HIS B CA  1 
ATOM   3162 C C   . HIS B 1 191 ? 16.634  -11.525 -18.399 1.00 48.11  ? 488 HIS B C   1 
ATOM   3163 O O   . HIS B 1 191 ? 17.459  -10.626 -18.548 1.00 50.53  ? 488 HIS B O   1 
ATOM   3164 C CB  . HIS B 1 191 ? 17.456  -13.873 -18.075 1.00 52.16  ? 488 HIS B CB  1 
ATOM   3165 C CG  . HIS B 1 191 ? 18.654  -13.578 -18.922 1.00 57.58  ? 488 HIS B CG  1 
ATOM   3166 N ND1 . HIS B 1 191 ? 19.927  -13.474 -18.403 1.00 62.81  ? 488 HIS B ND1 1 
ATOM   3167 C CD2 . HIS B 1 191 ? 18.773  -13.367 -20.254 1.00 55.31  ? 488 HIS B CD2 1 
ATOM   3168 C CE1 . HIS B 1 191 ? 20.777  -13.211 -19.378 1.00 63.62  ? 488 HIS B CE1 1 
ATOM   3169 N NE2 . HIS B 1 191 ? 20.103  -13.141 -20.512 1.00 60.57  ? 488 HIS B NE2 1 
ATOM   3170 N N   . LEU B 1 192 ? 15.499  -11.584 -19.085 1.00 45.66  ? 489 LEU B N   1 
ATOM   3171 C CA  . LEU B 1 192 ? 15.127  -10.556 -20.050 1.00 47.89  ? 489 LEU B CA  1 
ATOM   3172 C C   . LEU B 1 192 ? 14.888  -9.208  -19.373 1.00 52.53  ? 489 LEU B C   1 
ATOM   3173 O O   . LEU B 1 192 ? 15.349  -8.172  -19.853 1.00 56.03  ? 489 LEU B O   1 
ATOM   3174 C CB  . LEU B 1 192 ? 13.878  -10.983 -20.823 1.00 45.94  ? 489 LEU B CB  1 
ATOM   3175 C CG  . LEU B 1 192 ? 14.048  -12.179 -21.763 1.00 49.16  ? 489 LEU B CG  1 
ATOM   3176 C CD1 . LEU B 1 192 ? 12.710  -12.615 -22.345 1.00 36.10  ? 489 LEU B CD1 1 
ATOM   3177 C CD2 . LEU B 1 192 ? 15.041  -11.846 -22.871 1.00 51.55  ? 489 LEU B CD2 1 
ATOM   3178 N N   . MET B 1 193 ? 14.174  -9.234  -18.252 1.00 51.50  ? 490 MET B N   1 
ATOM   3179 C CA  . MET B 1 193 ? 13.803  -8.016  -17.536 1.00 49.67  ? 490 MET B CA  1 
ATOM   3180 C C   . MET B 1 193 ? 15.003  -7.309  -16.907 1.00 52.55  ? 490 MET B C   1 
ATOM   3181 O O   . MET B 1 193 ? 15.070  -6.078  -16.882 1.00 53.50  ? 490 MET B O   1 
ATOM   3182 C CB  . MET B 1 193 ? 12.752  -8.335  -16.473 1.00 43.95  ? 490 MET B CB  1 
ATOM   3183 C CG  . MET B 1 193 ? 11.495  -8.954  -17.053 1.00 38.95  ? 490 MET B CG  1 
ATOM   3184 S SD  . MET B 1 193 ? 10.337  -9.537  -15.809 1.00 51.45  ? 490 MET B SD  1 
ATOM   3185 C CE  . MET B 1 193 ? 9.070   -10.252 -16.850 1.00 40.50  ? 490 MET B CE  1 
ATOM   3186 N N   . ALA B 1 194 ? 15.947  -8.092  -16.397 1.00 53.75  ? 491 ALA B N   1 
ATOM   3187 C CA  . ALA B 1 194 ? 17.167  -7.531  -15.834 1.00 58.09  ? 491 ALA B CA  1 
ATOM   3188 C C   . ALA B 1 194 ? 17.986  -6.874  -16.937 1.00 63.72  ? 491 ALA B C   1 
ATOM   3189 O O   . ALA B 1 194 ? 18.656  -5.866  -16.713 1.00 68.32  ? 491 ALA B O   1 
ATOM   3190 C CB  . ALA B 1 194 ? 17.978  -8.612  -15.139 1.00 57.42  ? 491 ALA B CB  1 
ATOM   3191 N N   . LYS B 1 195 ? 17.915  -7.447  -18.134 1.00 64.63  ? 492 LYS B N   1 
ATOM   3192 C CA  . LYS B 1 195 ? 18.644  -6.924  -19.283 1.00 67.71  ? 492 LYS B CA  1 
ATOM   3193 C C   . LYS B 1 195 ? 18.032  -5.611  -19.765 1.00 65.82  ? 492 LYS B C   1 
ATOM   3194 O O   . LYS B 1 195 ? 18.721  -4.769  -20.337 1.00 70.07  ? 492 LYS B O   1 
ATOM   3195 C CB  . LYS B 1 195 ? 18.666  -7.954  -20.417 1.00 68.11  ? 492 LYS B CB  1 
ATOM   3196 C CG  . LYS B 1 195 ? 20.007  -8.067  -21.129 1.00 75.21  ? 492 LYS B CG  1 
ATOM   3197 C CD  . LYS B 1 195 ? 20.116  -9.363  -21.922 1.00 74.60  ? 492 LYS B CD  1 
ATOM   3198 C CE  . LYS B 1 195 ? 19.526  -9.225  -23.315 1.00 74.01  ? 492 LYS B CE  1 
ATOM   3199 N NZ  . LYS B 1 195 ? 20.370  -8.361  -24.187 1.00 78.73  ? 492 LYS B NZ  1 
ATOM   3200 N N   . ALA B 1 196 ? 16.736  -5.437  -19.522 1.00 60.34  ? 493 ALA B N   1 
ATOM   3201 C CA  . ALA B 1 196 ? 16.037  -4.224  -19.938 1.00 59.22  ? 493 ALA B CA  1 
ATOM   3202 C C   . ALA B 1 196 ? 16.179  -3.093  -18.919 1.00 63.22  ? 493 ALA B C   1 
ATOM   3203 O O   . ALA B 1 196 ? 15.607  -2.018  -19.096 1.00 63.91  ? 493 ALA B O   1 
ATOM   3204 C CB  . ALA B 1 196 ? 14.566  -4.519  -20.210 1.00 52.47  ? 493 ALA B CB  1 
ATOM   3205 N N   . GLY B 1 197 ? 16.934  -3.343  -17.852 1.00 65.15  ? 494 GLY B N   1 
ATOM   3206 C CA  . GLY B 1 197 ? 17.228  -2.318  -16.865 1.00 67.02  ? 494 GLY B CA  1 
ATOM   3207 C C   . GLY B 1 197 ? 16.271  -2.246  -15.687 1.00 65.77  ? 494 GLY B C   1 
ATOM   3208 O O   . GLY B 1 197 ? 16.306  -1.287  -14.915 1.00 65.73  ? 494 GLY B O   1 
ATOM   3209 N N   . LEU B 1 198 ? 15.420  -3.255  -15.537 1.00 61.31  ? 495 LEU B N   1 
ATOM   3210 C CA  . LEU B 1 198 ? 14.457  -3.275  -14.438 1.00 62.35  ? 495 LEU B CA  1 
ATOM   3211 C C   . LEU B 1 198 ? 15.107  -3.622  -13.100 1.00 63.89  ? 495 LEU B C   1 
ATOM   3212 O O   . LEU B 1 198 ? 15.955  -4.511  -13.026 1.00 65.02  ? 495 LEU B O   1 
ATOM   3213 C CB  . LEU B 1 198 ? 13.330  -4.267  -14.723 1.00 60.03  ? 495 LEU B CB  1 
ATOM   3214 C CG  . LEU B 1 198 ? 12.354  -3.928  -15.848 1.00 59.20  ? 495 LEU B CG  1 
ATOM   3215 C CD1 . LEU B 1 198 ? 11.246  -4.962  -15.889 1.00 54.52  ? 495 LEU B CD1 1 
ATOM   3216 C CD2 . LEU B 1 198 ? 11.783  -2.534  -15.660 1.00 63.18  ? 495 LEU B CD2 1 
ATOM   3217 N N   . THR B 1 199 ? 14.701  -2.919  -12.046 1.00 63.14  ? 496 THR B N   1 
ATOM   3218 C CA  . THR B 1 199 ? 15.149  -3.252  -10.698 1.00 65.09  ? 496 THR B CA  1 
ATOM   3219 C C   . THR B 1 199 ? 14.527  -4.574  -10.273 1.00 62.83  ? 496 THR B C   1 
ATOM   3220 O O   . THR B 1 199 ? 13.572  -5.045  -10.896 1.00 60.38  ? 496 THR B O   1 
ATOM   3221 C CB  . THR B 1 199 ? 14.764  -2.166  -9.673  1.00 68.12  ? 496 THR B CB  1 
ATOM   3222 O OG1 . THR B 1 199 ? 13.338  -2.084  -9.567  1.00 63.70  ? 496 THR B OG1 1 
ATOM   3223 C CG2 . THR B 1 199 ? 15.322  -0.810  -10.086 1.00 73.55  ? 496 THR B CG2 1 
ATOM   3224 N N   . LEU B 1 200 ? 15.070  -5.167  -9.214  1.00 63.37  ? 497 LEU B N   1 
ATOM   3225 C CA  . LEU B 1 200 ? 14.584  -6.450  -8.714  1.00 59.44  ? 497 LEU B CA  1 
ATOM   3226 C C   . LEU B 1 200 ? 13.093  -6.403  -8.399  1.00 56.95  ? 497 LEU B C   1 
ATOM   3227 O O   . LEU B 1 200 ? 12.353  -7.329  -8.731  1.00 56.18  ? 497 LEU B O   1 
ATOM   3228 C CB  . LEU B 1 200 ? 15.372  -6.891  -7.479  1.00 62.68  ? 497 LEU B CB  1 
ATOM   3229 C CG  . LEU B 1 200 ? 16.772  -7.485  -7.678  1.00 66.77  ? 497 LEU B CG  1 
ATOM   3230 C CD1 . LEU B 1 200 ? 17.780  -6.444  -8.158  1.00 71.64  ? 497 LEU B CD1 1 
ATOM   3231 C CD2 . LEU B 1 200 ? 17.252  -8.134  -6.388  1.00 68.22  ? 497 LEU B CD2 1 
ATOM   3232 N N   . GLN B 1 201 ? 12.656  -5.318  -7.766  1.00 56.32  ? 498 GLN B N   1 
ATOM   3233 C CA  . GLN B 1 201 ? 11.241  -5.124  -7.472  1.00 53.24  ? 498 GLN B CA  1 
ATOM   3234 C C   . GLN B 1 201 ? 10.433  -5.042  -8.764  1.00 49.95  ? 498 GLN B C   1 
ATOM   3235 O O   . GLN B 1 201 ? 9.360   -5.633  -8.875  1.00 51.35  ? 498 GLN B O   1 
ATOM   3236 C CB  . GLN B 1 201 ? 11.028  -3.861  -6.636  1.00 57.18  ? 498 GLN B CB  1 
ATOM   3237 C CG  . GLN B 1 201 ? 9.574   -3.593  -6.280  1.00 63.26  ? 498 GLN B CG  1 
ATOM   3238 C CD  . GLN B 1 201 ? 9.385   -2.278  -5.542  1.00 68.73  ? 498 GLN B CD  1 
ATOM   3239 O OE1 . GLN B 1 201 ? 10.284  -1.440  -5.506  1.00 72.70  ? 498 GLN B OE1 1 
ATOM   3240 N NE2 . GLN B 1 201 ? 8.210   -2.094  -4.949  1.00 67.90  ? 498 GLN B NE2 1 
ATOM   3241 N N   . GLN B 1 202 ? 10.958  -4.312  -9.741  1.00 51.23  ? 499 GLN B N   1 
ATOM   3242 C CA  . GLN B 1 202 ? 10.290  -4.178  -11.032 1.00 49.40  ? 499 GLN B CA  1 
ATOM   3243 C C   . GLN B 1 202 ? 10.195  -5.510  -11.775 1.00 45.70  ? 499 GLN B C   1 
ATOM   3244 O O   . GLN B 1 202 ? 9.175   -5.806  -12.394 1.00 44.99  ? 499 GLN B O   1 
ATOM   3245 C CB  . GLN B 1 202 ? 10.992  -3.131  -11.898 1.00 52.67  ? 499 GLN B CB  1 
ATOM   3246 C CG  . GLN B 1 202 ? 10.760  -1.702  -11.439 1.00 57.80  ? 499 GLN B CG  1 
ATOM   3247 C CD  . GLN B 1 202 ? 11.584  -0.702  -12.220 1.00 64.99  ? 499 GLN B CD  1 
ATOM   3248 O OE1 . GLN B 1 202 ? 12.614  -1.047  -12.798 1.00 67.11  ? 499 GLN B OE1 1 
ATOM   3249 N NE2 . GLN B 1 202 ? 11.130  0.546   -12.246 1.00 69.56  ? 499 GLN B NE2 1 
ATOM   3250 N N   . GLN B 1 203 ? 11.256  -6.309  -11.703 1.00 47.66  ? 500 GLN B N   1 
ATOM   3251 C CA  . GLN B 1 203 ? 11.279  -7.624  -12.341 1.00 46.24  ? 500 GLN B CA  1 
ATOM   3252 C C   . GLN B 1 203 ? 10.197  -8.545  -11.778 1.00 46.54  ? 500 GLN B C   1 
ATOM   3253 O O   . GLN B 1 203 ? 9.449   -9.166  -12.532 1.00 46.64  ? 500 GLN B O   1 
ATOM   3254 C CB  . GLN B 1 203 ? 12.650  -8.288  -12.175 1.00 48.65  ? 500 GLN B CB  1 
ATOM   3255 C CG  . GLN B 1 203 ? 13.812  -7.546  -12.820 1.00 50.48  ? 500 GLN B CG  1 
ATOM   3256 C CD  . GLN B 1 203 ? 15.157  -8.111  -12.402 1.00 55.76  ? 500 GLN B CD  1 
ATOM   3257 O OE1 . GLN B 1 203 ? 15.294  -9.313  -12.173 1.00 57.19  ? 500 GLN B OE1 1 
ATOM   3258 N NE2 . GLN B 1 203 ? 16.156  -7.241  -12.286 1.00 58.42  ? 500 GLN B NE2 1 
ATOM   3259 N N   . HIS B 1 204 ? 10.121  -8.631  -10.452 1.00 48.21  ? 501 HIS B N   1 
ATOM   3260 C CA  . HIS B 1 204 ? 9.150   -9.508  -9.799  1.00 46.83  ? 501 HIS B CA  1 
ATOM   3261 C C   . HIS B 1 204 ? 7.712   -9.076  -10.078 1.00 43.85  ? 501 HIS B C   1 
ATOM   3262 O O   . HIS B 1 204 ? 6.833   -9.914  -10.277 1.00 40.39  ? 501 HIS B O   1 
ATOM   3263 C CB  . HIS B 1 204 ? 9.399   -9.573  -8.288  1.00 51.61  ? 501 HIS B CB  1 
ATOM   3264 C CG  . HIS B 1 204 ? 10.750  -10.100 -7.916  1.00 56.85  ? 501 HIS B CG  1 
ATOM   3265 N ND1 . HIS B 1 204 ? 11.418  -11.044 -8.669  1.00 55.94  ? 501 HIS B ND1 1 
ATOM   3266 C CD2 . HIS B 1 204 ? 11.563  -9.813  -6.871  1.00 61.48  ? 501 HIS B CD2 1 
ATOM   3267 C CE1 . HIS B 1 204 ? 12.579  -11.315 -8.105  1.00 59.44  ? 501 HIS B CE1 1 
ATOM   3268 N NE2 . HIS B 1 204 ? 12.693  -10.581 -7.011  1.00 63.90  ? 501 HIS B NE2 1 
ATOM   3269 N N   . GLN B 1 205 ? 7.476   -7.768  -10.095 1.00 38.04  ? 502 GLN B N   1 
ATOM   3270 C CA  . GLN B 1 205 ? 6.146   -7.244  -10.384 1.00 36.93  ? 502 GLN B CA  1 
ATOM   3271 C C   . GLN B 1 205 ? 5.731   -7.516  -11.828 1.00 44.10  ? 502 GLN B C   1 
ATOM   3272 O O   . GLN B 1 205 ? 4.610   -7.956  -12.084 1.00 42.06  ? 502 GLN B O   1 
ATOM   3273 C CB  . GLN B 1 205 ? 6.072   -5.745  -10.091 1.00 40.25  ? 502 GLN B CB  1 
ATOM   3274 C CG  . GLN B 1 205 ? 6.192   -5.391  -8.620  1.00 43.13  ? 502 GLN B CG  1 
ATOM   3275 C CD  . GLN B 1 205 ? 6.136   -3.897  -8.376  1.00 56.44  ? 502 GLN B CD  1 
ATOM   3276 O OE1 . GLN B 1 205 ? 5.979   -3.111  -9.311  1.00 47.59  ? 502 GLN B OE1 1 
ATOM   3277 N NE2 . GLN B 1 205 ? 6.266   -3.495  -7.113  1.00 50.14  ? 502 GLN B NE2 1 
ATOM   3278 N N   . ARG B 1 206 ? 6.635   -7.258  -12.770 1.00 40.91  ? 503 ARG B N   1 
ATOM   3279 C CA  . ARG B 1 206 ? 6.329   -7.470  -14.184 1.00 39.19  ? 503 ARG B CA  1 
ATOM   3280 C C   . ARG B 1 206 ? 6.061   -8.944  -14.479 1.00 37.51  ? 503 ARG B C   1 
ATOM   3281 O O   . ARG B 1 206 ? 5.113   -9.279  -15.191 1.00 34.76  ? 503 ARG B O   1 
ATOM   3282 C CB  . ARG B 1 206 ? 7.458   -6.953  -15.074 1.00 39.01  ? 503 ARG B CB  1 
ATOM   3283 C CG  . ARG B 1 206 ? 7.175   -7.106  -16.559 1.00 39.39  ? 503 ARG B CG  1 
ATOM   3284 C CD  . ARG B 1 206 ? 8.256   -6.448  -17.399 1.00 43.23  ? 503 ARG B CD  1 
ATOM   3285 N NE  . ARG B 1 206 ? 7.984   -6.553  -18.827 1.00 43.79  ? 503 ARG B NE  1 
ATOM   3286 C CZ  . ARG B 1 206 ? 7.232   -5.694  -19.508 1.00 47.99  ? 503 ARG B CZ  1 
ATOM   3287 N NH1 . ARG B 1 206 ? 6.668   -4.666  -18.886 1.00 47.13  ? 503 ARG B NH1 1 
ATOM   3288 N NH2 . ARG B 1 206 ? 7.039   -5.866  -20.811 1.00 49.08  ? 503 ARG B NH2 1 
ATOM   3289 N N   . LEU B 1 207 ? 6.902   -9.812  -13.922 1.00 34.60  ? 504 LEU B N   1 
ATOM   3290 C CA  . LEU B 1 207 ? 6.744   -11.254 -14.057 1.00 30.11  ? 504 LEU B CA  1 
ATOM   3291 C C   . LEU B 1 207 ? 5.362   -11.691 -13.595 1.00 32.68  ? 504 LEU B C   1 
ATOM   3292 O O   . LEU B 1 207 ? 4.714   -12.519 -14.235 1.00 34.85  ? 504 LEU B O   1 
ATOM   3293 C CB  . LEU B 1 207 ? 7.808   -11.980 -13.238 1.00 33.30  ? 504 LEU B CB  1 
ATOM   3294 C CG  . LEU B 1 207 ? 7.570   -13.476 -13.031 1.00 35.47  ? 504 LEU B CG  1 
ATOM   3295 C CD1 . LEU B 1 207 ? 7.664   -14.222 -14.358 1.00 36.77  ? 504 LEU B CD1 1 
ATOM   3296 C CD2 . LEU B 1 207 ? 8.539   -14.050 -12.007 1.00 32.52  ? 504 LEU B CD2 1 
ATOM   3297 N N   . ALA B 1 208 ? 4.919   -11.118 -12.481 1.00 35.17  ? 505 ALA B N   1 
ATOM   3298 C CA  . ALA B 1 208 ? 3.606   -11.410 -11.922 1.00 31.69  ? 505 ALA B CA  1 
ATOM   3299 C C   . ALA B 1 208 ? 2.487   -10.895 -12.820 1.00 28.60  ? 505 ALA B C   1 
ATOM   3300 O O   . ALA B 1 208 ? 1.522   -11.611 -13.091 1.00 24.33  ? 505 ALA B O   1 
ATOM   3301 C CB  . ALA B 1 208 ? 3.483   -10.810 -10.523 1.00 30.83  ? 505 ALA B CB  1 
ATOM   3302 N N   . GLN B 1 209 ? 2.613   -9.648  -13.265 1.00 30.03  ? 506 GLN B N   1 
ATOM   3303 C CA  . GLN B 1 209 ? 1.634   -9.051  -14.171 1.00 35.84  ? 506 GLN B CA  1 
ATOM   3304 C C   . GLN B 1 209 ? 1.429   -9.921  -15.410 1.00 38.39  ? 506 GLN B C   1 
ATOM   3305 O O   . GLN B 1 209 ? 0.298   -10.141 -15.846 1.00 40.43  ? 506 GLN B O   1 
ATOM   3306 C CB  . GLN B 1 209 ? 2.072   -7.644  -14.591 1.00 35.35  ? 506 GLN B CB  1 
ATOM   3307 C CG  . GLN B 1 209 ? 2.153   -6.639  -13.449 1.00 37.58  ? 506 GLN B CG  1 
ATOM   3308 C CD  . GLN B 1 209 ? 2.981   -5.417  -13.813 1.00 45.34  ? 506 GLN B CD  1 
ATOM   3309 O OE1 . GLN B 1 209 ? 3.556   -5.345  -14.899 1.00 48.06  ? 506 GLN B OE1 1 
ATOM   3310 N NE2 . GLN B 1 209 ? 3.047   -4.450  -12.903 1.00 47.90  ? 506 GLN B NE2 1 
ATOM   3311 N N   . LEU B 1 210 ? 2.527   -10.428 -15.963 1.00 35.91  ? 507 LEU B N   1 
ATOM   3312 C CA  . LEU B 1 210 ? 2.465   -11.247 -17.169 1.00 35.79  ? 507 LEU B CA  1 
ATOM   3313 C C   . LEU B 1 210 ? 1.726   -12.560 -16.935 1.00 31.26  ? 507 LEU B C   1 
ATOM   3314 O O   . LEU B 1 210 ? 0.914   -12.978 -17.756 1.00 31.69  ? 507 LEU B O   1 
ATOM   3315 C CB  . LEU B 1 210 ? 3.870   -11.529 -17.702 1.00 37.81  ? 507 LEU B CB  1 
ATOM   3316 C CG  . LEU B 1 210 ? 4.614   -10.329 -18.289 1.00 42.42  ? 507 LEU B CG  1 
ATOM   3317 C CD1 . LEU B 1 210 ? 6.011   -10.732 -18.732 1.00 42.66  ? 507 LEU B CD1 1 
ATOM   3318 C CD2 . LEU B 1 210 ? 3.831   -9.751  -19.449 1.00 42.92  ? 507 LEU B CD2 1 
ATOM   3319 N N   . LEU B 1 211 ? 2.011   -13.208 -15.811 1.00 27.15  ? 508 LEU B N   1 
ATOM   3320 C CA  . LEU B 1 211 ? 1.416   -14.504 -15.522 1.00 27.17  ? 508 LEU B CA  1 
ATOM   3321 C C   . LEU B 1 211 ? -0.043  -14.388 -15.097 1.00 29.08  ? 508 LEU B C   1 
ATOM   3322 O O   . LEU B 1 211 ? -0.815  -15.334 -15.261 1.00 28.57  ? 508 LEU B O   1 
ATOM   3323 C CB  . LEU B 1 211 ? 2.225   -15.243 -14.458 1.00 27.43  ? 508 LEU B CB  1 
ATOM   3324 C CG  . LEU B 1 211 ? 3.680   -15.522 -14.838 1.00 29.98  ? 508 LEU B CG  1 
ATOM   3325 C CD1 . LEU B 1 211 ? 4.402   -16.184 -13.683 1.00 30.65  ? 508 LEU B CD1 1 
ATOM   3326 C CD2 . LEU B 1 211 ? 3.767   -16.378 -16.096 1.00 31.24  ? 508 LEU B CD2 1 
ATOM   3327 N N   . LEU B 1 212 ? -0.418  -13.234 -14.551 1.00 27.20  ? 509 LEU B N   1 
ATOM   3328 C CA  . LEU B 1 212 ? -1.805  -13.006 -14.162 1.00 29.60  ? 509 LEU B CA  1 
ATOM   3329 C C   . LEU B 1 212 ? -2.695  -12.849 -15.393 1.00 31.50  ? 509 LEU B C   1 
ATOM   3330 O O   . LEU B 1 212 ? -3.873  -13.196 -15.368 1.00 34.37  ? 509 LEU B O   1 
ATOM   3331 C CB  . LEU B 1 212 ? -1.930  -11.795 -13.230 1.00 29.51  ? 509 LEU B CB  1 
ATOM   3332 C CG  . LEU B 1 212 ? -1.504  -12.037 -11.776 1.00 35.45  ? 509 LEU B CG  1 
ATOM   3333 C CD1 . LEU B 1 212 ? -1.734  -10.806 -10.906 1.00 34.78  ? 509 LEU B CD1 1 
ATOM   3334 C CD2 . LEU B 1 212 ? -2.229  -13.246 -11.197 1.00 34.38  ? 509 LEU B CD2 1 
ATOM   3335 N N   . ILE B 1 213 ? -2.119  -12.337 -16.474 1.00 32.88  ? 510 ILE B N   1 
ATOM   3336 C CA  . ILE B 1 213 ? -2.838  -12.217 -17.739 1.00 33.19  ? 510 ILE B CA  1 
ATOM   3337 C C   . ILE B 1 213 ? -3.189  -13.600 -18.304 1.00 31.83  ? 510 ILE B C   1 
ATOM   3338 O O   . ILE B 1 213 ? -4.242  -13.782 -18.924 1.00 27.88  ? 510 ILE B O   1 
ATOM   3339 C CB  . ILE B 1 213 ? -2.033  -11.382 -18.755 1.00 34.05  ? 510 ILE B CB  1 
ATOM   3340 C CG1 . ILE B 1 213 ? -1.886  -9.948  -18.237 1.00 35.53  ? 510 ILE B CG1 1 
ATOM   3341 C CG2 . ILE B 1 213 ? -2.703  -11.384 -20.123 1.00 35.96  ? 510 ILE B CG2 1 
ATOM   3342 C CD1 . ILE B 1 213 ? -0.851  -9.131  -18.969 1.00 39.25  ? 510 ILE B CD1 1 
ATOM   3343 N N   . LEU B 1 214 ? -2.321  -14.578 -18.058 1.00 26.77  ? 511 LEU B N   1 
ATOM   3344 C CA  . LEU B 1 214 ? -2.594  -15.952 -18.467 1.00 26.77  ? 511 LEU B CA  1 
ATOM   3345 C C   . LEU B 1 214 ? -3.890  -16.478 -17.853 1.00 30.86  ? 511 LEU B C   1 
ATOM   3346 O O   . LEU B 1 214 ? -4.541  -17.356 -18.423 1.00 30.82  ? 511 LEU B O   1 
ATOM   3347 C CB  . LEU B 1 214 ? -1.425  -16.873 -18.113 1.00 24.92  ? 511 LEU B CB  1 
ATOM   3348 C CG  . LEU B 1 214 ? -0.088  -16.522 -18.772 1.00 30.15  ? 511 LEU B CG  1 
ATOM   3349 C CD1 . LEU B 1 214 ? 0.886   -17.686 -18.660 1.00 35.14  ? 511 LEU B CD1 1 
ATOM   3350 C CD2 . LEU B 1 214 ? -0.283  -16.116 -20.231 1.00 25.54  ? 511 LEU B CD2 1 
ATOM   3351 N N   . SER B 1 215 ? -4.266  -15.936 -16.697 1.00 27.60  ? 512 SER B N   1 
ATOM   3352 C CA  . SER B 1 215 ? -5.523  -16.321 -16.067 1.00 28.79  ? 512 SER B CA  1 
ATOM   3353 C C   . SER B 1 215 ? -6.718  -15.878 -16.909 1.00 29.32  ? 512 SER B C   1 
ATOM   3354 O O   . SER B 1 215 ? -7.703  -16.608 -17.038 1.00 28.67  ? 512 SER B O   1 
ATOM   3355 C CB  . SER B 1 215 ? -5.619  -15.752 -14.651 1.00 32.02  ? 512 SER B CB  1 
ATOM   3356 O OG  . SER B 1 215 ? -6.901  -15.985 -14.096 1.00 39.32  ? 512 SER B OG  1 
ATOM   3357 N N   . HIS B 1 216 ? -6.622  -14.684 -17.488 1.00 30.52  ? 513 HIS B N   1 
ATOM   3358 C CA  . HIS B 1 216 ? -7.682  -14.156 -18.342 1.00 31.64  ? 513 HIS B CA  1 
ATOM   3359 C C   . HIS B 1 216 ? -7.711  -14.856 -19.694 1.00 29.76  ? 513 HIS B C   1 
ATOM   3360 O O   . HIS B 1 216 ? -8.770  -15.017 -20.297 1.00 35.60  ? 513 HIS B O   1 
ATOM   3361 C CB  . HIS B 1 216 ? -7.507  -12.653 -18.539 1.00 39.39  ? 513 HIS B CB  1 
ATOM   3362 C CG  . HIS B 1 216 ? -7.460  -11.887 -17.257 1.00 52.22  ? 513 HIS B CG  1 
ATOM   3363 N ND1 . HIS B 1 216 ? -8.584  -11.337 -16.679 1.00 57.60  ? 513 HIS B ND1 1 
ATOM   3364 C CD2 . HIS B 1 216 ? -6.429  -11.591 -16.431 1.00 54.70  ? 513 HIS B CD2 1 
ATOM   3365 C CE1 . HIS B 1 216 ? -8.245  -10.729 -15.558 1.00 56.69  ? 513 HIS B CE1 1 
ATOM   3366 N NE2 . HIS B 1 216 ? -6.943  -10.867 -15.385 1.00 55.41  ? 513 HIS B NE2 1 
ATOM   3367 N N   . ILE B 1 217 ? -6.543  -15.266 -20.172 1.00 27.07  ? 514 ILE B N   1 
ATOM   3368 C CA  . ILE B 1 217 ? -6.470  -15.995 -21.431 1.00 30.44  ? 514 ILE B CA  1 
ATOM   3369 C C   . ILE B 1 217 ? -7.132  -17.369 -21.291 1.00 32.40  ? 514 ILE B C   1 
ATOM   3370 O O   . ILE B 1 217 ? -7.810  -17.839 -22.209 1.00 35.58  ? 514 ILE B O   1 
ATOM   3371 C CB  . ILE B 1 217 ? -5.020  -16.092 -21.941 1.00 30.57  ? 514 ILE B CB  1 
ATOM   3372 C CG1 . ILE B 1 217 ? -4.487  -14.685 -22.227 1.00 33.67  ? 514 ILE B CG1 1 
ATOM   3373 C CG2 . ILE B 1 217 ? -4.940  -16.949 -23.196 1.00 32.25  ? 514 ILE B CG2 1 
ATOM   3374 C CD1 . ILE B 1 217 ? -3.111  -14.651 -22.845 1.00 35.34  ? 514 ILE B CD1 1 
ATOM   3375 N N   . ARG B 1 218 ? -6.953  -17.992 -20.129 1.00 30.87  ? 515 ARG B N   1 
ATOM   3376 C CA  . ARG B 1 218 ? -7.640  -19.239 -19.805 1.00 28.49  ? 515 ARG B CA  1 
ATOM   3377 C C   . ARG B 1 218 ? -9.144  -19.016 -19.798 1.00 29.08  ? 515 ARG B C   1 
ATOM   3378 O O   . ARG B 1 218 ? -9.910  -19.816 -20.339 1.00 26.71  ? 515 ARG B O   1 
ATOM   3379 C CB  . ARG B 1 218 ? -7.214  -19.749 -18.429 1.00 28.81  ? 515 ARG B CB  1 
ATOM   3380 C CG  . ARG B 1 218 ? -7.914  -21.042 -18.029 1.00 31.33  ? 515 ARG B CG  1 
ATOM   3381 C CD  . ARG B 1 218 ? -7.304  -22.218 -18.782 1.00 34.97  ? 515 ARG B CD  1 
ATOM   3382 N NE  . ARG B 1 218 ? -6.003  -22.546 -18.211 1.00 39.38  ? 515 ARG B NE  1 
ATOM   3383 C CZ  . ARG B 1 218 ? -5.678  -23.735 -17.723 1.00 43.56  ? 515 ARG B CZ  1 
ATOM   3384 N NH1 . ARG B 1 218 ? -6.549  -24.733 -17.760 1.00 47.46  ? 515 ARG B NH1 1 
ATOM   3385 N NH2 . ARG B 1 218 ? -4.475  -23.927 -17.206 1.00 45.95  ? 515 ARG B NH2 1 
ATOM   3386 N N   . HIS B 1 219 ? -9.556  -17.920 -19.172 1.00 27.70  ? 516 HIS B N   1 
ATOM   3387 C CA  . HIS B 1 219 ? -10.962 -17.554 -19.092 1.00 28.82  ? 516 HIS B CA  1 
ATOM   3388 C C   . HIS B 1 219 ? -11.567 -17.345 -20.483 1.00 29.95  ? 516 HIS B C   1 
ATOM   3389 O O   . HIS B 1 219 ? -12.638 -17.873 -20.787 1.00 31.09  ? 516 HIS B O   1 
ATOM   3390 C CB  . HIS B 1 219 ? -11.129 -16.298 -18.236 1.00 28.71  ? 516 HIS B CB  1 
ATOM   3391 C CG  . HIS B 1 219 ? -12.554 -15.896 -18.027 1.00 34.43  ? 516 HIS B CG  1 
ATOM   3392 N ND1 . HIS B 1 219 ? -13.110 -14.787 -18.628 1.00 39.21  ? 516 HIS B ND1 1 
ATOM   3393 C CD2 . HIS B 1 219 ? -13.539 -16.455 -17.285 1.00 34.84  ? 516 HIS B CD2 1 
ATOM   3394 C CE1 . HIS B 1 219 ? -14.375 -14.680 -18.267 1.00 40.10  ? 516 HIS B CE1 1 
ATOM   3395 N NE2 . HIS B 1 219 ? -14.661 -15.679 -17.451 1.00 39.14  ? 516 HIS B NE2 1 
ATOM   3396 N N   . MET B 1 220 ? -10.871 -16.589 -21.328 1.00 27.50  ? 517 MET B N   1 
ATOM   3397 C CA  . MET B 1 220 ? -11.337 -16.350 -22.691 1.00 27.50  ? 517 MET B CA  1 
ATOM   3398 C C   . MET B 1 220 ? -11.415 -17.654 -23.485 1.00 27.70  ? 517 MET B C   1 
ATOM   3399 O O   . MET B 1 220 ? -12.352 -17.868 -24.258 1.00 28.91  ? 517 MET B O   1 
ATOM   3400 C CB  . MET B 1 220 ? -10.440 -15.330 -23.404 1.00 25.51  ? 517 MET B CB  1 
ATOM   3401 C CG  . MET B 1 220 ? -10.488 -13.934 -22.791 1.00 26.73  ? 517 MET B CG  1 
ATOM   3402 S SD  . MET B 1 220 ? -9.542  -12.697 -23.708 1.00 32.74  ? 517 MET B SD  1 
ATOM   3403 C CE  . MET B 1 220 ? -7.873  -13.289 -23.467 1.00 26.40  ? 517 MET B CE  1 
ATOM   3404 N N   . SER B 1 221 ? -10.432 -18.524 -23.282 1.00 24.88  ? 518 SER B N   1 
ATOM   3405 C CA  . SER B 1 221 ? -10.423 -19.831 -23.931 1.00 30.51  ? 518 SER B CA  1 
ATOM   3406 C C   . SER B 1 221 ? -11.662 -20.647 -23.562 1.00 33.36  ? 518 SER B C   1 
ATOM   3407 O O   . SER B 1 221 ? -12.358 -21.161 -24.441 1.00 34.01  ? 518 SER B O   1 
ATOM   3408 C CB  . SER B 1 221 ? -9.161  -20.603 -23.546 1.00 30.31  ? 518 SER B CB  1 
ATOM   3409 O OG  . SER B 1 221 ? -9.115  -21.859 -24.198 1.00 34.90  ? 518 SER B OG  1 
ATOM   3410 N N   . ASN B 1 222 ? -11.932 -20.753 -22.261 1.00 33.01  ? 519 ASN B N   1 
ATOM   3411 C CA  . ASN B 1 222 ? -13.076 -21.515 -21.761 1.00 33.64  ? 519 ASN B CA  1 
ATOM   3412 C C   . ASN B 1 222 ? -14.407 -21.015 -22.312 1.00 33.02  ? 519 ASN B C   1 
ATOM   3413 O O   . ASN B 1 222 ? -15.240 -21.809 -22.750 1.00 35.11  ? 519 ASN B O   1 
ATOM   3414 C CB  . ASN B 1 222 ? -13.114 -21.508 -20.231 1.00 31.32  ? 519 ASN B CB  1 
ATOM   3415 C CG  . ASN B 1 222 ? -11.936 -22.235 -19.611 1.00 34.24  ? 519 ASN B CG  1 
ATOM   3416 O OD1 . ASN B 1 222 ? -11.324 -21.750 -18.659 1.00 41.35  ? 519 ASN B OD1 1 
ATOM   3417 N ND2 . ASN B 1 222 ? -11.615 -23.405 -20.143 1.00 33.26  ? 519 ASN B ND2 1 
ATOM   3418 N N   . LYS B 1 223 ? -14.607 -19.700 -22.280 1.00 30.77  ? 520 LYS B N   1 
ATOM   3419 C CA  . LYS B 1 223 ? -15.804 -19.096 -22.857 1.00 37.97  ? 520 LYS B CA  1 
ATOM   3420 C C   . LYS B 1 223 ? -15.881 -19.382 -24.353 1.00 40.27  ? 520 LYS B C   1 
ATOM   3421 O O   . LYS B 1 223 ? -16.955 -19.665 -24.888 1.00 44.91  ? 520 LYS B O   1 
ATOM   3422 C CB  . LYS B 1 223 ? -15.819 -17.587 -22.611 1.00 42.74  ? 520 LYS B CB  1 
ATOM   3423 C CG  . LYS B 1 223 ? -15.859 -17.207 -21.145 1.00 49.44  ? 520 LYS B CG  1 
ATOM   3424 C CD  . LYS B 1 223 ? -17.110 -17.750 -20.475 1.00 56.33  ? 520 LYS B CD  1 
ATOM   3425 C CE  . LYS B 1 223 ? -17.015 -17.635 -18.966 1.00 59.35  ? 520 LYS B CE  1 
ATOM   3426 N NZ  . LYS B 1 223 ? -18.285 -18.046 -18.308 1.00 65.81  ? 520 LYS B NZ  1 
ATOM   3427 N N   . GLY B 1 224 ? -14.733 -19.312 -25.020 1.00 33.59  ? 521 GLY B N   1 
ATOM   3428 C CA  . GLY B 1 224 ? -14.658 -19.609 -26.435 1.00 32.04  ? 521 GLY B CA  1 
ATOM   3429 C C   . GLY B 1 224 ? -15.037 -21.040 -26.760 1.00 33.49  ? 521 GLY B C   1 
ATOM   3430 O O   . GLY B 1 224 ? -15.865 -21.270 -27.641 1.00 39.96  ? 521 GLY B O   1 
ATOM   3431 N N   . MET B 1 225 ? -14.430 -21.996 -26.057 1.00 37.16  ? 522 MET B N   1 
ATOM   3432 C CA  . MET B 1 225 ? -14.702 -23.420 -26.275 1.00 40.70  ? 522 MET B CA  1 
ATOM   3433 C C   . MET B 1 225 ? -16.176 -23.710 -26.107 1.00 40.46  ? 522 MET B C   1 
ATOM   3434 O O   . MET B 1 225 ? -16.787 -24.408 -26.917 1.00 41.99  ? 522 MET B O   1 
ATOM   3435 C CB  . MET B 1 225 ? -13.920 -24.272 -25.278 1.00 42.00  ? 522 MET B CB  1 
ATOM   3436 C CG  . MET B 1 225 ? -12.427 -24.307 -25.502 1.00 45.44  ? 522 MET B CG  1 
ATOM   3437 S SD  . MET B 1 225 ? -11.964 -25.233 -26.973 1.00 53.61  ? 522 MET B SD  1 
ATOM   3438 C CE  . MET B 1 225 ? -10.209 -25.396 -26.674 1.00 91.11  ? 522 MET B CE  1 
ATOM   3439 N N   . GLU B 1 226 ? -16.725 -23.163 -25.029 1.00 39.75  ? 523 GLU B N   1 
ATOM   3440 C CA  . GLU B 1 226 ? -18.132 -23.292 -24.668 1.00 46.65  ? 523 GLU B CA  1 
ATOM   3441 C C   . GLU B 1 226 ? -19.024 -22.966 -25.858 1.00 52.96  ? 523 GLU B C   1 
ATOM   3442 O O   . GLU B 1 226 ? -19.863 -23.772 -26.266 1.00 56.27  ? 523 GLU B O   1 
ATOM   3443 C CB  . GLU B 1 226 ? -18.417 -22.322 -23.523 1.00 53.00  ? 523 GLU B CB  1 
ATOM   3444 C CG  . GLU B 1 226 ? -19.624 -22.649 -22.671 1.00 62.28  ? 523 GLU B CG  1 
ATOM   3445 C CD  . GLU B 1 226 ? -19.812 -21.643 -21.549 1.00 66.77  ? 523 GLU B CD  1 
ATOM   3446 O OE1 . GLU B 1 226 ? -20.646 -21.896 -20.654 1.00 69.73  ? 523 GLU B OE1 1 
ATOM   3447 O OE2 . GLU B 1 226 ? -19.125 -20.596 -21.565 1.00 67.76  ? 523 GLU B OE2 1 
ATOM   3448 N N   . HIS B 1 227 ? -18.818 -21.780 -26.420 1.00 52.52  ? 524 HIS B N   1 
ATOM   3449 C CA  . HIS B 1 227 ? -19.612 -21.312 -27.548 1.00 54.75  ? 524 HIS B CA  1 
ATOM   3450 C C   . HIS B 1 227 ? -19.382 -22.173 -28.791 1.00 58.29  ? 524 HIS B C   1 
ATOM   3451 O O   . HIS B 1 227 ? -20.307 -22.431 -29.560 1.00 62.68  ? 524 HIS B O   1 
ATOM   3452 C CB  . HIS B 1 227 ? -19.274 -19.852 -27.846 1.00 49.09  ? 524 HIS B CB  1 
ATOM   3453 N N   . LEU B 1 228 ? -18.144 -22.625 -28.963 1.00 55.80  ? 525 LEU B N   1 
ATOM   3454 C CA  . LEU B 1 228 ? -17.759 -23.491 -30.074 1.00 55.61  ? 525 LEU B CA  1 
ATOM   3455 C C   . LEU B 1 228 ? -18.460 -24.844 -30.012 1.00 60.39  ? 525 LEU B C   1 
ATOM   3456 O O   . LEU B 1 228 ? -18.960 -25.341 -31.023 1.00 65.45  ? 525 LEU B O   1 
ATOM   3457 C CB  . LEU B 1 228 ? -16.242 -23.695 -30.069 1.00 51.72  ? 525 LEU B CB  1 
ATOM   3458 C CG  . LEU B 1 228 ? -15.471 -23.183 -31.282 1.00 54.49  ? 525 LEU B CG  1 
ATOM   3459 C CD1 . LEU B 1 228 ? -15.962 -21.802 -31.666 1.00 56.94  ? 525 LEU B CD1 1 
ATOM   3460 C CD2 . LEU B 1 228 ? -13.975 -23.163 -30.998 1.00 51.66  ? 525 LEU B CD2 1 
ATOM   3461 N N   . TYR B 1 229 ? -18.491 -25.434 -28.820 1.00 60.15  ? 526 TYR B N   1 
ATOM   3462 C CA  . TYR B 1 229 ? -19.134 -26.728 -28.609 1.00 63.02  ? 526 TYR B CA  1 
ATOM   3463 C C   . TYR B 1 229 ? -20.646 -26.630 -28.785 1.00 68.72  ? 526 TYR B C   1 
ATOM   3464 O O   . TYR B 1 229 ? -21.313 -27.623 -29.065 1.00 74.80  ? 526 TYR B O   1 
ATOM   3465 C CB  . TYR B 1 229 ? -18.793 -27.271 -27.218 1.00 59.09  ? 526 TYR B CB  1 
ATOM   3466 N N   . SER B 1 230 ? -21.185 -25.425 -28.629 1.00 67.99  ? 527 SER B N   1 
ATOM   3467 C CA  . SER B 1 230 ? -22.627 -25.208 -28.756 1.00 73.88  ? 527 SER B CA  1 
ATOM   3468 C C   . SER B 1 230 ? -23.081 -25.226 -30.212 1.00 84.60  ? 527 SER B C   1 
ATOM   3469 O O   . SER B 1 230 ? -24.172 -25.718 -30.518 1.00 89.90  ? 527 SER B O   1 
ATOM   3470 C CB  . SER B 1 230 ? -23.037 -23.890 -28.098 1.00 70.54  ? 527 SER B CB  1 
ATOM   3471 O OG  . SER B 1 230 ? -22.598 -22.781 -28.851 1.00 67.95  ? 527 SER B OG  1 
ATOM   3472 N N   . MET B 1 231 ? -22.254 -24.681 -31.102 1.00 87.84  ? 528 MET B N   1 
ATOM   3473 C CA  . MET B 1 231 ? -22.627 -24.564 -32.508 1.00 95.25  ? 528 MET B CA  1 
ATOM   3474 C C   . MET B 1 231 ? -22.127 -25.751 -33.309 1.00 98.51  ? 528 MET B C   1 
ATOM   3475 O O   . MET B 1 231 ? -22.409 -25.869 -34.503 1.00 100.62 ? 528 MET B O   1 
ATOM   3476 C CB  . MET B 1 231 ? -22.071 -23.272 -33.110 1.00 93.83  ? 528 MET B CB  1 
ATOM   3477 C CG  . MET B 1 231 ? -20.597 -23.359 -33.489 1.00 89.89  ? 528 MET B CG  1 
ATOM   3478 S SD  . MET B 1 231 ? -19.968 -21.918 -34.353 1.00 113.48 ? 528 MET B SD  1 
ATOM   3479 C CE  . MET B 1 231 ? -19.798 -20.751 -33.055 1.00 109.85 ? 528 MET B CE  1 
ATOM   3480 N N   . LYS B 1 232 ? -21.357 -26.611 -32.651 1.00 97.85  ? 529 LYS B N   1 
ATOM   3481 C CA  . LYS B 1 232 ? -21.027 -27.910 -33.212 1.00 100.72 ? 529 LYS B CA  1 
ATOM   3482 C C   . LYS B 1 232 ? -22.319 -28.714 -33.257 1.00 105.33 ? 529 LYS B C   1 
ATOM   3483 O O   . LYS B 1 232 ? -22.557 -29.484 -34.188 1.00 109.87 ? 529 LYS B O   1 
ATOM   3484 C CB  . LYS B 1 232 ? -19.991 -28.624 -32.342 1.00 98.32  ? 529 LYS B CB  1 
ATOM   3485 C CG  . LYS B 1 232 ? -19.760 -30.083 -32.708 1.00 101.08 ? 529 LYS B CG  1 
ATOM   3486 C CD  . LYS B 1 232 ? -18.927 -30.797 -31.650 1.00 98.22  ? 529 LYS B CD  1 
ATOM   3487 C CE  . LYS B 1 232 ? -19.607 -30.745 -30.287 1.00 95.91  ? 529 LYS B CE  1 
ATOM   3488 N NZ  . LYS B 1 232 ? -18.819 -31.444 -29.231 1.00 93.21  ? 529 LYS B NZ  1 
ATOM   3489 N N   . CYS B 1 233 ? -23.156 -28.513 -32.242 1.00 103.82 ? 530 CYS B N   1 
ATOM   3490 C CA  . CYS B 1 233 ? -24.457 -29.167 -32.167 1.00 108.00 ? 530 CYS B CA  1 
ATOM   3491 C C   . CYS B 1 233 ? -25.473 -28.446 -33.045 1.00 110.10 ? 530 CYS B C   1 
ATOM   3492 O O   . CYS B 1 233 ? -26.461 -29.036 -33.480 1.00 114.42 ? 530 CYS B O   1 
ATOM   3493 C CB  . CYS B 1 233 ? -24.954 -29.205 -30.721 1.00 107.03 ? 530 CYS B CB  1 
ATOM   3494 S SG  . CYS B 1 233 ? -23.813 -29.990 -29.561 1.00 144.78 ? 530 CYS B SG  1 
ATOM   3495 N N   . LYS B 1 234 ? -25.225 -27.165 -33.299 1.00 139.08 ? 531 LYS B N   1 
ATOM   3496 C CA  . LYS B 1 234 ? -26.092 -26.380 -34.169 1.00 143.58 ? 531 LYS B CA  1 
ATOM   3497 C C   . LYS B 1 234 ? -25.805 -26.718 -35.623 1.00 142.76 ? 531 LYS B C   1 
ATOM   3498 O O   . LYS B 1 234 ? -26.515 -26.277 -36.525 1.00 147.69 ? 531 LYS B O   1 
ATOM   3499 C CB  . LYS B 1 234 ? -25.893 -24.883 -33.930 1.00 141.73 ? 531 LYS B CB  1 
ATOM   3500 N N   . ASN B 1 235 ? -24.742 -27.485 -35.842 1.00 137.24 ? 532 ASN B N   1 
ATOM   3501 C CA  . ASN B 1 235 ? -24.372 -27.964 -37.175 1.00 136.00 ? 532 ASN B CA  1 
ATOM   3502 C C   . ASN B 1 235 ? -23.999 -26.878 -38.195 1.00 133.40 ? 532 ASN B C   1 
ATOM   3503 O O   . ASN B 1 235 ? -23.101 -27.085 -39.010 1.00 129.39 ? 532 ASN B O   1 
ATOM   3504 C CB  . ASN B 1 235 ? -25.453 -28.894 -37.741 1.00 143.33 ? 532 ASN B CB  1 
ATOM   3505 N N   . VAL B 1 236 ? -24.686 -25.737 -38.150 1.00 135.87 ? 533 VAL B N   1 
ATOM   3506 C CA  . VAL B 1 236 ? -24.430 -24.638 -39.082 1.00 134.07 ? 533 VAL B CA  1 
ATOM   3507 C C   . VAL B 1 236 ? -22.977 -24.153 -38.989 1.00 126.01 ? 533 VAL B C   1 
ATOM   3508 O O   . VAL B 1 236 ? -22.371 -23.746 -39.984 1.00 124.26 ? 533 VAL B O   1 
ATOM   3509 C CB  . VAL B 1 236 ? -25.394 -23.449 -38.849 1.00 138.20 ? 533 VAL B CB  1 
ATOM   3510 C CG1 . VAL B 1 236 ? -25.227 -22.408 -39.952 1.00 138.55 ? 533 VAL B CG1 1 
ATOM   3511 C CG2 . VAL B 1 236 ? -26.843 -23.937 -38.777 1.00 146.34 ? 533 VAL B CG2 1 
ATOM   3512 N N   . PRO B 1 238 ? -19.211 -26.101 -40.021 1.00 113.08 ? 535 PRO B N   1 
ATOM   3513 C CA  . PRO B 1 238 ? -18.229 -26.192 -41.101 1.00 110.28 ? 535 PRO B CA  1 
ATOM   3514 C C   . PRO B 1 238 ? -16.870 -26.508 -40.508 1.00 101.89 ? 535 PRO B C   1 
ATOM   3515 O O   . PRO B 1 238 ? -15.823 -26.239 -41.101 1.00 98.51  ? 535 PRO B O   1 
ATOM   3516 C CB  . PRO B 1 238 ? -18.246 -24.784 -41.701 1.00 112.64 ? 535 PRO B CB  1 
ATOM   3517 C CG  . PRO B 1 238 ? -19.089 -23.926 -40.753 1.00 114.92 ? 535 PRO B CG  1 
ATOM   3518 C CD  . PRO B 1 238 ? -19.316 -24.727 -39.517 1.00 112.96 ? 535 PRO B CD  1 
ATOM   3519 N N   . LEU B 1 239 ? -16.915 -27.087 -39.315 1.00 99.09  ? 536 LEU B N   1 
ATOM   3520 C CA  . LEU B 1 239 ? -15.717 -27.407 -38.568 1.00 92.70  ? 536 LEU B CA  1 
ATOM   3521 C C   . LEU B 1 239 ? -14.925 -28.470 -39.309 1.00 88.47  ? 536 LEU B C   1 
ATOM   3522 O O   . LEU B 1 239 ? -15.486 -29.457 -39.786 1.00 90.47  ? 536 LEU B O   1 
ATOM   3523 C CB  . LEU B 1 239 ? -16.070 -27.889 -37.160 1.00 92.46  ? 536 LEU B CB  1 
ATOM   3524 C CG  . LEU B 1 239 ? -16.522 -26.848 -36.135 1.00 92.52  ? 536 LEU B CG  1 
ATOM   3525 C CD1 . LEU B 1 239 ? -17.992 -26.505 -36.309 1.00 98.54  ? 536 LEU B CD1 1 
ATOM   3526 C CD2 . LEU B 1 239 ? -16.268 -27.361 -34.730 1.00 90.22  ? 536 LEU B CD2 1 
ATOM   3527 N N   . SER B 1 240 ? -13.620 -28.247 -39.419 1.00 81.51  ? 537 SER B N   1 
ATOM   3528 C CA  . SER B 1 240 ? -12.724 -29.196 -40.063 1.00 78.52  ? 537 SER B CA  1 
ATOM   3529 C C   . SER B 1 240 ? -12.430 -30.351 -39.109 1.00 76.41  ? 537 SER B C   1 
ATOM   3530 O O   . SER B 1 240 ? -12.713 -30.267 -37.911 1.00 75.24  ? 537 SER B O   1 
ATOM   3531 C CB  . SER B 1 240 ? -11.431 -28.505 -40.472 1.00 76.14  ? 537 SER B CB  1 
ATOM   3532 O OG  . SER B 1 240 ? -10.718 -28.066 -39.330 1.00 73.81  ? 537 SER B OG  1 
ATOM   3533 N N   . ASP B 1 241 ? -11.847 -31.420 -39.640 1.00 74.60  ? 538 ASP B N   1 
ATOM   3534 C CA  . ASP B 1 241 ? -11.687 -32.665 -38.893 1.00 74.40  ? 538 ASP B CA  1 
ATOM   3535 C C   . ASP B 1 241 ? -10.729 -32.619 -37.695 1.00 70.20  ? 538 ASP B C   1 
ATOM   3536 O O   . ASP B 1 241 ? -10.996 -33.256 -36.679 1.00 74.33  ? 538 ASP B O   1 
ATOM   3537 C CB  . ASP B 1 241 ? -11.311 -33.798 -39.849 1.00 79.87  ? 538 ASP B CB  1 
ATOM   3538 C CG  . ASP B 1 241 ? -12.444 -34.182 -40.782 1.00 84.78  ? 538 ASP B CG  1 
ATOM   3539 O OD1 . ASP B 1 241 ? -13.496 -33.515 -40.759 1.00 86.13  ? 538 ASP B OD1 1 
ATOM   3540 O OD2 . ASP B 1 241 ? -12.269 -35.158 -41.544 1.00 88.32  ? 538 ASP B OD2 1 
ATOM   3541 N N   . LEU B 1 242 ? -9.630  -31.879 -37.804 1.00 63.63  ? 539 LEU B N   1 
ATOM   3542 C CA  . LEU B 1 242 ? -8.713  -31.739 -36.676 1.00 58.80  ? 539 LEU B CA  1 
ATOM   3543 C C   . LEU B 1 242 ? -9.309  -30.820 -35.612 1.00 58.36  ? 539 LEU B C   1 
ATOM   3544 O O   . LEU B 1 242 ? -9.096  -31.009 -34.417 1.00 56.12  ? 539 LEU B O   1 
ATOM   3545 C CB  . LEU B 1 242 ? -7.354  -31.204 -37.140 1.00 54.93  ? 539 LEU B CB  1 
ATOM   3546 C CG  . LEU B 1 242 ? -6.332  -30.741 -36.096 1.00 52.82  ? 539 LEU B CG  1 
ATOM   3547 C CD1 . LEU B 1 242 ? -5.855  -31.911 -35.255 1.00 50.64  ? 539 LEU B CD1 1 
ATOM   3548 C CD2 . LEU B 1 242 ? -5.160  -30.046 -36.771 1.00 55.02  ? 539 LEU B CD2 1 
ATOM   3549 N N   . LEU B 1 243 ? -10.073 -29.830 -36.056 1.00 59.02  ? 540 LEU B N   1 
ATOM   3550 C CA  . LEU B 1 243 ? -10.694 -28.875 -35.149 1.00 59.42  ? 540 LEU B CA  1 
ATOM   3551 C C   . LEU B 1 243 ? -11.851 -29.528 -34.395 1.00 64.44  ? 540 LEU B C   1 
ATOM   3552 O O   . LEU B 1 243 ? -12.165 -29.137 -33.270 1.00 65.17  ? 540 LEU B O   1 
ATOM   3553 C CB  . LEU B 1 243 ? -11.167 -27.645 -35.928 1.00 60.66  ? 540 LEU B CB  1 
ATOM   3554 C CG  . LEU B 1 243 ? -11.303 -26.324 -35.168 1.00 62.10  ? 540 LEU B CG  1 
ATOM   3555 C CD1 . LEU B 1 243 ? -10.108 -26.091 -34.266 1.00 51.48  ? 540 LEU B CD1 1 
ATOM   3556 C CD2 . LEU B 1 243 ? -11.447 -25.179 -36.155 1.00 61.96  ? 540 LEU B CD2 1 
ATOM   3557 N N   . LEU B 1 244 ? -12.475 -30.526 -35.019 1.00 67.50  ? 541 LEU B N   1 
ATOM   3558 C CA  . LEU B 1 244 ? -13.568 -31.268 -34.393 1.00 71.42  ? 541 LEU B CA  1 
ATOM   3559 C C   . LEU B 1 244 ? -13.063 -32.189 -33.287 1.00 73.33  ? 541 LEU B C   1 
ATOM   3560 O O   . LEU B 1 244 ? -13.740 -32.380 -32.273 1.00 80.26  ? 541 LEU B O   1 
ATOM   3561 C CB  . LEU B 1 244 ? -14.356 -32.074 -35.434 1.00 74.42  ? 541 LEU B CB  1 
ATOM   3562 C CG  . LEU B 1 244 ? -15.694 -31.496 -35.913 1.00 76.17  ? 541 LEU B CG  1 
ATOM   3563 C CD1 . LEU B 1 244 ? -16.361 -32.404 -36.943 1.00 79.19  ? 541 LEU B CD1 1 
ATOM   3564 C CD2 . LEU B 1 244 ? -16.629 -31.265 -34.740 1.00 76.52  ? 541 LEU B CD2 1 
ATOM   3565 N N   . GLU B 1 245 ? -11.879 -32.764 -33.487 1.00 66.98  ? 542 GLU B N   1 
ATOM   3566 C CA  . GLU B 1 245 ? -11.281 -33.637 -32.479 1.00 66.70  ? 542 GLU B CA  1 
ATOM   3567 C C   . GLU B 1 245 ? -10.688 -32.835 -31.319 1.00 66.33  ? 542 GLU B C   1 
ATOM   3568 O O   . GLU B 1 245 ? -10.547 -33.344 -30.208 1.00 66.32  ? 542 GLU B O   1 
ATOM   3569 C CB  . GLU B 1 245 ? -10.229 -34.556 -33.105 1.00 63.38  ? 542 GLU B CB  1 
ATOM   3570 C CG  . GLU B 1 245 ? -10.806 -35.472 -34.185 1.00 66.08  ? 542 GLU B CG  1 
ATOM   3571 C CD  . GLU B 1 245 ? -9.844  -36.565 -34.626 1.00 66.56  ? 542 GLU B CD  1 
ATOM   3572 O OE1 . GLU B 1 245 ? -8.720  -36.646 -34.081 1.00 65.48  ? 542 GLU B OE1 1 
ATOM   3573 O OE2 . GLU B 1 245 ? -10.221 -37.351 -35.519 1.00 69.41  ? 542 GLU B OE2 1 
ATOM   3574 N N   . MET B 1 246 ? -10.344 -31.578 -31.584 1.00 67.24  ? 543 MET B N   1 
ATOM   3575 C CA  . MET B 1 246 ? -9.877  -30.674 -30.538 1.00 66.15  ? 543 MET B CA  1 
ATOM   3576 C C   . MET B 1 246 ? -11.028 -30.335 -29.602 1.00 71.53  ? 543 MET B C   1 
ATOM   3577 O O   . MET B 1 246 ? -10.875 -30.361 -28.381 1.00 77.75  ? 543 MET B O   1 
ATOM   3578 C CB  . MET B 1 246 ? -9.308  -29.389 -31.141 1.00 61.37  ? 543 MET B CB  1 
ATOM   3579 C CG  . MET B 1 246 ? -8.029  -29.572 -31.937 1.00 59.73  ? 543 MET B CG  1 
ATOM   3580 S SD  . MET B 1 246 ? -6.636  -30.163 -30.965 1.00 89.21  ? 543 MET B SD  1 
ATOM   3581 C CE  . MET B 1 246 ? -5.316  -30.004 -32.165 1.00 50.07  ? 543 MET B CE  1 
ATOM   3582 N N   . LEU B 1 247 ? -12.182 -30.018 -30.183 1.00 71.10  ? 544 LEU B N   1 
ATOM   3583 C CA  . LEU B 1 247 ? -13.369 -29.679 -29.404 1.00 74.22  ? 544 LEU B CA  1 
ATOM   3584 C C   . LEU B 1 247 ? -13.812 -30.822 -28.500 1.00 77.96  ? 544 LEU B C   1 
ATOM   3585 O O   . LEU B 1 247 ? -14.180 -30.600 -27.346 1.00 82.57  ? 544 LEU B O   1 
ATOM   3586 C CB  . LEU B 1 247 ? -14.523 -29.270 -30.321 1.00 74.64  ? 544 LEU B CB  1 
ATOM   3587 C CG  . LEU B 1 247 ? -14.792 -27.770 -30.441 1.00 74.13  ? 544 LEU B CG  1 
ATOM   3588 C CD1 . LEU B 1 247 ? -13.658 -27.072 -31.173 1.00 72.06  ? 544 LEU B CD1 1 
ATOM   3589 C CD2 . LEU B 1 247 ? -16.124 -27.521 -31.129 1.00 75.53  ? 544 LEU B CD2 1 
ATOM   3590 N N   . ASP B 1 248 ? -13.774 -32.042 -29.028 1.00 77.09  ? 545 ASP B N   1 
ATOM   3591 C CA  . ASP B 1 248 ? -14.204 -33.216 -28.275 1.00 83.13  ? 545 ASP B CA  1 
ATOM   3592 C C   . ASP B 1 248 ? -13.327 -33.478 -27.057 1.00 84.70  ? 545 ASP B C   1 
ATOM   3593 O O   . ASP B 1 248 ? -13.750 -34.141 -26.110 1.00 88.56  ? 545 ASP B O   1 
ATOM   3594 C CB  . ASP B 1 248 ? -14.242 -34.454 -29.173 1.00 84.01  ? 545 ASP B CB  1 
ATOM   3595 C CG  . ASP B 1 248 ? -15.470 -34.491 -30.057 1.00 86.32  ? 545 ASP B CG  1 
ATOM   3596 O OD1 . ASP B 1 248 ? -15.967 -35.602 -30.336 1.00 93.12  ? 545 ASP B OD1 1 
ATOM   3597 O OD2 . ASP B 1 248 ? -15.939 -33.410 -30.470 1.00 83.60  ? 545 ASP B OD2 1 
ATOM   3598 N N   . ALA B 1 249 ? -12.108 -32.953 -27.085 1.00 82.19  ? 546 ALA B N   1 
ATOM   3599 C CA  . ALA B 1 249 ? -11.194 -33.090 -25.959 1.00 85.42  ? 546 ALA B CA  1 
ATOM   3600 C C   . ALA B 1 249 ? -11.667 -32.278 -24.753 1.00 86.77  ? 546 ALA B C   1 
ATOM   3601 O O   . ALA B 1 249 ? -11.214 -32.501 -23.631 1.00 91.77  ? 546 ALA B O   1 
ATOM   3602 C CB  . ALA B 1 249 ? -9.791  -32.676 -26.364 1.00 83.82  ? 546 ALA B CB  1 
ATOM   3603 N N   . HIS B 1 250 ? -12.578 -31.337 -24.989 1.00 84.20  ? 547 HIS B N   1 
ATOM   3604 C CA  . HIS B 1 250 ? -13.131 -30.514 -23.916 1.00 86.98  ? 547 HIS B CA  1 
ATOM   3605 C C   . HIS B 1 250 ? -14.555 -30.928 -23.549 1.00 92.24  ? 547 HIS B C   1 
ATOM   3606 O O   . HIS B 1 250 ? -15.213 -30.275 -22.738 1.00 94.94  ? 547 HIS B O   1 
ATOM   3607 C CB  . HIS B 1 250 ? -13.090 -29.032 -24.297 1.00 83.71  ? 547 HIS B CB  1 
ATOM   3608 C CG  . HIS B 1 250 ? -11.727 -28.421 -24.201 1.00 80.65  ? 547 HIS B CG  1 
ATOM   3609 N ND1 . HIS B 1 250 ? -11.382 -27.522 -23.215 1.00 84.21  ? 547 HIS B ND1 1 
ATOM   3610 C CD2 . HIS B 1 250 ? -10.620 -28.586 -24.964 1.00 75.27  ? 547 HIS B CD2 1 
ATOM   3611 C CE1 . HIS B 1 250 ? -10.122 -27.157 -23.376 1.00 80.78  ? 547 HIS B CE1 1 
ATOM   3612 N NE2 . HIS B 1 250 ? -9.636  -27.789 -24.429 1.00 74.42  ? 547 HIS B NE2 1 
ATOM   3613 N N   . ARG B 1 251 ? -15.023 -32.018 -24.148 1.00 94.56  ? 548 ARG B N   1 
ATOM   3614 C CA  . ARG B 1 251 ? -16.364 -32.527 -23.884 1.00 99.37  ? 548 ARG B CA  1 
ATOM   3615 C C   . ARG B 1 251 ? -16.364 -34.049 -23.825 1.00 102.55 ? 548 ARG B C   1 
ATOM   3616 O O   . ARG B 1 251 ? -15.471 -34.656 -23.234 1.00 103.76 ? 548 ARG B O   1 
ATOM   3617 C CB  . ARG B 1 251 ? -17.343 -32.042 -24.954 1.00 98.80  ? 548 ARG B CB  1 
ATOM   3618 N N   . HIS C 2 2   ? -32.388 -3.802  -7.469  1.00 94.84  ? 687 HIS C N   1 
ATOM   3619 C CA  . HIS C 2 2   ? -30.941 -3.970  -7.541  1.00 90.44  ? 687 HIS C CA  1 
ATOM   3620 C C   . HIS C 2 2   ? -30.529 -5.388  -7.155  1.00 82.49  ? 687 HIS C C   1 
ATOM   3621 O O   . HIS C 2 2   ? -31.302 -6.333  -7.313  1.00 82.63  ? 687 HIS C O   1 
ATOM   3622 C CB  . HIS C 2 2   ? -30.236 -2.951  -6.643  1.00 93.33  ? 687 HIS C CB  1 
ATOM   3623 N N   . LYS C 2 3   ? -29.309 -5.532  -6.646  1.00 76.67  ? 688 LYS C N   1 
ATOM   3624 C CA  . LYS C 2 3   ? -28.784 -6.844  -6.284  1.00 68.41  ? 688 LYS C CA  1 
ATOM   3625 C C   . LYS C 2 3   ? -28.682 -7.035  -4.771  1.00 66.76  ? 688 LYS C C   1 
ATOM   3626 O O   . LYS C 2 3   ? -28.554 -6.072  -4.017  1.00 69.89  ? 688 LYS C O   1 
ATOM   3627 C CB  . LYS C 2 3   ? -27.412 -7.069  -6.923  1.00 65.11  ? 688 LYS C CB  1 
ATOM   3628 C CG  . LYS C 2 3   ? -27.389 -6.952  -8.439  1.00 67.10  ? 688 LYS C CG  1 
ATOM   3629 C CD  . LYS C 2 3   ? -26.059 -7.436  -8.999  1.00 65.94  ? 688 LYS C CD  1 
ATOM   3630 C CE  . LYS C 2 3   ? -25.984 -7.263  -10.506 1.00 68.42  ? 688 LYS C CE  1 
ATOM   3631 N NZ  . LYS C 2 3   ? -25.941 -5.828  -10.901 1.00 77.85  ? 688 LYS C NZ  1 
ATOM   3632 N N   . ILE C 2 4   ? -28.741 -8.290  -4.339  1.00 62.76  ? 689 ILE C N   1 
ATOM   3633 C CA  . ILE C 2 4   ? -28.536 -8.636  -2.940  1.00 61.76  ? 689 ILE C CA  1 
ATOM   3634 C C   . ILE C 2 4   ? -27.088 -8.357  -2.556  1.00 61.01  ? 689 ILE C C   1 
ATOM   3635 O O   . ILE C 2 4   ? -26.801 -7.899  -1.449  1.00 64.42  ? 689 ILE C O   1 
ATOM   3636 C CB  . ILE C 2 4   ? -28.855 -10.122 -2.684  1.00 59.10  ? 689 ILE C CB  1 
ATOM   3637 C CG1 . ILE C 2 4   ? -30.299 -10.431 -3.084  1.00 61.41  ? 689 ILE C CG1 1 
ATOM   3638 C CG2 . ILE C 2 4   ? -28.604 -10.489 -1.226  1.00 57.04  ? 689 ILE C CG2 1 
ATOM   3639 C CD1 . ILE C 2 4   ? -30.702 -11.870 -2.855  1.00 60.90  ? 689 ILE C CD1 1 
ATOM   3640 N N   . LEU C 2 5   ? -26.181 -8.631  -3.488  1.00 57.36  ? 690 LEU C N   1 
ATOM   3641 C CA  . LEU C 2 5   ? -24.757 -8.394  -3.283  1.00 57.10  ? 690 LEU C CA  1 
ATOM   3642 C C   . LEU C 2 5   ? -24.468 -6.921  -2.992  1.00 60.97  ? 690 LEU C C   1 
ATOM   3643 O O   . LEU C 2 5   ? -23.533 -6.597  -2.260  1.00 61.48  ? 690 LEU C O   1 
ATOM   3644 C CB  . LEU C 2 5   ? -23.962 -8.862  -4.503  1.00 55.16  ? 690 LEU C CB  1 
ATOM   3645 C CG  . LEU C 2 5   ? -22.445 -8.671  -4.449  1.00 54.95  ? 690 LEU C CG  1 
ATOM   3646 C CD1 . LEU C 2 5   ? -21.861 -9.374  -3.234  1.00 48.66  ? 690 LEU C CD1 1 
ATOM   3647 C CD2 . LEU C 2 5   ? -21.783 -9.160  -5.735  1.00 54.87  ? 690 LEU C CD2 1 
ATOM   3648 N N   . HIS C 2 6   ? -25.276 -6.037  -3.570  1.00 63.45  ? 691 HIS C N   1 
ATOM   3649 C CA  . HIS C 2 6   ? -25.177 -4.607  -3.300  1.00 69.08  ? 691 HIS C CA  1 
ATOM   3650 C C   . HIS C 2 6   ? -25.395 -4.329  -1.819  1.00 67.07  ? 691 HIS C C   1 
ATOM   3651 O O   . HIS C 2 6   ? -24.599 -3.643  -1.176  1.00 67.32  ? 691 HIS C O   1 
ATOM   3652 C CB  . HIS C 2 6   ? -26.227 -3.844  -4.109  1.00 79.56  ? 691 HIS C CB  1 
ATOM   3653 C CG  . HIS C 2 6   ? -25.850 -3.616  -5.538  1.00 85.32  ? 691 HIS C CG  1 
ATOM   3654 N ND1 . HIS C 2 6   ? -26.726 -3.828  -6.583  1.00 89.57  ? 691 HIS C ND1 1 
ATOM   3655 C CD2 . HIS C 2 6   ? -24.701 -3.174  -6.099  1.00 87.32  ? 691 HIS C CD2 1 
ATOM   3656 C CE1 . HIS C 2 6   ? -26.127 -3.541  -7.723  1.00 91.28  ? 691 HIS C CE1 1 
ATOM   3657 N NE2 . HIS C 2 6   ? -24.896 -3.138  -7.458  1.00 89.67  ? 691 HIS C NE2 1 
ATOM   3658 N N   . ARG C 2 7   ? -26.486 -4.872  -1.289  1.00 65.61  ? 692 ARG C N   1 
ATOM   3659 C CA  . ARG C 2 7   ? -26.869 -4.661  0.100   1.00 65.00  ? 692 ARG C CA  1 
ATOM   3660 C C   . ARG C 2 7   ? -25.846 -5.258  1.060   1.00 60.37  ? 692 ARG C C   1 
ATOM   3661 O O   . ARG C 2 7   ? -25.530 -4.666  2.092   1.00 60.76  ? 692 ARG C O   1 
ATOM   3662 C CB  . ARG C 2 7   ? -28.244 -5.277  0.360   1.00 64.74  ? 692 ARG C CB  1 
ATOM   3663 C CG  . ARG C 2 7   ? -28.864 -4.882  1.687   1.00 69.78  ? 692 ARG C CG  1 
ATOM   3664 C CD  . ARG C 2 7   ? -29.491 -6.083  2.365   1.00 69.88  ? 692 ARG C CD  1 
ATOM   3665 N NE  . ARG C 2 7   ? -30.355 -6.835  1.462   1.00 69.80  ? 692 ARG C NE  1 
ATOM   3666 C CZ  . ARG C 2 7   ? -30.585 -8.140  1.566   1.00 66.85  ? 692 ARG C CZ  1 
ATOM   3667 N NH1 . ARG C 2 7   ? -31.387 -8.747  0.702   1.00 67.57  ? 692 ARG C NH1 1 
ATOM   3668 N NH2 . ARG C 2 7   ? -30.009 -8.840  2.534   1.00 62.93  ? 692 ARG C NH2 1 
ATOM   3669 N N   . LEU C 2 8   ? -25.330 -6.433  0.718   1.00 55.79  ? 693 LEU C N   1 
ATOM   3670 C CA  . LEU C 2 8   ? -24.379 -7.121  1.583   1.00 52.81  ? 693 LEU C CA  1 
ATOM   3671 C C   . LEU C 2 8   ? -23.060 -6.361  1.694   1.00 54.26  ? 693 LEU C C   1 
ATOM   3672 O O   . LEU C 2 8   ? -22.451 -6.315  2.763   1.00 47.34  ? 693 LEU C O   1 
ATOM   3673 C CB  . LEU C 2 8   ? -24.148 -8.559  1.105   1.00 45.05  ? 693 LEU C CB  1 
ATOM   3674 C CG  . LEU C 2 8   ? -25.361 -9.481  1.276   1.00 47.56  ? 693 LEU C CG  1 
ATOM   3675 C CD1 . LEU C 2 8   ? -25.074 -10.887 0.777   1.00 45.08  ? 693 LEU C CD1 1 
ATOM   3676 C CD2 . LEU C 2 8   ? -25.814 -9.513  2.731   1.00 50.33  ? 693 LEU C CD2 1 
ATOM   3677 N N   . LEU C 2 9   ? -22.635 -5.750  0.593   1.00 55.20  ? 694 LEU C N   1 
ATOM   3678 C CA  . LEU C 2 9   ? -21.390 -4.989  0.571   1.00 52.93  ? 694 LEU C CA  1 
ATOM   3679 C C   . LEU C 2 9   ? -21.465 -3.721  1.422   1.00 57.76  ? 694 LEU C C   1 
ATOM   3680 O O   . LEU C 2 9   ? -20.482 -3.333  2.057   1.00 59.71  ? 694 LEU C O   1 
ATOM   3681 C CB  . LEU C 2 9   ? -21.000 -4.644  -0.866  1.00 51.40  ? 694 LEU C CB  1 
ATOM   3682 C CG  . LEU C 2 9   ? -20.343 -5.774  -1.656  1.00 47.67  ? 694 LEU C CG  1 
ATOM   3683 C CD1 . LEU C 2 9   ? -20.234 -5.408  -3.125  1.00 49.63  ? 694 LEU C CD1 1 
ATOM   3684 C CD2 . LEU C 2 9   ? -18.970 -6.080  -1.081  1.00 45.88  ? 694 LEU C CD2 1 
ATOM   3685 N N   . GLN C 2 10  ? -22.631 -3.082  1.436   1.00 59.89  ? 695 GLN C N   1 
ATOM   3686 C CA  . GLN C 2 10  ? -22.831 -1.876  2.236   1.00 66.70  ? 695 GLN C CA  1 
ATOM   3687 C C   . GLN C 2 10  ? -23.002 -2.189  3.722   1.00 69.12  ? 695 GLN C C   1 
ATOM   3688 O O   . GLN C 2 10  ? -22.707 -1.351  4.575   1.00 72.89  ? 695 GLN C O   1 
ATOM   3689 C CB  . GLN C 2 10  ? -24.038 -1.083  1.725   1.00 71.05  ? 695 GLN C CB  1 
ATOM   3690 C CG  . GLN C 2 10  ? -23.844 -0.500  0.338   1.00 74.10  ? 695 GLN C CG  1 
ATOM   3691 C CD  . GLN C 2 10  ? -24.981 0.412   -0.087  1.00 79.92  ? 695 GLN C CD  1 
ATOM   3692 O OE1 . GLN C 2 10  ? -26.088 0.339   0.446   1.00 83.09  ? 695 GLN C OE1 1 
ATOM   3693 N NE2 . GLN C 2 10  ? -24.708 1.285   -1.051  1.00 81.22  ? 695 GLN C NE2 1 
ATOM   3694 N N   . ASP C 2 11  ? -23.474 -3.394  4.028   1.00 65.46  ? 696 ASP C N   1 
ATOM   3695 C CA  . ASP C 2 11  ? -23.756 -3.777  5.407   1.00 63.31  ? 696 ASP C CA  1 
ATOM   3696 C C   . ASP C 2 11  ? -22.679 -4.678  6.007   1.00 60.54  ? 696 ASP C C   1 
ATOM   3697 O O   . ASP C 2 11  ? -21.566 -4.770  5.494   1.00 59.67  ? 696 ASP C O   1 
ATOM   3698 C CB  . ASP C 2 11  ? -25.122 -4.467  5.493   1.00 63.63  ? 696 ASP C CB  1 
ATOM   3699 C CG  . ASP C 2 11  ? -26.250 -3.599  4.972   1.00 68.97  ? 696 ASP C CG  1 
ATOM   3700 O OD1 . ASP C 2 11  ? -26.092 -2.361  4.945   1.00 73.29  ? 696 ASP C OD1 1 
ATOM   3701 O OD2 . ASP C 2 11  ? -27.298 -4.159  4.591   1.00 69.28  ? 696 ASP C OD2 1 
ATOM   3702 N N   . HIS D 2 2   ? -4.447  -42.743 -33.507 1.00 74.90  ? 687 HIS D N   1 
ATOM   3703 C CA  . HIS D 2 2   ? -5.847  -42.723 -33.913 1.00 76.72  ? 687 HIS D CA  1 
ATOM   3704 C C   . HIS D 2 2   ? -6.319  -41.296 -34.183 1.00 73.60  ? 687 HIS D C   1 
ATOM   3705 O O   . HIS D 2 2   ? -6.864  -41.004 -35.249 1.00 73.59  ? 687 HIS D O   1 
ATOM   3706 C CB  . HIS D 2 2   ? -6.726  -43.382 -32.846 1.00 77.33  ? 687 HIS D CB  1 
ATOM   3707 N N   . LYS D 2 3   ? -6.109  -40.412 -33.214 1.00 70.36  ? 688 LYS D N   1 
ATOM   3708 C CA  . LYS D 2 3   ? -6.453  -39.002 -33.378 1.00 66.23  ? 688 LYS D CA  1 
ATOM   3709 C C   . LYS D 2 3   ? -5.565  -38.350 -34.433 1.00 64.62  ? 688 LYS D C   1 
ATOM   3710 O O   . LYS D 2 3   ? -4.421  -38.760 -34.630 1.00 65.05  ? 688 LYS D O   1 
ATOM   3711 C CB  . LYS D 2 3   ? -6.313  -38.256 -32.050 1.00 64.83  ? 688 LYS D CB  1 
ATOM   3712 C CG  . LYS D 2 3   ? -7.240  -38.748 -30.950 1.00 65.21  ? 688 LYS D CG  1 
ATOM   3713 C CD  . LYS D 2 3   ? -6.960  -38.029 -29.640 1.00 64.02  ? 688 LYS D CD  1 
ATOM   3714 C CE  . LYS D 2 3   ? -7.887  -38.504 -28.532 1.00 64.88  ? 688 LYS D CE  1 
ATOM   3715 N NZ  . LYS D 2 3   ? -7.589  -37.837 -27.232 1.00 60.62  ? 688 LYS D NZ  1 
ATOM   3716 N N   . ILE D 2 4   ? -6.102  -37.341 -35.111 1.00 65.74  ? 689 ILE D N   1 
ATOM   3717 C CA  . ILE D 2 4   ? -5.344  -36.594 -36.110 1.00 67.34  ? 689 ILE D CA  1 
ATOM   3718 C C   . ILE D 2 4   ? -4.134  -35.912 -35.475 1.00 66.33  ? 689 ILE D C   1 
ATOM   3719 O O   . ILE D 2 4   ? -3.029  -35.962 -36.015 1.00 67.56  ? 689 ILE D O   1 
ATOM   3720 C CB  . ILE D 2 4   ? -6.222  -35.535 -36.808 1.00 66.42  ? 689 ILE D CB  1 
ATOM   3721 C CG1 . ILE D 2 4   ? -7.438  -36.198 -37.460 1.00 66.88  ? 689 ILE D CG1 1 
ATOM   3722 C CG2 . ILE D 2 4   ? -5.415  -34.764 -37.844 1.00 65.54  ? 689 ILE D CG2 1 
ATOM   3723 C CD1 . ILE D 2 4   ? -8.365  -35.226 -38.157 1.00 64.12  ? 689 ILE D CD1 1 
ATOM   3724 N N   . LEU D 2 5   ? -4.354  -35.286 -34.321 1.00 65.49  ? 690 LEU D N   1 
ATOM   3725 C CA  . LEU D 2 5   ? -3.291  -34.614 -33.578 1.00 63.36  ? 690 LEU D CA  1 
ATOM   3726 C C   . LEU D 2 5   ? -2.182  -35.593 -33.225 1.00 63.60  ? 690 LEU D C   1 
ATOM   3727 O O   . LEU D 2 5   ? -0.995  -35.264 -33.287 1.00 62.30  ? 690 LEU D O   1 
ATOM   3728 C CB  . LEU D 2 5   ? -3.853  -33.991 -32.298 1.00 57.24  ? 690 LEU D CB  1 
ATOM   3729 C CG  . LEU D 2 5   ? -2.848  -33.336 -31.345 1.00 53.70  ? 690 LEU D CG  1 
ATOM   3730 C CD1 . LEU D 2 5   ? -2.120  -32.191 -32.028 1.00 53.06  ? 690 LEU D CD1 1 
ATOM   3731 C CD2 . LEU D 2 5   ? -3.541  -32.848 -30.079 1.00 51.42  ? 690 LEU D CD2 1 
ATOM   3732 N N   . HIS D 2 6   ? -2.585  -36.801 -32.853 1.00 63.49  ? 691 HIS D N   1 
ATOM   3733 C CA  . HIS D 2 6   ? -1.646  -37.854 -32.516 1.00 64.26  ? 691 HIS D CA  1 
ATOM   3734 C C   . HIS D 2 6   ? -0.771  -38.191 -33.717 1.00 66.05  ? 691 HIS D C   1 
ATOM   3735 O O   . HIS D 2 6   ? 0.452   -38.261 -33.602 1.00 66.86  ? 691 HIS D O   1 
ATOM   3736 C CB  . HIS D 2 6   ? -2.396  -39.100 -32.053 1.00 66.96  ? 691 HIS D CB  1 
ATOM   3737 C CG  . HIS D 2 6   ? -1.498  -40.192 -31.569 1.00 70.14  ? 691 HIS D CG  1 
ATOM   3738 N ND1 . HIS D 2 6   ? -0.803  -41.020 -32.424 1.00 75.24  ? 691 HIS D ND1 1 
ATOM   3739 C CD2 . HIS D 2 6   ? -1.175  -40.589 -30.316 1.00 70.47  ? 691 HIS D CD2 1 
ATOM   3740 C CE1 . HIS D 2 6   ? -0.092  -41.880 -31.719 1.00 77.44  ? 691 HIS D CE1 1 
ATOM   3741 N NE2 . HIS D 2 6   ? -0.300  -41.640 -30.437 1.00 75.46  ? 691 HIS D NE2 1 
ATOM   3742 N N   . ARG D 2 7   ? -1.410  -38.395 -34.867 1.00 64.90  ? 692 ARG D N   1 
ATOM   3743 C CA  . ARG D 2 7   ? -0.699  -38.722 -36.099 1.00 67.79  ? 692 ARG D CA  1 
ATOM   3744 C C   . ARG D 2 7   ? 0.271   -37.614 -36.496 1.00 65.38  ? 692 ARG D C   1 
ATOM   3745 O O   . ARG D 2 7   ? 1.417   -37.882 -36.852 1.00 69.44  ? 692 ARG D O   1 
ATOM   3746 C CB  . ARG D 2 7   ? -1.683  -38.998 -37.244 1.00 70.65  ? 692 ARG D CB  1 
ATOM   3747 C CG  . ARG D 2 7   ? -1.005  -39.289 -38.581 1.00 77.57  ? 692 ARG D CG  1 
ATOM   3748 C CD  . ARG D 2 7   ? -2.001  -39.569 -39.709 1.00 79.72  ? 692 ARG D CD  1 
ATOM   3749 N NE  . ARG D 2 7   ? -2.935  -38.467 -39.937 1.00 77.25  ? 692 ARG D NE  1 
ATOM   3750 C CZ  . ARG D 2 7   ? -2.653  -37.371 -40.637 1.00 76.99  ? 692 ARG D CZ  1 
ATOM   3751 N NH1 . ARG D 2 7   ? -3.572  -36.428 -40.792 1.00 75.14  ? 692 ARG D NH1 1 
ATOM   3752 N NH2 . ARG D 2 7   ? -1.453  -37.214 -41.178 1.00 77.71  ? 692 ARG D NH2 1 
ATOM   3753 N N   . LEU D 2 8   ? -0.194  -36.371 -36.425 1.00 61.84  ? 693 LEU D N   1 
ATOM   3754 C CA  . LEU D 2 8   ? 0.633   -35.220 -36.770 1.00 61.24  ? 693 LEU D CA  1 
ATOM   3755 C C   . LEU D 2 8   ? 1.846   -35.086 -35.854 1.00 61.88  ? 693 LEU D C   1 
ATOM   3756 O O   . LEU D 2 8   ? 2.961   -34.856 -36.320 1.00 64.04  ? 693 LEU D O   1 
ATOM   3757 C CB  . LEU D 2 8   ? -0.204  -33.939 -36.749 1.00 57.12  ? 693 LEU D CB  1 
ATOM   3758 C CG  . LEU D 2 8   ? -1.264  -33.890 -37.852 1.00 59.07  ? 693 LEU D CG  1 
ATOM   3759 C CD1 . LEU D 2 8   ? -2.099  -32.624 -37.768 1.00 51.82  ? 693 LEU D CD1 1 
ATOM   3760 C CD2 . LEU D 2 8   ? -0.605  -34.016 -39.220 1.00 57.93  ? 693 LEU D CD2 1 
ATOM   3761 N N   . LEU D 2 9   ? 1.623   -35.237 -34.553 1.00 60.60  ? 694 LEU D N   1 
ATOM   3762 C CA  . LEU D 2 9   ? 2.711   -35.211 -33.583 1.00 59.80  ? 694 LEU D CA  1 
ATOM   3763 C C   . LEU D 2 9   ? 3.653   -36.388 -33.801 1.00 65.84  ? 694 LEU D C   1 
ATOM   3764 O O   . LEU D 2 9   ? 4.842   -36.313 -33.487 1.00 65.79  ? 694 LEU D O   1 
ATOM   3765 C CB  . LEU D 2 9   ? 2.162   -35.257 -32.156 1.00 55.20  ? 694 LEU D CB  1 
ATOM   3766 C CG  . LEU D 2 9   ? 1.593   -33.969 -31.562 1.00 51.29  ? 694 LEU D CG  1 
ATOM   3767 C CD1 . LEU D 2 9   ? 0.816   -34.281 -30.293 1.00 47.51  ? 694 LEU D CD1 1 
ATOM   3768 C CD2 . LEU D 2 9   ? 2.710   -32.981 -31.271 1.00 45.90  ? 694 LEU D CD2 1 
ATOM   3769 N N   . GLN D 2 10  ? 3.111   -37.473 -34.345 1.00 71.07  ? 695 GLN D N   1 
ATOM   3770 C CA  . GLN D 2 10  ? 3.865   -38.706 -34.534 1.00 80.25  ? 695 GLN D CA  1 
ATOM   3771 C C   . GLN D 2 10  ? 4.845   -38.609 -35.702 1.00 85.79  ? 695 GLN D C   1 
ATOM   3772 O O   . GLN D 2 10  ? 5.971   -39.101 -35.620 1.00 87.06  ? 695 GLN D O   1 
ATOM   3773 C CB  . GLN D 2 10  ? 2.901   -39.874 -34.754 1.00 84.21  ? 695 GLN D CB  1 
ATOM   3774 C CG  . GLN D 2 10  ? 3.468   -41.239 -34.411 1.00 88.89  ? 695 GLN D CG  1 
ATOM   3775 C CD  . GLN D 2 10  ? 2.481   -42.355 -34.683 1.00 91.58  ? 695 GLN D CD  1 
ATOM   3776 O OE1 . GLN D 2 10  ? 1.676   -42.274 -35.612 1.00 90.92  ? 695 GLN D OE1 1 
ATOM   3777 N NE2 . GLN D 2 10  ? 2.534   -43.402 -33.870 1.00 93.95  ? 695 GLN D NE2 1 
ATOM   3778 N N   . ASP D 2 11  ? 4.413   -37.962 -36.783 1.00 89.95  ? 696 ASP D N   1 
ATOM   3779 C CA  . ASP D 2 11  ? 5.242   -37.789 -37.979 1.00 99.26  ? 696 ASP D CA  1 
ATOM   3780 C C   . ASP D 2 11  ? 6.547   -37.058 -37.678 1.00 100.69 ? 696 ASP D C   1 
ATOM   3781 O O   . ASP D 2 11  ? 7.617   -37.468 -38.128 1.00 106.06 ? 696 ASP D O   1 
ATOM   3782 C CB  . ASP D 2 11  ? 4.471   -37.037 -39.066 1.00 101.62 ? 696 ASP D CB  1 
ATOM   3783 C CG  . ASP D 2 11  ? 3.250   -37.797 -39.545 1.00 104.63 ? 696 ASP D CG  1 
ATOM   3784 O OD1 . ASP D 2 11  ? 3.161   -39.015 -39.281 1.00 108.71 ? 696 ASP D OD1 1 
ATOM   3785 O OD2 . ASP D 2 11  ? 2.382   -37.176 -40.195 1.00 102.58 ? 696 ASP D OD2 1 
HETATM 3786 C C01 A 5C9 E 3 .   ? -16.096 -27.828 -5.817  0.60 37.70  ? 601 5C9 A C01 1 
HETATM 3787 C C02 A 5C9 E 3 .   ? -17.459 -27.892 -5.222  0.60 37.19  ? 601 5C9 A C02 1 
HETATM 3788 C C03 A 5C9 E 3 .   ? -18.414 -26.807 -5.611  0.60 35.87  ? 601 5C9 A C03 1 
HETATM 3789 C C04 A 5C9 E 3 .   ? -18.998 -25.959 -4.673  0.60 32.41  ? 601 5C9 A C04 1 
HETATM 3790 C C05 A 5C9 E 3 .   ? -20.352 -25.380 -4.936  0.60 31.28  ? 601 5C9 A C05 1 
HETATM 3791 C C06 A 5C9 E 3 .   ? -20.504 -24.008 -5.079  0.60 29.29  ? 601 5C9 A C06 1 
HETATM 3792 C C07 A 5C9 E 3 .   ? -21.761 -23.467 -5.322  0.60 29.26  ? 601 5C9 A C07 1 
HETATM 3793 C C08 A 5C9 E 3 .   ? -22.866 -24.303 -5.426  0.60 31.19  ? 601 5C9 A C08 1 
HETATM 3794 O O09 A 5C9 E 3 .   ? -24.109 -23.770 -5.671  0.60 33.74  ? 601 5C9 A O09 1 
HETATM 3795 C C10 A 5C9 E 3 .   ? -22.718 -25.676 -5.285  0.60 30.80  ? 601 5C9 A C10 1 
HETATM 3796 C C11 A 5C9 E 3 .   ? -21.464 -26.213 -5.037  0.60 31.12  ? 601 5C9 A C11 1 
HETATM 3797 C C12 A 5C9 E 3 .   ? -18.277 -25.479 -3.436  0.60 30.60  ? 601 5C9 A C12 1 
HETATM 3798 C C13 A 5C9 E 3 .   ? -16.921 -25.164 -3.469  0.60 29.49  ? 601 5C9 A C13 1 
HETATM 3799 C C14 A 5C9 E 3 .   ? -16.268 -24.724 -2.325  0.60 29.09  ? 601 5C9 A C14 1 
HETATM 3800 C C15 A 5C9 E 3 .   ? -16.973 -24.579 -1.138  0.60 30.10  ? 601 5C9 A C15 1 
HETATM 3801 O O16 A 5C9 E 3 .   ? -16.324 -24.137 -0.005  0.60 31.29  ? 601 5C9 A O16 1 
HETATM 3802 C C17 A 5C9 E 3 .   ? -18.328 -24.881 -1.097  0.60 30.14  ? 601 5C9 A C17 1 
HETATM 3803 C C18 A 5C9 E 3 .   ? -18.977 -25.328 -2.244  0.60 31.85  ? 601 5C9 A C18 1 
HETATM 3804 C C19 A 5C9 E 3 .   ? -19.017 -27.006 -6.976  0.60 40.99  ? 601 5C9 A C19 1 
HETATM 3805 C C20 A 5C9 E 3 .   ? -19.161 -25.967 -7.893  0.60 42.71  ? 601 5C9 A C20 1 
HETATM 3806 C C21 A 5C9 E 3 .   ? -19.723 -26.225 -9.143  0.60 43.67  ? 601 5C9 A C21 1 
HETATM 3807 C C22 A 5C9 E 3 .   ? -20.130 -27.514 -9.483  0.60 44.62  ? 601 5C9 A C22 1 
HETATM 3808 C C23 A 5C9 E 3 .   ? -19.977 -28.549 -8.567  0.60 46.53  ? 601 5C9 A C23 1 
HETATM 3809 N N24 A 5C9 E 3 .   ? -20.370 -29.899 -8.857  0.60 51.32  ? 601 5C9 A N24 1 
HETATM 3810 C C25 A 5C9 E 3 .   ? -20.977 -30.312 -10.094 0.60 54.54  ? 601 5C9 A C25 1 
HETATM 3811 C C26 A 5C9 E 3 .   ? -22.338 -30.166 -10.302 0.60 56.65  ? 601 5C9 A C26 1 
HETATM 3812 C C27 A 5C9 E 3 .   ? -22.901 -30.585 -11.501 0.60 57.65  ? 601 5C9 A C27 1 
HETATM 3813 C C28 A 5C9 E 3 .   ? -22.116 -31.146 -12.491 0.60 58.65  ? 601 5C9 A C28 1 
HETATM 3814 C C29 A 5C9 E 3 .   ? -20.754 -31.295 -12.281 0.60 58.20  ? 601 5C9 A C29 1 
HETATM 3815 C C30 A 5C9 E 3 .   ? -19.905 -31.899 -13.347 0.60 57.88  ? 601 5C9 A C30 1 
HETATM 3816 C C31 A 5C9 E 3 .   ? -20.186 -30.882 -11.083 0.60 56.16  ? 601 5C9 A C31 1 
HETATM 3817 C C32 A 5C9 E 3 .   ? -19.417 -28.288 -7.321  0.60 43.83  ? 601 5C9 A C32 1 
HETATM 3818 C C01 B 5C9 F 3 .   ? -16.102 -27.833 -5.842  0.40 37.64  ? 602 5C9 A C01 1 
HETATM 3819 C C02 B 5C9 F 3 .   ? -17.470 -27.932 -5.264  0.40 37.11  ? 602 5C9 A C02 1 
HETATM 3820 C C03 B 5C9 F 3 .   ? -18.442 -26.863 -5.655  0.40 36.71  ? 602 5C9 A C03 1 
HETATM 3821 C C04 B 5C9 F 3 .   ? -19.005 -25.991 -4.726  0.40 32.86  ? 602 5C9 A C04 1 
HETATM 3822 C C05 B 5C9 F 3 .   ? -20.360 -25.407 -4.976  0.40 31.26  ? 602 5C9 A C05 1 
HETATM 3823 C C06 B 5C9 F 3 .   ? -20.504 -24.037 -5.141  0.40 29.54  ? 602 5C9 A C06 1 
HETATM 3824 C C07 B 5C9 F 3 .   ? -21.760 -23.491 -5.370  0.40 29.56  ? 602 5C9 A C07 1 
HETATM 3825 C C08 B 5C9 F 3 .   ? -22.874 -24.318 -5.435  0.40 31.21  ? 602 5C9 A C08 1 
HETATM 3826 O O09 B 5C9 F 3 .   ? -24.118 -23.780 -5.665  0.40 33.37  ? 602 5C9 A O09 1 
HETATM 3827 C C10 B 5C9 F 3 .   ? -22.735 -25.689 -5.270  0.40 30.89  ? 602 5C9 A C10 1 
HETATM 3828 C C11 B 5C9 F 3 .   ? -21.479 -26.232 -5.036  0.40 31.10  ? 602 5C9 A C11 1 
HETATM 3829 C C12 B 5C9 F 3 .   ? -18.283 -25.509 -3.491  0.40 31.01  ? 602 5C9 A C12 1 
HETATM 3830 C C13 B 5C9 F 3 .   ? -16.931 -25.181 -3.524  0.40 29.60  ? 602 5C9 A C13 1 
HETATM 3831 C C14 B 5C9 F 3 .   ? -16.282 -24.738 -2.378  0.40 29.25  ? 602 5C9 A C14 1 
HETATM 3832 C C15 B 5C9 F 3 .   ? -16.988 -24.603 -1.191  0.40 30.13  ? 602 5C9 A C15 1 
HETATM 3833 O O16 B 5C9 F 3 .   ? -16.345 -24.159 -0.055  0.40 31.14  ? 602 5C9 A O16 1 
HETATM 3834 C C17 B 5C9 F 3 .   ? -18.340 -24.918 -1.150  0.40 30.39  ? 602 5C9 A C17 1 
HETATM 3835 C C18 B 5C9 F 3 .   ? -18.984 -25.367 -2.298  0.40 31.59  ? 602 5C9 A C18 1 
HETATM 3836 C C19 B 5C9 F 3 .   ? -19.061 -27.059 -7.015  0.40 41.81  ? 602 5C9 A C19 1 
HETATM 3837 C C20 B 5C9 F 3 .   ? -19.123 -26.030 -7.949  0.40 42.77  ? 602 5C9 A C20 1 
HETATM 3838 C C21 B 5C9 F 3 .   ? -19.702 -26.264 -9.196  0.40 43.66  ? 602 5C9 A C21 1 
HETATM 3839 C C22 B 5C9 F 3 .   ? -20.210 -27.522 -9.512  0.40 44.71  ? 602 5C9 A C22 1 
HETATM 3840 C C23 B 5C9 F 3 .   ? -20.138 -28.553 -8.583  0.40 46.55  ? 602 5C9 A C23 1 
HETATM 3841 N N24 B 5C9 F 3 .   ? -20.651 -29.868 -8.862  0.40 51.14  ? 602 5C9 A N24 1 
HETATM 3842 C C25 B 5C9 F 3 .   ? -20.797 -30.414 -10.187 0.40 54.39  ? 602 5C9 A C25 1 
HETATM 3843 C C26 B 5C9 F 3 .   ? -19.709 -30.593 -11.030 0.40 55.93  ? 602 5C9 A C26 1 
HETATM 3844 C C27 B 5C9 F 3 .   ? -19.892 -31.131 -12.300 0.40 57.44  ? 602 5C9 A C27 1 
HETATM 3845 C C28 B 5C9 F 3 .   ? -21.161 -31.493 -12.726 0.40 58.48  ? 602 5C9 A C28 1 
HETATM 3846 C C29 B 5C9 F 3 .   ? -22.251 -31.318 -11.884 0.40 58.32  ? 602 5C9 A C29 1 
HETATM 3847 C C30 B 5C9 F 3 .   ? -23.619 -31.707 -12.336 0.40 58.88  ? 602 5C9 A C30 1 
HETATM 3848 C C31 B 5C9 F 3 .   ? -22.065 -30.782 -10.617 0.40 56.50  ? 602 5C9 A C31 1 
HETATM 3849 C C32 B 5C9 F 3 .   ? -19.562 -28.313 -7.337  0.40 43.92  ? 602 5C9 A C32 1 
HETATM 3850 C C01 A 5C9 G 3 .   ? -11.113 -15.240 -30.636 0.85 28.91  ? 601 5C9 B C01 1 
HETATM 3851 C C02 A 5C9 G 3 .   ? -11.692 -15.639 -31.921 0.85 31.60  ? 601 5C9 B C02 1 
HETATM 3852 C C03 A 5C9 G 3 .   ? -11.913 -17.072 -32.162 0.85 32.34  ? 601 5C9 B C03 1 
HETATM 3853 C C04 A 5C9 G 3 .   ? -11.286 -17.749 -33.194 0.85 26.41  ? 601 5C9 B C04 1 
HETATM 3854 C C05 A 5C9 G 3 .   ? -11.792 -19.066 -33.613 0.85 25.35  ? 601 5C9 B C05 1 
HETATM 3855 C C06 A 5C9 G 3 .   ? -11.062 -20.192 -33.315 0.85 26.03  ? 601 5C9 B C06 1 
HETATM 3856 C C07 A 5C9 G 3 .   ? -11.512 -21.414 -33.679 0.85 25.67  ? 601 5C9 B C07 1 
HETATM 3857 C C08 A 5C9 G 3 .   ? -12.705 -21.483 -34.333 0.85 29.56  ? 601 5C9 B C08 1 
HETATM 3858 O O09 A 5C9 G 3 .   ? -13.185 -22.676 -34.705 0.85 33.56  ? 601 5C9 B O09 1 
HETATM 3859 C C10 A 5C9 G 3 .   ? -13.438 -20.378 -34.617 0.85 26.76  ? 601 5C9 B C10 1 
HETATM 3860 C C11 A 5C9 G 3 .   ? -12.987 -19.149 -34.263 0.85 27.33  ? 601 5C9 B C11 1 
HETATM 3861 C C12 A 5C9 G 3 .   ? -9.848  -17.540 -33.516 0.85 24.37  ? 601 5C9 B C12 1 
HETATM 3862 C C13 A 5C9 G 3 .   ? -9.034  -16.900 -32.650 0.85 21.99  ? 601 5C9 B C13 1 
HETATM 3863 C C14 A 5C9 G 3 .   ? -7.730  -16.716 -32.957 0.85 20.97  ? 601 5C9 B C14 1 
HETATM 3864 C C15 A 5C9 G 3 .   ? -7.245  -17.194 -34.126 0.85 21.04  ? 601 5C9 B C15 1 
HETATM 3865 O O16 A 5C9 G 3 .   ? -5.965  -17.006 -34.403 0.85 24.63  ? 601 5C9 B O16 1 
HETATM 3866 C C17 A 5C9 G 3 .   ? -8.036  -17.849 -35.006 0.85 18.37  ? 601 5C9 B C17 1 
HETATM 3867 C C18 A 5C9 G 3 .   ? -9.344  -18.018 -34.689 0.85 22.14  ? 601 5C9 B C18 1 
HETATM 3868 C C19 A 5C9 G 3 .   ? -13.135 -17.600 -31.500 0.85 36.65  ? 601 5C9 B C19 1 
HETATM 3869 C C20 A 5C9 G 3 .   ? -13.096 -18.736 -30.739 0.85 35.38  ? 601 5C9 B C20 1 
HETATM 3870 C C21 A 5C9 G 3 .   ? -14.234 -19.203 -30.161 0.85 39.20  ? 601 5C9 B C21 1 
HETATM 3871 C C22 A 5C9 G 3 .   ? -15.411 -18.523 -30.315 0.85 43.51  ? 601 5C9 B C22 1 
HETATM 3872 C C23 A 5C9 G 3 .   ? -15.442 -17.387 -31.064 0.85 47.22  ? 601 5C9 B C23 1 
HETATM 3873 N N24 A 5C9 G 3 .   ? -16.623 -16.638 -31.240 0.85 58.63  ? 601 5C9 B N24 1 
HETATM 3874 C C25 A 5C9 G 3 .   ? -17.960 -16.946 -30.829 0.85 68.12  ? 601 5C9 B C25 1 
HETATM 3875 C C26 A 5C9 G 3 .   ? -18.593 -16.201 -29.866 0.85 71.92  ? 601 5C9 B C26 1 
HETATM 3876 C C27 A 5C9 G 3 .   ? -19.901 -16.496 -29.507 0.85 74.55  ? 601 5C9 B C27 1 
HETATM 3877 C C28 A 5C9 G 3 .   ? -20.600 -17.525 -30.108 0.85 74.99  ? 601 5C9 B C28 1 
HETATM 3878 C C29 A 5C9 G 3 .   ? -19.972 -18.268 -31.075 0.85 75.24  ? 601 5C9 B C29 1 
HETATM 3879 C C30 A 5C9 G 3 .   ? -20.684 -19.387 -31.740 0.85 76.18  ? 601 5C9 B C30 1 
HETATM 3880 C C31 A 5C9 G 3 .   ? -18.672 -17.963 -31.426 0.85 72.47  ? 601 5C9 B C31 1 
HETATM 3881 C C32 A 5C9 G 3 .   ? -14.300 -16.918 -31.645 0.85 41.39  ? 601 5C9 B C32 1 
HETATM 3882 O O   . HOH H 4 .   ? -26.995 -10.171 -5.895  1.00 47.01  ? 701 HOH A O   1 
HETATM 3883 O O   . HOH H 4 .   ? -19.394 -1.630  0.264   1.00 47.53  ? 702 HOH A O   1 
HETATM 3884 O O   . HOH H 4 .   ? -7.664  -13.139 3.617   1.00 37.09  ? 703 HOH A O   1 
HETATM 3885 O O   . HOH H 4 .   ? -1.705  -7.853  -15.660 1.00 38.35  ? 704 HOH A O   1 
HETATM 3886 O O   . HOH H 4 .   ? -6.800  -33.120 -0.662  1.00 24.71  ? 705 HOH A O   1 
HETATM 3887 O O   . HOH H 4 .   ? -10.998 -19.119 2.350   1.00 30.96  ? 706 HOH A O   1 
HETATM 3888 O O   . HOH H 4 .   ? -24.247 -27.653 3.908   1.00 39.05  ? 707 HOH A O   1 
HETATM 3889 O O   . HOH H 4 .   ? -10.652 -2.721  1.637   1.00 40.40  ? 708 HOH A O   1 
HETATM 3890 O O   . HOH H 4 .   ? -15.570 -22.569 4.989   1.00 36.71  ? 709 HOH A O   1 
HETATM 3891 O O   . HOH H 4 .   ? -13.624 -16.165 -12.912 1.00 27.25  ? 710 HOH A O   1 
HETATM 3892 O O   . HOH H 4 .   ? -12.306 -10.685 -9.751  1.00 38.70  ? 711 HOH A O   1 
HETATM 3893 O O   . HOH H 4 .   ? -4.332  -26.130 5.142   1.00 51.09  ? 712 HOH A O   1 
HETATM 3894 O O   . HOH H 4 .   ? 2.885   -7.434  -9.894  1.00 41.21  ? 713 HOH A O   1 
HETATM 3895 O O   . HOH H 4 .   ? -16.474 -6.091  6.821   1.00 49.55  ? 714 HOH A O   1 
HETATM 3896 O O   . HOH H 4 .   ? -18.803 -37.754 -10.894 1.00 48.86  ? 715 HOH A O   1 
HETATM 3897 O O   . HOH H 4 .   ? 8.364   -7.453  -6.202  1.00 42.97  ? 716 HOH A O   1 
HETATM 3898 O O   . HOH H 4 .   ? -7.256  -16.814 -11.537 1.00 25.13  ? 717 HOH A O   1 
HETATM 3899 O O   . HOH H 4 .   ? -30.497 -15.357 -1.161  1.00 49.16  ? 718 HOH A O   1 
HETATM 3900 O O   . HOH H 4 .   ? -14.988 -18.292 -13.565 1.00 33.41  ? 719 HOH A O   1 
HETATM 3901 O O   . HOH H 4 .   ? -29.889 -29.910 -15.511 1.00 48.47  ? 720 HOH A O   1 
HETATM 3902 O O   . HOH H 4 .   ? -27.947 -24.172 7.537   1.00 59.53  ? 721 HOH A O   1 
HETATM 3903 O O   . HOH H 4 .   ? -21.494 -9.538  4.757   1.00 47.99  ? 722 HOH A O   1 
HETATM 3904 O O   . HOH H 4 .   ? -14.284 -21.974 0.572   1.00 33.65  ? 723 HOH A O   1 
HETATM 3905 O O   . HOH H 4 .   ? -23.493 -39.913 4.458   1.00 56.64  ? 724 HOH A O   1 
HETATM 3906 O O   . HOH H 4 .   ? -13.111 -19.529 0.361   1.00 26.36  ? 725 HOH A O   1 
HETATM 3907 O O   . HOH H 4 .   ? 2.484   -24.402 -10.929 1.00 46.72  ? 726 HOH A O   1 
HETATM 3908 O O   . HOH H 4 .   ? -23.551 -17.080 6.480   1.00 36.53  ? 727 HOH A O   1 
HETATM 3909 O O   . HOH H 4 .   ? -5.209  -28.628 5.277   1.00 41.49  ? 728 HOH A O   1 
HETATM 3910 O O   . HOH H 4 .   ? -15.948 -17.134 3.104   1.00 27.43  ? 729 HOH A O   1 
HETATM 3911 O O   . HOH H 4 .   ? -15.197 -17.491 -9.905  1.00 42.15  ? 730 HOH A O   1 
HETATM 3912 O O   . HOH H 4 .   ? -12.193 -15.484 1.623   1.00 24.95  ? 731 HOH A O   1 
HETATM 3913 O O   . HOH H 4 .   ? 9.408   -7.173  -1.283  1.00 46.59  ? 732 HOH A O   1 
HETATM 3914 O O   . HOH H 4 .   ? -17.243 -36.141 6.816   1.00 45.45  ? 733 HOH A O   1 
HETATM 3915 O O   . HOH H 4 .   ? -0.119  -5.464  -11.475 1.00 39.67  ? 734 HOH A O   1 
HETATM 3916 O O   . HOH H 4 .   ? -8.792  3.747   -11.421 1.00 38.85  ? 735 HOH A O   1 
HETATM 3917 O O   . HOH H 4 .   ? -11.591 -9.759  -16.324 1.00 45.28  ? 736 HOH A O   1 
HETATM 3918 O O   . HOH H 4 .   ? 11.869  -23.897 -7.389  1.00 50.99  ? 737 HOH A O   1 
HETATM 3919 O O   . HOH H 4 .   ? 2.929   -0.051  -8.601  1.00 50.86  ? 738 HOH A O   1 
HETATM 3920 O O   . HOH H 4 .   ? -15.092 -13.069 7.044   1.00 34.22  ? 739 HOH A O   1 
HETATM 3921 O O   . HOH H 4 .   ? -21.822 -32.693 12.284  1.00 62.14  ? 740 HOH A O   1 
HETATM 3922 O O   . HOH H 4 .   ? -7.012  -14.375 -10.850 1.00 28.92  ? 741 HOH A O   1 
HETATM 3923 O O   . HOH H 4 .   ? -24.404 -26.782 10.614  1.00 32.48  ? 742 HOH A O   1 
HETATM 3924 O O   . HOH H 4 .   ? -11.413 -29.801 -18.913 1.00 51.52  ? 743 HOH A O   1 
HETATM 3925 O O   . HOH H 4 .   ? -13.524 -20.910 5.242   1.00 43.24  ? 744 HOH A O   1 
HETATM 3926 O O   . HOH H 4 .   ? -10.928 -21.826 4.144   1.00 50.08  ? 745 HOH A O   1 
HETATM 3927 O O   . HOH H 4 .   ? 11.135  -22.468 -5.269  1.00 45.55  ? 746 HOH A O   1 
HETATM 3928 O O   . HOH H 4 .   ? 9.232   -24.447 -4.358  1.00 53.86  ? 747 HOH A O   1 
HETATM 3929 O O   . HOH H 4 .   ? -6.625  4.954   -10.305 1.00 54.07  ? 748 HOH A O   1 
HETATM 3930 O O   . HOH H 4 .   ? -16.102 -31.731 13.152  1.00 60.65  ? 749 HOH A O   1 
HETATM 3931 O O   . HOH H 4 .   ? -7.582  -28.392 -20.367 1.00 39.24  ? 750 HOH A O   1 
HETATM 3932 O O   . HOH H 4 .   ? -14.272 -16.997 1.161   1.00 25.62  ? 751 HOH A O   1 
HETATM 3933 O O   . HOH I 4 .   ? -9.118  -29.809 -39.190 1.00 68.31  ? 701 HOH B O   1 
HETATM 3934 O O   . HOH I 4 .   ? -1.860  -22.273 -19.036 1.00 47.17  ? 702 HOH B O   1 
HETATM 3935 O O   . HOH I 4 .   ? -6.180  -4.452  -30.654 1.00 38.22  ? 703 HOH B O   1 
HETATM 3936 O O   . HOH I 4 .   ? -6.353  -31.979 -16.975 1.00 55.37  ? 704 HOH B O   1 
HETATM 3937 O O   . HOH I 4 .   ? 8.976   -21.517 -12.107 1.00 43.32  ? 705 HOH B O   1 
HETATM 3938 O O   . HOH I 4 .   ? 8.175   -19.373 -30.256 1.00 34.69  ? 706 HOH B O   1 
HETATM 3939 O O   . HOH I 4 .   ? -7.754  -34.641 -30.424 1.00 52.78  ? 707 HOH B O   1 
HETATM 3940 O O   . HOH I 4 .   ? 1.685   -17.141 -32.180 1.00 31.15  ? 708 HOH B O   1 
HETATM 3941 O O   . HOH I 4 .   ? -4.776  -33.943 -16.337 1.00 49.38  ? 709 HOH B O   1 
HETATM 3942 O O   . HOH I 4 .   ? -4.958  -29.193 -16.286 1.00 65.14  ? 710 HOH B O   1 
HETATM 3943 O O   . HOH I 4 .   ? 7.062   -20.425 -15.697 1.00 39.91  ? 711 HOH B O   1 
HETATM 3944 O O   . HOH I 4 .   ? -9.883  -23.664 -22.476 1.00 27.77  ? 712 HOH B O   1 
HETATM 3945 O O   . HOH I 4 .   ? 10.568  -30.449 -27.803 1.00 41.95  ? 713 HOH B O   1 
HETATM 3946 O O   . HOH I 4 .   ? -0.709  -18.839 -35.292 1.00 42.24  ? 714 HOH B O   1 
HETATM 3947 O O   . HOH I 4 .   ? -2.123  -17.224 -13.863 1.00 29.69  ? 715 HOH B O   1 
HETATM 3948 O O   . HOH I 4 .   ? -3.213  -14.564 -38.703 1.00 22.53  ? 716 HOH B O   1 
HETATM 3949 O O   . HOH I 4 .   ? -1.703  -27.228 -21.815 1.00 33.37  ? 717 HOH B O   1 
HETATM 3950 O O   . HOH I 4 .   ? -7.330  -23.754 -24.898 1.00 32.24  ? 718 HOH B O   1 
HETATM 3951 O O   . HOH I 4 .   ? -7.278  -24.729 -21.345 1.00 45.33  ? 719 HOH B O   1 
HETATM 3952 O O   . HOH I 4 .   ? -2.936  -20.069 -18.790 1.00 32.17  ? 720 HOH B O   1 
HETATM 3953 O O   . HOH I 4 .   ? 0.258   -13.707 -34.178 1.00 42.64  ? 721 HOH B O   1 
HETATM 3954 O O   . HOH I 4 .   ? 11.462  -6.717  -20.493 1.00 52.12  ? 722 HOH B O   1 
HETATM 3955 O O   . HOH I 4 .   ? 2.760   -20.641 -31.584 1.00 48.48  ? 723 HOH B O   1 
HETATM 3956 O O   . HOH I 4 .   ? -1.600  -16.403 -37.738 1.00 28.31  ? 724 HOH B O   1 
HETATM 3957 O O   . HOH I 4 .   ? -2.975  -16.964 -33.259 1.00 27.85  ? 725 HOH B O   1 
HETATM 3958 O O   . HOH I 4 .   ? -1.611  -17.642 -45.261 1.00 33.66  ? 726 HOH B O   1 
HETATM 3959 O O   . HOH I 4 .   ? 0.482   -16.522 -36.335 1.00 37.16  ? 727 HOH B O   1 
HETATM 3960 O O   . HOH I 4 .   ? -1.627  -24.808 -42.473 1.00 30.98  ? 728 HOH B O   1 
HETATM 3961 O O   . HOH I 4 .   ? 0.267   -21.410 -35.201 1.00 30.54  ? 729 HOH B O   1 
HETATM 3962 O O   . HOH I 4 .   ? -0.871  -18.462 -31.904 1.00 37.47  ? 730 HOH B O   1 
HETATM 3963 O O   . HOH I 4 .   ? 11.664  -0.194  -8.160  1.00 51.88  ? 731 HOH B O   1 
HETATM 3964 O O   . HOH I 4 .   ? 0.961   -5.454  -33.114 1.00 38.39  ? 732 HOH B O   1 
HETATM 3965 O O   . HOH I 4 .   ? 5.150   -2.131  -11.940 1.00 47.79  ? 733 HOH B O   1 
HETATM 3966 O O   . HOH I 4 .   ? 4.541   2.131   -32.600 1.00 60.68  ? 734 HOH B O   1 
HETATM 3967 O O   . HOH I 4 .   ? 5.669   -24.126 -37.183 1.00 47.34  ? 735 HOH B O   1 
HETATM 3968 O O   . HOH I 4 .   ? -0.240  -23.007 -43.894 1.00 31.07  ? 736 HOH B O   1 
HETATM 3969 O O   . HOH I 4 .   ? -14.221 -4.093  -45.154 1.00 59.82  ? 737 HOH B O   1 
HETATM 3970 O O   . HOH I 4 .   ? 7.128   -31.622 -9.837  1.00 58.14  ? 738 HOH B O   1 
HETATM 3971 O O   . HOH I 4 .   ? 7.438   -24.109 -36.002 1.00 43.70  ? 739 HOH B O   1 
HETATM 3972 O O   . HOH I 4 .   ? -1.811  -20.921 -45.011 1.00 16.84  ? 740 HOH B O   1 
HETATM 3973 O O   . HOH I 4 .   ? 18.256  -21.318 -31.680 1.00 53.90  ? 741 HOH B O   1 
HETATM 3974 O O   . HOH I 4 .   ? 7.436   -3.520  -13.519 1.00 50.49  ? 742 HOH B O   1 
HETATM 3975 O O   . HOH I 4 .   ? -1.715  -7.214  -46.252 1.00 45.73  ? 743 HOH B O   1 
HETATM 3976 O O   . HOH I 4 .   ? 0.786   -4.668  -38.453 1.00 54.70  ? 744 HOH B O   1 
HETATM 3977 O O   . HOH I 4 .   ? -15.551 -13.237 -46.792 1.00 49.63  ? 745 HOH B O   1 
HETATM 3978 O O   . HOH I 4 .   ? 15.085  -24.899 -13.881 1.00 46.27  ? 746 HOH B O   1 
HETATM 3979 O O   . HOH I 4 .   ? -10.015 -6.021  -43.054 1.00 40.98  ? 747 HOH B O   1 
HETATM 3980 O O   . HOH I 4 .   ? -9.301  -5.974  -45.346 1.00 62.24  ? 748 HOH B O   1 
HETATM 3981 O O   . HOH I 4 .   ? -5.261  -16.316 -48.657 1.00 41.16  ? 749 HOH B O   1 
HETATM 3982 O O   . HOH I 4 .   ? 3.334   -7.033  -32.333 1.00 63.43  ? 750 HOH B O   1 
HETATM 3983 O O   . HOH I 4 .   ? -23.487 -9.920  -40.427 1.00 59.44  ? 751 HOH B O   1 
HETATM 3984 O O   . HOH I 4 .   ? 10.377  -4.092  -20.325 1.00 49.87  ? 752 HOH B O   1 
HETATM 3985 O O   . HOH I 4 .   ? -0.936  -6.993  -12.479 1.00 40.44  ? 753 HOH B O   1 
HETATM 3986 O O   . HOH I 4 .   ? -15.498 -12.965 -14.727 1.00 42.44  ? 754 HOH B O   1 
HETATM 3987 O O   . HOH I 4 .   ? 2.098   -31.875 -40.695 1.00 59.11  ? 755 HOH B O   1 
HETATM 3988 O O   . HOH I 4 .   ? -4.910  -8.468  -48.470 1.00 49.22  ? 756 HOH B O   1 
HETATM 3989 O O   . HOH I 4 .   ? 0.327   -21.154 -32.726 1.00 27.58  ? 757 HOH B O   1 
HETATM 3990 O O   . HOH J 4 .   ? -28.188 -6.788  5.076   1.00 47.41  ? 701 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 8   ? 1.1705 0.5747 1.0213 -0.1949 0.1440  -0.1221 305 SER A N   
2    C CA  . SER A 8   ? 1.1199 0.5510 0.9575 -0.1941 0.1237  -0.1237 305 SER A CA  
3    C C   . SER A 8   ? 1.1361 0.5871 0.9454 -0.2343 0.1152  -0.1339 305 SER A C   
4    O O   . SER A 8   ? 1.1404 0.5983 0.9491 -0.2542 0.1090  -0.1259 305 SER A O   
5    C CB  . SER A 8   ? 1.0717 0.5102 0.9166 -0.1662 0.1051  -0.1026 305 SER A CB  
6    O OG  . SER A 8   ? 1.0556 0.5179 0.8876 -0.1636 0.0880  -0.1043 305 SER A OG  
7    N N   . LEU A 9   ? 1.1611 0.6220 0.9485 -0.2467 0.1140  -0.1489 306 LEU A N   
8    C CA  . LEU A 9   ? 1.1936 0.6740 0.9486 -0.2854 0.1019  -0.1576 306 LEU A CA  
9    C C   . LEU A 9   ? 1.1427 0.6582 0.8919 -0.2886 0.0745  -0.1438 306 LEU A C   
10   O O   . LEU A 9   ? 1.1637 0.7043 0.8931 -0.3215 0.0574  -0.1436 306 LEU A O   
11   C CB  . LEU A 9   ? 1.2174 0.6890 0.9425 -0.2957 0.1129  -0.1757 306 LEU A CB  
12   N N   . ALA A 10  ? 1.1060 0.6229 0.8715 -0.2554 0.0691  -0.1300 307 ALA A N   
13   C CA  . ALA A 10  ? 1.0497 0.5922 0.8050 -0.2554 0.0471  -0.1152 307 ALA A CA  
14   C C   . ALA A 10  ? 1.0136 0.5671 0.7764 -0.2777 0.0376  -0.0960 307 ALA A C   
15   O O   . ALA A 10  ? 0.9853 0.5688 0.7400 -0.2930 0.0173  -0.0807 307 ALA A O   
16   C CB  . ALA A 10  ? 1.0126 0.5445 0.7776 -0.2131 0.0455  -0.1053 307 ALA A CB  
17   N N   . LEU A 11  ? 0.9991 0.5312 0.7830 -0.2797 0.0532  -0.0926 308 LEU A N   
18   C CA  . LEU A 11  ? 1.0046 0.5465 0.8077 -0.2983 0.0504  -0.0695 308 LEU A CA  
19   C C   . LEU A 11  ? 1.0612 0.6398 0.8706 -0.3464 0.0371  -0.0741 308 LEU A C   
20   O O   . LEU A 11  ? 1.0728 0.6853 0.9076 -0.3691 0.0248  -0.0497 308 LEU A O   
21   C CB  . LEU A 11  ? 0.9759 0.4785 0.8005 -0.2752 0.0748  -0.0607 308 LEU A CB  
22   C CG  . LEU A 11  ? 0.9307 0.4002 0.7497 -0.2238 0.0823  -0.0516 308 LEU A CG  
23   C CD1 . LEU A 11  ? 0.9187 0.3561 0.7562 -0.2023 0.1029  -0.0430 308 LEU A CD1 
24   C CD2 . LEU A 11  ? 0.8997 0.3849 0.7090 -0.2009 0.0690  -0.0239 308 LEU A CD2 
25   N N   . SER A 12  ? 1.0923 0.6648 0.8806 -0.3604 0.0396  -0.1011 309 SER A N   
26   C CA  . SER A 12  ? 1.1434 0.7395 0.9263 -0.4042 0.0259  -0.1082 309 SER A CA  
27   C C   . SER A 12  ? 1.1152 0.7587 0.8770 -0.4249 -0.0061 -0.1020 309 SER A C   
28   O O   . SER A 12  ? 1.1367 0.8091 0.8943 -0.4615 -0.0266 -0.1008 309 SER A O   
29   C CB  . SER A 12  ? 1.2058 0.7633 0.9623 -0.4099 0.0459  -0.1368 309 SER A CB  
30   O OG  . SER A 12  ? 1.2097 0.7271 0.9871 -0.3875 0.0747  -0.1394 309 SER A OG  
31   N N   . LEU A 13  ? 1.0914 0.7424 0.8402 -0.4003 -0.0116 -0.0961 310 LEU A N   
32   C CA  . LEU A 13  ? 1.0638 0.7568 0.7896 -0.4133 -0.0394 -0.0889 310 LEU A CA  
33   C C   . LEU A 13  ? 1.0266 0.7818 0.7891 -0.4347 -0.0693 -0.0529 310 LEU A C   
34   O O   . LEU A 13  ? 1.0551 0.8162 0.8613 -0.4286 -0.0630 -0.0288 310 LEU A O   
35   C CB  . LEU A 13  ? 1.0250 0.7050 0.7300 -0.3782 -0.0334 -0.0933 310 LEU A CB  
36   C CG  . LEU A 13  ? 1.0447 0.6787 0.7309 -0.3525 -0.0054 -0.1198 310 LEU A CG  
37   C CD1 . LEU A 13  ? 0.9989 0.6295 0.6801 -0.3168 -0.0028 -0.1187 310 LEU A CD1 
38   C CD2 . LEU A 13  ? 1.0943 0.7193 0.7440 -0.3774 -0.0019 -0.1385 310 LEU A CD2 
39   N N   . THR A 14  ? 0.9783 0.7802 0.7271 -0.4577 -0.0995 -0.0439 311 THR A N   
40   C CA  . THR A 14  ? 0.9416 0.8170 0.7363 -0.4722 -0.1306 -0.0021 311 THR A CA  
41   C C   . THR A 14  ? 0.8871 0.7843 0.6808 -0.4413 -0.1354 0.0172  311 THR A C   
42   O O   . THR A 14  ? 0.8465 0.6998 0.5984 -0.4153 -0.1187 -0.0065 311 THR A O   
43   C CB  . THR A 14  ? 1.0018 0.9203 0.7851 -0.5063 -0.1637 0.0042  311 THR A CB  
44   O OG1 . THR A 14  ? 1.0213 0.9290 0.7437 -0.5006 -0.1697 -0.0099 311 THR A OG1 
45   C CG2 . THR A 14  ? 1.0641 0.9521 0.8360 -0.5351 -0.1579 -0.0192 311 THR A CG2 
46   N N   . ALA A 15  ? 0.8609 0.8292 0.7074 -0.4274 -0.1513 0.0625  312 ALA A N   
47   C CA  . ALA A 15  ? 0.8212 0.8126 0.6718 -0.3787 -0.1464 0.0852  312 ALA A CA  
48   C C   . ALA A 15  ? 0.8466 0.8415 0.6418 -0.3894 -0.1654 0.0696  312 ALA A C   
49   O O   . ALA A 15  ? 0.8034 0.7721 0.5687 -0.3540 -0.1504 0.0585  312 ALA A O   
50   C CB  . ALA A 15  ? 0.7186 0.7818 0.6422 -0.3633 -0.1533 0.1398  312 ALA A CB  
51   N N   . ASP A 16  ? 0.9025 0.9274 0.6822 -0.4401 -0.1995 0.0694  313 ASP A N   
52   C CA  . ASP A 16  ? 0.9378 0.9605 0.6605 -0.4432 -0.2114 0.0582  313 ASP A CA  
53   C C   . ASP A 16  ? 0.9433 0.8862 0.6024 -0.4288 -0.1796 0.0109  313 ASP A C   
54   O O   . ASP A 16  ? 0.9553 0.8856 0.5845 -0.4058 -0.1712 0.0038  313 ASP A O   
55   C CB  . ASP A 16  ? 1.0413 1.0952 0.7591 -0.4773 -0.2383 0.0700  313 ASP A CB  
56   C CG  . ASP A 16  ? 1.0488 1.1922 0.8334 -0.4807 -0.2704 0.1251  313 ASP A CG  
57   O OD1 . ASP A 16  ? 1.0210 1.2031 0.8366 -0.4513 -0.2707 0.1534  313 ASP A OD1 
58   O OD2 . ASP A 16  ? 1.0776 1.2533 0.8870 -0.5101 -0.2941 0.1422  313 ASP A OD2 
59   N N   . GLN A 17  ? 0.9567 0.8488 0.6046 -0.4386 -0.1588 -0.0178 314 GLN A N   
60   C CA  . GLN A 17  ? 1.0196 0.8447 0.6247 -0.4219 -0.1257 -0.0551 314 GLN A CA  
61   C C   . GLN A 17  ? 0.9991 0.7923 0.6184 -0.3831 -0.1012 -0.0644 314 GLN A C   
62   O O   . GLN A 17  ? 1.0187 0.7692 0.6189 -0.3612 -0.0754 -0.0873 314 GLN A O   
63   C CB  . GLN A 17  ? 1.1267 0.9118 0.7139 -0.4452 -0.1114 -0.0792 314 GLN A CB  
64   C CG  . GLN A 17  ? 1.1365 0.9061 0.7618 -0.4454 -0.0986 -0.0829 314 GLN A CG  
65   C CD  . GLN A 17  ? 1.2351 0.9827 0.8461 -0.4778 -0.0952 -0.0985 314 GLN A CD  
66   O OE1 . GLN A 17  ? 1.2678 0.9718 0.8835 -0.4714 -0.0677 -0.1178 314 GLN A OE1 
67   N NE2 . GLN A 17  ? 1.2765 1.0536 0.8696 -0.5128 -0.1241 -0.0885 314 GLN A NE2 
68   N N   . MET A 18  ? 0.9378 0.7519 0.5945 -0.3756 -0.1100 -0.0429 315 MET A N   
69   C CA  . MET A 18  ? 0.8666 0.6542 0.5346 -0.3300 -0.0902 -0.0428 315 MET A CA  
70   C C   . MET A 18  ? 0.8323 0.6444 0.4863 -0.3037 -0.0972 -0.0320 315 MET A C   
71   O O   . MET A 18  ? 0.7244 0.4997 0.3594 -0.2791 -0.0815 -0.0508 315 MET A O   
72   C CB  . MET A 18  ? 0.8556 0.6635 0.5772 -0.3028 -0.0835 -0.0113 315 MET A CB  
73   C CG  . MET A 18  ? 0.8287 0.6184 0.5586 -0.2476 -0.0670 -0.0010 315 MET A CG  
74   S SD  . MET A 18  ? 0.9729 0.6833 0.6846 -0.2281 -0.0427 -0.0359 315 MET A SD  
75   C CE  . MET A 18  ? 0.8203 0.5043 0.5517 -0.2532 -0.0303 -0.0419 315 MET A CE  
76   N N   . VAL A 19  ? 0.8117 0.6872 0.4806 -0.3099 -0.1203 0.0001  316 VAL A N   
77   C CA  . VAL A 19  ? 0.8011 0.7038 0.4556 -0.2901 -0.1276 0.0134  316 VAL A CA  
78   C C   . VAL A 19  ? 0.8221 0.6884 0.4209 -0.3049 -0.1233 -0.0201 316 VAL A C   
79   O O   . VAL A 19  ? 0.8007 0.6471 0.3889 -0.2741 -0.1077 -0.0289 316 VAL A O   
80   C CB  . VAL A 19  ? 0.7938 0.7726 0.4756 -0.3032 -0.1554 0.0552  316 VAL A CB  
81   C CG1 . VAL A 19  ? 0.6900 0.6912 0.3479 -0.2887 -0.1625 0.0658  316 VAL A CG1 
82   C CG2 . VAL A 19  ? 0.7630 0.7782 0.5102 -0.2762 -0.1486 0.0953  316 VAL A CG2 
83   N N   . SER A 20  ? 0.8530 0.7128 0.4376 -0.3355 -0.1248 -0.0312 317 SER A N   
84   C CA  . SER A 20  ? 0.8839 0.7118 0.4332 -0.3362 -0.1087 -0.0524 317 SER A CA  
85   C C   . SER A 20  ? 0.8994 0.6709 0.4478 -0.3113 -0.0740 -0.0811 317 SER A C   
86   O O   . SER A 20  ? 0.9411 0.6946 0.4776 -0.2942 -0.0584 -0.0910 317 SER A O   
87   C CB  . SER A 20  ? 0.9899 0.8135 0.5135 -0.3763 -0.1182 -0.0574 317 SER A CB  
88   O OG  . SER A 20  ? 1.0687 0.8459 0.5873 -0.3842 -0.0964 -0.0822 317 SER A OG  
89   N N   . ALA A 21  ? 0.9002 0.6472 0.4686 -0.3083 -0.0622 -0.0913 318 ALA A N   
90   C CA  . ALA A 21  ? 0.8982 0.6015 0.4809 -0.2812 -0.0321 -0.1116 318 ALA A CA  
91   C C   . ALA A 21  ? 0.8608 0.5659 0.4611 -0.2436 -0.0289 -0.1064 318 ALA A C   
92   O O   . ALA A 21  ? 0.8996 0.5838 0.5099 -0.2222 -0.0096 -0.1184 318 ALA A O   
93   C CB  . ALA A 21  ? 0.8872 0.5688 0.4933 -0.2824 -0.0226 -0.1180 318 ALA A CB  
94   N N   . LEU A 22  ? 0.8134 0.5436 0.4174 -0.2369 -0.0485 -0.0867 319 LEU A N   
95   C CA  . LEU A 22  ? 0.7866 0.5140 0.3979 -0.2015 -0.0473 -0.0803 319 LEU A CA  
96   C C   . LEU A 22  ? 0.7779 0.5260 0.3766 -0.1926 -0.0478 -0.0763 319 LEU A C   
97   O O   . LEU A 22  ? 0.8031 0.5365 0.4137 -0.1657 -0.0348 -0.0833 319 LEU A O   
98   C CB  . LEU A 22  ? 0.7394 0.4908 0.3652 -0.1861 -0.0612 -0.0516 319 LEU A CB  
99   C CG  . LEU A 22  ? 0.7778 0.5064 0.4306 -0.1768 -0.0535 -0.0484 319 LEU A CG  
100  C CD1 . LEU A 22  ? 0.7382 0.4988 0.4158 -0.1522 -0.0582 -0.0111 319 LEU A CD1 
101  C CD2 . LEU A 22  ? 0.7742 0.4495 0.4323 -0.1535 -0.0384 -0.0689 319 LEU A CD2 
102  N N   . LEU A 23  ? 0.7091 0.4936 0.2898 -0.2152 -0.0638 -0.0627 320 LEU A N   
103  C CA  . LEU A 23  ? 0.7717 0.5726 0.3404 -0.2087 -0.0629 -0.0583 320 LEU A CA  
104  C C   . LEU A 23  ? 0.8394 0.6012 0.3992 -0.2094 -0.0391 -0.0836 320 LEU A C   
105  O O   . LEU A 23  ? 0.8049 0.5601 0.3669 -0.1898 -0.0275 -0.0874 320 LEU A O   
106  C CB  . LEU A 23  ? 0.7791 0.6249 0.3351 -0.2351 -0.0865 -0.0370 320 LEU A CB  
107  C CG  . LEU A 23  ? 0.7369 0.6390 0.3145 -0.2266 -0.1081 0.0004  320 LEU A CG  
108  C CD1 . LEU A 23  ? 0.7068 0.6574 0.2863 -0.2553 -0.1334 0.0240  320 LEU A CD1 
109  C CD2 . LEU A 23  ? 0.6901 0.6024 0.2790 -0.1854 -0.0976 0.0128  320 LEU A CD2 
110  N N   . ASP A 24  ? 0.8997 0.6358 0.4504 -0.2318 -0.0303 -0.0986 321 ASP A N   
111  C CA  . ASP A 24  ? 0.9425 0.6401 0.4825 -0.2339 -0.0046 -0.1186 321 ASP A CA  
112  C C   . ASP A 24  ? 0.9028 0.5796 0.4820 -0.2014 0.0165  -0.1288 321 ASP A C   
113  O O   . ASP A 24  ? 0.9155 0.5715 0.4964 -0.1938 0.0369  -0.1388 321 ASP A O   
114  C CB  . ASP A 24  ? 1.0686 0.7428 0.5880 -0.2642 0.0014  -0.1299 321 ASP A CB  
115  C CG  . ASP A 24  ? 1.1914 0.8223 0.6895 -0.2702 0.0303  -0.1477 321 ASP A CG  
116  O OD1 . ASP A 24  ? 1.1953 0.8192 0.6641 -0.2749 0.0343  -0.1476 321 ASP A OD1 
117  O OD2 . ASP A 24  ? 1.2483 0.8505 0.7586 -0.2699 0.0506  -0.1605 321 ASP A OD2 
118  N N   . ALA A 25  ? 0.8386 0.5212 0.4502 -0.1835 0.0101  -0.1242 322 ALA A N   
119  C CA  . ALA A 25  ? 0.8174 0.4855 0.4732 -0.1536 0.0229  -0.1303 322 ALA A CA  
120  C C   . ALA A 25  ? 0.7551 0.4358 0.4260 -0.1276 0.0198  -0.1238 322 ALA A C   
121  O O   . ALA A 25  ? 0.7231 0.3970 0.4336 -0.1055 0.0280  -0.1284 322 ALA A O   
122  C CB  . ALA A 25  ? 0.7982 0.4617 0.4782 -0.1457 0.0159  -0.1266 322 ALA A CB  
123  N N   . GLU A 26  ? 0.5402 0.5094 0.3948 0.1429  0.0783  0.0459  323 GLU A N   
124  C CA  . GLU A 26  ? 0.6067 0.5501 0.4585 0.1185  0.1063  0.0369  323 GLU A CA  
125  C C   . GLU A 26  ? 0.5854 0.5696 0.4357 0.1082  0.0912  0.0338  323 GLU A C   
126  O O   . GLU A 26  ? 0.5583 0.5877 0.4351 0.1222  0.0751  0.0471  323 GLU A O   
127  C CB  . GLU A 26  ? 0.5840 0.4966 0.4816 0.1251  0.1378  0.0492  323 GLU A CB  
128  C CG  . GLU A 26  ? 0.6606 0.5328 0.5577 0.1004  0.1690  0.0374  323 GLU A CG  
129  C CD  . GLU A 26  ? 0.6488 0.4765 0.5128 0.0796  0.1933  0.0126  323 GLU A CD  
130  O OE1 . GLU A 26  ? 0.6619 0.4864 0.4963 0.0807  0.1855  0.0058  323 GLU A OE1 
131  O OE2 . GLU A 26  ? 0.6204 0.4141 0.4849 0.0595  0.2199  -0.0006 323 GLU A OE2 
132  N N   . PRO A 27  ? 0.5636 0.5328 0.3819 0.0813  0.0972  0.0139  324 PRO A N   
133  C CA  . PRO A 27  ? 0.5427 0.5507 0.3604 0.0669  0.0859  0.0052  324 PRO A CA  
134  C C   . PRO A 27  ? 0.5621 0.5647 0.4087 0.0583  0.1102  0.0197  324 PRO A C   
135  O O   . PRO A 27  ? 0.6731 0.6281 0.5350 0.0590  0.1366  0.0298  324 PRO A O   
136  C CB  . PRO A 27  ? 0.5666 0.5442 0.3406 0.0405  0.0890  -0.0198 324 PRO A CB  
137  C CG  . PRO A 27  ? 0.5643 0.4775 0.3245 0.0337  0.1205  -0.0200 324 PRO A CG  
138  C CD  . PRO A 27  ? 0.6082 0.5223 0.3877 0.0603  0.1167  -0.0038 324 PRO A CD  
139  N N   . PRO A 28  ? 0.4977 0.5472 0.3523 0.0483  0.1000  0.0187  325 PRO A N   
140  C CA  . PRO A 28  ? 0.5189 0.5587 0.3908 0.0345  0.1190  0.0350  325 PRO A CA  
141  C C   . PRO A 28  ? 0.6150 0.6106 0.4715 0.0055  0.1434  0.0238  325 PRO A C   
142  O O   . PRO A 28  ? 0.6400 0.6308 0.4703 -0.0079 0.1420  -0.0002 325 PRO A O   
143  C CB  . PRO A 28  ? 0.4973 0.6082 0.3744 0.0271  0.1004  0.0308  325 PRO A CB  
144  C CG  . PRO A 28  ? 0.4891 0.6362 0.3507 0.0258  0.0779  0.0002  325 PRO A CG  
145  C CD  . PRO A 28  ? 0.4695 0.5831 0.3183 0.0471  0.0692  -0.0005 325 PRO A CD  
146  N N   . ILE A 29  ? 0.6863 0.6458 0.5578 -0.0043 0.1621  0.0412  326 ILE A N   
147  C CA  . ILE A 29  ? 0.7386 0.6569 0.5991 -0.0326 0.1834  0.0318  326 ILE A CA  
148  C C   . ILE A 29  ? 0.7179 0.6792 0.5648 -0.0606 0.1775  0.0241  326 ILE A C   
149  O O   . ILE A 29  ? 0.6962 0.6843 0.5507 -0.0671 0.1716  0.0409  326 ILE A O   
150  C CB  . ILE A 29  ? 0.8154 0.6728 0.7007 -0.0320 0.2004  0.0520  326 ILE A CB  
151  C CG1 . ILE A 29  ? 0.8474 0.6671 0.7552 -0.0057 0.2096  0.0515  326 ILE A CG1 
152  C CG2 . ILE A 29  ? 0.8698 0.6860 0.7449 -0.0621 0.2190  0.0419  326 ILE A CG2 
153  C CD1 . ILE A 29  ? 0.9037 0.6615 0.8470 -0.0021 0.2237  0.0630  326 ILE A CD1 
154  N N   . LEU A 30  ? 0.6412 0.6092 0.4663 -0.0793 0.1789  -0.0030 327 LEU A N   
155  C CA  . LEU A 30  ? 0.6471 0.6617 0.4645 -0.1067 0.1737  -0.0174 327 LEU A CA  
156  C C   . LEU A 30  ? 0.6981 0.6709 0.5091 -0.1387 0.1960  -0.0127 327 LEU A C   
157  O O   . LEU A 30  ? 0.7304 0.6368 0.5416 -0.1388 0.2134  -0.0068 327 LEU A O   
158  C CB  . LEU A 30  ? 0.6385 0.6848 0.4398 -0.1096 0.1568  -0.0514 327 LEU A CB  
159  C CG  . LEU A 30  ? 0.5949 0.6803 0.3995 -0.0803 0.1273  -0.0588 327 LEU A CG  
160  C CD1 . LEU A 30  ? 0.6118 0.7226 0.4003 -0.0867 0.1032  -0.0935 327 LEU A CD1 
161  C CD2 . LEU A 30  ? 0.5540 0.7020 0.3848 -0.0684 0.1137  -0.0474 327 LEU A CD2 
162  N N   . TYR A 31  ? 0.7597 0.7725 0.5672 -0.1671 0.1955  -0.0176 328 TYR A N   
163  C CA  . TYR A 31  ? 0.7604 0.7354 0.5576 -0.2019 0.2139  -0.0132 328 TYR A CA  
164  C C   . TYR A 31  ? 0.8179 0.8065 0.6017 -0.2252 0.2172  -0.0467 328 TYR A C   
165  O O   . TYR A 31  ? 0.7882 0.8326 0.5731 -0.2205 0.2008  -0.0735 328 TYR A O   
166  C CB  . TYR A 31  ? 0.7742 0.7748 0.5692 -0.2265 0.2144  0.0061  328 TYR A CB  
167  C CG  . TYR A 31  ? 0.7848 0.7420 0.5859 -0.2130 0.2125  0.0447  328 TYR A CG  
168  C CD1 . TYR A 31  ? 0.7982 0.7863 0.6127 -0.1827 0.1976  0.0570  328 TYR A CD1 
169  C CD2 . TYR A 31  ? 0.8469 0.7295 0.6420 -0.2300 0.2215  0.0680  328 TYR A CD2 
170  C CE1 . TYR A 31  ? 0.7914 0.7379 0.6126 -0.1696 0.1925  0.0916  328 TYR A CE1 
171  C CE2 . TYR A 31  ? 0.8745 0.7123 0.6776 -0.2166 0.2131  0.1023  328 TYR A CE2 
172  C CZ  . TYR A 31  ? 0.8499 0.7204 0.6658 -0.1864 0.1989  0.1139  328 TYR A CZ  
173  O OH  . TYR A 31  ? 0.8820 0.7064 0.7071 -0.1724 0.1875  0.1472  328 TYR A OH  
174  N N   . SER A 32  ? 0.8839 0.8184 0.6574 -0.2494 0.2351  -0.0461 329 SER A N   
175  C CA  . SER A 32  ? 0.9274 0.8689 0.6877 -0.2745 0.2390  -0.0764 329 SER A CA  
176  C C   . SER A 32  ? 0.9933 0.9855 0.7536 -0.3111 0.2406  -0.0833 329 SER A C   
177  O O   . SER A 32  ? 0.8698 0.8709 0.6313 -0.3240 0.2442  -0.0598 329 SER A O   
178  C CB  . SER A 32  ? 0.9488 0.8094 0.6993 -0.2847 0.2585  -0.0755 329 SER A CB  
179  O OG  . SER A 32  ? 0.9267 0.7919 0.6632 -0.3125 0.2625  -0.1026 329 SER A OG  
180  N N   . GLU A 33  ? 1.0546 1.0783 0.8116 -0.3306 0.2378  -0.1170 330 GLU A N   
181  C CA  . GLU A 33  ? 1.1152 1.1852 0.8744 -0.3712 0.2441  -0.1301 330 GLU A CA  
182  C C   . GLU A 33  ? 1.1519 1.1551 0.8936 -0.4040 0.2656  -0.1126 330 GLU A C   
183  O O   . GLU A 33  ? 1.1880 1.2146 0.9249 -0.4443 0.2747  -0.1212 330 GLU A O   
184  C CB  . GLU A 33  ? 1.1695 1.2926 0.9379 -0.3793 0.2312  -0.1757 330 GLU A CB  
185  C CG  . GLU A 33  ? 1.1662 1.3496 0.9534 -0.3473 0.2021  -0.1988 330 GLU A CG  
186  C CD  . GLU A 33  ? 1.2047 1.4323 1.0040 -0.3569 0.1835  -0.2456 330 GLU A CD  
187  O OE1 . GLU A 33  ? 1.2510 1.4342 1.0330 -0.3732 0.1903  -0.2562 330 GLU A OE1 
188  O OE2 . GLU A 33  ? 1.1880 1.4944 1.0172 -0.3481 0.1603  -0.2736 330 GLU A OE2 
189  N N   . TYR A 34  ? 1.1796 1.1005 0.9145 -0.3871 0.2728  -0.0909 331 TYR A N   
190  C CA  . TYR A 34  ? 1.2622 1.1074 0.9855 -0.4109 0.2887  -0.0785 331 TYR A CA  
191  C C   . TYR A 34  ? 1.3281 1.1754 1.0388 -0.4566 0.2961  -0.0642 331 TYR A C   
192  O O   . TYR A 34  ? 1.3374 1.2085 1.0439 -0.4651 0.2923  -0.0425 331 TYR A O   
193  C CB  . TYR A 34  ? 1.2707 1.0385 1.0012 -0.3837 0.2920  -0.0522 331 TYR A CB  
194  C CG  . TYR A 34  ? 1.3488 1.0363 1.0749 -0.4057 0.3033  -0.0396 331 TYR A CG  
195  C CD1 . TYR A 34  ? 1.3981 1.0545 1.1179 -0.4198 0.3142  -0.0635 331 TYR A CD1 
196  C CD2 . TYR A 34  ? 1.4078 1.0466 1.1352 -0.4126 0.2992  -0.0042 331 TYR A CD2 
197  C CE1 . TYR A 34  ? 1.4643 1.0473 1.1836 -0.4389 0.3223  -0.0543 331 TYR A CE1 
198  C CE2 . TYR A 34  ? 1.4878 1.0482 1.2138 -0.4316 0.3034  0.0064  331 TYR A CE2 
199  C CZ  . TYR A 34  ? 1.5107 1.0452 1.2347 -0.4441 0.3158  -0.0196 331 TYR A CZ  
200  O OH  . TYR A 34  ? 1.5755 1.0319 1.3014 -0.4621 0.3182  -0.0114 331 TYR A OH  
201  N N   . ASP A 35  ? 1.3514 1.1708 1.0516 -0.4885 0.3066  -0.0768 332 ASP A N   
202  C CA  . ASP A 35  ? 1.3755 1.1949 1.0580 -0.5393 0.3148  -0.0678 332 ASP A CA  
203  C C   . ASP A 35  ? 1.4370 1.1599 1.1074 -0.5567 0.3220  -0.0510 332 ASP A C   
204  O O   . ASP A 35  ? 1.4070 1.1078 1.0781 -0.5642 0.3291  -0.0738 332 ASP A O   
205  C CB  . ASP A 35  ? 1.3500 1.2457 1.0363 -0.5679 0.3189  -0.1076 332 ASP A CB  
206  C CG  . ASP A 35  ? 1.3816 1.2939 1.0493 -0.6252 0.3302  -0.1021 332 ASP A CG  
207  O OD1 . ASP A 35  ? 1.4137 1.3049 1.0641 -0.6299 0.3242  -0.0685 332 ASP A OD1 
208  O OD2 . ASP A 35  ? 1.3856 1.3307 1.0562 -0.6533 0.3361  -0.1330 332 ASP A OD2 
209  N N   . PRO A 36  ? 1.5108 1.1730 1.1703 -0.5634 0.3169  -0.0117 333 PRO A N   
210  C CA  . PRO A 36  ? 1.5752 1.1390 1.2310 -0.5715 0.3151  0.0059  333 PRO A CA  
211  C C   . PRO A 36  ? 1.6115 1.1704 1.2487 -0.6107 0.3151  -0.0004 333 PRO A C   
212  O O   . PRO A 36  ? 1.6821 1.1730 1.3225 -0.6130 0.3138  0.0008  333 PRO A O   
213  C CB  . PRO A 36  ? 1.6145 1.1346 1.2669 -0.5602 0.2965  0.0483  333 PRO A CB  
214  C CG  . PRO A 36  ? 1.5959 1.1949 1.2317 -0.5729 0.2930  0.0542  333 PRO A CG  
215  C CD  . PRO A 36  ? 1.5129 1.1971 1.1632 -0.5629 0.3073  0.0171  333 PRO A CD  
216  N N   . THR A 37  ? 1.5774 1.2086 1.1981 -0.6401 0.3168  -0.0097 334 THR A N   
217  C CA  . THR A 37  ? 1.6081 1.2398 1.2102 -0.6793 0.3192  -0.0184 334 THR A CA  
218  C C   . THR A 37  ? 1.5865 1.2311 1.2016 -0.6838 0.3325  -0.0578 334 THR A C   
219  O O   . THR A 37  ? 1.6699 1.2912 1.2747 -0.7091 0.3347  -0.0648 334 THR A O   
220  C CB  . THR A 37  ? 1.6135 1.3214 1.1960 -0.7109 0.3196  -0.0231 334 THR A CB  
221  O OG1 . THR A 37  ? 1.6937 1.3912 1.2549 -0.7504 0.3225  -0.0287 334 THR A OG1 
222  C CG2 . THR A 37  ? 1.5214 1.3322 1.1260 -0.7052 0.3293  -0.0627 334 THR A CG2 
223  N N   . ARG A 38  ? 1.4859 1.1646 1.1213 -0.6598 0.3396  -0.0831 335 ARG A N   
224  C CA  . ARG A 38  ? 1.4555 1.1370 1.1003 -0.6613 0.3487  -0.1201 335 ARG A CA  
225  C C   . ARG A 38  ? 1.4644 1.0684 1.1174 -0.6306 0.3517  -0.1173 335 ARG A C   
226  O O   . ARG A 38  ? 1.3545 0.9427 1.0178 -0.5934 0.3458  -0.1003 335 ARG A O   
227  C CB  . ARG A 38  ? 1.3797 1.1554 1.0404 -0.6553 0.3480  -0.1565 335 ARG A CB  
228  N N   . PRO A 39  ? 1.5043 1.0665 1.1558 -0.6368 0.3571  -0.1364 336 PRO A N   
229  C CA  . PRO A 39  ? 1.5054 0.9980 1.1660 -0.6076 0.3619  -0.1409 336 PRO A CA  
230  C C   . PRO A 39  ? 1.4544 0.9840 1.1168 -0.5776 0.3611  -0.1726 336 PRO A C   
231  O O   . PRO A 39  ? 1.3351 0.9397 0.9953 -0.5790 0.3531  -0.1899 336 PRO A O   
232  C CB  . PRO A 39  ? 1.5703 1.0145 1.2265 -0.6250 0.3636  -0.1485 336 PRO A CB  
233  C CG  . PRO A 39  ? 1.5872 1.0933 1.2309 -0.6601 0.3639  -0.1674 336 PRO A CG  
234  C CD  . PRO A 39  ? 1.5525 1.1301 1.1947 -0.6702 0.3592  -0.1556 336 PRO A CD  
235  N N   . PHE A 40  ? 1.4727 0.9487 1.1387 -0.5528 0.3679  -0.1822 337 PHE A N   
236  C CA  . PHE A 40  ? 1.3482 0.8469 1.0054 -0.5269 0.3660  -0.2079 337 PHE A CA  
237  C C   . PHE A 40  ? 1.4667 0.9554 1.1039 -0.5438 0.3693  -0.2432 337 PHE A C   
238  O O   . PHE A 40  ? 1.4252 0.8546 1.0606 -0.5576 0.3818  -0.2508 337 PHE A O   
239  C CB  . PHE A 40  ? 1.3709 0.8249 1.0394 -0.4918 0.3734  -0.2007 337 PHE A CB  
240  C CG  . PHE A 40  ? 1.3324 0.8145 1.0168 -0.4660 0.3645  -0.1736 337 PHE A CG  
241  C CD1 . PHE A 40  ? 1.2694 0.8260 0.9476 -0.4585 0.3496  -0.1737 337 PHE A CD1 
242  C CD2 . PHE A 40  ? 1.3537 0.7875 1.0632 -0.4484 0.3683  -0.1503 337 PHE A CD2 
243  C CE1 . PHE A 40  ? 1.2039 0.7861 0.8962 -0.4348 0.3412  -0.1495 337 PHE A CE1 
244  C CE2 . PHE A 40  ? 1.3115 0.7692 1.0351 -0.4247 0.3584  -0.1255 337 PHE A CE2 
245  C CZ  . PHE A 40  ? 1.2161 0.7480 0.9290 -0.4183 0.3461  -0.1243 337 PHE A CZ  
246  N N   . SER A 41  ? 1.4477 0.9933 1.0715 -0.5424 0.3547  -0.2657 338 SER A N   
247  C CA  . SER A 41  ? 1.4899 1.0229 1.0886 -0.5504 0.3512  -0.2999 338 SER A CA  
248  C C   . SER A 41  ? 1.4847 1.0207 1.0632 -0.5205 0.3415  -0.3093 338 SER A C   
249  O O   . SER A 41  ? 1.2977 0.8630 0.8872 -0.4962 0.3342  -0.2919 338 SER A O   
250  C CB  . SER A 41  ? 1.3634 0.9554 0.9631 -0.5753 0.3351  -0.3217 338 SER A CB  
251  O OG  . SER A 41  ? 1.3106 0.9755 0.9195 -0.5599 0.3130  -0.3263 338 SER A OG  
252  N N   . GLU A 42  ? 0.9754 0.7975 0.7734 -0.4164 0.0189  -0.0958 339 GLU A N   
253  C CA  . GLU A 42  ? 0.9777 0.8314 0.7697 -0.4014 -0.0016 -0.0949 339 GLU A CA  
254  C C   . GLU A 42  ? 0.9069 0.8418 0.7542 -0.3930 -0.0185 -0.0755 339 GLU A C   
255  O O   . GLU A 42  ? 0.8543 0.8004 0.7041 -0.3687 -0.0235 -0.0682 339 GLU A O   
256  C CB  . GLU A 42  ? 1.0710 0.9359 0.8358 -0.4234 -0.0203 -0.1094 339 GLU A CB  
257  C CG  . GLU A 42  ? 1.0818 1.0014 0.8518 -0.4129 -0.0470 -0.1025 339 GLU A CG  
258  C CD  . GLU A 42  ? 1.1895 1.0952 0.9126 -0.4273 -0.0576 -0.1175 339 GLU A CD  
259  O OE1 . GLU A 42  ? 1.2613 1.1035 0.9369 -0.4140 -0.0409 -0.1294 339 GLU A OE1 
260  O OE2 . GLU A 42  ? 1.2123 1.1721 0.9470 -0.4511 -0.0815 -0.1160 339 GLU A OE2 
261  N N   . ALA A 43  ? 0.9002 0.8920 0.7949 -0.4125 -0.0253 -0.0665 340 ALA A N   
262  C CA  . ALA A 43  ? 0.8319 0.9079 0.7886 -0.4033 -0.0375 -0.0455 340 ALA A CA  
263  C C   . ALA A 43  ? 0.8071 0.8736 0.7829 -0.3798 -0.0143 -0.0322 340 ALA A C   
264  O O   . ALA A 43  ? 0.7851 0.8874 0.7846 -0.3445 -0.0184 -0.0184 340 ALA A O   
265  C CB  . ALA A 43  ? 0.8019 0.9412 0.8081 -0.4284 -0.0475 -0.0383 340 ALA A CB  
266  N N   . SER A 44  ? 0.8105 0.8237 0.7719 -0.3826 0.0123  -0.0338 341 SER A N   
267  C CA  . SER A 44  ? 0.7585 0.7600 0.7298 -0.3527 0.0357  -0.0192 341 SER A CA  
268  C C   . SER A 44  ? 0.7647 0.7185 0.6964 -0.3126 0.0396  -0.0208 341 SER A C   
269  O O   . SER A 44  ? 0.6870 0.6521 0.6294 -0.2792 0.0473  -0.0092 341 SER A O   
270  C CB  . SER A 44  ? 0.7218 0.6814 0.6863 -0.3703 0.0624  -0.0169 341 SER A CB  
271  O OG  . SER A 44  ? 0.7591 0.6331 0.6686 -0.3645 0.0744  -0.0270 341 SER A OG  
272  N N   . MET A 45  ? 0.8346 0.7355 0.7208 -0.3178 0.0355  -0.0360 342 MET A N   
273  C CA  . MET A 45  ? 0.7830 0.6446 0.6376 -0.2820 0.0385  -0.0368 342 MET A CA  
274  C C   . MET A 45  ? 0.7329 0.6461 0.6077 -0.2577 0.0197  -0.0314 342 MET A C   
275  O O   . MET A 45  ? 0.7319 0.6462 0.6106 -0.2242 0.0244  -0.0228 342 MET A O   
276  C CB  . MET A 45  ? 0.7984 0.5946 0.6041 -0.2937 0.0420  -0.0544 342 MET A CB  
277  C CG  . MET A 45  ? 0.7702 0.5394 0.5517 -0.2586 0.0425  -0.0549 342 MET A CG  
278  S SD  . MET A 45  ? 1.2524 0.9720 1.0219 -0.2240 0.0659  -0.0409 342 MET A SD  
279  C CE  . MET A 45  ? 0.9932 0.6260 0.7226 -0.2452 0.0891  -0.0521 342 MET A CE  
280  N N   . MET A 46  ? 0.7157 0.6710 0.6018 -0.2762 -0.0019 -0.0357 343 MET A N   
281  C CA  . MET A 46  ? 0.6527 0.6571 0.5594 -0.2543 -0.0194 -0.0271 343 MET A CA  
282  C C   . MET A 46  ? 0.5910 0.6500 0.5507 -0.2358 -0.0156 -0.0092 343 MET A C   
283  O O   . MET A 46  ? 0.5961 0.6746 0.5702 -0.2061 -0.0182 -0.0006 343 MET A O   
284  C CB  . MET A 46  ? 0.6874 0.7281 0.5918 -0.2804 -0.0452 -0.0319 343 MET A CB  
285  C CG  . MET A 46  ? 0.7007 0.6857 0.5446 -0.2950 -0.0476 -0.0518 343 MET A CG  
286  S SD  . MET A 46  ? 0.7939 0.7311 0.6051 -0.2531 -0.0367 -0.0529 343 MET A SD  
287  C CE  . MET A 46  ? 0.6145 0.6217 0.4685 -0.2243 -0.0536 -0.0316 343 MET A CE  
288  N N   . GLY A 47  ? 0.5811 0.6613 0.5695 -0.2541 -0.0060 -0.0043 344 GLY A N   
289  C CA  . GLY A 47  ? 0.5073 0.6323 0.5434 -0.2366 0.0054  0.0113  344 GLY A CA  
290  C C   . GLY A 47  ? 0.4769 0.5626 0.4930 -0.2045 0.0255  0.0126  344 GLY A C   
291  O O   . GLY A 47  ? 0.4558 0.5651 0.4934 -0.1777 0.0298  0.0202  344 GLY A O   
292  N N   . LEU A 48  ? 0.5225 0.5474 0.4966 -0.2080 0.0379  0.0056  345 LEU A N   
293  C CA  . LEU A 48  ? 0.5583 0.5476 0.5078 -0.1811 0.0526  0.0079  345 LEU A CA  
294  C C   . LEU A 48  ? 0.5931 0.5773 0.5313 -0.1542 0.0418  0.0050  345 LEU A C   
295  O O   . LEU A 48  ? 0.5857 0.5764 0.5285 -0.1315 0.0483  0.0084  345 LEU A O   
296  C CB  . LEU A 48  ? 0.5786 0.5058 0.4868 -0.1890 0.0644  0.0053  345 LEU A CB  
297  C CG  . LEU A 48  ? 0.7110 0.6254 0.6172 -0.1972 0.0864  0.0145  345 LEU A CG  
298  C CD1 . LEU A 48  ? 0.7491 0.7119 0.6988 -0.2215 0.0908  0.0184  345 LEU A CD1 
299  C CD2 . LEU A 48  ? 0.7453 0.5956 0.6136 -0.2076 0.0965  0.0141  345 LEU A CD2 
300  N N   . LEU A 49  ? 0.5807 0.5507 0.5016 -0.1592 0.0273  -0.0026 346 LEU A N   
301  C CA  . LEU A 49  ? 0.5687 0.5321 0.4790 -0.1366 0.0188  -0.0047 346 LEU A CA  
302  C C   . LEU A 49  ? 0.5586 0.5709 0.5047 -0.1232 0.0112  0.0026  346 LEU A C   
303  O O   . LEU A 49  ? 0.5896 0.5985 0.5364 -0.1003 0.0135  0.0039  346 LEU A O   
304  C CB  . LEU A 49  ? 0.5858 0.5225 0.4674 -0.1468 0.0090  -0.0142 346 LEU A CB  
305  C CG  . LEU A 49  ? 0.6080 0.4859 0.4531 -0.1539 0.0209  -0.0213 346 LEU A CG  
306  C CD1 . LEU A 49  ? 0.6455 0.4943 0.4606 -0.1590 0.0160  -0.0325 346 LEU A CD1 
307  C CD2 . LEU A 49  ? 0.5927 0.4460 0.4288 -0.1297 0.0325  -0.0144 346 LEU A CD2 
308  N N   . THR A 50  ? 0.5336 0.5918 0.5117 -0.1380 0.0025  0.0086  347 THR A N   
309  C CA  . THR A 50  ? 0.5180 0.6260 0.5373 -0.1229 -0.0031 0.0207  347 THR A CA  
310  C C   . THR A 50  ? 0.4877 0.6034 0.5301 -0.1028 0.0175  0.0259  347 THR A C   
311  O O   . THR A 50  ? 0.4777 0.5976 0.5318 -0.0793 0.0216  0.0296  347 THR A O   
312  C CB  . THR A 50  ? 0.5426 0.7079 0.5979 -0.1437 -0.0182 0.0301  347 THR A CB  
313  O OG1 . THR A 50  ? 0.5540 0.7127 0.5805 -0.1623 -0.0391 0.0237  347 THR A OG1 
314  C CG2 . THR A 50  ? 0.5177 0.7380 0.6249 -0.1226 -0.0200 0.0486  347 THR A CG2 
315  N N   . ASN A 51  ? 0.4622 0.5751 0.5077 -0.1135 0.0330  0.0253  348 ASN A N   
316  C CA  . ASN A 51  ? 0.4633 0.5787 0.5214 -0.0975 0.0563  0.0280  348 ASN A CA  
317  C C   . ASN A 51  ? 0.4465 0.5173 0.4662 -0.0786 0.0629  0.0188  348 ASN A C   
318  O O   . ASN A 51  ? 0.4239 0.4968 0.4525 -0.0600 0.0757  0.0182  348 ASN A O   
319  C CB  . ASN A 51  ? 0.5318 0.6473 0.5914 -0.1152 0.0730  0.0298  348 ASN A CB  
320  C CG  . ASN A 51  ? 0.5811 0.6935 0.6427 -0.0999 0.1005  0.0309  348 ASN A CG  
321  O OD1 . ASN A 51  ? 0.6092 0.6803 0.6279 -0.0907 0.1086  0.0235  348 ASN A OD1 
322  N ND2 . ASN A 51  ? 0.5713 0.7297 0.6825 -0.0976 0.1153  0.0407  348 ASN A ND2 
323  N N   . LEU A 52  ? 0.3573 0.3881 0.3357 -0.0845 0.0550  0.0118  349 LEU A N   
324  C CA  . LEU A 52  ? 0.3710 0.3671 0.3164 -0.0697 0.0564  0.0052  349 LEU A CA  
325  C C   . LEU A 52  ? 0.4067 0.4082 0.3624 -0.0540 0.0478  0.0031  349 LEU A C   
326  O O   . LEU A 52  ? 0.4490 0.4412 0.3996 -0.0405 0.0556  -0.0016 349 LEU A O   
327  C CB  . LEU A 52  ? 0.4214 0.3803 0.3308 -0.0770 0.0497  0.0028  349 LEU A CB  
328  C CG  . LEU A 52  ? 0.4671 0.3987 0.3482 -0.0630 0.0470  -0.0005 349 LEU A CG  
329  C CD1 . LEU A 52  ? 0.4083 0.3370 0.2754 -0.0569 0.0591  -0.0012 349 LEU A CD1 
330  C CD2 . LEU A 52  ? 0.4900 0.3890 0.3452 -0.0668 0.0428  0.0017  349 LEU A CD2 
331  N N   . ALA A 53  ? 0.3506 0.3649 0.3171 -0.0578 0.0327  0.0062  350 ALA A N   
332  C CA  . ALA A 53  ? 0.3720 0.3891 0.3459 -0.0438 0.0253  0.0075  350 ALA A CA  
333  C C   . ALA A 53  ? 0.4112 0.4528 0.4203 -0.0288 0.0358  0.0139  350 ALA A C   
334  O O   . ALA A 53  ? 0.4162 0.4444 0.4255 -0.0141 0.0408  0.0114  350 ALA A O   
335  C CB  . ALA A 53  ? 0.3652 0.3930 0.3383 -0.0529 0.0082  0.0114  350 ALA A CB  
336  N N   . ASP A 54  ? 0.4077 0.4843 0.4491 -0.0329 0.0413  0.0227  351 ASP A N   
337  C CA  . ASP A 54  ? 0.4279 0.5307 0.5104 -0.0156 0.0553  0.0320  351 ASP A CA  
338  C C   . ASP A 54  ? 0.4046 0.4768 0.4728 -0.0032 0.0791  0.0205  351 ASP A C   
339  O O   . ASP A 54  ? 0.3993 0.4644 0.4817 0.0146  0.0908  0.0210  351 ASP A O   
340  C CB  . ASP A 54  ? 0.5137 0.6654 0.6383 -0.0235 0.0584  0.0448  351 ASP A CB  
341  C CG  . ASP A 54  ? 0.6321 0.8143 0.8073 -0.0015 0.0765  0.0580  351 ASP A CG  
342  O OD1 . ASP A 54  ? 0.6851 0.8875 0.8868 0.0128  0.0677  0.0722  351 ASP A OD1 
343  O OD2 . ASP A 54  ? 0.6715 0.8556 0.8591 0.0029  0.1019  0.0556  351 ASP A OD2 
344  N N   . ARG A 55  ? 0.3915 0.4422 0.4276 -0.0139 0.0868  0.0101  352 ARG A N   
345  C CA  . ARG A 55  ? 0.4412 0.4625 0.4523 -0.0070 0.1069  -0.0027 352 ARG A CA  
346  C C   . ARG A 55  ? 0.4081 0.3952 0.3877 -0.0036 0.0979  -0.0143 352 ARG A C   
347  O O   . ARG A 55  ? 0.4215 0.3892 0.3949 0.0051  0.1119  -0.0242 352 ARG A O   
348  C CB  . ARG A 55  ? 0.4850 0.4971 0.4679 -0.0199 0.1167  -0.0064 352 ARG A CB  
349  C CG  . ARG A 55  ? 0.4527 0.4946 0.4685 -0.0204 0.1386  0.0018  352 ARG A CG  
350  C CD  . ARG A 55  ? 0.5122 0.5567 0.5137 -0.0397 0.1387  0.0064  352 ARG A CD  
351  N NE  . ARG A 55  ? 0.5976 0.6024 0.5412 -0.0452 0.1393  -0.0020 352 ARG A NE  
352  C CZ  . ARG A 55  ? 0.5976 0.5866 0.5152 -0.0586 0.1274  0.0021  352 ARG A CZ  
353  N NH1 . ARG A 55  ? 0.5365 0.5402 0.4762 -0.0713 0.1155  0.0098  352 ARG A NH1 
354  N NH2 . ARG A 55  ? 0.6588 0.6167 0.5272 -0.0598 0.1274  -0.0010 352 ARG A NH2 
355  N N   . GLU A 56  ? 0.4550 0.4345 0.4167 -0.0116 0.0764  -0.0135 353 GLU A N   
356  C CA  . GLU A 56  ? 0.4902 0.4463 0.4318 -0.0091 0.0665  -0.0212 353 GLU A CA  
357  C C   . GLU A 56  ? 0.4665 0.4225 0.4323 0.0032  0.0695  -0.0196 353 GLU A C   
358  O O   . GLU A 56  ? 0.4970 0.4307 0.4508 0.0054  0.0725  -0.0297 353 GLU A O   
359  C CB  . GLU A 56  ? 0.4759 0.4281 0.4038 -0.0164 0.0473  -0.0172 353 GLU A CB  
360  C CG  . GLU A 56  ? 0.4353 0.3736 0.3324 -0.0252 0.0447  -0.0185 353 GLU A CG  
361  C CD  . GLU A 56  ? 0.4763 0.4043 0.3629 -0.0278 0.0308  -0.0148 353 GLU A CD  
362  O OE1 . GLU A 56  ? 0.4752 0.4081 0.3687 -0.0338 0.0268  -0.0100 353 GLU A OE1 
363  O OE2 . GLU A 56  ? 0.5058 0.4217 0.3778 -0.0245 0.0248  -0.0169 353 GLU A OE2 
364  N N   . LEU A 57  ? 0.4221 0.4043 0.4223 0.0099  0.0682  -0.0056 354 LEU A N   
365  C CA  . LEU A 57  ? 0.4797 0.4631 0.5051 0.0242  0.0714  0.0022  354 LEU A CA  
366  C C   . LEU A 57  ? 0.4394 0.4018 0.4724 0.0359  0.0965  -0.0060 354 LEU A C   
367  O O   . LEU A 57  ? 0.4213 0.3601 0.4549 0.0425  0.1017  -0.0092 354 LEU A O   
368  C CB  . LEU A 57  ? 0.5321 0.5556 0.5938 0.0295  0.0636  0.0231  354 LEU A CB  
369  C CG  . LEU A 57  ? 0.5893 0.6245 0.6409 0.0204  0.0394  0.0311  354 LEU A CG  
370  C CD1 . LEU A 57  ? 0.6242 0.7053 0.7096 0.0225  0.0293  0.0518  354 LEU A CD1 
371  C CD2 . LEU A 57  ? 0.5950 0.6045 0.6327 0.0262  0.0361  0.0298  354 LEU A CD2 
372  N N   . VAL A 58  ? 0.4521 0.4195 0.4896 0.0375  0.1150  -0.0100 355 VAL A N   
373  C CA  . VAL A 58  ? 0.5043 0.4458 0.5435 0.0481  0.1445  -0.0210 355 VAL A CA  
374  C C   . VAL A 58  ? 0.5222 0.4200 0.5173 0.0373  0.1453  -0.0442 355 VAL A C   
375  O O   . VAL A 58  ? 0.5196 0.3869 0.5161 0.0436  0.1611  -0.0530 355 VAL A O   
376  C CB  . VAL A 58  ? 0.5050 0.4578 0.5484 0.0491  0.1668  -0.0234 355 VAL A CB  
377  C CG1 . VAL A 58  ? 0.4609 0.3807 0.5026 0.0612  0.2026  -0.0370 355 VAL A CG1 
378  C CG2 . VAL A 58  ? 0.4559 0.4607 0.5503 0.0563  0.1636  0.0007  355 VAL A CG2 
379  N N   . HIS A 59  ? 0.5075 0.4034 0.4655 0.0202  0.1277  -0.0526 356 HIS A N   
380  C CA  . HIS A 59  ? 0.5414 0.4083 0.4610 0.0072  0.1218  -0.0713 356 HIS A CA  
381  C C   . HIS A 59  ? 0.5382 0.3993 0.4681 0.0065  0.1064  -0.0682 356 HIS A C   
382  O O   . HIS A 59  ? 0.5940 0.4298 0.5083 -0.0018 0.1085  -0.0832 356 HIS A O   
383  C CB  . HIS A 59  ? 0.5338 0.4064 0.4156 -0.0075 0.1070  -0.0750 356 HIS A CB  
384  C CG  . HIS A 59  ? 0.5530 0.4226 0.4126 -0.0102 0.1255  -0.0812 356 HIS A CG  
385  N ND1 . HIS A 59  ? 0.5620 0.4543 0.4312 -0.0091 0.1276  -0.0678 356 HIS A ND1 
386  C CD2 . HIS A 59  ? 0.5778 0.4223 0.4035 -0.0159 0.1451  -0.1001 356 HIS A CD2 
387  C CE1 . HIS A 59  ? 0.6144 0.4977 0.4591 -0.0122 0.1487  -0.0760 356 HIS A CE1 
388  N NE2 . HIS A 59  ? 0.6474 0.5009 0.4624 -0.0158 0.1599  -0.0962 356 HIS A NE2 
389  N N   . MET A 60  ? 0.4804 0.3646 0.4345 0.0129  0.0920  -0.0496 357 MET A N   
390  C CA  . MET A 60  ? 0.4578 0.3376 0.4213 0.0134  0.0808  -0.0440 357 MET A CA  
391  C C   . MET A 60  ? 0.4648 0.3207 0.4468 0.0227  0.0994  -0.0455 357 MET A C   
392  O O   . MET A 60  ? 0.4885 0.3245 0.4673 0.0167  0.0986  -0.0516 357 MET A O   
393  C CB  . MET A 60  ? 0.4129 0.3193 0.3924 0.0184  0.0656  -0.0245 357 MET A CB  
394  C CG  . MET A 60  ? 0.4222 0.3237 0.4060 0.0189  0.0565  -0.0178 357 MET A CG  
395  S SD  . MET A 60  ? 0.3609 0.2887 0.3546 0.0238  0.0424  0.0035  357 MET A SD  
396  C CE  . MET A 60  ? 0.3004 0.2396 0.2712 0.0111  0.0295  -0.0018 357 MET A CE  
397  N N   . ILE A 61  ? 0.5000 0.3578 0.5046 0.0377  0.1186  -0.0385 358 ILE A N   
398  C CA  . ILE A 61  ? 0.5514 0.3815 0.5768 0.0510  0.1421  -0.0370 358 ILE A CA  
399  C C   . ILE A 61  ? 0.5968 0.3807 0.5946 0.0389  0.1603  -0.0654 358 ILE A C   
400  O O   . ILE A 61  ? 0.6479 0.3988 0.6501 0.0381  0.1711  -0.0703 358 ILE A O   
401  C CB  . ILE A 61  ? 0.5478 0.3966 0.6103 0.0732  0.1598  -0.0195 358 ILE A CB  
402  C CG1 . ILE A 61  ? 0.5381 0.4332 0.6281 0.0815  0.1381  0.0094  358 ILE A CG1 
403  C CG2 . ILE A 61  ? 0.5930 0.4048 0.6764 0.0903  0.1912  -0.0188 358 ILE A CG2 
404  C CD1 . ILE A 61  ? 0.5690 0.5050 0.6928 0.0939  0.1430  0.0262  358 ILE A CD1 
405  N N   . ASN A 62  ? 0.6113 0.3912 0.5772 0.0270  0.1638  -0.0844 359 ASN A N   
406  C CA  . ASN A 62  ? 0.6253 0.3645 0.5534 0.0089  0.1755  -0.1142 359 ASN A CA  
407  C C   . ASN A 62  ? 0.5876 0.3251 0.4994 -0.0123 0.1512  -0.1222 359 ASN A C   
408  O O   . ASN A 62  ? 0.6380 0.3408 0.5367 -0.0267 0.1596  -0.1412 359 ASN A O   
409  C CB  . ASN A 62  ? 0.6131 0.3532 0.5029 -0.0009 0.1812  -0.1302 359 ASN A CB  
410  C CG  . ASN A 62  ? 0.6860 0.4212 0.5913 0.0180  0.2139  -0.1273 359 ASN A CG  
411  O OD1 . ASN A 62  ? 0.6799 0.3982 0.6195 0.0372  0.2382  -0.1202 359 ASN A OD1 
412  N ND2 . ASN A 62  ? 0.7132 0.4640 0.5960 0.0140  0.2168  -0.1305 359 ASN A ND2 
413  N N   . TRP A 63  ? 0.5230 0.2978 0.4379 -0.0149 0.1227  -0.1079 360 TRP A N   
414  C CA  . TRP A 63  ? 0.5513 0.3332 0.4599 -0.0313 0.1005  -0.1107 360 TRP A CA  
415  C C   . TRP A 63  ? 0.6057 0.3734 0.5432 -0.0276 0.1059  -0.1028 360 TRP A C   
416  O O   . TRP A 63  ? 0.5013 0.2544 0.4347 -0.0451 0.1030  -0.1150 360 TRP A O   
417  C CB  . TRP A 63  ? 0.5153 0.3357 0.4229 -0.0304 0.0750  -0.0954 360 TRP A CB  
418  C CG  . TRP A 63  ? 0.5186 0.3519 0.4380 -0.0373 0.0574  -0.0890 360 TRP A CG  
419  C CD1 . TRP A 63  ? 0.4876 0.3283 0.3955 -0.0555 0.0427  -0.0985 360 TRP A CD1 
420  C CD2 . TRP A 63  ? 0.4891 0.3329 0.4350 -0.0263 0.0539  -0.0703 360 TRP A CD2 
421  N NE1 . TRP A 63  ? 0.4304 0.2864 0.3622 -0.0547 0.0328  -0.0863 360 TRP A NE1 
422  C CE2 . TRP A 63  ? 0.4511 0.3057 0.4023 -0.0371 0.0408  -0.0700 360 TRP A CE2 
423  C CE3 . TRP A 63  ? 0.4981 0.3462 0.4626 -0.0092 0.0599  -0.0529 360 TRP A CE3 
424  C CZ2 . TRP A 63  ? 0.4353 0.2993 0.4068 -0.0305 0.0382  -0.0546 360 TRP A CZ2 
425  C CZ3 . TRP A 63  ? 0.4534 0.3105 0.4318 -0.0046 0.0538  -0.0380 360 TRP A CZ3 
426  C CH2 . TRP A 63  ? 0.4386 0.3007 0.4189 -0.0147 0.0452  -0.0397 360 TRP A CH2 
427  N N   . ALA A 64  ? 0.5866 0.3605 0.5531 -0.0062 0.1131  -0.0810 361 ALA A N   
428  C CA  . ALA A 64  ? 0.5746 0.3341 0.5662 0.0005  0.1203  -0.0682 361 ALA A CA  
429  C C   . ALA A 64  ? 0.6334 0.3435 0.6252 -0.0054 0.1460  -0.0844 361 ALA A C   
430  O O   . ALA A 64  ? 0.6626 0.3536 0.6612 -0.0165 0.1483  -0.0867 361 ALA A O   
431  C CB  . ALA A 64  ? 0.5230 0.3012 0.5410 0.0250  0.1225  -0.0399 361 ALA A CB  
432  N N   . LYS A 65  ? 0.6556 0.3419 0.6395 0.0010  0.1684  -0.0965 362 LYS A N   
433  C CA  . LYS A 65  ? 0.7579 0.3899 0.7379 -0.0041 0.1977  -0.1140 362 LYS A CA  
434  C C   . LYS A 65  ? 0.8001 0.4197 0.7507 -0.0386 0.1868  -0.1407 362 LYS A C   
435  O O   . LYS A 65  ? 0.8474 0.4401 0.8009 -0.0491 0.1982  -0.1472 362 LYS A O   
436  C CB  . LYS A 65  ? 0.7429 0.3666 0.7169 0.0083  0.2199  -0.1194 362 LYS A CB  
437  C CG  . LYS A 65  ? 0.7390 0.3819 0.7518 0.0424  0.2315  -0.0900 362 LYS A CG  
438  C CD  . LYS A 65  ? 0.7911 0.4207 0.8386 0.0593  0.2445  -0.0661 362 LYS A CD  
439  C CE  . LYS A 65  ? 0.8895 0.4765 0.9284 0.0530  0.2714  -0.0805 362 LYS A CE  
440  N NZ  . LYS A 65  ? 0.9009 0.4788 0.9774 0.0783  0.2917  -0.0524 362 LYS A NZ  
441  N N   . ARG A 66  ? 0.8115 0.4547 0.7353 -0.0566 0.1638  -0.1542 363 ARG A N   
442  C CA  . ARG A 66  ? 0.8169 0.4614 0.7148 -0.0899 0.1476  -0.1764 363 ARG A CA  
443  C C   . ARG A 66  ? 0.7568 0.4242 0.6757 -0.1034 0.1259  -0.1679 363 ARG A C   
444  O O   . ARG A 66  ? 0.8079 0.4795 0.7154 -0.1329 0.1124  -0.1846 363 ARG A O   
445  C CB  . ARG A 66  ? 0.8122 0.4770 0.6687 -0.1021 0.1325  -0.1910 363 ARG A CB  
446  C CG  . ARG A 66  ? 0.8978 0.5419 0.7308 -0.0943 0.1552  -0.2010 363 ARG A CG  
447  C CD  . ARG A 66  ? 0.9494 0.6147 0.7388 -0.1059 0.1404  -0.2112 363 ARG A CD  
448  N NE  . ARG A 66  ? 1.0535 0.6968 0.8191 -0.1009 0.1650  -0.2215 363 ARG A NE  
449  C CZ  . ARG A 66  ? 1.0734 0.7158 0.8507 -0.0765 0.1860  -0.2109 363 ARG A CZ  
450  N NH1 . ARG A 66  ? 1.0164 0.6791 0.8273 -0.0553 0.1839  -0.1902 363 ARG A NH1 
451  N NH2 . ARG A 66  ? 1.1309 0.7534 0.8879 -0.0738 0.2101  -0.2207 363 ARG A NH2 
452  N N   . VAL A 67  ? 0.6184 0.3100 0.5694 -0.0814 0.1205  -0.1383 364 VAL A N   
453  C CA  . VAL A 67  ? 0.5887 0.3018 0.5640 -0.0891 0.1065  -0.1255 364 VAL A CA  
454  C C   . VAL A 67  ? 0.7101 0.3796 0.7002 -0.1016 0.1278  -0.1327 364 VAL A C   
455  O O   . VAL A 67  ? 0.8031 0.4379 0.8061 -0.0832 0.1526  -0.1223 364 VAL A O   
456  C CB  . VAL A 67  ? 0.5621 0.3035 0.5595 -0.0630 0.1004  -0.0940 364 VAL A CB  
457  C CG1 . VAL A 67  ? 0.5727 0.3279 0.5937 -0.0698 0.0944  -0.0814 364 VAL A CG1 
458  C CG2 . VAL A 67  ? 0.4863 0.2661 0.4698 -0.0543 0.0807  -0.0878 364 VAL A CG2 
459  N N   . PRO A 68  ? 0.7126 0.3848 0.7032 -0.1336 0.1183  -0.1489 365 PRO A N   
460  C CA  . PRO A 68  ? 0.7655 0.4048 0.7684 -0.1479 0.1351  -0.1546 365 PRO A CA  
461  C C   . PRO A 68  ? 0.7910 0.4165 0.8261 -0.1273 0.1522  -0.1264 365 PRO A C   
462  O O   . PRO A 68  ? 0.7624 0.4150 0.8191 -0.1238 0.1427  -0.1079 365 PRO A O   
463  C CB  . PRO A 68  ? 0.7575 0.4278 0.7663 -0.1836 0.1122  -0.1672 365 PRO A CB  
464  C CG  . PRO A 68  ? 0.7369 0.4422 0.7197 -0.1919 0.0869  -0.1790 365 PRO A CG  
465  C CD  . PRO A 68  ? 0.6879 0.4087 0.6703 -0.1543 0.0868  -0.1562 365 PRO A CD  
466  N N   . GLY A 69  ? 0.8680 0.4561 0.9048 -0.1120 0.1773  -0.1206 366 GLY A N   
467  C CA  . GLY A 69  ? 0.8631 0.4386 0.9254 -0.0915 0.1935  -0.0914 366 GLY A CA  
468  C C   . GLY A 69  ? 0.8083 0.3845 0.8752 -0.0541 0.2021  -0.0671 366 GLY A C   
469  O O   . GLY A 69  ? 0.8578 0.4197 0.9403 -0.0340 0.2184  -0.0432 366 GLY A O   
470  N N   . PHE A 70  ? 0.7171 0.3132 0.7711 -0.0453 0.1903  -0.0719 367 PHE A N   
471  C CA  . PHE A 70  ? 0.7121 0.3190 0.7747 -0.0119 0.1941  -0.0478 367 PHE A CA  
472  C C   . PHE A 70  ? 0.7797 0.3623 0.8475 0.0057  0.2185  -0.0446 367 PHE A C   
473  O O   . PHE A 70  ? 0.7852 0.3728 0.8733 0.0328  0.2271  -0.0155 367 PHE A O   
474  C CB  . PHE A 70  ? 0.6396 0.2829 0.6870 -0.0096 0.1733  -0.0543 367 PHE A CB  
475  C CG  . PHE A 70  ? 0.6092 0.2818 0.6677 0.0201  0.1689  -0.0274 367 PHE A CG  
476  C CD1 . PHE A 70  ? 0.5837 0.2918 0.6491 0.0292  0.1515  -0.0019 367 PHE A CD1 
477  C CD2 . PHE A 70  ? 0.6171 0.2838 0.6788 0.0368  0.1828  -0.0282 367 PHE A CD2 
478  C CE1 . PHE A 70  ? 0.5456 0.2841 0.6189 0.0512  0.1441  0.0213  367 PHE A CE1 
479  C CE2 . PHE A 70  ? 0.6086 0.3109 0.6867 0.0610  0.1762  -0.0023 367 PHE A CE2 
480  C CZ  . PHE A 70  ? 0.5642 0.3033 0.6470 0.0664  0.1548  0.0219  367 PHE A CZ  
481  N N   . VAL A 71  ? 0.8479 0.4062 0.8968 -0.0103 0.2294  -0.0732 368 VAL A N   
482  C CA  . VAL A 71  ? 0.9185 0.4497 0.9710 0.0049  0.2568  -0.0728 368 VAL A CA  
483  C C   . VAL A 71  ? 0.9737 0.4746 1.0455 0.0114  0.2783  -0.0572 368 VAL A C   
484  O O   . VAL A 71  ? 1.0526 0.5361 1.1387 0.0328  0.3021  -0.0441 368 VAL A O   
485  C CB  . VAL A 71  ? 1.0009 0.5104 1.0207 -0.0163 0.2644  -0.1089 368 VAL A CB  
486  C CG1 . VAL A 71  ? 1.0568 0.5389 1.0612 -0.0491 0.2657  -0.1321 368 VAL A CG1 
487  C CG2 . VAL A 71  ? 1.0603 0.5477 1.0845 0.0041  0.2941  -0.1062 368 VAL A CG2 
488  N N   . ASP A 72  ? 0.9239 0.4201 0.9984 -0.0066 0.2711  -0.0570 369 ASP A N   
489  C CA  . ASP A 72  ? 0.9171 0.3843 1.0084 -0.0025 0.2914  -0.0417 369 ASP A CA  
490  C C   . ASP A 72  ? 0.8728 0.3600 0.9891 0.0298  0.2919  0.0007  369 ASP A C   
491  O O   . ASP A 72  ? 0.8743 0.3410 1.0052 0.0395  0.3093  0.0201  369 ASP A O   
492  C CB  . ASP A 72  ? 0.9236 0.3840 1.0120 -0.0337 0.2834  -0.0540 369 ASP A CB  
493  C CG  . ASP A 72  ? 0.9814 0.4297 1.0449 -0.0690 0.2775  -0.0942 369 ASP A CG  
494  O OD1 . ASP A 72  ? 1.0585 0.4730 1.1067 -0.0732 0.2968  -0.1131 369 ASP A OD1 
495  O OD2 . ASP A 72  ? 0.9528 0.4274 1.0116 -0.0929 0.2536  -0.1056 369 ASP A OD2 
496  N N   . LEU A 73  ? 0.8435 0.3713 0.9624 0.0453  0.2718  0.0153  370 LEU A N   
497  C CA  . LEU A 73  ? 0.7941 0.3492 0.9313 0.0731  0.2660  0.0555  370 LEU A CA  
498  C C   . LEU A 73  ? 0.8468 0.4054 1.0033 0.1030  0.2812  0.0754  370 LEU A C   
499  O O   . LEU A 73  ? 0.8931 0.4417 1.0477 0.1045  0.2927  0.0577  370 LEU A O   
500  C CB  . LEU A 73  ? 0.6810 0.2789 0.8112 0.0743  0.2371  0.0626  370 LEU A CB  
501  C CG  . LEU A 73  ? 0.6588 0.2614 0.7760 0.0492  0.2219  0.0510  370 LEU A CG  
502  C CD1 . LEU A 73  ? 0.5831 0.2222 0.6914 0.0521  0.1977  0.0553  370 LEU A CD1 
503  C CD2 . LEU A 73  ? 0.6567 0.2526 0.7811 0.0493  0.2282  0.0735  370 LEU A CD2 
504  N N   . THR A 74  ? 0.8437 0.4187 1.0187 0.1262  0.2816  0.1135  371 THR A N   
505  C CA  . THR A 74  ? 0.8676 0.4625 1.0674 0.1566  0.2892  0.1402  371 THR A CA  
506  C C   . THR A 74  ? 0.8578 0.4956 1.0594 0.1630  0.2694  0.1378  371 THR A C   
507  O O   . THR A 74  ? 0.8226 0.4853 1.0088 0.1523  0.2441  0.1328  371 THR A O   
508  C CB  . THR A 74  ? 0.9864 0.6024 1.2014 0.1775  0.2845  0.1839  371 THR A CB  
509  O OG1 . THR A 74  ? 1.0496 0.6224 1.2731 0.1809  0.3130  0.1904  371 THR A OG1 
510  C CG2 . THR A 74  ? 0.9793 0.6430 1.2196 0.2059  0.2755  0.2154  371 THR A CG2 
511  N N   . LEU A 75  ? 0.8571 0.5015 1.0781 0.1797  0.2834  0.1408  372 LEU A N   
512  C CA  . LEU A 75  ? 0.8583 0.5453 1.0870 0.1871  0.2684  0.1407  372 LEU A CA  
513  C C   . LEU A 75  ? 0.8421 0.5862 1.0785 0.1968  0.2361  0.1710  372 LEU A C   
514  O O   . LEU A 75  ? 0.7964 0.5696 1.0239 0.1900  0.2151  0.1628  372 LEU A O   
515  C CB  . LEU A 75  ? 0.8915 0.5813 1.1486 0.2076  0.2919  0.1491  372 LEU A CB  
516  C CG  . LEU A 75  ? 0.8812 0.6273 1.1626 0.2228  0.2791  0.1634  372 LEU A CG  
517  C CD1 . LEU A 75  ? 0.9440 0.6719 1.2308 0.2254  0.3061  0.1433  372 LEU A CD1 
518  C CD2 . LEU A 75  ? 0.8926 0.6863 1.2115 0.2484  0.2699  0.2102  372 LEU A CD2 
519  N N   . HIS A 76  ? 0.8679 0.6268 1.1176 0.2114  0.2325  0.2059  373 HIS A N   
520  C CA  . HIS A 76  ? 0.8171 0.6305 1.0671 0.2179  0.2008  0.2357  373 HIS A CA  
521  C C   . HIS A 76  ? 0.7283 0.5352 0.9421 0.1970  0.1817  0.2244  373 HIS A C   
522  O O   . HIS A 76  ? 0.7106 0.5583 0.9128 0.1942  0.1538  0.2347  373 HIS A O   
523  C CB  . HIS A 76  ? 0.8758 0.7054 1.1449 0.2379  0.2029  0.2756  373 HIS A CB  
524  C CG  . HIS A 76  ? 0.9402 0.7795 1.2492 0.2607  0.2226  0.2918  373 HIS A CG  
525  N ND1 . HIS A 76  ? 0.9235 0.8111 1.2589 0.2704  0.2135  0.2986  373 HIS A ND1 
526  C CD2 . HIS A 76  ? 1.0128 0.8199 1.3420 0.2759  0.2531  0.3033  373 HIS A CD2 
527  C CE1 . HIS A 76  ? 0.9680 0.8534 1.3386 0.2909  0.2376  0.3142  373 HIS A CE1 
528  N NE2 . HIS A 76  ? 1.0367 0.8717 1.4033 0.2955  0.2626  0.3176  373 HIS A NE2 
529  N N   . ASP A 77  ? 0.6836 0.4403 0.8798 0.1809  0.1973  0.2035  374 ASP A N   
530  C CA  . ASP A 77  ? 0.6592 0.4073 0.8252 0.1596  0.1840  0.1907  374 ASP A CA  
531  C C   . ASP A 77  ? 0.6643 0.4151 0.8178 0.1449  0.1740  0.1607  374 ASP A C   
532  O O   . ASP A 77  ? 0.7401 0.5095 0.8722 0.1332  0.1537  0.1579  374 ASP A O   
533  C CB  . ASP A 77  ? 0.6947 0.3950 0.8531 0.1448  0.2038  0.1780  374 ASP A CB  
534  C CG  . ASP A 77  ? 0.7713 0.4708 0.9337 0.1567  0.2094  0.2105  374 ASP A CG  
535  O OD1 . ASP A 77  ? 0.7456 0.4811 0.9172 0.1772  0.1983  0.2423  374 ASP A OD1 
536  O OD2 . ASP A 77  ? 0.8503 0.5154 1.0070 0.1445  0.2242  0.2046  374 ASP A OD2 
537  N N   . GLN A 78  ? 0.6479 0.3819 0.8103 0.1437  0.1890  0.1369  375 GLN A N   
538  C CA  . GLN A 78  ? 0.6284 0.3675 0.7782 0.1316  0.1808  0.1090  375 GLN A CA  
539  C C   . GLN A 78  ? 0.4926 0.2949 0.6451 0.1381  0.1542  0.1236  375 GLN A C   
540  O O   . GLN A 78  ? 0.4578 0.2857 0.5860 0.1195  0.1317  0.1083  375 GLN A O   
541  C CB  . GLN A 78  ? 0.6655 0.3777 0.8186 0.1290  0.2036  0.0823  375 GLN A CB  
542  C CG  . GLN A 78  ? 0.7278 0.3902 0.8655 0.1084  0.2217  0.0565  375 GLN A CG  
543  C CD  . GLN A 78  ? 0.7611 0.3972 0.8958 0.1063  0.2451  0.0333  375 GLN A CD  
544  O OE1 . GLN A 78  ? 0.7266 0.3796 0.8783 0.1252  0.2535  0.0426  375 GLN A OE1 
545  N NE2 . GLN A 78  ? 0.8064 0.4034 0.9196 0.0820  0.2559  0.0037  375 GLN A NE2 
546  N N   . VAL A 79  ? 0.5031 0.3302 0.6877 0.1641  0.1577  0.1543  376 VAL A N   
547  C CA  . VAL A 79  ? 0.4939 0.3855 0.6875 0.1683  0.1321  0.1709  376 VAL A CA  
548  C C   . VAL A 79  ? 0.5308 0.4506 0.6943 0.1541  0.1021  0.1804  376 VAL A C   
549  O O   . VAL A 79  ? 0.5445 0.4972 0.6889 0.1375  0.0795  0.1687  376 VAL A O   
550  C CB  . VAL A 79  ? 0.5237 0.4437 0.7639 0.1996  0.1396  0.2092  376 VAL A CB  
551  C CG1 . VAL A 79  ? 0.4721 0.4659 0.7208 0.1999  0.1063  0.2332  376 VAL A CG1 
552  C CG2 . VAL A 79  ? 0.5516 0.4570 0.8163 0.2080  0.1675  0.1940  376 VAL A CG2 
553  N N   . HIS A 80  ? 0.5279 0.4296 0.6846 0.1602  0.1054  0.2012  377 HIS A N   
554  C CA  . HIS A 80  ? 0.5365 0.4586 0.6596 0.1482  0.0825  0.2112  377 HIS A CA  
555  C C   . HIS A 80  ? 0.4908 0.4021 0.5782 0.1209  0.0742  0.1763  377 HIS A C   
556  O O   . HIS A 80  ? 0.5046 0.4457 0.5668 0.1078  0.0522  0.1719  377 HIS A O   
557  C CB  . HIS A 80  ? 0.6233 0.5189 0.7432 0.1592  0.0942  0.2385  377 HIS A CB  
558  C CG  . HIS A 80  ? 0.6672 0.5776 0.7460 0.1465  0.0759  0.2474  377 HIS A CG  
559  N ND1 . HIS A 80  ? 0.7064 0.6632 0.7716 0.1509  0.0517  0.2753  377 HIS A ND1 
560  C CD2 . HIS A 80  ? 0.6632 0.5497 0.7104 0.1284  0.0794  0.2310  377 HIS A CD2 
561  C CE1 . HIS A 80  ? 0.7040 0.6580 0.7241 0.1357  0.0432  0.2737  377 HIS A CE1 
562  N NE2 . HIS A 80  ? 0.6780 0.5902 0.6898 0.1237  0.0613  0.2479  377 HIS A NE2 
563  N N   . LEU A 81  ? 0.4548 0.3237 0.5412 0.1119  0.0923  0.1523  378 LEU A N   
564  C CA  . LEU A 81  ? 0.4455 0.3080 0.5060 0.0890  0.0853  0.1234  378 LEU A CA  
565  C C   . LEU A 81  ? 0.4329 0.3226 0.4845 0.0795  0.0694  0.1050  378 LEU A C   
566  O O   . LEU A 81  ? 0.4488 0.3518 0.4756 0.0664  0.0549  0.0959  378 LEU A O   
567  C CB  . LEU A 81  ? 0.5033 0.3234 0.5701 0.0792  0.1047  0.1018  378 LEU A CB  
568  C CG  . LEU A 81  ? 0.5797 0.3672 0.6517 0.0802  0.1218  0.1149  378 LEU A CG  
569  C CD1 . LEU A 81  ? 0.4786 0.2302 0.5559 0.0625  0.1367  0.0882  378 LEU A CD1 
570  C CD2 . LEU A 81  ? 0.6200 0.4235 0.6700 0.0755  0.1113  0.1290  378 LEU A CD2 
571  N N   . LEU A 82  ? 0.4569 0.3516 0.5290 0.0869  0.0757  0.1001  379 LEU A N   
572  C CA  . LEU A 82  ? 0.4203 0.3390 0.4860 0.0780  0.0642  0.0849  379 LEU A CA  
573  C C   . LEU A 82  ? 0.4298 0.3915 0.4897 0.0764  0.0422  0.1004  379 LEU A C   
574  O O   . LEU A 82  ? 0.3388 0.3124 0.3774 0.0611  0.0289  0.0868  379 LEU A O   
575  C CB  . LEU A 82  ? 0.4139 0.3269 0.5029 0.0871  0.0809  0.0776  379 LEU A CB  
576  C CG  . LEU A 82  ? 0.4404 0.3152 0.5171 0.0763  0.0960  0.0484  379 LEU A CG  
577  C CD1 . LEU A 82  ? 0.4488 0.3112 0.5433 0.0869  0.1184  0.0416  379 LEU A CD1 
578  C CD2 . LEU A 82  ? 0.4142 0.2975 0.4621 0.0564  0.0800  0.0282  379 LEU A CD2 
579  N N   . GLU A 83  ? 0.3705 0.3548 0.4484 0.0910  0.0384  0.1295  380 GLU A N   
580  C CA  . GLU A 83  ? 0.4321 0.4613 0.5019 0.0856  0.0141  0.1454  380 GLU A CA  
581  C C   . GLU A 83  ? 0.4339 0.4554 0.4579 0.0680  0.0011  0.1372  380 GLU A C   
582  O O   . GLU A 83  ? 0.4431 0.4863 0.4457 0.0521  -0.0163 0.1307  380 GLU A O   
583  C CB  . GLU A 83  ? 0.4265 0.4841 0.5236 0.1058  0.0105  0.1830  380 GLU A CB  
584  C CG  . GLU A 83  ? 0.4887 0.5702 0.6376 0.1250  0.0206  0.1967  380 GLU A CG  
585  C CD  . GLU A 83  ? 0.5831 0.6943 0.7637 0.1491  0.0173  0.2397  380 GLU A CD  
586  O OE1 . GLU A 83  ? 0.6102 0.7597 0.8383 0.1653  0.0194  0.2582  380 GLU A OE1 
587  O OE2 . GLU A 83  ? 0.6089 0.7072 0.7690 0.1533  0.0138  0.2575  380 GLU A OE2 
588  N N   . CYS A 84  ? 0.4106 0.3988 0.4202 0.0700  0.0126  0.1369  381 CYS A N   
589  C CA  . CYS A 84  ? 0.3958 0.3736 0.3644 0.0565  0.0068  0.1301  381 CYS A CA  
590  C C   . CYS A 84  ? 0.4072 0.3695 0.3594 0.0414  0.0081  0.1002  381 CYS A C   
591  O O   . CYS A 84  ? 0.4077 0.3713 0.3275 0.0288  -0.0002 0.0918  381 CYS A O   
592  C CB  . CYS A 84  ? 0.4562 0.4056 0.4203 0.0635  0.0222  0.1412  381 CYS A CB  
593  S SG  . CYS A 84  ? 1.0872 1.0518 1.0534 0.0804  0.0191  0.1832  381 CYS A SG  
594  N N   . ALA A 85  ? 0.4143 0.3605 0.3868 0.0429  0.0191  0.0849  382 ALA A N   
595  C CA  . ALA A 85  ? 0.4092 0.3400 0.3690 0.0318  0.0213  0.0622  382 ALA A CA  
596  C C   . ALA A 85  ? 0.3641 0.3035 0.3246 0.0250  0.0155  0.0472  382 ALA A C   
597  O O   . ALA A 85  ? 0.3226 0.2515 0.2719 0.0176  0.0158  0.0325  382 ALA A O   
598  C CB  . ALA A 85  ? 0.4370 0.3435 0.4113 0.0332  0.0359  0.0551  382 ALA A CB  
599  N N   . TRP A 86  ? 0.3932 0.3537 0.3691 0.0284  0.0112  0.0536  383 TRP A N   
600  C CA  . TRP A 86  ? 0.4097 0.3759 0.3898 0.0226  0.0109  0.0407  383 TRP A CA  
601  C C   . TRP A 86  ? 0.4174 0.3815 0.3713 0.0084  0.0025  0.0293  383 TRP A C   
602  O O   . TRP A 86  ? 0.4164 0.3696 0.3652 0.0041  0.0060  0.0167  383 TRP A O   
603  C CB  . TRP A 86  ? 0.3998 0.3943 0.4068 0.0290  0.0105  0.0519  383 TRP A CB  
604  C CG  . TRP A 86  ? 0.4113 0.4395 0.4164 0.0220  -0.0065 0.0650  383 TRP A CG  
605  C CD1 . TRP A 86  ? 0.4365 0.4862 0.4475 0.0281  -0.0158 0.0864  383 TRP A CD1 
606  C CD2 . TRP A 86  ? 0.3848 0.4298 0.3797 0.0050  -0.0172 0.0580  383 TRP A CD2 
607  N NE1 . TRP A 86  ? 0.4649 0.5478 0.4685 0.0138  -0.0344 0.0916  383 TRP A NE1 
608  C CE2 . TRP A 86  ? 0.4300 0.5086 0.4249 -0.0017 -0.0345 0.0731  383 TRP A CE2 
609  C CE3 . TRP A 86  ? 0.3612 0.3954 0.3457 -0.0066 -0.0139 0.0416  383 TRP A CE3 
610  C CZ2 . TRP A 86  ? 0.3943 0.4946 0.3799 -0.0229 -0.0484 0.0688  383 TRP A CZ2 
611  C CZ3 . TRP A 86  ? 0.3582 0.4096 0.3349 -0.0249 -0.0245 0.0394  383 TRP A CZ3 
612  C CH2 . TRP A 86  ? 0.3737 0.4574 0.3515 -0.0345 -0.0416 0.0512  383 TRP A CH2 
613  N N   . LEU A 87  ? 0.3970 0.3681 0.3311 0.0006  -0.0075 0.0338  384 LEU A N   
614  C CA  . LEU A 87  ? 0.3910 0.3511 0.2983 -0.0132 -0.0112 0.0219  384 LEU A CA  
615  C C   . LEU A 87  ? 0.4411 0.3726 0.3330 -0.0109 -0.0026 0.0131  384 LEU A C   
616  O O   . LEU A 87  ? 0.4769 0.3944 0.3592 -0.0150 0.0002  0.0039  384 LEU A O   
617  C CB  . LEU A 87  ? 0.3951 0.3676 0.2806 -0.0265 -0.0232 0.0256  384 LEU A CB  
618  C CG  . LEU A 87  ? 0.4137 0.3692 0.2707 -0.0442 -0.0244 0.0114  384 LEU A CG  
619  C CD1 . LEU A 87  ? 0.3984 0.3574 0.2719 -0.0485 -0.0219 0.0060  384 LEU A CD1 
620  C CD2 . LEU A 87  ? 0.3922 0.3613 0.2245 -0.0627 -0.0380 0.0124  384 LEU A CD2 
621  N N   . GLU A 88  ? 0.3263 0.2510 0.2193 -0.0033 0.0027  0.0187  385 GLU A N   
622  C CA  . GLU A 88  ? 0.3966 0.3031 0.2871 0.0003  0.0120  0.0132  385 GLU A CA  
623  C C   . GLU A 88  ? 0.3871 0.2932 0.2959 0.0025  0.0134  0.0064  385 GLU A C   
624  O O   . GLU A 88  ? 0.3745 0.2727 0.2795 0.0024  0.0154  0.0015  385 GLU A O   
625  C CB  . GLU A 88  ? 0.4647 0.3679 0.3612 0.0068  0.0195  0.0221  385 GLU A CB  
626  C CG  . GLU A 88  ? 0.4999 0.3992 0.3680 0.0044  0.0206  0.0290  385 GLU A CG  
627  C CD  . GLU A 88  ? 0.5047 0.3980 0.3777 0.0109  0.0318  0.0396  385 GLU A CD  
628  O OE1 . GLU A 88  ? 0.5117 0.4123 0.3834 0.0142  0.0292  0.0542  385 GLU A OE1 
629  O OE2 . GLU A 88  ? 0.4768 0.3602 0.3574 0.0131  0.0437  0.0357  385 GLU A OE2 
630  N N   . ILE A 89  ? 0.3723 0.2863 0.2993 0.0049  0.0132  0.0071  386 ILE A N   
631  C CA  . ILE A 89  ? 0.3378 0.2499 0.2741 0.0039  0.0146  -0.0015 386 ILE A CA  
632  C C   . ILE A 89  ? 0.3736 0.2870 0.2973 -0.0009 0.0104  -0.0067 386 ILE A C   
633  O O   . ILE A 89  ? 0.3739 0.2843 0.2937 -0.0023 0.0089  -0.0111 386 ILE A O   
634  C CB  . ILE A 89  ? 0.3780 0.2898 0.3315 0.0072  0.0208  -0.0022 386 ILE A CB  
635  C CG1 . ILE A 89  ? 0.3530 0.2562 0.3190 0.0109  0.0276  0.0037  386 ILE A CG1 
636  C CG2 . ILE A 89  ? 0.4067 0.3136 0.3586 0.0022  0.0226  -0.0150 386 ILE A CG2 
637  C CD1 . ILE A 89  ? 0.3923 0.2884 0.3754 0.0177  0.0377  0.0078  386 ILE A CD1 
638  N N   . LEU A 90  ? 0.3674 0.2875 0.2855 -0.0043 0.0080  -0.0041 387 LEU A N   
639  C CA  . LEU A 90  ? 0.3833 0.3012 0.2893 -0.0108 0.0068  -0.0075 387 LEU A CA  
640  C C   . LEU A 90  ? 0.4451 0.3461 0.3338 -0.0120 0.0068  -0.0082 387 LEU A C   
641  O O   . LEU A 90  ? 0.4163 0.3095 0.2975 -0.0120 0.0077  -0.0087 387 LEU A O   
642  C CB  . LEU A 90  ? 0.3345 0.2665 0.2430 -0.0180 0.0043  -0.0042 387 LEU A CB  
643  C CG  . LEU A 90  ? 0.3466 0.2991 0.2785 -0.0144 0.0079  -0.0006 387 LEU A CG  
644  C CD1 . LEU A 90  ? 0.3311 0.3063 0.2711 -0.0239 0.0029  0.0052  387 LEU A CD1 
645  C CD2 . LEU A 90  ? 0.3190 0.2648 0.2498 -0.0127 0.0167  -0.0076 387 LEU A CD2 
646  N N   . MET A 91  ? 0.4743 0.3682 0.3552 -0.0118 0.0078  -0.0067 388 MET A N   
647  C CA  . MET A 91  ? 0.4346 0.3071 0.2991 -0.0108 0.0136  -0.0080 388 MET A CA  
648  C C   . MET A 91  ? 0.4232 0.2946 0.3002 -0.0001 0.0168  -0.0047 388 MET A C   
649  O O   . MET A 91  ? 0.4540 0.3131 0.3258 0.0040  0.0206  -0.0020 388 MET A O   
650  C CB  . MET A 91  ? 0.4395 0.3027 0.2873 -0.0139 0.0170  -0.0091 388 MET A CB  
651  C CG  . MET A 91  ? 0.4842 0.3474 0.3126 -0.0294 0.0113  -0.0130 388 MET A CG  
652  S SD  . MET A 91  ? 0.5261 0.3811 0.3233 -0.0376 0.0117  -0.0152 388 MET A SD  
653  C CE  . MET A 91  ? 0.6981 0.5597 0.4770 -0.0621 0.0000  -0.0216 388 MET A CE  
654  N N   . ILE A 92  ? 0.3162 0.2017 0.2121 0.0041  0.0154  -0.0031 389 ILE A N   
655  C CA  . ILE A 92  ? 0.3846 0.2780 0.2977 0.0107  0.0154  0.0007  389 ILE A CA  
656  C C   . ILE A 92  ? 0.3755 0.2776 0.2887 0.0088  0.0068  0.0008  389 ILE A C   
657  O O   . ILE A 92  ? 0.4248 0.3339 0.3453 0.0143  0.0039  0.0077  389 ILE A O   
658  C CB  . ILE A 92  ? 0.3319 0.2375 0.2664 0.0110  0.0169  0.0015  389 ILE A CB  
659  C CG1 . ILE A 92  ? 0.3570 0.2772 0.3144 0.0157  0.0168  0.0071  389 ILE A CG1 
660  C CG2 . ILE A 92  ? 0.2952 0.2074 0.2360 0.0044  0.0118  -0.0042 389 ILE A CG2 
661  C CD1 . ILE A 92  ? 0.3762 0.3086 0.3583 0.0123  0.0199  0.0079  389 ILE A CD1 
662  N N   . GLY A 93  ? 0.3735 0.2768 0.2782 0.0019  0.0037  -0.0049 390 GLY A N   
663  C CA  . GLY A 93  ? 0.4264 0.3333 0.3211 -0.0013 -0.0013 -0.0054 390 GLY A CA  
664  C C   . GLY A 93  ? 0.4653 0.3588 0.3447 0.0015  0.0010  0.0022  390 GLY A C   
665  O O   . GLY A 93  ? 0.4828 0.3799 0.3584 0.0055  -0.0034 0.0103  390 GLY A O   
666  N N   . LEU A 94  ? 0.4507 0.3284 0.3209 -0.0018 0.0078  0.0007  391 LEU A N   
667  C CA  . LEU A 94  ? 0.4973 0.3527 0.3515 -0.0021 0.0141  0.0058  391 LEU A CA  
668  C C   . LEU A 94  ? 0.5367 0.3807 0.3950 0.0112  0.0189  0.0154  391 LEU A C   
669  O O   . LEU A 94  ? 0.5523 0.3857 0.4044 0.0174  0.0212  0.0263  391 LEU A O   
670  C CB  . LEU A 94  ? 0.4707 0.3114 0.3139 -0.0129 0.0196  -0.0011 391 LEU A CB  
671  C CG  . LEU A 94  ? 0.4741 0.2813 0.2984 -0.0169 0.0298  0.0004  391 LEU A CG  
672  C CD1 . LEU A 94  ? 0.5214 0.3236 0.3385 -0.0206 0.0315  0.0072  391 LEU A CD1 
673  C CD2 . LEU A 94  ? 0.4731 0.2689 0.2839 -0.0329 0.0323  -0.0101 391 LEU A CD2 
674  N N   . VAL A 95  ? 0.4715 0.3184 0.3421 0.0170  0.0223  0.0136  392 VAL A N   
675  C CA  . VAL A 95  ? 0.4945 0.3354 0.3773 0.0322  0.0306  0.0236  392 VAL A CA  
676  C C   . VAL A 95  ? 0.5253 0.3944 0.4288 0.0413  0.0195  0.0373  392 VAL A C   
677  O O   . VAL A 95  ? 0.5349 0.3990 0.4447 0.0549  0.0237  0.0525  392 VAL A O   
678  C CB  . VAL A 95  ? 0.5007 0.3444 0.3942 0.0352  0.0382  0.0190  392 VAL A CB  
679  C CG1 . VAL A 95  ? 0.5286 0.3788 0.4470 0.0525  0.0471  0.0314  392 VAL A CG1 
680  C CG2 . VAL A 95  ? 0.5047 0.3178 0.3700 0.0269  0.0495  0.0079  392 VAL A CG2 
681  N N   . TRP A 96  ? 0.5057 0.4038 0.4188 0.0332  0.0054  0.0324  393 TRP A N   
682  C CA  . TRP A 96  ? 0.4512 0.3812 0.3800 0.0354  -0.0093 0.0423  393 TRP A CA  
683  C C   . TRP A 96  ? 0.4647 0.3928 0.3745 0.0376  -0.0160 0.0539  393 TRP A C   
684  O O   . TRP A 96  ? 0.5065 0.4512 0.4289 0.0493  -0.0223 0.0728  393 TRP A O   
685  C CB  . TRP A 96  ? 0.4178 0.3691 0.3519 0.0209  -0.0203 0.0293  393 TRP A CB  
686  C CG  . TRP A 96  ? 0.4094 0.3884 0.3420 0.0141  -0.0384 0.0329  393 TRP A CG  
687  C CD1 . TRP A 96  ? 0.4009 0.3783 0.3054 0.0019  -0.0454 0.0239  393 TRP A CD1 
688  C CD2 . TRP A 96  ? 0.4092 0.4244 0.3678 0.0174  -0.0520 0.0465  393 TRP A CD2 
689  N NE1 . TRP A 96  ? 0.4677 0.4747 0.3712 -0.0048 -0.0636 0.0291  393 TRP A NE1 
690  C CE2 . TRP A 96  ? 0.4279 0.4621 0.3670 0.0040  -0.0703 0.0440  393 TRP A CE2 
691  C CE3 . TRP A 96  ? 0.3915 0.4276 0.3890 0.0300  -0.0497 0.0612  393 TRP A CE3 
692  C CZ2 . TRP A 96  ? 0.3844 0.4620 0.3410 0.0005  -0.0910 0.0563  393 TRP A CZ2 
693  C CZ3 . TRP A 96  ? 0.4285 0.5105 0.4519 0.0292  -0.0684 0.0754  393 TRP A CZ3 
694  C CH2 . TRP A 96  ? 0.4921 0.5965 0.4946 0.0133  -0.0912 0.0732  393 TRP A CH2 
695  N N   . ARG A 97  ? 0.4775 0.3882 0.3591 0.0275  -0.0139 0.0456  394 ARG A N   
696  C CA  . ARG A 97  ? 0.5769 0.4835 0.4361 0.0282  -0.0176 0.0576  394 ARG A CA  
697  C C   . ARG A 97  ? 0.6171 0.4924 0.4710 0.0406  -0.0037 0.0728  394 ARG A C   
698  O O   . ARG A 97  ? 0.6705 0.5386 0.5080 0.0448  -0.0044 0.0887  394 ARG A O   
699  C CB  . ARG A 97  ? 0.5765 0.4777 0.4096 0.0128  -0.0169 0.0445  394 ARG A CB  
700  C CG  . ARG A 97  ? 0.5880 0.4661 0.4168 0.0058  -0.0029 0.0329  394 ARG A CG  
701  C CD  . ARG A 97  ? 0.5703 0.4522 0.3840 -0.0067 -0.0006 0.0222  394 ARG A CD  
702  N NE  . ARG A 97  ? 0.5815 0.4513 0.3985 -0.0140 0.0102  0.0149  394 ARG A NE  
703  C CZ  . ARG A 97  ? 0.5654 0.4440 0.3985 -0.0175 0.0110  0.0038  394 ARG A CZ  
704  N NH1 . ARG A 97  ? 0.5650 0.4571 0.4109 -0.0142 0.0052  -0.0023 394 ARG A NH1 
705  N NH2 . ARG A 97  ? 0.5192 0.3946 0.3566 -0.0253 0.0171  0.0006  394 ARG A NH2 
706  N N   . SER A 98  ? 0.6168 0.4697 0.4812 0.0461  0.0108  0.0681  395 SER A N   
707  C CA  . SER A 98  ? 0.6404 0.4542 0.4984 0.0572  0.0287  0.0790  395 SER A CA  
708  C C   . SER A 98  ? 0.6393 0.4609 0.5250 0.0810  0.0330  0.0992  395 SER A C   
709  O O   . SER A 98  ? 0.6821 0.4681 0.5663 0.0950  0.0516  0.1108  395 SER A O   
710  C CB  . SER A 98  ? 0.6416 0.4206 0.4873 0.0470  0.0448  0.0602  395 SER A CB  
711  O OG  . SER A 98  ? 0.6706 0.4472 0.4978 0.0264  0.0412  0.0465  395 SER A OG  
712  N N   . MET A 99  ? 0.6220 0.4896 0.5356 0.0852  0.0175  0.1037  396 MET A N   
713  C CA  . MET A 99  ? 0.6336 0.5223 0.5848 0.1078  0.0199  0.1251  396 MET A CA  
714  C C   . MET A 99  ? 0.6963 0.5810 0.6498 0.1273  0.0205  0.1558  396 MET A C   
715  O O   . MET A 99  ? 0.7502 0.6179 0.7249 0.1509  0.0392  0.1732  396 MET A O   
716  C CB  . MET A 99  ? 0.5892 0.5365 0.5709 0.1026  -0.0019 0.1258  396 MET A CB  
717  C CG  . MET A 99  ? 0.5039 0.4559 0.5027 0.0957  0.0057  0.1074  396 MET A CG  
718  S SD  . MET A 99  ? 0.7796 0.7977 0.8195 0.0873  -0.0172 0.1103  396 MET A SD  
719  C CE  . MET A 99  ? 0.4005 0.4568 0.4873 0.1142  -0.0201 0.1468  396 MET A CE  
720  N N   . GLU A 100 ? 0.7065 0.6046 0.6368 0.1188  0.0026  0.1638  397 GLU A N   
721  C CA  . GLU A 100 ? 0.7409 0.6400 0.6701 0.1373  -0.0001 0.1977  397 GLU A CA  
722  C C   . GLU A 100 ? 0.7328 0.5663 0.6330 0.1417  0.0253  0.2019  397 GLU A C   
723  O O   . GLU A 100 ? 0.7108 0.5342 0.6013 0.1548  0.0263  0.2304  397 GLU A O   
724  C CB  . GLU A 100 ? 0.7904 0.7330 0.7008 0.1252  -0.0304 0.2064  397 GLU A CB  
725  C CG  . GLU A 100 ? 0.8436 0.8497 0.7807 0.1163  -0.0568 0.2015  397 GLU A CG  
726  C CD  . GLU A 100 ? 0.9198 0.9634 0.9137 0.1400  -0.0590 0.2266  397 GLU A CD  
727  O OE1 . GLU A 100 ? 1.0089 1.0449 1.0178 0.1670  -0.0500 0.2593  397 GLU A OE1 
728  O OE2 . GLU A 100 ? 0.8915 0.9721 0.9182 0.1324  -0.0675 0.2152  397 GLU A OE2 
729  N N   . HIS A 101 ? 0.7088 0.4982 0.5944 0.1290  0.0454  0.1746  398 HIS A N   
730  C CA  . HIS A 101 ? 0.7781 0.5018 0.6376 0.1275  0.0713  0.1737  398 HIS A CA  
731  C C   . HIS A 101 ? 0.8118 0.4918 0.6779 0.1326  0.0987  0.1584  398 HIS A C   
732  O O   . HIS A 101 ? 0.8197 0.4756 0.6649 0.1104  0.1058  0.1291  398 HIS A O   
733  C CB  . HIS A 101 ? 0.7604 0.4713 0.5843 0.0979  0.0676  0.1529  398 HIS A CB  
734  C CG  . HIS A 101 ? 0.7732 0.5195 0.5821 0.0913  0.0463  0.1643  398 HIS A CG  
735  N ND1 . HIS A 101 ? 0.8503 0.5770 0.6365 0.0950  0.0509  0.1875  398 HIS A ND1 
736  C CD2 . HIS A 101 ? 0.7530 0.5484 0.5614 0.0801  0.0227  0.1549  398 HIS A CD2 
737  C CE1 . HIS A 101 ? 0.8408 0.6055 0.6100 0.0862  0.0304  0.1914  398 HIS A CE1 
738  N NE2 . HIS A 101 ? 0.7993 0.6043 0.5812 0.0765  0.0135  0.1703  398 HIS A NE2 
739  N N   . PRO A 102 ? 0.8026 0.4741 0.6974 0.1622  0.1148  0.1791  399 PRO A N   
740  C CA  . PRO A 102 ? 0.7917 0.4277 0.6922 0.1661  0.1431  0.1610  399 PRO A CA  
741  C C   . PRO A 102 ? 0.8178 0.3896 0.6800 0.1466  0.1653  0.1395  399 PRO A C   
742  O O   . PRO A 102 ? 0.7589 0.3094 0.6117 0.1470  0.1709  0.1514  399 PRO A O   
743  C CB  . PRO A 102 ? 0.8401 0.4972 0.7828 0.1960  0.1525  0.1866  399 PRO A CB  
744  C CG  . PRO A 102 ? 0.8195 0.5404 0.7874 0.2069  0.1207  0.2163  399 PRO A CG  
745  C CD  . PRO A 102 ? 0.8029 0.5158 0.7302 0.1865  0.1032  0.2140  399 PRO A CD  
746  N N   . GLY A 103 ? 0.8071 0.3514 0.6469 0.1278  0.1764  0.1085  400 GLY A N   
747  C CA  . GLY A 103 ? 0.8300 0.3209 0.6330 0.1039  0.1941  0.0853  400 GLY A CA  
748  C C   . GLY A 103 ? 0.8574 0.3441 0.6323 0.0737  0.1781  0.0735  400 GLY A C   
749  O O   . GLY A 103 ? 0.9416 0.3937 0.6888 0.0482  0.1877  0.0535  400 GLY A O   
750  N N   . LYS A 104 ? 0.8016 0.3317 0.5858 0.0744  0.1528  0.0854  401 LYS A N   
751  C CA  . LYS A 104 ? 0.7868 0.3347 0.5544 0.0461  0.1358  0.0744  401 LYS A CA  
752  C C   . LYS A 104 ? 0.7737 0.3826 0.5534 0.0363  0.1097  0.0619  401 LYS A C   
753  O O   . LYS A 104 ? 0.7588 0.4033 0.5618 0.0522  0.1001  0.0671  401 LYS A O   
754  C CB  . LYS A 104 ? 0.7747 0.3259 0.5400 0.0519  0.1315  0.0998  401 LYS A CB  
755  C CG  . LYS A 104 ? 0.8182 0.3151 0.5743 0.0575  0.1562  0.1112  401 LYS A CG  
756  C CD  . LYS A 104 ? 0.8601 0.3673 0.6129 0.0626  0.1499  0.1377  401 LYS A CD  
757  C CE  . LYS A 104 ? 0.8969 0.3624 0.6477 0.0662  0.1719  0.1456  401 LYS A CE  
758  N NZ  . LYS A 104 ? 0.9066 0.3816 0.6510 0.0699  0.1658  0.1725  401 LYS A NZ  
759  N N   . LEU A 105 ? 0.7738 0.3941 0.5409 0.0102  0.1001  0.0464  402 LEU A N   
760  C CA  . LEU A 105 ? 0.6917 0.3644 0.4707 0.0021  0.0788  0.0366  402 LEU A CA  
761  C C   . LEU A 105 ? 0.6748 0.3735 0.4525 -0.0057 0.0677  0.0434  402 LEU A C   
762  O O   . LEU A 105 ? 0.6739 0.3569 0.4388 -0.0230 0.0741  0.0407  402 LEU A O   
763  C CB  . LEU A 105 ? 0.6968 0.3681 0.4668 -0.0190 0.0777  0.0137  402 LEU A CB  
764  C CG  . LEU A 105 ? 0.6938 0.3454 0.4583 -0.0134 0.0877  0.0037  402 LEU A CG  
765  C CD1 . LEU A 105 ? 0.6235 0.2745 0.3701 -0.0381 0.0837  -0.0170 402 LEU A CD1 
766  C CD2 . LEU A 105 ? 0.6208 0.3067 0.4104 0.0075  0.0800  0.0115  402 LEU A CD2 
767  N N   . LEU A 106 ? 0.6549 0.3924 0.4449 0.0052  0.0528  0.0512  403 LEU A N   
768  C CA  . LEU A 106 ? 0.6088 0.3692 0.3914 -0.0013 0.0446  0.0556  403 LEU A CA  
769  C C   . LEU A 106 ? 0.5767 0.3653 0.3668 -0.0156 0.0374  0.0376  403 LEU A C   
770  O O   . LEU A 106 ? 0.4897 0.3074 0.2904 -0.0113 0.0262  0.0330  403 LEU A O   
771  C CB  . LEU A 106 ? 0.5970 0.3832 0.3828 0.0143  0.0317  0.0713  403 LEU A CB  
772  C CG  . LEU A 106 ? 0.6251 0.4274 0.3909 0.0090  0.0253  0.0787  403 LEU A CG  
773  C CD1 . LEU A 106 ? 0.7044 0.4747 0.4489 0.0089  0.0387  0.0964  403 LEU A CD1 
774  C CD2 . LEU A 106 ? 0.5648 0.4006 0.3326 0.0189  0.0068  0.0884  403 LEU A CD2 
775  N N   . PHE A 107 ? 0.6214 0.4016 0.4088 -0.0329 0.0445  0.0287  404 PHE A N   
776  C CA  . PHE A 107 ? 0.6260 0.4365 0.4268 -0.0436 0.0392  0.0167  404 PHE A CA  
777  C C   . PHE A 107 ? 0.6193 0.4503 0.4167 -0.0424 0.0386  0.0199  404 PHE A C   
778  O O   . PHE A 107 ? 0.6284 0.4842 0.4376 -0.0409 0.0341  0.0119  404 PHE A O   
779  C CB  . PHE A 107 ? 0.6490 0.4538 0.4522 -0.0639 0.0452  0.0099  404 PHE A CB  
780  C CG  . PHE A 107 ? 0.7053 0.4925 0.5050 -0.0701 0.0444  0.0010  404 PHE A CG  
781  C CD1 . PHE A 107 ? 0.7124 0.5239 0.5242 -0.0727 0.0344  -0.0076 404 PHE A CD1 
782  C CD2 . PHE A 107 ? 0.7228 0.4655 0.5036 -0.0729 0.0558  0.0019  404 PHE A CD2 
783  C CE1 . PHE A 107 ? 0.7030 0.4976 0.5029 -0.0802 0.0339  -0.0163 404 PHE A CE1 
784  C CE2 . PHE A 107 ? 0.7490 0.4700 0.5189 -0.0804 0.0583  -0.0097 404 PHE A CE2 
785  C CZ  . PHE A 107 ? 0.7260 0.4744 0.5028 -0.0850 0.0464  -0.0193 404 PHE A CZ  
786  N N   . ALA A 108 ? 0.6829 0.4990 0.4610 -0.0429 0.0458  0.0318  405 ALA A N   
787  C CA  . ALA A 108 ? 0.6779 0.5074 0.4407 -0.0424 0.0474  0.0357  405 ALA A CA  
788  C C   . ALA A 108 ? 0.7130 0.5216 0.4496 -0.0360 0.0499  0.0554  405 ALA A C   
789  O O   . ALA A 108 ? 0.7607 0.5408 0.4961 -0.0341 0.0560  0.0652  405 ALA A O   
790  C CB  . ALA A 108 ? 0.6406 0.4810 0.4100 -0.0563 0.0603  0.0302  405 ALA A CB  
791  N N   . PRO A 109 ? 0.7065 0.5267 0.4193 -0.0327 0.0459  0.0620  406 PRO A N   
792  C CA  . PRO A 109 ? 0.7250 0.5300 0.4105 -0.0252 0.0458  0.0860  406 PRO A CA  
793  C C   . PRO A 109 ? 0.8002 0.5735 0.4757 -0.0330 0.0657  0.0984  406 PRO A C   
794  O O   . PRO A 109 ? 0.8532 0.6018 0.5148 -0.0240 0.0693  0.1211  406 PRO A O   
795  C CB  . PRO A 109 ? 0.7404 0.5664 0.3952 -0.0278 0.0397  0.0852  406 PRO A CB  
796  C CG  . PRO A 109 ? 0.6867 0.5364 0.3588 -0.0304 0.0307  0.0616  406 PRO A CG  
797  C CD  . PRO A 109 ? 0.6786 0.5243 0.3854 -0.0351 0.0404  0.0480  406 PRO A CD  
798  N N   . ASN A 110 ? 0.7682 0.5432 0.4541 -0.0495 0.0793  0.0854  407 ASN A N   
799  C CA  . ASN A 110 ? 0.7887 0.5357 0.4711 -0.0627 0.0990  0.0944  407 ASN A CA  
800  C C   . ASN A 110 ? 0.8229 0.5559 0.5330 -0.0741 0.1023  0.0819  407 ASN A C   
801  O O   . ASN A 110 ? 0.8919 0.6090 0.6067 -0.0927 0.1173  0.0819  407 ASN A O   
802  C CB  . ASN A 110 ? 0.7524 0.5145 0.4277 -0.0767 0.1145  0.0920  407 ASN A CB  
803  C CG  . ASN A 110 ? 0.7477 0.5464 0.4518 -0.0824 0.1124  0.0698  407 ASN A CG  
804  O OD1 . ASN A 110 ? 0.7071 0.5184 0.4346 -0.0777 0.0984  0.0568  407 ASN A OD1 
805  N ND2 . ASN A 110 ? 0.7690 0.5840 0.4723 -0.0910 0.1289  0.0675  407 ASN A ND2 
806  N N   . LEU A 111 ? 0.9744 0.5855 0.6190 -0.1447 0.1884  0.1158  408 LEU A N   
807  C CA  . LEU A 111 ? 0.9271 0.5291 0.5991 -0.1555 0.1845  0.1031  408 LEU A CA  
808  C C   . LEU A 111 ? 0.8594 0.4364 0.5142 -0.1393 0.1689  0.1006  408 LEU A C   
809  O O   . LEU A 111 ? 0.7502 0.3459 0.4091 -0.1328 0.1592  0.0887  408 LEU A O   
810  C CB  . LEU A 111 ? 0.8840 0.5288 0.5924 -0.1671 0.1863  0.0862  408 LEU A CB  
811  C CG  . LEU A 111 ? 0.8497 0.4928 0.5901 -0.1843 0.1811  0.0726  408 LEU A CG  
812  C CD1 . LEU A 111 ? 0.9045 0.5234 0.6581 -0.2026 0.1894  0.0783  408 LEU A CD1 
813  C CD2 . LEU A 111 ? 0.7439 0.4364 0.5229 -0.1941 0.1813  0.0603  408 LEU A CD2 
814  N N   . LEU A 112 ? 0.9004 0.4345 0.5372 -0.1318 0.1678  0.1131  409 LEU A N   
815  C CA  . LEU A 112 ? 0.9277 0.4340 0.5509 -0.1131 0.1561  0.1131  409 LEU A CA  
816  C C   . LEU A 112 ? 0.9788 0.4470 0.6151 -0.1235 0.1591  0.1030  409 LEU A C   
817  O O   . LEU A 112 ? 1.0350 0.4744 0.6728 -0.1327 0.1676  0.1112  409 LEU A O   
818  C CB  . LEU A 112 ? 0.9709 0.4583 0.5657 -0.0918 0.1512  0.1362  409 LEU A CB  
819  C CG  . LEU A 112 ? 0.9783 0.4431 0.5629 -0.0663 0.1392  0.1412  409 LEU A CG  
820  C CD1 . LEU A 112 ? 0.9159 0.4129 0.5039 -0.0567 0.1282  0.1287  409 LEU A CD1 
821  C CD2 . LEU A 112 ? 1.0152 0.4694 0.5775 -0.0475 0.1326  0.1679  409 LEU A CD2 
822  N N   . LEU A 113 ? 0.9935 0.4609 0.6380 -0.1231 0.1520  0.0843  410 LEU A N   
823  C CA  . LEU A 113 ? 1.0485 0.4848 0.7045 -0.1365 0.1531  0.0681  410 LEU A CA  
824  C C   . LEU A 113 ? 1.0582 0.4601 0.7003 -0.1157 0.1477  0.0603  410 LEU A C   
825  O O   . LEU A 113 ? 0.9838 0.4005 0.6185 -0.0986 0.1408  0.0579  410 LEU A O   
826  C CB  . LEU A 113 ? 1.0018 0.4722 0.6844 -0.1617 0.1495  0.0476  410 LEU A CB  
827  C CG  . LEU A 113 ? 0.9437 0.4572 0.6505 -0.1803 0.1562  0.0528  410 LEU A CG  
828  C CD1 . LEU A 113 ? 0.8900 0.4415 0.6285 -0.2008 0.1490  0.0340  410 LEU A CD1 
829  C CD2 . LEU A 113 ? 0.9749 0.4682 0.6883 -0.1935 0.1679  0.0648  410 LEU A CD2 
830  N N   . ASP A 114 ? 1.1277 0.4840 0.7680 -0.1168 0.1524  0.0560  411 ASP A N   
831  C CA  . ASP A 114 ? 1.1905 0.5146 0.8218 -0.0984 0.1508  0.0430  411 ASP A CA  
832  C C   . ASP A 114 ? 1.1701 0.4972 0.8089 -0.1188 0.1462  0.0121  411 ASP A C   
833  O O   . ASP A 114 ? 1.1222 0.4767 0.7772 -0.1471 0.1423  0.0035  411 ASP A O   
834  C CB  . ASP A 114 ? 1.3203 0.5926 0.9441 -0.0837 0.1588  0.0547  411 ASP A CB  
835  C CG  . ASP A 114 ? 1.4302 0.6757 1.0621 -0.1107 0.1657  0.0510  411 ASP A CG  
836  O OD1 . ASP A 114 ? 1.4357 0.7029 1.0819 -0.1406 0.1629  0.0355  411 ASP A OD1 
837  O OD2 . ASP A 114 ? 1.5004 0.7038 1.1270 -0.1018 0.1730  0.0648  411 ASP A OD2 
838  N N   . ARG A 115 ? 1.1895 0.4924 0.8178 -0.1036 0.1462  -0.0041 412 ARG A N   
839  C CA  . ARG A 115 ? 1.1839 0.4940 0.8121 -0.1207 0.1393  -0.0340 412 ARG A CA  
840  C C   . ARG A 115 ? 1.1934 0.4829 0.8288 -0.1497 0.1393  -0.0455 412 ARG A C   
841  O O   . ARG A 115 ? 1.2071 0.5156 0.8479 -0.1730 0.1289  -0.0661 412 ARG A O   
842  C CB  . ARG A 115 ? 1.2523 0.5439 0.8647 -0.0955 0.1423  -0.0485 412 ARG A CB  
843  C CG  . ARG A 115 ? 1.3468 0.5850 0.9518 -0.0778 0.1548  -0.0460 412 ARG A CG  
844  C CD  . ARG A 115 ? 1.3990 0.6234 0.9910 -0.0647 0.1588  -0.0698 412 ARG A CD  
845  N NE  . ARG A 115 ? 1.4411 0.6747 1.0258 -0.0946 0.1495  -0.0967 412 ARG A NE  
846  C CZ  . ARG A 115 ? 1.4990 0.7219 1.0670 -0.0917 0.1512  -0.1203 412 ARG A CZ  
847  N NH1 . ARG A 115 ? 1.5486 0.7518 1.1092 -0.0598 0.1650  -0.1213 412 ARG A NH1 
848  N NH2 . ARG A 115 ? 1.5064 0.7409 1.0664 -0.1202 0.1391  -0.1418 412 ARG A NH2 
849  N N   . ASN A 116 ? 1.1974 0.4493 0.8337 -0.1485 0.1495  -0.0307 413 ASN A N   
850  C CA  . ASN A 116 ? 1.2704 0.4980 0.9153 -0.1764 0.1506  -0.0395 413 ASN A CA  
851  C C   . ASN A 116 ? 1.2179 0.4894 0.8887 -0.2087 0.1436  -0.0377 413 ASN A C   
852  O O   . ASN A 116 ? 1.2190 0.4927 0.9030 -0.2370 0.1366  -0.0537 413 ASN A O   
853  C CB  . ASN A 116 ? 1.3738 0.5509 1.0146 -0.1665 0.1640  -0.0204 413 ASN A CB  
854  C CG  . ASN A 116 ? 1.5091 0.6461 1.1535 -0.1907 0.1665  -0.0340 413 ASN A CG  
855  O OD1 . ASN A 116 ? 1.5559 0.6970 1.2004 -0.2102 0.1576  -0.0607 413 ASN A OD1 
856  N ND2 . ASN A 116 ? 1.5731 0.6705 1.2191 -0.1903 0.1774  -0.0153 413 ASN A ND2 
857  N N   . GLN A 117 ? 1.1999 0.5085 0.8799 -0.2036 0.1453  -0.0181 414 GLN A N   
858  C CA  . GLN A 117 ? 1.1945 0.5512 0.9038 -0.2295 0.1418  -0.0144 414 GLN A CA  
859  C C   . GLN A 117 ? 1.1577 0.5624 0.8784 -0.2391 0.1264  -0.0328 414 GLN A C   
860  O O   . GLN A 117 ? 1.1702 0.6175 0.9218 -0.2625 0.1202  -0.0350 414 GLN A O   
861  C CB  . GLN A 117 ? 1.1885 0.5657 0.8999 -0.2188 0.1518  0.0128  414 GLN A CB  
862  C CG  . GLN A 117 ? 1.2607 0.5953 0.9604 -0.2108 0.1650  0.0343  414 GLN A CG  
863  C CD  . GLN A 117 ? 1.2599 0.6172 0.9548 -0.2000 0.1728  0.0604  414 GLN A CD  
864  O OE1 . GLN A 117 ? 1.2534 0.6099 0.9264 -0.1732 0.1713  0.0719  414 GLN A OE1 
865  N NE2 . GLN A 117 ? 1.2576 0.6372 0.9732 -0.2208 0.1810  0.0697  414 GLN A NE2 
866  N N   . GLY A 118 ? 1.1235 0.5227 0.8215 -0.2199 0.1204  -0.0447 415 GLY A N   
867  C CA  . GLY A 118 ? 1.0955 0.5349 0.7985 -0.2276 0.1046  -0.0623 415 GLY A CA  
868  C C   . GLY A 118 ? 1.1246 0.5637 0.8346 -0.2531 0.0915  -0.0842 415 GLY A C   
869  O O   . GLY A 118 ? 1.0945 0.5755 0.8165 -0.2667 0.0748  -0.0957 415 GLY A O   
870  N N   . LYS A 119 ? 1.2075 0.5990 0.9096 -0.2595 0.0978  -0.0891 416 LYS A N   
871  C CA  . LYS A 119 ? 1.2681 0.6526 0.9739 -0.2852 0.0853  -0.1105 416 LYS A CA  
872  C C   . LYS A 119 ? 1.2683 0.6895 1.0170 -0.3178 0.0776  -0.1057 416 LYS A C   
873  O O   . LYS A 119 ? 1.2851 0.7165 1.0451 -0.3425 0.0617  -0.1223 416 LYS A O   
874  C CB  . LYS A 119 ? 1.3445 0.6609 1.0275 -0.2809 0.0963  -0.1182 416 LYS A CB  
875  C CG  . LYS A 119 ? 1.3773 0.6589 1.0237 -0.2486 0.1048  -0.1255 416 LYS A CG  
876  C CD  . LYS A 119 ? 1.4634 0.6768 1.0938 -0.2417 0.1191  -0.1286 416 LYS A CD  
877  C CE  . LYS A 119 ? 1.4810 0.6640 1.0826 -0.2065 0.1302  -0.1337 416 LYS A CE  
878  N NZ  . LYS A 119 ? 1.5615 0.6780 1.1525 -0.1957 0.1462  -0.1327 416 LYS A NZ  
879  N N   . CYS A 120 ? 1.2528 0.6957 1.0262 -0.3171 0.0890  -0.0824 417 CYS A N   
880  C CA  . CYS A 120 ? 1.2455 0.7272 1.0659 -0.3449 0.0866  -0.0743 417 CYS A CA  
881  C C   . CYS A 120 ? 1.2334 0.7801 1.0841 -0.3603 0.0651  -0.0839 417 CYS A C   
882  O O   . CYS A 120 ? 1.2737 0.8538 1.1674 -0.3866 0.0569  -0.0837 417 CYS A O   
883  C CB  . CYS A 120 ? 1.1785 0.6716 1.0137 -0.3364 0.1066  -0.0468 417 CYS A CB  
884  S SG  . CYS A 120 ? 1.5708 1.0088 1.4039 -0.3434 0.1263  -0.0308 417 CYS A SG  
885  N N   . VAL A 121 ? 1.1915 0.7575 1.0224 -0.3434 0.0557  -0.0907 418 VAL A N   
886  C CA  . VAL A 121 ? 1.1754 0.7985 1.0278 -0.3550 0.0321  -0.1002 418 VAL A CA  
887  C C   . VAL A 121 ? 1.1964 0.8007 1.0066 -0.3485 0.0159  -0.1224 418 VAL A C   
888  O O   . VAL A 121 ? 1.1716 0.7428 0.9408 -0.3237 0.0249  -0.1254 418 VAL A O   
889  C CB  . VAL A 121 ? 0.8937 0.5706 0.7694 -0.3434 0.0347  -0.0848 418 VAL A CB  
890  C CG1 . VAL A 121 ? 0.8688 0.5175 0.7187 -0.3172 0.0576  -0.0705 418 VAL A CG1 
891  C CG2 . VAL A 121 ? 0.8605 0.5738 0.7291 -0.3391 0.0122  -0.0953 418 VAL A CG2 
892  N N   . GLU A 122 ? 1.2396 0.8669 1.0613 -0.3704 -0.0076 -0.1371 419 GLU A N   
893  C CA  . GLU A 122 ? 1.2898 0.8963 1.0685 -0.3685 -0.0226 -0.1596 419 GLU A CA  
894  C C   . GLU A 122 ? 1.2219 0.8322 0.9630 -0.3409 -0.0229 -0.1616 419 GLU A C   
895  O O   . GLU A 122 ? 1.1605 0.8228 0.9147 -0.3383 -0.0376 -0.1560 419 GLU A O   
896  C CB  . GLU A 122 ? 1.3501 0.9981 1.1521 -0.3959 -0.0522 -0.1706 419 GLU A CB  
897  C CG  . GLU A 122 ? 1.4614 1.0899 1.2154 -0.3962 -0.0686 -0.1938 419 GLU A CG  
898  C CD  . GLU A 122 ? 1.5936 1.1562 1.3192 -0.4062 -0.0604 -0.2124 419 GLU A CD  
899  O OE1 . GLU A 122 ? 1.6434 1.1746 1.3869 -0.4122 -0.0428 -0.2055 419 GLU A OE1 
900  O OE2 . GLU A 122 ? 1.6466 1.1877 1.3311 -0.4080 -0.0708 -0.2334 419 GLU A OE2 
901  N N   . GLY A 123 ? 1.2350 0.7911 0.9328 -0.3195 -0.0062 -0.1685 420 GLY A N   
902  C CA  . GLY A 123 ? 1.2102 0.7657 0.8717 -0.2939 -0.0049 -0.1730 420 GLY A CA  
903  C C   . GLY A 123 ? 1.1902 0.7519 0.8537 -0.2681 0.0109  -0.1558 420 GLY A C   
904  O O   . GLY A 123 ? 1.1941 0.7534 0.8309 -0.2448 0.0152  -0.1580 420 GLY A O   
905  N N   . MET A 124 ? 1.1238 0.6944 0.8192 -0.2723 0.0203  -0.1385 421 MET A N   
906  C CA  . MET A 124 ? 1.0373 0.6170 0.7354 -0.2510 0.0330  -0.1221 421 MET A CA  
907  C C   . MET A 124 ? 1.0545 0.5841 0.7207 -0.2225 0.0523  -0.1205 421 MET A C   
908  O O   . MET A 124 ? 1.0250 0.5610 0.6850 -0.2002 0.0595  -0.1110 421 MET A O   
909  C CB  . MET A 124 ? 0.9849 0.5850 0.7222 -0.2623 0.0410  -0.1030 421 MET A CB  
910  C CG  . MET A 124 ? 0.9117 0.5427 0.6594 -0.2381 0.0492  -0.0846 421 MET A CG  
911  S SD  . MET A 124 ? 0.8814 0.5527 0.6771 -0.2488 0.0588  -0.0631 421 MET A SD  
912  C CE  . MET A 124 ? 0.8452 0.4526 0.6205 -0.2461 0.0832  -0.0508 421 MET A CE  
913  N N   . VAL A 125 ? 1.1103 0.5919 0.7594 -0.2224 0.0599  -0.1297 422 VAL A N   
914  C CA  . VAL A 125 ? 1.1286 0.5634 0.7539 -0.1941 0.0783  -0.1270 422 VAL A CA  
915  C C   . VAL A 125 ? 1.1107 0.5550 0.7131 -0.1694 0.0790  -0.1347 422 VAL A C   
916  O O   . VAL A 125 ? 1.0980 0.5229 0.6913 -0.1411 0.0934  -0.1270 422 VAL A O   
917  C CB  . VAL A 125 ? 1.1516 0.5326 0.7649 -0.1998 0.0863  -0.1372 422 VAL A CB  
918  C CG1 . VAL A 125 ? 1.1597 0.5307 0.7467 -0.2018 0.0796  -0.1620 422 VAL A CG1 
919  C CG2 . VAL A 125 ? 1.1830 0.5185 0.7881 -0.1729 0.1068  -0.1236 422 VAL A CG2 
920  N N   . GLU A 126 ? 1.0855 0.5635 0.6814 -0.1795 0.0630  -0.1476 423 GLU A N   
921  C CA  . GLU A 126 ? 1.0659 0.5590 0.6414 -0.1582 0.0641  -0.1532 423 GLU A CA  
922  C C   . GLU A 126 ? 0.9974 0.5229 0.5847 -0.1404 0.0666  -0.1374 423 GLU A C   
923  O O   . GLU A 126 ? 0.9646 0.4816 0.5439 -0.1129 0.0802  -0.1329 423 GLU A O   
924  C CB  . GLU A 126 ? 1.0591 0.5821 0.6237 -0.1747 0.0446  -0.1667 423 GLU A CB  
925  N N   . ILE A 127 ? 0.9827 0.5489 0.5935 -0.1555 0.0536  -0.1285 424 ILE A N   
926  C CA  . ILE A 127 ? 0.9618 0.5762 0.5985 -0.1359 0.0540  -0.1081 424 ILE A CA  
927  C C   . ILE A 127 ? 0.9250 0.5229 0.5744 -0.1202 0.0683  -0.0910 424 ILE A C   
928  O O   . ILE A 127 ? 0.8968 0.5199 0.5576 -0.0994 0.0718  -0.0768 424 ILE A O   
929  C CB  . ILE A 127 ? 0.9724 0.6412 0.6407 -0.1519 0.0380  -0.0996 424 ILE A CB  
930  C CG1 . ILE A 127 ? 0.9499 0.6644 0.6330 -0.1324 0.0364  -0.0861 424 ILE A CG1 
931  C CG2 . ILE A 127 ? 0.9956 0.6646 0.6924 -0.1668 0.0414  -0.0891 424 ILE A CG2 
932  C CD1 . ILE A 127 ? 0.9330 0.6973 0.6465 -0.1440 0.0222  -0.0786 424 ILE A CD1 
933  N N   . PHE A 128 ? 0.9168 0.4704 0.5622 -0.1317 0.0756  -0.0920 425 PHE A N   
934  C CA  . PHE A 128 ? 0.9029 0.4332 0.5534 -0.1175 0.0886  -0.0739 425 PHE A CA  
935  C C   . PHE A 128 ? 0.8603 0.3668 0.4953 -0.0862 0.0993  -0.0724 425 PHE A C   
936  O O   . PHE A 128 ? 0.8543 0.3796 0.5002 -0.0646 0.1020  -0.0545 425 PHE A O   
937  C CB  . PHE A 128 ? 1.0283 0.5085 0.6741 -0.1385 0.0953  -0.0760 425 PHE A CB  
938  C CG  . PHE A 128 ? 1.0791 0.5595 0.7405 -0.1409 0.1026  -0.0530 425 PHE A CG  
939  C CD1 . PHE A 128 ? 1.1041 0.6197 0.7904 -0.1639 0.0982  -0.0472 425 PHE A CD1 
940  C CD2 . PHE A 128 ? 1.1390 0.5841 0.7896 -0.1199 0.1146  -0.0361 425 PHE A CD2 
941  C CE1 . PHE A 128 ? 1.1146 0.6282 0.8099 -0.1670 0.1086  -0.0266 425 PHE A CE1 
942  C CE2 . PHE A 128 ? 1.1696 0.6123 0.8263 -0.1233 0.1213  -0.0137 425 PHE A CE2 
943  C CZ  . PHE A 128 ? 1.1534 0.6291 0.8301 -0.1475 0.1198  -0.0098 425 PHE A CZ  
944  N N   . ASP A 129 ? 0.8856 0.3513 0.4959 -0.0842 0.1057  -0.0919 426 ASP A N   
945  C CA  . ASP A 129 ? 0.8955 0.3386 0.4951 -0.0529 0.1195  -0.0924 426 ASP A CA  
946  C C   . ASP A 129 ? 0.8667 0.3649 0.4786 -0.0331 0.1163  -0.0863 426 ASP A C   
947  O O   . ASP A 129 ? 0.8818 0.3846 0.5040 -0.0052 0.1247  -0.0746 426 ASP A O   
948  C CB  . ASP A 129 ? 0.9441 0.3452 0.5183 -0.0560 0.1275  -0.1159 426 ASP A CB  
949  C CG  . ASP A 129 ? 1.0695 0.4233 0.6424 -0.0684 0.1322  -0.1165 426 ASP A CG  
950  O OD1 . ASP A 129 ? 1.1069 0.4412 0.6909 -0.0628 0.1375  -0.0971 426 ASP A OD1 
951  O OD2 . ASP A 129 ? 1.1611 0.4970 0.7209 -0.0838 0.1304  -0.1354 426 ASP A OD2 
952  N N   . MET A 130 ? 0.7421 0.2825 0.3555 -0.0480 0.1036  -0.0928 427 MET A N   
953  C CA  . MET A 130 ? 0.7998 0.3909 0.4256 -0.0334 0.1005  -0.0859 427 MET A CA  
954  C C   . MET A 130 ? 0.7432 0.3683 0.3981 -0.0231 0.0963  -0.0626 427 MET A C   
955  O O   . MET A 130 ? 0.7249 0.3721 0.3925 -0.0020 0.1000  -0.0531 427 MET A O   
956  C CB  . MET A 130 ? 0.7641 0.3882 0.3842 -0.0524 0.0868  -0.0950 427 MET A CB  
957  C CG  . MET A 130 ? 0.7434 0.3415 0.3268 -0.0605 0.0889  -0.1182 427 MET A CG  
958  S SD  . MET A 130 ? 1.0509 0.6983 0.6297 -0.0749 0.0708  -0.1204 427 MET A SD  
959  C CE  . MET A 130 ? 0.9495 0.5954 0.5314 -0.1095 0.0504  -0.1271 427 MET A CE  
960  N N   . LEU A 131 ? 0.7238 0.3534 0.3887 -0.0393 0.0893  -0.0542 428 LEU A N   
961  C CA  . LEU A 131 ? 0.6642 0.3206 0.3476 -0.0326 0.0860  -0.0345 428 LEU A CA  
962  C C   . LEU A 131 ? 0.6640 0.2968 0.3466 -0.0111 0.0933  -0.0207 428 LEU A C   
963  O O   . LEU A 131 ? 0.6487 0.3093 0.3437 0.0047  0.0899  -0.0076 428 LEU A O   
964  C CB  . LEU A 131 ? 0.6796 0.3405 0.3702 -0.0545 0.0819  -0.0297 428 LEU A CB  
965  C CG  . LEU A 131 ? 0.6875 0.3818 0.3890 -0.0729 0.0724  -0.0384 428 LEU A CG  
966  C CD1 . LEU A 131 ? 0.7370 0.4241 0.4473 -0.0962 0.0723  -0.0377 428 LEU A CD1 
967  C CD2 . LEU A 131 ? 0.6694 0.4098 0.3871 -0.0654 0.0673  -0.0303 428 LEU A CD2 
968  N N   . LEU A 132 ? 0.7145 0.2953 0.3833 -0.0112 0.1022  -0.0230 429 LEU A N   
969  C CA  . LEU A 132 ? 0.7778 0.3300 0.4462 0.0119  0.1094  -0.0078 429 LEU A CA  
970  C C   . LEU A 132 ? 0.7778 0.3480 0.4576 0.0398  0.1133  -0.0074 429 LEU A C   
971  O O   . LEU A 132 ? 0.7712 0.3560 0.4656 0.0607  0.1107  0.0115  429 LEU A O   
972  C CB  . LEU A 132 ? 0.8622 0.3474 0.5130 0.0070  0.1210  -0.0136 429 LEU A CB  
973  C CG  . LEU A 132 ? 0.8957 0.3597 0.5405 -0.0189 0.1202  -0.0075 429 LEU A CG  
974  C CD1 . LEU A 132 ? 0.9557 0.3510 0.5836 -0.0288 0.1318  -0.0179 429 LEU A CD1 
975  C CD2 . LEU A 132 ? 0.9027 0.3756 0.5512 -0.0099 0.1176  0.0206  429 LEU A CD2 
976  N N   . ALA A 133 ? 0.7803 0.3522 0.4537 0.0392  0.1192  -0.0274 430 ALA A N   
977  C CA  . ALA A 133 ? 0.7903 0.3825 0.4762 0.0637  0.1271  -0.0285 430 ALA A CA  
978  C C   . ALA A 133 ? 0.7342 0.3896 0.4459 0.0682  0.1155  -0.0151 430 ALA A C   
979  O O   . ALA A 133 ? 0.7415 0.4188 0.4765 0.0907  0.1168  -0.0020 430 ALA A O   
980  C CB  . ALA A 133 ? 0.7512 0.3309 0.4163 0.0581  0.1372  -0.0534 430 ALA A CB  
981  N N   . THR A 134 ? 0.6611 0.3453 0.3711 0.0466  0.1040  -0.0182 431 THR A N   
982  C CA  . THR A 134 ? 0.6461 0.3830 0.3773 0.0471  0.0934  -0.0079 431 THR A CA  
983  C C   . THR A 134 ? 0.6436 0.3895 0.3863 0.0554  0.0846  0.0124  431 THR A C   
984  O O   . THR A 134 ? 0.6316 0.4132 0.3955 0.0668  0.0784  0.0230  431 THR A O   
985  C CB  . THR A 134 ? 0.6070 0.3653 0.3340 0.0236  0.0843  -0.0143 431 THR A CB  
986  O OG1 . THR A 134 ? 0.6252 0.3727 0.3361 0.0142  0.0887  -0.0312 431 THR A OG1 
987  C CG2 . THR A 134 ? 0.5678 0.3734 0.3148 0.0247  0.0768  -0.0070 431 THR A CG2 
988  N N   . SER A 135 ? 0.6604 0.3740 0.3877 0.0480  0.0835  0.0184  432 SER A N   
989  C CA  . SER A 135 ? 0.7110 0.4267 0.4392 0.0549  0.0752  0.0392  432 SER A CA  
990  C C   . SER A 135 ? 0.7261 0.4393 0.4697 0.0835  0.0764  0.0529  432 SER A C   
991  O O   . SER A 135 ? 0.7400 0.4874 0.4993 0.0937  0.0642  0.0679  432 SER A O   
992  C CB  . SER A 135 ? 0.7832 0.4589 0.4892 0.0411  0.0783  0.0440  432 SER A CB  
993  O OG  . SER A 135 ? 0.8174 0.4959 0.5162 0.0455  0.0701  0.0650  432 SER A OG  
994  N N   . SER A 136 ? 0.7245 0.3975 0.4650 0.0963  0.0909  0.0472  433 SER A N   
995  C CA  . SER A 136 ? 0.7733 0.4417 0.5341 0.1276  0.0964  0.0592  433 SER A CA  
996  C C   . SER A 136 ? 0.7608 0.4862 0.5548 0.1400  0.0936  0.0595  433 SER A C   
997  O O   . SER A 136 ? 0.7944 0.5463 0.6167 0.1615  0.0867  0.0778  433 SER A O   
998  C CB  . SER A 136 ? 0.8626 0.4749 0.6123 0.1374  0.1175  0.0456  433 SER A CB  
999  O OG  . SER A 136 ? 0.9420 0.4996 0.6632 0.1218  0.1210  0.0437  433 SER A OG  
1000 N N   . ARG A 137 ? 0.6728 0.4182 0.4651 0.1258  0.0983  0.0406  434 ARG A N   
1001 C CA  . ARG A 137 ? 0.6380 0.4361 0.4604 0.1326  0.0981  0.0403  434 ARG A CA  
1002 C C   . ARG A 137 ? 0.6018 0.4482 0.4435 0.1273  0.0763  0.0563  434 ARG A C   
1003 O O   . ARG A 137 ? 0.5716 0.4574 0.4488 0.1427  0.0713  0.0683  434 ARG A O   
1004 C CB  . ARG A 137 ? 0.6451 0.4495 0.4535 0.1149  0.1060  0.0195  434 ARG A CB  
1005 C CG  . ARG A 137 ? 0.6708 0.5247 0.5075 0.1195  0.1097  0.0195  434 ARG A CG  
1006 C CD  . ARG A 137 ? 0.7384 0.5946 0.5988 0.1472  0.1291  0.0208  434 ARG A CD  
1007 N NE  . ARG A 137 ? 0.7664 0.6703 0.6538 0.1484  0.1364  0.0203  434 ARG A NE  
1008 C CZ  . ARG A 137 ? 0.7987 0.7455 0.7337 0.1668  0.1389  0.0339  434 ARG A CZ  
1009 N NH1 . ARG A 137 ? 0.8265 0.7754 0.7870 0.1879  0.1323  0.0502  434 ARG A NH1 
1010 N NH2 . ARG A 137 ? 0.7786 0.7677 0.7379 0.1637  0.1477  0.0331  434 ARG A NH2 
1011 N N   . PHE A 138 ? 0.5815 0.4249 0.4005 0.1050  0.0639  0.0556  435 PHE A N   
1012 C CA  . PHE A 138 ? 0.5832 0.4629 0.4095 0.0970  0.0439  0.0674  435 PHE A CA  
1013 C C   . PHE A 138 ? 0.6099 0.4925 0.4449 0.1150  0.0314  0.0902  435 PHE A C   
1014 O O   . PHE A 138 ? 0.5864 0.5121 0.4447 0.1190  0.0153  0.1015  435 PHE A O   
1015 C CB  . PHE A 138 ? 0.6001 0.4668 0.3958 0.0721  0.0383  0.0613  435 PHE A CB  
1016 C CG  . PHE A 138 ? 0.6341 0.5171 0.4305 0.0542  0.0419  0.0450  435 PHE A CG  
1017 C CD1 . PHE A 138 ? 0.6439 0.5538 0.4635 0.0584  0.0473  0.0388  435 PHE A CD1 
1018 C CD2 . PHE A 138 ? 0.6713 0.5431 0.4469 0.0345  0.0411  0.0379  435 PHE A CD2 
1019 C CE1 . PHE A 138 ? 0.6129 0.5346 0.4310 0.0430  0.0501  0.0273  435 PHE A CE1 
1020 C CE2 . PHE A 138 ? 0.6469 0.5331 0.4261 0.0211  0.0436  0.0259  435 PHE A CE2 
1021 C CZ  . PHE A 138 ? 0.5824 0.4917 0.3809 0.0253  0.0472  0.0213  435 PHE A CZ  
1022 N N   . ARG A 139 ? 0.6573 0.4934 0.4734 0.1248  0.0378  0.0977  436 ARG A N   
1023 C CA  . ARG A 139 ? 0.7142 0.5453 0.5337 0.1436  0.0261  0.1231  436 ARG A CA  
1024 C C   . ARG A 139 ? 0.7024 0.5654 0.5686 0.1726  0.0253  0.1347  436 ARG A C   
1025 O O   . ARG A 139 ? 0.7333 0.6323 0.6194 0.1828  0.0048  0.1551  436 ARG A O   
1026 C CB  . ARG A 139 ? 0.8144 0.5812 0.6041 0.1474  0.0372  0.1288  436 ARG A CB  
1027 C CG  . ARG A 139 ? 0.9317 0.6854 0.7195 0.1678  0.0257  0.1589  436 ARG A CG  
1028 C CD  . ARG A 139 ? 1.0649 0.7510 0.8166 0.1642  0.0368  0.1656  436 ARG A CD  
1029 N NE  . ARG A 139 ? 1.1501 0.7890 0.9021 0.1676  0.0613  0.1477  436 ARG A NE  
1030 C CZ  . ARG A 139 ? 1.1494 0.7638 0.8806 0.1424  0.0736  0.1244  436 ARG A CZ  
1031 N NH1 . ARG A 139 ? 1.1031 0.7368 0.8168 0.1149  0.0662  0.1176  436 ARG A NH1 
1032 N NH2 . ARG A 139 ? 1.1729 0.7439 0.9013 0.1447  0.0931  0.1074  436 ARG A NH2 
1033 N N   . MET A 140 ? 0.6931 0.5453 0.5771 0.1855  0.0476  0.1215  437 MET A N   
1034 C CA  . MET A 140 ? 0.7062 0.5909 0.6399 0.2143  0.0530  0.1307  437 MET A CA  
1035 C C   . MET A 140 ? 0.6824 0.6387 0.6527 0.2061  0.0406  0.1307  437 MET A C   
1036 O O   . MET A 140 ? 0.7008 0.7014 0.7204 0.2266  0.0359  0.1452  437 MET A O   
1037 C CB  . MET A 140 ? 0.7600 0.6097 0.6960 0.2287  0.0846  0.1133  437 MET A CB  
1038 C CG  . MET A 140 ? 0.8229 0.5986 0.7293 0.2393  0.0979  0.1137  437 MET A CG  
1039 S SD  . MET A 140 ? 1.0491 0.8161 0.9759 0.2713  0.0845  0.1506  437 MET A SD  
1040 C CE  . MET A 140 ? 0.8141 0.6361 0.8120 0.3083  0.0935  0.1601  437 MET A CE  
1041 N N   . MET A 141 ? 0.6517 0.6195 0.6013 0.1761  0.0355  0.1153  438 MET A N   
1042 C CA  . MET A 141 ? 0.6270 0.6550 0.6071 0.1637  0.0243  0.1140  438 MET A CA  
1043 C C   . MET A 141 ? 0.6309 0.6877 0.6085 0.1517  -0.0071 0.1281  438 MET A C   
1044 O O   . MET A 141 ? 0.5630 0.6723 0.5714 0.1428  -0.0212 0.1306  438 MET A O   
1045 C CB  . MET A 141 ? 0.6006 0.6243 0.5612 0.1387  0.0354  0.0913  438 MET A CB  
1046 C CG  . MET A 141 ? 0.6390 0.6525 0.6071 0.1477  0.0636  0.0775  438 MET A CG  
1047 S SD  . MET A 141 ? 0.7782 0.8007 0.7304 0.1198  0.0710  0.0582  438 MET A SD  
1048 C CE  . MET A 141 ? 0.6121 0.7032 0.6120 0.1111  0.0555  0.0686  438 MET A CE  
1049 N N   . ASN A 142 ? 0.7117 0.7326 0.6500 0.1499  -0.0173 0.1370  439 ASN A N   
1050 C CA  . ASN A 142 ? 0.7804 0.8189 0.6996 0.1353  -0.0454 0.1476  439 ASN A CA  
1051 C C   . ASN A 142 ? 0.7277 0.7815 0.6330 0.1044  -0.0485 0.1280  439 ASN A C   
1052 O O   . ASN A 142 ? 0.7304 0.8294 0.6566 0.0933  -0.0661 0.1288  439 ASN A O   
1053 C CB  . ASN A 142 ? 0.8815 0.9726 0.8432 0.1512  -0.0693 0.1701  439 ASN A CB  
1054 C CG  . ASN A 142 ? 1.0106 1.1165 0.9436 0.1358  -0.1014 0.1815  439 ASN A CG  
1055 O OD1 . ASN A 142 ? 1.0870 1.1581 0.9654 0.1164  -0.1020 0.1737  439 ASN A OD1 
1056 N ND2 . ASN A 142 ? 1.0416 1.2004 1.0108 0.1440  -0.1281 0.2000  439 ASN A ND2 
1057 N N   . LEU A 143 ? 0.6838 0.6994 0.5571 0.0905  -0.0310 0.1105  440 LEU A N   
1058 C CA  . LEU A 143 ? 0.5996 0.6214 0.4583 0.0641  -0.0309 0.0930  440 LEU A CA  
1059 C C   . LEU A 143 ? 0.6122 0.6341 0.4381 0.0484  -0.0505 0.0969  440 LEU A C   
1060 O O   . LEU A 143 ? 0.6349 0.6233 0.4233 0.0486  -0.0506 0.1034  440 LEU A O   
1061 C CB  . LEU A 143 ? 0.5629 0.5454 0.3972 0.0554  -0.0098 0.0769  440 LEU A CB  
1062 C CG  . LEU A 143 ? 0.5721 0.5599 0.3957 0.0317  -0.0083 0.0609  440 LEU A CG  
1063 C CD1 . LEU A 143 ? 0.5513 0.5734 0.4098 0.0289  -0.0054 0.0546  440 LEU A CD1 
1064 C CD2 . LEU A 143 ? 0.5576 0.5095 0.3558 0.0224  0.0070  0.0491  440 LEU A CD2 
1065 N N   . GLN A 144 ? 0.5994 0.6568 0.4370 0.0335  -0.0657 0.0922  441 GLN A N   
1066 C CA  . GLN A 144 ? 0.5942 0.6510 0.3954 0.0159  -0.0843 0.0917  441 GLN A CA  
1067 C C   . GLN A 144 ? 0.5971 0.6246 0.3650 -0.0042 -0.0698 0.0720  441 GLN A C   
1068 O O   . GLN A 144 ? 0.5493 0.5739 0.3341 -0.0085 -0.0532 0.0588  441 GLN A O   
1069 C CB  . GLN A 144 ? 0.6284 0.7341 0.4564 0.0055  -0.1081 0.0928  441 GLN A CB  
1070 C CG  . GLN A 144 ? 0.6757 0.8215 0.5448 0.0253  -0.1263 0.1148  441 GLN A CG  
1071 C CD  . GLN A 144 ? 0.7467 0.8788 0.5840 0.0376  -0.1433 0.1358  441 GLN A CD  
1072 O OE1 . GLN A 144 ? 0.8242 0.9448 0.6132 0.0220  -0.1590 0.1354  441 GLN A OE1 
1073 N NE2 . GLN A 144 ? 0.7565 0.8865 0.6180 0.0664  -0.1388 0.1549  441 GLN A NE2 
1074 N N   . GLY A 145 ? 0.6519 0.6581 0.3722 -0.0153 -0.0755 0.0713  442 GLY A N   
1075 C CA  . GLY A 145 ? 0.6369 0.6169 0.3271 -0.0326 -0.0606 0.0534  442 GLY A CA  
1076 C C   . GLY A 145 ? 0.6278 0.6247 0.3358 -0.0486 -0.0608 0.0358  442 GLY A C   
1077 O O   . GLY A 145 ? 0.6203 0.6006 0.3286 -0.0553 -0.0425 0.0221  442 GLY A O   
1078 N N   . GLU A 146 ? 0.6372 0.6674 0.3625 -0.0551 -0.0821 0.0374  443 GLU A N   
1079 C CA  . GLU A 146 ? 0.6391 0.6845 0.3855 -0.0721 -0.0830 0.0221  443 GLU A CA  
1080 C C   . GLU A 146 ? 0.5795 0.6326 0.3692 -0.0645 -0.0649 0.0203  443 GLU A C   
1081 O O   . GLU A 146 ? 0.5811 0.6273 0.3782 -0.0762 -0.0542 0.0073  443 GLU A O   
1082 C CB  . GLU A 146 ? 0.6990 0.7841 0.4626 -0.0820 -0.1115 0.0263  443 GLU A CB  
1083 C CG  . GLU A 146 ? 0.7821 0.8606 0.4952 -0.0947 -0.1335 0.0255  443 GLU A CG  
1084 C CD  . GLU A 146 ? 0.8680 0.9504 0.5649 -0.0766 -0.1472 0.0486  443 GLU A CD  
1085 O OE1 . GLU A 146 ? 0.8348 0.9201 0.5605 -0.0536 -0.1372 0.0634  443 GLU A OE1 
1086 O OE2 . GLU A 146 ? 0.9777 1.0571 0.6300 -0.0854 -0.1676 0.0522  443 GLU A OE2 
1087 N N   . GLU A 147 ? 0.5498 0.6137 0.3645 -0.0443 -0.0606 0.0336  444 GLU A N   
1088 C CA  . GLU A 147 ? 0.4997 0.5679 0.3465 -0.0361 -0.0424 0.0320  444 GLU A CA  
1089 C C   . GLU A 147 ? 0.4598 0.4910 0.2841 -0.0342 -0.0224 0.0244  444 GLU A C   
1090 O O   . GLU A 147 ? 0.4437 0.4707 0.2780 -0.0390 -0.0097 0.0166  444 GLU A O   
1091 C CB  . GLU A 147 ? 0.4621 0.5519 0.3407 -0.0145 -0.0425 0.0465  444 GLU A CB  
1092 C CG  . GLU A 147 ? 0.4942 0.6310 0.4094 -0.0142 -0.0619 0.0565  444 GLU A CG  
1093 C CD  . GLU A 147 ? 0.5543 0.7111 0.5035 0.0118  -0.0593 0.0724  444 GLU A CD  
1094 O OE1 . GLU A 147 ? 0.5693 0.6983 0.4985 0.0288  -0.0542 0.0794  444 GLU A OE1 
1095 O OE2 . GLU A 147 ? 0.5749 0.7740 0.5729 0.0154  -0.0604 0.0778  444 GLU A OE2 
1096 N N   . PHE A 148 ? 0.4566 0.4626 0.2518 -0.0278 -0.0205 0.0286  445 PHE A N   
1097 C CA  . PHE A 148 ? 0.4873 0.4621 0.2642 -0.0285 -0.0039 0.0224  445 PHE A CA  
1098 C C   . PHE A 148 ? 0.5195 0.4853 0.2889 -0.0435 0.0038  0.0089  445 PHE A C   
1099 O O   . PHE A 148 ? 0.4816 0.4404 0.2607 -0.0434 0.0161  0.0040  445 PHE A O   
1100 C CB  . PHE A 148 ? 0.5302 0.4803 0.2757 -0.0246 -0.0040 0.0298  445 PHE A CB  
1101 C CG  . PHE A 148 ? 0.5363 0.4594 0.2635 -0.0314 0.0116  0.0226  445 PHE A CG  
1102 C CD1 . PHE A 148 ? 0.4843 0.3966 0.2234 -0.0273 0.0237  0.0200  445 PHE A CD1 
1103 C CD2 . PHE A 148 ? 0.5945 0.5045 0.2930 -0.0427 0.0145  0.0179  445 PHE A CD2 
1104 C CE1 . PHE A 148 ? 0.4578 0.3524 0.1878 -0.0349 0.0359  0.0147  445 PHE A CE1 
1105 C CE2 . PHE A 148 ? 0.6010 0.4920 0.2909 -0.0482 0.0310  0.0126  445 PHE A CE2 
1106 C CZ  . PHE A 148 ? 0.5369 0.4231 0.2464 -0.0445 0.0404  0.0118  445 PHE A CZ  
1107 N N   . VAL A 149 ? 0.5572 0.5218 0.3080 -0.0558 -0.0037 0.0032  446 VAL A N   
1108 C CA  . VAL A 149 ? 0.5435 0.4943 0.2866 -0.0680 0.0062  -0.0104 446 VAL A CA  
1109 C C   . VAL A 149 ? 0.5254 0.4882 0.2999 -0.0715 0.0097  -0.0147 446 VAL A C   
1110 O O   . VAL A 149 ? 0.5328 0.4826 0.3117 -0.0739 0.0223  -0.0209 446 VAL A O   
1111 C CB  . VAL A 149 ? 0.5598 0.5013 0.2702 -0.0817 -0.0011 -0.0191 446 VAL A CB  
1112 C CG1 . VAL A 149 ? 0.4728 0.3943 0.1442 -0.0796 0.0027  -0.0152 446 VAL A CG1 
1113 C CG2 . VAL A 149 ? 0.5445 0.5113 0.2619 -0.0883 -0.0234 -0.0166 446 VAL A CG2 
1114 N N   . CYS A 150 ? 0.5198 0.5089 0.3185 -0.0710 -0.0007 -0.0092 447 CYS A N   
1115 C CA  . CYS A 150 ? 0.4916 0.4927 0.3200 -0.0746 0.0048  -0.0100 447 CYS A CA  
1116 C C   . CYS A 150 ? 0.4894 0.4858 0.3273 -0.0626 0.0183  -0.0052 447 CYS A C   
1117 O O   . CYS A 150 ? 0.4722 0.4609 0.3172 -0.0656 0.0278  -0.0074 447 CYS A O   
1118 C CB  . CYS A 150 ? 0.4742 0.5095 0.3309 -0.0770 -0.0072 -0.0037 447 CYS A CB  
1119 S SG  . CYS A 150 ? 0.5999 0.6459 0.4504 -0.0981 -0.0275 -0.0113 447 CYS A SG  
1120 N N   . LEU A 151 ? 0.4876 0.4861 0.3231 -0.0493 0.0185  0.0015  448 LEU A N   
1121 C CA  . LEU A 151 ? 0.4778 0.4691 0.3156 -0.0400 0.0295  0.0035  448 LEU A CA  
1122 C C   . LEU A 151 ? 0.4388 0.4087 0.2630 -0.0437 0.0366  -0.0017 448 LEU A C   
1123 O O   . LEU A 151 ? 0.4512 0.4195 0.2812 -0.0429 0.0429  -0.0014 448 LEU A O   
1124 C CB  . LEU A 151 ? 0.5066 0.4952 0.3398 -0.0263 0.0291  0.0090  448 LEU A CB  
1125 C CG  . LEU A 151 ? 0.5061 0.5192 0.3620 -0.0162 0.0263  0.0163  448 LEU A CG  
1126 C CD1 . LEU A 151 ? 0.5010 0.5017 0.3504 0.0000  0.0291  0.0212  448 LEU A CD1 
1127 C CD2 . LEU A 151 ? 0.4768 0.5058 0.3530 -0.0165 0.0361  0.0162  448 LEU A CD2 
1128 N N   . LYS A 152 ? 0.4662 0.4219 0.2729 -0.0474 0.0357  -0.0051 449 LYS A N   
1129 C CA  . LYS A 152 ? 0.4657 0.4062 0.2664 -0.0500 0.0441  -0.0089 449 LYS A CA  
1130 C C   . LYS A 152 ? 0.4894 0.4288 0.3014 -0.0557 0.0492  -0.0130 449 LYS A C   
1131 O O   . LYS A 152 ? 0.5120 0.4485 0.3331 -0.0538 0.0549  -0.0120 449 LYS A O   
1132 C CB  . LYS A 152 ? 0.3984 0.3249 0.1777 -0.0528 0.0459  -0.0106 449 LYS A CB  
1133 C CG  . LYS A 152 ? 0.3755 0.2914 0.1552 -0.0549 0.0570  -0.0131 449 LYS A CG  
1134 C CD  . LYS A 152 ? 0.4115 0.3134 0.1689 -0.0573 0.0618  -0.0118 449 LYS A CD  
1135 C CE  . LYS A 152 ? 0.4447 0.3403 0.1778 -0.0626 0.0605  -0.0159 449 LYS A CE  
1136 N NZ  . LYS A 152 ? 0.4758 0.3564 0.1859 -0.0655 0.0695  -0.0143 449 LYS A NZ  
1137 N N   . SER A 153 ? 0.4592 0.4004 0.2719 -0.0628 0.0459  -0.0170 450 SER A N   
1138 C CA  . SER A 153 ? 0.4539 0.3879 0.2777 -0.0683 0.0517  -0.0207 450 SER A CA  
1139 C C   . SER A 153 ? 0.4245 0.3687 0.2678 -0.0648 0.0530  -0.0121 450 SER A C   
1140 O O   . SER A 153 ? 0.3697 0.3060 0.2225 -0.0634 0.0593  -0.0093 450 SER A O   
1141 C CB  . SER A 153 ? 0.5260 0.4568 0.3440 -0.0803 0.0466  -0.0287 450 SER A CB  
1142 O OG  . SER A 153 ? 0.6688 0.5861 0.4602 -0.0845 0.0467  -0.0375 450 SER A OG  
1143 N N   . ILE A 154 ? 0.4131 0.3745 0.2616 -0.0623 0.0480  -0.0067 451 ILE A N   
1144 C CA  . ILE A 154 ? 0.4372 0.4079 0.2975 -0.0591 0.0519  0.0016  451 ILE A CA  
1145 C C   . ILE A 154 ? 0.4705 0.4348 0.3242 -0.0518 0.0550  0.0053  451 ILE A C   
1146 O O   . ILE A 154 ? 0.4638 0.4257 0.3225 -0.0514 0.0582  0.0119  451 ILE A O   
1147 C CB  . ILE A 154 ? 0.3830 0.3743 0.2503 -0.0551 0.0500  0.0057  451 ILE A CB  
1148 C CG1 . ILE A 154 ? 0.3692 0.3754 0.2532 -0.0651 0.0451  0.0049  451 ILE A CG1 
1149 C CG2 . ILE A 154 ? 0.3605 0.3575 0.2300 -0.0499 0.0579  0.0130  451 ILE A CG2 
1150 C CD1 . ILE A 154 ? 0.3633 0.3968 0.2636 -0.0596 0.0427  0.0102  451 ILE A CD1 
1151 N N   . ILE A 155 ? 0.4705 0.4316 0.3129 -0.0472 0.0526  0.0022  452 ILE A N   
1152 C CA  . ILE A 155 ? 0.4518 0.4092 0.2892 -0.0439 0.0524  0.0040  452 ILE A CA  
1153 C C   . ILE A 155 ? 0.4720 0.4251 0.3206 -0.0452 0.0540  0.0064  452 ILE A C   
1154 O O   . ILE A 155 ? 0.4588 0.4155 0.3110 -0.0429 0.0518  0.0133  452 ILE A O   
1155 C CB  . ILE A 155 ? 0.4661 0.4168 0.2925 -0.0427 0.0506  -0.0008 452 ILE A CB  
1156 C CG1 . ILE A 155 ? 0.4939 0.4451 0.3110 -0.0374 0.0500  -0.0015 452 ILE A CG1 
1157 C CG2 . ILE A 155 ? 0.4454 0.3946 0.2715 -0.0437 0.0483  -0.0003 452 ILE A CG2 
1158 C CD1 . ILE A 155 ? 0.5266 0.4646 0.3320 -0.0360 0.0493  -0.0045 452 ILE A CD1 
1159 N N   . LEU A 156 ? 0.4834 0.4284 0.3363 -0.0480 0.0582  0.0010  453 LEU A N   
1160 C CA  . LEU A 156 ? 0.4582 0.3970 0.3256 -0.0465 0.0638  0.0021  453 LEU A CA  
1161 C C   . LEU A 156 ? 0.4460 0.3827 0.3250 -0.0447 0.0648  0.0111  453 LEU A C   
1162 O O   . LEU A 156 ? 0.4349 0.3749 0.3262 -0.0389 0.0635  0.0203  453 LEU A O   
1163 C CB  . LEU A 156 ? 0.4776 0.4027 0.3403 -0.0503 0.0717  -0.0081 453 LEU A CB  
1164 C CG  . LEU A 156 ? 0.4352 0.3485 0.3129 -0.0470 0.0830  -0.0101 453 LEU A CG  
1165 C CD1 . LEU A 156 ? 0.4089 0.3330 0.3035 -0.0406 0.0861  -0.0056 453 LEU A CD1 
1166 C CD2 . LEU A 156 ? 0.5011 0.3958 0.3625 -0.0531 0.0917  -0.0239 453 LEU A CD2 
1167 N N   . LEU A 157 ? 0.4292 0.3614 0.3056 -0.0502 0.0662  0.0101  454 LEU A N   
1168 C CA  . LEU A 157 ? 0.5077 0.4328 0.3943 -0.0510 0.0696  0.0194  454 LEU A CA  
1169 C C   . LEU A 157 ? 0.5061 0.4430 0.3880 -0.0479 0.0659  0.0328  454 LEU A C   
1170 O O   . LEU A 157 ? 0.5122 0.4432 0.3999 -0.0449 0.0676  0.0458  454 LEU A O   
1171 C CB  . LEU A 157 ? 0.5579 0.4745 0.4458 -0.0621 0.0728  0.0129  454 LEU A CB  
1172 C CG  . LEU A 157 ? 0.5858 0.4844 0.4701 -0.0677 0.0769  -0.0020 454 LEU A CG  
1173 C CD1 . LEU A 157 ? 0.5977 0.4931 0.4801 -0.0826 0.0745  -0.0098 454 LEU A CD1 
1174 C CD2 . LEU A 157 ? 0.6127 0.4885 0.5083 -0.0616 0.0872  -0.0007 454 LEU A CD2 
1175 N N   . ASN A 158 ? 0.4971 0.4477 0.3658 -0.0478 0.0621  0.0303  455 ASN A N   
1176 C CA  . ASN A 158 ? 0.4734 0.4323 0.3306 -0.0456 0.0620  0.0400  455 ASN A CA  
1177 C C   . ASN A 158 ? 0.4906 0.4527 0.3353 -0.0402 0.0543  0.0450  455 ASN A C   
1178 O O   . ASN A 158 ? 0.5445 0.5074 0.3793 -0.0386 0.0531  0.0574  455 ASN A O   
1179 C CB  . ASN A 158 ? 0.4930 0.4634 0.3428 -0.0466 0.0650  0.0347  455 ASN A CB  
1180 C CG  . ASN A 158 ? 0.5399 0.5162 0.3730 -0.0438 0.0697  0.0427  455 ASN A CG  
1181 O OD1 . ASN A 158 ? 0.5253 0.5017 0.3604 -0.0467 0.0765  0.0539  455 ASN A OD1 
1182 N ND2 . ASN A 158 ? 0.5413 0.5190 0.3549 -0.0390 0.0677  0.0366  455 ASN A ND2 
1183 N N   . SER A 159 ? 0.6287 0.7768 0.6702 0.0607  0.0005  -0.0816 456 SER A N   
1184 C CA  . SER A 159 ? 0.6180 0.7839 0.6186 0.0649  -0.0214 -0.0622 456 SER A CA  
1185 C C   . SER A 159 ? 0.6796 0.8205 0.6010 0.0735  -0.0117 -0.0167 456 SER A C   
1186 O O   . SER A 159 ? 0.6725 0.8183 0.5441 0.0603  -0.0125 -0.0077 456 SER A O   
1187 C CB  . SER A 159 ? 0.5120 0.7265 0.5488 0.0778  -0.0716 -0.0531 456 SER A CB  
1188 O OG  . SER A 159 ? 0.5353 0.7788 0.6480 0.0638  -0.0851 -0.0887 456 SER A OG  
1189 N N   . GLY A 160 ? 0.6480 0.7644 0.5626 0.0919  -0.0016 0.0124  457 GLY A N   
1190 C CA  . GLY A 160 ? 0.7045 0.7993 0.5656 0.1026  0.0048  0.0652  457 GLY A CA  
1191 C C   . GLY A 160 ? 1.1196 1.1618 0.9678 0.0974  0.0493  0.0754  457 GLY A C   
1192 O O   . GLY A 160 ? 0.8086 0.8291 0.6359 0.1105  0.0557  0.1260  457 GLY A O   
1193 N N   . VAL A 161 ? 0.7652 0.7880 0.6340 0.0779  0.0795  0.0310  458 VAL A N   
1194 C CA  . VAL A 161 ? 0.9753 0.9470 0.8400 0.0711  0.1231  0.0356  458 VAL A CA  
1195 C C   . VAL A 161 ? 1.0400 0.9923 0.8416 0.0528  0.1412  0.0701  458 VAL A C   
1196 O O   . VAL A 161 ? 0.9498 0.8602 0.7440 0.0521  0.1700  0.0978  458 VAL A O   
1197 C CB  . VAL A 161 ? 0.7968 0.7584 0.7051 0.0524  0.1484  -0.0212 458 VAL A CB  
1198 C CG1 . VAL A 161 ? 0.8110 0.7833 0.7055 0.0229  0.1616  -0.0528 458 VAL A CG1 
1199 C CG2 . VAL A 161 ? 0.8385 0.7475 0.7580 0.0518  0.1887  -0.0177 458 VAL A CG2 
1200 N N   . TYR A 162 ? 1.0241 1.0089 0.7812 0.0339  0.1244  0.0693  459 TYR A N   
1201 C CA  . TYR A 162 ? 1.1085 1.0865 0.7941 0.0049  0.1393  0.0999  459 TYR A CA  
1202 C C   . TYR A 162 ? 1.1429 1.1443 0.7811 0.0111  0.1047  0.1667  459 TYR A C   
1203 O O   . TYR A 162 ? 1.1707 1.1829 0.7399 -0.0204 0.1060  0.1968  459 TYR A O   
1204 C CB  . TYR A 162 ? 1.1327 1.1309 0.7944 -0.0336 0.1553  0.0456  459 TYR A CB  
1205 C CG  . TYR A 162 ? 1.1616 1.1390 0.8749 -0.0436 0.1919  -0.0128 459 TYR A CG  
1206 C CD1 . TYR A 162 ? 1.1400 1.1420 0.8924 -0.0587 0.1969  -0.0757 459 TYR A CD1 
1207 C CD2 . TYR A 162 ? 1.2236 1.1573 0.9562 -0.0387 0.2219  -0.0035 459 TYR A CD2 
1208 C CE1 . TYR A 162 ? 1.1583 1.1467 0.9694 -0.0682 0.2280  -0.1235 459 TYR A CE1 
1209 C CE2 . TYR A 162 ? 1.2299 1.1485 1.0108 -0.0506 0.2532  -0.0545 459 TYR A CE2 
1210 C CZ  . TYR A 162 ? 1.1997 1.1481 1.0203 -0.0652 0.2548  -0.1122 459 TYR A CZ  
1211 O OH  . TYR A 162 ? 1.1943 1.1327 1.0734 -0.0775 0.2836  -0.1576 459 TYR A OH  
1212 N N   . THR A 163 ? 1.1302 1.1439 0.8054 0.0476  0.0738  0.1913  460 THR A N   
1213 C CA  . THR A 163 ? 1.1916 1.2316 0.8359 0.0568  0.0380  0.2583  460 THR A CA  
1214 C C   . THR A 163 ? 1.2735 1.2846 0.9554 0.0882  0.0417  0.3223  460 THR A C   
1215 O O   . THR A 163 ? 1.2892 1.3227 0.9773 0.1078  0.0106  0.3780  460 THR A O   
1216 C CB  . THR A 163 ? 1.0888 1.1757 0.7455 0.0710  -0.0046 0.2433  460 THR A CB  
1217 O OG1 . THR A 163 ? 0.9802 1.0648 0.7025 0.0903  -0.0016 0.1891  460 THR A OG1 
1218 C CG2 . THR A 163 ? 1.1054 1.2273 0.7052 0.0330  -0.0163 0.2158  460 THR A CG2 
1219 N N   . PHE A 164 ? 1.3214 1.2826 1.0371 0.0923  0.0819  0.3130  461 PHE A N   
1220 C CA  . PHE A 164 ? 1.3827 1.3073 1.1410 0.1160  0.0956  0.3739  461 PHE A CA  
1221 C C   . PHE A 164 ? 1.4558 1.3306 1.2108 0.0960  0.1385  0.3802  461 PHE A C   
1222 O O   . PHE A 164 ? 1.4562 1.3203 1.1897 0.0702  0.1632  0.3237  461 PHE A O   
1223 C CB  . PHE A 164 ? 1.3320 1.2433 1.1703 0.1568  0.1006  0.3560  461 PHE A CB  
1224 C CG  . PHE A 164 ? 1.2813 1.1720 1.1503 0.1537  0.1288  0.2761  461 PHE A CG  
1225 C CD1 . PHE A 164 ? 1.3111 1.1477 1.2069 0.1472  0.1742  0.2596  461 PHE A CD1 
1226 C CD2 . PHE A 164 ? 1.1984 1.1268 1.0741 0.1547  0.1073  0.2226  461 PHE A CD2 
1227 C CE1 . PHE A 164 ? 1.2680 1.0915 1.1906 0.1392  0.1968  0.1895  461 PHE A CE1 
1228 C CE2 . PHE A 164 ? 1.1504 1.0683 1.0572 0.1467  0.1274  0.1581  461 PHE A CE2 
1229 C CZ  . PHE A 164 ? 1.1860 1.0528 1.1138 0.1379  0.1719  0.1409  461 PHE A CZ  
1230 N N   . LYS A 175 ? 1.2878 0.9697 1.2945 0.0923  0.3315  0.0722  472 LYS A N   
1231 C CA  . LYS A 175 ? 1.2801 0.9992 1.2410 0.0683  0.3131  0.0526  472 LYS A CA  
1232 C C   . LYS A 175 ? 1.2751 0.9815 1.2509 0.0392  0.3405  -0.0041 472 LYS A C   
1233 O O   . LYS A 175 ? 1.1893 0.9365 1.1690 0.0247  0.3231  -0.0464 472 LYS A O   
1234 C CB  . LYS A 175 ? 1.3490 1.0639 1.2580 0.0592  0.3110  0.1070  472 LYS A CB  
1235 C CG  . LYS A 175 ? 1.3479 1.0957 1.2104 0.0282  0.3049  0.0789  472 LYS A CG  
1236 C CD  . LYS A 175 ? 1.4456 1.1827 1.2511 0.0063  0.3160  0.1272  472 LYS A CD  
1237 C CE  . LYS A 175 ? 1.4727 1.2521 1.2244 -0.0254 0.3081  0.1003  472 LYS A CE  
1238 N NZ  . LYS A 175 ? 1.4703 1.2478 1.2437 -0.0491 0.3368  0.0328  472 LYS A NZ  
1239 N N   A ASP A 176 ? 1.0988 0.4841 0.9333 0.0193  0.0705  0.0326  473 ASP A N   
1240 N N   B ASP A 176 ? 1.0984 0.4839 0.9327 0.0191  0.0705  0.0330  473 ASP A N   
1241 C CA  A ASP A 176 ? 1.1078 0.4827 0.9265 -0.0208 0.0741  0.0307  473 ASP A CA  
1242 C CA  B ASP A 176 ? 1.1072 0.4832 0.9253 -0.0212 0.0742  0.0307  473 ASP A CA  
1243 C C   A ASP A 176 ? 1.0907 0.4752 0.9041 -0.0375 0.0825  -0.0095 473 ASP A C   
1244 C C   B ASP A 176 ? 1.0911 0.4753 0.9045 -0.0379 0.0826  -0.0097 473 ASP A C   
1245 O O   A ASP A 176 ? 1.0613 0.4783 0.8615 -0.0664 0.0833  -0.0140 473 ASP A O   
1246 O O   B ASP A 176 ? 1.0649 0.4795 0.8649 -0.0675 0.0836  -0.0146 473 ASP A O   
1247 C CB  A ASP A 176 ? 1.1703 0.4957 0.9998 -0.0320 0.0699  0.0438  473 ASP A CB  
1248 C CB  B ASP A 176 ? 1.1704 0.4988 0.9980 -0.0338 0.0698  0.0459  473 ASP A CB  
1249 C CG  A ASP A 176 ? 1.1872 0.5144 1.0012 -0.0735 0.0710  0.0575  473 ASP A CG  
1250 C CG  B ASP A 176 ? 1.1859 0.5171 1.0110 -0.0305 0.0612  0.0908  473 ASP A CG  
1251 O OD1 A ASP A 176 ? 1.1532 0.5132 0.9521 -0.0976 0.0763  0.0431  473 ASP A OD1 
1252 O OD1 B ASP A 176 ? 1.1594 0.5349 0.9686 -0.0305 0.0604  0.1080  473 ASP A OD1 
1253 O OD2 A ASP A 176 ? 1.2428 0.5427 1.0620 -0.0830 0.0660  0.0839  473 ASP A OD2 
1254 O OD2 B ASP A 176 ? 1.2238 0.5143 1.0627 -0.0287 0.0547  0.1089  473 ASP A OD2 
1255 N N   . HIS A 177 ? 1.0916 0.4663 0.9212 -0.0181 0.0860  -0.0378 474 HIS A N   
1256 C CA  . HIS A 177 ? 1.0194 0.4117 0.8436 -0.0322 0.0936  -0.0770 474 HIS A CA  
1257 C C   . HIS A 177 ? 0.9147 0.3662 0.7252 -0.0357 0.0945  -0.0811 474 HIS A C   
1258 O O   . HIS A 177 ? 0.8747 0.3563 0.6723 -0.0627 0.0952  -0.0962 474 HIS A O   
1259 C CB  . HIS A 177 ? 1.0504 0.4314 0.8970 -0.0057 0.0970  -0.1042 474 HIS A CB  
1260 C CG  . HIS A 177 ? 1.0455 0.4663 0.8855 -0.0114 0.1049  -0.1402 474 HIS A CG  
1261 N ND1 . HIS A 177 ? 1.0614 0.4846 0.8883 -0.0412 0.1087  -0.1668 474 HIS A ND1 
1262 C CD2 . HIS A 177 ? 1.0089 0.4745 0.8525 0.0064  0.1090  -0.1521 474 HIS A CD2 
1263 C CE1 . HIS A 177 ? 1.0270 0.4956 0.8481 -0.0409 0.1142  -0.1915 474 HIS A CE1 
1264 N NE2 . HIS A 177 ? 0.9818 0.4762 0.8134 -0.0130 0.1149  -0.1831 474 HIS A NE2 
1265 N N   . ILE A 178 ? 0.8590 0.3437 0.6794 -0.0081 0.0896  -0.0646 475 ILE A N   
1266 C CA  . ILE A 178 ? 0.8022 0.3539 0.6187 -0.0082 0.0856  -0.0635 475 ILE A CA  
1267 C C   . ILE A 178 ? 0.8215 0.4032 0.6261 -0.0328 0.0792  -0.0454 475 ILE A C   
1268 O O   . ILE A 178 ? 0.8247 0.4468 0.6219 -0.0477 0.0776  -0.0542 475 ILE A O   
1269 C CB  . ILE A 178 ? 0.7822 0.3585 0.6118 0.0233  0.0809  -0.0485 475 ILE A CB  
1270 C CG1 . ILE A 178 ? 0.8333 0.3942 0.6803 0.0494  0.0876  -0.0685 475 ILE A CG1 
1271 C CG2 . ILE A 178 ? 0.6896 0.3258 0.5141 0.0199  0.0763  -0.0455 475 ILE A CG2 
1272 C CD1 . ILE A 178 ? 0.8135 0.4066 0.6765 0.0786  0.0822  -0.0559 475 ILE A CD1 
1273 N N   . HIS A 179 ? 0.8441 0.4087 0.6480 -0.0365 0.0756  -0.0192 476 HIS A N   
1274 C CA  . HIS A 179 ? 0.8222 0.4193 0.6190 -0.0584 0.0716  -0.0028 476 HIS A CA  
1275 C C   . HIS A 179 ? 0.8016 0.3982 0.5910 -0.0923 0.0737  -0.0180 476 HIS A C   
1276 O O   . HIS A 179 ? 0.7383 0.3824 0.5259 -0.1077 0.0699  -0.0149 476 HIS A O   
1277 C CB  . HIS A 179 ? 0.8881 0.4691 0.6835 -0.0578 0.0693  0.0281  476 HIS A CB  
1278 C CG  . HIS A 179 ? 0.9221 0.5274 0.7206 -0.0310 0.0645  0.0458  476 HIS A CG  
1279 N ND1 . HIS A 179 ? 0.9789 0.5532 0.7803 -0.0109 0.0619  0.0627  476 HIS A ND1 
1280 C CD2 . HIS A 179 ? 0.8928 0.5502 0.6917 -0.0218 0.0610  0.0483  476 HIS A CD2 
1281 C CE1 . HIS A 179 ? 0.9650 0.5773 0.7668 0.0073  0.0567  0.0741  476 HIS A CE1 
1282 N NE2 . HIS A 179 ? 0.9244 0.5841 0.7243 0.0005  0.0569  0.0638  476 HIS A NE2 
1283 N N   . ARG A 180 ? 0.8401 0.3845 0.6269 -0.1035 0.0794  -0.0354 477 ARG A N   
1284 C CA  . ARG A 180 ? 0.8903 0.4348 0.6680 -0.1388 0.0812  -0.0552 477 ARG A CA  
1285 C C   . ARG A 180 ? 0.8248 0.4137 0.5965 -0.1426 0.0804  -0.0795 477 ARG A C   
1286 O O   . ARG A 180 ? 0.8427 0.4651 0.6071 -0.1707 0.0766  -0.0863 477 ARG A O   
1287 C CB  . ARG A 180 ? 1.0231 0.4930 0.7980 -0.1514 0.0882  -0.0714 477 ARG A CB  
1288 C CG  . ARG A 180 ? 1.1181 0.5468 0.8934 -0.1667 0.0875  -0.0449 477 ARG A CG  
1289 C CD  . ARG A 180 ? 1.2545 0.6384 1.0376 -0.1800 0.0887  -0.0617 477 ARG A CD  
1290 N NE  . ARG A 180 ? 1.3599 0.7060 1.1576 -0.1467 0.0909  -0.0780 477 ARG A NE  
1291 C CZ  . ARG A 180 ? 1.4381 0.7454 1.2515 -0.1194 0.0876  -0.0573 477 ARG A CZ  
1292 N NH1 . ARG A 180 ? 1.4640 0.7650 1.2764 -0.1232 0.0826  -0.0187 477 ARG A NH1 
1293 N NH2 . ARG A 180 ? 1.4659 0.7469 1.2969 -0.0886 0.0884  -0.0745 477 ARG A NH2 
1294 N N   . VAL A 181 ? 0.7804 0.3738 0.5551 -0.1161 0.0833  -0.0908 478 VAL A N   
1295 C CA  . VAL A 181 ? 0.8057 0.4442 0.5719 -0.1207 0.0825  -0.1088 478 VAL A CA  
1296 C C   . VAL A 181 ? 0.7220 0.4183 0.4904 -0.1180 0.0723  -0.0857 478 VAL A C   
1297 O O   . VAL A 181 ? 0.7142 0.4521 0.4744 -0.1341 0.0668  -0.0895 478 VAL A O   
1298 C CB  . VAL A 181 ? 0.8352 0.4672 0.6050 -0.0960 0.0903  -0.1280 478 VAL A CB  
1299 C CG1 . VAL A 181 ? 0.8457 0.5274 0.6027 -0.1058 0.0899  -0.1428 478 VAL A CG1 
1300 C CG2 . VAL A 181 ? 0.8617 0.4343 0.6338 -0.0936 0.1015  -0.1542 478 VAL A CG2 
1301 N N   . LEU A 182 ? 0.6854 0.3835 0.4648 -0.0971 0.0695  -0.0618 479 LEU A N   
1302 C CA  . LEU A 182 ? 0.6154 0.3603 0.3994 -0.0915 0.0613  -0.0421 479 LEU A CA  
1303 C C   . LEU A 182 ? 0.6269 0.3994 0.4114 -0.1156 0.0561  -0.0332 479 LEU A C   
1304 O O   . LEU A 182 ? 0.6312 0.4484 0.4180 -0.1185 0.0487  -0.0276 479 LEU A O   
1305 C CB  . LEU A 182 ? 0.5456 0.2849 0.3385 -0.0668 0.0608  -0.0229 479 LEU A CB  
1306 C CG  . LEU A 182 ? 0.5504 0.2884 0.3470 -0.0418 0.0621  -0.0278 479 LEU A CG  
1307 C CD1 . LEU A 182 ? 0.4875 0.2212 0.2908 -0.0212 0.0602  -0.0096 479 LEU A CD1 
1308 C CD2 . LEU A 182 ? 0.4955 0.2720 0.2897 -0.0416 0.0577  -0.0316 479 LEU A CD2 
1309 N N   . ASP A 183 ? 0.6329 0.3793 0.4171 -0.1332 0.0595  -0.0308 480 ASP A N   
1310 C CA  . ASP A 183 ? 0.6403 0.4171 0.4269 -0.1614 0.0555  -0.0254 480 ASP A CA  
1311 C C   . ASP A 183 ? 0.7101 0.5121 0.4881 -0.1833 0.0508  -0.0445 480 ASP A C   
1312 O O   . ASP A 183 ? 0.7160 0.5713 0.4995 -0.1945 0.0421  -0.0374 480 ASP A O   
1313 C CB  . ASP A 183 ? 0.6145 0.3511 0.3997 -0.1822 0.0611  -0.0211 480 ASP A CB  
1314 C CG  . ASP A 183 ? 0.6739 0.4040 0.4654 -0.1686 0.0635  0.0050  480 ASP A CG  
1315 O OD1 . ASP A 183 ? 0.5940 0.3629 0.3926 -0.1478 0.0607  0.0176  480 ASP A OD1 
1316 O OD2 . ASP A 183 ? 0.6993 0.3845 0.4871 -0.1803 0.0683  0.0130  480 ASP A OD2 
1317 N N   . LYS A 184 ? 0.7476 0.5141 0.5124 -0.1884 0.0564  -0.0691 481 LYS A N   
1318 C CA  . LYS A 184 ? 0.7943 0.5835 0.5447 -0.2117 0.0534  -0.0911 481 LYS A CA  
1319 C C   . LYS A 184 ? 0.7169 0.5617 0.4658 -0.2016 0.0438  -0.0824 481 LYS A C   
1320 O O   . LYS A 184 ? 0.7255 0.6168 0.4698 -0.2218 0.0339  -0.0816 481 LYS A O   
1321 C CB  . LYS A 184 ? 0.9011 0.6417 0.6382 -0.2126 0.0644  -0.1224 481 LYS A CB  
1322 C CG  . LYS A 184 ? 1.0056 0.7691 0.7226 -0.2405 0.0633  -0.1501 481 LYS A CG  
1323 C CD  . LYS A 184 ? 1.0942 0.8716 0.8073 -0.2798 0.0574  -0.1539 481 LYS A CD  
1324 C CE  . LYS A 184 ? 1.1380 0.9556 0.8311 -0.3065 0.0531  -0.1766 481 LYS A CE  
1325 N NZ  . LYS A 184 ? 1.1922 0.9795 0.8807 -0.2954 0.0665  -0.2043 481 LYS A NZ  
1326 N N   . ILE A 185 ? 0.6065 0.4464 0.3598 -0.1714 0.0457  -0.0743 482 ILE A N   
1327 C CA  . ILE A 185 ? 0.5763 0.4581 0.3286 -0.1610 0.0370  -0.0629 482 ILE A CA  
1328 C C   . ILE A 185 ? 0.5971 0.5197 0.3656 -0.1574 0.0255  -0.0376 482 ILE A C   
1329 O O   . ILE A 185 ? 0.6137 0.5777 0.3813 -0.1609 0.0141  -0.0281 482 ILE A O   
1330 C CB  . ILE A 185 ? 0.5824 0.4466 0.3372 -0.1325 0.0424  -0.0609 482 ILE A CB  
1331 C CG1 . ILE A 185 ? 0.5869 0.4219 0.3302 -0.1335 0.0543  -0.0878 482 ILE A CG1 
1332 C CG2 . ILE A 185 ? 0.5656 0.4656 0.3195 -0.1246 0.0330  -0.0460 482 ILE A CG2 
1333 C CD1 . ILE A 185 ? 0.6279 0.4539 0.3771 -0.1076 0.0598  -0.0873 482 ILE A CD1 
1334 N N   . THR A 186 ? 0.5684 0.4813 0.3523 -0.1496 0.0286  -0.0262 483 THR A N   
1335 C CA  . THR A 186 ? 0.5963 0.5524 0.3989 -0.1469 0.0208  -0.0070 483 THR A CA  
1336 C C   . THR A 186 ? 0.6419 0.6406 0.4454 -0.1756 0.0117  -0.0087 483 THR A C   
1337 O O   . THR A 186 ? 0.6597 0.7073 0.4744 -0.1718 -0.0003 0.0044  483 THR A O   
1338 C CB  . THR A 186 ? 0.5751 0.5191 0.3903 -0.1404 0.0282  0.0029  483 THR A CB  
1339 O OG1 . THR A 186 ? 0.5765 0.4881 0.3900 -0.1145 0.0344  0.0056  483 THR A OG1 
1340 C CG2 . THR A 186 ? 0.5274 0.5247 0.3644 -0.1357 0.0225  0.0188  483 THR A CG2 
1341 N N   . ASP A 187 ? 0.6203 0.5997 0.4129 -0.2044 0.0167  -0.0248 484 ASP A N   
1342 C CA  . ASP A 187 ? 0.6293 0.6501 0.4204 -0.2377 0.0080  -0.0303 484 ASP A CA  
1343 C C   . ASP A 187 ? 0.6482 0.7054 0.4266 -0.2413 -0.0041 -0.0323 484 ASP A C   
1344 O O   . ASP A 187 ? 0.6523 0.7678 0.4376 -0.2554 -0.0181 -0.0235 484 ASP A O   
1345 C CB  . ASP A 187 ? 0.6928 0.6726 0.4684 -0.2698 0.0166  -0.0536 484 ASP A CB  
1346 C CG  . ASP A 187 ? 0.7667 0.7116 0.5530 -0.2734 0.0265  -0.0466 484 ASP A CG  
1347 O OD1 . ASP A 187 ? 0.7653 0.7387 0.5716 -0.2600 0.0254  -0.0245 484 ASP A OD1 
1348 O OD2 . ASP A 187 ? 0.8265 0.7148 0.6005 -0.2902 0.0356  -0.0632 484 ASP A OD2 
1349 N N   . THR A 188 ? 0.6248 0.6515 0.3849 -0.2290 0.0009  -0.0422 485 THR A N   
1350 C CA  . THR A 188 ? 0.6416 0.6991 0.3838 -0.2346 -0.0086 -0.0429 485 THR A CA  
1351 C C   . THR A 188 ? 0.6400 0.7372 0.3985 -0.2121 -0.0229 -0.0125 485 THR A C   
1352 O O   . THR A 188 ? 0.6457 0.7922 0.4006 -0.2228 -0.0386 -0.0010 485 THR A O   
1353 C CB  . THR A 188 ? 0.6328 0.6507 0.3533 -0.2275 0.0033  -0.0617 485 THR A CB  
1354 O OG1 . THR A 188 ? 0.5821 0.5547 0.2935 -0.2414 0.0176  -0.0906 485 THR A OG1 
1355 C CG2 . THR A 188 ? 0.6386 0.6931 0.3345 -0.2422 -0.0049 -0.0644 485 THR A CG2 
1356 N N   . LEU A 189 ? 0.6237 0.6983 0.3999 -0.1809 -0.0181 0.0004  486 LEU A N   
1357 C CA  . LEU A 189 ? 0.6109 0.7116 0.4061 -0.1561 -0.0296 0.0262  486 LEU A CA  
1358 C C   . LEU A 189 ? 0.6265 0.7833 0.4459 -0.1603 -0.0426 0.0411  486 LEU A C   
1359 O O   . LEU A 189 ? 0.6623 0.8590 0.4883 -0.1554 -0.0591 0.0596  486 LEU A O   
1360 C CB  . LEU A 189 ? 0.5780 0.6437 0.3877 -0.1258 -0.0199 0.0307  486 LEU A CB  
1361 C CG  . LEU A 189 ? 0.5736 0.6020 0.3694 -0.1114 -0.0141 0.0274  486 LEU A CG  
1362 C CD1 . LEU A 189 ? 0.6046 0.6041 0.4144 -0.0865 -0.0050 0.0287  486 LEU A CD1 
1363 C CD2 . LEU A 189 ? 0.5308 0.5778 0.3223 -0.1061 -0.0274 0.0449  486 LEU A CD2 
1364 N N   . ILE A 190 ? 0.5605 0.7226 0.3944 -0.1695 -0.0354 0.0348  487 ILE A N   
1365 C CA  . ILE A 190 ? 0.5531 0.7769 0.4134 -0.1773 -0.0454 0.0459  487 ILE A CA  
1366 C C   . ILE A 190 ? 0.5615 0.8331 0.4106 -0.2070 -0.0611 0.0452  487 ILE A C   
1367 O O   . ILE A 190 ? 0.5139 0.8469 0.3841 -0.2028 -0.0779 0.0634  487 ILE A O   
1368 C CB  . ILE A 190 ? 0.5708 0.7900 0.4425 -0.1916 -0.0326 0.0374  487 ILE A CB  
1369 C CG1 . ILE A 190 ? 0.5435 0.7311 0.4271 -0.1620 -0.0195 0.0422  487 ILE A CG1 
1370 C CG2 . ILE A 190 ? 0.5703 0.8633 0.4694 -0.2068 -0.0422 0.0462  487 ILE A CG2 
1371 C CD1 . ILE A 190 ? 0.5376 0.7627 0.4512 -0.1291 -0.0258 0.0591  487 ILE A CD1 
1372 N N   . HIS A 191 ? 0.6185 0.8638 0.4348 -0.2359 -0.0559 0.0232  488 HIS A N   
1373 C CA  . HIS A 191 ? 0.6862 0.9754 0.4839 -0.2684 -0.0697 0.0174  488 HIS A CA  
1374 C C   . HIS A 191 ? 0.6665 0.9879 0.4574 -0.2549 -0.0873 0.0393  488 HIS A C   
1375 O O   . HIS A 191 ? 0.6351 1.0197 0.4269 -0.2703 -0.1067 0.0513  488 HIS A O   
1376 C CB  . HIS A 191 ? 0.7478 0.9933 0.5092 -0.2982 -0.0571 -0.0160 488 HIS A CB  
1377 C CG  . HIS A 191 ? 0.8029 1.0917 0.5375 -0.3332 -0.0695 -0.0271 488 HIS A CG  
1378 N ND1 . HIS A 191 ? 0.8046 1.0941 0.5196 -0.3267 -0.0703 -0.0240 488 HIS A ND1 
1379 C CD2 . HIS A 191 ? 0.8457 1.1689 0.5839 -0.3635 -0.0719 -0.0361 488 HIS A CD2 
1380 C CE1 . HIS A 191 ? 0.8399 1.1638 0.5472 -0.3510 -0.0729 -0.0308 488 HIS A CE1 
1381 N NE2 . HIS A 191 ? 0.8824 1.2261 0.6019 -0.3729 -0.0739 -0.0387 488 HIS A NE2 
1382 N N   . LEU A 192 ? 0.6542 0.9333 0.4379 -0.2276 -0.0816 0.0465  489 LEU A N   
1383 C CA  . LEU A 192 ? 0.6623 0.9607 0.4380 -0.2151 -0.0972 0.0709  489 LEU A CA  
1384 C C   . LEU A 192 ? 0.6635 1.0040 0.4776 -0.1884 -0.1147 0.1031  489 LEU A C   
1385 O O   . LEU A 192 ? 0.7007 1.0871 0.5147 -0.1896 -0.1360 0.1268  489 LEU A O   
1386 C CB  . LEU A 192 ? 0.6321 0.8724 0.3927 -0.1958 -0.0851 0.0692  489 LEU A CB  
1387 C CG  . LEU A 192 ? 0.6257 0.8337 0.3487 -0.2174 -0.0700 0.0405  489 LEU A CG  
1388 C CD1 . LEU A 192 ? 0.5121 0.6687 0.2314 -0.1948 -0.0567 0.0392  489 LEU A CD1 
1389 C CD2 . LEU A 192 ? 0.5588 0.8031 0.2602 -0.2414 -0.0786 0.0412  489 LEU A CD2 
1390 N N   . MET A 193 ? 0.6353 0.9620 0.4827 -0.1636 -0.1054 0.1037  490 MET A N   
1391 C CA  . MET A 193 ? 0.6084 0.9724 0.4977 -0.1330 -0.1178 0.1285  490 MET A CA  
1392 C C   . MET A 193 ? 0.5923 1.0365 0.5045 -0.1492 -0.1331 0.1358  490 MET A C   
1393 O O   . MET A 193 ? 0.6219 1.1156 0.5609 -0.1308 -0.1529 0.1618  490 MET A O   
1394 C CB  . MET A 193 ? 0.5951 0.9268 0.5100 -0.1053 -0.1005 0.1213  490 MET A CB  
1395 C CG  . MET A 193 ? 0.6029 0.8628 0.4996 -0.0883 -0.0873 0.1149  490 MET A CG  
1396 S SD  . MET A 193 ? 0.5419 0.7701 0.4606 -0.0636 -0.0667 0.1025  490 MET A SD  
1397 C CE  . MET A 193 ? 0.7713 0.9249 0.6613 -0.0540 -0.0560 0.0945  490 MET A CE  
1398 N N   . ALA A 194 ? 0.5368 0.9935 0.4403 -0.1837 -0.1245 0.1133  491 ALA A N   
1399 C CA  . ALA A 194 ? 0.5389 1.0752 0.4623 -0.2069 -0.1381 0.1166  491 ALA A CA  
1400 C C   . ALA A 194 ? 0.5983 1.1762 0.5029 -0.2247 -0.1589 0.1286  491 ALA A C   
1401 O O   . ALA A 194 ? 0.6080 1.2469 0.5410 -0.2206 -0.1717 0.1451  491 ALA A O   
1402 C CB  . ALA A 194 ? 0.5064 1.0333 0.4200 -0.2448 -0.1223 0.0883  491 ALA A CB  
1403 N N   . LYS A 195 ? 0.6400 1.1710 0.5012 -0.2386 -0.1527 0.1177  492 LYS A N   
1404 C CA  . LYS A 195 ? 0.6991 1.2511 0.5432 -0.2516 -0.1613 0.1260  492 LYS A CA  
1405 C C   . LYS A 195 ? 0.6891 1.2568 0.5539 -0.2165 -0.1788 0.1634  492 LYS A C   
1406 O O   . LYS A 195 ? 0.7215 1.3338 0.5922 -0.2206 -0.1930 0.1807  492 LYS A O   
1407 C CB  . LYS A 195 ? 0.7500 1.2506 0.5477 -0.2724 -0.1470 0.1032  492 LYS A CB  
1408 C CG  . LYS A 195 ? 0.8360 1.3613 0.6146 -0.2868 -0.1545 0.1118  492 LYS A CG  
1409 C CD  . LYS A 195 ? 0.8813 1.3617 0.6201 -0.3039 -0.1378 0.0877  492 LYS A CD  
1410 C CE  . LYS A 195 ? 0.9162 1.3831 0.6363 -0.3368 -0.1206 0.0475  492 LYS A CE  
1411 N NZ  . LYS A 195 ? 0.9515 1.3881 0.6379 -0.3522 -0.1050 0.0236  492 LYS A NZ  
1412 N N   . ALA A 196 ? 0.6465 1.1742 0.5219 -0.1819 -0.1776 0.1758  493 ALA A N   
1413 C CA  . ALA A 196 ? 0.6089 1.1343 0.5049 -0.1458 -0.1923 0.2095  493 ALA A CA  
1414 C C   . ALA A 196 ? 0.6015 1.1832 0.5501 -0.1195 -0.2062 0.2290  493 ALA A C   
1415 O O   . ALA A 196 ? 0.6085 1.1883 0.5800 -0.0865 -0.2192 0.2561  493 ALA A O   
1416 C CB  . ALA A 196 ? 0.5468 1.0050 0.4366 -0.1189 -0.1842 0.2134  493 ALA A CB  
1417 N N   . GLY A 197 ? 0.5977 1.2274 0.5668 -0.1341 -0.2023 0.2139  494 GLY A N   
1418 C CA  . GLY A 197 ? 0.6046 1.2989 0.6254 -0.1133 -0.2129 0.2282  494 GLY A CA  
1419 C C   . GLY A 197 ? 0.5624 1.2578 0.6268 -0.0770 -0.2056 0.2278  494 GLY A C   
1420 O O   . GLY A 197 ? 0.5126 1.2640 0.6245 -0.0576 -0.2099 0.2347  494 GLY A O   
1421 N N   . LEU A 198 ? 0.5475 1.1840 0.5963 -0.0673 -0.1932 0.2185  495 LEU A N   
1422 C CA  . LEU A 198 ? 0.5639 1.1866 0.6493 -0.0331 -0.1778 0.2111  495 LEU A CA  
1423 C C   . LEU A 198 ? 0.5462 1.2204 0.6554 -0.0518 -0.1647 0.1916  495 LEU A C   
1424 O O   . LEU A 198 ? 0.5462 1.2220 0.6272 -0.0956 -0.1575 0.1735  495 LEU A O   
1425 C CB  . LEU A 198 ? 0.5911 1.1173 0.6448 -0.0267 -0.1559 0.1941  495 LEU A CB  
1426 C CG  . LEU A 198 ? 0.6601 1.1277 0.6845 -0.0162 -0.1643 0.2097  495 LEU A CG  
1427 C CD1 . LEU A 198 ? 0.6825 1.0673 0.6825 -0.0117 -0.1411 0.1893  495 LEU A CD1 
1428 C CD2 . LEU A 198 ? 0.6790 1.1584 0.7387 0.0256  -0.1834 0.2405  495 LEU A CD2 
1429 N N   . THR A 199 ? 0.5389 1.2546 0.7002 -0.0195 -0.1606 0.1944  496 THR A N   
1430 C CA  . THR A 199 ? 0.5408 1.3122 0.7277 -0.0373 -0.1466 0.1783  496 THR A CA  
1431 C C   . THR A 199 ? 0.5614 1.2655 0.7191 -0.0528 -0.1177 0.1529  496 THR A C   
1432 O O   . THR A 199 ? 0.5850 1.2060 0.7104 -0.0427 -0.1088 0.1473  496 THR A O   
1433 C CB  . THR A 199 ? 0.5308 1.3698 0.7831 0.0041  -0.1468 0.1857  496 THR A CB  
1434 O OG1 . THR A 199 ? 0.5862 1.4993 0.8633 -0.0224 -0.1367 0.1739  496 THR A OG1 
1435 C CG2 . THR A 199 ? 0.4499 1.2273 0.7102 0.0457  -0.1273 0.1758  496 THR A CG2 
1436 N N   . LEU A 200 ? 0.5559 1.2994 0.7258 -0.0783 -0.1039 0.1399  497 LEU A N   
1437 C CA  . LEU A 200 ? 0.5535 1.2385 0.6956 -0.0970 -0.0786 0.1204  497 LEU A CA  
1438 C C   . LEU A 200 ? 0.5141 1.1512 0.6617 -0.0559 -0.0623 0.1158  497 LEU A C   
1439 O O   . LEU A 200 ? 0.5144 1.0757 0.6266 -0.0600 -0.0485 0.1052  497 LEU A O   
1440 C CB  . LEU A 200 ? 0.5769 1.3210 0.7363 -0.1316 -0.0682 0.1127  497 LEU A CB  
1441 C CG  . LEU A 200 ? 0.6181 1.3022 0.7407 -0.1670 -0.0477 0.0973  497 LEU A CG  
1442 C CD1 . LEU A 200 ? 0.6285 1.2448 0.7018 -0.1951 -0.0535 0.0893  497 LEU A CD1 
1443 C CD2 . LEU A 200 ? 0.6571 1.4070 0.8002 -0.2046 -0.0401 0.0944  497 LEU A CD2 
1444 N N   . GLN A 201 ? 0.5112 1.1947 0.7046 -0.0156 -0.0645 0.1225  498 GLN A N   
1445 C CA  . GLN A 201 ? 0.4834 1.1261 0.6837 0.0237  -0.0494 0.1142  498 GLN A CA  
1446 C C   . GLN A 201 ? 0.4895 1.0497 0.6612 0.0434  -0.0573 0.1188  498 GLN A C   
1447 O O   . GLN A 201 ? 0.4965 0.9915 0.6446 0.0524  -0.0431 0.1071  498 GLN A O   
1448 C CB  . GLN A 201 ? 0.4492 1.1626 0.7088 0.0640  -0.0494 0.1165  498 GLN A CB  
1449 C CG  . GLN A 201 ? 0.4721 1.1502 0.7390 0.1008  -0.0302 0.1010  498 GLN A CG  
1450 C CD  . GLN A 201 ? 0.5068 1.2481 0.8345 0.1470  -0.0305 0.0999  498 GLN A CD  
1451 O OE1 . GLN A 201 ? 0.5734 1.3648 0.9374 0.1632  -0.0512 0.1170  498 GLN A OE1 
1452 N NE2 . GLN A 201 ? 0.4665 1.2083 0.8062 0.1696  -0.0078 0.0793  498 GLN A NE2 
1453 N N   . GLN A 202 ? 0.4560 1.0238 0.6292 0.0475  -0.0808 0.1373  499 GLN A N   
1454 C CA  . GLN A 202 ? 0.4825 0.9782 0.6275 0.0602  -0.0899 0.1456  499 GLN A CA  
1455 C C   . GLN A 202 ? 0.4866 0.9180 0.5770 0.0266  -0.0812 0.1344  499 GLN A C   
1456 O O   . GLN A 202 ? 0.5091 0.8733 0.5746 0.0363  -0.0781 0.1325  499 GLN A O   
1457 C CB  . GLN A 202 ? 0.4828 1.0099 0.6392 0.0670  -0.1182 0.1725  499 GLN A CB  
1458 C CG  . GLN A 202 ? 0.4941 1.0579 0.7048 0.1146  -0.1286 0.1868  499 GLN A CG  
1459 C CD  . GLN A 202 ? 0.5329 1.1504 0.7621 0.1186  -0.1590 0.2175  499 GLN A CD  
1460 O OE1 . GLN A 202 ? 0.5583 1.2132 0.7667 0.0807  -0.1710 0.2241  499 GLN A OE1 
1461 N NE2 . GLN A 202 ? 0.4734 1.0937 0.7411 0.1645  -0.1724 0.2360  499 GLN A NE2 
1462 N N   . GLN A 203 ? 0.4987 0.9519 0.5731 -0.0130 -0.0771 0.1260  500 GLN A N   
1463 C CA  . GLN A 203 ? 0.4873 0.8822 0.5147 -0.0435 -0.0679 0.1127  500 GLN A CA  
1464 C C   . GLN A 203 ? 0.4685 0.8072 0.4830 -0.0340 -0.0464 0.0978  500 GLN A C   
1465 O O   . GLN A 203 ? 0.4301 0.7066 0.4154 -0.0316 -0.0422 0.0927  500 GLN A O   
1466 C CB  . GLN A 203 ? 0.4909 0.9186 0.5077 -0.0877 -0.0681 0.1050  500 GLN A CB  
1467 C CG  . GLN A 203 ? 0.5191 0.9933 0.5327 -0.1068 -0.0904 0.1160  500 GLN A CG  
1468 C CD  . GLN A 203 ? 0.5200 1.0296 0.5252 -0.1534 -0.0903 0.1045  500 GLN A CD  
1469 O OE1 . GLN A 203 ? 0.5170 0.9844 0.4997 -0.1777 -0.0741 0.0864  500 GLN A OE1 
1470 N NE2 . GLN A 203 ? 0.5102 1.0970 0.5343 -0.1664 -0.1096 0.1156  500 GLN A NE2 
1471 N N   . HIS A 204 ? 0.4661 0.8322 0.5020 -0.0298 -0.0328 0.0915  501 HIS A N   
1472 C CA  . HIS A 204 ? 0.4791 0.7992 0.5000 -0.0231 -0.0137 0.0796  501 HIS A CA  
1473 C C   . HIS A 204 ? 0.4128 0.7020 0.4403 0.0157  -0.0120 0.0782  501 HIS A C   
1474 O O   . HIS A 204 ? 0.3730 0.6077 0.3765 0.0199  -0.0029 0.0698  501 HIS A O   
1475 C CB  . HIS A 204 ? 0.5352 0.8936 0.5696 -0.0365 0.0015  0.0746  501 HIS A CB  
1476 C CG  . HIS A 204 ? 0.6413 1.0691 0.7198 -0.0131 0.0036  0.0766  501 HIS A CG  
1477 N ND1 . HIS A 204 ? 0.6796 1.1839 0.7864 -0.0306 0.0026  0.0807  501 HIS A ND1 
1478 C CD2 . HIS A 204 ? 0.6684 1.1027 0.7695 0.0260  0.0082  0.0724  501 HIS A CD2 
1479 C CE1 . HIS A 204 ? 0.6775 1.2371 0.8249 -0.0005 0.0067  0.0795  501 HIS A CE1 
1480 N NE2 . HIS A 204 ? 0.6758 1.1911 0.8200 0.0350  0.0105  0.0733  501 HIS A NE2 
1481 N N   . GLN A 205 ? 0.3832 0.7064 0.4443 0.0436  -0.0219 0.0863  502 GLN A N   
1482 C CA  . GLN A 205 ? 0.3891 0.6778 0.4586 0.0798  -0.0216 0.0838  502 GLN A CA  
1483 C C   . GLN A 205 ? 0.4291 0.6529 0.4672 0.0771  -0.0303 0.0891  502 GLN A C   
1484 O O   . GLN A 205 ? 0.4530 0.6259 0.4751 0.0870  -0.0222 0.0793  502 GLN A O   
1485 C CB  . GLN A 205 ? 0.3990 0.7345 0.5150 0.1122  -0.0319 0.0928  502 GLN A CB  
1486 C CG  . GLN A 205 ? 0.4350 0.8321 0.5870 0.1255  -0.0178 0.0814  502 GLN A CG  
1487 C CD  . GLN A 205 ? 0.4853 0.9287 0.6891 0.1641  -0.0273 0.0880  502 GLN A CD  
1488 O OE1 . GLN A 205 ? 0.5713 0.9997 0.7839 0.1798  -0.0472 0.1057  502 GLN A OE1 
1489 N NE2 . GLN A 205 ? 0.4623 0.9641 0.7017 0.1804  -0.0129 0.0748  502 GLN A NE2 
1490 N N   . ARG A 206 ? 0.4368 0.6682 0.4652 0.0611  -0.0466 0.1041  503 ARG A N   
1491 C CA  . ARG A 206 ? 0.4472 0.6272 0.4444 0.0536  -0.0542 0.1104  503 ARG A CA  
1492 C C   . ARG A 206 ? 0.4442 0.5812 0.4056 0.0320  -0.0401 0.0944  503 ARG A C   
1493 O O   . ARG A 206 ? 0.4660 0.5544 0.4090 0.0369  -0.0370 0.0908  503 ARG A O   
1494 C CB  . ARG A 206 ? 0.4631 0.6717 0.4538 0.0363  -0.0736 0.1290  503 ARG A CB  
1495 C CG  . ARG A 206 ? 0.4702 0.6351 0.4278 0.0265  -0.0811 0.1377  503 ARG A CG  
1496 C CD  . ARG A 206 ? 0.4629 0.6651 0.4148 0.0121  -0.1022 0.1596  503 ARG A CD  
1497 N NE  . ARG A 206 ? 0.4568 0.6237 0.3748 -0.0001 -0.1084 0.1697  503 ARG A NE  
1498 C CZ  . ARG A 206 ? 0.5469 0.6831 0.4674 0.0185  -0.1181 0.1894  503 ARG A CZ  
1499 N NH1 . ARG A 206 ? 0.5167 0.6481 0.4737 0.0534  -0.1228 0.1986  503 ARG A NH1 
1500 N NH2 . ARG A 206 ? 0.5610 0.6707 0.4480 0.0013  -0.1222 0.1992  503 ARG A NH2 
1501 N N   . LEU A 207 ? 0.4401 0.5958 0.3939 0.0080  -0.0321 0.0857  504 LEU A N   
1502 C CA  . LEU A 207 ? 0.4580 0.5738 0.3833 -0.0090 -0.0190 0.0717  504 LEU A CA  
1503 C C   . LEU A 207 ? 0.4870 0.5695 0.4111 0.0111  -0.0070 0.0629  504 LEU A C   
1504 O O   . LEU A 207 ? 0.4858 0.5258 0.3887 0.0103  -0.0031 0.0569  504 LEU A O   
1505 C CB  . LEU A 207 ? 0.4871 0.6257 0.4114 -0.0341 -0.0118 0.0656  504 LEU A CB  
1506 C CG  . LEU A 207 ? 0.4824 0.5769 0.3825 -0.0475 0.0019  0.0537  504 LEU A CG  
1507 C CD1 . LEU A 207 ? 0.4655 0.5242 0.3385 -0.0610 -0.0006 0.0472  504 LEU A CD1 
1508 C CD2 . LEU A 207 ? 0.4738 0.5871 0.3773 -0.0705 0.0094  0.0514  504 LEU A CD2 
1509 N N   . ALA A 208 ? 0.4602 0.5688 0.4080 0.0284  -0.0012 0.0609  505 ALA A N   
1510 C CA  . ALA A 208 ? 0.4516 0.5381 0.3980 0.0467  0.0101  0.0503  505 ALA A CA  
1511 C C   . ALA A 208 ? 0.4621 0.5107 0.4056 0.0654  0.0042  0.0495  505 ALA A C   
1512 O O   . ALA A 208 ? 0.3579 0.3702 0.2834 0.0667  0.0100  0.0407  505 ALA A O   
1513 C CB  . ALA A 208 ? 0.4107 0.5421 0.3842 0.0612  0.0183  0.0459  505 ALA A CB  
1514 N N   . GLN A 209 ? 0.4649 0.5231 0.4271 0.0789  -0.0084 0.0604  506 GLN A N   
1515 C CA  . GLN A 209 ? 0.4708 0.4883 0.4313 0.0942  -0.0154 0.0633  506 GLN A CA  
1516 C C   . GLN A 209 ? 0.4643 0.4425 0.3925 0.0748  -0.0171 0.0646  506 GLN A C   
1517 O O   . GLN A 209 ? 0.4885 0.4292 0.4064 0.0795  -0.0137 0.0570  506 GLN A O   
1518 C CB  . GLN A 209 ? 0.4807 0.5141 0.4652 0.1090  -0.0317 0.0818  506 GLN A CB  
1519 C CG  . GLN A 209 ? 0.4686 0.5386 0.4928 0.1372  -0.0299 0.0784  506 GLN A CG  
1520 C CD  . GLN A 209 ? 0.5343 0.6376 0.5858 0.1489  -0.0483 0.1010  506 GLN A CD  
1521 O OE1 . GLN A 209 ? 0.5850 0.6827 0.6216 0.1338  -0.0633 0.1206  506 GLN A OE1 
1522 N NE2 . GLN A 209 ? 0.5291 0.6730 0.6216 0.1763  -0.0474 0.0984  506 GLN A NE2 
1523 N N   . LEU A 210 ? 0.4424 0.4333 0.3557 0.0517  -0.0214 0.0716  507 LEU A N   
1524 C CA  . LEU A 210 ? 0.4763 0.4390 0.3612 0.0334  -0.0211 0.0704  507 LEU A CA  
1525 C C   . LEU A 210 ? 0.4859 0.4267 0.3568 0.0297  -0.0073 0.0536  507 LEU A C   
1526 O O   . LEU A 210 ? 0.4893 0.4022 0.3472 0.0280  -0.0054 0.0493  507 LEU A O   
1527 C CB  . LEU A 210 ? 0.5014 0.4868 0.3732 0.0094  -0.0268 0.0764  507 LEU A CB  
1528 C CG  . LEU A 210 ? 0.5470 0.5565 0.4246 0.0078  -0.0441 0.0971  507 LEU A CG  
1529 C CD1 . LEU A 210 ? 0.5517 0.5900 0.4127 -0.0199 -0.0482 0.0973  507 LEU A CD1 
1530 C CD2 . LEU A 210 ? 0.5679 0.5466 0.4354 0.0117  -0.0517 0.1099  507 LEU A CD2 
1531 N N   . LEU A 211 ? 0.4572 0.4134 0.3315 0.0273  0.0015  0.0463  508 LEU A N   
1532 C CA  . LEU A 211 ? 0.4451 0.3826 0.3062 0.0244  0.0122  0.0352  508 LEU A CA  
1533 C C   . LEU A 211 ? 0.4170 0.3403 0.2808 0.0416  0.0163  0.0277  508 LEU A C   
1534 O O   . LEU A 211 ? 0.3974 0.3019 0.2487 0.0403  0.0205  0.0208  508 LEU A O   
1535 C CB  . LEU A 211 ? 0.4619 0.4160 0.3239 0.0148  0.0194  0.0339  508 LEU A CB  
1536 C CG  . LEU A 211 ? 0.4751 0.4381 0.3313 -0.0073 0.0169  0.0360  508 LEU A CG  
1537 C CD1 . LEU A 211 ? 0.4626 0.4340 0.3196 -0.0189 0.0247  0.0353  508 LEU A CD1 
1538 C CD2 . LEU A 211 ? 0.4520 0.3886 0.2889 -0.0180 0.0169  0.0297  508 LEU A CD2 
1539 N N   . LEU A 212 ? 0.3924 0.3273 0.2738 0.0580  0.0150  0.0274  509 LEU A N   
1540 C CA  . LEU A 212 ? 0.4322 0.3525 0.3152 0.0732  0.0191  0.0157  509 LEU A CA  
1541 C C   . LEU A 212 ? 0.4848 0.3699 0.3587 0.0716  0.0132  0.0146  509 LEU A C   
1542 O O   . LEU A 212 ? 0.4587 0.3277 0.3252 0.0745  0.0168  0.0028  509 LEU A O   
1543 C CB  . LEU A 212 ? 0.4315 0.3708 0.3381 0.0934  0.0204  0.0116  509 LEU A CB  
1544 C CG  . LEU A 212 ? 0.4533 0.4335 0.3682 0.0947  0.0306  0.0076  509 LEU A CG  
1545 C CD1 . LEU A 212 ? 0.4837 0.4859 0.4240 0.1183  0.0349  -0.0024 509 LEU A CD1 
1546 C CD2 . LEU A 212 ? 0.3627 0.3395 0.2556 0.0855  0.0401  0.0005  509 LEU A CD2 
1547 N N   . ILE A 213 ? 0.5101 0.3874 0.3833 0.0640  0.0038  0.0278  510 ILE A N   
1548 C CA  . ILE A 213 ? 0.5254 0.3726 0.3886 0.0571  -0.0015 0.0307  510 ILE A CA  
1549 C C   . ILE A 213 ? 0.5214 0.3641 0.3664 0.0424  0.0043  0.0231  510 ILE A C   
1550 O O   . ILE A 213 ? 0.5146 0.3386 0.3531 0.0375  0.0040  0.0183  510 ILE A O   
1551 C CB  . ILE A 213 ? 0.5966 0.4430 0.4601 0.0500  -0.0133 0.0508  510 ILE A CB  
1552 C CG1 . ILE A 213 ? 0.6052 0.4548 0.4923 0.0702  -0.0212 0.0601  510 ILE A CG1 
1553 C CG2 . ILE A 213 ? 0.6419 0.4606 0.4912 0.0368  -0.0175 0.0567  510 ILE A CG2 
1554 C CD1 . ILE A 213 ? 0.6179 0.4771 0.5070 0.0651  -0.0355 0.0844  510 ILE A CD1 
1555 N N   . LEU A 214 ? 0.4863 0.3466 0.3257 0.0356  0.0096  0.0215  511 LEU A N   
1556 C CA  . LEU A 214 ? 0.4768 0.3348 0.3047 0.0274  0.0154  0.0139  511 LEU A CA  
1557 C C   . LEU A 214 ? 0.4732 0.3271 0.3005 0.0358  0.0193  0.0032  511 LEU A C   
1558 O O   . LEU A 214 ? 0.4824 0.3347 0.3041 0.0313  0.0209  -0.0022 511 LEU A O   
1559 C CB  . LEU A 214 ? 0.4433 0.3126 0.2678 0.0213  0.0202  0.0139  511 LEU A CB  
1560 C CG  . LEU A 214 ? 0.5235 0.4018 0.3445 0.0081  0.0168  0.0200  511 LEU A CG  
1561 C CD1 . LEU A 214 ? 0.5241 0.4030 0.3392 -0.0006 0.0234  0.0139  511 LEU A CD1 
1562 C CD2 . LEU A 214 ? 0.4269 0.3014 0.2390 -0.0023 0.0122  0.0237  511 LEU A CD2 
1563 N N   . SER A 215 ? 0.4001 0.2585 0.2339 0.0477  0.0209  -0.0007 512 SER A N   
1564 C CA  . SER A 215 ? 0.4927 0.3521 0.3223 0.0538  0.0240  -0.0124 512 SER A CA  
1565 C C   . SER A 215 ? 0.4849 0.3251 0.3134 0.0508  0.0198  -0.0203 512 SER A C   
1566 O O   . SER A 215 ? 0.4990 0.3417 0.3209 0.0471  0.0201  -0.0293 512 SER A O   
1567 C CB  . SER A 215 ? 0.5243 0.3983 0.3589 0.0656  0.0288  -0.0178 512 SER A CB  
1568 O OG  . SER A 215 ? 0.6271 0.5029 0.4546 0.0698  0.0311  -0.0321 512 SER A OG  
1569 N N   . HIS A 216 ? 0.4770 0.2985 0.3126 0.0513  0.0148  -0.0152 513 HIS A N   
1570 C CA  A HIS A 216 ? 0.5128 0.3076 0.3472 0.0451  0.0102  -0.0197 513 HIS A CA  
1571 C CA  B HIS A 216 ? 0.5124 0.3071 0.3469 0.0451  0.0102  -0.0197 513 HIS A CA  
1572 C C   . HIS A 216 ? 0.5065 0.3020 0.3324 0.0263  0.0084  -0.0140 513 HIS A C   
1573 O O   . HIS A 216 ? 0.5634 0.3512 0.3854 0.0159  0.0075  -0.0221 513 HIS A O   
1574 C CB  A HIS A 216 ? 0.5304 0.3007 0.3760 0.0528  0.0041  -0.0111 513 HIS A CB  
1575 C CB  B HIS A 216 ? 0.5310 0.3011 0.3767 0.0528  0.0040  -0.0109 513 HIS A CB  
1576 C CG  A HIS A 216 ? 0.5565 0.3321 0.4161 0.0742  0.0073  -0.0195 513 HIS A CG  
1577 C CG  B HIS A 216 ? 0.5669 0.2990 0.4116 0.0453  -0.0010 -0.0136 513 HIS A CG  
1578 N ND1 A HIS A 216 ? 0.6358 0.3959 0.4988 0.0842  0.0109  -0.0400 513 HIS A ND1 
1579 N ND1 B HIS A 216 ? 0.5818 0.2908 0.4254 0.0347  -0.0092 0.0056  513 HIS A ND1 
1580 C CD2 A HIS A 216 ? 0.5501 0.3501 0.4220 0.0865  0.0088  -0.0128 513 HIS A CD2 
1581 C CD2 B HIS A 216 ? 0.6024 0.3143 0.4450 0.0439  0.0007  -0.0329 513 HIS A CD2 
1582 C CE1 A HIS A 216 ? 0.6140 0.3899 0.4915 0.1039  0.0157  -0.0461 513 HIS A CE1 
1583 C CE1 B HIS A 216 ? 0.6038 0.2756 0.4460 0.0267  -0.0121 0.0000  513 HIS A CE1 
1584 N NE2 A HIS A 216 ? 0.5843 0.3864 0.4686 0.1053  0.0141  -0.0285 513 HIS A NE2 
1585 N NE2 B HIS A 216 ? 0.6279 0.3003 0.4700 0.0318  -0.0061 -0.0253 513 HIS A NE2 
1586 N N   . ILE A 217 ? 0.4766 0.2852 0.2999 0.0203  0.0088  -0.0022 514 ILE A N   
1587 C CA  . ILE A 217 ? 0.5270 0.3446 0.3430 0.0037  0.0101  0.0002  514 ILE A CA  
1588 C C   . ILE A 217 ? 0.5129 0.3492 0.3290 0.0047  0.0150  -0.0125 514 ILE A C   
1589 O O   . ILE A 217 ? 0.5336 0.3772 0.3491 -0.0070 0.0152  -0.0170 514 ILE A O   
1590 C CB  . ILE A 217 ? 0.5447 0.3755 0.3561 -0.0021 0.0111  0.0099  514 ILE A CB  
1591 C CG1 . ILE A 217 ? 0.6017 0.4203 0.4119 -0.0061 0.0030  0.0265  514 ILE A CG1 
1592 C CG2 . ILE A 217 ? 0.5055 0.3530 0.3106 -0.0162 0.0164  0.0059  514 ILE A CG2 
1593 C CD1 . ILE A 217 ? 0.6071 0.4437 0.4105 -0.0138 0.0022  0.0351  514 ILE A CD1 
1594 N N   . ARG A 218 ? 0.5028 0.3498 0.3206 0.0180  0.0180  -0.0163 515 ARG A N   
1595 C CA  . ARG A 218 ? 0.5056 0.3710 0.3240 0.0224  0.0199  -0.0239 515 ARG A CA  
1596 C C   . ARG A 218 ? 0.4972 0.3631 0.3146 0.0181  0.0164  -0.0347 515 ARG A C   
1597 O O   . ARG A 218 ? 0.5176 0.4021 0.3375 0.0117  0.0152  -0.0400 515 ARG A O   
1598 C CB  . ARG A 218 ? 0.5368 0.4088 0.3537 0.0355  0.0224  -0.0215 515 ARG A CB  
1599 C CG  . ARG A 218 ? 0.5415 0.4325 0.3576 0.0415  0.0219  -0.0238 515 ARG A CG  
1600 C CD  . ARG A 218 ? 0.5736 0.4712 0.3959 0.0433  0.0243  -0.0197 515 ARG A CD  
1601 N NE  . ARG A 218 ? 0.5861 0.4735 0.4068 0.0492  0.0279  -0.0111 515 ARG A NE  
1602 C CZ  . ARG A 218 ? 0.5729 0.4609 0.3972 0.0576  0.0290  -0.0060 515 ARG A CZ  
1603 N NH1 . ARG A 218 ? 0.4849 0.3895 0.3175 0.0647  0.0264  -0.0081 515 ARG A NH1 
1604 N NH2 . ARG A 218 ? 0.6516 0.5237 0.4730 0.0588  0.0323  0.0019  515 ARG A NH2 
1605 N N   . HIS A 219 ? 0.4214 0.2693 0.2369 0.0218  0.0148  -0.0400 516 HIS A N   
1606 C CA  . HIS A 219 ? 0.4740 0.3159 0.2867 0.0160  0.0119  -0.0549 516 HIS A CA  
1607 C C   . HIS A 219 ? 0.4891 0.3212 0.3034 -0.0040 0.0086  -0.0551 516 HIS A C   
1608 O O   . HIS A 219 ? 0.4555 0.3044 0.2692 -0.0152 0.0065  -0.0650 516 HIS A O   
1609 C CB  . HIS A 219 ? 0.4320 0.2498 0.2450 0.0257  0.0127  -0.0630 516 HIS A CB  
1610 C CG  . HIS A 219 ? 0.6800 0.4863 0.4885 0.0195  0.0111  -0.0837 516 HIS A CG  
1611 N ND1 . HIS A 219 ? 0.6570 0.4897 0.4560 0.0199  0.0119  -0.0988 516 HIS A ND1 
1612 C CD2 . HIS A 219 ? 0.7502 0.5192 0.5606 0.0110  0.0082  -0.0924 516 HIS A CD2 
1613 C CE1 . HIS A 219 ? 0.6737 0.4889 0.4685 0.0108  0.0102  -0.1195 516 HIS A CE1 
1614 N NE2 . HIS A 219 ? 0.7512 0.5236 0.5537 0.0054  0.0083  -0.1165 516 HIS A NE2 
1615 N N   . MET A 220 ? 0.4949 0.3046 0.3105 -0.0104 0.0076  -0.0425 517 MET A N   
1616 C CA  . MET A 220 ? 0.5297 0.3309 0.3442 -0.0331 0.0053  -0.0382 517 MET A CA  
1617 C C   . MET A 220 ? 0.4778 0.3202 0.2952 -0.0434 0.0086  -0.0400 517 MET A C   
1618 O O   . MET A 220 ? 0.4731 0.3266 0.2924 -0.0617 0.0073  -0.0466 517 MET A O   
1619 C CB  . MET A 220 ? 0.5302 0.3076 0.3424 -0.0380 0.0030  -0.0189 517 MET A CB  
1620 C CG  . MET A 220 ? 0.4923 0.2276 0.3074 -0.0270 -0.0021 -0.0153 517 MET A CG  
1621 S SD  . MET A 220 ? 0.6336 0.3431 0.4459 -0.0349 -0.0092 0.0134  517 MET A SD  
1622 C CE  . MET A 220 ? 0.4904 0.2364 0.3024 -0.0225 -0.0064 0.0226  517 MET A CE  
1623 N N   . SER A 221 ? 0.4329 0.2987 0.2529 -0.0315 0.0131  -0.0355 518 SER A N   
1624 C CA  . SER A 221 ? 0.4441 0.3493 0.2718 -0.0347 0.0172  -0.0391 518 SER A CA  
1625 C C   . SER A 221 ? 0.4521 0.3842 0.2866 -0.0323 0.0138  -0.0508 518 SER A C   
1626 O O   . SER A 221 ? 0.4645 0.4271 0.3077 -0.0454 0.0139  -0.0560 518 SER A O   
1627 C CB  . SER A 221 ? 0.4476 0.3632 0.2776 -0.0190 0.0226  -0.0351 518 SER A CB  
1628 O OG  . SER A 221 ? 0.4646 0.4160 0.3065 -0.0157 0.0269  -0.0411 518 SER A OG  
1629 N N   . ASN A 222 ? 0.4354 0.3624 0.2658 -0.0171 0.0107  -0.0545 519 ASN A N   
1630 C CA  . ASN A 222 ? 0.4856 0.4415 0.3181 -0.0157 0.0054  -0.0644 519 ASN A CA  
1631 C C   . ASN A 222 ? 0.4884 0.4455 0.3198 -0.0389 0.0010  -0.0767 519 ASN A C   
1632 O O   . ASN A 222 ? 0.5160 0.5129 0.3565 -0.0482 -0.0026 -0.0826 519 ASN A O   
1633 C CB  . ASN A 222 ? 0.4932 0.4428 0.3153 0.0003  0.0037  -0.0659 519 ASN A CB  
1634 C CG  . ASN A 222 ? 0.5631 0.5177 0.3868 0.0196  0.0068  -0.0528 519 ASN A CG  
1635 O OD1 . ASN A 222 ? 0.5702 0.5403 0.4049 0.0246  0.0087  -0.0464 519 ASN A OD1 
1636 N ND2 . ASN A 222 ? 0.5876 0.5290 0.4011 0.0297  0.0084  -0.0501 519 ASN A ND2 
1637 N N   . LYS A 223 ? 0.5174 0.4308 0.3399 -0.0482 0.0007  -0.0804 520 LYS A N   
1638 C CA  . LYS A 223 ? 0.5662 0.4670 0.3865 -0.0732 -0.0032 -0.0925 520 LYS A CA  
1639 C C   . LYS A 223 ? 0.5548 0.4762 0.3842 -0.0966 -0.0020 -0.0862 520 LYS A C   
1640 O O   . LYS A 223 ? 0.6144 0.5626 0.4488 -0.1174 -0.0054 -0.0965 520 LYS A O   
1641 C CB  . LYS A 223 ? 0.6209 0.4608 0.4330 -0.0749 -0.0033 -0.0947 520 LYS A CB  
1642 C CG  . LYS A 223 ? 0.7088 0.5345 0.5136 -0.0554 -0.0029 -0.1082 520 LYS A CG  
1643 C CD  . LYS A 223 ? 0.8168 0.6625 0.6145 -0.0660 -0.0067 -0.1322 520 LYS A CD  
1644 C CE  . LYS A 223 ? 0.8956 0.7305 0.6828 -0.0489 -0.0040 -0.1487 520 LYS A CE  
1645 N NZ  . LYS A 223 ? 0.9743 0.8252 0.7500 -0.0634 -0.0078 -0.1762 520 LYS A NZ  
1646 N N   . GLY A 224 ? 0.5115 0.4263 0.3424 -0.0951 0.0034  -0.0702 521 GLY A N   
1647 C CA  . GLY A 224 ? 0.5328 0.4731 0.3703 -0.1176 0.0073  -0.0640 521 GLY A CA  
1648 C C   . GLY A 224 ? 0.4749 0.4816 0.3297 -0.1140 0.0094  -0.0710 521 GLY A C   
1649 O O   . GLY A 224 ? 0.4781 0.5202 0.3428 -0.1372 0.0097  -0.0760 521 GLY A O   
1650 N N   . MET A 225 ? 0.4373 0.4615 0.2979 -0.0848 0.0106  -0.0703 522 MET A N   
1651 C CA  . MET A 225 ? 0.4998 0.5831 0.3806 -0.0735 0.0113  -0.0746 522 MET A CA  
1652 C C   . MET A 225 ? 0.5324 0.6510 0.4205 -0.0839 0.0020  -0.0856 522 MET A C   
1653 O O   . MET A 225 ? 0.5238 0.6984 0.4318 -0.0929 0.0017  -0.0903 522 MET A O   
1654 C CB  . MET A 225 ? 0.5220 0.6029 0.4049 -0.0400 0.0119  -0.0694 522 MET A CB  
1655 C CG  . MET A 225 ? 0.5580 0.6886 0.4649 -0.0231 0.0149  -0.0702 522 MET A CG  
1656 S SD  . MET A 225 ? 0.6881 0.8260 0.6021 -0.0280 0.0300  -0.0710 522 MET A SD  
1657 C CE  . MET A 225 ? 0.4211 0.4978 0.3136 -0.0143 0.0333  -0.0622 522 MET A CE  
1658 N N   . GLU A 226 ? 0.5352 0.6256 0.4076 -0.0834 -0.0053 -0.0915 523 GLU A N   
1659 C CA  . GLU A 226 ? 0.5984 0.7196 0.4714 -0.0960 -0.0152 -0.1050 523 GLU A CA  
1660 C C   . GLU A 226 ? 0.6349 0.7732 0.5154 -0.1329 -0.0157 -0.1131 523 GLU A C   
1661 O O   . GLU A 226 ? 0.6300 0.8278 0.5258 -0.1446 -0.0216 -0.1208 523 GLU A O   
1662 C CB  . GLU A 226 ? 0.6317 0.7108 0.4818 -0.0938 -0.0196 -0.1145 523 GLU A CB  
1663 C CG  . GLU A 226 ? 0.6649 0.7748 0.5100 -0.1096 -0.0297 -0.1327 523 GLU A CG  
1664 C CD  . GLU A 226 ? 0.7569 0.8248 0.5778 -0.1081 -0.0310 -0.1475 523 GLU A CD  
1665 O OE1 . GLU A 226 ? 0.7295 0.8242 0.5408 -0.1184 -0.0389 -0.1647 523 GLU A OE1 
1666 O OE2 . GLU A 226 ? 0.7821 0.7949 0.5943 -0.0966 -0.0238 -0.1433 523 GLU A OE2 
1667 N N   . HIS A 227 ? 0.6751 0.7632 0.5453 -0.1522 -0.0101 -0.1092 524 HIS A N   
1668 C CA  . HIS A 227 ? 0.7040 0.7991 0.5782 -0.1919 -0.0096 -0.1129 524 HIS A CA  
1669 C C   . HIS A 227 ? 0.7001 0.8616 0.5972 -0.1985 -0.0029 -0.1068 524 HIS A C   
1670 O O   . HIS A 227 ? 0.7267 0.9373 0.6380 -0.2258 -0.0048 -0.1144 524 HIS A O   
1671 C CB  . HIS A 227 ? 0.7225 0.7425 0.5791 -0.2084 -0.0063 -0.1040 524 HIS A CB  
1672 N N   . LEU A 228 ? 0.6573 0.8238 0.5591 -0.1741 0.0057  -0.0956 525 LEU A N   
1673 C CA  . LEU A 228 ? 0.6154 0.8432 0.5389 -0.1773 0.0154  -0.0935 525 LEU A CA  
1674 C C   . LEU A 228 ? 0.6540 0.9636 0.6081 -0.1666 0.0112  -0.1033 525 LEU A C   
1675 O O   . LEU A 228 ? 0.6595 1.0301 0.6344 -0.1879 0.0153  -0.1080 525 LEU A O   
1676 C CB  . LEU A 228 ? 0.5519 0.7641 0.4719 -0.1528 0.0259  -0.0843 525 LEU A CB  
1677 C CG  . LEU A 228 ? 0.5865 0.7491 0.4834 -0.1728 0.0321  -0.0718 525 LEU A CG  
1678 C CD1 . LEU A 228 ? 0.5920 0.7560 0.4867 -0.1531 0.0428  -0.0667 525 LEU A CD1 
1679 C CD2 . LEU A 228 ? 0.5886 0.7734 0.4862 -0.2164 0.0359  -0.0693 525 LEU A CD2 
1680 N N   . TYR A 229 ? 0.7177 1.0334 0.6756 -0.1344 0.0025  -0.1046 526 TYR A N   
1681 C CA  . TYR A 229 ? 0.7746 1.1693 0.7621 -0.1232 -0.0053 -0.1101 526 TYR A CA  
1682 C C   . TYR A 229 ? 0.7876 1.2093 0.7735 -0.1529 -0.0184 -0.1211 526 TYR A C   
1683 O O   . TYR A 229 ? 0.8230 1.3087 0.8285 -0.1441 -0.0296 -0.1247 526 TYR A O   
1684 C CB  . TYR A 229 ? 0.8154 1.2162 0.8111 -0.0772 -0.0103 -0.1026 526 TYR A CB  
1685 C CG  . TYR A 229 ? 0.8700 1.2100 0.8361 -0.0623 -0.0173 -0.0971 526 TYR A CG  
1686 C CD1 . TYR A 229 ? 0.8717 1.1605 0.8259 -0.0375 -0.0103 -0.0873 526 TYR A CD1 
1687 C CD2 . TYR A 229 ? 0.9210 1.2611 0.8713 -0.0742 -0.0302 -0.1035 526 TYR A CD2 
1688 C CE1 . TYR A 229 ? 0.8818 1.1239 0.8115 -0.0254 -0.0152 -0.0820 526 TYR A CE1 
1689 C CE2 . TYR A 229 ? 0.9473 1.2400 0.8708 -0.0606 -0.0342 -0.1003 526 TYR A CE2 
1690 C CZ  . TYR A 229 ? 0.9260 1.1717 0.8406 -0.0362 -0.0264 -0.0885 526 TYR A CZ  
1691 O OH  . TYR A 229 ? 0.9323 1.1389 0.8225 -0.0247 -0.0290 -0.0852 526 TYR A OH  
1692 N N   . SER A 230 ? 0.7830 1.1551 0.7460 -0.1887 -0.0176 -0.1263 527 SER A N   
1693 C CA  . SER A 230 ? 0.7801 1.1712 0.7405 -0.2257 -0.0278 -0.1407 527 SER A CA  
1694 C C   . SER A 230 ? 0.8101 1.2448 0.7883 -0.2668 -0.0216 -0.1432 527 SER A C   
1695 O O   . SER A 230 ? 0.8056 1.3008 0.7993 -0.2928 -0.0297 -0.1546 527 SER A O   
1696 C CB  . SER A 230 ? 0.7591 1.0634 0.6846 -0.2405 -0.0311 -0.1480 527 SER A CB  
1697 O OG  . SER A 230 ? 0.7680 1.0517 0.6877 -0.2879 -0.0302 -0.1555 527 SER A OG  
1698 N N   . MET A 231 ? 0.8599 1.2689 0.8348 -0.2754 -0.0073 -0.1320 528 MET A N   
1699 C CA  . MET A 231 ? 0.8765 1.3284 0.8651 -0.3175 0.0009  -0.1315 528 MET A CA  
1700 C C   . MET A 231 ? 0.8244 1.3717 0.8504 -0.3012 0.0103  -0.1312 528 MET A C   
1701 O O   . MET A 231 ? 0.8287 1.4283 0.8705 -0.3330 0.0200  -0.1314 528 MET A O   
1702 C CB  . MET A 231 ? 0.9114 1.2908 0.8738 -0.3424 0.0107  -0.1177 528 MET A CB  
1703 C CG  . MET A 231 ? 0.8964 1.2598 0.8537 -0.3135 0.0233  -0.1040 528 MET A CG  
1704 S SD  . MET A 231 ? 1.6187 1.8649 1.5348 -0.3238 0.0233  -0.0868 528 MET A SD  
1705 C CE  . MET A 231 ? 1.0696 1.2606 0.9734 -0.3169 0.0068  -0.1011 528 MET A CE  
1706 N N   . LYS A 232 ? 1.1770 1.4346 1.3136 -0.3269 -0.0971 -0.2501 529 LYS A N   
1707 C CA  . LYS A 232 ? 1.1355 1.5100 1.3153 -0.3005 -0.0950 -0.2402 529 LYS A CA  
1708 C C   . LYS A 232 ? 1.1700 1.6678 1.3957 -0.3224 -0.1197 -0.2741 529 LYS A C   
1709 O O   . LYS A 232 ? 1.1663 1.7826 1.4464 -0.3215 -0.1195 -0.2776 529 LYS A O   
1710 C CB  . LYS A 232 ? 1.0762 1.4468 1.2248 -0.2274 -0.0993 -0.2136 529 LYS A CB  
1711 N N   . CYS A 233 ? 1.1942 1.6654 1.3978 -0.3428 -0.1405 -0.3004 530 CYS A N   
1712 C CA  . CYS A 233 ? 1.2066 1.7805 1.4461 -0.3774 -0.1634 -0.3368 530 CYS A CA  
1713 C C   . CYS A 233 ? 1.2425 1.7822 1.4951 -0.4560 -0.1509 -0.3623 530 CYS A C   
1714 O O   . CYS A 233 ? 1.2669 1.6840 1.4782 -0.4794 -0.1441 -0.3676 530 CYS A O   
1715 C CB  . CYS A 233 ? 1.2173 1.7821 1.4195 -0.3571 -0.1927 -0.3534 530 CYS A CB  
1716 S SG  . CYS A 233 ? 1.6455 2.1380 1.7852 -0.2776 -0.1971 -0.3203 530 CYS A SG  
1717 N N   . PRO A 238 ? 1.1735 1.3539 1.3816 -0.5181 0.0479  -0.1809 535 PRO A N   
1718 C CA  . PRO A 238 ? 1.1324 1.3991 1.3765 -0.5046 0.0710  -0.1688 535 PRO A CA  
1719 C C   . PRO A 238 ? 1.0549 1.3284 1.2836 -0.4256 0.0707  -0.1447 535 PRO A C   
1720 O O   . PRO A 238 ? 1.0251 1.4101 1.2938 -0.3871 0.0624  -0.1536 535 PRO A O   
1721 C CB  . PRO A 238 ? 1.1543 1.3380 1.3736 -0.5549 0.1008  -0.1491 535 PRO A CB  
1722 C CG  . PRO A 238 ? 1.2141 1.3230 1.4102 -0.5999 0.0882  -0.1615 535 PRO A CG  
1723 C CD  . PRO A 238 ? 1.2185 1.2917 1.3965 -0.5814 0.0597  -0.1778 535 PRO A CD  
1724 N N   . LEU A 239 ? 1.0283 1.1852 1.1989 -0.4033 0.0792  -0.1149 536 LEU A N   
1725 C CA  . LEU A 239 ? 0.9754 1.1169 1.1168 -0.3329 0.0790  -0.0920 536 LEU A CA  
1726 C C   . LEU A 239 ? 0.9383 1.1533 1.1062 -0.3040 0.1032  -0.0788 536 LEU A C   
1727 O O   . LEU A 239 ? 0.9529 1.2887 1.1795 -0.3010 0.1022  -0.0972 536 LEU A O   
1728 C CB  . LEU A 239 ? 0.9600 1.1306 1.0961 -0.2883 0.0459  -0.1067 536 LEU A CB  
1729 C CG  . LEU A 239 ? 1.0005 1.1081 1.1132 -0.3121 0.0220  -0.1256 536 LEU A CG  
1730 C CD1 . LEU A 239 ? 0.9738 1.1163 1.0777 -0.2678 -0.0082 -0.1396 536 LEU A CD1 
1731 C CD2 . LEU A 239 ? 1.0275 0.9946 1.0841 -0.3222 0.0307  -0.1052 536 LEU A CD2 
1732 N N   . SER A 240 ? 0.8702 1.0134 0.9950 -0.2822 0.1251  -0.0483 537 SER A N   
1733 C CA  . SER A 240 ? 0.8142 1.0103 0.9546 -0.2502 0.1507  -0.0353 537 SER A CA  
1734 C C   . SER A 240 ? 0.7965 1.0448 0.9390 -0.1781 0.1333  -0.0360 537 SER A C   
1735 O O   . SER A 240 ? 0.7905 1.0128 0.9072 -0.1541 0.1045  -0.0405 537 SER A O   
1736 C CB  . SER A 240 ? 0.8014 0.8977 0.8871 -0.2525 0.1793  -0.0030 537 SER A CB  
1737 O OG  . SER A 240 ? 0.7873 0.7936 0.8110 -0.2161 0.1664  0.0145  537 SER A OG  
1738 N N   . ASP A 241 ? 0.7660 1.0848 0.9368 -0.1440 0.1514  -0.0319 538 ASP A N   
1739 C CA  . ASP A 241 ? 0.7275 1.0932 0.8984 -0.0729 0.1358  -0.0298 538 ASP A CA  
1740 C C   . ASP A 241 ? 0.6949 0.9533 0.7854 -0.0319 0.1321  -0.0052 538 ASP A C   
1741 O O   . ASP A 241 ? 0.6730 0.9404 0.7445 0.0137  0.1064  -0.0062 538 ASP A O   
1742 C CB  . ASP A 241 ? 0.7315 1.1833 0.9473 -0.0429 0.1601  -0.0292 538 ASP A CB  
1743 C CG  . ASP A 241 ? 0.7503 1.3461 1.0548 -0.0594 0.1511  -0.0591 538 ASP A CG  
1744 O OD1 . ASP A 241 ? 0.7827 1.4006 1.1117 -0.1139 0.1369  -0.0793 538 ASP A OD1 
1745 O OD2 . ASP A 241 ? 0.7196 1.4072 1.0693 -0.0178 0.1585  -0.0635 538 ASP A OD2 
1746 N N   . LEU A 242 ? 0.6509 0.8105 0.6922 -0.0509 0.1575  0.0165  539 LEU A N   
1747 C CA  . LEU A 242 ? 0.6470 0.7062 0.6110 -0.0195 0.1570  0.0388  539 LEU A CA  
1748 C C   . LEU A 242 ? 0.7400 0.7549 0.6766 -0.0245 0.1236  0.0297  539 LEU A C   
1749 O O   . LEU A 242 ? 0.6714 0.6624 0.5670 0.0170  0.1070  0.0337  539 LEU A O   
1750 C CB  . LEU A 242 ? 0.6520 0.6236 0.5735 -0.0462 0.1901  0.0627  539 LEU A CB  
1751 C CG  . LEU A 242 ? 0.6496 0.5172 0.4904 -0.0236 0.1917  0.0851  539 LEU A CG  
1752 C CD1 . LEU A 242 ? 0.6458 0.5215 0.4558 0.0391  0.1924  0.0929  539 LEU A CD1 
1753 C CD2 . LEU A 242 ? 0.7094 0.5032 0.5143 -0.0563 0.2230  0.1079  539 LEU A CD2 
1754 N N   . LEU A 243 ? 0.7767 0.7786 0.7337 -0.0768 0.1151  0.0161  540 LEU A N   
1755 C CA  . LEU A 243 ? 0.7913 0.7544 0.7292 -0.0853 0.0853  0.0023  540 LEU A CA  
1756 C C   . LEU A 243 ? 0.7924 0.8356 0.7550 -0.0572 0.0544  -0.0200 540 LEU A C   
1757 O O   . LEU A 243 ? 0.8301 0.8418 0.7545 -0.0322 0.0333  -0.0233 540 LEU A O   
1758 C CB  . LEU A 243 ? 0.8228 0.7584 0.7814 -0.1477 0.0836  -0.0100 540 LEU A CB  
1759 C CG  . LEU A 243 ? 0.8707 0.6887 0.7801 -0.1698 0.0935  0.0093  540 LEU A CG  
1760 C CD1 . LEU A 243 ? 0.9074 0.6967 0.7988 -0.1746 0.1273  0.0376  540 LEU A CD1 
1761 C CD2 . LEU A 243 ? 0.9128 0.6995 0.8394 -0.2253 0.0846  -0.0058 540 LEU A CD2 
1762 N N   . LEU A 244 ? 0.7690 0.9197 0.7951 -0.0629 0.0517  -0.0358 541 LEU A N   
1763 C CA  . LEU A 244 ? 0.7522 0.9927 0.8069 -0.0374 0.0206  -0.0559 541 LEU A CA  
1764 C C   . LEU A 244 ? 0.7434 0.9726 0.7532 0.0283  0.0108  -0.0403 541 LEU A C   
1765 O O   . LEU A 244 ? 0.7786 1.0284 0.7750 0.0488  -0.0197 -0.0517 541 LEU A O   
1766 C CB  . LEU A 244 ? 0.7330 1.1003 0.8659 -0.0480 0.0233  -0.0717 541 LEU A CB  
1767 C CG  . LEU A 244 ? 0.7508 1.1504 0.9304 -0.1177 0.0240  -0.0959 541 LEU A CG  
1768 C CD1 . LEU A 244 ? 0.7457 1.2847 1.0042 -0.1254 0.0269  -0.1134 541 LEU A CD1 
1769 C CD2 . LEU A 244 ? 0.7614 1.1408 0.9282 -0.1413 -0.0069 -0.1183 541 LEU A CD2 
1770 N N   . GLU A 245 ? 0.7055 0.8970 0.6867 0.0579  0.0375  -0.0147 542 GLU A N   
1771 C CA  . GLU A 245 ? 0.7142 0.8766 0.6411 0.1171  0.0328  0.0028  542 GLU A CA  
1772 C C   . GLU A 245 ? 0.7065 0.7601 0.5570 0.1164  0.0285  0.0116  542 GLU A C   
1773 O O   . GLU A 245 ? 0.6618 0.7010 0.4691 0.1498  0.0084  0.0124  542 GLU A O   
1774 C CB  . GLU A 245 ? 0.7122 0.8720 0.6343 0.1476  0.0655  0.0246  542 GLU A CB  
1775 C CG  . GLU A 245 ? 0.7397 1.0174 0.7395 0.1594  0.0694  0.0140  542 GLU A CG  
1776 C CD  . GLU A 245 ? 0.7675 1.0422 0.7591 0.2004  0.1002  0.0330  542 GLU A CD  
1777 O OE1 . GLU A 245 ? 0.8004 0.9777 0.7295 0.2036  0.1257  0.0542  542 GLU A OE1 
1778 O OE2 . GLU A 245 ? 0.7356 1.1073 0.7838 0.2299  0.0992  0.0255  542 GLU A OE2 
1779 N N   . MET A 246 ? 0.7313 0.7113 0.5655 0.0777  0.0467  0.0177  543 MET A N   
1780 C CA  . MET A 246 ? 0.7692 0.6546 0.5412 0.0732  0.0423  0.0226  543 MET A CA  
1781 C C   . MET A 246 ? 0.7878 0.6871 0.5636 0.0638  0.0084  -0.0037 543 MET A C   
1782 O O   . MET A 246 ? 0.7940 0.6514 0.5181 0.0832  -0.0044 -0.0049 543 MET A O   
1783 C CB  . MET A 246 ? 0.7941 0.6097 0.5599 0.0308  0.0637  0.0325  543 MET A CB  
1784 C CG  . MET A 246 ? 0.7865 0.5721 0.5350 0.0332  0.0995  0.0593  543 MET A CG  
1785 S SD  . MET A 246 ? 0.8585 0.5885 0.5271 0.0836  0.1128  0.0830  543 MET A SD  
1786 C CE  . MET A 246 ? 1.1690 0.8459 0.8197 0.0604  0.1539  0.1086  543 MET A CE  
1787 N N   . LEU A 247 ? 0.8072 0.7662 0.6428 0.0302  -0.0042 -0.0264 544 LEU A N   
1788 C CA  . LEU A 247 ? 0.8642 0.8385 0.7079 0.0130  -0.0339 -0.0551 544 LEU A CA  
1789 C C   . LEU A 247 ? 0.8703 0.9108 0.7082 0.0506  -0.0607 -0.0642 544 LEU A C   
1790 O O   . LEU A 247 ? 0.8891 0.9139 0.6970 0.0537  -0.0828 -0.0795 544 LEU A O   
1791 C CB  . LEU A 247 ? 0.9054 0.9237 0.8115 -0.0386 -0.0366 -0.0768 544 LEU A CB  
1792 C CG  . LEU A 247 ? 0.9688 0.9736 0.8797 -0.0723 -0.0588 -0.1074 544 LEU A CG  
1793 C CD1 . LEU A 247 ? 0.9967 0.8888 0.8572 -0.0773 -0.0539 -0.1028 544 LEU A CD1 
1794 C CD2 . LEU A 247 ? 0.9875 1.0322 0.9557 -0.1265 -0.0562 -0.1259 544 LEU A CD2 
1795 N N   . ASP A 248 ? 0.8870 1.0015 0.7529 0.0797  -0.0588 -0.0545 545 ASP A N   
1796 C CA  . ASP A 248 ? 0.9299 1.1123 0.7926 0.1194  -0.0863 -0.0588 545 ASP A CA  
1797 C C   . ASP A 248 ? 0.9444 1.0590 0.7253 0.1604  -0.0904 -0.0421 545 ASP A C   
1798 O O   . ASP A 248 ? 0.9680 1.1103 0.7251 0.1831  -0.1184 -0.0491 545 ASP A O   
1799 C CB  . ASP A 248 ? 0.9492 1.2218 0.8628 0.1466  -0.0807 -0.0500 545 ASP A CB  
1800 C CG  . ASP A 248 ? 0.9989 1.3920 0.9706 0.1445  -0.1121 -0.0730 545 ASP A CG  
1801 O OD1 . ASP A 248 ? 1.0240 1.4503 0.9734 0.1826  -0.1399 -0.0718 545 ASP A OD1 
1802 O OD2 . ASP A 248 ? 1.0174 1.4723 1.0541 0.1024  -0.1094 -0.0922 545 ASP A OD2 
1803 N N   . ALA A 249 ? 0.9342 0.9610 0.6690 0.1665  -0.0622 -0.0202 546 ALA A N   
1804 C CA  . ALA A 249 ? 0.9516 0.9065 0.6033 0.1977  -0.0611 -0.0051 546 ALA A CA  
1805 C C   . ALA A 249 ? 1.0001 0.9208 0.6163 0.1802  -0.0818 -0.0257 546 ALA A C   
1806 O O   . ALA A 249 ? 1.0428 0.9317 0.5947 0.2042  -0.0917 -0.0219 546 ALA A O   
1807 C CB  . ALA A 249 ? 0.9275 0.8007 0.5418 0.1982  -0.0250 0.0195  546 ALA A CB  
1808 N N   . HIS A 250 ? 1.0225 0.9474 0.6784 0.1368  -0.0870 -0.0488 547 HIS A N   
1809 C CA  . HIS A 250 ? 1.0477 0.9470 0.6802 0.1179  -0.1058 -0.0744 547 HIS A CA  
1810 C C   . HIS A 250 ? 1.1253 1.1086 0.7939 0.1076  -0.1378 -0.1017 547 HIS A C   
1811 O O   . HIS A 250 ? 1.1647 1.1512 0.8583 0.0704  -0.1477 -0.1298 547 HIS A O   
1812 C CB  . HIS A 250 ? 0.9851 0.8240 0.6317 0.0784  -0.0920 -0.0840 547 HIS A CB  
1813 C CG  . HIS A 250 ? 0.9510 0.7027 0.5485 0.0867  -0.0678 -0.0625 547 HIS A CG  
1814 N ND1 . HIS A 250 ? 0.9470 0.6382 0.5007 0.0833  -0.0697 -0.0731 547 HIS A ND1 
1815 C CD2 . HIS A 250 ? 0.9459 0.6656 0.5313 0.0966  -0.0410 -0.0328 547 HIS A CD2 
1816 C CE1 . HIS A 250 ? 0.9375 0.5669 0.4558 0.0908  -0.0466 -0.0500 547 HIS A CE1 
1817 N NE2 . HIS A 250 ? 0.9354 0.5783 0.4697 0.0977  -0.0287 -0.0249 547 HIS A NE2 
1818 N N   . ARG A 251 ? 1.1552 1.2048 0.8247 0.1410  -0.1541 -0.0932 548 ARG A N   
1819 C CA  . ARG A 251 ? 1.1616 1.3007 0.8615 0.1349  -0.1876 -0.1161 548 ARG A CA  
1820 C C   . ARG A 251 ? 1.1890 1.3605 0.8472 0.1822  -0.2094 -0.1018 548 ARG A C   
1821 O O   . ARG A 251 ? 1.2421 1.4714 0.8996 0.1812  -0.2412 -0.1186 548 ARG A O   
1822 C CB  . ARG A 251 ? 1.1451 1.3721 0.9309 0.1135  -0.1880 -0.1249 548 ARG A CB  
1823 N N   . LEU B 9   ? 0.7398 1.3103 1.4218 0.3601  -0.0695 0.1845  306 LEU B N   
1824 C CA  . LEU B 9   ? 0.7371 1.3564 1.4305 0.3494  -0.0500 0.1561  306 LEU B CA  
1825 C C   . LEU B 9   ? 0.6973 1.3226 1.3414 0.3051  -0.0384 0.1596  306 LEU B C   
1826 O O   . LEU B 9   ? 0.6861 1.3700 1.3301 0.2845  -0.0286 0.1550  306 LEU B O   
1827 C CB  . LEU B 9   ? 0.7598 1.3460 1.4722 0.3746  -0.0355 0.1158  306 LEU B CB  
1828 N N   . ALA B 10  ? 0.6659 1.2297 1.2684 0.2907  -0.0391 0.1683  307 ALA B N   
1829 C CA  . ALA B 10  ? 0.5950 1.1572 1.1510 0.2523  -0.0288 0.1728  307 ALA B CA  
1830 C C   . ALA B 10  ? 0.5836 1.1906 1.1219 0.2271  -0.0397 0.2045  307 ALA B C   
1831 O O   . ALA B 10  ? 0.5516 1.1803 1.0577 0.1950  -0.0317 0.2061  307 ALA B O   
1832 C CB  . ALA B 10  ? 0.5651 1.0510 1.0887 0.2466  -0.0263 0.1738  307 ALA B CB  
1833 N N   . LEU B 11  ? 0.5997 1.2205 1.1574 0.2416  -0.0589 0.2293  308 LEU B N   
1834 C CA  . LEU B 11  ? 0.5812 1.2479 1.1219 0.2188  -0.0724 0.2601  308 LEU B CA  
1835 C C   . LEU B 11  ? 0.5783 1.3299 1.1452 0.2139  -0.0753 0.2564  308 LEU B C   
1836 O O   . LEU B 11  ? 0.5791 1.3802 1.1292 0.1886  -0.0856 0.2757  308 LEU B O   
1837 C CB  . LEU B 11  ? 0.6198 1.2642 1.1655 0.2340  -0.0923 0.2917  308 LEU B CB  
1838 C CG  . LEU B 11  ? 0.6524 1.2257 1.1627 0.2252  -0.0917 0.3077  308 LEU B CG  
1839 C CD1 . LEU B 11  ? 0.6723 1.1732 1.1901 0.2448  -0.0814 0.2848  308 LEU B CD1 
1840 C CD2 . LEU B 11  ? 0.6988 1.2705 1.2087 0.2309  -0.1116 0.3446  308 LEU B CD2 
1841 N N   . SER B 12  ? 0.5802 1.3502 1.1881 0.2366  -0.0659 0.2306  309 SER B N   
1842 C CA  . SER B 12  ? 0.5781 1.4303 1.2178 0.2331  -0.0658 0.2258  309 SER B CA  
1843 C C   . SER B 12  ? 0.5290 1.4048 1.1446 0.2008  -0.0454 0.2049  309 SER B C   
1844 O O   . SER B 12  ? 0.4947 1.4365 1.1316 0.1916  -0.0413 0.1985  309 SER B O   
1845 C CB  . SER B 12  ? 0.6048 1.4708 1.3068 0.2760  -0.0648 0.2106  309 SER B CB  
1846 O OG  . SER B 12  ? 0.6497 1.4937 1.3737 0.3065  -0.0854 0.2313  309 SER B OG  
1847 N N   . LEU B 13  ? 0.5258 1.3470 1.0972 0.1833  -0.0329 0.1958  310 LEU B N   
1848 C CA  . LEU B 13  ? 0.5021 1.3341 1.0435 0.1519  -0.0140 0.1778  310 LEU B CA  
1849 C C   . LEU B 13  ? 0.4825 1.3466 0.9845 0.1094  -0.0216 0.1944  310 LEU B C   
1850 O O   . LEU B 13  ? 0.5038 1.3445 0.9761 0.0982  -0.0330 0.2145  310 LEU B O   
1851 C CB  . LEU B 13  ? 0.4806 1.2411 0.9926 0.1522  0.0017  0.1611  310 LEU B CB  
1852 C CG  . LEU B 13  ? 0.4960 1.2282 1.0370 0.1837  0.0148  0.1341  310 LEU B CG  
1853 C CD1 . LEU B 13  ? 0.4956 1.1597 1.0020 0.1792  0.0262  0.1212  310 LEU B CD1 
1854 C CD2 . LEU B 13  ? 0.4772 1.2629 1.0407 0.1816  0.0309  0.1143  310 LEU B CD2 
1855 N N   . THR B 14  ? 0.4489 1.3659 0.9496 0.0841  -0.0149 0.1850  311 THR B N   
1856 C CA  . THR B 14  ? 0.4288 1.3707 0.8877 0.0385  -0.0209 0.1938  311 THR B CA  
1857 C C   . THR B 14  ? 0.4221 1.3052 0.8289 0.0149  -0.0063 0.1830  311 THR B C   
1858 O O   . THR B 14  ? 0.4305 1.2606 0.8359 0.0341  0.0078  0.1701  311 THR B O   
1859 C CB  . THR B 14  ? 0.4163 1.4264 0.8889 0.0155  -0.0178 0.1856  311 THR B CB  
1860 O OG1 . THR B 14  ? 0.4114 1.4045 0.8803 0.0123  0.0064  0.1611  311 THR B OG1 
1861 C CG2 . THR B 14  ? 0.4141 1.4865 0.9468 0.0430  -0.0301 0.1949  311 THR B CG2 
1862 N N   . ALA B 15  ? 0.3941 1.2853 0.7577 -0.0274 -0.0101 0.1869  312 ALA B N   
1863 C CA  . ALA B 15  ? 0.3434 1.1767 0.6571 -0.0512 0.0032  0.1768  312 ALA B CA  
1864 C C   . ALA B 15  ? 0.3338 1.1407 0.6430 -0.0525 0.0258  0.1523  312 ALA B C   
1865 O O   . ALA B 15  ? 0.3176 1.0650 0.6106 -0.0422 0.0389  0.1434  312 ALA B O   
1866 C CB  . ALA B 15  ? 0.3283 1.1745 0.5970 -0.0988 -0.0052 0.1808  312 ALA B CB  
1867 N N   . ASP B 16  ? 0.3257 1.1786 0.6491 -0.0658 0.0299  0.1432  313 ASP B N   
1868 C CA  . ASP B 16  ? 0.3779 1.2122 0.6952 -0.0698 0.0510  0.1233  313 ASP B CA  
1869 C C   . ASP B 16  ? 0.3440 1.1574 0.6905 -0.0283 0.0629  0.1132  313 ASP B C   
1870 O O   . ASP B 16  ? 0.3223 1.0864 0.6462 -0.0270 0.0785  0.1001  313 ASP B O   
1871 C CB  . ASP B 16  ? 0.4336 1.3304 0.7666 -0.0914 0.0526  0.1194  313 ASP B CB  
1872 C CG  . ASP B 16  ? 0.5177 1.4172 0.8099 -0.1409 0.0457  0.1214  313 ASP B CG  
1873 O OD1 . ASP B 16  ? 0.5533 1.4167 0.8094 -0.1561 0.0370  0.1271  313 ASP B OD1 
1874 O OD2 . ASP B 16  ? 0.5503 1.4871 0.8462 -0.1657 0.0496  0.1166  313 ASP B OD2 
1875 N N   . GLN B 17  ? 0.3522 1.2001 0.7475 0.0053  0.0544  0.1186  314 GLN B N   
1876 C CA  . GLN B 17  ? 0.3409 1.1662 0.7658 0.0450  0.0639  0.1060  314 GLN B CA  
1877 C C   . GLN B 17  ? 0.3533 1.1065 0.7548 0.0570  0.0642  0.1060  314 GLN B C   
1878 O O   . GLN B 17  ? 0.3675 1.0849 0.7695 0.0745  0.0769  0.0895  314 GLN B O   
1879 C CB  . GLN B 17  ? 0.3551 1.2232 0.8376 0.0788  0.0523  0.1126  314 GLN B CB  
1880 C CG  . GLN B 17  ? 0.3927 1.3384 0.9079 0.0719  0.0536  0.1121  314 GLN B CG  
1881 C CD  . GLN B 17  ? 0.4606 1.4463 1.0377 0.1096  0.0430  0.1181  314 GLN B CD  
1882 O OE1 . GLN B 17  ? 0.4796 1.4424 1.0686 0.1316  0.0262  0.1313  314 GLN B OE1 
1883 N NE2 . GLN B 17  ? 0.5139 1.5582 1.1313 0.1179  0.0530  0.1094  314 GLN B NE2 
1884 N N   . MET B 18  ? 0.3270 1.0623 0.7075 0.0462  0.0501  0.1251  315 MET B N   
1885 C CA  . MET B 18  ? 0.2915 0.9621 0.6491 0.0532  0.0507  0.1289  315 MET B CA  
1886 C C   . MET B 18  ? 0.2919 0.9202 0.6071 0.0319  0.0679  0.1146  315 MET B C   
1887 O O   . MET B 18  ? 0.2442 0.8265 0.5536 0.0466  0.0760  0.1053  315 MET B O   
1888 C CB  . MET B 18  ? 0.2897 0.9579 0.6311 0.0416  0.0344  0.1548  315 MET B CB  
1889 C CG  . MET B 18  ? 0.2759 0.8813 0.5894 0.0414  0.0380  0.1613  315 MET B CG  
1890 S SD  . MET B 18  ? 0.6594 1.2179 1.0044 0.0841  0.0326  0.1648  315 MET B SD  
1891 C CE  . MET B 18  ? 0.2593 0.8470 0.6268 0.0950  0.0087  0.1951  315 MET B CE  
1892 N N   . VAL B 19  ? 0.3619 1.0024 0.6468 -0.0034 0.0719  0.1130  316 VAL B N   
1893 C CA  . VAL B 19  ? 0.4120 1.0039 0.6534 -0.0251 0.0865  0.1014  316 VAL B CA  
1894 C C   . VAL B 19  ? 0.4391 1.0248 0.6879 -0.0119 0.1021  0.0832  316 VAL B C   
1895 O O   . VAL B 19  ? 0.4383 0.9747 0.6662 -0.0068 0.1108  0.0760  316 VAL B O   
1896 C CB  . VAL B 19  ? 0.4356 1.0368 0.6464 -0.0651 0.0865  0.1013  316 VAL B CB  
1897 C CG1 . VAL B 19  ? 0.4499 0.9910 0.6194 -0.0823 0.1013  0.0901  316 VAL B CG1 
1898 C CG2 . VAL B 19  ? 0.4230 1.0257 0.6165 -0.0827 0.0723  0.1158  316 VAL B CG2 
1899 N N   . SER B 20  ? 0.4370 1.0763 0.7151 -0.0069 0.1056  0.0767  317 SER B N   
1900 C CA  . SER B 20  ? 0.4936 1.1350 0.7771 0.0041  0.1223  0.0596  317 SER B CA  
1901 C C   . SER B 20  ? 0.4693 1.0848 0.7707 0.0393  0.1244  0.0498  317 SER B C   
1902 O O   . SER B 20  ? 0.4733 1.0633 0.7581 0.0441  0.1372  0.0362  317 SER B O   
1903 C CB  . SER B 20  ? 0.5390 1.2489 0.8561 0.0051  0.1266  0.0558  317 SER B CB  
1904 O OG  . SER B 20  ? 0.5678 1.3158 0.9346 0.0342  0.1164  0.0592  317 SER B OG  
1905 N N   . ALA B 21  ? 0.4118 1.0320 0.7455 0.0629  0.1105  0.0573  318 ALA B N   
1906 C CA  . ALA B 21  ? 0.3708 0.9590 0.7243 0.0957  0.1093  0.0479  318 ALA B CA  
1907 C C   . ALA B 21  ? 0.3338 0.8626 0.6506 0.0888  0.1112  0.0481  318 ALA B C   
1908 O O   . ALA B 21  ? 0.3307 0.8347 0.6429 0.1015  0.1196  0.0319  318 ALA B O   
1909 C CB  . ALA B 21  ? 0.3536 0.9492 0.7455 0.1192  0.0909  0.0608  318 ALA B CB  
1910 N N   . LEU B 22  ? 0.3340 0.8427 0.6248 0.0686  0.1037  0.0664  319 LEU B N   
1911 C CA  . LEU B 22  ? 0.3218 0.7761 0.5806 0.0618  0.1055  0.0702  319 LEU B CA  
1912 C C   . LEU B 22  ? 0.3557 0.7910 0.5775 0.0440  0.1203  0.0578  319 LEU B C   
1913 O O   . LEU B 22  ? 0.3819 0.7830 0.5895 0.0503  0.1242  0.0523  319 LEU B O   
1914 C CB  . LEU B 22  ? 0.2778 0.7164 0.5168 0.0437  0.0970  0.0921  319 LEU B CB  
1915 C CG  . LEU B 22  ? 0.2737 0.7230 0.5421 0.0602  0.0812  0.1112  319 LEU B CG  
1916 C CD1 . LEU B 22  ? 0.2576 0.6925 0.4992 0.0395  0.0764  0.1322  319 LEU B CD1 
1917 C CD2 . LEU B 22  ? 0.2570 0.6725 0.5499 0.0902  0.0760  0.1090  319 LEU B CD2 
1918 N N   . LEU B 23  ? 0.3712 0.8285 0.5781 0.0218  0.1271  0.0556  320 LEU B N   
1919 C CA  . LEU B 23  ? 0.4017 0.8379 0.5732 0.0048  0.1400  0.0479  320 LEU B CA  
1920 C C   . LEU B 23  ? 0.4353 0.8836 0.6150 0.0237  0.1504  0.0308  320 LEU B C   
1921 O O   . LEU B 23  ? 0.4484 0.8661 0.5995 0.0214  0.1567  0.0263  320 LEU B O   
1922 C CB  . LEU B 23  ? 0.4219 0.8792 0.5813 -0.0219 0.1439  0.0512  320 LEU B CB  
1923 C CG  . LEU B 23  ? 0.4218 0.8551 0.5590 -0.0462 0.1364  0.0634  320 LEU B CG  
1924 C CD1 . LEU B 23  ? 0.4480 0.9084 0.5789 -0.0722 0.1394  0.0645  320 LEU B CD1 
1925 C CD2 . LEU B 23  ? 0.3867 0.7489 0.4853 -0.0530 0.1394  0.0662  320 LEU B CD2 
1926 N N   . ASP B 24  ? 0.4578 0.9506 0.6756 0.0434  0.1522  0.0211  321 ASP B N   
1927 C CA  . ASP B 24  ? 0.4862 0.9908 0.7113 0.0633  0.1640  0.0011  321 ASP B CA  
1928 C C   . ASP B 24  ? 0.4535 0.9232 0.6804 0.0860  0.1603  -0.0090 321 ASP B C   
1929 O O   . ASP B 24  ? 0.4467 0.9114 0.6592 0.0958  0.1700  -0.0263 321 ASP B O   
1930 C CB  . ASP B 24  ? 0.5637 1.1197 0.8340 0.0828  0.1673  -0.0075 321 ASP B CB  
1931 C CG  . ASP B 24  ? 0.6659 1.2666 0.9359 0.0609  0.1737  -0.0009 321 ASP B CG  
1932 O OD1 . ASP B 24  ? 0.7264 1.3153 0.9577 0.0342  0.1810  0.0034  321 ASP B OD1 
1933 O OD2 . ASP B 24  ? 0.6966 1.3439 1.0073 0.0707  0.1705  0.0010  321 ASP B OD2 
1934 N N   . ALA B 25  ? 0.3998 0.8464 0.6426 0.0938  0.1457  0.0022  322 ALA B N   
1935 C CA  . ALA B 25  ? 0.4003 0.8127 0.6521 0.1157  0.1393  -0.0053 322 ALA B CA  
1936 C C   . ALA B 25  ? 0.3678 0.7447 0.5811 0.1007  0.1393  0.0029  322 ALA B C   
1937 O O   . ALA B 25  ? 0.3760 0.7255 0.5940 0.1160  0.1338  -0.0010 322 ALA B O   
1938 C CB  . ALA B 25  ? 0.4326 0.8338 0.7222 0.1325  0.1221  0.0065  322 ALA B CB  
1939 N N   . GLU B 26  ? 0.3375 0.7110 0.5147 0.0716  0.1446  0.0149  323 GLU B N   
1940 C CA  . GLU B 26  ? 0.3257 0.6614 0.4674 0.0568  0.1439  0.0268  323 GLU B CA  
1941 C C   . GLU B 26  ? 0.3296 0.6600 0.4518 0.0658  0.1499  0.0133  323 GLU B C   
1942 O O   . GLU B 26  ? 0.3938 0.7439 0.4992 0.0636  0.1600  -0.0015 323 GLU B O   
1943 C CB  . GLU B 26  ? 0.3361 0.6584 0.4434 0.0257  0.1477  0.0382  323 GLU B CB  
1944 C CG  . GLU B 26  ? 0.3603 0.6345 0.4341 0.0119  0.1450  0.0516  323 GLU B CG  
1945 C CD  . GLU B 26  ? 0.3649 0.6141 0.4482 0.0132  0.1344  0.0664  323 GLU B CD  
1946 O OE1 . GLU B 26  ? 0.2864 0.5552 0.4026 0.0264  0.1285  0.0692  323 GLU B OE1 
1947 O OE2 . GLU B 26  ? 0.3991 0.6076 0.4568 0.0023  0.1319  0.0755  323 GLU B OE2 
1948 N N   . PRO B 27  ? 0.3169 0.6225 0.4411 0.0762  0.1436  0.0198  324 PRO B N   
1949 C CA  . PRO B 27  ? 0.3502 0.6392 0.4494 0.0801  0.1404  0.0056  324 PRO B CA  
1950 C C   . PRO B 27  ? 0.3860 0.6765 0.4372 0.0587  0.1502  0.0179  324 PRO B C   
1951 O O   . PRO B 27  ? 0.4271 0.7002 0.4660 0.0390  0.1513  0.0379  324 PRO B O   
1952 C CB  . PRO B 27  ? 0.3419 0.5832 0.4569 0.0851  0.1207  0.0149  324 PRO B CB  
1953 C CG  . PRO B 27  ? 0.3259 0.5575 0.4521 0.0755  0.1208  0.0425  324 PRO B CG  
1954 C CD  . PRO B 27  ? 0.3099 0.5821 0.4527 0.0767  0.1311  0.0404  324 PRO B CD  
1955 N N   . PRO B 28  ? 0.4469 0.7413 0.4667 0.0593  0.1509  0.0034  325 PRO B N   
1956 C CA  . PRO B 28  ? 0.4231 0.7174 0.3948 0.0405  0.1586  0.0190  325 PRO B CA  
1957 C C   . PRO B 28  ? 0.4333 0.6844 0.3947 0.0346  0.1446  0.0436  325 PRO B C   
1958 O O   . PRO B 28  ? 0.4323 0.6576 0.4224 0.0443  0.1288  0.0449  325 PRO B O   
1959 C CB  . PRO B 28  ? 0.4498 0.7637 0.3929 0.0467  0.1599  -0.0066 325 PRO B CB  
1960 C CG  . PRO B 28  ? 0.4607 0.7587 0.4344 0.0674  0.1441  -0.0324 325 PRO B CG  
1961 C CD  . PRO B 28  ? 0.4356 0.7348 0.4597 0.0776  0.1454  -0.0297 325 PRO B CD  
1962 N N   . ILE B 29  ? 0.4904 0.7296 0.4145 0.0188  0.1492  0.0634  326 ILE B N   
1963 C CA  . ILE B 29  ? 0.5475 0.7557 0.4608 0.0180  0.1394  0.0889  326 ILE B CA  
1964 C C   . ILE B 29  ? 0.5353 0.7486 0.4250 0.0226  0.1244  0.0810  326 ILE B C   
1965 O O   . ILE B 29  ? 0.6000 0.8325 0.4482 0.0149  0.1312  0.0804  326 ILE B O   
1966 C CB  . ILE B 29  ? 0.6295 0.7955 0.5220 -0.0011 0.1393  0.1044  326 ILE B CB  
1967 C CG1 . ILE B 29  ? 0.6151 0.7622 0.5259 -0.0123 0.1431  0.0980  326 ILE B CG1 
1968 C CG2 . ILE B 29  ? 0.6487 0.7843 0.5385 0.0038  0.1285  0.1280  326 ILE B CG2 
1969 C CD1 . ILE B 29  ? 0.5811 0.7197 0.5265 -0.0018 0.1360  0.1014  326 ILE B CD1 
1970 N N   . LEU B 30  ? 0.4408 0.6392 0.3557 0.0327  0.1034  0.0756  327 LEU B N   
1971 C CA  . LEU B 30  ? 0.4281 0.6338 0.3238 0.0346  0.0847  0.0640  327 LEU B CA  
1972 C C   . LEU B 30  ? 0.4830 0.6795 0.3565 0.0298  0.0744  0.0957  327 LEU B C   
1973 O O   . LEU B 30  ? 0.4573 0.6320 0.3467 0.0307  0.0774  0.1242  327 LEU B O   
1974 C CB  . LEU B 30  ? 0.4142 0.6084 0.3495 0.0437  0.0649  0.0434  327 LEU B CB  
1975 C CG  . LEU B 30  ? 0.4079 0.6041 0.3725 0.0534  0.0727  0.0155  327 LEU B CG  
1976 C CD1 . LEU B 30  ? 0.3826 0.5584 0.3823 0.0603  0.0517  -0.0027 327 LEU B CD1 
1977 C CD2 . LEU B 30  ? 0.4096 0.6359 0.3431 0.0551  0.0883  -0.0115 327 LEU B CD2 
1978 N N   . TYR B 31  ? 0.5377 0.7520 0.3732 0.0262  0.0624  0.0907  328 TYR B N   
1979 C CA  . TYR B 31  ? 0.5475 0.7593 0.3632 0.0242  0.0481  0.1223  328 TYR B CA  
1980 C C   . TYR B 31  ? 0.5815 0.7923 0.4304 0.0291  0.0189  0.1207  328 TYR B C   
1981 O O   . TYR B 31  ? 0.6222 0.8365 0.4897 0.0295  0.0072  0.0887  328 TYR B O   
1982 C CB  . TYR B 31  ? 0.5620 0.7988 0.3152 0.0156  0.0480  0.1224  328 TYR B CB  
1983 C CG  . TYR B 31  ? 0.5534 0.7885 0.2720 0.0068  0.0744  0.1440  328 TYR B CG  
1984 C CD1 . TYR B 31  ? 0.5478 0.7909 0.2680 0.0016  0.0999  0.1257  328 TYR B CD1 
1985 C CD2 . TYR B 31  ? 0.6160 0.8318 0.3122 0.0027  0.0708  0.1779  328 TYR B CD2 
1986 C CE1 . TYR B 31  ? 0.5867 0.8017 0.2984 -0.0115 0.1147  0.1328  328 TYR B CE1 
1987 C CE2 . TYR B 31  ? 0.6544 0.8387 0.3380 -0.0089 0.0883  0.1828  328 TYR B CE2 
1988 C CZ  . TYR B 31  ? 0.6740 0.8582 0.3641 -0.0174 0.1096  0.1605  328 TYR B CZ  
1989 O OH  . TYR B 31  ? 0.7578 0.9115 0.4336 -0.0311 0.1250  0.1663  328 TYR B OH  
1990 N N   . SER B 32  ? 0.5797 0.7855 0.4391 0.0328  0.0077  0.1558  329 SER B N   
1991 C CA  . SER B 32  ? 0.5667 0.7832 0.4582 0.0347  -0.0217 0.1590  329 SER B CA  
1992 C C   . SER B 32  ? 0.6030 0.8493 0.4514 0.0273  -0.0454 0.1565  329 SER B C   
1993 O O   . SER B 32  ? 0.6192 0.8753 0.4118 0.0223  -0.0362 0.1553  329 SER B O   
1994 C CB  . SER B 32  ? 0.5253 0.7308 0.4546 0.0451  -0.0218 0.1984  329 SER B CB  
1995 O OG  . SER B 32  ? 0.5527 0.7578 0.4492 0.0496  -0.0181 0.2327  329 SER B OG  
1996 N N   . GLU B 33  ? 0.6193 0.8833 0.4923 0.0244  -0.0762 0.1562  330 GLU B N   
1997 C CA  . GLU B 33  ? 0.7406 1.0376 0.5731 0.0156  -0.1040 0.1561  330 GLU B CA  
1998 C C   . GLU B 33  ? 0.7421 1.0555 0.5836 0.0240  -0.1179 0.2064  330 GLU B C   
1999 O O   . GLU B 33  ? 0.8050 1.1523 0.6446 0.0186  -0.1506 0.2147  330 GLU B O   
2000 C CB  . GLU B 33  ? 0.8226 1.1320 0.6725 0.0031  -0.1330 0.1199  330 GLU B CB  
2001 C CG  . GLU B 33  ? 0.8863 1.1755 0.7247 -0.0013 -0.1198 0.0685  330 GLU B CG  
2002 C CD  . GLU B 33  ? 0.9376 1.2228 0.8044 -0.0132 -0.1460 0.0337  330 GLU B CD  
2003 O OE1 . GLU B 33  ? 0.9279 1.2308 0.8271 -0.0212 -0.1748 0.0502  330 GLU B OE1 
2004 O OE2 . GLU B 33  ? 0.9889 1.2529 0.8479 -0.0145 -0.1375 -0.0099 330 GLU B OE2 
2005 N N   . TYR B 34  ? 0.6867 0.9756 0.5386 0.0375  -0.0931 0.2392  331 TYR B N   
2006 C CA  . TYR B 34  ? 0.6626 0.9573 0.5270 0.0517  -0.0998 0.2889  331 TYR B CA  
2007 C C   . TYR B 34  ? 0.7278 1.0437 0.5380 0.0474  -0.1161 0.3045  331 TYR B C   
2008 O O   . TYR B 34  ? 0.6848 0.9891 0.4379 0.0396  -0.1006 0.2968  331 TYR B O   
2009 C CB  . TYR B 34  ? 0.6353 0.8820 0.5102 0.0635  -0.0633 0.3061  331 TYR B CB  
2010 C CG  . TYR B 34  ? 0.6545 0.8803 0.5488 0.0762  -0.0596 0.3307  331 TYR B CG  
2011 C CD1 . TYR B 34  ? 0.6812 0.9204 0.6336 0.0881  -0.0705 0.3433  331 TYR B CD1 
2012 C CD2 . TYR B 34  ? 0.7343 0.9278 0.5898 0.0758  -0.0444 0.3400  331 TYR B CD2 
2013 C CE1 . TYR B 34  ? 0.7189 0.9434 0.6873 0.1022  -0.0655 0.3641  331 TYR B CE1 
2014 C CE2 . TYR B 34  ? 0.8136 0.9866 0.6846 0.0892  -0.0427 0.3624  331 TYR B CE2 
2015 C CZ  . TYR B 34  ? 0.7926 0.9826 0.7194 0.1039  -0.0527 0.3740  331 TYR B CZ  
2016 O OH  . TYR B 34  ? 0.8380 1.0113 0.7798 0.1197  -0.0496 0.3955  331 TYR B OH  
2017 N N   . ASP B 35  ? 0.7647 1.1074 0.5995 0.0508  -0.1445 0.3202  332 ASP B N   
2018 C CA  . ASP B 35  ? 0.8350 1.1915 0.6287 0.0484  -0.1600 0.3345  332 ASP B CA  
2019 C C   . ASP B 35  ? 0.8628 1.1938 0.6879 0.0679  -0.1497 0.3692  332 ASP B C   
2020 O O   . ASP B 35  ? 0.8462 1.1948 0.7271 0.0784  -0.1629 0.3828  332 ASP B O   
2021 C CB  . ASP B 35  ? 0.8933 1.3035 0.6876 0.0358  -0.2032 0.3234  332 ASP B CB  
2022 C CG  . ASP B 35  ? 0.9778 1.4059 0.7118 0.0285  -0.2201 0.3297  332 ASP B CG  
2023 O OD1 . ASP B 35  ? 1.0026 1.4043 0.7145 0.0387  -0.2036 0.3561  332 ASP B OD1 
2024 O OD2 . ASP B 35  ? 1.0194 1.4851 0.7272 0.0112  -0.2506 0.3062  332 ASP B OD2 
2025 N N   . PRO B 36  ? 0.9438 1.2334 0.7332 0.0716  -0.1257 0.3811  333 PRO B N   
2026 C CA  . PRO B 36  ? 0.9810 1.2369 0.7921 0.0896  -0.1141 0.4093  333 PRO B CA  
2027 C C   . PRO B 36  ? 1.0178 1.3060 0.8354 0.0986  -0.1432 0.4359  333 PRO B C   
2028 O O   . PRO B 36  ? 1.0211 1.2892 0.8642 0.1168  -0.1375 0.4600  333 PRO B O   
2029 C CB  . PRO B 36  ? 1.0373 1.2465 0.7939 0.0825  -0.0895 0.4107  333 PRO B CB  
2030 C CG  . PRO B 36  ? 1.0475 1.2840 0.7467 0.0624  -0.0969 0.3917  333 PRO B CG  
2031 C CD  . PRO B 36  ? 0.9867 1.2600 0.7113 0.0566  -0.1088 0.3657  333 PRO B CD  
2032 N N   . THR B 37  ? 1.0297 1.3677 0.8225 0.0857  -0.1747 0.4294  334 THR B N   
2033 C CA  . THR B 37  ? 1.0682 1.4447 0.8685 0.0918  -0.2064 0.4525  334 THR B CA  
2034 C C   . THR B 37  ? 1.0392 1.4576 0.9103 0.0959  -0.2267 0.4502  334 THR B C   
2035 O O   . THR B 37  ? 1.0656 1.5020 0.9774 0.1115  -0.2377 0.4752  334 THR B O   
2036 C CB  . THR B 37  ? 1.1282 1.5387 0.8615 0.0726  -0.2322 0.4437  334 THR B CB  
2037 O OG1 . THR B 37  ? 1.0973 1.5483 0.8347 0.0543  -0.2539 0.4105  334 THR B OG1 
2038 C CG2 . THR B 37  ? 1.1673 1.5411 0.8305 0.0627  -0.2075 0.4367  334 THR B CG2 
2039 N N   . ARG B 38  ? 0.9746 1.4089 0.8610 0.0812  -0.2311 0.4203  335 ARG B N   
2040 C CA  . ARG B 38  ? 0.9218 1.3944 0.8756 0.0794  -0.2502 0.4148  335 ARG B CA  
2041 C C   . ARG B 38  ? 0.8839 1.3342 0.9052 0.1008  -0.2238 0.4299  335 ARG B C   
2042 O O   . ARG B 38  ? 0.8300 1.2343 0.8534 0.1071  -0.1902 0.4228  335 ARG B O   
2043 C CB  . ARG B 38  ? 0.8615 1.3472 0.8129 0.0572  -0.2602 0.3776  335 ARG B CB  
2044 N N   . PRO B 39  ? 0.9156 1.4005 0.9902 0.1111  -0.2382 0.4490  336 PRO B N   
2045 C CA  . PRO B 39  ? 0.9013 1.3722 1.0383 0.1317  -0.2127 0.4620  336 PRO B CA  
2046 C C   . PRO B 39  ? 0.8689 1.3310 1.0456 0.1239  -0.1959 0.4394  336 PRO B C   
2047 O O   . PRO B 39  ? 0.8368 1.3256 1.0200 0.1028  -0.2168 0.4191  336 PRO B O   
2048 C CB  . PRO B 39  ? 0.9222 1.4497 1.1042 0.1381  -0.2398 0.4834  336 PRO B CB  
2049 C CG  . PRO B 39  ? 0.9403 1.5152 1.0977 0.1129  -0.2818 0.4705  336 PRO B CG  
2050 C CD  . PRO B 39  ? 0.9601 1.5036 1.0367 0.1024  -0.2798 0.4576  336 PRO B CD  
2051 N N   . PHE B 40  ? 0.8809 1.3042 1.0816 0.1396  -0.1593 0.4415  337 PHE B N   
2052 C CA  . PHE B 40  ? 0.8513 1.2610 1.0843 0.1331  -0.1394 0.4220  337 PHE B CA  
2053 C C   . PHE B 40  ? 0.8188 1.2750 1.1178 0.1286  -0.1517 0.4253  337 PHE B C   
2054 O O   . PHE B 40  ? 0.8102 1.2999 1.1414 0.1397  -0.1610 0.4465  337 PHE B O   
2055 C CB  . PHE B 40  ? 0.8606 1.2158 1.0919 0.1487  -0.0969 0.4205  337 PHE B CB  
2056 N N   . SER B 41  ? 0.7743 1.2326 1.0941 0.1116  -0.1518 0.4053  338 SER B N   
2057 C CA  . SER B 41  ? 0.7369 1.2314 1.1192 0.1032  -0.1583 0.4068  338 SER B CA  
2058 C C   . SER B 41  ? 0.6913 1.1564 1.0877 0.0936  -0.1366 0.3880  338 SER B C   
2059 O O   . SER B 41  ? 0.6728 1.1030 1.0323 0.0883  -0.1297 0.3704  338 SER B O   
2060 C CB  . SER B 41  ? 0.7542 1.3034 1.1494 0.0816  -0.2040 0.4029  338 SER B CB  
2061 O OG  . SER B 41  ? 0.7510 1.2924 1.1194 0.0589  -0.2222 0.3760  338 SER B OG  
2062 N N   . GLU B 42  ? 0.6670 1.6030 1.0712 -0.0459 -0.2078 0.2066  339 GLU B N   
2063 C CA  . GLU B 42  ? 0.6082 1.5286 1.0338 -0.0623 -0.1660 0.2051  339 GLU B CA  
2064 C C   . GLU B 42  ? 0.5792 1.4595 0.9723 -0.1245 -0.1686 0.1796  339 GLU B C   
2065 O O   . GLU B 42  ? 0.5715 1.3654 0.9152 -0.1284 -0.1379 0.1704  339 GLU B O   
2066 C CB  . GLU B 42  ? 0.6351 1.6270 1.1529 -0.0609 -0.1405 0.2129  339 GLU B CB  
2067 C CG  . GLU B 42  ? 0.6242 1.5895 1.1583 -0.0776 -0.0918 0.2113  339 GLU B CG  
2068 C CD  . GLU B 42  ? 0.6683 1.6951 1.2845 -0.0741 -0.0622 0.2200  339 GLU B CD  
2069 O OE1 . GLU B 42  ? 0.7097 1.8012 1.3841 -0.1068 -0.0813 0.2120  339 GLU B OE1 
2070 O OE2 . GLU B 42  ? 0.6714 1.6783 1.2911 -0.0379 -0.0195 0.2344  339 GLU B OE2 
2071 N N   . ALA B 43  ? 0.6052 1.5087 1.0045 -0.1661 -0.1993 0.1613  340 ALA B N   
2072 C CA  . ALA B 43  ? 0.6336 1.4859 0.9915 -0.2245 -0.2025 0.1335  340 ALA B CA  
2073 C C   . ALA B 43  ? 0.6619 1.4319 0.9185 -0.2231 -0.2121 0.1238  340 ALA B C   
2074 O O   . ALA B 43  ? 0.7013 1.3867 0.9065 -0.2467 -0.1881 0.1039  340 ALA B O   
2075 C CB  . ALA B 43  ? 0.6850 1.5746 1.0679 -0.2639 -0.2364 0.1162  340 ALA B CB  
2076 N N   . SER B 44  ? 0.6422 1.4068 0.8579 -0.1860 -0.2364 0.1356  341 SER B N   
2077 C CA  . SER B 44  ? 0.6213 1.3006 0.7359 -0.1821 -0.2408 0.1276  341 SER B CA  
2078 C C   . SER B 44  ? 0.5948 1.1923 0.6747 -0.1514 -0.1971 0.1337  341 SER B C   
2079 O O   . SER B 44  ? 0.6068 1.1247 0.6263 -0.1659 -0.1786 0.1172  341 SER B O   
2080 C CB  . SER B 44  ? 0.6088 1.2872 0.6829 -0.1520 -0.2729 0.1371  341 SER B CB  
2081 O OG  . SER B 44  ? 0.5664 1.2636 0.6659 -0.0981 -0.2667 0.1640  341 SER B OG  
2082 N N   . MET B 45  ? 0.5677 1.1843 0.6849 -0.1081 -0.1819 0.1567  342 MET B N   
2083 C CA  . MET B 45  ? 0.5435 1.0823 0.6278 -0.0803 -0.1470 0.1619  342 MET B CA  
2084 C C   . MET B 45  ? 0.5297 1.0260 0.6209 -0.1039 -0.1120 0.1446  342 MET B C   
2085 O O   . MET B 45  ? 0.5614 0.9811 0.6036 -0.1041 -0.0929 0.1351  342 MET B O   
2086 C CB  . MET B 45  ? 0.5325 1.0908 0.6461 -0.0285 -0.1395 0.1880  342 MET B CB  
2087 C CG  . MET B 45  ? 0.5258 0.9987 0.6022 -0.0042 -0.1087 0.1908  342 MET B CG  
2088 S SD  . MET B 45  ? 1.5636 2.0187 1.6272 0.0583  -0.1099 0.2194  342 MET B SD  
2089 C CE  . MET B 45  ? 0.5075 1.0396 0.6531 0.0825  -0.0932 0.2309  342 MET B CE  
2090 N N   . MET B 46  ? 0.4688 1.0165 0.6224 -0.1229 -0.1031 0.1421  343 MET B N   
2091 C CA  . MET B 46  ? 0.4581 0.9608 0.6114 -0.1485 -0.0713 0.1262  343 MET B CA  
2092 C C   . MET B 46  ? 0.5164 0.9677 0.6152 -0.1888 -0.0786 0.1000  343 MET B C   
2093 O O   . MET B 46  ? 0.5326 0.9109 0.5945 -0.1947 -0.0534 0.0866  343 MET B O   
2094 C CB  . MET B 46  ? 0.4329 1.0028 0.6634 -0.1672 -0.0592 0.1309  343 MET B CB  
2095 C CG  . MET B 46  ? 0.3940 0.9918 0.6673 -0.1223 -0.0346 0.1548  343 MET B CG  
2096 S SD  . MET B 46  ? 0.5270 1.0132 0.7373 -0.0851 0.0007  0.1554  343 MET B SD  
2097 C CE  . MET B 46  ? 0.3619 0.7893 0.5542 -0.1294 0.0278  0.1334  343 MET B CE  
2098 N N   . GLY B 47  ? 0.5210 1.0078 0.6096 -0.2123 -0.1144 0.0927  344 GLY B N   
2099 C CA  . GLY B 47  ? 0.5037 0.9355 0.5260 -0.2452 -0.1233 0.0674  344 GLY B CA  
2100 C C   . GLY B 47  ? 0.5561 0.9135 0.5078 -0.2203 -0.1093 0.0661  344 GLY B C   
2101 O O   . GLY B 47  ? 0.5728 0.8628 0.4769 -0.2340 -0.0908 0.0470  344 GLY B O   
2102 N N   . LEU B 48  ? 0.4874 0.8570 0.4340 -0.1834 -0.1170 0.0875  345 LEU B N   
2103 C CA  . LEU B 48  ? 0.5199 0.8267 0.4116 -0.1618 -0.1018 0.0908  345 LEU B CA  
2104 C C   . LEU B 48  ? 0.5185 0.7752 0.4178 -0.1510 -0.0660 0.0870  345 LEU B C   
2105 O O   . LEU B 48  ? 0.5478 0.7497 0.4074 -0.1543 -0.0483 0.0750  345 LEU B O   
2106 C CB  . LEU B 48  ? 0.4962 0.8204 0.3846 -0.1261 -0.1159 0.1171  345 LEU B CB  
2107 C CG  . LEU B 48  ? 0.6040 0.9642 0.4668 -0.1264 -0.1533 0.1250  345 LEU B CG  
2108 C CD1 . LEU B 48  ? 0.6291 0.9965 0.4901 -0.0850 -0.1625 0.1540  345 LEU B CD1 
2109 C CD2 . LEU B 48  ? 0.6712 0.9837 0.4556 -0.1465 -0.1559 0.1098  345 LEU B CD2 
2110 N N   . LEU B 49  ? 0.4695 0.7466 0.4186 -0.1350 -0.0554 0.0980  346 LEU B N   
2111 C CA  . LEU B 49  ? 0.4733 0.7013 0.4244 -0.1216 -0.0262 0.0955  346 LEU B CA  
2112 C C   . LEU B 49  ? 0.4769 0.6688 0.4152 -0.1500 -0.0090 0.0727  346 LEU B C   
2113 O O   . LEU B 49  ? 0.4538 0.5896 0.3655 -0.1430 0.0097  0.0638  346 LEU B O   
2114 C CB  . LEU B 49  ? 0.4474 0.6995 0.4426 -0.0958 -0.0177 0.1125  346 LEU B CB  
2115 C CG  . LEU B 49  ? 0.4080 0.6802 0.4079 -0.0603 -0.0317 0.1352  346 LEU B CG  
2116 C CD1 . LEU B 49  ? 0.3789 0.6627 0.4121 -0.0304 -0.0174 0.1496  346 LEU B CD1 
2117 C CD2 . LEU B 49  ? 0.4159 0.6322 0.3707 -0.0463 -0.0322 0.1381  346 LEU B CD2 
2118 N N   . THR B 50  ? 0.5044 0.7280 0.4620 -0.1823 -0.0168 0.0636  347 THR B N   
2119 C CA  . THR B 50  ? 0.5315 0.7110 0.4679 -0.2138 -0.0026 0.0412  347 THR B CA  
2120 C C   . THR B 50  ? 0.5572 0.6832 0.4282 -0.2220 -0.0029 0.0222  347 THR B C   
2121 O O   . THR B 50  ? 0.5878 0.6512 0.4280 -0.2203 0.0197  0.0087  347 THR B O   
2122 C CB  . THR B 50  ? 0.5387 0.7647 0.5094 -0.2548 -0.0160 0.0351  347 THR B CB  
2123 O OG1 . THR B 50  ? 0.4810 0.7536 0.5158 -0.2463 -0.0041 0.0530  347 THR B OG1 
2124 C CG2 . THR B 50  ? 0.5929 0.7566 0.5265 -0.2914 -0.0037 0.0100  347 THR B CG2 
2125 N N   . ASN B 51  ? 0.5850 0.7340 0.4315 -0.2268 -0.0268 0.0222  348 ASN B N   
2126 C CA  . ASN B 51  ? 0.6434 0.7435 0.4220 -0.2306 -0.0234 0.0065  348 ASN B CA  
2127 C C   . ASN B 51  ? 0.6045 0.6663 0.3700 -0.1985 0.0024  0.0125  348 ASN B C   
2128 O O   . ASN B 51  ? 0.5934 0.6032 0.3205 -0.1976 0.0229  -0.0033 348 ASN B O   
2129 C CB  . ASN B 51  ? 0.7510 0.8825 0.5006 -0.2365 -0.0538 0.0105  348 ASN B CB  
2130 C CG  . ASN B 51  ? 0.9474 1.0250 0.6174 -0.2387 -0.0458 -0.0047 348 ASN B CG  
2131 O OD1 . ASN B 51  ? 0.9878 1.0487 0.6381 -0.2139 -0.0296 0.0060  348 ASN B OD1 
2132 N ND2 . ASN B 51  ? 1.0415 1.0898 0.6634 -0.2695 -0.0561 -0.0294 348 ASN B ND2 
2133 N N   . LEU B 52  ? 0.4952 0.5834 0.2941 -0.1717 0.0005  0.0352  349 LEU B N   
2134 C CA  . LEU B 52  ? 0.5176 0.5781 0.3151 -0.1457 0.0189  0.0427  349 LEU B CA  
2135 C C   . LEU B 52  ? 0.5377 0.5606 0.3480 -0.1371 0.0408  0.0335  349 LEU B C   
2136 O O   . LEU B 52  ? 0.5475 0.5369 0.3417 -0.1264 0.0583  0.0261  349 LEU B O   
2137 C CB  . LEU B 52  ? 0.4744 0.5621 0.3000 -0.1229 0.0077  0.0678  349 LEU B CB  
2138 C CG  . LEU B 52  ? 0.4749 0.5383 0.3051 -0.1013 0.0195  0.0779  349 LEU B CG  
2139 C CD1 . LEU B 52  ? 0.4881 0.5384 0.2840 -0.1062 0.0290  0.0764  349 LEU B CD1 
2140 C CD2 . LEU B 52  ? 0.4526 0.5304 0.3036 -0.0814 0.0056  0.1004  349 LEU B CD2 
2141 N N   . ALA B 53  ? 0.4835 0.5134 0.3225 -0.1396 0.0408  0.0355  350 ALA B N   
2142 C CA  . ALA B 53  ? 0.5217 0.5091 0.3640 -0.1290 0.0604  0.0294  350 ALA B CA  
2143 C C   . ALA B 53  ? 0.5831 0.5213 0.3859 -0.1433 0.0755  0.0066  350 ALA B C   
2144 O O   . ALA B 53  ? 0.6109 0.5064 0.4011 -0.1246 0.0919  0.0005  350 ALA B O   
2145 C CB  . ALA B 53  ? 0.4286 0.4309 0.3019 -0.1315 0.0623  0.0377  350 ALA B CB  
2146 N N   . ASP B 54  ? 0.6077 0.5489 0.3876 -0.1746 0.0677  -0.0065 351 ASP B N   
2147 C CA  . ASP B 54  ? 0.6548 0.5368 0.3851 -0.1894 0.0813  -0.0302 351 ASP B CA  
2148 C C   . ASP B 54  ? 0.6947 0.5479 0.3894 -0.1676 0.0955  -0.0378 351 ASP B C   
2149 O O   . ASP B 54  ? 0.7766 0.5738 0.4407 -0.1571 0.1159  -0.0520 351 ASP B O   
2150 C CB  . ASP B 54  ? 0.7514 0.6401 0.4592 -0.2308 0.0639  -0.0441 351 ASP B CB  
2151 C CG  . ASP B 54  ? 0.8923 0.7047 0.5353 -0.2472 0.0769  -0.0711 351 ASP B CG  
2152 O OD1 . ASP B 54  ? 0.9583 0.7236 0.5955 -0.2568 0.0911  -0.0786 351 ASP B OD1 
2153 O OD2 . ASP B 54  ? 0.9329 0.7250 0.5236 -0.2486 0.0749  -0.0843 351 ASP B OD2 
2154 N N   . ARG B 55  ? 0.6487 0.5398 0.3477 -0.1591 0.0873  -0.0267 352 ARG B N   
2155 C CA  . ARG B 55  ? 0.6749 0.5510 0.3509 -0.1392 0.1055  -0.0293 352 ARG B CA  
2156 C C   . ARG B 55  ? 0.6340 0.5130 0.3514 -0.1076 0.1181  -0.0182 352 ARG B C   
2157 O O   . ARG B 55  ? 0.5771 0.4343 0.2850 -0.0885 0.1390  -0.0253 352 ARG B O   
2158 C CB  . ARG B 55  ? 0.7037 0.6136 0.3640 -0.1442 0.0953  -0.0191 352 ARG B CB  
2159 C CG  . ARG B 55  ? 0.8091 0.6976 0.4035 -0.1682 0.0880  -0.0366 352 ARG B CG  
2160 C CD  . ARG B 55  ? 0.8393 0.7683 0.4235 -0.1783 0.0629  -0.0226 352 ARG B CD  
2161 N NE  . ARG B 55  ? 0.8816 0.8307 0.4769 -0.1575 0.0738  -0.0015 352 ARG B NE  
2162 C CZ  . ARG B 55  ? 0.8050 0.7936 0.4319 -0.1522 0.0559  0.0225  352 ARG B CZ  
2163 N NH1 . ARG B 55  ? 0.7080 0.7282 0.3624 -0.1609 0.0273  0.0287  352 ARG B NH1 
2164 N NH2 . ARG B 55  ? 0.7866 0.7823 0.4181 -0.1381 0.0684  0.0410  352 ARG B NH2 
2165 N N   . GLU B 56  ? 0.5777 0.4835 0.3401 -0.1006 0.1041  -0.0011 353 GLU B N   
2166 C CA  . GLU B 56  ? 0.5678 0.4713 0.3649 -0.0735 0.1082  0.0077  353 GLU B CA  
2167 C C   . GLU B 56  ? 0.5650 0.4203 0.3507 -0.0599 0.1216  -0.0052 353 GLU B C   
2168 O O   . GLU B 56  ? 0.5396 0.3852 0.3401 -0.0344 0.1287  -0.0050 353 GLU B O   
2169 C CB  . GLU B 56  ? 0.5499 0.4782 0.3816 -0.0681 0.0893  0.0264  353 GLU B CB  
2170 C CG  . GLU B 56  ? 0.5229 0.4884 0.3660 -0.0718 0.0763  0.0432  353 GLU B CG  
2171 C CD  . GLU B 56  ? 0.5539 0.5299 0.4223 -0.0606 0.0594  0.0601  353 GLU B CD  
2172 O OE1 . GLU B 56  ? 0.5822 0.5724 0.4521 -0.0666 0.0505  0.0645  353 GLU B OE1 
2173 O OE2 . GLU B 56  ? 0.5373 0.5072 0.4244 -0.0454 0.0548  0.0685  353 GLU B OE2 
2174 N N   . LEU B 57  ? 0.5579 0.3833 0.3182 -0.0778 0.1237  -0.0155 354 LEU B N   
2175 C CA  . LEU B 57  ? 0.5844 0.3505 0.3217 -0.0676 0.1381  -0.0264 354 LEU B CA  
2176 C C   . LEU B 57  ? 0.6623 0.3912 0.3683 -0.0497 0.1572  -0.0418 354 LEU B C   
2177 O O   . LEU B 57  ? 0.6241 0.3169 0.3261 -0.0215 0.1666  -0.0444 354 LEU B O   
2178 C CB  . LEU B 57  ? 0.6449 0.3844 0.3587 -0.0995 0.1393  -0.0344 354 LEU B CB  
2179 C CG  . LEU B 57  ? 0.6351 0.3881 0.3778 -0.1042 0.1338  -0.0197 354 LEU B CG  
2180 C CD1 . LEU B 57  ? 0.6812 0.4113 0.4071 -0.1412 0.1394  -0.0279 354 LEU B CD1 
2181 C CD2 . LEU B 57  ? 0.6309 0.3478 0.3742 -0.0689 0.1412  -0.0126 354 LEU B CD2 
2182 N N   . VAL B 58  ? 0.7134 0.4491 0.3929 -0.0624 0.1632  -0.0515 355 VAL B N   
2183 C CA  . VAL B 58  ? 0.7688 0.4700 0.4141 -0.0418 0.1865  -0.0661 355 VAL B CA  
2184 C C   . VAL B 58  ? 0.7045 0.4428 0.3979 -0.0056 0.1931  -0.0545 355 VAL B C   
2185 O O   . VAL B 58  ? 0.6808 0.3913 0.3692 0.0259  0.2090  -0.0614 355 VAL B O   
2186 C CB  . VAL B 58  ? 0.8463 0.5459 0.4451 -0.0613 0.1926  -0.0778 355 VAL B CB  
2187 C CG1 . VAL B 58  ? 0.8417 0.4928 0.3931 -0.0361 0.2224  -0.0951 355 VAL B CG1 
2188 C CG2 . VAL B 58  ? 0.9215 0.5975 0.4833 -0.1029 0.1763  -0.0885 355 VAL B CG2 
2189 N N   . HIS B 59  ? 0.5911 0.3920 0.3327 -0.0103 0.1793  -0.0363 356 HIS B N   
2190 C CA  . HIS B 59  ? 0.6064 0.4491 0.4038 0.0153  0.1803  -0.0238 356 HIS B CA  
2191 C C   . HIS B 59  ? 0.5735 0.4017 0.3983 0.0384  0.1665  -0.0196 356 HIS B C   
2192 O O   . HIS B 59  ? 0.5738 0.4120 0.4280 0.0682  0.1708  -0.0190 356 HIS B O   
2193 C CB  . HIS B 59  ? 0.5083 0.4081 0.3420 -0.0011 0.1674  -0.0049 356 HIS B CB  
2194 C CG  . HIS B 59  ? 0.5506 0.4673 0.3590 -0.0142 0.1847  -0.0052 356 HIS B CG  
2195 N ND1 . HIS B 59  ? 0.5839 0.5296 0.4133 -0.0001 0.2087  -0.0011 356 HIS B ND1 
2196 C CD2 . HIS B 59  ? 0.5919 0.5004 0.3531 -0.0390 0.1817  -0.0084 356 HIS B CD2 
2197 C CE1 . HIS B 59  ? 0.6316 0.5787 0.4194 -0.0147 0.2234  -0.0012 356 HIS B CE1 
2198 N NE2 . HIS B 59  ? 0.6493 0.5722 0.3924 -0.0379 0.2042  -0.0063 356 HIS B NE2 
2199 N N   . MET B 60  ? 0.5652 0.3718 0.3797 0.0264  0.1501  -0.0161 357 MET B N   
2200 C CA  . MET B 60  ? 0.5368 0.3204 0.3629 0.0482  0.1367  -0.0109 357 MET B CA  
2201 C C   . MET B 60  ? 0.6244 0.3515 0.4192 0.0760  0.1511  -0.0234 357 MET B C   
2202 O O   . MET B 60  ? 0.6428 0.3645 0.4559 0.1078  0.1419  -0.0199 357 MET B O   
2203 C CB  . MET B 60  ? 0.5214 0.2890 0.3339 0.0304  0.1252  -0.0043 357 MET B CB  
2204 C CG  . MET B 60  ? 0.5237 0.2621 0.3369 0.0540  0.1125  0.0029  357 MET B CG  
2205 S SD  . MET B 60  ? 0.5191 0.2224 0.3018 0.0374  0.1163  0.0080  357 MET B SD  
2206 C CE  . MET B 60  ? 0.4607 0.2292 0.2766 0.0123  0.1028  0.0205  357 MET B CE  
2207 N N   . ILE B 61  ? 0.6357 0.3160 0.3788 0.0643  0.1711  -0.0382 358 ILE B N   
2208 C CA  . ILE B 61  ? 0.7411 0.3527 0.4411 0.0907  0.1877  -0.0507 358 ILE B CA  
2209 C C   . ILE B 61  ? 0.8094 0.4454 0.5364 0.1307  0.1966  -0.0528 358 ILE B C   
2210 O O   . ILE B 61  ? 0.8201 0.4411 0.5551 0.1643  0.1888  -0.0496 358 ILE B O   
2211 C CB  . ILE B 61  ? 0.8490 0.4011 0.4834 0.0653  0.2068  -0.0683 358 ILE B CB  
2212 C CG1 . ILE B 61  ? 0.8533 0.3844 0.4713 0.0269  0.1983  -0.0651 358 ILE B CG1 
2213 C CG2 . ILE B 61  ? 0.9042 0.4113 0.5125 0.0882  0.2118  -0.0709 358 ILE B CG2 
2214 C CD1 . ILE B 61  ? 0.9418 0.4363 0.5105 -0.0125 0.2074  -0.0814 358 ILE B CD1 
2215 N N   . ASN B 62  ? 0.7719 0.4587 0.5202 0.1235  0.2083  -0.0540 359 ASN B N   
2216 C CA  . ASN B 62  ? 0.7729 0.5004 0.5606 0.1590  0.2218  -0.0531 359 ASN B CA  
2217 C C   . ASN B 62  ? 0.6283 0.4236 0.4971 0.1738  0.1968  -0.0361 359 ASN B C   
2218 O O   . ASN B 62  ? 0.6391 0.4612 0.5480 0.2111  0.1986  -0.0344 359 ASN B O   
2219 C CB  . ASN B 62  ? 0.8481 0.6083 0.6306 0.1454  0.2465  -0.0570 359 ASN B CB  
2220 C CG  . ASN B 62  ? 0.9822 0.6695 0.6813 0.1420  0.2692  -0.0772 359 ASN B CG  
2221 O OD1 . ASN B 62  ? 1.0600 0.7328 0.7507 0.1698  0.2809  -0.0825 359 ASN B OD1 
2222 N ND2 . ASN B 62  ? 0.9980 0.6506 0.6471 0.1011  0.2622  -0.0843 359 ASN B ND2 
2223 N N   . TRP B 63  ? 0.5802 0.4020 0.4725 0.1453  0.1717  -0.0239 360 TRP B N   
2224 C CA  . TRP B 63  ? 0.5458 0.4124 0.5002 0.1545  0.1416  -0.0101 360 TRP B CA  
2225 C C   . TRP B 63  ? 0.6161 0.4345 0.5533 0.1874  0.1236  -0.0123 360 TRP B C   
2226 O O   . TRP B 63  ? 0.6401 0.4894 0.6242 0.2149  0.1044  -0.0074 360 TRP B O   
2227 C CB  . TRP B 63  ? 0.4800 0.3658 0.4446 0.1195  0.1207  0.0018  360 TRP B CB  
2228 C CG  . TRP B 63  ? 0.5336 0.4278 0.5299 0.1279  0.0853  0.0118  360 TRP B CG  
2229 C CD1 . TRP B 63  ? 0.4815 0.4312 0.5427 0.1287  0.0651  0.0215  360 TRP B CD1 
2230 C CD2 . TRP B 63  ? 0.5396 0.3798 0.4983 0.1352  0.0659  0.0127  360 TRP B CD2 
2231 N NE1 . TRP B 63  ? 0.4496 0.3774 0.5100 0.1362  0.0299  0.0260  360 TRP B NE1 
2232 C CE2 . TRP B 63  ? 0.5077 0.3672 0.5024 0.1432  0.0319  0.0211  360 TRP B CE2 
2233 C CE3 . TRP B 63  ? 0.5867 0.3624 0.4835 0.1342  0.0756  0.0076  360 TRP B CE3 
2234 C CZ2 . TRP B 63  ? 0.5196 0.3299 0.4799 0.1551  0.0082  0.0236  360 TRP B CZ2 
2235 C CZ3 . TRP B 63  ? 0.5742 0.3083 0.4451 0.1451  0.0568  0.0129  360 TRP B CZ3 
2236 C CH2 . TRP B 63  ? 0.5400 0.2885 0.4375 0.1578  0.0237  0.0203  360 TRP B CH2 
2237 N N   . ALA B 64  ? 0.6218 0.3646 0.4912 0.1834  0.1291  -0.0187 361 ALA B N   
2238 C CA  . ALA B 64  ? 0.6424 0.3280 0.4792 0.2106  0.1153  -0.0188 361 ALA B CA  
2239 C C   . ALA B 64  ? 0.6698 0.3617 0.5184 0.2437  0.1158  -0.0236 361 ALA B C   
2240 O O   . ALA B 64  ? 0.6806 0.3760 0.5434 0.2637  0.0898  -0.0190 361 ALA B O   
2241 C CB  . ALA B 64  ? 0.6589 0.2862 0.4325 0.1823  0.1237  -0.0209 361 ALA B CB  
2242 N N   . LYS B 65  ? 0.6987 0.3913 0.5383 0.2492  0.1454  -0.0331 362 LYS B N   
2243 C CA  . LYS B 65  ? 0.7455 0.4430 0.5945 0.2835  0.1500  -0.0374 362 LYS B CA  
2244 C C   . LYS B 65  ? 0.7725 0.5498 0.7081 0.3157  0.1348  -0.0305 362 LYS B C   
2245 O O   . LYS B 65  ? 0.7947 0.5805 0.7493 0.3468  0.1228  -0.0304 362 LYS B O   
2246 C CB  . LYS B 65  ? 0.7885 0.4704 0.6065 0.2811  0.1857  -0.0488 362 LYS B CB  
2247 C CG  . LYS B 65  ? 0.9063 0.5133 0.6453 0.2470  0.1968  -0.0558 362 LYS B CG  
2248 C CD  . LYS B 65  ? 0.9514 0.5376 0.6551 0.2469  0.2258  -0.0682 362 LYS B CD  
2249 C CE  . LYS B 65  ? 0.9905 0.5011 0.6195 0.2112  0.2316  -0.0752 362 LYS B CE  
2250 N NZ  . LYS B 65  ? 1.0496 0.5233 0.6325 0.2147  0.2540  -0.0878 362 LYS B NZ  
2251 N N   . ARG B 66  ? 0.7086 0.5488 0.7013 0.3071  0.1353  -0.0226 363 ARG B N   
2252 C CA  . ARG B 66  ? 0.6975 0.6341 0.7899 0.3237  0.1180  -0.0123 363 ARG B CA  
2253 C C   . ARG B 66  ? 0.6750 0.6206 0.7947 0.3234  0.0667  -0.0034 363 ARG B C   
2254 O O   . ARG B 66  ? 0.6382 0.6621 0.8424 0.3288  0.0413  0.0046  363 ARG B O   
2255 C CB  . ARG B 66  ? 0.6828 0.6966 0.8285 0.2864  0.1368  -0.0055 363 ARG B CB  
2256 C CG  . ARG B 66  ? 0.7641 0.7808 0.8901 0.2952  0.1873  -0.0137 363 ARG B CG  
2257 C CD  . ARG B 66  ? 0.7874 0.8478 0.9278 0.2507  0.2069  -0.0070 363 ARG B CD  
2258 N NE  . ARG B 66  ? 0.7864 0.9441 1.0266 0.2357  0.1931  0.0101  363 ARG B NE  
2259 C CZ  . ARG B 66  ? 0.7953 1.0323 1.1038 0.2457  0.2211  0.0174  363 ARG B CZ  
2260 N NH1 . ARG B 66  ? 0.8793 1.1068 1.1608 0.2767  0.2660  0.0082  363 ARG B NH1 
2261 N NH2 . ARG B 66  ? 0.7374 1.0601 1.1393 0.2240  0.2063  0.0343  363 ARG B NH2 
2262 N N   . VAL B 67  ? 0.6549 0.5161 0.5466 0.1793  0.0863  0.0489  364 VAL B N   
2263 C CA  . VAL B 67  ? 0.6362 0.5071 0.5328 0.1734  0.0601  0.0571  364 VAL B CA  
2264 C C   . VAL B 67  ? 0.6825 0.5460 0.5760 0.2067  0.0534  0.0686  364 VAL B C   
2265 O O   . VAL B 67  ? 0.7117 0.5198 0.5675 0.2229  0.0663  0.0678  364 VAL B O   
2266 C CB  . VAL B 67  ? 0.6495 0.4735 0.5056 0.1508  0.0558  0.0500  364 VAL B CB  
2267 C CG1 . VAL B 67  ? 0.6732 0.4971 0.5214 0.1521  0.0315  0.0581  364 VAL B CG1 
2268 C CG2 . VAL B 67  ? 0.6208 0.4580 0.4831 0.1207  0.0580  0.0408  364 VAL B CG2 
2269 N N   . PRO B 68  ? 0.7292 0.6483 0.6632 0.2166  0.0320  0.0798  365 PRO B N   
2270 C CA  . PRO B 68  ? 0.7908 0.7179 0.7310 0.2525  0.0219  0.0929  365 PRO B CA  
2271 C C   . PRO B 68  ? 0.8381 0.6982 0.7206 0.2644  0.0177  0.0964  365 PRO B C   
2272 O O   . PRO B 68  ? 0.8906 0.7328 0.7478 0.2463  0.0017  0.0950  365 PRO B O   
2273 C CB  . PRO B 68  ? 0.7601 0.7572 0.7496 0.2455  -0.0099 0.1006  365 PRO B CB  
2274 C CG  . PRO B 68  ? 0.7206 0.7571 0.7463 0.2140  -0.0045 0.0940  365 PRO B CG  
2275 C CD  . PRO B 68  ? 0.7018 0.6804 0.6805 0.1924  0.0143  0.0807  365 PRO B CD  
2276 N N   . GLY B 69  ? 0.8767 0.6965 0.7359 0.2959  0.0343  0.1017  366 GLY B N   
2277 C CA  . GLY B 69  ? 0.9512 0.7040 0.7554 0.3102  0.0338  0.1092  366 GLY B CA  
2278 C C   . GLY B 69  ? 0.9665 0.6425 0.7236 0.2949  0.0603  0.0992  366 GLY B C   
2279 O O   . GLY B 69  ? 1.0308 0.6424 0.7441 0.3104  0.0696  0.1066  366 GLY B O   
2280 N N   . PHE B 70  ? 0.8707 0.5534 0.6373 0.2639  0.0716  0.0834  367 PHE B N   
2281 C CA  . PHE B 70  ? 0.8807 0.5001 0.6097 0.2432  0.0921  0.0719  367 PHE B CA  
2282 C C   . PHE B 70  ? 0.9383 0.5036 0.6448 0.2645  0.1158  0.0682  367 PHE B C   
2283 O O   . PHE B 70  ? 0.9914 0.4862 0.6573 0.2594  0.1286  0.0670  367 PHE B O   
2284 C CB  . PHE B 70  ? 0.8117 0.4576 0.5579 0.2079  0.0948  0.0561  367 PHE B CB  
2285 C CG  . PHE B 70  ? 0.8060 0.3982 0.5204 0.1826  0.1098  0.0442  367 PHE B CG  
2286 C CD1 . PHE B 70  ? 0.7885 0.3610 0.4840 0.1615  0.1051  0.0467  367 PHE B CD1 
2287 C CD2 . PHE B 70  ? 0.8557 0.4188 0.5595 0.1802  0.1284  0.0300  367 PHE B CD2 
2288 C CE1 . PHE B 70  ? 0.7883 0.3202 0.4639 0.1367  0.1185  0.0371  367 PHE B CE1 
2289 C CE2 . PHE B 70  ? 0.8756 0.3934 0.5549 0.1538  0.1382  0.0180  367 PHE B CE2 
2290 C CZ  . PHE B 70  ? 0.8156 0.3215 0.4853 0.1312  0.1332  0.0224  367 PHE B CZ  
2291 N N   . VAL B 71  ? 0.9370 0.5336 0.6697 0.2883  0.1228  0.0665  368 VAL B N   
2292 C CA  . VAL B 71  ? 0.9972 0.5407 0.7057 0.3119  0.1464  0.0601  368 VAL B CA  
2293 C C   . VAL B 71  ? 1.0420 0.5597 0.7337 0.3383  0.1435  0.0750  368 VAL B C   
2294 O O   . VAL B 71  ? 1.0560 0.5271 0.7221 0.3435  0.1579  0.0698  368 VAL B O   
2295 C CB  . VAL B 71  ? 1.0386 0.6304 0.7794 0.3272  0.1582  0.0524  368 VAL B CB  
2296 C CG1 . VAL B 71  ? 1.0465 0.6720 0.8136 0.3730  0.1575  0.0681  368 VAL B CG1 
2297 C CG2 . VAL B 71  ? 1.1006 0.6412 0.8086 0.3170  0.1799  0.0314  368 VAL B CG2 
2298 N N   . ASP B 72  ? 1.0506 0.5994 0.7548 0.3531  0.1224  0.0930  369 ASP B N   
2299 C CA  . ASP B 72  ? 1.0945 0.6223 0.7797 0.3755  0.1165  0.1079  369 ASP B CA  
2300 C C   . ASP B 72  ? 1.1225 0.5794 0.7583 0.3520  0.1245  0.1073  369 ASP B C   
2301 O O   . ASP B 72  ? 1.2268 0.6470 0.8370 0.3668  0.1285  0.1166  369 ASP B O   
2302 C CB  . ASP B 72  ? 1.0854 0.6686 0.7942 0.3932  0.0874  0.1253  369 ASP B CB  
2303 C CG  . ASP B 72  ? 1.0815 0.7469 0.8506 0.4166  0.0775  0.1292  369 ASP B CG  
2304 O OD1 . ASP B 72  ? 1.0898 0.7650 0.8768 0.4345  0.0957  0.1245  369 ASP B OD1 
2305 O OD2 . ASP B 72  ? 1.0839 0.8072 0.8837 0.4157  0.0514  0.1371  369 ASP B OD2 
2306 N N   . LEU B 73  ? 1.0607 0.5020 0.6863 0.3155  0.1277  0.0975  370 LEU B N   
2307 C CA  . LEU B 73  ? 1.0798 0.4676 0.6690 0.2898  0.1361  0.0981  370 LEU B CA  
2308 C C   . LEU B 73  ? 1.1254 0.4579 0.6948 0.2775  0.1573  0.0863  370 LEU B C   
2309 O O   . LEU B 73  ? 1.0795 0.4129 0.6590 0.2814  0.1658  0.0725  370 LEU B O   
2310 C CB  . LEU B 73  ? 1.0171 0.4158 0.6081 0.2554  0.1316  0.0925  370 LEU B CB  
2311 C CG  . LEU B 73  ? 0.9939 0.4348 0.5932 0.2616  0.1089  0.1038  370 LEU B CG  
2312 C CD1 . LEU B 73  ? 0.9778 0.4231 0.5761 0.2273  0.1083  0.0964  370 LEU B CD1 
2313 C CD2 . LEU B 73  ? 1.0579 0.4856 0.6307 0.2789  0.1005  0.1211  370 LEU B CD2 
2314 N N   . THR B 74  ? 1.1932 0.4780 0.7335 0.2628  0.1656  0.0919  371 THR B N   
2315 C CA  . THR B 74  ? 1.2442 0.4733 0.7660 0.2443  0.1829  0.0812  371 THR B CA  
2316 C C   . THR B 74  ? 1.2074 0.4441 0.7434 0.2091  0.1862  0.0600  371 THR B C   
2317 O O   . THR B 74  ? 1.1434 0.4152 0.6953 0.1906  0.1785  0.0579  371 THR B O   
2318 C CB  . THR B 74  ? 1.2839 0.4681 0.7780 0.2322  0.1908  0.0941  371 THR B CB  
2319 O OG1 . THR B 74  ? 1.3366 0.4914 0.8094 0.2654  0.1936  0.1084  371 THR B OG1 
2320 C CG2 . THR B 74  ? 1.3331 0.4742 0.8203 0.1955  0.2049  0.0812  371 THR B CG2 
2321 N N   . LEU B 75  ? 1.1647 0.3686 0.6932 0.2017  0.1960  0.0437  372 LEU B N   
2322 C CA  . LEU B 75  ? 1.2818 0.4900 0.8199 0.1689  0.1969  0.0220  372 LEU B CA  
2323 C C   . LEU B 75  ? 1.2517 0.4577 0.7940 0.1299  0.1965  0.0225  372 LEU B C   
2324 O O   . LEU B 75  ? 1.1722 0.4129 0.7331 0.1083  0.1903  0.0134  372 LEU B O   
2325 C CB  . LEU B 75  ? 1.3404 0.5025 0.8613 0.1671  0.2059  0.0050  372 LEU B CB  
2326 C CG  . LEU B 75  ? 1.3709 0.5504 0.8987 0.1586  0.2042  -0.0188 372 LEU B CG  
2327 C CD1 . LEU B 75  ? 1.4527 0.5812 0.9560 0.1660  0.2123  -0.0338 372 LEU B CD1 
2328 C CD2 . LEU B 75  ? 1.3665 0.5635 0.9075 0.1167  0.1974  -0.0314 372 LEU B CD2 
2329 N N   . HIS B 76  ? 1.3116 0.4784 0.8380 0.1223  0.2043  0.0340  373 HIS B N   
2330 C CA  . HIS B 76  ? 1.2798 0.4473 0.8133 0.0881  0.2073  0.0375  373 HIS B CA  
2331 C C   . HIS B 76  ? 1.1700 0.3859 0.7156 0.0895  0.1995  0.0490  373 HIS B C   
2332 O O   . HIS B 76  ? 1.0554 0.2927 0.6169 0.0613  0.1992  0.0454  373 HIS B O   
2333 C CB  . HIS B 76  ? 1.3725 0.4882 0.8860 0.0838  0.2198  0.0507  373 HIS B CB  
2334 C CG  . HIS B 76  ? 1.4772 0.5443 0.9860 0.0618  0.2268  0.0361  373 HIS B CG  
2335 N ND1 . HIS B 76  ? 1.5530 0.5829 1.0444 0.0799  0.2285  0.0261  373 HIS B ND1 
2336 C CD2 . HIS B 76  ? 1.5140 0.5640 1.0344 0.0231  0.2314  0.0294  373 HIS B CD2 
2337 C CE1 . HIS B 76  ? 1.6064 0.5939 1.0951 0.0528  0.2326  0.0126  373 HIS B CE1 
2338 N NE2 . HIS B 76  ? 1.5814 0.5819 1.0900 0.0171  0.2335  0.0145  373 HIS B NE2 
2339 N N   . ASP B 77  ? 1.1517 0.3853 0.6904 0.1229  0.1921  0.0625  374 ASP B N   
2340 C CA  . ASP B 77  ? 1.0945 0.3707 0.6405 0.1270  0.1812  0.0722  374 ASP B CA  
2341 C C   . ASP B 77  ? 1.0196 0.3394 0.5908 0.1186  0.1710  0.0586  374 ASP B C   
2342 O O   . ASP B 77  ? 1.0248 0.3720 0.6059 0.1025  0.1660  0.0591  374 ASP B O   
2343 C CB  . ASP B 77  ? 1.1265 0.4095 0.6582 0.1649  0.1719  0.0898  374 ASP B CB  
2344 C CG  . ASP B 77  ? 1.2167 0.4625 0.7195 0.1713  0.1808  0.1066  374 ASP B CG  
2345 O OD1 . ASP B 77  ? 1.1455 0.3554 0.6414 0.1479  0.1966  0.1050  374 ASP B OD1 
2346 O OD2 . ASP B 77  ? 1.2633 0.5164 0.7510 0.1996  0.1713  0.1216  374 ASP B OD2 
2347 N N   . GLN B 78  ? 0.9844 0.3093 0.5644 0.1311  0.1694  0.0468  375 GLN B N   
2348 C CA  . GLN B 78  ? 0.9250 0.2865 0.5267 0.1230  0.1628  0.0327  375 GLN B CA  
2349 C C   . GLN B 78  ? 0.9068 0.2682 0.5162 0.0832  0.1661  0.0190  375 GLN B C   
2350 O O   . GLN B 78  ? 0.8407 0.2345 0.4648 0.0694  0.1592  0.0158  375 GLN B O   
2351 C CB  . GLN B 78  ? 0.9227 0.2846 0.5282 0.1422  0.1661  0.0208  375 GLN B CB  
2352 C CG  . GLN B 78  ? 0.9700 0.3442 0.5780 0.1843  0.1629  0.0339  375 GLN B CG  
2353 C CD  . GLN B 78  ? 1.0120 0.3923 0.6265 0.2040  0.1703  0.0220  375 GLN B CD  
2354 O OE1 . GLN B 78  ? 0.9349 0.3222 0.5532 0.1879  0.1744  0.0038  375 GLN B OE1 
2355 N NE2 . GLN B 78  ? 0.9851 0.3654 0.5994 0.2399  0.1721  0.0324  375 GLN B NE2 
2356 N N   . VAL B 79  ? 0.9712 0.2964 0.5720 0.0655  0.1753  0.0111  376 VAL B N   
2357 C CA  . VAL B 79  ? 0.9840 0.3105 0.5964 0.0274  0.1766  -0.0015 376 VAL B CA  
2358 C C   . VAL B 79  ? 1.0033 0.3511 0.6263 0.0112  0.1769  0.0107  376 VAL B C   
2359 O O   . VAL B 79  ? 0.9751 0.3536 0.6166 -0.0098 0.1721  0.0031  376 VAL B O   
2360 C CB  . VAL B 79  ? 1.0502 0.3291 0.6521 0.0122  0.1852  -0.0082 376 VAL B CB  
2361 C CG1 . VAL B 79  ? 1.0534 0.3384 0.6739 -0.0281 0.1853  -0.0162 376 VAL B CG1 
2362 C CG2 . VAL B 79  ? 1.0181 0.2764 0.6080 0.0238  0.1842  -0.0255 376 VAL B CG2 
2363 N N   . HIS B 80  ? 0.9748 0.3067 0.5834 0.0235  0.1830  0.0299  377 HIS B N   
2364 C CA  . HIS B 80  ? 0.9034 0.2522 0.5157 0.0130  0.1864  0.0428  377 HIS B CA  
2365 C C   . HIS B 80  ? 0.8455 0.2375 0.4663 0.0192  0.1746  0.0443  377 HIS B C   
2366 O O   . HIS B 80  ? 0.8145 0.2315 0.4512 -0.0014 0.1752  0.0420  377 HIS B O   
2367 C CB  . HIS B 80  ? 1.0089 0.3306 0.5963 0.0312  0.1944  0.0627  377 HIS B CB  
2368 C CG  . HIS B 80  ? 1.0249 0.3621 0.6101 0.0247  0.2001  0.0760  377 HIS B CG  
2369 N ND1 . HIS B 80  ? 1.0353 0.3696 0.6345 -0.0032 0.2141  0.0777  377 HIS B ND1 
2370 C CD2 . HIS B 80  ? 1.0004 0.3571 0.5710 0.0433  0.1934  0.0875  377 HIS B CD2 
2371 C CE1 . HIS B 80  ? 0.9986 0.3501 0.5911 0.0008  0.2188  0.0905  377 HIS B CE1 
2372 N NE2 . HIS B 80  ? 0.9783 0.3413 0.5504 0.0289  0.2056  0.0955  377 HIS B NE2 
2373 N N   . LEU B 81  ? 0.8349 0.2361 0.4471 0.0477  0.1633  0.0488  378 LEU B N   
2374 C CA  . LEU B 81  ? 0.8050 0.2424 0.4238 0.0545  0.1494  0.0509  378 LEU B CA  
2375 C C   . LEU B 81  ? 0.7488 0.2289 0.3984 0.0319  0.1429  0.0331  378 LEU B C   
2376 O O   . LEU B 81  ? 0.7157 0.2325 0.3779 0.0218  0.1360  0.0329  378 LEU B O   
2377 C CB  . LEU B 81  ? 0.7999 0.2529 0.4170 0.0866  0.1348  0.0561  378 LEU B CB  
2378 C CG  . LEU B 81  ? 0.8664 0.2972 0.4564 0.1134  0.1329  0.0742  378 LEU B CG  
2379 C CD1 . LEU B 81  ? 0.8365 0.2909 0.4336 0.1444  0.1153  0.0790  378 LEU B CD1 
2380 C CD2 . LEU B 81  ? 0.8307 0.2674 0.4036 0.1086  0.1311  0.0844  378 LEU B CD2 
2381 N N   . LEU B 82  ? 0.7781 0.2518 0.4358 0.0262  0.1449  0.0180  379 LEU B N   
2382 C CA  . LEU B 82  ? 0.7645 0.2775 0.4460 0.0070  0.1377  0.0015  379 LEU B CA  
2383 C C   . LEU B 82  ? 0.7621 0.2777 0.4543 -0.0235 0.1428  -0.0028 379 LEU B C   
2384 O O   . LEU B 82  ? 0.7143 0.2741 0.4265 -0.0348 0.1344  -0.0067 379 LEU B O   
2385 C CB  . LEU B 82  ? 0.7395 0.2403 0.4181 0.0112  0.1395  -0.0141 379 LEU B CB  
2386 C CG  . LEU B 82  ? 0.7495 0.2800 0.4352 0.0374  0.1326  -0.0124 379 LEU B CG  
2387 C CD1 . LEU B 82  ? 0.8185 0.3267 0.4930 0.0468  0.1405  -0.0265 379 LEU B CD1 
2388 C CD2 . LEU B 82  ? 0.6369 0.2279 0.3475 0.0302  0.1193  -0.0131 379 LEU B CD2 
2389 N N   . GLU B 83  ? 0.8426 0.3114 0.5239 -0.0366 0.1571  -0.0010 380 GLU B N   
2390 C CA  . GLU B 83  ? 0.8716 0.3463 0.5704 -0.0674 0.1637  -0.0026 380 GLU B CA  
2391 C C   . GLU B 83  ? 0.8580 0.3676 0.5661 -0.0661 0.1649  0.0118  380 GLU B C   
2392 O O   . GLU B 83  ? 0.8943 0.4416 0.6283 -0.0844 0.1631  0.0080  380 GLU B O   
2393 C CB  . GLU B 83  ? 0.9264 0.3631 0.6205 -0.0779 0.1760  0.0009  380 GLU B CB  
2394 C CG  . GLU B 83  ? 0.9588 0.3705 0.6508 -0.0880 0.1724  -0.0179 380 GLU B CG  
2395 C CD  . GLU B 83  ? 1.0444 0.4152 0.7314 -0.0977 0.1832  -0.0130 380 GLU B CD  
2396 O OE1 . GLU B 83  ? 1.0865 0.4337 0.7730 -0.1114 0.1797  -0.0289 380 GLU B OE1 
2397 O OE2 . GLU B 83  ? 1.0747 0.4348 0.7555 -0.0911 0.1948  0.0066  380 GLU B OE2 
2398 N N   . CYS B 84  ? 0.7983 0.2949 0.4830 -0.0420 0.1671  0.0279  381 CYS B N   
2399 C CA  . CYS B 84  ? 0.7941 0.3145 0.4757 -0.0357 0.1682  0.0404  381 CYS B CA  
2400 C C   . CYS B 84  ? 0.7256 0.2971 0.4214 -0.0287 0.1494  0.0329  381 CYS B C   
2401 O O   . CYS B 84  ? 0.6529 0.2526 0.3586 -0.0340 0.1502  0.0348  381 CYS B O   
2402 C CB  . CYS B 84  ? 0.9036 0.3928 0.5496 -0.0107 0.1725  0.0577  381 CYS B CB  
2403 S SG  . CYS B 84  ? 1.7001 1.2097 1.3285 0.0020  0.1728  0.0704  381 CYS B SG  
2404 N N   . ALA B 85  ? 0.7071 0.2893 0.4046 -0.0164 0.1343  0.0253  382 ALA B N   
2405 C CA  . ALA B 85  ? 0.6309 0.2528 0.3378 -0.0079 0.1168  0.0221  382 ALA B CA  
2406 C C   . ALA B 85  ? 0.6068 0.2644 0.3399 -0.0205 0.1080  0.0085  382 ALA B C   
2407 O O   . ALA B 85  ? 0.5225 0.2099 0.2641 -0.0169 0.0957  0.0074  382 ALA B O   
2408 C CB  . ALA B 85  ? 0.6364 0.2544 0.3316 0.0153  0.1052  0.0271  382 ALA B CB  
2409 N N   . TRP B 86  ? 0.5615 0.2121 0.3032 -0.0350 0.1133  -0.0019 383 TRP B N   
2410 C CA  . TRP B 86  ? 0.5878 0.2672 0.3450 -0.0428 0.1041  -0.0147 383 TRP B CA  
2411 C C   . TRP B 86  ? 0.5857 0.3049 0.3599 -0.0500 0.0957  -0.0152 383 TRP B C   
2412 O O   . TRP B 86  ? 0.5715 0.3153 0.3520 -0.0462 0.0855  -0.0183 383 TRP B O   
2413 C CB  . TRP B 86  ? 0.6216 0.2820 0.3782 -0.0581 0.1090  -0.0282 383 TRP B CB  
2414 C CG  . TRP B 86  ? 0.6202 0.2823 0.3908 -0.0817 0.1139  -0.0309 383 TRP B CG  
2415 C CD1 . TRP B 86  ? 0.6625 0.2923 0.4303 -0.0925 0.1277  -0.0254 383 TRP B CD1 
2416 C CD2 . TRP B 86  ? 0.5794 0.2808 0.3727 -0.0977 0.1053  -0.0382 383 TRP B CD2 
2417 N NE1 . TRP B 86  ? 0.6745 0.3257 0.4677 -0.1167 0.1288  -0.0289 383 TRP B NE1 
2418 C CE2 . TRP B 86  ? 0.6119 0.3090 0.4216 -0.1189 0.1138  -0.0372 383 TRP B CE2 
2419 C CE3 . TRP B 86  ? 0.5320 0.2721 0.3341 -0.0955 0.0915  -0.0436 383 TRP B CE3 
2420 C CZ2 . TRP B 86  ? 0.5770 0.3141 0.4163 -0.1371 0.1069  -0.0425 383 TRP B CZ2 
2421 C CZ3 . TRP B 86  ? 0.5388 0.3126 0.3635 -0.1110 0.0844  -0.0484 383 TRP B CZ3 
2422 C CH2 . TRP B 86  ? 0.5603 0.3358 0.4058 -0.1311 0.0911  -0.0484 383 TRP B CH2 
2423 N N   . LEU B 87  ? 0.5774 0.3025 0.3593 -0.0589 0.1019  -0.0107 384 LEU B N   
2424 C CA  . LEU B 87  ? 0.4968 0.2581 0.2945 -0.0613 0.0953  -0.0104 384 LEU B CA  
2425 C C   . LEU B 87  ? 0.5417 0.3068 0.3282 -0.0444 0.0886  -0.0028 384 LEU B C   
2426 O O   . LEU B 87  ? 0.6321 0.4197 0.4258 -0.0419 0.0786  -0.0043 384 LEU B O   
2427 C CB  . LEU B 87  ? 0.4944 0.2679 0.3097 -0.0746 0.1056  -0.0078 384 LEU B CB  
2428 C CG  . LEU B 87  ? 0.5047 0.3191 0.3402 -0.0744 0.0997  -0.0076 384 LEU B CG  
2429 C CD1 . LEU B 87  ? 0.4739 0.3110 0.3173 -0.0776 0.0834  -0.0173 384 LEU B CD1 
2430 C CD2 . LEU B 87  ? 0.4651 0.2995 0.3272 -0.0883 0.1115  -0.0044 384 LEU B CD2 
2431 N N   . GLU B 88  ? 0.5277 0.2676 0.2938 -0.0329 0.0927  0.0051  385 GLU B N   
2432 C CA  . GLU B 88  ? 0.5375 0.2763 0.2891 -0.0182 0.0820  0.0094  385 GLU B CA  
2433 C C   . GLU B 88  ? 0.5296 0.2824 0.2905 -0.0160 0.0672  0.0055  385 GLU B C   
2434 O O   . GLU B 88  ? 0.4972 0.2624 0.2607 -0.0137 0.0560  0.0054  385 GLU B O   
2435 C CB  . GLU B 88  ? 0.6153 0.3239 0.3395 -0.0052 0.0854  0.0178  385 GLU B CB  
2436 C CG  . GLU B 88  ? 0.6414 0.3360 0.3470 -0.0015 0.0995  0.0255  385 GLU B CG  
2437 C CD  . GLU B 88  ? 0.7064 0.3697 0.3754 0.0153  0.0996  0.0347  385 GLU B CD  
2438 O OE1 . GLU B 88  ? 0.7916 0.4522 0.4401 0.0279  0.0856  0.0342  385 GLU B OE1 
2439 O OE2 . GLU B 88  ? 0.6924 0.3307 0.3505 0.0161  0.1124  0.0423  385 GLU B OE2 
2440 N N   . ILE B 89  ? 0.5400 0.2886 0.3053 -0.0164 0.0691  0.0029  386 ILE B N   
2441 C CA  . ILE B 89  ? 0.5244 0.2897 0.3011 -0.0131 0.0602  0.0014  386 ILE B CA  
2442 C C   . ILE B 89  ? 0.5091 0.2989 0.2993 -0.0227 0.0569  -0.0033 386 ILE B C   
2443 O O   . ILE B 89  ? 0.4998 0.3054 0.2983 -0.0216 0.0481  -0.0004 386 ILE B O   
2444 C CB  . ILE B 89  ? 0.5426 0.2956 0.3176 -0.0067 0.0670  -0.0002 386 ILE B CB  
2445 C CG1 . ILE B 89  ? 0.5486 0.2808 0.3101 0.0083  0.0660  0.0080  386 ILE B CG1 
2446 C CG2 . ILE B 89  ? 0.4676 0.2442 0.2576 -0.0039 0.0636  -0.0018 386 ILE B CG2 
2447 C CD1 . ILE B 89  ? 0.6064 0.3171 0.3615 0.0185  0.0753  0.0080  386 ILE B CD1 
2448 N N   . LEU B 90  ? 0.4990 0.2915 0.2915 -0.0328 0.0629  -0.0097 387 LEU B N   
2449 C CA  . LEU B 90  ? 0.4909 0.3068 0.2919 -0.0395 0.0578  -0.0131 387 LEU B CA  
2450 C C   . LEU B 90  ? 0.5006 0.3267 0.3046 -0.0367 0.0508  -0.0072 387 LEU B C   
2451 O O   . LEU B 90  ? 0.4832 0.3228 0.2908 -0.0365 0.0442  -0.0049 387 LEU B O   
2452 C CB  . LEU B 90  ? 0.4734 0.2935 0.2782 -0.0515 0.0614  -0.0217 387 LEU B CB  
2453 C CG  . LEU B 90  ? 0.5139 0.3206 0.3111 -0.0571 0.0657  -0.0323 387 LEU B CG  
2454 C CD1 . LEU B 90  ? 0.5411 0.3565 0.3454 -0.0730 0.0634  -0.0421 387 LEU B CD1 
2455 C CD2 . LEU B 90  ? 0.5485 0.3625 0.3379 -0.0498 0.0635  -0.0342 387 LEU B CD2 
2456 N N   . MET B 91  ? 0.5012 0.3165 0.2998 -0.0331 0.0538  -0.0041 388 MET B N   
2457 C CA  . MET B 91  ? 0.4381 0.2562 0.2338 -0.0273 0.0490  -0.0005 388 MET B CA  
2458 C C   . MET B 91  ? 0.4838 0.2914 0.2716 -0.0217 0.0377  0.0029  388 MET B C   
2459 O O   . MET B 91  ? 0.5461 0.3567 0.3348 -0.0207 0.0306  0.0047  388 MET B O   
2460 C CB  . MET B 91  ? 0.4894 0.2988 0.2778 -0.0228 0.0588  0.0016  388 MET B CB  
2461 C CG  . MET B 91  ? 0.4757 0.3061 0.2827 -0.0309 0.0680  0.0000  388 MET B CG  
2462 S SD  . MET B 91  ? 0.5635 0.3871 0.3661 -0.0263 0.0861  0.0061  388 MET B SD  
2463 C CE  . MET B 91  ? 0.5321 0.3982 0.3720 -0.0371 0.0913  0.0048  388 MET B CE  
2464 N N   . ILE B 92  ? 0.4657 0.2607 0.2468 -0.0183 0.0349  0.0040  389 ILE B N   
2465 C CA  . ILE B 92  ? 0.4552 0.2454 0.2350 -0.0164 0.0208  0.0063  389 ILE B CA  
2466 C C   . ILE B 92  ? 0.4457 0.2555 0.2459 -0.0240 0.0172  0.0089  389 ILE B C   
2467 O O   . ILE B 92  ? 0.4587 0.2683 0.2643 -0.0278 0.0068  0.0120  389 ILE B O   
2468 C CB  . ILE B 92  ? 0.5257 0.3041 0.2962 -0.0094 0.0151  0.0077  389 ILE B CB  
2469 C CG1 . ILE B 92  ? 0.5202 0.2944 0.2895 -0.0098 -0.0042 0.0081  389 ILE B CG1 
2470 C CG2 . ILE B 92  ? 0.5040 0.2935 0.2886 -0.0087 0.0210  0.0093  389 ILE B CG2 
2471 C CD1 . ILE B 92  ? 0.4661 0.2335 0.2264 -0.0016 -0.0153 0.0094  389 ILE B CD1 
2472 N N   . GLY B 93  ? 0.4742 0.2981 0.2832 -0.0266 0.0269  0.0077  390 GLY B N   
2473 C CA  . GLY B 93  ? 0.4944 0.3366 0.3163 -0.0314 0.0280  0.0111  390 GLY B CA  
2474 C C   . GLY B 93  ? 0.5118 0.3564 0.3307 -0.0348 0.0252  0.0138  390 GLY B C   
2475 O O   . GLY B 93  ? 0.5204 0.3675 0.3456 -0.0388 0.0206  0.0210  390 GLY B O   
2476 N N   . LEU B 94  ? 0.5050 0.3493 0.3163 -0.0333 0.0283  0.0093  391 LEU B N   
2477 C CA  . LEU B 94  ? 0.5432 0.3913 0.3514 -0.0318 0.0251  0.0125  391 LEU B CA  
2478 C C   . LEU B 94  ? 0.5540 0.3830 0.3568 -0.0288 0.0172  0.0174  391 LEU B C   
2479 O O   . LEU B 94  ? 0.6008 0.4265 0.4030 -0.0301 0.0134  0.0246  391 LEU B O   
2480 C CB  . LEU B 94  ? 0.5117 0.3673 0.3199 -0.0292 0.0286  0.0071  391 LEU B CB  
2481 C CG  . LEU B 94  ? 0.4574 0.3193 0.2650 -0.0221 0.0248  0.0112  391 LEU B CG  
2482 C CD1 . LEU B 94  ? 0.4782 0.3532 0.2841 -0.0230 0.0205  0.0161  391 LEU B CD1 
2483 C CD2 . LEU B 94  ? 0.4412 0.3192 0.2583 -0.0196 0.0295  0.0071  391 LEU B CD2 
2484 N N   . VAL B 95  ? 0.5277 0.3396 0.3223 -0.0246 0.0150  0.0135  392 VAL B N   
2485 C CA  . VAL B 95  ? 0.5577 0.3435 0.3395 -0.0210 0.0059  0.0139  392 VAL B CA  
2486 C C   . VAL B 95  ? 0.6105 0.3902 0.4010 -0.0314 -0.0043 0.0187  392 VAL B C   
2487 O O   . VAL B 95  ? 0.6597 0.4198 0.4444 -0.0334 -0.0111 0.0220  392 VAL B O   
2488 C CB  . VAL B 95  ? 0.5793 0.3472 0.3438 -0.0136 0.0055  0.0078  392 VAL B CB  
2489 C CG1 . VAL B 95  ? 0.6363 0.3733 0.3829 -0.0121 -0.0083 0.0050  392 VAL B CG1 
2490 C CG2 . VAL B 95  ? 0.5833 0.3543 0.3403 -0.0033 0.0177  0.0059  392 VAL B CG2 
2491 N N   . TRP B 96  ? 0.5780 0.3749 0.3847 -0.0379 -0.0042 0.0200  393 TRP B N   
2492 C CA  . TRP B 96  ? 0.5293 0.3316 0.3548 -0.0494 -0.0121 0.0263  393 TRP B CA  
2493 C C   . TRP B 96  ? 0.5711 0.3807 0.4059 -0.0567 -0.0065 0.0368  393 TRP B C   
2494 O O   . TRP B 96  ? 0.6008 0.3959 0.4407 -0.0665 -0.0140 0.0429  393 TRP B O   
2495 C CB  . TRP B 96  ? 0.4961 0.3227 0.3408 -0.0501 -0.0101 0.0269  393 TRP B CB  
2496 C CG  . TRP B 96  ? 0.5672 0.4170 0.4423 -0.0611 -0.0105 0.0366  393 TRP B CG  
2497 C CD1 . TRP B 96  ? 0.5247 0.4007 0.4147 -0.0615 0.0046  0.0437  393 TRP B CD1 
2498 C CD2 . TRP B 96  ? 0.5576 0.4083 0.4532 -0.0739 -0.0256 0.0405  393 TRP B CD2 
2499 N NE1 . TRP B 96  ? 0.5224 0.4190 0.4438 -0.0727 0.0031  0.0542  393 TRP B NE1 
2500 C CE2 . TRP B 96  ? 0.5339 0.4173 0.4631 -0.0825 -0.0165 0.0525  393 TRP B CE2 
2501 C CE3 . TRP B 96  ? 0.5654 0.3920 0.4531 -0.0795 -0.0464 0.0343  393 TRP B CE3 
2502 C CZ2 . TRP B 96  ? 0.5489 0.4468 0.5123 -0.0993 -0.0272 0.0601  393 TRP B CZ2 
2503 C CZ3 . TRP B 96  ? 0.5895 0.4259 0.5070 -0.0970 -0.0609 0.0392  393 TRP B CZ3 
2504 C CH2 . TRP B 96  ? 0.6015 0.4759 0.5606 -0.1081 -0.0510 0.0528  393 TRP B CH2 
2505 N N   . ARG B 97  ? 0.5648 0.3932 0.3987 -0.0525 0.0061  0.0392  394 ARG B N   
2506 C CA  . ARG B 97  ? 0.5494 0.3842 0.3848 -0.0565 0.0126  0.0508  394 ARG B CA  
2507 C C   . ARG B 97  ? 0.5669 0.3775 0.3839 -0.0517 0.0083  0.0545  394 ARG B C   
2508 O O   . ARG B 97  ? 0.5073 0.3132 0.3208 -0.0543 0.0117  0.0669  394 ARG B O   
2509 C CB  . ARG B 97  ? 0.5220 0.3815 0.3543 -0.0517 0.0253  0.0507  394 ARG B CB  
2510 C CG  . ARG B 97  ? 0.5417 0.4039 0.3590 -0.0428 0.0262  0.0394  394 ARG B CG  
2511 C CD  . ARG B 97  ? 0.5940 0.4749 0.4046 -0.0407 0.0357  0.0365  394 ARG B CD  
2512 N NE  . ARG B 97  ? 0.5863 0.4711 0.3862 -0.0369 0.0338  0.0251  394 ARG B NE  
2513 C CZ  . ARG B 97  ? 0.5133 0.3972 0.3154 -0.0376 0.0362  0.0135  394 ARG B CZ  
2514 N NH1 . ARG B 97  ? 0.5027 0.3811 0.3136 -0.0378 0.0402  0.0123  394 ARG B NH1 
2515 N NH2 . ARG B 97  ? 0.4331 0.3219 0.2305 -0.0385 0.0340  0.0040  394 ARG B NH2 
2516 N N   . SER B 98  ? 0.6102 0.4040 0.4140 -0.0426 0.0026  0.0453  395 SER B N   
2517 C CA  . SER B 98  ? 0.6112 0.3821 0.3978 -0.0328 -0.0002 0.0482  395 SER B CA  
2518 C C   . SER B 98  ? 0.6325 0.3627 0.4103 -0.0368 -0.0103 0.0483  395 SER B C   
2519 O O   . SER B 98  ? 0.6724 0.3744 0.4326 -0.0268 -0.0123 0.0507  395 SER B O   
2520 C CB  . SER B 98  ? 0.6002 0.3793 0.3790 -0.0182 0.0024  0.0393  395 SER B CB  
2521 O OG  . SER B 98  ? 0.6238 0.4367 0.4105 -0.0177 0.0087  0.0379  395 SER B OG  
2522 N N   . MET B 99  ? 0.6198 0.3461 0.4095 -0.0507 -0.0178 0.0453  396 MET B N   
2523 C CA  . MET B 99  ? 0.6662 0.3520 0.4470 -0.0583 -0.0318 0.0416  396 MET B CA  
2524 C C   . MET B 99  ? 0.7739 0.4277 0.5487 -0.0645 -0.0329 0.0531  396 MET B C   
2525 O O   . MET B 99  ? 0.8587 0.4665 0.6090 -0.0582 -0.0401 0.0484  396 MET B O   
2526 C CB  . MET B 99  ? 0.6394 0.3377 0.4429 -0.0755 -0.0425 0.0388  396 MET B CB  
2527 C CG  . MET B 99  ? 0.6520 0.3531 0.4457 -0.0675 -0.0499 0.0250  396 MET B CG  
2528 S SD  . MET B 99  ? 0.8061 0.5326 0.6317 -0.0841 -0.0643 0.0244  396 MET B SD  
2529 C CE  . MET B 99  ? 0.5683 0.2608 0.4007 -0.1069 -0.0839 0.0255  396 MET B CE  
2530 N N   . GLU B 100 ? 0.7878 0.4620 0.5814 -0.0752 -0.0240 0.0688  397 GLU B N   
2531 C CA  . GLU B 100 ? 0.8668 0.5094 0.6554 -0.0833 -0.0224 0.0842  397 GLU B CA  
2532 C C   . GLU B 100 ? 0.8668 0.4968 0.6290 -0.0615 -0.0145 0.0919  397 GLU B C   
2533 O O   . GLU B 100 ? 0.9234 0.5334 0.6781 -0.0637 -0.0090 0.1091  397 GLU B O   
2534 C CB  . GLU B 100 ? 0.9406 0.6118 0.7593 -0.1031 -0.0128 0.1011  397 GLU B CB  
2535 C CG  . GLU B 100 ? 1.0031 0.6945 0.8570 -0.1246 -0.0213 0.0967  397 GLU B CG  
2536 C CD  . GLU B 100 ? 1.1215 0.7677 0.9755 -0.1419 -0.0405 0.0907  397 GLU B CD  
2537 O OE1 . GLU B 100 ? 1.2014 0.8107 1.0516 -0.1542 -0.0395 0.1032  397 GLU B OE1 
2538 O OE2 . GLU B 100 ? 1.1175 0.7613 0.9719 -0.1432 -0.0573 0.0734  397 GLU B OE2 
2539 N N   . HIS B 101 ? 0.8237 0.4673 0.5734 -0.0404 -0.0137 0.0808  398 HIS B N   
2540 C CA  . HIS B 101 ? 0.8287 0.4706 0.5598 -0.0177 -0.0089 0.0871  398 HIS B CA  
2541 C C   . HIS B 101 ? 0.8212 0.4435 0.5351 0.0034  -0.0126 0.0744  398 HIS B C   
2542 O O   . HIS B 101 ? 0.7653 0.4215 0.4840 0.0164  -0.0088 0.0668  398 HIS B O   
2543 C CB  . HIS B 101 ? 0.7975 0.4925 0.5379 -0.0122 -0.0014 0.0896  398 HIS B CB  
2544 C CG  . HIS B 101 ? 0.8137 0.5274 0.5639 -0.0272 0.0061  0.1024  398 HIS B CG  
2545 N ND1 . HIS B 101 ? 0.8641 0.5665 0.6005 -0.0249 0.0116  0.1220  398 HIS B ND1 
2546 C CD2 . HIS B 101 ? 0.7851 0.5275 0.5554 -0.0421 0.0111  0.0999  398 HIS B CD2 
2547 C CE1 . HIS B 101 ? 0.8562 0.5809 0.6033 -0.0385 0.0214  0.1309  398 HIS B CE1 
2548 N NE2 . HIS B 101 ? 0.8289 0.5792 0.5982 -0.0484 0.0213  0.1172  398 HIS B NE2 
2549 N N   . PRO B 102 ? 0.8758 0.4415 0.5689 0.0064  -0.0188 0.0721  399 PRO B N   
2550 C CA  . PRO B 102 ? 0.9010 0.4393 0.5712 0.0290  -0.0201 0.0595  399 PRO B CA  
2551 C C   . PRO B 102 ? 0.8888 0.4532 0.5570 0.0582  -0.0117 0.0645  399 PRO B C   
2552 O O   . PRO B 102 ? 0.9125 0.4749 0.5771 0.0676  -0.0100 0.0799  399 PRO B O   
2553 C CB  . PRO B 102 ? 0.9690 0.4343 0.6131 0.0270  -0.0274 0.0610  399 PRO B CB  
2554 C CG  . PRO B 102 ? 0.9657 0.4261 0.6281 -0.0066 -0.0335 0.0682  399 PRO B CG  
2555 C CD  . PRO B 102 ? 0.9274 0.4483 0.6167 -0.0127 -0.0239 0.0817  399 PRO B CD  
2556 N N   . GLY B 103 ? 0.8091 0.4001 0.4812 0.0721  -0.0065 0.0530  400 GLY B N   
2557 C CA  . GLY B 103 ? 0.7904 0.4154 0.4699 0.0983  0.0010  0.0570  400 GLY B CA  
2558 C C   . GLY B 103 ? 0.8219 0.5103 0.5301 0.0911  0.0019  0.0633  400 GLY B C   
2559 O O   . GLY B 103 ? 0.8434 0.5695 0.5647 0.1090  0.0045  0.0671  400 GLY B O   
2560 N N   . LYS B 104 ? 0.8082 0.5096 0.5266 0.0655  -0.0008 0.0636  401 LYS B N   
2561 C CA  . LYS B 104 ? 0.7523 0.5046 0.4894 0.0579  -0.0005 0.0672  401 LYS B CA  
2562 C C   . LYS B 104 ? 0.6809 0.4560 0.4332 0.0373  0.0018  0.0567  401 LYS B C   
2563 O O   . LYS B 104 ? 0.6380 0.3901 0.3874 0.0238  0.0009  0.0522  401 LYS B O   
2564 C CB  . LYS B 104 ? 0.8068 0.5508 0.5342 0.0532  -0.0034 0.0830  401 LYS B CB  
2565 C CG  . LYS B 104 ? 0.8540 0.5792 0.5646 0.0767  -0.0059 0.0969  401 LYS B CG  
2566 C CD  . LYS B 104 ? 0.8969 0.6084 0.5926 0.0707  -0.0063 0.1151  401 LYS B CD  
2567 C CE  . LYS B 104 ? 0.9751 0.6650 0.6499 0.0968  -0.0092 0.1317  401 LYS B CE  
2568 N NZ  . LYS B 104 ? 1.0218 0.6992 0.6774 0.0922  -0.0075 0.1525  401 LYS B NZ  
2569 N N   . LEU B 105 ? 0.6358 0.4555 0.4045 0.0352  0.0033  0.0526  402 LEU B N   
2570 C CA  . LEU B 105 ? 0.5849 0.4225 0.3651 0.0178  0.0064  0.0435  402 LEU B CA  
2571 C C   . LEU B 105 ? 0.6046 0.4608 0.3842 0.0083  0.0051  0.0477  402 LEU B C   
2572 O O   . LEU B 105 ? 0.5742 0.4553 0.3534 0.0143  0.0010  0.0500  402 LEU B O   
2573 C CB  . LEU B 105 ? 0.5288 0.3946 0.3252 0.0198  0.0110  0.0338  402 LEU B CB  
2574 C CG  . LEU B 105 ? 0.5465 0.3946 0.3393 0.0298  0.0172  0.0296  402 LEU B CG  
2575 C CD1 . LEU B 105 ? 0.4904 0.3704 0.3030 0.0298  0.0256  0.0238  402 LEU B CD1 
2576 C CD2 . LEU B 105 ? 0.5341 0.3472 0.3124 0.0212  0.0166  0.0255  402 LEU B CD2 
2577 N N   . LEU B 106 ? 0.6399 0.4853 0.4184 -0.0050 0.0082  0.0489  403 LEU B N   
2578 C CA  . LEU B 106 ? 0.6276 0.4881 0.4015 -0.0116 0.0112  0.0532  403 LEU B CA  
2579 C C   . LEU B 106 ? 0.5709 0.4529 0.3522 -0.0186 0.0146  0.0398  403 LEU B C   
2580 O O   . LEU B 106 ? 0.5033 0.3815 0.2910 -0.0267 0.0202  0.0363  403 LEU B O   
2581 C CB  . LEU B 106 ? 0.6326 0.4749 0.4063 -0.0212 0.0158  0.0639  403 LEU B CB  
2582 C CG  . LEU B 106 ? 0.6889 0.5427 0.4531 -0.0243 0.0234  0.0742  403 LEU B CG  
2583 C CD1 . LEU B 106 ? 0.7366 0.5674 0.4978 -0.0292 0.0269  0.0928  403 LEU B CD1 
2584 C CD2 . LEU B 106 ? 0.7070 0.5780 0.4811 -0.0323 0.0320  0.0668  403 LEU B CD2 
2585 N N   . PHE B 107 ? 0.5894 0.4936 0.3713 -0.0154 0.0102  0.0323  404 PHE B N   
2586 C CA  . PHE B 107 ? 0.6025 0.5202 0.3885 -0.0239 0.0124  0.0184  404 PHE B CA  
2587 C C   . PHE B 107 ? 0.6000 0.5177 0.3697 -0.0272 0.0174  0.0184  404 PHE B C   
2588 O O   . PHE B 107 ? 0.6183 0.5326 0.3884 -0.0329 0.0241  0.0093  404 PHE B O   
2589 C CB  . PHE B 107 ? 0.6077 0.5512 0.4011 -0.0232 0.0038  0.0105  404 PHE B CB  
2590 C CG  . PHE B 107 ? 0.5669 0.5171 0.3805 -0.0182 0.0034  0.0111  404 PHE B CG  
2591 C CD1 . PHE B 107 ? 0.5789 0.5275 0.4077 -0.0257 0.0106  0.0031  404 PHE B CD1 
2592 C CD2 . PHE B 107 ? 0.5730 0.5296 0.3880 -0.0035 -0.0021 0.0210  404 PHE B CD2 
2593 C CE1 . PHE B 107 ? 0.5635 0.5198 0.4086 -0.0192 0.0142  0.0052  404 PHE B CE1 
2594 C CE2 . PHE B 107 ? 0.5707 0.5348 0.4031 0.0049  0.0008  0.0217  404 PHE B CE2 
2595 C CZ  . PHE B 107 ? 0.5492 0.5147 0.3967 -0.0032 0.0099  0.0138  404 PHE B CZ  
2596 N N   . ALA B 108 ? 0.5767 0.4956 0.3291 -0.0211 0.0161  0.0301  405 ALA B N   
2597 C CA  . ALA B 108 ? 0.6028 0.5215 0.3355 -0.0211 0.0247  0.0339  405 ALA B CA  
2598 C C   . ALA B 108 ? 0.6416 0.5519 0.3624 -0.0153 0.0268  0.0548  405 ALA B C   
2599 O O   . ALA B 108 ? 0.6344 0.5392 0.3572 -0.0093 0.0183  0.0623  405 ALA B O   
2600 C CB  . ALA B 108 ? 0.6148 0.5468 0.3251 -0.0195 0.0187  0.0210  405 ALA B CB  
2601 N N   . PRO B 109 ? 0.6235 0.5312 0.3324 -0.0161 0.0401  0.0655  406 PRO B N   
2602 C CA  . PRO B 109 ? 0.6232 0.5196 0.3188 -0.0126 0.0450  0.0883  406 PRO B CA  
2603 C C   . PRO B 109 ? 0.6313 0.5293 0.2982 0.0007  0.0332  0.0937  406 PRO B C   
2604 O O   . PRO B 109 ? 0.6361 0.5175 0.2970 0.0062  0.0312  0.1112  406 PRO B O   
2605 C CB  . PRO B 109 ? 0.6376 0.5404 0.3212 -0.0139 0.0641  0.0960  406 PRO B CB  
2606 C CG  . PRO B 109 ? 0.5993 0.5112 0.3066 -0.0203 0.0697  0.0806  406 PRO B CG  
2607 C CD  . PRO B 109 ? 0.5966 0.5103 0.3069 -0.0197 0.0542  0.0593  406 PRO B CD  
2608 N N   . ASN B 110 ? 0.6510 0.5675 0.3005 0.0058  0.0239  0.0785  407 ASN B N   
2609 C CA  . ASN B 110 ? 0.7018 0.6279 0.3262 0.0193  0.0080  0.0820  407 ASN B CA  
2610 C C   . ASN B 110 ? 0.7218 0.6650 0.3709 0.0212  -0.0105 0.0696  407 ASN B C   
2611 O O   . ASN B 110 ? 0.7958 0.7586 0.4330 0.0314  -0.0274 0.0678  407 ASN B O   
2612 C CB  . ASN B 110 ? 0.6676 0.6048 0.2514 0.0243  0.0062  0.0741  407 ASN B CB  
2613 C CG  . ASN B 110 ? 0.6831 0.6321 0.2745 0.0145  0.0012  0.0460  407 ASN B CG  
2614 O OD1 . ASN B 110 ? 0.6500 0.5967 0.2759 0.0033  0.0058  0.0360  407 ASN B OD1 
2615 N ND2 . ASN B 110 ? 0.7101 0.6674 0.2650 0.0187  -0.0089 0.0331  407 ASN B ND2 
2616 N N   . LEU B 111 ? 0.4442 0.9237 0.4634 0.0366  -0.0182 0.2756  408 LEU B N   
2617 C CA  . LEU B 111 ? 0.4560 1.0053 0.5143 0.0643  -0.0028 0.2997  408 LEU B CA  
2618 C C   . LEU B 111 ? 0.4688 1.0006 0.5059 0.1012  0.0125  0.2952  408 LEU B C   
2619 O O   . LEU B 111 ? 0.4471 0.9998 0.5002 0.1084  0.0280  0.2906  408 LEU B O   
2620 C CB  . LEU B 111 ? 0.3039 0.9286 0.4214 0.0452  0.0097  0.3114  408 LEU B CB  
2621 C CG  . LEU B 111 ? 0.3466 1.0519 0.5030 0.0653  0.0294  0.3436  408 LEU B CG  
2622 C CD1 . LEU B 111 ? 0.3798 1.0980 0.5307 0.0733  0.0157  0.3610  408 LEU B CD1 
2623 C CD2 . LEU B 111 ? 0.3256 1.0267 0.4944 0.0440  0.0261  0.3378  408 LEU B CD2 
2624 N N   . LEU B 112 ? 0.5133 1.0046 0.5116 0.1262  0.0075  0.2970  409 LEU B N   
2625 C CA  . LEU B 112 ? 0.5449 1.0195 0.5204 0.1621  0.0230  0.2937  409 LEU B CA  
2626 C C   . LEU B 112 ? 0.5994 1.1201 0.5960 0.1987  0.0338  0.3191  409 LEU B C   
2627 O O   . LEU B 112 ? 0.5150 1.0270 0.5033 0.2077  0.0195  0.3310  409 LEU B O   
2628 C CB  . LEU B 112 ? 0.5983 0.9900 0.5102 0.1636  0.0139  0.2777  409 LEU B CB  
2629 C CG  . LEU B 112 ? 0.6140 0.9820 0.4948 0.1981  0.0309  0.2704  409 LEU B CG  
2630 C CD1 . LEU B 112 ? 0.5844 0.9647 0.4721 0.1953  0.0417  0.2512  409 LEU B CD1 
2631 C CD2 . LEU B 112 ? 0.5772 0.8657 0.3927 0.1975  0.0253  0.2612  409 LEU B CD2 
2632 N N   . LEU B 113 ? 0.6116 1.1780 0.6313 0.2217  0.0587  0.3274  410 LEU B N   
2633 C CA  . LEU B 113 ? 0.6422 1.2594 0.6849 0.2529  0.0726  0.3531  410 LEU B CA  
2634 C C   . LEU B 113 ? 0.6475 1.2568 0.6693 0.2941  0.0970  0.3535  410 LEU B C   
2635 O O   . LEU B 113 ? 0.5819 1.1813 0.5915 0.2994  0.1120  0.3395  410 LEU B O   
2636 C CB  . LEU B 113 ? 0.6400 1.3333 0.7312 0.2391  0.0854  0.3738  410 LEU B CB  
2637 C CG  . LEU B 113 ? 0.6268 1.3408 0.7434 0.1972  0.0666  0.3759  410 LEU B CG  
2638 C CD1 . LEU B 113 ? 0.6169 1.4025 0.7703 0.1846  0.0850  0.4015  410 LEU B CD1 
2639 C CD2 . LEU B 113 ? 0.6540 1.3537 0.7647 0.1974  0.0375  0.3789  410 LEU B CD2 
2640 N N   . ASP B 114 ? 0.7136 1.3260 0.7311 0.3258  0.0990  0.3680  411 ASP B N   
2641 C CA  . ASP B 114 ? 0.7444 1.3605 0.7473 0.3657  0.1261  0.3740  411 ASP B CA  
2642 C C   . ASP B 114 ? 0.7296 1.4120 0.7685 0.3735  0.1433  0.3997  411 ASP B C   
2643 O O   . ASP B 114 ? 0.6971 1.4227 0.7737 0.3500  0.1325  0.4119  411 ASP B O   
2644 C CB  . ASP B 114 ? 0.8371 1.4125 0.8128 0.3981  0.1208  0.3754  411 ASP B CB  
2645 C CG  . ASP B 114 ? 0.8817 1.4740 0.8827 0.4000  0.0958  0.3901  411 ASP B CG  
2646 O OD1 . ASP B 114 ? 0.8734 1.5290 0.9221 0.3941  0.0925  0.4052  411 ASP B OD1 
2647 O OD2 . ASP B 114 ? 0.9378 1.4776 0.9076 0.4100  0.0792  0.3864  411 ASP B OD2 
2648 N N   . ARG B 115 ? 0.7602 1.4449 0.7824 0.4051  0.1688  0.4085  412 ARG B N   
2649 C CA  . ARG B 115 ? 0.8162 1.5461 0.8629 0.4119  0.1830  0.4335  412 ARG B CA  
2650 C C   . ARG B 115 ? 0.8401 1.6175 0.9467 0.4152  0.1658  0.4456  412 ARG B C   
2651 O O   . ARG B 115 ? 0.8199 1.6430 0.9693 0.4050  0.1678  0.4577  412 ARG B O   
2652 C CB  . ARG B 115 ? 0.8728 1.5795 0.8836 0.4462  0.2076  0.4387  412 ARG B CB  
2653 C CG  . ARG B 115 ? 0.9198 1.5889 0.9058 0.4769  0.2097  0.4267  412 ARG B CG  
2654 C CD  . ARG B 115 ? 0.9813 1.6322 0.9405 0.5094  0.2323  0.4336  412 ARG B CD  
2655 N NE  . ARG B 115 ? 0.9996 1.6905 1.0039 0.5118  0.2401  0.4514  412 ARG B NE  
2656 C CZ  . ARG B 115 ? 1.0295 1.7124 1.0332 0.5364  0.2596  0.4557  412 ARG B CZ  
2657 N NH1 . ARG B 115 ? 1.0774 1.7138 1.0314 0.5615  0.2705  0.4473  412 ARG B NH1 
2658 N NH2 . ARG B 115 ? 1.0268 1.7477 1.0844 0.5339  0.2705  0.4639  412 ARG B NH2 
2659 N N   . ASN B 116 ? 0.8765 1.6403 0.9874 0.4316  0.1475  0.4389  413 ASN B N   
2660 C CA  . ASN B 116 ? 0.8979 1.7076 1.0646 0.4402  0.1260  0.4449  413 ASN B CA  
2661 C C   . ASN B 116 ? 0.8303 1.6852 1.0377 0.4040  0.1054  0.4466  413 ASN B C   
2662 O O   . ASN B 116 ? 0.8119 1.7274 1.0807 0.4048  0.0980  0.4500  413 ASN B O   
2663 C CB  . ASN B 116 ? 0.9684 1.7393 1.1150 0.4639  0.1047  0.4387  413 ASN B CB  
2664 C CG  . ASN B 116 ? 1.0460 1.7732 1.1555 0.5012  0.1260  0.4371  413 ASN B CG  
2665 O OD1 . ASN B 116 ? 1.0703 1.8128 1.1872 0.5168  0.1523  0.4422  413 ASN B OD1 
2666 N ND2 . ASN B 116 ? 1.0985 1.7654 1.1647 0.5156  0.1154  0.4302  413 ASN B ND2 
2667 N N   . GLN B 117 ? 0.7838 1.6099 0.9617 0.3715  0.0967  0.4397  414 GLN B N   
2668 C CA  . GLN B 117 ? 0.7457 1.6069 0.9539 0.3333  0.0791  0.4406  414 GLN B CA  
2669 C C   . GLN B 117 ? 0.7112 1.6033 0.9354 0.3127  0.1013  0.4508  414 GLN B C   
2670 O O   . GLN B 117 ? 0.7237 1.6562 0.9863 0.2858  0.0913  0.4530  414 GLN B O   
2671 C CB  . GLN B 117 ? 0.7180 1.5294 0.8895 0.3053  0.0618  0.4270  414 GLN B CB  
2672 C CG  . GLN B 117 ? 0.7905 1.5406 0.9234 0.3270  0.0436  0.4166  414 GLN B CG  
2673 C CD  . GLN B 117 ? 0.8301 1.5234 0.9275 0.2959  0.0238  0.4011  414 GLN B CD  
2674 O OE1 . GLN B 117 ? 0.8515 1.4819 0.9045 0.2954  0.0298  0.3865  414 GLN B OE1 
2675 N NE2 . GLN B 117 ? 0.8330 1.5467 0.9492 0.2694  -0.0006 0.4023  414 GLN B NE2 
2676 N N   . GLY B 118 ? 0.6653 1.5307 0.8550 0.3268  0.1292  0.4556  415 GLY B N   
2677 C CA  . GLY B 118 ? 0.6669 1.5423 0.8611 0.3169  0.1459  0.4670  415 GLY B CA  
2678 C C   . GLY B 118 ? 0.7095 1.6353 0.9717 0.3278  0.1534  0.4677  415 GLY B C   
2679 O O   . GLY B 118 ? 0.7247 1.6652 1.0167 0.3110  0.1647  0.4663  415 GLY B O   
2680 N N   . LYS B 119 ? 0.7285 1.6781 1.0208 0.3552  0.1492  0.4633  416 LYS B N   
2681 C CA  . LYS B 119 ? 0.7371 1.7436 1.1059 0.3665  0.1581  0.4563  416 LYS B CA  
2682 C C   . LYS B 119 ? 0.7303 1.7975 1.1671 0.3375  0.1384  0.4446  416 LYS B C   
2683 O O   . LYS B 119 ? 0.7478 1.8699 1.2594 0.3361  0.1491  0.4305  416 LYS B O   
2684 C CB  . LYS B 119 ? 0.7560 1.7689 1.1370 0.4074  0.1543  0.4533  416 LYS B CB  
2685 C CG  . LYS B 119 ? 0.7679 1.7256 1.0910 0.4371  0.1784  0.4597  416 LYS B CG  
2686 C CD  . LYS B 119 ? 0.8136 1.7723 1.1483 0.4762  0.1726  0.4557  416 LYS B CD  
2687 C CE  . LYS B 119 ? 0.8515 1.8815 1.2787 0.4881  0.1736  0.4457  416 LYS B CE  
2688 N NZ  . LYS B 119 ? 0.9085 1.9396 1.3491 0.5291  0.1642  0.4420  416 LYS B NZ  
2689 N N   . CYS B 120 ? 0.7047 1.7612 1.1170 0.3128  0.1117  0.4459  417 CYS B N   
2690 C CA  . CYS B 120 ? 0.6733 1.7802 1.1394 0.2821  0.0906  0.4333  417 CYS B CA  
2691 C C   . CYS B 120 ? 0.6318 1.7600 1.1394 0.2521  0.1151  0.4228  417 CYS B C   
2692 O O   . CYS B 120 ? 0.6306 1.8184 1.2139 0.2373  0.1133  0.4021  417 CYS B O   
2693 C CB  . CYS B 120 ? 0.6536 1.7285 1.0720 0.2569  0.0639  0.4369  417 CYS B CB  
2694 S SG  . CYS B 120 ? 1.0895 2.2077 1.5533 0.2096  0.0431  0.4220  417 CYS B SG  
2695 N N   . VAL B 121 ? 0.6037 1.6787 1.0624 0.2443  0.1384  0.4324  418 VAL B N   
2696 C CA  . VAL B 121 ? 0.6022 1.6764 1.0906 0.2206  0.1683  0.4190  418 VAL B CA  
2697 C C   . VAL B 121 ? 0.6409 1.7126 1.1446 0.2474  0.2053  0.4170  418 VAL B C   
2698 O O   . VAL B 121 ? 0.6675 1.6969 1.1160 0.2779  0.2120  0.4332  418 VAL B O   
2699 C CB  . VAL B 121 ? 0.5521 1.5615 0.9788 0.1981  0.1697  0.4251  418 VAL B CB  
2700 C CG1 . VAL B 121 ? 0.5496 1.5467 1.0039 0.1736  0.2043  0.4057  418 VAL B CG1 
2701 C CG2 . VAL B 121 ? 0.5164 1.5235 0.9249 0.1700  0.1352  0.4259  418 VAL B CG2 
2702 N N   . GLU B 122 ? 0.6369 1.7528 1.2159 0.2338  0.2319  0.3932  419 GLU B N   
2703 C CA  . GLU B 122 ? 0.6597 1.7792 1.2626 0.2550  0.2713  0.3863  419 GLU B CA  
2704 C C   . GLU B 122 ? 0.6831 1.7238 1.2119 0.2620  0.3001  0.3989  419 GLU B C   
2705 O O   . GLU B 122 ? 0.6790 1.6842 1.1910 0.2338  0.3187  0.3909  419 GLU B O   
2706 C CB  . GLU B 122 ? 0.6600 1.8398 1.3599 0.2295  0.3003  0.3511  419 GLU B CB  
2707 N N   . GLY B 123 ? 0.7123 1.7223 1.1946 0.3010  0.3027  0.4159  420 GLY B N   
2708 C CA  . GLY B 123 ? 0.7428 1.6816 1.1569 0.3148  0.3281  0.4247  420 GLY B CA  
2709 C C   . GLY B 123 ? 0.7290 1.6063 1.0591 0.3197  0.3029  0.4409  420 GLY B C   
2710 O O   . GLY B 123 ? 0.7280 1.5465 1.0024 0.3321  0.3182  0.4439  420 GLY B O   
2711 N N   . MET B 124 ? 0.7123 1.6037 1.0344 0.3104  0.2641  0.4479  421 MET B N   
2712 C CA  . MET B 124 ? 0.6985 1.5391 0.9511 0.3123  0.2395  0.4572  421 MET B CA  
2713 C C   . MET B 124 ? 0.7354 1.5413 0.9294 0.3519  0.2357  0.4674  421 MET B C   
2714 O O   . MET B 124 ? 0.6939 1.4518 0.8331 0.3619  0.2249  0.4669  421 MET B O   
2715 C CB  . MET B 124 ? 0.6514 1.5147 0.9116 0.2854  0.2041  0.4588  421 MET B CB  
2716 C CG  . MET B 124 ? 0.5272 1.3432 0.7298 0.2807  0.1801  0.4611  421 MET B CG  
2717 S SD  . MET B 124 ? 0.8505 1.6856 1.0576 0.2432  0.1436  0.4610  421 MET B SD  
2718 C CE  . MET B 124 ? 0.5066 1.2747 0.6616 0.2444  0.1246  0.4389  421 MET B CE  
2719 N N   . VAL B 125 ? 0.5392 1.1227 1.0227 0.1949  -0.0524 0.1990  422 VAL B N   
2720 C CA  . VAL B 125 ? 0.6044 1.1174 1.0379 0.2404  -0.0274 0.1994  422 VAL B CA  
2721 C C   . VAL B 125 ? 0.5940 1.0642 1.0017 0.2473  0.0149  0.1886  422 VAL B C   
2722 O O   . VAL B 125 ? 0.6243 1.0123 0.9693 0.2705  0.0288  0.1799  422 VAL B O   
2723 C CB  . VAL B 125 ? 0.5356 1.0731 0.9972 0.2819  -0.0233 0.2116  422 VAL B CB  
2724 C CG1 . VAL B 125 ? 0.5665 1.1867 1.0849 0.2666  -0.0592 0.2228  422 VAL B CG1 
2725 C CG2 . VAL B 125 ? 0.5342 1.0916 1.0228 0.3049  0.0200  0.2105  422 VAL B CG2 
2726 N N   . GLU B 126 ? 0.5486 1.0683 0.9989 0.2239  0.0336  0.1888  423 GLU B N   
2727 C CA  . GLU B 126 ? 0.5326 1.0154 0.9524 0.2290  0.0739  0.1798  423 GLU B CA  
2728 C C   . GLU B 126 ? 0.4697 0.8698 0.8175 0.1963  0.0658  0.1592  423 GLU B C   
2729 O O   . GLU B 126 ? 0.4722 0.7962 0.7531 0.2103  0.0833  0.1446  423 GLU B O   
2730 C CB  . GLU B 126 ? 0.5649 1.1144 1.0401 0.2064  0.0954  0.1888  423 GLU B CB  
2731 C CG  . GLU B 126 ? 0.6002 1.1145 1.0354 0.2145  0.1383  0.1827  423 GLU B CG  
2732 C CD  . GLU B 126 ? 0.6361 1.2120 1.1215 0.1875  0.1577  0.1973  423 GLU B CD  
2733 O OE1 . GLU B 126 ? 0.6786 1.3270 1.2292 0.1862  0.1530  0.2112  423 GLU B OE1 
2734 O OE2 . GLU B 126 ? 0.6222 1.1722 1.0807 0.1668  0.1765  0.1964  423 GLU B OE2 
2735 N N   . ILE B 127 ? 0.4409 0.8528 0.7988 0.1513  0.0371  0.1550  424 ILE B N   
2736 C CA  . ILE B 127 ? 0.4224 0.7615 0.7156 0.1213  0.0287  0.1349  424 ILE B CA  
2737 C C   . ILE B 127 ? 0.3884 0.6665 0.6212 0.1328  0.0104  0.1267  424 ILE B C   
2738 O O   . ILE B 127 ? 0.3527 0.5659 0.5263 0.1212  0.0123  0.1120  424 ILE B O   
2739 C CB  . ILE B 127 ? 0.4644 0.8276 0.7835 0.0741  0.0055  0.1297  424 ILE B CB  
2740 C CG1 . ILE B 127 ? 0.5186 0.8239 0.7939 0.0506  0.0179  0.1156  424 ILE B CG1 
2741 C CG2 . ILE B 127 ? 0.5012 0.8654 0.8069 0.0625  -0.0350 0.1230  424 ILE B CG2 
2742 C CD1 . ILE B 127 ? 0.5496 0.8688 0.8543 0.0082  0.0025  0.1113  424 ILE B CD1 
2743 N N   . PHE B 128 ? 0.3931 0.6967 0.6445 0.1558  -0.0071 0.1402  425 PHE B N   
2744 C CA  . PHE B 128 ? 0.4666 0.7146 0.6644 0.1675  -0.0233 0.1409  425 PHE B CA  
2745 C C   . PHE B 128 ? 0.4932 0.6655 0.6425 0.1929  0.0018  0.1345  425 PHE B C   
2746 O O   . PHE B 128 ? 0.4921 0.5977 0.5835 0.1798  -0.0015 0.1246  425 PHE B O   
2747 C CB  . PHE B 128 ? 0.5426 0.8373 0.7741 0.1925  -0.0464 0.1630  425 PHE B CB  
2748 C CG  . PHE B 128 ? 0.6234 0.8739 0.8024 0.1936  -0.0700 0.1699  425 PHE B CG  
2749 C CD1 . PHE B 128 ? 0.6503 0.9402 0.8297 0.1735  -0.1044 0.1746  425 PHE B CD1 
2750 C CD2 . PHE B 128 ? 0.7046 0.8727 0.8307 0.2127  -0.0582 0.1723  425 PHE B CD2 
2751 C CE1 . PHE B 128 ? 0.7001 0.9543 0.8262 0.1754  -0.1228 0.1854  425 PHE B CE1 
2752 C CE2 . PHE B 128 ? 0.7641 0.8933 0.8445 0.2102  -0.0772 0.1851  425 PHE B CE2 
2753 C CZ  . PHE B 128 ? 0.7525 0.9279 0.8319 0.1929  -0.1077 0.1936  425 PHE B CZ  
2754 N N   . ASP B 129 ? 0.5066 0.6923 0.6804 0.2290  0.0266  0.1392  426 ASP B N   
2755 C CA  . ASP B 129 ? 0.5202 0.6301 0.6444 0.2571  0.0498  0.1279  426 ASP B CA  
2756 C C   . ASP B 129 ? 0.4987 0.5603 0.5731 0.2304  0.0631  0.1059  426 ASP B C   
2757 O O   . ASP B 129 ? 0.5706 0.5537 0.5866 0.2318  0.0645  0.0924  426 ASP B O   
2758 C CB  . ASP B 129 ? 0.5239 0.6673 0.6842 0.3052  0.0779  0.1343  426 ASP B CB  
2759 C CG  . ASP B 129 ? 0.6018 0.7673 0.7942 0.3367  0.0638  0.1524  426 ASP B CG  
2760 O OD1 . ASP B 129 ? 0.5469 0.6698 0.7126 0.3348  0.0380  0.1605  426 ASP B OD1 
2761 O OD2 . ASP B 129 ? 0.6261 0.8492 0.8655 0.3571  0.0776  0.1581  426 ASP B OD2 
2762 N N   . MET B 130 ? 0.4270 0.5351 0.5264 0.2049  0.0704  0.1040  427 MET B N   
2763 C CA  . MET B 130 ? 0.4348 0.5053 0.4907 0.1818  0.0804  0.0878  427 MET B CA  
2764 C C   . MET B 130 ? 0.4514 0.4776 0.4675 0.1515  0.0566  0.0791  427 MET B C   
2765 O O   . MET B 130 ? 0.4949 0.4682 0.4614 0.1435  0.0596  0.0653  427 MET B O   
2766 C CB  . MET B 130 ? 0.3679 0.4948 0.4626 0.1616  0.0924  0.0941  427 MET B CB  
2767 C CG  . MET B 130 ? 0.3852 0.5613 0.5159 0.1886  0.1244  0.1051  427 MET B CG  
2768 S SD  . MET B 130 ? 0.6084 0.8337 0.7725 0.1584  0.1429  0.1174  427 MET B SD  
2769 C CE  . MET B 130 ? 0.4894 0.7887 0.7394 0.1283  0.1158  0.1333  427 MET B CE  
2770 N N   . LEU B 131 ? 0.3948 0.4485 0.4327 0.1351  0.0328  0.0872  428 LEU B N   
2771 C CA  . LEU B 131 ? 0.3753 0.3980 0.3776 0.1105  0.0143  0.0814  428 LEU B CA  
2772 C C   . LEU B 131 ? 0.4468 0.4100 0.4080 0.1215  0.0101  0.0836  428 LEU B C   
2773 O O   . LEU B 131 ? 0.4620 0.3840 0.3850 0.1039  0.0082  0.0752  428 LEU B O   
2774 C CB  . LEU B 131 ? 0.3662 0.4332 0.3930 0.0941  -0.0089 0.0874  428 LEU B CB  
2775 C CG  . LEU B 131 ? 0.3050 0.4135 0.3653 0.0719  -0.0109 0.0810  428 LEU B CG  
2776 C CD1 . LEU B 131 ? 0.3023 0.4592 0.3933 0.0628  -0.0367 0.0859  428 LEU B CD1 
2777 C CD2 . LEU B 131 ? 0.2918 0.3707 0.3202 0.0494  -0.0091 0.0660  428 LEU B CD2 
2778 N N   . LEU B 132 ? 0.4319 0.3916 0.4051 0.1501  0.0079  0.0971  429 LEU B N   
2779 C CA  . LEU B 132 ? 0.5338 0.4231 0.4692 0.1637  0.0056  0.1014  429 LEU B CA  
2780 C C   . LEU B 132 ? 0.5824 0.4091 0.4778 0.1644  0.0212  0.0808  429 LEU B C   
2781 O O   . LEU B 132 ? 0.6113 0.3809 0.4678 0.1456  0.0139  0.0761  429 LEU B O   
2782 C CB  . LEU B 132 ? 0.5295 0.4220 0.4882 0.2051  0.0054  0.1187  429 LEU B CB  
2783 C CG  . LEU B 132 ? 0.5351 0.4764 0.5224 0.2102  -0.0175 0.1438  429 LEU B CG  
2784 C CD1 . LEU B 132 ? 0.5739 0.5125 0.5839 0.2589  -0.0160 0.1622  429 LEU B CD1 
2785 C CD2 . LEU B 132 ? 0.5714 0.4808 0.5189 0.1837  -0.0358 0.1543  429 LEU B CD2 
2786 N N   . ALA B 133 ? 0.5454 0.3868 0.4501 0.1847  0.0422  0.0694  430 ALA B N   
2787 C CA  . ALA B 133 ? 0.6108 0.3969 0.4695 0.1893  0.0563  0.0467  430 ALA B CA  
2788 C C   . ALA B 133 ? 0.6068 0.3825 0.4378 0.1494  0.0473  0.0353  430 ALA B C   
2789 O O   . ALA B 133 ? 0.6765 0.3921 0.4628 0.1387  0.0423  0.0203  430 ALA B O   
2790 C CB  . ALA B 133 ? 0.6179 0.4390 0.4908 0.2178  0.0838  0.0404  430 ALA B CB  
2791 N N   . THR B 134 ? 0.5655 0.3994 0.4249 0.1279  0.0435  0.0420  431 THR B N   
2792 C CA  . THR B 134 ? 0.5497 0.3836 0.3909 0.0965  0.0358  0.0341  431 THR B CA  
2793 C C   . THR B 134 ? 0.6038 0.4068 0.4267 0.0740  0.0177  0.0375  431 THR B C   
2794 O O   . THR B 134 ? 0.6338 0.4079 0.4282 0.0555  0.0119  0.0275  431 THR B O   
2795 C CB  . THR B 134 ? 0.4395 0.3326 0.3157 0.0822  0.0349  0.0408  431 THR B CB  
2796 O OG1 . THR B 134 ? 0.4815 0.4093 0.3854 0.0982  0.0520  0.0447  431 THR B OG1 
2797 C CG2 . THR B 134 ? 0.4029 0.2947 0.2606 0.0600  0.0308  0.0329  431 THR B CG2 
2798 N N   . SER B 135 ? 0.5667 0.3821 0.4072 0.0746  0.0084  0.0542  432 SER B N   
2799 C CA  . SER B 135 ? 0.6233 0.4169 0.4481 0.0535  -0.0050 0.0649  432 SER B CA  
2800 C C   . SER B 135 ? 0.6976 0.4155 0.4904 0.0534  -0.0075 0.0619  432 SER B C   
2801 O O   . SER B 135 ? 0.7333 0.4262 0.5086 0.0249  -0.0159 0.0624  432 SER B O   
2802 C CB  . SER B 135 ? 0.6268 0.4485 0.4689 0.0597  -0.0140 0.0861  432 SER B CB  
2803 O OG  . SER B 135 ? 0.6907 0.4961 0.5142 0.0393  -0.0230 0.1014  432 SER B OG  
2804 N N   . SER B 136 ? 0.7248 0.4066 0.5125 0.0854  -0.0001 0.0583  433 SER B N   
2805 C CA  . SER B 136 ? 0.8429 0.4374 0.5940 0.0907  -0.0017 0.0485  433 SER B CA  
2806 C C   . SER B 136 ? 0.8191 0.3893 0.5388 0.0700  -0.0028 0.0217  433 SER B C   
2807 O O   . SER B 136 ? 0.8816 0.3920 0.5731 0.0460  -0.0153 0.0149  433 SER B O   
2808 C CB  . SER B 136 ? 0.9266 0.4942 0.6782 0.1388  0.0113  0.0449  433 SER B CB  
2809 O OG  . SER B 136 ? 1.0547 0.5388 0.7613 0.1489  0.0151  0.0201  433 SER B OG  
2810 N N   . ARG B 137 ? 0.7143 0.3321 0.4393 0.0772  0.0082  0.0088  434 ARG B N   
2811 C CA  . ARG B 137 ? 0.7807 0.3874 0.4739 0.0609  0.0051  -0.0135 434 ARG B CA  
2812 C C   . ARG B 137 ? 0.7681 0.3932 0.4670 0.0177  -0.0132 -0.0079 434 ARG B C   
2813 O O   . ARG B 137 ? 0.7819 0.3702 0.4526 -0.0052 -0.0271 -0.0223 434 ARG B O   
2814 C CB  . ARG B 137 ? 0.7946 0.4550 0.4952 0.0782  0.0221  -0.0190 434 ARG B CB  
2815 C CG  . ARG B 137 ? 0.8567 0.5150 0.5220 0.0644  0.0174  -0.0370 434 ARG B CG  
2816 C CD  . ARG B 137 ? 0.9834 0.5658 0.5899 0.0713  0.0130  -0.0643 434 ARG B CD  
2817 N NE  . ARG B 137 ? 1.0486 0.6326 0.6180 0.0524  0.0001  -0.0812 434 ARG B NE  
2818 C CZ  . ARG B 137 ? 1.2127 0.7354 0.7215 0.0518  -0.0099 -0.1106 434 ARG B CZ  
2819 N NH1 . ARG B 137 ? 1.2700 0.7160 0.7475 0.0716  -0.0054 -0.1282 434 ARG B NH1 
2820 N NH2 . ARG B 137 ? 1.2842 0.8201 0.7612 0.0335  -0.0262 -0.1234 434 ARG B NH2 
2821 N N   . PHE B 138 ? 0.7091 0.3941 0.4449 0.0073  -0.0135 0.0118  435 PHE B N   
2822 C CA  . PHE B 138 ? 0.7125 0.4268 0.4601 -0.0274 -0.0255 0.0206  435 PHE B CA  
2823 C C   . PHE B 138 ? 0.7521 0.4184 0.4900 -0.0533 -0.0380 0.0304  435 PHE B C   
2824 O O   . PHE B 138 ? 0.7353 0.4074 0.4740 -0.0866 -0.0501 0.0301  435 PHE B O   
2825 C CB  . PHE B 138 ? 0.6762 0.4561 0.4572 -0.0264 -0.0203 0.0369  435 PHE B CB  
2826 C CG  . PHE B 138 ? 0.6944 0.5224 0.4885 -0.0187 -0.0137 0.0291  435 PHE B CG  
2827 C CD1 . PHE B 138 ? 0.7529 0.5764 0.5301 -0.0189 -0.0147 0.0149  435 PHE B CD1 
2828 C CD2 . PHE B 138 ? 0.6630 0.5357 0.4819 -0.0116 -0.0085 0.0363  435 PHE B CD2 
2829 C CE1 . PHE B 138 ? 0.7197 0.5812 0.5074 -0.0106 -0.0085 0.0134  435 PHE B CE1 
2830 C CE2 . PHE B 138 ? 0.6296 0.5333 0.4600 -0.0057 -0.0031 0.0304  435 PHE B CE2 
2831 C CZ  . PHE B 138 ? 0.6329 0.5305 0.4491 -0.0045 -0.0020 0.0218  435 PHE B CZ  
2832 N N   . ARG B 139 ? 0.7256 0.3470 0.4583 -0.0388 -0.0358 0.0424  436 ARG B N   
2833 C CA  . ARG B 139 ? 0.8129 0.3791 0.5361 -0.0630 -0.0463 0.0583  436 ARG B CA  
2834 C C   . ARG B 139 ? 0.9458 0.4330 0.6358 -0.0793 -0.0586 0.0352  436 ARG B C   
2835 O O   . ARG B 139 ? 0.9884 0.4513 0.6774 -0.1205 -0.0729 0.0415  436 ARG B O   
2836 C CB  . ARG B 139 ? 0.8503 0.3843 0.5737 -0.0369 -0.0418 0.0801  436 ARG B CB  
2837 C CG  . ARG B 139 ? 0.9216 0.3942 0.6347 -0.0612 -0.0512 0.1054  436 ARG B CG  
2838 C CD  . ARG B 139 ? 0.9774 0.4403 0.6939 -0.0342 -0.0481 0.1366  436 ARG B CD  
2839 N NE  . ARG B 139 ? 1.0325 0.4584 0.7425 0.0148  -0.0426 0.1252  436 ARG B NE  
2840 C CZ  . ARG B 139 ? 0.9893 0.4777 0.7213 0.0495  -0.0344 0.1229  436 ARG B CZ  
2841 N NH1 . ARG B 139 ? 1.0546 0.5159 0.7871 0.0943  -0.0274 0.1153  436 ARG B NH1 
2842 N NH2 . ARG B 139 ? 0.8752 0.4532 0.6305 0.0396  -0.0331 0.1278  436 ARG B NH2 
2843 N N   . MET B 140 ? 1.0050 0.4544 0.6669 -0.0478 -0.0528 0.0078  437 MET B N   
2844 C CA  . MET B 140 ? 1.0822 0.4504 0.6995 -0.0569 -0.0649 -0.0228 437 MET B CA  
2845 C C   . MET B 140 ? 1.0532 0.4585 0.6679 -0.0951 -0.0815 -0.0373 437 MET B C   
2846 O O   . MET B 140 ? 1.1023 0.4555 0.6970 -0.1308 -0.1030 -0.0501 437 MET B O   
2847 C CB  . MET B 140 ? 1.1573 0.4934 0.7420 -0.0072 -0.0490 -0.0490 437 MET B CB  
2848 C CG  . MET B 140 ? 1.3124 0.5726 0.8391 -0.0103 -0.0597 -0.0887 437 MET B CG  
2849 S SD  . MET B 140 ? 2.2122 1.4583 1.7118 0.0551  -0.0321 -0.1119 437 MET B SD  
2850 C CE  . MET B 140 ? 1.2005 0.5492 0.7321 0.0804  -0.0084 -0.0958 437 MET B CE  
2851 N N   . MET B 141 ? 0.9753 0.4704 0.6127 -0.0880 -0.0736 -0.0341 438 MET B N   
2852 C CA  . MET B 141 ? 0.9336 0.4793 0.5765 -0.1174 -0.0892 -0.0417 438 MET B CA  
2853 C C   . MET B 141 ? 0.9053 0.4954 0.5909 -0.1600 -0.1002 -0.0163 438 MET B C   
2854 O O   . MET B 141 ? 0.9091 0.5407 0.6070 -0.1899 -0.1171 -0.0195 438 MET B O   
2855 C CB  . MET B 141 ? 0.8927 0.5142 0.5480 -0.0922 -0.0755 -0.0411 438 MET B CB  
2856 C CG  . MET B 141 ? 0.9355 0.5340 0.5529 -0.0532 -0.0609 -0.0614 438 MET B CG  
2857 S SD  . MET B 141 ? 0.8856 0.5707 0.5218 -0.0363 -0.0486 -0.0527 438 MET B SD  
2858 C CE  . MET B 141 ? 0.9227 0.6379 0.5517 -0.0712 -0.0779 -0.0595 438 MET B CE  
2859 N N   . ASN B 142 ? 0.8778 0.4658 0.5861 -0.1610 -0.0900 0.0111  439 ASN B N   
2860 C CA  . ASN B 142 ? 0.8199 0.4616 0.5682 -0.1955 -0.0921 0.0406  439 ASN B CA  
2861 C C   . ASN B 142 ? 0.7458 0.4909 0.5264 -0.1925 -0.0867 0.0443  439 ASN B C   
2862 O O   . ASN B 142 ? 0.7269 0.5202 0.5318 -0.2233 -0.0987 0.0480  439 ASN B O   
2863 C CB  . ASN B 142 ? 0.8928 0.4939 0.6414 -0.2469 -0.1143 0.0425  439 ASN B CB  
2864 C CG  . ASN B 142 ? 0.9225 0.5777 0.7146 -0.2831 -0.1109 0.0801  439 ASN B CG  
2865 O OD1 . ASN B 142 ? 0.9354 0.6178 0.7393 -0.2675 -0.0919 0.1065  439 ASN B OD1 
2866 N ND2 . ASN B 142 ? 0.9512 0.6286 0.7671 -0.3323 -0.1296 0.0833  439 ASN B ND2 
2867 N N   . LEU B 143 ? 0.6976 0.4758 0.4816 -0.1550 -0.0696 0.0436  440 LEU B N   
2868 C CA  . LEU B 143 ? 0.6228 0.4820 0.4322 -0.1451 -0.0631 0.0448  440 LEU B CA  
2869 C C   . LEU B 143 ? 0.6278 0.5518 0.4731 -0.1651 -0.0582 0.0685  440 LEU B C   
2870 O O   . LEU B 143 ? 0.6702 0.5885 0.5182 -0.1703 -0.0496 0.0882  440 LEU B O   
2871 C CB  . LEU B 143 ? 0.6024 0.4706 0.4085 -0.1063 -0.0468 0.0406  440 LEU B CB  
2872 C CG  . LEU B 143 ? 0.5525 0.4849 0.3795 -0.0919 -0.0397 0.0397  440 LEU B CG  
2873 C CD1 . LEU B 143 ? 0.5812 0.5209 0.3988 -0.0902 -0.0493 0.0262  440 LEU B CD1 
2874 C CD2 . LEU B 143 ? 0.4955 0.4305 0.3244 -0.0634 -0.0259 0.0387  440 LEU B CD2 
2875 N N   . GLN B 144 ? 0.6063 0.5960 0.4778 -0.1734 -0.0626 0.0684  441 GLN B N   
2876 C CA  . GLN B 144 ? 0.5439 0.6082 0.4531 -0.1869 -0.0535 0.0900  441 GLN B CA  
2877 C C   . GLN B 144 ? 0.5180 0.6300 0.4352 -0.1512 -0.0346 0.0890  441 GLN B C   
2878 O O   . GLN B 144 ? 0.4559 0.5580 0.3620 -0.1235 -0.0339 0.0724  441 GLN B O   
2879 C CB  . GLN B 144 ? 0.5577 0.6765 0.4995 -0.2143 -0.0696 0.0923  441 GLN B CB  
2880 C CG  . GLN B 144 ? 0.6143 0.6846 0.5492 -0.2579 -0.0933 0.0904  441 GLN B CG  
2881 C CD  . GLN B 144 ? 0.6847 0.7357 0.6294 -0.2904 -0.0870 0.1166  441 GLN B CD  
2882 O OE1 . GLN B 144 ? 0.7540 0.7197 0.6650 -0.2909 -0.0869 0.1162  441 GLN B OE1 
2883 N NE2 . GLN B 144 ? 0.6420 0.7747 0.6342 -0.3156 -0.0799 0.1429  441 GLN B NE2 
2884 N N   . GLY B 145 ? 0.5487 0.7089 0.4819 -0.1528 -0.0186 0.1069  442 GLY B N   
2885 C CA  . GLY B 145 ? 0.4490 0.6495 0.3842 -0.1197 -0.0014 0.1016  442 GLY B CA  
2886 C C   . GLY B 145 ? 0.4431 0.6887 0.4013 -0.1011 -0.0028 0.0906  442 GLY B C   
2887 O O   . GLY B 145 ? 0.4737 0.7158 0.4236 -0.0693 0.0044  0.0768  442 GLY B O   
2888 N N   . GLU B 146 ? 0.4187 0.7050 0.4070 -0.1221 -0.0145 0.0982  443 GLU B N   
2889 C CA  . GLU B 146 ? 0.3536 0.6878 0.3666 -0.1033 -0.0201 0.0926  443 GLU B CA  
2890 C C   . GLU B 146 ? 0.4105 0.6881 0.3942 -0.0856 -0.0327 0.0746  443 GLU B C   
2891 O O   . GLU B 146 ? 0.4417 0.7335 0.4296 -0.0551 -0.0301 0.0692  443 GLU B O   
2892 C CB  . GLU B 146 ? 0.3797 0.7767 0.4348 -0.1346 -0.0357 0.1066  443 GLU B CB  
2893 C CG  . GLU B 146 ? 0.4488 0.9259 0.5461 -0.1508 -0.0188 0.1305  443 GLU B CG  
2894 C CD  . GLU B 146 ? 0.5725 1.0147 0.6574 -0.1893 -0.0153 0.1459  443 GLU B CD  
2895 O OE1 . GLU B 146 ? 0.6158 0.9677 0.6590 -0.1978 -0.0258 0.1356  443 GLU B OE1 
2896 O OE2 . GLU B 146 ? 0.6425 1.1488 0.7603 -0.2093 -0.0004 0.1711  443 GLU B OE2 
2897 N N   . GLU B 147 ? 0.4337 0.6455 0.3864 -0.1028 -0.0444 0.0672  444 GLU B N   
2898 C CA  . GLU B 147 ? 0.4598 0.6209 0.3805 -0.0859 -0.0513 0.0522  444 GLU B CA  
2899 C C   . GLU B 147 ? 0.4470 0.5744 0.3517 -0.0586 -0.0339 0.0462  444 GLU B C   
2900 O O   . GLU B 147 ? 0.4738 0.5875 0.3690 -0.0365 -0.0317 0.0405  444 GLU B O   
2901 C CB  . GLU B 147 ? 0.5072 0.6098 0.3971 -0.1090 -0.0667 0.0432  444 GLU B CB  
2902 C CG  . GLU B 147 ? 0.5585 0.6841 0.4593 -0.1418 -0.0911 0.0440  444 GLU B CG  
2903 C CD  . GLU B 147 ? 0.6470 0.6989 0.5114 -0.1660 -0.1059 0.0307  444 GLU B CD  
2904 O OE1 . GLU B 147 ? 0.6604 0.6599 0.5101 -0.1669 -0.0946 0.0319  444 GLU B OE1 
2905 O OE2 . GLU B 147 ? 0.7019 0.7456 0.5491 -0.1819 -0.1301 0.0180  444 GLU B OE2 
2906 N N   . PHE B 148 ? 0.4781 0.5939 0.3804 -0.0625 -0.0233 0.0498  445 PHE B N   
2907 C CA  . PHE B 148 ? 0.4607 0.5526 0.3520 -0.0418 -0.0117 0.0435  445 PHE B CA  
2908 C C   . PHE B 148 ? 0.4425 0.5605 0.3459 -0.0173 -0.0031 0.0383  445 PHE B C   
2909 O O   . PHE B 148 ? 0.4286 0.5190 0.3250 -0.0016 -0.0007 0.0307  445 PHE B O   
2910 C CB  . PHE B 148 ? 0.4287 0.5157 0.3137 -0.0500 -0.0057 0.0510  445 PHE B CB  
2911 C CG  . PHE B 148 ? 0.4486 0.5299 0.3263 -0.0309 0.0020  0.0435  445 PHE B CG  
2912 C CD1 . PHE B 148 ? 0.4606 0.5047 0.3302 -0.0222 -0.0005 0.0365  445 PHE B CD1 
2913 C CD2 . PHE B 148 ? 0.4514 0.5679 0.3302 -0.0223 0.0112  0.0425  445 PHE B CD2 
2914 C CE1 . PHE B 148 ? 0.4127 0.4554 0.2805 -0.0108 0.0014  0.0290  445 PHE B CE1 
2915 C CE2 . PHE B 148 ? 0.4640 0.5702 0.3301 -0.0080 0.0133  0.0306  445 PHE B CE2 
2916 C CZ  . PHE B 148 ? 0.4605 0.5300 0.3236 -0.0051 0.0060  0.0242  445 PHE B CZ  
2917 N N   . VAL B 149 ? 0.4158 0.5858 0.3388 -0.0137 0.0027  0.0433  446 VAL B N   
2918 C CA  . VAL B 149 ? 0.3835 0.5709 0.3148 0.0152  0.0125  0.0357  446 VAL B CA  
2919 C C   . VAL B 149 ? 0.4301 0.6092 0.3678 0.0313  0.0055  0.0355  446 VAL B C   
2920 O O   . VAL B 149 ? 0.4742 0.6343 0.4104 0.0555  0.0112  0.0285  446 VAL B O   
2921 C CB  . VAL B 149 ? 0.3355 0.5879 0.2871 0.0221  0.0247  0.0415  446 VAL B CB  
2922 C CG1 . VAL B 149 ? 0.2830 0.5428 0.2197 0.0081  0.0341  0.0457  446 VAL B CG1 
2923 C CG2 . VAL B 149 ? 0.3516 0.6597 0.3359 0.0089  0.0166  0.0569  446 VAL B CG2 
2924 N N   . CYS B 150 ? 0.3868 0.5750 0.3273 0.0170  -0.0085 0.0436  447 CYS B N   
2925 C CA  . CYS B 150 ? 0.3749 0.5557 0.3122 0.0317  -0.0174 0.0472  447 CYS B CA  
2926 C C   . CYS B 150 ? 0.3758 0.4946 0.2858 0.0360  -0.0142 0.0425  447 CYS B C   
2927 O O   . CYS B 150 ? 0.3932 0.4925 0.3010 0.0564  -0.0102 0.0456  447 CYS B O   
2928 C CB  . CYS B 150 ? 0.3797 0.5892 0.3197 0.0127  -0.0372 0.0542  447 CYS B CB  
2929 S SG  . CYS B 150 ? 0.5147 0.8188 0.5039 0.0114  -0.0440 0.0669  447 CYS B SG  
2930 N N   . LEU B 151 ? 0.3303 0.4193 0.2226 0.0174  -0.0145 0.0375  448 LEU B N   
2931 C CA  . LEU B 151 ? 0.3787 0.4221 0.2526 0.0210  -0.0084 0.0351  448 LEU B CA  
2932 C C   . LEU B 151 ? 0.4457 0.4725 0.3305 0.0330  0.0024  0.0318  448 LEU B C   
2933 O O   . LEU B 151 ? 0.4945 0.4966 0.3768 0.0416  0.0075  0.0365  448 LEU B O   
2934 C CB  . LEU B 151 ? 0.4036 0.4240 0.2632 0.0049  -0.0091 0.0300  448 LEU B CB  
2935 C CG  . LEU B 151 ? 0.4987 0.5097 0.3356 -0.0076 -0.0208 0.0276  448 LEU B CG  
2936 C CD1 . LEU B 151 ? 0.5196 0.4941 0.3409 -0.0167 -0.0191 0.0215  448 LEU B CD1 
2937 C CD2 . LEU B 151 ? 0.5334 0.5350 0.3474 0.0047  -0.0221 0.0296  448 LEU B CD2 
2938 N N   . LYS B 152 ? 0.4250 0.4646 0.3194 0.0315  0.0053  0.0244  449 LYS B N   
2939 C CA  . LYS B 152 ? 0.4404 0.4613 0.3392 0.0395  0.0108  0.0150  449 LYS B CA  
2940 C C   . LYS B 152 ? 0.4618 0.4716 0.3674 0.0599  0.0138  0.0147  449 LYS B C   
2941 O O   . LYS B 152 ? 0.4616 0.4348 0.3692 0.0629  0.0159  0.0114  449 LYS B O   
2942 C CB  . LYS B 152 ? 0.4124 0.4530 0.3085 0.0362  0.0122  0.0058  449 LYS B CB  
2943 C CG  . LYS B 152 ? 0.4256 0.4435 0.3171 0.0380  0.0117  -0.0086 449 LYS B CG  
2944 C CD  . LYS B 152 ? 0.4423 0.4809 0.3196 0.0322  0.0107  -0.0142 449 LYS B CD  
2945 C CE  . LYS B 152 ? 0.4173 0.4941 0.2899 0.0429  0.0200  -0.0151 449 LYS B CE  
2946 N NZ  . LYS B 152 ? 0.4257 0.5215 0.2759 0.0401  0.0221  -0.0195 449 LYS B NZ  
2947 N N   . SER B 153 ? 0.4257 0.4672 0.3386 0.0735  0.0129  0.0203  450 SER B N   
2948 C CA  . SER B 153 ? 0.4670 0.4974 0.3871 0.0997  0.0150  0.0240  450 SER B CA  
2949 C C   . SER B 153 ? 0.4751 0.4740 0.3878 0.1009  0.0121  0.0407  450 SER B C   
2950 O O   . SER B 153 ? 0.4751 0.4344 0.3888 0.1152  0.0156  0.0453  450 SER B O   
2951 C CB  . SER B 153 ? 0.4814 0.5679 0.4182 0.1168  0.0139  0.0301  450 SER B CB  
2952 O OG  . SER B 153 ? 0.5957 0.7143 0.5386 0.1199  0.0227  0.0175  450 SER B OG  
2953 N N   . ILE B 154 ? 0.4432 0.4554 0.3441 0.0861  0.0063  0.0501  451 ILE B N   
2954 C CA  . ILE B 154 ? 0.4409 0.4292 0.3251 0.0878  0.0065  0.0668  451 ILE B CA  
2955 C C   . ILE B 154 ? 0.4149 0.3592 0.3003 0.0794  0.0177  0.0678  451 ILE B C   
2956 O O   . ILE B 154 ? 0.4664 0.3805 0.3503 0.0873  0.0229  0.0837  451 ILE B O   
2957 C CB  . ILE B 154 ? 0.4187 0.4259 0.2804 0.0744  -0.0014 0.0694  451 ILE B CB  
2958 C CG1 . ILE B 154 ? 0.4081 0.4610 0.2728 0.0797  -0.0177 0.0734  451 ILE B CG1 
2959 C CG2 . ILE B 154 ? 0.3804 0.3615 0.2158 0.0766  0.0048  0.0840  451 ILE B CG2 
2960 C CD1 . ILE B 154 ? 0.4079 0.4756 0.2500 0.0602  -0.0311 0.0681  451 ILE B CD1 
2961 N N   . ILE B 155 ? 0.4229 0.3666 0.3147 0.0626  0.0202  0.0539  452 ILE B N   
2962 C CA  . ILE B 155 ? 0.4634 0.3794 0.3674 0.0510  0.0275  0.0540  452 ILE B CA  
2963 C C   . ILE B 155 ? 0.5156 0.3950 0.4328 0.0568  0.0279  0.0519  452 ILE B C   
2964 O O   . ILE B 155 ? 0.5062 0.3547 0.4315 0.0509  0.0340  0.0664  452 ILE B O   
2965 C CB  . ILE B 155 ? 0.4383 0.3679 0.3504 0.0364  0.0247  0.0385  452 ILE B CB  
2966 C CG1 . ILE B 155 ? 0.4345 0.3821 0.3330 0.0315  0.0261  0.0419  452 ILE B CG1 
2967 C CG2 . ILE B 155 ? 0.4312 0.3426 0.3651 0.0232  0.0267  0.0370  452 ILE B CG2 
2968 C CD1 . ILE B 155 ? 0.3647 0.3237 0.2689 0.0222  0.0221  0.0316  452 ILE B CD1 
2969 N N   . LEU B 156 ? 0.4959 0.3767 0.4140 0.0686  0.0228  0.0341  453 LEU B N   
2970 C CA  . LEU B 156 ? 0.4361 0.2719 0.3593 0.0788  0.0224  0.0245  453 LEU B CA  
2971 C C   . LEU B 156 ? 0.4961 0.2961 0.4190 0.0948  0.0262  0.0477  453 LEU B C   
2972 O O   . LEU B 156 ? 0.5376 0.2827 0.4678 0.0884  0.0277  0.0522  453 LEU B O   
2973 C CB  . LEU B 156 ? 0.4743 0.3260 0.3909 0.0985  0.0208  0.0019  453 LEU B CB  
2974 C CG  . LEU B 156 ? 0.5176 0.3150 0.4312 0.1183  0.0215  -0.0135 453 LEU B CG  
2975 C CD1 . LEU B 156 ? 0.5356 0.2820 0.4511 0.0935  0.0150  -0.0292 453 LEU B CD1 
2976 C CD2 . LEU B 156 ? 0.5473 0.3713 0.4511 0.1449  0.0256  -0.0356 453 LEU B CD2 
2977 N N   . LEU B 157 ? 0.4705 0.3011 0.3849 0.1136  0.0255  0.0643  454 LEU B N   
2978 C CA  . LEU B 157 ? 0.5783 0.3818 0.4880 0.1350  0.0265  0.0905  454 LEU B CA  
2979 C C   . LEU B 157 ? 0.6015 0.3923 0.5007 0.1205  0.0326  0.1204  454 LEU B C   
2980 O O   . LEU B 157 ? 0.6505 0.3990 0.5460 0.1299  0.0365  0.1461  454 LEU B O   
2981 C CB  . LEU B 157 ? 0.5693 0.4222 0.4766 0.1625  0.0193  0.0974  454 LEU B CB  
2982 C CG  . LEU B 157 ? 0.5852 0.4565 0.5065 0.1860  0.0191  0.0752  454 LEU B CG  
2983 C CD1 . LEU B 157 ? 0.5932 0.5355 0.5237 0.2058  0.0113  0.0856  454 LEU B CD1 
2984 C CD2 . LEU B 157 ? 0.6517 0.4545 0.5755 0.2114  0.0237  0.0720  454 LEU B CD2 
2985 N N   . ASN B 158 ? 0.5680 0.3933 0.4600 0.1001  0.0353  0.1186  455 ASN B N   
2986 C CA  . ASN B 158 ? 0.6305 0.4555 0.5058 0.0917  0.0452  0.1453  455 ASN B CA  
2987 C C   . ASN B 158 ? 0.6598 0.4580 0.5544 0.0676  0.0590  0.1543  455 ASN B C   
2988 O O   . ASN B 158 ? 0.7340 0.5112 0.6230 0.0653  0.0708  0.1855  455 ASN B O   
2989 C CB  . ASN B 158 ? 0.5665 0.4380 0.4183 0.0875  0.0430  0.1389  455 ASN B CB  
2990 C CG  . ASN B 158 ? 0.5867 0.4595 0.4099 0.0857  0.0559  0.1635  455 ASN B CG  
2991 O OD1 . ASN B 158 ? 0.5783 0.4433 0.3774 0.1005  0.0558  0.1895  455 ASN B OD1 
2992 N ND2 . ASN B 158 ? 0.5702 0.4554 0.3941 0.0712  0.0682  0.1571  455 ASN B ND2 
2993 N N   . SER B 159 ? 1.4359 1.0085 0.6551 0.2915  0.2150  0.0327  456 SER B N   
2994 C CA  . SER B 159 ? 1.4034 0.9899 0.5614 0.2894  0.2516  0.0519  456 SER B CA  
2995 C C   . SER B 159 ? 1.3837 0.9691 0.4843 0.2815  0.2518  0.0862  456 SER B C   
2996 O O   . SER B 159 ? 1.3993 1.0101 0.4696 0.2759  0.2558  0.1025  456 SER B O   
2997 C CB  . SER B 159 ? 1.3353 0.9467 0.5458 0.2809  0.2933  0.0607  456 SER B CB  
2998 O OG  . SER B 159 ? 1.3010 0.9130 0.5405 0.2897  0.2986  0.0369  456 SER B OG  
2999 N N   . GLY B 160 ? 1.3726 0.9425 0.5011 0.2744  0.2357  0.0966  457 GLY B N   
3000 C CA  . GLY B 160 ? 1.3990 0.9556 0.4841 0.2640  0.2284  0.1302  457 GLY B CA  
3001 C C   . GLY B 160 ? 1.6507 1.1831 0.7140 0.2714  0.1875  0.1341  457 GLY B C   
3002 O O   . GLY B 160 ? 1.4713 0.9813 0.5208 0.2631  0.1743  0.1608  457 GLY B O   
3003 N N   . VAL B 161 ? 1.4771 1.0102 0.5378 0.2864  0.1627  0.1082  458 VAL B N   
3004 C CA  . VAL B 161 ? 1.5977 1.1133 0.6460 0.2950  0.1202  0.1107  458 VAL B CA  
3005 C C   . VAL B 161 ? 1.6806 1.2004 0.6416 0.2994  0.1084  0.1383  458 VAL B C   
3006 O O   . VAL B 161 ? 1.7282 1.2369 0.6708 0.3068  0.0735  0.1480  458 VAL B O   
3007 C CB  . VAL B 161 ? 1.5377 1.0537 0.6289 0.3066  0.0888  0.0743  458 VAL B CB  
3008 C CG1 . VAL B 161 ? 1.5932 1.1108 0.6169 0.3197  0.0715  0.0523  458 VAL B CG1 
3009 C CG2 . VAL B 161 ? 1.5503 1.0544 0.6742 0.3125  0.0512  0.0817  458 VAL B CG2 
3010 N N   . TYR B 162 ? 1.6931 1.2371 0.6045 0.2971  0.1394  0.1577  459 TYR B N   
3011 C CA  . TYR B 162 ? 1.7476 1.3211 0.6105 0.2961  0.1338  0.1945  459 TYR B CA  
3012 C C   . TYR B 162 ? 1.7130 1.3204 0.6295 0.2596  0.1529  0.2356  459 TYR B C   
3013 O O   . TYR B 162 ? 1.6514 1.2689 0.6157 0.2427  0.1770  0.2294  459 TYR B O   
3014 C CB  . TYR B 162 ? 1.7714 1.3848 0.6009 0.3153  0.1367  0.1713  459 TYR B CB  
3015 C CG  . TYR B 162 ? 1.8394 1.4118 0.6078 0.3501  0.1058  0.1241  459 TYR B CG  
3016 C CD1 . TYR B 162 ? 1.8414 1.4036 0.6007 0.3669  0.1126  0.0770  459 TYR B CD1 
3017 C CD2 . TYR B 162 ? 1.8857 1.4370 0.6452 0.3562  0.0601  0.1225  459 TYR B CD2 
3018 C CE1 . TYR B 162 ? 1.7866 1.3202 0.5510 0.3803  0.0681  0.0269  459 TYR B CE1 
3019 C CE2 . TYR B 162 ? 1.9267 1.4585 0.6912 0.3703  0.0179  0.0743  459 TYR B CE2 
3020 C CZ  . TYR B 162 ? 1.9327 1.4534 0.7007 0.3804  0.0195  0.0262  459 TYR B CZ  
3021 O OH  . TYR B 162 ? 1.8652 1.3595 0.6457 0.3894  -0.0319 -0.0207 459 TYR B OH  
3022 N N   . GLU B 173 ? 2.0739 1.3213 1.1315 0.3430  -0.1121 0.3126  470 GLU B N   
3023 C CA  . GLU B 173 ? 2.0983 1.4073 1.1186 0.3374  -0.1147 0.3164  470 GLU B CA  
3024 C C   . GLU B 173 ? 2.0847 1.4298 1.1430 0.3595  -0.1300 0.2827  470 GLU B C   
3025 O O   . GLU B 173 ? 2.1014 1.4815 1.1308 0.3641  -0.1536 0.2854  470 GLU B O   
3026 C CB  . GLU B 173 ? 2.1970 1.5057 1.1689 0.3309  -0.1402 0.3724  470 GLU B CB  
3027 C CG  . GLU B 173 ? 2.2399 1.6122 1.1473 0.3302  -0.1382 0.3823  470 GLU B CG  
3028 C CD  . GLU B 173 ? 2.2415 1.6405 1.1097 0.3107  -0.1003 0.3917  470 GLU B CD  
3029 O OE1 . GLU B 173 ? 2.2620 1.6322 1.1432 0.2881  -0.0872 0.4214  470 GLU B OE1 
3030 O OE2 . GLU B 173 ? 2.2263 1.6736 1.0507 0.3198  -0.0869 0.3696  470 GLU B OE2 
3031 N N   . GLU B 174 ? 2.0828 1.4228 1.2073 0.3743  -0.1189 0.2537  471 GLU B N   
3032 C CA  . GLU B 174 ? 2.1086 1.4907 1.2900 0.3908  -0.1348 0.2309  471 GLU B CA  
3033 C C   . GLU B 174 ? 2.0864 1.5069 1.2889 0.3794  -0.1118 0.1953  471 GLU B C   
3034 O O   . GLU B 174 ? 2.0573 1.5045 1.3361 0.3897  -0.1061 0.1775  471 GLU B O   
3035 C CB  . GLU B 174 ? 2.1189 1.4886 1.3721 0.4211  -0.1396 0.2333  471 GLU B CB  
3036 C CG  . GLU B 174 ? 2.1996 1.5452 1.4469 0.4385  -0.1773 0.2664  471 GLU B CG  
3037 C CD  . GLU B 174 ? 2.2671 1.5490 1.4542 0.4279  -0.1801 0.2964  471 GLU B CD  
3038 O OE1 . GLU B 174 ? 2.2480 1.4987 1.4111 0.4118  -0.1527 0.2892  471 GLU B OE1 
3039 O OE2 . GLU B 174 ? 2.3330 1.5977 1.5025 0.4339  -0.2128 0.3314  471 GLU B OE2 
3040 N N   . LYS B 175 ? 2.0879 1.5134 1.2253 0.3601  -0.0974 0.1911  472 LYS B N   
3041 C CA  . LYS B 175 ? 2.0323 1.4887 1.1715 0.3515  -0.0863 0.1580  472 LYS B CA  
3042 C C   . LYS B 175 ? 2.0756 1.5546 1.2240 0.3593  -0.1335 0.1438  472 LYS B C   
3043 O O   . LYS B 175 ? 2.1507 1.6317 1.2268 0.3628  -0.1607 0.1512  472 LYS B O   
3044 C CB  . LYS B 175 ? 2.0316 1.4891 1.0872 0.3383  -0.0631 0.1629  472 LYS B CB  
3045 N N   . ASP B 176 ? 1.2087 0.8371 0.9764 0.3393  0.0494  0.1466  473 ASP B N   
3046 C CA  . ASP B 176 ? 1.1830 0.8838 0.9698 0.3597  0.0310  0.1687  473 ASP B CA  
3047 C C   . ASP B 176 ? 1.0879 0.8542 0.9083 0.3783  0.0335  0.1513  473 ASP B C   
3048 O O   . ASP B 176 ? 1.0218 0.8680 0.8598 0.3752  0.0217  0.1545  473 ASP B O   
3049 C CB  . ASP B 176 ? 1.2846 0.9599 1.0739 0.3903  0.0244  0.1942  473 ASP B CB  
3050 C CG  . ASP B 176 ? 1.2982 1.0575 1.1135 0.4154  0.0056  0.2140  473 ASP B CG  
3051 O OD1 . ASP B 176 ? 1.2918 1.0841 1.0957 0.4010  -0.0113 0.2348  473 ASP B OD1 
3052 O OD2 . ASP B 176 ? 1.3112 1.1084 1.1586 0.4473  0.0078  0.2073  473 ASP B OD2 
3053 N N   . HIS B 177 ? 1.0669 0.7997 0.8960 0.3944  0.0495  0.1312  474 HIS B N   
3054 C CA  . HIS B 177 ? 1.0056 0.7945 0.8631 0.4069  0.0567  0.1092  474 HIS B CA  
3055 C C   . HIS B 177 ? 0.9064 0.7259 0.7589 0.3744  0.0581  0.0937  474 HIS B C   
3056 O O   . HIS B 177 ? 0.8265 0.7279 0.7020 0.3750  0.0508  0.0935  474 HIS B O   
3057 C CB  . HIS B 177 ? 1.0601 0.7956 0.9212 0.4228  0.0757  0.0855  474 HIS B CB  
3058 C CG  . HIS B 177 ? 1.0308 0.8219 0.9168 0.4297  0.0861  0.0587  474 HIS B CG  
3059 N ND1 . HIS B 177 ? 1.0429 0.9158 0.9652 0.4586  0.0823  0.0618  474 HIS B ND1 
3060 C CD2 . HIS B 177 ? 1.0013 0.7854 0.8814 0.4086  0.1001  0.0285  474 HIS B CD2 
3061 C CE1 . HIS B 177 ? 1.0329 0.9456 0.9697 0.4544  0.0949  0.0347  474 HIS B CE1 
3062 N NE2 . HIS B 177 ? 1.0095 0.8692 0.9204 0.4246  0.1053  0.0144  474 HIS B NE2 
3063 N N   . ILE B 178 ? 0.8939 0.6495 0.7181 0.3450  0.0668  0.0818  475 ILE B N   
3064 C CA  . ILE B 178 ? 0.8415 0.6150 0.6591 0.3145  0.0676  0.0691  475 ILE B CA  
3065 C C   . ILE B 178 ? 0.8482 0.6765 0.6698 0.3039  0.0493  0.0886  475 ILE B C   
3066 O O   . ILE B 178 ? 0.8309 0.7193 0.6694 0.2968  0.0442  0.0837  475 ILE B O   
3067 C CB  . ILE B 178 ? 0.8873 0.5839 0.6735 0.2823  0.0775  0.0574  475 ILE B CB  
3068 C CG1 . ILE B 178 ? 0.9447 0.5878 0.7261 0.2852  0.0942  0.0350  475 ILE B CG1 
3069 C CG2 . ILE B 178 ? 0.8533 0.5707 0.6364 0.2542  0.0776  0.0450  475 ILE B CG2 
3070 C CD1 . ILE B 178 ? 0.9483 0.5304 0.7033 0.2479  0.1034  0.0203  475 ILE B CD1 
3071 N N   . HIS B 179 ? 0.8624 0.6716 0.6683 0.3002  0.0391  0.1100  476 HIS B N   
3072 C CA  . HIS B 179 ? 0.8063 0.6675 0.6130 0.2862  0.0210  0.1258  476 HIS B CA  
3073 C C   . HIS B 179 ? 0.7220 0.6753 0.5630 0.3041  0.0084  0.1325  476 HIS B C   
3074 O O   . HIS B 179 ? 0.6924 0.7055 0.5433 0.2857  -0.0040 0.1334  476 HIS B O   
3075 C CB  . HIS B 179 ? 0.8821 0.7091 0.6639 0.2787  0.0139  0.1461  476 HIS B CB  
3076 C CG  . HIS B 179 ? 0.9298 0.6906 0.6800 0.2490  0.0235  0.1403  476 HIS B CG  
3077 N ND1 . HIS B 179 ? 0.9899 0.6818 0.7191 0.2477  0.0325  0.1468  476 HIS B ND1 
3078 C CD2 . HIS B 179 ? 0.8899 0.6472 0.6280 0.2181  0.0257  0.1290  476 HIS B CD2 
3079 C CE1 . HIS B 179 ? 0.9845 0.6398 0.6912 0.2155  0.0404  0.1387  476 HIS B CE1 
3080 N NE2 . HIS B 179 ? 0.9327 0.6267 0.6451 0.1987  0.0367  0.1275  476 HIS B NE2 
3081 N N   . ARG B 180 ? 0.6935 0.6597 0.5537 0.3371  0.0117  0.1358  477 ARG B N   
3082 C CA  . ARG B 180 ? 0.7224 0.7826 0.6193 0.3537  0.0025  0.1400  477 ARG B CA  
3083 C C   . ARG B 180 ? 0.7276 0.8410 0.6465 0.3438  0.0086  0.1209  477 ARG B C   
3084 O O   . ARG B 180 ? 0.7078 0.9070 0.6513 0.3332  -0.0027 0.1239  477 ARG B O   
3085 C CB  . ARG B 180 ? 0.7740 0.8315 0.6876 0.3937  0.0074  0.1457  477 ARG B CB  
3086 N N   . VAL B 181 ? 0.7569 0.8215 0.6666 0.3429  0.0266  0.1007  478 VAL B N   
3087 C CA  . VAL B 181 ? 0.6920 0.8051 0.6202 0.3320  0.0341  0.0829  478 VAL B CA  
3088 C C   . VAL B 181 ? 0.6625 0.7881 0.5829 0.2859  0.0232  0.0832  478 VAL B C   
3089 O O   . VAL B 181 ? 0.6344 0.8290 0.5766 0.2632  0.0177  0.0803  478 VAL B O   
3090 C CB  . VAL B 181 ? 0.6552 0.7115 0.5709 0.3351  0.0566  0.0572  478 VAL B CB  
3091 C CG1 . VAL B 181 ? 0.6090 0.7206 0.5393 0.3130  0.0640  0.0394  478 VAL B CG1 
3092 C CG2 . VAL B 181 ? 0.6716 0.7101 0.5954 0.3666  0.0666  0.0513  478 VAL B CG2 
3093 N N   . LEU B 182 ? 0.6634 0.7191 0.5524 0.2668  0.0214  0.0856  479 LEU B N   
3094 C CA  . LEU B 182 ? 0.6086 0.6660 0.4893 0.2229  0.0125  0.0831  479 LEU B CA  
3095 C C   . LEU B 182 ? 0.5922 0.7180 0.4872 0.2116  -0.0067 0.0958  479 LEU B C   
3096 O O   . LEU B 182 ? 0.6160 0.7736 0.5211 0.1786  -0.0125 0.0895  479 LEU B O   
3097 C CB  . LEU B 182 ? 0.5987 0.5783 0.4454 0.2100  0.0153  0.0840  479 LEU B CB  
3098 C CG  . LEU B 182 ? 0.5497 0.4697 0.3824 0.1988  0.0317  0.0662  479 LEU B CG  
3099 C CD1 . LEU B 182 ? 0.5541 0.4036 0.3551 0.1904  0.0358  0.0704  479 LEU B CD1 
3100 C CD2 . LEU B 182 ? 0.4616 0.4068 0.3060 0.1663  0.0311  0.0531  479 LEU B CD2 
3101 N N   . ASP B 183 ? 0.5605 0.7078 0.4554 0.2382  -0.0170 0.1142  480 ASP B N   
3102 C CA  . ASP B 183 ? 0.5835 0.8074 0.4922 0.2279  -0.0369 0.1254  480 ASP B CA  
3103 C C   . ASP B 183 ? 0.6089 0.9196 0.5572 0.2227  -0.0383 0.1198  480 ASP B C   
3104 O O   . ASP B 183 ? 0.6407 1.0039 0.5999 0.1896  -0.0504 0.1181  480 ASP B O   
3105 C CB  . ASP B 183 ? 0.6345 0.8635 0.5400 0.2506  -0.0446 0.1424  480 ASP B CB  
3106 C CG  . ASP B 183 ? 0.6285 0.7857 0.4944 0.2428  -0.0456 0.1500  480 ASP B CG  
3107 O OD1 . ASP B 183 ? 0.5813 0.6996 0.4233 0.2162  -0.0429 0.1411  480 ASP B OD1 
3108 O OD2 . ASP B 183 ? 0.6605 0.8026 0.5192 0.2626  -0.0487 0.1657  480 ASP B OD2 
3109 N N   . LYS B 184 ? 0.6029 0.9276 0.5714 0.2529  -0.0243 0.1152  481 LYS B N   
3110 C CA  . LYS B 184 ? 0.5429 0.9544 0.5484 0.2477  -0.0214 0.1092  481 LYS B CA  
3111 C C   . LYS B 184 ? 0.4588 0.8645 0.4618 0.1994  -0.0169 0.0959  481 LYS B C   
3112 O O   . LYS B 184 ? 0.4161 0.8914 0.4413 0.1721  -0.0231 0.0969  481 LYS B O   
3113 C CB  . LYS B 184 ? 0.5422 0.9591 0.5635 0.2886  -0.0024 0.1012  481 LYS B CB  
3114 N N   . ILE B 185 ? 0.4358 0.7594 0.4122 0.1883  -0.0066 0.0855  482 ILE B N   
3115 C CA  . ILE B 185 ? 0.4626 0.7741 0.4354 0.1475  -0.0040 0.0773  482 ILE B CA  
3116 C C   . ILE B 185 ? 0.4711 0.7827 0.4391 0.1107  -0.0200 0.0816  482 ILE B C   
3117 O O   . ILE B 185 ? 0.4679 0.8028 0.4460 0.0768  -0.0231 0.0809  482 ILE B O   
3118 C CB  . ILE B 185 ? 0.4638 0.6953 0.4115 0.1462  0.0087  0.0660  482 ILE B CB  
3119 C CG1 . ILE B 185 ? 0.4360 0.6596 0.3837 0.1801  0.0259  0.0561  482 ILE B CG1 
3120 C CG2 . ILE B 185 ? 0.4332 0.6607 0.3805 0.1092  0.0094  0.0623  482 ILE B CG2 
3121 C CD1 . ILE B 185 ? 0.4533 0.6064 0.3760 0.1743  0.0379  0.0422  482 ILE B CD1 
3122 N N   . THR B 186 ? 0.4779 0.7607 0.4279 0.1166  -0.0293 0.0857  483 THR B N   
3123 C CA  . THR B 186 ? 0.4509 0.7369 0.3932 0.0841  -0.0436 0.0850  483 THR B CA  
3124 C C   . THR B 186 ? 0.4213 0.7953 0.3897 0.0674  -0.0559 0.0900  483 THR B C   
3125 O O   . THR B 186 ? 0.4309 0.8141 0.4038 0.0280  -0.0616 0.0846  483 THR B O   
3126 C CB  . THR B 186 ? 0.4889 0.7416 0.4039 0.0954  -0.0506 0.0892  483 THR B CB  
3127 O OG1 . THR B 186 ? 0.4988 0.6729 0.3905 0.1044  -0.0380 0.0843  483 THR B OG1 
3128 C CG2 . THR B 186 ? 0.4609 0.7208 0.3649 0.0601  -0.0636 0.0826  483 THR B CG2 
3129 N N   . ASP B 187 ? 0.4364 0.8750 0.4237 0.0976  -0.0598 0.1004  484 ASP B N   
3130 C CA  . ASP B 187 ? 0.4324 0.9722 0.4508 0.0838  -0.0710 0.1058  484 ASP B CA  
3131 C C   . ASP B 187 ? 0.4178 0.9879 0.4576 0.0551  -0.0617 0.1008  484 ASP B C   
3132 O O   . ASP B 187 ? 0.4005 1.0254 0.4560 0.0171  -0.0707 0.1011  484 ASP B O   
3133 C CB  . ASP B 187 ? 0.4188 1.0127 0.4582 0.1279  -0.0696 0.1160  484 ASP B CB  
3134 C CG  . ASP B 187 ? 0.4640 1.0222 0.4812 0.1509  -0.0774 0.1245  484 ASP B CG  
3135 O OD1 . ASP B 187 ? 0.4395 0.9648 0.4300 0.1261  -0.0883 0.1224  484 ASP B OD1 
3136 O OD2 . ASP B 187 ? 0.5140 1.0762 0.5389 0.1927  -0.0720 0.1333  484 ASP B OD2 
3137 N N   . THR B 188 ? 0.4331 0.9670 0.4704 0.0699  -0.0438 0.0967  485 THR B N   
3138 C CA  . THR B 188 ? 0.4450 1.0065 0.4967 0.0445  -0.0337 0.0954  485 THR B CA  
3139 C C   . THR B 188 ? 0.4465 0.9583 0.4834 -0.0041 -0.0387 0.0939  485 THR B C   
3140 O O   . THR B 188 ? 0.4097 0.9610 0.4607 -0.0411 -0.0403 0.0987  485 THR B O   
3141 C CB  . THR B 188 ? 0.4457 0.9795 0.4916 0.0722  -0.0138 0.0892  485 THR B CB  
3142 O OG1 . THR B 188 ? 0.4680 1.0426 0.5297 0.1200  -0.0069 0.0882  485 THR B OG1 
3143 C CG2 . THR B 188 ? 0.4233 0.9921 0.4789 0.0436  -0.0039 0.0905  485 THR B CG2 
3144 N N   . LEU B 189 ? 0.4778 0.9024 0.4873 -0.0032 -0.0401 0.0880  486 LEU B N   
3145 C CA  . LEU B 189 ? 0.4634 0.8323 0.4602 -0.0408 -0.0446 0.0849  486 LEU B CA  
3146 C C   . LEU B 189 ? 0.4949 0.8940 0.4978 -0.0768 -0.0591 0.0830  486 LEU B C   
3147 O O   . LEU B 189 ? 0.5253 0.9188 0.5331 -0.1160 -0.0611 0.0849  486 LEU B O   
3148 C CB  . LEU B 189 ? 0.4479 0.7316 0.4184 -0.0273 -0.0426 0.0764  486 LEU B CB  
3149 C CG  . LEU B 189 ? 0.4306 0.6670 0.3919 -0.0115 -0.0297 0.0757  486 LEU B CG  
3150 C CD1 . LEU B 189 ? 0.4651 0.6329 0.4042 0.0011  -0.0280 0.0670  486 LEU B CD1 
3151 C CD2 . LEU B 189 ? 0.3973 0.6223 0.3641 -0.0399 -0.0281 0.0823  486 LEU B CD2 
3152 N N   . ILE B 190 ? 0.5001 0.9292 0.5002 -0.0652 -0.0697 0.0798  487 ILE B N   
3153 C CA  . ILE B 190 ? 0.4964 0.9630 0.4992 -0.1008 -0.0851 0.0744  487 ILE B CA  
3154 C C   . ILE B 190 ? 0.4935 1.0477 0.5275 -0.1279 -0.0877 0.0824  487 ILE B C   
3155 O O   . ILE B 190 ? 0.5476 1.1079 0.5843 -0.1761 -0.0945 0.0777  487 ILE B O   
3156 C CB  . ILE B 190 ? 0.4868 0.9864 0.4799 -0.0796 -0.0976 0.0737  487 ILE B CB  
3157 C CG1 . ILE B 190 ? 0.5129 0.9275 0.4713 -0.0626 -0.0944 0.0658  487 ILE B CG1 
3158 C CG2 . ILE B 190 ? 0.4872 1.0443 0.4841 -0.1199 -0.1151 0.0668  487 ILE B CG2 
3159 C CD1 . ILE B 190 ? 0.5297 0.8802 0.4676 -0.0997 -0.0954 0.0474  487 ILE B CD1 
3160 N N   . HIS B 191 ? 0.4194 1.0400 0.4770 -0.0978 -0.0804 0.0929  488 HIS B N   
3161 C CA  . HIS B 191 ? 0.3702 1.0855 0.4601 -0.1189 -0.0786 0.1006  488 HIS B CA  
3162 C C   . HIS B 191 ? 0.3505 1.0377 0.4399 -0.1634 -0.0710 0.1047  488 HIS B C   
3163 O O   . HIS B 191 ? 0.3682 1.0871 0.4645 -0.2035 -0.0716 0.1074  488 HIS B O   
3164 C CB  . HIS B 191 ? 0.3683 1.1365 0.4770 -0.0697 -0.0646 0.1063  488 HIS B CB  
3165 C CG  . HIS B 191 ? 0.4059 1.2473 0.5346 -0.0853 -0.0540 0.1109  488 HIS B CG  
3166 N ND1 . HIS B 191 ? 0.4449 1.3552 0.5863 -0.0921 -0.0587 0.1117  488 HIS B ND1 
3167 C CD2 . HIS B 191 ? 0.3702 1.2276 0.5040 -0.0960 -0.0394 0.1152  488 HIS B CD2 
3168 C CE1 . HIS B 191 ? 0.4327 1.3981 0.5864 -0.1059 -0.0481 0.1157  488 HIS B CE1 
3169 N NE2 . HIS B 191 ? 0.4073 1.3397 0.5544 -0.1087 -0.0363 0.1178  488 HIS B NE2 
3170 N N   . LEU B 192 ? 0.3542 0.9572 0.4234 -0.1513 -0.0599 0.1056  489 LEU B N   
3171 C CA  . LEU B 192 ? 0.3976 0.9609 0.4611 -0.1877 -0.0536 0.1147  489 LEU B CA  
3172 C C   . LEU B 192 ? 0.4792 0.9857 0.5310 -0.2347 -0.0645 0.1100  489 LEU B C   
3173 O O   . LEU B 192 ? 0.5183 1.0338 0.5768 -0.2807 -0.0649 0.1196  489 LEU B O   
3174 C CB  . LEU B 192 ? 0.4038 0.8938 0.4479 -0.1605 -0.0424 0.1167  489 LEU B CB  
3175 C CG  . LEU B 192 ? 0.4274 0.9621 0.4783 -0.1222 -0.0281 0.1182  489 LEU B CG  
3176 C CD1 . LEU B 192 ? 0.2950 0.7538 0.3227 -0.0997 -0.0199 0.1159  489 LEU B CD1 
3177 C CD2 . LEU B 192 ? 0.4238 1.0409 0.4939 -0.1457 -0.0193 0.1306  489 LEU B CD2 
3178 N N   . MET B 193 ? 0.4926 0.9389 0.5254 -0.2240 -0.0721 0.0943  490 MET B N   
3179 C CA  . MET B 193 ? 0.4965 0.8763 0.5145 -0.2625 -0.0798 0.0828  490 MET B CA  
3180 C C   . MET B 193 ? 0.5087 0.9500 0.5380 -0.3090 -0.0916 0.0764  490 MET B C   
3181 O O   . MET B 193 ? 0.5378 0.9346 0.5604 -0.3534 -0.0932 0.0728  490 MET B O   
3182 C CB  . MET B 193 ? 0.4545 0.7670 0.4485 -0.2367 -0.0822 0.0644  490 MET B CB  
3183 C CG  . MET B 193 ? 0.4146 0.6669 0.3984 -0.1976 -0.0711 0.0690  490 MET B CG  
3184 S SD  . MET B 193 ? 0.6009 0.7946 0.5593 -0.1669 -0.0711 0.0494  490 MET B SD  
3185 C CE  . MET B 193 ? 0.4790 0.6252 0.4344 -0.1303 -0.0577 0.0590  490 MET B CE  
3186 N N   . ALA B 194 ? 0.4873 1.0238 0.5311 -0.2939 -0.0984 0.0750  491 ALA B N   
3187 C CA  . ALA B 194 ? 0.5252 1.1108 0.5712 -0.3213 -0.1029 0.0692  491 ALA B CA  
3188 C C   . ALA B 194 ? 0.5831 1.1968 0.6410 -0.3489 -0.0939 0.0839  491 ALA B C   
3189 O O   . ALA B 194 ? 0.6434 1.2563 0.6961 -0.3899 -0.0967 0.0790  491 ALA B O   
3190 C CB  . ALA B 194 ? 0.4843 1.1561 0.5413 -0.2863 -0.1081 0.0695  491 ALA B CB  
3191 N N   . LYS B 195 ? 0.5825 1.2200 0.6530 -0.3266 -0.0826 0.1009  492 LYS B N   
3192 C CA  . LYS B 195 ? 0.6099 1.2767 0.6861 -0.3490 -0.0733 0.1160  492 LYS B CA  
3193 C C   . LYS B 195 ? 0.6230 1.1964 0.6814 -0.3882 -0.0722 0.1221  492 LYS B C   
3194 O O   . LYS B 195 ? 0.6747 1.2566 0.7312 -0.4215 -0.0696 0.1312  492 LYS B O   
3195 C CB  . LYS B 195 ? 0.5948 1.3094 0.6836 -0.3109 -0.0602 0.1286  492 LYS B CB  
3196 C CG  . LYS B 195 ? 0.6499 1.4557 0.7519 -0.3146 -0.0528 0.1359  492 LYS B CG  
3197 C CD  . LYS B 195 ? 0.6200 1.4799 0.7346 -0.2652 -0.0400 0.1384  492 LYS B CD  
3198 C CE  . LYS B 195 ? 0.6266 1.4556 0.7298 -0.2682 -0.0286 0.1499  492 LYS B CE  
3199 N NZ  . LYS B 195 ? 0.6775 1.5371 0.7766 -0.3061 -0.0254 0.1611  492 LYS B NZ  
3200 N N   . ALA B 196 ? 0.5884 1.0704 0.6337 -0.3821 -0.0740 0.1178  493 ALA B N   
3201 C CA  . ALA B 196 ? 0.6136 0.9940 0.6426 -0.4085 -0.0723 0.1245  493 ALA B CA  
3202 C C   . ALA B 196 ? 0.6868 1.0117 0.7037 -0.4433 -0.0797 0.1049  493 ALA B C   
3203 O O   . ALA B 196 ? 0.7305 0.9622 0.7356 -0.4613 -0.0779 0.1066  493 ALA B O   
3204 C CB  . ALA B 196 ? 0.5559 0.8609 0.5768 -0.3820 -0.0691 0.1295  493 ALA B CB  
3205 N N   . GLY B 197 ? 0.6911 1.0733 0.7111 -0.4494 -0.0874 0.0860  494 GLY B N   
3206 C CA  . GLY B 197 ? 0.7315 1.0761 0.7390 -0.4846 -0.0935 0.0642  494 GLY B CA  
3207 C C   . GLY B 197 ? 0.7448 1.0197 0.7347 -0.4754 -0.0984 0.0372  494 GLY B C   
3208 O O   . GLY B 197 ? 0.7653 0.9901 0.7418 -0.5027 -0.1008 0.0155  494 GLY B O   
3209 N N   . LEU B 198 ? 0.6894 0.9618 0.6783 -0.4374 -0.0990 0.0365  495 LEU B N   
3210 C CA  . LEU B 198 ? 0.7301 0.9403 0.6988 -0.4262 -0.1024 0.0102  495 LEU B CA  
3211 C C   . LEU B 198 ? 0.7323 1.0034 0.6920 -0.4288 -0.1124 -0.0112 495 LEU B C   
3212 O O   . LEU B 198 ? 0.7088 1.0794 0.6823 -0.4142 -0.1178 -0.0006 495 LEU B O   
3213 C CB  . LEU B 198 ? 0.7076 0.8976 0.6758 -0.3873 -0.1002 0.0173  495 LEU B CB  
3214 C CG  . LEU B 198 ? 0.7225 0.8342 0.6927 -0.3762 -0.0898 0.0361  495 LEU B CG  
3215 C CD1 . LEU B 198 ? 0.6730 0.7621 0.6364 -0.3180 -0.0829 0.0371  495 LEU B CD1 
3216 C CD2 . LEU B 198 ? 0.8131 0.8168 0.7707 -0.3960 -0.0856 0.0236  495 LEU B CD2 
3217 N N   . THR B 199 ? 0.7504 0.9616 0.6871 -0.4431 -0.1135 -0.0407 496 THR B N   
3218 C CA  . THR B 199 ? 0.7629 1.0255 0.6848 -0.4436 -0.1226 -0.0610 496 THR B CA  
3219 C C   . THR B 199 ? 0.7280 1.0172 0.6421 -0.4005 -0.1264 -0.0583 496 THR B C   
3220 O O   . THR B 199 ? 0.7100 0.9586 0.6256 -0.3758 -0.1213 -0.0493 496 THR B O   
3221 C CB  . THR B 199 ? 0.8345 1.0231 0.7308 -0.4677 -0.1204 -0.0961 496 THR B CB  
3222 O OG1 . THR B 199 ? 0.8146 0.9095 0.6962 -0.4455 -0.1116 -0.1100 496 THR B OG1 
3223 C CG2 . THR B 199 ? 0.9137 1.0641 0.8167 -0.5096 -0.1168 -0.0991 496 THR B CG2 
3224 N N   . LEU B 200 ? 0.7156 1.0717 0.6203 -0.3915 -0.1355 -0.0642 497 LEU B N   
3225 C CA  . LEU B 200 ? 0.6607 1.0431 0.5548 -0.3483 -0.1397 -0.0578 497 LEU B CA  
3226 C C   . LEU B 200 ? 0.6691 0.9596 0.5350 -0.3359 -0.1324 -0.0765 497 LEU B C   
3227 O O   . LEU B 200 ? 0.6638 0.9445 0.5263 -0.3012 -0.1304 -0.0647 497 LEU B O   
3228 C CB  . LEU B 200 ? 0.6807 1.1359 0.5650 -0.3442 -0.1498 -0.0605 497 LEU B CB  
3229 C CG  . LEU B 200 ? 0.6865 1.2497 0.6007 -0.3353 -0.1570 -0.0363 497 LEU B CG  
3230 C CD1 . LEU B 200 ? 0.7335 1.3226 0.6657 -0.3795 -0.1560 -0.0385 497 LEU B CD1 
3231 C CD2 . LEU B 200 ? 0.6894 1.3116 0.5909 -0.3204 -0.1674 -0.0351 497 LEU B CD2 
3232 N N   . GLN B 201 ? 0.6906 0.9130 0.5365 -0.3615 -0.1262 -0.1066 498 GLN B N   
3233 C CA  . GLN B 201 ? 0.6892 0.8213 0.5123 -0.3481 -0.1146 -0.1278 498 GLN B CA  
3234 C C   . GLN B 201 ? 0.6630 0.7320 0.5027 -0.3368 -0.1057 -0.1142 498 GLN B C   
3235 O O   . GLN B 201 ? 0.6950 0.7257 0.5303 -0.2961 -0.0944 -0.1093 498 GLN B O   
3236 C CB  . GLN B 201 ? 0.7647 0.8368 0.5710 -0.3735 -0.1073 -0.1628 498 GLN B CB  
3237 C CG  . GLN B 201 ? 0.8769 0.8610 0.6656 -0.3536 -0.0919 -0.1866 498 GLN B CG  
3238 C CD  . GLN B 201 ? 0.9694 0.8943 0.7477 -0.3739 -0.0840 -0.2213 498 GLN B CD  
3239 O OE1 . GLN B 201 ? 1.0151 0.9475 0.7998 -0.4075 -0.0897 -0.2266 498 GLN B OE1 
3240 N NE2 . GLN B 201 ? 0.9828 0.8510 0.7460 -0.3529 -0.0704 -0.2453 498 GLN B NE2 
3241 N N   . GLN B 202 ? 0.6746 0.7331 0.5390 -0.3594 -0.1050 -0.1001 499 GLN B N   
3242 C CA  . GLN B 202 ? 0.6634 0.6667 0.5468 -0.3425 -0.0948 -0.0783 499 GLN B CA  
3243 C C   . GLN B 202 ? 0.5952 0.6478 0.4933 -0.2969 -0.0924 -0.0476 499 GLN B C   
3244 O O   . GLN B 202 ? 0.6007 0.6061 0.5026 -0.2643 -0.0818 -0.0375 499 GLN B O   
3245 C CB  . GLN B 202 ? 0.7031 0.6930 0.6053 -0.3797 -0.0953 -0.0654 499 GLN B CB  
3246 C CG  . GLN B 202 ? 0.7983 0.7053 0.6924 -0.3997 -0.0884 -0.0895 499 GLN B CG  
3247 C CD  . GLN B 202 ? 0.8861 0.7861 0.7972 -0.4317 -0.0882 -0.0737 499 GLN B CD  
3248 O OE1 . GLN B 202 ? 0.8824 0.8603 0.8073 -0.4458 -0.0938 -0.0514 499 GLN B OE1 
3249 N NE2 . GLN B 202 ? 0.9742 0.7827 0.8861 -0.4409 -0.0808 -0.0849 499 GLN B NE2 
3250 N N   . GLN B 203 ? 0.5848 0.7337 0.4922 -0.2944 -0.1022 -0.0344 500 GLN B N   
3251 C CA  . GLN B 203 ? 0.5474 0.7419 0.4677 -0.2504 -0.0990 -0.0094 500 GLN B CA  
3252 C C   . GLN B 203 ? 0.5693 0.7297 0.4694 -0.2087 -0.0924 -0.0145 500 GLN B C   
3253 O O   . GLN B 203 ? 0.5779 0.7109 0.4833 -0.1768 -0.0821 -0.0016 500 GLN B O   
3254 C CB  . GLN B 203 ? 0.5358 0.8413 0.4713 -0.2515 -0.1111 0.0025  500 GLN B CB  
3255 C CG  . GLN B 203 ? 0.5323 0.8928 0.4930 -0.2929 -0.1163 0.0107  500 GLN B CG  
3256 C CD  . GLN B 203 ? 0.5553 1.0310 0.5324 -0.2921 -0.1278 0.0179  500 GLN B CD  
3257 O OE1 . GLN B 203 ? 0.5567 1.0790 0.5372 -0.2492 -0.1304 0.0286  500 GLN B OE1 
3258 N NE2 . GLN B 203 ? 0.5770 1.0813 0.5613 -0.3292 -0.1286 0.0140  500 GLN B NE2 
3259 N N   . HIS B 204 ? 0.5970 0.7630 0.4719 -0.2127 -0.0982 -0.0334 501 HIS B N   
3260 C CA  . HIS B 204 ? 0.5958 0.7358 0.4478 -0.1790 -0.0915 -0.0368 501 HIS B CA  
3261 C C   . HIS B 204 ? 0.5888 0.6410 0.4364 -0.1693 -0.0758 -0.0484 501 HIS B C   
3262 O O   . HIS B 204 ? 0.5532 0.5842 0.3974 -0.1370 -0.0662 -0.0403 501 HIS B O   
3263 C CB  . HIS B 204 ? 0.6567 0.8262 0.4779 -0.1913 -0.1011 -0.0542 501 HIS B CB  
3264 C CG  . HIS B 204 ? 0.6892 0.9551 0.5156 -0.1951 -0.1191 -0.0398 501 HIS B CG  
3265 N ND1 . HIS B 204 ? 0.6513 0.9709 0.5034 -0.1668 -0.1222 -0.0104 501 HIS B ND1 
3266 C CD2 . HIS B 204 ? 0.7336 1.0579 0.5446 -0.2226 -0.1354 -0.0514 501 HIS B CD2 
3267 C CE1 . HIS B 204 ? 0.6647 1.0729 0.5210 -0.1730 -0.1397 -0.0024 501 HIS B CE1 
3268 N NE2 . HIS B 204 ? 0.7288 1.1339 0.5650 -0.2031 -0.1441 -0.0246 501 HIS B NE2 
3269 N N   . GLN B 205 ? 0.5315 0.5330 0.3807 -0.1973 -0.0731 -0.0673 502 GLN B N   
3270 C CA  . GLN B 205 ? 0.5433 0.4653 0.3946 -0.1848 -0.0592 -0.0773 502 GLN B CA  
3271 C C   . GLN B 205 ? 0.6305 0.5383 0.5069 -0.1634 -0.0539 -0.0501 502 GLN B C   
3272 O O   . GLN B 205 ? 0.6138 0.4926 0.4918 -0.1354 -0.0440 -0.0475 502 GLN B O   
3273 C CB  . GLN B 205 ? 0.6055 0.4698 0.4542 -0.2172 -0.0576 -0.1030 502 GLN B CB  
3274 C CG  . GLN B 205 ? 0.6514 0.5177 0.4696 -0.2385 -0.0592 -0.1391 502 GLN B CG  
3275 C CD  . GLN B 205 ? 0.8435 0.6426 0.6583 -0.2716 -0.0557 -0.1691 502 GLN B CD  
3276 O OE1 . GLN B 205 ? 0.7422 0.4875 0.5785 -0.2766 -0.0525 -0.1586 502 GLN B OE1 
3277 N NE2 . GLN B 205 ? 0.7690 0.5743 0.5617 -0.2852 -0.0549 -0.2004 502 GLN B NE2 
3278 N N   . ARG B 206 ? 0.5748 0.5098 0.4697 -0.1794 -0.0602 -0.0303 503 ARG B N   
3279 C CA  . ARG B 206 ? 0.5486 0.4777 0.4627 -0.1636 -0.0558 -0.0045 503 ARG B CA  
3280 C C   . ARG B 206 ? 0.5161 0.4800 0.4290 -0.1279 -0.0515 0.0077  503 ARG B C   
3281 O O   . ARG B 206 ? 0.4881 0.4264 0.4060 -0.1064 -0.0440 0.0157  503 ARG B O   
3282 C CB  . ARG B 206 ? 0.5297 0.4925 0.4601 -0.1916 -0.0620 0.0142  503 ARG B CB  
3283 C CG  . ARG B 206 ? 0.5299 0.4915 0.4750 -0.1794 -0.0572 0.0411  503 ARG B CG  
3284 C CD  . ARG B 206 ? 0.5637 0.5571 0.5219 -0.2131 -0.0614 0.0599  503 ARG B CD  
3285 N NE  . ARG B 206 ? 0.5669 0.5630 0.5338 -0.2042 -0.0567 0.0863  503 ARG B NE  
3286 C CZ  . ARG B 206 ? 0.6399 0.5752 0.6082 -0.2089 -0.0555 0.1001  503 ARG B CZ  
3287 N NH1 . ARG B 206 ? 0.6552 0.5155 0.6200 -0.2190 -0.0570 0.0879  503 ARG B NH1 
3288 N NH2 . ARG B 206 ? 0.6474 0.5977 0.6199 -0.2020 -0.0528 0.1260  503 ARG B NH2 
3289 N N   . LEU B 207 ? 0.4622 0.4839 0.3686 -0.1223 -0.0570 0.0090  504 LEU B N   
3290 C CA  . LEU B 207 ? 0.3985 0.4445 0.3009 -0.0884 -0.0526 0.0191  504 LEU B CA  
3291 C C   . LEU B 207 ? 0.4528 0.4494 0.3393 -0.0686 -0.0432 0.0092  504 LEU B C   
3292 O O   . LEU B 207 ? 0.4832 0.4695 0.3715 -0.0463 -0.0353 0.0175  504 LEU B O   
3293 C CB  . LEU B 207 ? 0.4207 0.5281 0.3166 -0.0837 -0.0618 0.0218  504 LEU B CB  
3294 C CG  . LEU B 207 ? 0.4491 0.5645 0.3341 -0.0472 -0.0574 0.0307  504 LEU B CG  
3295 C CD1 . LEU B 207 ? 0.4563 0.5826 0.3580 -0.0259 -0.0496 0.0450  504 LEU B CD1 
3296 C CD2 . LEU B 207 ? 0.3963 0.5668 0.2723 -0.0413 -0.0692 0.0357  504 LEU B CD2 
3297 N N   . ALA B 208 ? 0.4985 0.4685 0.3692 -0.0798 -0.0430 -0.0108 505 ALA B N   
3298 C CA  . ALA B 208 ? 0.4721 0.4033 0.3288 -0.0651 -0.0322 -0.0230 505 ALA B CA  
3299 C C   . ALA B 208 ? 0.4415 0.3289 0.3161 -0.0580 -0.0236 -0.0228 505 ALA B C   
3300 O O   . ALA B 208 ? 0.3910 0.2676 0.2658 -0.0389 -0.0150 -0.0195 505 ALA B O   
3301 C CB  . ALA B 208 ? 0.4721 0.3925 0.3067 -0.0811 -0.0324 -0.0481 505 ALA B CB  
3302 N N   . GLN B 209 ? 0.4628 0.3257 0.3523 -0.0747 -0.0268 -0.0249 506 GLN B N   
3303 C CA  . GLN B 209 ? 0.5430 0.3670 0.4518 -0.0660 -0.0220 -0.0190 506 GLN B CA  
3304 C C   . GLN B 209 ? 0.5643 0.4110 0.4832 -0.0497 -0.0211 0.0040  506 GLN B C   
3305 O O   . GLN B 209 ? 0.5924 0.4244 0.5192 -0.0332 -0.0152 0.0060  506 GLN B O   
3306 C CB  . GLN B 209 ? 0.5428 0.3361 0.4642 -0.0881 -0.0277 -0.0162 506 GLN B CB  
3307 C CG  . GLN B 209 ? 0.5866 0.3439 0.4975 -0.1068 -0.0267 -0.0446 506 GLN B CG  
3308 C CD  . GLN B 209 ? 0.6908 0.4230 0.6089 -0.1382 -0.0340 -0.0404 506 GLN B CD  
3309 O OE1 . GLN B 209 ? 0.7154 0.4646 0.6459 -0.1471 -0.0399 -0.0133 506 GLN B OE1 
3310 N NE2 . GLN B 209 ? 0.7403 0.4313 0.6484 -0.1580 -0.0325 -0.0685 506 GLN B NE2 
3311 N N   . LEU B 210 ? 0.5190 0.4072 0.4381 -0.0550 -0.0265 0.0188  507 LEU B N   
3312 C CA  . LEU B 210 ? 0.5075 0.4195 0.4328 -0.0420 -0.0243 0.0359  507 LEU B CA  
3313 C C   . LEU B 210 ? 0.4535 0.3668 0.3673 -0.0203 -0.0162 0.0302  507 LEU B C   
3314 O O   . LEU B 210 ? 0.4590 0.3679 0.3772 -0.0102 -0.0117 0.0352  507 LEU B O   
3315 C CB  . LEU B 210 ? 0.5155 0.4772 0.4441 -0.0504 -0.0289 0.0484  507 LEU B CB  
3316 C CG  . LEU B 210 ? 0.5678 0.5352 0.5088 -0.0772 -0.0354 0.0600  507 LEU B CG  
3317 C CD1 . LEU B 210 ? 0.5474 0.5791 0.4943 -0.0850 -0.0377 0.0702  507 LEU B CD1 
3318 C CD2 . LEU B 210 ? 0.5799 0.5212 0.5298 -0.0776 -0.0344 0.0754  507 LEU B CD2 
3319 N N   . LEU B 211 ? 0.4048 0.3248 0.3019 -0.0158 -0.0151 0.0211  508 LEU B N   
3320 C CA  . LEU B 211 ? 0.4114 0.3269 0.2940 0.0013  -0.0070 0.0190  508 LEU B CA  
3321 C C   . LEU B 211 ? 0.4467 0.3311 0.3271 0.0038  0.0014  0.0072  508 LEU B C   
3322 O O   . LEU B 211 ? 0.4445 0.3224 0.3186 0.0129  0.0094  0.0071  508 LEU B O   
3323 C CB  . LEU B 211 ? 0.4152 0.3484 0.2788 0.0063  -0.0098 0.0193  508 LEU B CB  
3324 C CG  . LEU B 211 ? 0.4305 0.4071 0.3014 0.0094  -0.0175 0.0312  508 LEU B CG  
3325 C CD1 . LEU B 211 ? 0.4375 0.4354 0.2915 0.0174  -0.0230 0.0345  508 LEU B CD1 
3326 C CD2 . LEU B 211 ? 0.4409 0.4263 0.3197 0.0246  -0.0112 0.0398  508 LEU B CD2 
3327 N N   . LEU B 212 ? 0.4271 0.2930 0.3135 -0.0049 0.0007  -0.0046 509 LEU B N   
3328 C CA  . LEU B 212 ? 0.4631 0.3077 0.3538 0.0005  0.0102  -0.0178 509 LEU B CA  
3329 C C   . LEU B 212 ? 0.4802 0.3224 0.3943 0.0083  0.0110  -0.0089 509 LEU B C   
3330 O O   . LEU B 212 ? 0.5147 0.3568 0.4345 0.0157  0.0191  -0.0146 509 LEU B O   
3331 C CB  . LEU B 212 ? 0.4689 0.2922 0.3601 -0.0076 0.0113  -0.0369 509 LEU B CB  
3332 C CG  . LEU B 212 ? 0.5515 0.3821 0.4136 -0.0161 0.0133  -0.0517 509 LEU B CG  
3333 C CD1 . LEU B 212 ? 0.5513 0.3584 0.4118 -0.0256 0.0169  -0.0776 509 LEU B CD1 
3334 C CD2 . LEU B 212 ? 0.5411 0.3808 0.3844 -0.0080 0.0238  -0.0521 509 LEU B CD2 
3335 N N   . ILE B 213 ? 0.4915 0.3390 0.4187 0.0045  0.0021  0.0066  510 ILE B N   
3336 C CA  . ILE B 213 ? 0.4874 0.3411 0.4327 0.0104  -0.0002 0.0197  510 ILE B CA  
3337 C C   . ILE B 213 ? 0.4658 0.3417 0.4018 0.0151  0.0047  0.0219  510 ILE B C   
3338 O O   . ILE B 213 ? 0.4092 0.2941 0.3562 0.0197  0.0062  0.0236  510 ILE B O   
3339 C CB  . ILE B 213 ? 0.4940 0.3508 0.4490 0.0013  -0.0105 0.0390  510 ILE B CB  
3340 C CG1 . ILE B 213 ? 0.5213 0.3426 0.4860 -0.0058 -0.0142 0.0356  510 ILE B CG1 
3341 C CG2 . ILE B 213 ? 0.5088 0.3812 0.4762 0.0063  -0.0145 0.0564  510 ILE B CG2 
3342 C CD1 . ILE B 213 ? 0.5677 0.3875 0.5361 -0.0231 -0.0233 0.0544  510 ILE B CD1 
3343 N N   . LEU B 214 ? 0.4055 0.2899 0.3218 0.0142  0.0071  0.0210  511 LEU B N   
3344 C CA  . LEU B 214 ? 0.4073 0.2989 0.3109 0.0184  0.0139  0.0194  511 LEU B CA  
3345 C C   . LEU B 214 ? 0.4641 0.3442 0.3642 0.0189  0.0233  0.0080  511 LEU B C   
3346 O O   . LEU B 214 ? 0.4634 0.3480 0.3596 0.0168  0.0285  0.0056  511 LEU B O   
3347 C CB  . LEU B 214 ? 0.3892 0.2838 0.2740 0.0232  0.0156  0.0207  511 LEU B CB  
3348 C CG  . LEU B 214 ? 0.4448 0.3651 0.3358 0.0223  0.0086  0.0309  511 LEU B CG  
3349 C CD1 . LEU B 214 ? 0.5090 0.4394 0.3868 0.0346  0.0123  0.0317  511 LEU B CD1 
3350 C CD2 . LEU B 214 ? 0.3764 0.3144 0.2795 0.0169  0.0059  0.0390  511 LEU B CD2 
3351 N N   . SER B 215 ? 0.4265 0.2949 0.3272 0.0187  0.0265  -0.0010 512 SER B N   
3352 C CA  . SER B 215 ? 0.4425 0.3089 0.3424 0.0172  0.0375  -0.0122 512 SER B CA  
3353 C C   . SER B 215 ? 0.4337 0.3184 0.3619 0.0193  0.0367  -0.0123 512 SER B C   
3354 O O   . SER B 215 ? 0.4206 0.3184 0.3504 0.0142  0.0439  -0.0173 512 SER B O   
3355 C CB  . SER B 215 ? 0.4891 0.3456 0.3821 0.0165  0.0427  -0.0245 512 SER B CB  
3356 O OG  . SER B 215 ? 0.5779 0.4416 0.4744 0.0145  0.0553  -0.0360 512 SER B OG  
3357 N N   . HIS B 216 ? 0.4406 0.3276 0.3914 0.0256  0.0270  -0.0049 513 HIS B N   
3358 C CA  . HIS B 216 ? 0.4380 0.3461 0.4181 0.0322  0.0225  0.0008  513 HIS B CA  
3359 C C   . HIS B 216 ? 0.4068 0.3399 0.3839 0.0257  0.0163  0.0122  513 HIS B C   
3360 O O   . HIS B 216 ? 0.4656 0.4284 0.4586 0.0255  0.0149  0.0132  513 HIS B O   
3361 C CB  . HIS B 216 ? 0.5339 0.4268 0.5359 0.0423  0.0135  0.0096  513 HIS B CB  
3362 C CG  . HIS B 216 ? 0.7056 0.5700 0.7086 0.0469  0.0204  -0.0071 513 HIS B CG  
3363 N ND1 . HIS B 216 ? 0.7655 0.6318 0.7911 0.0604  0.0286  -0.0211 513 HIS B ND1 
3364 C CD2 . HIS B 216 ? 0.7520 0.5907 0.7356 0.0390  0.0210  -0.0150 513 HIS B CD2 
3365 C CE1 . HIS B 216 ? 0.7665 0.6041 0.7835 0.0603  0.0353  -0.0391 513 HIS B CE1 
3366 N NE2 . HIS B 216 ? 0.7645 0.5857 0.7549 0.0456  0.0297  -0.0353 513 HIS B NE2 
3367 N N   . ILE B 217 ? 0.3814 0.3085 0.3384 0.0201  0.0130  0.0190  514 ILE B N   
3368 C CA  . ILE B 217 ? 0.4193 0.3696 0.3677 0.0129  0.0099  0.0244  514 ILE B CA  
3369 C C   . ILE B 217 ? 0.4486 0.4005 0.3819 0.0039  0.0207  0.0091  514 ILE B C   
3370 O O   . ILE B 217 ? 0.4797 0.4576 0.4144 -0.0050 0.0190  0.0071  514 ILE B O   
3371 C CB  . ILE B 217 ? 0.4270 0.3751 0.3595 0.0110  0.0069  0.0324  514 ILE B CB  
3372 C CG1 . ILE B 217 ? 0.4611 0.4092 0.4089 0.0126  -0.0039 0.0501  514 ILE B CG1 
3373 C CG2 . ILE B 217 ? 0.4446 0.4170 0.3638 0.0038  0.0075  0.0317  514 ILE B CG2 
3374 C CD1 . ILE B 217 ? 0.4821 0.4416 0.4190 0.0067  -0.0067 0.0602  514 ILE B CD1 
3375 N N   . ARG B 218 ? 0.4438 0.3681 0.3611 0.0035  0.0312  -0.0008 515 ARG B N   
3376 C CA  . ARG B 218 ? 0.4219 0.3372 0.3234 -0.0080 0.0429  -0.0130 515 ARG B CA  
3377 C C   . ARG B 218 ? 0.4118 0.3572 0.3359 -0.0154 0.0448  -0.0187 515 ARG B C   
3378 O O   . ARG B 218 ? 0.3773 0.3389 0.2987 -0.0310 0.0483  -0.0261 515 ARG B O   
3379 C CB  . ARG B 218 ? 0.4445 0.3256 0.3245 -0.0062 0.0524  -0.0161 515 ARG B CB  
3380 C CG  . ARG B 218 ? 0.4891 0.3521 0.3493 -0.0212 0.0656  -0.0244 515 ARG B CG  
3381 C CD  . ARG B 218 ? 0.5511 0.3893 0.3883 -0.0242 0.0685  -0.0264 515 ARG B CD  
3382 N NE  . ARG B 218 ? 0.6235 0.4312 0.4416 -0.0084 0.0686  -0.0183 515 ARG B NE  
3383 C CZ  . ARG B 218 ? 0.6997 0.4650 0.4904 -0.0075 0.0776  -0.0169 515 ARG B CZ  
3384 N NH1 . ARG B 218 ? 0.7623 0.5026 0.5383 -0.0261 0.0887  -0.0248 515 ARG B NH1 
3385 N NH2 . ARG B 218 ? 0.7397 0.4878 0.5184 0.0115  0.0748  -0.0063 515 ARG B NH2 
3386 N N   . HIS B 219 ? 0.3832 0.3381 0.3311 -0.0042 0.0431  -0.0172 516 HIS B N   
3387 C CA  . HIS B 219 ? 0.3753 0.3672 0.3528 -0.0043 0.0454  -0.0225 516 HIS B CA  
3388 C C   . HIS B 219 ? 0.3677 0.4034 0.3667 -0.0057 0.0328  -0.0139 516 HIS B C   
3389 O O   . HIS B 219 ? 0.3658 0.4397 0.3758 -0.0187 0.0351  -0.0206 516 HIS B O   
3390 C CB  . HIS B 219 ? 0.3676 0.3557 0.3675 0.0141  0.0464  -0.0243 516 HIS B CB  
3391 C CG  . HIS B 219 ? 0.4144 0.4444 0.4495 0.0202  0.0515  -0.0318 516 HIS B CG  
3392 N ND1 . HIS B 219 ? 0.4531 0.5092 0.5273 0.0402  0.0409  -0.0229 516 HIS B ND1 
3393 C CD2 . HIS B 219 ? 0.4100 0.4645 0.4493 0.0098  0.0666  -0.0461 516 HIS B CD2 
3394 C CE1 . HIS B 219 ? 0.4399 0.5392 0.5447 0.0456  0.0490  -0.0329 516 HIS B CE1 
3395 N NE2 . HIS B 219 ? 0.4336 0.5358 0.5178 0.0252  0.0654  -0.0481 516 HIS B NE2 
3396 N N   . MET B 220 ? 0.3356 0.3703 0.3390 0.0047  0.0189  0.0020  517 MET B N   
3397 C CA  . MET B 220 ? 0.3160 0.3949 0.3340 0.0031  0.0047  0.0149  517 MET B CA  
3398 C C   . MET B 220 ? 0.3214 0.4167 0.3144 -0.0208 0.0070  0.0047  517 MET B C   
3399 O O   . MET B 220 ? 0.3163 0.4612 0.3210 -0.0316 0.0004  0.0041  517 MET B O   
3400 C CB  . MET B 220 ? 0.2934 0.3625 0.3133 0.0147  -0.0090 0.0371  517 MET B CB  
3401 C CG  . MET B 220 ? 0.3069 0.3551 0.3535 0.0365  -0.0126 0.0470  517 MET B CG  
3402 S SD  . MET B 220 ? 0.3875 0.4202 0.4361 0.0438  -0.0289 0.0776  517 MET B SD  
3403 C CE  . MET B 220 ? 0.3311 0.3305 0.3415 0.0287  -0.0216 0.0705  517 MET B CE  
3404 N N   . SER B 221 ? 0.3108 0.3649 0.2696 -0.0286 0.0164  -0.0046 518 SER B N   
3405 C CA  . SER B 221 ? 0.3915 0.4450 0.3229 -0.0498 0.0223  -0.0194 518 SER B CA  
3406 C C   . SER B 221 ? 0.4219 0.4894 0.3564 -0.0705 0.0312  -0.0355 518 SER B C   
3407 O O   . SER B 221 ? 0.4184 0.5224 0.3513 -0.0910 0.0277  -0.0441 518 SER B O   
3408 C CB  . SER B 221 ? 0.4177 0.4170 0.3169 -0.0468 0.0329  -0.0260 518 SER B CB  
3409 O OG  . SER B 221 ? 0.4884 0.4769 0.3606 -0.0641 0.0405  -0.0430 518 SER B OG  
3410 N N   . ASN B 222 ? 0.4246 0.4679 0.3619 -0.0685 0.0429  -0.0398 519 ASN B N   
3411 C CA  . ASN B 222 ? 0.4272 0.4841 0.3669 -0.0916 0.0543  -0.0534 519 ASN B CA  
3412 C C   . ASN B 222 ? 0.3811 0.5145 0.3589 -0.0978 0.0453  -0.0529 519 ASN B C   
3413 O O   . ASN B 222 ? 0.3979 0.5620 0.3739 -0.1265 0.0477  -0.0653 519 ASN B O   
3414 C CB  . ASN B 222 ? 0.4090 0.4357 0.3454 -0.0866 0.0682  -0.0545 519 ASN B CB  
3415 C CG  . ASN B 222 ? 0.4822 0.4396 0.3793 -0.0837 0.0766  -0.0534 519 ASN B CG  
3416 O OD1 . ASN B 222 ? 0.5813 0.5155 0.4743 -0.0669 0.0785  -0.0466 519 ASN B OD1 
3417 N ND2 . ASN B 222 ? 0.4902 0.4153 0.3582 -0.0994 0.0814  -0.0608 519 ASN B ND2 
3418 N N   . LYS B 223 ? 0.3306 0.4947 0.3438 -0.0709 0.0348  -0.0387 520 LYS B N   
3419 C CA  . LYS B 223 ? 0.3819 0.6235 0.4373 -0.0675 0.0232  -0.0330 520 LYS B CA  
3420 C C   . LYS B 223 ? 0.4003 0.6816 0.4482 -0.0826 0.0074  -0.0288 520 LYS B C   
3421 O O   . LYS B 223 ? 0.4308 0.7789 0.4968 -0.1005 0.0015  -0.0337 520 LYS B O   
3422 C CB  . LYS B 223 ? 0.4273 0.6776 0.5190 -0.0299 0.0144  -0.0159 520 LYS B CB  
3423 C CG  . LYS B 223 ? 0.5194 0.7398 0.6193 -0.0157 0.0306  -0.0250 520 LYS B CG  
3424 C CD  . LYS B 223 ? 0.5852 0.8515 0.7036 -0.0314 0.0451  -0.0413 520 LYS B CD  
3425 C CE  . LYS B 223 ? 0.6368 0.8696 0.7484 -0.0252 0.0648  -0.0533 520 LYS B CE  
3426 N NZ  . LYS B 223 ? 0.6933 0.9809 0.8264 -0.0404 0.0807  -0.0679 520 LYS B NZ  
3427 N N   . GLY B 224 ? 0.3363 0.5832 0.3567 -0.0772 0.0009  -0.0207 521 GLY B N   
3428 C CA  . GLY B 224 ? 0.3102 0.5924 0.3148 -0.0929 -0.0119 -0.0189 521 GLY B CA  
3429 C C   . GLY B 224 ? 0.3368 0.6223 0.3135 -0.1315 -0.0025 -0.0462 521 GLY B C   
3430 O O   . GLY B 224 ? 0.3950 0.7454 0.3779 -0.1526 -0.0130 -0.0509 521 GLY B O   
3431 N N   . MET B 225 ? 0.4174 0.6322 0.3625 -0.1413 0.0165  -0.0634 522 MET B N   
3432 C CA  . MET B 225 ? 0.4789 0.6747 0.3928 -0.1784 0.0285  -0.0906 522 MET B CA  
3433 C C   . MET B 225 ? 0.4489 0.7019 0.3865 -0.2063 0.0291  -0.1002 522 MET B C   
3434 O O   . MET B 225 ? 0.4598 0.7487 0.3869 -0.2408 0.0261  -0.1177 522 MET B O   
3435 C CB  . MET B 225 ? 0.5358 0.6408 0.4191 -0.1774 0.0488  -0.1000 522 MET B CB  
3436 C CG  . MET B 225 ? 0.6057 0.6579 0.4630 -0.1551 0.0506  -0.0963 522 MET B CG  
3437 S SD  . MET B 225 ? 0.7228 0.7712 0.5428 -0.1751 0.0518  -0.1197 522 MET B SD  
3438 C CE  . MET B 225 ? 1.2288 1.2071 1.0259 -0.1427 0.0614  -0.1154 522 MET B CE  
3439 N N   . GLU B 226 ? 0.4255 0.6902 0.3948 -0.1924 0.0340  -0.0908 523 GLU B N   
3440 C CA  . GLU B 226 ? 0.4809 0.8097 0.4817 -0.2138 0.0371  -0.0977 523 GLU B CA  
3441 C C   . GLU B 226 ? 0.5186 0.9470 0.5465 -0.2248 0.0164  -0.0953 523 GLU B C   
3442 O O   . GLU B 226 ? 0.5470 1.0188 0.5722 -0.2660 0.0172  -0.1134 523 GLU B O   
3443 C CB  . GLU B 226 ? 0.5455 0.8850 0.5831 -0.1823 0.0419  -0.0842 523 GLU B CB  
3444 C CG  . GLU B 226 ? 0.6406 1.0234 0.7023 -0.2036 0.0560  -0.0947 523 GLU B CG  
3445 C CD  . GLU B 226 ? 0.6836 1.0750 0.7783 -0.1688 0.0632  -0.0857 523 GLU B CD  
3446 O OE1 . GLU B 226 ? 0.7066 1.1263 0.8165 -0.1835 0.0795  -0.0948 523 GLU B OE1 
3447 O OE2 . GLU B 226 ? 0.7002 1.0702 0.8042 -0.1290 0.0536  -0.0710 523 GLU B OE2 
3448 N N   . HIS B 227 ? 0.4932 0.9570 0.5453 -0.1896 -0.0029 -0.0714 524 HIS B N   
3449 C CA  . HIS B 227 ? 0.4793 1.0422 0.5588 -0.1923 -0.0265 -0.0606 524 HIS B CA  
3450 C C   . HIS B 227 ? 0.5345 1.1081 0.5721 -0.2287 -0.0336 -0.0764 524 HIS B C   
3451 O O   . HIS B 227 ? 0.5642 1.2091 0.6081 -0.2509 -0.0435 -0.0811 524 HIS B O   
3452 C CB  . HIS B 227 ? 0.3932 0.9714 0.5004 -0.1446 -0.0447 -0.0266 524 HIS B CB  
3453 N N   . LEU B 228 ? 0.5462 1.0376 0.5365 -0.2287 -0.0244 -0.0845 525 LEU B N   
3454 C CA  . LEU B 228 ? 0.5603 1.0475 0.5049 -0.2602 -0.0258 -0.1056 525 LEU B CA  
3455 C C   . LEU B 228 ? 0.6322 1.1061 0.5563 -0.3048 -0.0092 -0.1378 525 LEU B C   
3456 O O   . LEU B 228 ? 0.6896 1.1978 0.5995 -0.3258 -0.0109 -0.1468 525 LEU B O   
3457 C CB  . LEU B 228 ? 0.5547 0.9512 0.4591 -0.2430 -0.0141 -0.1083 525 LEU B CB  
3458 C CG  . LEU B 228 ? 0.5881 1.0087 0.4737 -0.2319 -0.0283 -0.0957 525 LEU B CG  
3459 C CD1 . LEU B 228 ? 0.5802 1.0772 0.5060 -0.2074 -0.0532 -0.0577 525 LEU B CD1 
3460 C CD2 . LEU B 228 ? 0.5876 0.9270 0.4483 -0.2069 -0.0155 -0.0930 525 LEU B CD2 
3461 N N   . TYR B 229 ? 0.6496 1.0648 0.5708 -0.3156 0.0100  -0.1506 526 TYR B N   
3462 C CA  . TYR B 229 ? 0.7040 1.0868 0.6035 -0.3518 0.0299  -0.1730 526 TYR B CA  
3463 C C   . TYR B 229 ? 0.7350 1.2099 0.6661 -0.3685 0.0230  -0.1702 526 TYR B C   
3464 O O   . TYR B 229 ? 0.8188 1.2928 0.7304 -0.4027 0.0332  -0.1882 526 TYR B O   
3465 C CB  . TYR B 229 ? 0.6871 0.9833 0.5747 -0.3545 0.0518  -0.1782 526 TYR B CB  
3466 N N   . SER B 230 ? 0.6828 1.2364 0.6639 -0.3415 0.0059  -0.1469 527 SER B N   
3467 C CA  . SER B 230 ? 0.7153 1.3604 0.7312 -0.3480 -0.0019 -0.1415 527 SER B CA  
3468 C C   . SER B 230 ? 0.8328 1.5421 0.8396 -0.3586 -0.0180 -0.1400 527 SER B C   
3469 O O   . SER B 230 ? 0.8817 1.6429 0.8913 -0.3854 -0.0174 -0.1495 527 SER B O   
3470 C CB  . SER B 230 ? 0.6343 1.3356 0.7102 -0.3070 -0.0125 -0.1159 527 SER B CB  
3471 O OG  . SER B 230 ? 0.5850 1.3185 0.6781 -0.2709 -0.0349 -0.0904 527 SER B OG  
3472 N N   . MET B 231 ? 0.8780 1.5868 0.8728 -0.3391 -0.0319 -0.1270 528 MET B N   
3473 C CA  . MET B 231 ? 0.9532 1.7266 0.9394 -0.3461 -0.0473 -0.1206 528 MET B CA  
3474 C C   . MET B 231 ? 1.0271 1.7558 0.9601 -0.3821 -0.0337 -0.1496 528 MET B C   
3475 O O   . MET B 231 ? 1.0418 1.8201 0.9612 -0.3965 -0.0419 -0.1510 528 MET B O   
3476 C CB  . MET B 231 ? 0.9209 1.7217 0.9227 -0.3052 -0.0689 -0.0861 528 MET B CB  
3477 C CG  . MET B 231 ? 0.9063 1.6395 0.8694 -0.2994 -0.0647 -0.0891 528 MET B CG  
3478 S SD  . MET B 231 ? 1.1917 1.9556 1.1646 -0.2586 -0.0884 -0.0459 528 MET B SD  
3479 C CE  . MET B 231 ? 1.1361 1.8814 1.1565 -0.2141 -0.0949 -0.0194 528 MET B CE  
3480 N N   . LYS B 232 ? 1.0604 1.6929 0.9645 -0.3940 -0.0123 -0.1718 529 LYS B N   
3481 C CA  . LYS B 232 ? 1.1299 1.7079 0.9891 -0.4275 0.0053  -0.2028 529 LYS B CA  
3482 C C   . LYS B 232 ? 1.1758 1.7911 1.0352 -0.4676 0.0120  -0.2197 529 LYS B C   
3483 O O   . LYS B 232 ? 1.2381 1.8645 1.0720 -0.4986 0.0163  -0.2398 529 LYS B O   
3484 C CB  . LYS B 232 ? 1.1475 1.6073 0.9807 -0.4241 0.0268  -0.2173 529 LYS B CB  
3485 C CG  . LYS B 232 ? 1.2195 1.6095 1.0116 -0.4551 0.0476  -0.2488 529 LYS B CG  
3486 C CD  . LYS B 232 ? 1.2293 1.5015 1.0011 -0.4468 0.0685  -0.2563 529 LYS B CD  
3487 C CE  . LYS B 232 ? 1.1967 1.4602 0.9874 -0.4511 0.0749  -0.2463 529 LYS B CE  
3488 N NZ  . LYS B 232 ? 1.2079 1.3573 0.9761 -0.4420 0.0947  -0.2482 529 LYS B NZ  
3489 N N   . CYS B 233 ? 1.1392 1.7775 1.0281 -0.4675 0.0131  -0.2120 530 CYS B N   
3490 C CA  . CYS B 233 ? 1.1757 1.8588 1.0691 -0.5044 0.0184  -0.2250 530 CYS B CA  
3491 C C   . CYS B 233 ? 1.1514 1.9581 1.0739 -0.5021 -0.0045 -0.2103 530 CYS B C   
3492 O O   . CYS B 233 ? 1.1906 2.0485 1.1085 -0.5378 -0.0035 -0.2241 530 CYS B O   
3493 C CB  . CYS B 233 ? 1.1623 1.8271 1.0773 -0.5038 0.0294  -0.2215 530 CYS B CB  
3494 S SG  . CYS B 233 ? 1.6998 2.2200 1.5811 -0.5030 0.0555  -0.2314 530 CYS B SG  
3495 N N   . LYS B 234 ? 1.2920 1.7876 2.2048 -0.3559 0.0155  -0.1190 531 LYS B N   
3496 C CA  . LYS B 234 ? 1.2586 1.8874 2.3093 -0.3174 -0.0309 -0.1186 531 LYS B CA  
3497 C C   . LYS B 234 ? 1.2436 1.8993 2.2814 -0.3270 -0.1279 -0.1237 531 LYS B C   
3498 O O   . LYS B 234 ? 1.2320 2.0039 2.3758 -0.3018 -0.1833 -0.1232 531 LYS B O   
3499 C CB  . LYS B 234 ? 1.2512 1.8555 2.2783 -0.2400 -0.0190 -0.1037 531 LYS B CB  
3500 N N   . ASN B 235 ? 1.2555 1.8028 2.1560 -0.3578 -0.1481 -0.1281 532 ASN B N   
3501 C CA  . ASN B 235 ? 1.2501 1.8053 2.1119 -0.3697 -0.2314 -0.1384 532 ASN B CA  
3502 C C   . ASN B 235 ? 1.2221 1.7966 2.0498 -0.3067 -0.2932 -0.1188 532 ASN B C   
3503 O O   . ASN B 235 ? 1.2267 1.7450 1.9445 -0.3031 -0.3389 -0.1168 532 ASN B O   
3504 C CB  . ASN B 235 ? 1.2628 1.9285 2.2545 -0.4233 -0.2654 -0.1669 532 ASN B CB  
3505 N N   . VAL B 236 ? 1.1973 1.8475 2.1175 -0.2548 -0.2900 -0.1016 533 VAL B N   
3506 C CA  . VAL B 236 ? 1.1782 1.8425 2.0733 -0.1914 -0.3438 -0.0744 533 VAL B CA  
3507 C C   . VAL B 236 ? 1.1768 1.7003 1.9107 -0.1701 -0.3332 -0.0528 533 VAL B C   
3508 O O   . VAL B 236 ? 1.1839 1.6890 1.8483 -0.1420 -0.3832 -0.0318 533 VAL B O   
3509 C CB  . VAL B 236 ? 1.1597 1.9090 2.1822 -0.1326 -0.3293 -0.0567 533 VAL B CB  
3510 C CG1 . VAL B 236 ? 1.1657 1.9316 2.1669 -0.0679 -0.3926 -0.0228 533 VAL B CG1 
3511 C CG2 . VAL B 236 ? 1.1502 2.0543 2.3555 -0.1561 -0.3291 -0.0777 533 VAL B CG2 
3512 N N   . PRO B 238 ? 1.2402 1.4912 1.5653 -0.2308 -0.3710 -0.0567 535 PRO B N   
3513 C CA  . PRO B 238 ? 1.2496 1.4690 1.4714 -0.2161 -0.4103 -0.0448 535 PRO B CA  
3514 C C   . PRO B 238 ? 1.2135 1.3262 1.3315 -0.2263 -0.3753 -0.0389 535 PRO B C   
3515 O O   . PRO B 238 ? 1.2099 1.2864 1.2467 -0.2057 -0.3877 -0.0175 535 PRO B O   
3516 C CB  . PRO B 238 ? 1.2657 1.5142 1.4997 -0.1618 -0.4325 -0.0045 535 PRO B CB  
3517 C CG  . PRO B 238 ? 1.2520 1.5261 1.5883 -0.1452 -0.3983 0.0013  535 PRO B CG  
3518 C CD  . PRO B 238 ? 1.2281 1.4760 1.5879 -0.1883 -0.3473 -0.0292 535 PRO B CD  
3519 N N   . LEU B 239 ? 1.1901 1.2590 1.3156 -0.2572 -0.3302 -0.0553 536 LEU B N   
3520 C CA  . LEU B 239 ? 1.1704 1.1450 1.2068 -0.2650 -0.2988 -0.0496 536 LEU B CA  
3521 C C   . LEU B 239 ? 1.1547 1.0950 1.1119 -0.2759 -0.3204 -0.0607 536 LEU B C   
3522 O O   . LEU B 239 ? 1.1692 1.1279 1.1404 -0.3014 -0.3384 -0.0893 536 LEU B O   
3523 C CB  . LEU B 239 ? 1.1742 1.1118 1.2271 -0.2934 -0.2478 -0.0627 536 LEU B CB  
3524 C CG  . LEU B 239 ? 1.1593 1.1003 1.2558 -0.2772 -0.2105 -0.0542 536 LEU B CG  
3525 C CD1 . LEU B 239 ? 1.1630 1.1991 1.3820 -0.2738 -0.2104 -0.0628 536 LEU B CD1 
3526 C CD2 . LEU B 239 ? 1.1697 1.0403 1.2181 -0.2986 -0.1593 -0.0601 536 LEU B CD2 
3527 N N   . SER B 240 ? 1.1087 1.0004 0.9879 -0.2562 -0.3181 -0.0401 537 SER B N   
3528 C CA  . SER B 240 ? 1.1091 0.9648 0.9094 -0.2564 -0.3298 -0.0486 537 SER B CA  
3529 C C   . SER B 240 ? 1.1169 0.9011 0.8853 -0.2828 -0.3000 -0.0656 537 SER B C   
3530 O O   . SER B 240 ? 1.1025 0.8624 0.8939 -0.2976 -0.2682 -0.0627 537 SER B O   
3531 C CB  . SER B 240 ? 1.1014 0.9442 0.8473 -0.2249 -0.3314 -0.0158 537 SER B CB  
3532 O OG  . SER B 240 ? 1.0883 0.8879 0.8281 -0.2257 -0.3029 0.0010  537 SER B OG  
3533 N N   . ASP B 241 ? 1.1276 0.8720 0.8349 -0.2840 -0.3079 -0.0816 538 ASP B N   
3534 C CA  . ASP B 241 ? 1.1605 0.8288 0.8377 -0.3062 -0.2826 -0.0970 538 ASP B CA  
3535 C C   . ASP B 241 ? 1.1409 0.7500 0.7764 -0.2968 -0.2523 -0.0719 538 ASP B C   
3536 O O   . ASP B 241 ? 1.2125 0.7693 0.8426 -0.3186 -0.2246 -0.0739 538 ASP B O   
3537 C CB  . ASP B 241 ? 1.2556 0.8953 0.8838 -0.2967 -0.2936 -0.1215 538 ASP B CB  
3538 C CG  . ASP B 241 ? 1.2856 0.9754 0.9600 -0.3126 -0.3176 -0.1564 538 ASP B CG  
3539 O OD1 . ASP B 241 ? 1.2547 1.0129 1.0050 -0.3279 -0.3303 -0.1575 538 ASP B OD1 
3540 O OD2 . ASP B 241 ? 1.3534 1.0142 0.9883 -0.3088 -0.3266 -0.1856 538 ASP B OD2 
3541 N N   . LEU B 242 ? 1.0632 0.6837 0.6709 -0.2655 -0.2577 -0.0465 539 LEU B N   
3542 C CA  . LEU B 242 ? 1.0263 0.6057 0.6022 -0.2565 -0.2392 -0.0250 539 LEU B CA  
3543 C C   . LEU B 242 ? 1.0063 0.5941 0.6168 -0.2691 -0.2232 -0.0180 539 LEU B C   
3544 O O   . LEU B 242 ? 1.0040 0.5452 0.5832 -0.2746 -0.2029 -0.0122 539 LEU B O   
3545 C CB  . LEU B 242 ? 0.9775 0.5786 0.5311 -0.2253 -0.2517 -0.0018 539 LEU B CB  
3546 C CG  . LEU B 242 ? 0.9611 0.5459 0.4998 -0.2165 -0.2465 0.0206  539 LEU B CG  
3547 C CD1 . LEU B 242 ? 0.9726 0.4926 0.4591 -0.2128 -0.2350 0.0198  539 LEU B CD1 
3548 C CD2 . LEU B 242 ? 0.9706 0.6011 0.5187 -0.1939 -0.2593 0.0439  539 LEU B CD2 
3549 N N   . LEU B 243 ? 0.9764 0.6209 0.6451 -0.2691 -0.2321 -0.0188 540 LEU B N   
3550 C CA  . LEU B 243 ? 0.9670 0.6190 0.6719 -0.2736 -0.2141 -0.0166 540 LEU B CA  
3551 C C   . LEU B 243 ? 1.0263 0.6665 0.7555 -0.3003 -0.1834 -0.0338 540 LEU B C   
3552 O O   . LEU B 243 ? 1.0431 0.6633 0.7700 -0.3042 -0.1536 -0.0334 540 LEU B O   
3553 C CB  . LEU B 243 ? 0.9429 0.6548 0.7069 -0.2579 -0.2321 -0.0087 540 LEU B CB  
3554 C CG  . LEU B 243 ? 0.9550 0.6610 0.7437 -0.2481 -0.2191 -0.0015 540 LEU B CG  
3555 C CD1 . LEU B 243 ? 0.8582 0.5093 0.5883 -0.2473 -0.2139 0.0059  540 LEU B CD1 
3556 C CD2 . LEU B 243 ? 0.9238 0.6730 0.7574 -0.2256 -0.2418 0.0165  540 LEU B CD2 
3557 N N   . LEU B 244 ? 1.0541 0.7054 0.8051 -0.3202 -0.1889 -0.0502 541 LEU B N   
3558 C CA  . LEU B 244 ? 1.0942 0.7376 0.8818 -0.3544 -0.1571 -0.0641 541 LEU B CA  
3559 C C   . LEU B 244 ? 1.1732 0.7268 0.8861 -0.3661 -0.1237 -0.0548 541 LEU B C   
3560 O O   . LEU B 244 ? 1.2644 0.7991 0.9860 -0.3859 -0.0813 -0.0522 541 LEU B O   
3561 C CB  . LEU B 244 ? 1.1030 0.7825 0.9420 -0.3794 -0.1798 -0.0884 541 LEU B CB  
3562 C CG  . LEU B 244 ? 1.0550 0.8335 1.0055 -0.3889 -0.1917 -0.1011 541 LEU B CG  
3563 C CD1 . LEU B 244 ? 1.0683 0.8798 1.0608 -0.4185 -0.2250 -0.1310 541 LEU B CD1 
3564 C CD2 . LEU B 244 ? 1.0342 0.8288 1.0445 -0.4061 -0.1410 -0.0978 541 LEU B CD2 
3565 N N   . GLU B 245 ? 1.1352 0.6357 0.7742 -0.3498 -0.1402 -0.0466 542 GLU B N   
3566 C CA  . GLU B 245 ? 1.1870 0.5994 0.7478 -0.3509 -0.1156 -0.0315 542 GLU B CA  
3567 C C   . GLU B 245 ? 1.2044 0.6003 0.7156 -0.3313 -0.1043 -0.0125 542 GLU B C   
3568 O O   . GLU B 245 ? 1.2465 0.5790 0.6945 -0.3342 -0.0771 0.0019  542 GLU B O   
3569 C CB  . GLU B 245 ? 1.1789 0.5439 0.6853 -0.3326 -0.1377 -0.0299 542 GLU B CB  
3570 C CG  . GLU B 245 ? 1.2020 0.5679 0.7411 -0.3507 -0.1479 -0.0566 542 GLU B CG  
3571 C CD  . GLU B 245 ? 1.2534 0.5481 0.7276 -0.3307 -0.1576 -0.0590 542 GLU B CD  
3572 O OE1 . GLU B 245 ? 1.2747 0.5267 0.6867 -0.3004 -0.1568 -0.0352 542 GLU B OE1 
3573 O OE2 . GLU B 245 ? 1.2841 0.5758 0.7773 -0.3384 -0.1654 -0.0855 542 GLU B OE2 
3574 N N   . MET B 246 ? 1.1910 0.6384 0.7256 -0.3120 -0.1269 -0.0127 543 MET B N   
3575 C CA  . MET B 246 ? 1.1951 0.6281 0.6902 -0.2987 -0.1220 -0.0051 543 MET B CA  
3576 C C   . MET B 246 ? 1.2598 0.6899 0.7682 -0.3133 -0.0788 -0.0137 543 MET B C   
3577 O O   . MET B 246 ? 1.3786 0.7596 0.8159 -0.3110 -0.0552 -0.0081 543 MET B O   
3578 C CB  . MET B 246 ? 1.1072 0.5882 0.6364 -0.2810 -0.1544 -0.0047 543 MET B CB  
3579 C CG  . MET B 246 ? 1.0872 0.5793 0.6028 -0.2639 -0.1890 0.0087  543 MET B CG  
3580 S SD  . MET B 246 ? 1.5054 0.9467 0.9374 -0.2491 -0.1997 0.0248  543 MET B SD  
3581 C CE  . MET B 246 ? 0.9831 0.4751 0.4441 -0.2273 -0.2342 0.0394  543 MET B CE  
3582 N N   . LEU B 247 ? 1.2051 0.6932 0.8033 -0.3250 -0.0684 -0.0270 544 LEU B N   
3583 C CA  . LEU B 247 ? 1.2277 0.7315 0.8610 -0.3353 -0.0212 -0.0356 544 LEU B CA  
3584 C C   . LEU B 247 ? 1.3059 0.7587 0.8977 -0.3604 0.0270  -0.0267 544 LEU B C   
3585 O O   . LEU B 247 ? 1.3862 0.8134 0.9379 -0.3593 0.0724  -0.0242 544 LEU B O   
3586 C CB  . LEU B 247 ? 1.1632 0.7542 0.9185 -0.3411 -0.0252 -0.0486 544 LEU B CB  
3587 C CG  . LEU B 247 ? 1.1260 0.7606 0.9299 -0.3128 -0.0325 -0.0551 544 LEU B CG  
3588 C CD1 . LEU B 247 ? 1.1109 0.7385 0.8886 -0.2906 -0.0827 -0.0464 544 LEU B CD1 
3589 C CD2 . LEU B 247 ? 1.0719 0.7974 1.0006 -0.3155 -0.0293 -0.0640 544 LEU B CD2 
3590 N N   . ASP B 248 ? 1.3012 0.7315 0.8964 -0.3821 0.0200  -0.0215 545 ASP B N   
3591 C CA  . ASP B 248 ? 1.4090 0.7790 0.9707 -0.4108 0.0672  -0.0075 545 ASP B CA  
3592 C C   . ASP B 248 ? 1.5030 0.7841 0.9310 -0.3924 0.0836  0.0171  545 ASP B C   
3593 O O   . ASP B 248 ? 1.5855 0.8130 0.9666 -0.4089 0.1352  0.0360  545 ASP B O   
3594 C CB  . ASP B 248 ? 1.4186 0.7660 1.0075 -0.4370 0.0498  -0.0114 545 ASP B CB  
3595 C CG  . ASP B 248 ? 1.3770 0.8066 1.0962 -0.4700 0.0468  -0.0358 545 ASP B CG  
3596 O OD1 . ASP B 248 ? 1.4614 0.8645 1.2124 -0.5096 0.0572  -0.0415 545 ASP B OD1 
3597 O OD2 . ASP B 248 ? 1.2885 0.8072 1.0805 -0.4564 0.0315  -0.0492 545 ASP B OD2 
3598 N N   . ALA B 249 ? 1.4949 0.7645 0.8633 -0.3587 0.0389  0.0193  546 ALA B N   
3599 C CA  . ALA B 249 ? 1.6006 0.8004 0.8445 -0.3368 0.0396  0.0399  546 ALA B CA  
3600 C C   . ALA B 249 ? 1.6357 0.8299 0.8315 -0.3315 0.0778  0.0349  546 ALA B C   
3601 O O   . ALA B 249 ? 1.7589 0.8902 0.8378 -0.3182 0.0904  0.0520  546 ALA B O   
3602 C CB  . ALA B 249 ? 1.5861 0.7953 0.8033 -0.3064 -0.0221 0.0401  546 ALA B CB  
3603 N N   . HIS B 250 ? 1.5534 0.8121 0.8337 -0.3370 0.0954  0.0108  547 HIS B N   
3604 C CA  . HIS B 250 ? 1.6031 0.8573 0.8445 -0.3273 0.1387  -0.0011 547 HIS B CA  
3605 C C   . HIS B 250 ? 1.6458 0.9200 0.9390 -0.3518 0.2143  0.0033  547 HIS B C   
3606 O O   . HIS B 250 ? 1.6825 0.9647 0.9601 -0.3421 0.2633  -0.0082 547 HIS B O   
3607 C CB  . HIS B 250 ? 1.5271 0.8307 0.8226 -0.3073 0.1105  -0.0313 547 HIS B CB  
3608 C CG  . HIS B 250 ? 1.5204 0.7957 0.7484 -0.2868 0.0515  -0.0368 547 HIS B CG  
3609 N ND1 . HIS B 250 ? 1.6053 0.8438 0.7506 -0.2695 0.0504  -0.0566 547 HIS B ND1 
3610 C CD2 . HIS B 250 ? 1.4470 0.7298 0.6832 -0.2829 -0.0074 -0.0270 547 HIS B CD2 
3611 C CE1 . HIS B 250 ? 1.5752 0.8036 0.6906 -0.2612 -0.0115 -0.0586 547 HIS B CE1 
3612 N NE2 . HIS B 250 ? 1.4649 0.7244 0.6383 -0.2678 -0.0439 -0.0380 547 HIS B NE2 
3613 N N   . ARG B 251 ? 1.6508 0.9332 1.0089 -0.3846 0.2252  0.0179  548 ARG B N   
3614 C CA  . ARG B 251 ? 1.6783 0.9888 1.1084 -0.4184 0.2955  0.0248  548 ARG B CA  
3615 C C   . ARG B 251 ? 1.7496 0.9933 1.1534 -0.4536 0.3161  0.0553  548 ARG B C   
3616 O O   . ARG B 251 ? 1.8392 0.9891 1.1142 -0.4408 0.3099  0.0815  548 ARG B O   
3617 C CB  . ARG B 251 ? 1.5763 0.9997 1.1780 -0.4318 0.2846  -0.0004 548 ARG B CB  
3618 N N   . HIS C 2   ? 1.0810 1.1721 1.3504 0.4659  0.0773  0.2382  687 HIS C N   
3619 C CA  . HIS C 2   ? 1.0659 1.0946 1.2760 0.4267  0.0957  0.2749  687 HIS C CA  
3620 C C   . HIS C 2   ? 0.9598 1.0564 1.1181 0.3940  0.1190  0.2807  687 HIS C C   
3621 O O   . HIS C 2   ? 0.9410 1.1174 1.0811 0.3900  0.1131  0.2789  687 HIS C O   
3622 C CB  . HIS C 2   ? 1.1104 1.0753 1.3606 0.4356  0.1108  0.2490  687 HIS C CB  
3623 N N   . LYS C 3   ? 0.9078 0.9665 1.0390 0.3625  0.1374  0.2813  688 LYS C N   
3624 C CA  . LYS C 3   ? 0.8074 0.9089 0.8829 0.3152  0.1409  0.2752  688 LYS C CA  
3625 C C   . LYS C 3   ? 0.7779 0.9040 0.8548 0.2823  0.1551  0.2170  688 LYS C C   
3626 O O   . LYS C 3   ? 0.8141 0.9089 0.9325 0.2897  0.1713  0.1831  688 LYS C O   
3627 C CB  . LYS C 3   ? 0.7970 0.8434 0.8333 0.2886  0.1404  0.3080  688 LYS C CB  
3628 C CG  . LYS C 3   ? 0.8306 0.8670 0.8520 0.2768  0.1264  0.3322  688 LYS C CG  
3629 C CD  . LYS C 3   ? 0.8290 0.8539 0.8224 0.2359  0.1263  0.3318  688 LYS C CD  
3630 C CE  . LYS C 3   ? 0.8666 0.8868 0.8463 0.2215  0.1147  0.3509  688 LYS C CE  
3631 N NZ  . LYS C 3   ? 1.0107 0.9543 0.9929 0.2312  0.1139  0.3790  688 LYS C NZ  
3632 N N   . ILE C 4   ? 0.7266 0.9048 0.7530 0.2415  0.1440  0.2065  689 ILE C N   
3633 C CA  . ILE C 4   ? 0.7171 0.9087 0.7207 0.1929  0.1486  0.1595  689 ILE C CA  
3634 C C   . ILE C 4   ? 0.7382 0.8462 0.7337 0.1714  0.1523  0.1559  689 ILE C C   
3635 O O   . ILE C 4   ? 0.7846 0.8730 0.7900 0.1496  0.1670  0.1166  689 ILE C O   
3636 C CB  . ILE C 4   ? 0.6884 0.9343 0.6229 0.1458  0.1206  0.1599  689 ILE C CB  
3637 C CG1 . ILE C 4   ? 0.6853 1.0218 0.6261 0.1638  0.1192  0.1617  689 ILE C CG1 
3638 C CG2 . ILE C 4   ? 0.6760 0.9215 0.5696 0.0820  0.1165  0.1168  689 ILE C CG2 
3639 C CD1 . ILE C 4   ? 0.6865 1.0749 0.5526 0.1130  0.0887  0.1652  689 ILE C CD1 
3640 N N   . LEU C 5   ? 0.7105 0.7776 0.6911 0.1755  0.1400  0.1920  690 LEU C N   
3641 C CA  . LEU C 5   ? 0.7307 0.7285 0.7103 0.1565  0.1431  0.1846  690 LEU C CA  
3642 C C   . LEU C 5   ? 0.7830 0.7240 0.8095 0.1771  0.1742  0.1744  690 LEU C C   
3643 O O   . LEU C 5   ? 0.8046 0.6967 0.8346 0.1554  0.1830  0.1500  690 LEU C O   
3644 C CB  . LEU C 5   ? 0.7137 0.7017 0.6805 0.1586  0.1294  0.2163  690 LEU C CB  
3645 C CG  . LEU C 5   ? 0.7270 0.6606 0.7003 0.1378  0.1329  0.2008  690 LEU C CG  
3646 C CD1 . LEU C 5   ? 0.6591 0.5763 0.6133 0.1000  0.1086  0.1586  690 LEU C CD1 
3647 C CD2 . LEU C 5   ? 0.7218 0.6740 0.6892 0.1359  0.1230  0.2204  690 LEU C CD2 
3648 N N   . HIS C 6   ? 0.8017 0.7438 0.8653 0.2199  0.1841  0.1924  691 HIS C N   
3649 C CA  . HIS C 6   ? 0.8763 0.7597 0.9888 0.2444  0.2020  0.1815  691 HIS C CA  
3650 C C   . HIS C 6   ? 0.8371 0.7373 0.9739 0.2305  0.2173  0.1222  691 HIS C C   
3651 O O   . HIS C 6   ? 0.8541 0.6975 1.0062 0.2200  0.2320  0.1018  691 HIS C O   
3652 C CB  . HIS C 6   ? 0.9958 0.8800 1.1471 0.2952  0.1925  0.2045  691 HIS C CB  
3653 C CG  . HIS C 6   ? 1.0929 0.9281 1.2207 0.3039  0.1796  0.2660  691 HIS C CG  
3654 N ND1 . HIS C 6   ? 1.1393 1.0023 1.2616 0.3299  0.1592  0.3029  691 HIS C ND1 
3655 C CD2 . HIS C 6   ? 1.1500 0.9140 1.2536 0.2828  0.1847  0.2950  691 HIS C CD2 
3656 C CE1 . HIS C 6   ? 1.1870 1.0079 1.2732 0.3047  0.1468  0.3376  691 HIS C CE1 
3657 N NE2 . HIS C 6   ? 1.1893 0.9531 1.2645 0.2784  0.1640  0.3361  691 HIS C NE2 
3658 N N   . ARG C 7   ? 0.7903 0.7750 0.9275 0.2249  0.2151  0.0923  692 ARG C N   
3659 C CA  . ARG C 7   ? 0.7631 0.7876 0.9189 0.2017  0.2321  0.0291  692 ARG C CA  
3660 C C   . ARG C 7   ? 0.7326 0.7268 0.8346 0.1410  0.2313  0.0129  692 ARG C C   
3661 O O   . ARG C 7   ? 0.7378 0.7127 0.8581 0.1234  0.2494  -0.0282 692 ARG C O   
3662 C CB  . ARG C 7   ? 0.7231 0.8597 0.8772 0.1940  0.2298  0.0002  692 ARG C CB  
3663 C CG  . ARG C 7   ? 0.7542 0.9569 0.9403 0.1707  0.2530  -0.0761 692 ARG C CG  
3664 C CD  . ARG C 7   ? 0.7473 1.0417 0.8663 0.1046  0.2484  -0.1000 692 ARG C CD  
3665 N NE  . ARG C 7   ? 0.7322 1.0860 0.8341 0.1204  0.2305  -0.0701 692 ARG C NE  
3666 C CZ  . ARG C 7   ? 0.7087 1.1039 0.7272 0.0655  0.2100  -0.0553 692 ARG C CZ  
3667 N NH1 . ARG C 7   ? 0.7031 1.1518 0.7124 0.0850  0.1950  -0.0284 692 ARG C NH1 
3668 N NH2 . ARG C 7   ? 0.6916 1.0669 0.6325 -0.0109 0.1981  -0.0658 692 ARG C NH2 
3669 N N   . LEU C 8   ? 0.6978 0.6853 0.7368 0.1102  0.2047  0.0422  693 LEU C N   
3670 C CA  . LEU C 8   ? 0.6896 0.6402 0.6768 0.0534  0.1872  0.0263  693 LEU C CA  
3671 C C   . LEU C 8   ? 0.7286 0.5924 0.7405 0.0591  0.1994  0.0240  693 LEU C C   
3672 O O   . LEU C 8   ? 0.6570 0.4874 0.6542 0.0218  0.1996  -0.0074 693 LEU C O   
3673 C CB  . LEU C 8   ? 0.6089 0.5680 0.5348 0.0270  0.1427  0.0531  693 LEU C CB  
3674 C CG  . LEU C 8   ? 0.6288 0.6680 0.5102 0.0011  0.1244  0.0513  693 LEU C CG  
3675 C CD1 . LEU C 8   ? 0.6184 0.6531 0.4413 -0.0224 0.0716  0.0786  693 LEU C CD1 
3676 C CD2 . LEU C 8   ? 0.6651 0.7335 0.5138 -0.0574 0.1308  0.0048  693 LEU C CD2 
3677 N N   . LEU C 9   ? 0.7418 0.5698 0.7860 0.0999  0.2090  0.0574  694 LEU C N   
3678 C CA  . LEU C 9   ? 0.7317 0.4829 0.7964 0.1011  0.2230  0.0568  694 LEU C CA  
3679 C C   . LEU C 9   ? 0.7890 0.5076 0.8978 0.1124  0.2523  0.0266  694 LEU C C   
3680 O O   . LEU C 9   ? 0.8307 0.4945 0.9436 0.0930  0.2616  0.0066  694 LEU C O   
3681 C CB  . LEU C 9   ? 0.7166 0.4446 0.7917 0.1282  0.2259  0.1012  694 LEU C CB  
3682 C CG  . LEU C 9   ? 0.6736 0.4215 0.7160 0.1098  0.2010  0.1167  694 LEU C CG  
3683 C CD1 . LEU C 9   ? 0.6978 0.4435 0.7443 0.1295  0.2086  0.1599  694 LEU C CD1 
3684 C CD2 . LEU C 9   ? 0.6654 0.3749 0.7030 0.0760  0.1918  0.0840  694 LEU C CD2 
3685 N N   . GLN C 10  ? 0.7905 0.5461 0.9390 0.1457  0.2636  0.0174  695 GLN C N   
3686 C CA  . GLN C 10  ? 0.8648 0.6008 1.0689 0.1626  0.2860  -0.0219 695 GLN C CA  
3687 C C   . GLN C 10  ? 0.8856 0.6638 1.0770 0.1178  0.2964  -0.0796 695 GLN C C   
3688 O O   . GLN C 10  ? 0.9314 0.6820 1.1562 0.1146  0.3159  -0.1171 695 GLN C O   
3689 C CB  . GLN C 10  ? 0.8898 0.6550 1.1550 0.2181  0.2848  -0.0239 695 GLN C CB  
3690 C CG  . GLN C 10  ? 0.9471 0.6474 1.2209 0.2565  0.2697  0.0346  695 GLN C CG  
3691 C CD  . GLN C 10  ? 0.9968 0.7028 1.3369 0.3143  0.2545  0.0291  695 GLN C CD  
3692 O OE1 . GLN C 10  ? 0.9953 0.7842 1.3777 0.3303  0.2558  -0.0193 695 GLN C OE1 
3693 N NE2 . GLN C 10  ? 1.0397 0.6623 1.3840 0.3374  0.2319  0.0738  695 GLN C NE2 
3694 N N   . ASP C 11  ? 0.8361 0.6786 0.9726 0.0771  0.2807  -0.0856 696 ASP C N   
3695 C CA  . ASP C 11  ? 0.8042 0.6922 0.9092 0.0186  0.2858  -0.1367 696 ASP C CA  
3696 C C   . ASP C 11  ? 0.8122 0.6460 0.8422 -0.0432 0.2592  -0.1305 696 ASP C C   
3697 O O   . ASP C 11  ? 0.8274 0.5878 0.8520 -0.0334 0.2447  -0.1013 696 ASP C O   
3698 C CB  . ASP C 11  ? 0.7780 0.7762 0.8634 0.0009  0.2816  -0.1542 696 ASP C CB  
3699 C CG  . ASP C 11  ? 0.7970 0.8558 0.9679 0.0645  0.3005  -0.1731 696 ASP C CG  
3700 O OD1 . ASP C 11  ? 0.8397 0.8595 1.0857 0.1112  0.3168  -0.1895 696 ASP C OD1 
3701 O OD2 . ASP C 11  ? 0.7754 0.9172 0.9398 0.0680  0.2931  -0.1731 696 ASP C OD2 
3702 N N   . HIS D 2   ? 1.5347 0.5964 0.7148 0.0224  0.0753  -0.1644 687 HIS D N   
3703 C CA  . HIS D 2   ? 1.5642 0.6215 0.7291 0.0034  0.0798  -0.1570 687 HIS D CA  
3704 C C   . HIS D 2   ? 1.5113 0.6015 0.6835 -0.0056 0.0855  -0.1384 687 HIS D C   
3705 O O   . HIS D 2   ? 1.5059 0.6069 0.6831 -0.0151 0.0881  -0.1459 687 HIS D O   
3706 C CB  . HIS D 2   ? 1.5926 0.6175 0.7281 -0.0069 0.0760  -0.1441 687 HIS D CB  
3707 N N   . LYS D 3   ? 1.4661 0.5689 0.6382 -0.0026 0.0850  -0.1156 688 LYS D N   
3708 C CA  . LYS D 3   ? 1.4000 0.5320 0.5844 -0.0078 0.0860  -0.1004 688 LYS D CA  
3709 C C   . LYS D 3   ? 1.3680 0.5195 0.5676 -0.0024 0.0862  -0.1090 688 LYS D C   
3710 O O   . LYS D 3   ? 1.3711 0.5227 0.5779 0.0088  0.0876  -0.1235 688 LYS D O   
3711 C CB  . LYS D 3   ? 1.3808 0.5195 0.5627 -0.0046 0.0850  -0.0773 688 LYS D CB  
3712 C CG  . LYS D 3   ? 1.3973 0.5184 0.5621 -0.0157 0.0882  -0.0704 688 LYS D CG  
3713 C CD  . LYS D 3   ? 1.3824 0.5081 0.5422 -0.0138 0.0891  -0.0505 688 LYS D CD  
3714 C CE  . LYS D 3   ? 1.4060 0.5130 0.5464 -0.0303 0.0959  -0.0470 688 LYS D CE  
3715 N NZ  . LYS D 3   ? 1.3546 0.4624 0.4864 -0.0311 0.0986  -0.0296 688 LYS D NZ  
3716 N N   . ILE D 4   ? 1.3748 0.5427 0.5802 -0.0112 0.0839  -0.1038 689 ILE D N   
3717 C CA  . ILE D 4   ? 1.3882 0.5702 0.6001 -0.0116 0.0840  -0.1102 689 ILE D CA  
3718 C C   . ILE D 4   ? 1.3683 0.5629 0.5892 0.0007  0.0834  -0.0993 689 ILE D C   
3719 O O   . ILE D 4   ? 1.3782 0.5814 0.6072 0.0050  0.0881  -0.1152 689 ILE D O   
3720 C CB  . ILE D 4   ? 1.3745 0.5645 0.5847 -0.0237 0.0764  -0.1033 689 ILE D CB  
3721 C CG1 . ILE D 4   ? 1.3871 0.5653 0.5887 -0.0360 0.0752  -0.1154 689 ILE D CG1 
3722 C CG2 . ILE D 4   ? 1.3620 0.5589 0.5693 -0.0288 0.0763  -0.1092 689 ILE D CG2 
3723 C CD1 . ILE D 4   ? 1.3507 0.5349 0.5507 -0.0466 0.0632  -0.1124 689 ILE D CD1 
3724 N N   . LEU D 5   ? 1.3566 0.5544 0.5774 0.0054  0.0783  -0.0757 690 LEU D N   
3725 C CA  . LEU D 5   ? 1.3251 0.5316 0.5507 0.0169  0.0759  -0.0617 690 LEU D CA  
3726 C C   . LEU D 5   ? 1.3298 0.5298 0.5569 0.0292  0.0797  -0.0750 690 LEU D C   
3727 O O   . LEU D 5   ? 1.3054 0.5178 0.5438 0.0379  0.0801  -0.0802 690 LEU D O   
3728 C CB  . LEU D 5   ? 1.2484 0.4559 0.4706 0.0184  0.0708  -0.0377 690 LEU D CB  
3729 C CG  . LEU D 5   ? 1.2024 0.4142 0.4239 0.0299  0.0672  -0.0201 690 LEU D CG  
3730 C CD1 . LEU D 5   ? 1.1861 0.4119 0.4181 0.0323  0.0622  -0.0168 690 LEU D CD1 
3731 C CD2 . LEU D 5   ? 1.1751 0.3866 0.3919 0.0281  0.0648  -0.0017 690 LEU D CD2 
3732 N N   . HIS D 6   ? 1.3383 0.5184 0.5557 0.0298  0.0809  -0.0836 691 HIS D N   
3733 C CA  . HIS D 6   ? 1.3507 0.5195 0.5714 0.0433  0.0796  -0.1014 691 HIS D CA  
3734 C C   . HIS D 6   ? 1.3597 0.5441 0.6060 0.0479  0.0849  -0.1365 691 HIS D C   
3735 O O   . HIS D 6   ? 1.3589 0.5558 0.6257 0.0612  0.0843  -0.1527 691 HIS D O   
3736 C CB  . HIS D 6   ? 1.4015 0.5390 0.6038 0.0402  0.0773  -0.1063 691 HIS D CB  
3737 C CG  . HIS D 6   ? 1.4473 0.5649 0.6528 0.0553  0.0698  -0.1249 691 HIS D CG  
3738 N ND1 . HIS D 6   ? 1.5020 0.6214 0.7355 0.0650  0.0697  -0.1627 691 HIS D ND1 
3739 C CD2 . HIS D 6   ? 1.4655 0.5594 0.6525 0.0623  0.0599  -0.1146 691 HIS D CD2 
3740 C CE1 . HIS D 6   ? 1.5350 0.6324 0.7748 0.0795  0.0581  -0.1761 691 HIS D CE1 
3741 N NE2 . HIS D 6   ? 1.5268 0.6060 0.7342 0.0775  0.0507  -0.1454 691 HIS D NE2 
3742 N N   . ARG D 7   ? 1.3447 0.5302 0.5910 0.0358  0.0906  -0.1519 692 ARG D N   
3743 C CA  . ARG D 7   ? 1.3689 0.5710 0.6359 0.0358  0.0983  -0.1903 692 ARG D CA  
3744 C C   . ARG D 7   ? 1.3236 0.5563 0.6041 0.0350  0.1028  -0.1930 692 ARG D C   
3745 O O   . ARG D 7   ? 1.3588 0.6135 0.6660 0.0438  0.1082  -0.2268 692 ARG D O   
3746 C CB  . ARG D 7   ? 1.4121 0.6064 0.6660 0.0191  0.1027  -0.2011 692 ARG D CB  
3747 C CG  . ARG D 7   ? 1.4888 0.7014 0.7571 0.0153  0.1123  -0.2433 692 ARG D CG  
3748 C CD  . ARG D 7   ? 1.5274 0.7270 0.7746 -0.0033 0.1155  -0.2519 692 ARG D CD  
3749 N NE  . ARG D 7   ? 1.5056 0.7006 0.7290 -0.0211 0.1116  -0.2197 692 ARG D NE  
3750 C CZ  . ARG D 7   ? 1.5003 0.7093 0.7158 -0.0343 0.1135  -0.2161 692 ARG D CZ  
3751 N NH1 . ARG D 7   ? 1.4863 0.6858 0.6830 -0.0478 0.1048  -0.1894 692 ARG D NH1 
3752 N NH2 . ARG D 7   ? 1.4975 0.7305 0.7244 -0.0341 0.1227  -0.2424 692 ARG D NH2 
3753 N N   . LEU D 8   ? 1.2831 0.5181 0.5484 0.0246  0.0996  -0.1613 693 LEU D N   
3754 C CA  . LEU D 8   ? 1.2658 0.5231 0.5378 0.0209  0.1016  -0.1595 693 LEU D CA  
3755 C C   . LEU D 8   ? 1.2633 0.5342 0.5536 0.0382  0.0997  -0.1590 693 LEU D C   
3756 O O   . LEU D 8   ? 1.2752 0.5729 0.5851 0.0400  0.1062  -0.1841 693 LEU D O   
3757 C CB  . LEU D 8   ? 1.2226 0.4717 0.4761 0.0090  0.0933  -0.1252 693 LEU D CB  
3758 C CG  . LEU D 8   ? 1.2565 0.4950 0.4931 -0.0099 0.0931  -0.1301 693 LEU D CG  
3759 C CD1 . LEU D 8   ? 1.1713 0.4020 0.3956 -0.0176 0.0801  -0.1012 693 LEU D CD1 
3760 C CD2 . LEU D 8   ? 1.2383 0.4897 0.4731 -0.0238 0.1041  -0.1636 693 LEU D CD2 
3761 N N   . LEU D 9   ? 1.2557 0.5095 0.5375 0.0495  0.0909  -0.1329 694 LEU D N   
3762 C CA  . LEU D 9   ? 1.2396 0.4997 0.5328 0.0661  0.0863  -0.1305 694 LEU D CA  
3763 C C   . LEU D 9   ? 1.3026 0.5724 0.6268 0.0794  0.0899  -0.1752 694 LEU D C   
3764 O O   . LEU D 9   ? 1.2876 0.5756 0.6366 0.0919  0.0890  -0.1909 694 LEU D O   
3765 C CB  . LEU D 9   ? 1.1980 0.4333 0.4662 0.0718  0.0760  -0.0957 694 LEU D CB  
3766 C CG  . LEU D 9   ? 1.1554 0.3883 0.4052 0.0657  0.0704  -0.0564 694 LEU D CG  
3767 C CD1 . LEU D 9   ? 1.1233 0.3341 0.3478 0.0660  0.0652  -0.0334 694 LEU D CD1 
3768 C CD2 . LEU D 9   ? 1.0791 0.3273 0.3376 0.0731  0.0667  -0.0472 694 LEU D CD2 
3769 N N   . GLN D 10  ? 1.3717 0.6295 0.6991 0.0774  0.0928  -0.1989 695 GLN D N   
3770 C CA  . GLN D 10  ? 1.4746 0.7362 0.8383 0.0920  0.0932  -0.2464 695 GLN D CA  
3771 C C   . GLN D 10  ? 1.5170 0.8226 0.9198 0.0920  0.1058  -0.2964 695 GLN D C   
3772 O O   . GLN D 10  ? 1.5108 0.8373 0.9598 0.1080  0.1064  -0.3374 695 GLN D O   
3773 C CB  . GLN D 10  ? 1.5388 0.7696 0.8914 0.0891  0.0908  -0.2556 695 GLN D CB  
3774 C CG  . GLN D 10  ? 1.5930 0.8064 0.9779 0.1071  0.0828  -0.2918 695 GLN D CG  
3775 C CD  . GLN D 10  ? 1.6434 0.8223 1.0140 0.1023  0.0792  -0.2999 695 GLN D CD  
3776 O OE1 . GLN D 10  ? 1.6394 0.8220 0.9933 0.0874  0.0876  -0.3008 695 GLN D OE1 
3777 N NE2 . GLN D 10  ? 1.6850 0.8254 1.0593 0.1137  0.0649  -0.3049 695 GLN D NE2 
3778 N N   . ASP D 11  ? 1.5711 0.8911 0.9556 0.0731  0.1151  -0.2958 696 ASP D N   
3779 C CA  . ASP D 11  ? 1.6674 1.0306 1.0733 0.0690  0.1269  -0.3426 696 ASP D CA  
3780 C C   . ASP D 11  ? 1.6646 1.0651 1.0962 0.0774  0.1288  -0.3541 696 ASP D C   
3781 O O   . ASP D 11  ? 1.7063 1.1463 1.1772 0.0914  0.1328  -0.4090 696 ASP D O   
3782 C CB  . ASP D 11  ? 1.7115 1.0721 1.0776 0.0420  0.1341  -0.3278 696 ASP D CB  
3783 C CG  . ASP D 11  ? 1.7673 1.0966 1.1114 0.0328  0.1334  -0.3249 696 ASP D CG  
3784 O OD1 . ASP D 11  ? 1.8174 1.1333 1.1798 0.0476  0.1296  -0.3464 696 ASP D OD1 
3785 O OD2 . ASP D 11  ? 1.7575 1.0731 1.0671 0.0101  0.1351  -0.3027 696 ASP D OD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   298 ?   ?   ?   A . n 
A 1 2   LYS 2   299 ?   ?   ?   A . n 
A 1 3   ARG 3   300 ?   ?   ?   A . n 
A 1 4   SER 4   301 ?   ?   ?   A . n 
A 1 5   LYS 5   302 ?   ?   ?   A . n 
A 1 6   LYS 6   303 ?   ?   ?   A . n 
A 1 7   ASN 7   304 ?   ?   ?   A . n 
A 1 8   SER 8   305 305 SER SER A . n 
A 1 9   LEU 9   306 306 LEU LEU A . n 
A 1 10  ALA 10  307 307 ALA ALA A . n 
A 1 11  LEU 11  308 308 LEU LEU A . n 
A 1 12  SER 12  309 309 SER SER A . n 
A 1 13  LEU 13  310 310 LEU LEU A . n 
A 1 14  THR 14  311 311 THR THR A . n 
A 1 15  ALA 15  312 312 ALA ALA A . n 
A 1 16  ASP 16  313 313 ASP ASP A . n 
A 1 17  GLN 17  314 314 GLN GLN A . n 
A 1 18  MET 18  315 315 MET MET A . n 
A 1 19  VAL 19  316 316 VAL VAL A . n 
A 1 20  SER 20  317 317 SER SER A . n 
A 1 21  ALA 21  318 318 ALA ALA A . n 
A 1 22  LEU 22  319 319 LEU LEU A . n 
A 1 23  LEU 23  320 320 LEU LEU A . n 
A 1 24  ASP 24  321 321 ASP ASP A . n 
A 1 25  ALA 25  322 322 ALA ALA A . n 
A 1 26  GLU 26  323 323 GLU GLU A . n 
A 1 27  PRO 27  324 324 PRO PRO A . n 
A 1 28  PRO 28  325 325 PRO PRO A . n 
A 1 29  ILE 29  326 326 ILE ILE A . n 
A 1 30  LEU 30  327 327 LEU LEU A . n 
A 1 31  TYR 31  328 328 TYR TYR A . n 
A 1 32  SER 32  329 329 SER SER A . n 
A 1 33  GLU 33  330 330 GLU GLU A . n 
A 1 34  TYR 34  331 331 TYR TYR A . n 
A 1 35  ASP 35  332 332 ASP ASP A . n 
A 1 36  PRO 36  333 333 PRO PRO A . n 
A 1 37  THR 37  334 334 THR THR A . n 
A 1 38  ARG 38  335 335 ARG ARG A . n 
A 1 39  PRO 39  336 336 PRO PRO A . n 
A 1 40  PHE 40  337 337 PHE PHE A . n 
A 1 41  SER 41  338 338 SER SER A . n 
A 1 42  GLU 42  339 339 GLU GLU A . n 
A 1 43  ALA 43  340 340 ALA ALA A . n 
A 1 44  SER 44  341 341 SER SER A . n 
A 1 45  MET 45  342 342 MET MET A . n 
A 1 46  MET 46  343 343 MET MET A . n 
A 1 47  GLY 47  344 344 GLY GLY A . n 
A 1 48  LEU 48  345 345 LEU LEU A . n 
A 1 49  LEU 49  346 346 LEU LEU A . n 
A 1 50  THR 50  347 347 THR THR A . n 
A 1 51  ASN 51  348 348 ASN ASN A . n 
A 1 52  LEU 52  349 349 LEU LEU A . n 
A 1 53  ALA 53  350 350 ALA ALA A . n 
A 1 54  ASP 54  351 351 ASP ASP A . n 
A 1 55  ARG 55  352 352 ARG ARG A . n 
A 1 56  GLU 56  353 353 GLU GLU A . n 
A 1 57  LEU 57  354 354 LEU LEU A . n 
A 1 58  VAL 58  355 355 VAL VAL A . n 
A 1 59  HIS 59  356 356 HIS HIS A . n 
A 1 60  MET 60  357 357 MET MET A . n 
A 1 61  ILE 61  358 358 ILE ILE A . n 
A 1 62  ASN 62  359 359 ASN ASN A . n 
A 1 63  TRP 63  360 360 TRP TRP A . n 
A 1 64  ALA 64  361 361 ALA ALA A . n 
A 1 65  LYS 65  362 362 LYS LYS A . n 
A 1 66  ARG 66  363 363 ARG ARG A . n 
A 1 67  VAL 67  364 364 VAL VAL A . n 
A 1 68  PRO 68  365 365 PRO PRO A . n 
A 1 69  GLY 69  366 366 GLY GLY A . n 
A 1 70  PHE 70  367 367 PHE PHE A . n 
A 1 71  VAL 71  368 368 VAL VAL A . n 
A 1 72  ASP 72  369 369 ASP ASP A . n 
A 1 73  LEU 73  370 370 LEU LEU A . n 
A 1 74  THR 74  371 371 THR THR A . n 
A 1 75  LEU 75  372 372 LEU LEU A . n 
A 1 76  HIS 76  373 373 HIS HIS A . n 
A 1 77  ASP 77  374 374 ASP ASP A . n 
A 1 78  GLN 78  375 375 GLN GLN A . n 
A 1 79  VAL 79  376 376 VAL VAL A . n 
A 1 80  HIS 80  377 377 HIS HIS A . n 
A 1 81  LEU 81  378 378 LEU LEU A . n 
A 1 82  LEU 82  379 379 LEU LEU A . n 
A 1 83  GLU 83  380 380 GLU GLU A . n 
A 1 84  CYS 84  381 381 CYS CYS A . n 
A 1 85  ALA 85  382 382 ALA ALA A . n 
A 1 86  TRP 86  383 383 TRP TRP A . n 
A 1 87  LEU 87  384 384 LEU LEU A . n 
A 1 88  GLU 88  385 385 GLU GLU A . n 
A 1 89  ILE 89  386 386 ILE ILE A . n 
A 1 90  LEU 90  387 387 LEU LEU A . n 
A 1 91  MET 91  388 388 MET MET A . n 
A 1 92  ILE 92  389 389 ILE ILE A . n 
A 1 93  GLY 93  390 390 GLY GLY A . n 
A 1 94  LEU 94  391 391 LEU LEU A . n 
A 1 95  VAL 95  392 392 VAL VAL A . n 
A 1 96  TRP 96  393 393 TRP TRP A . n 
A 1 97  ARG 97  394 394 ARG ARG A . n 
A 1 98  SER 98  395 395 SER SER A . n 
A 1 99  MET 99  396 396 MET MET A . n 
A 1 100 GLU 100 397 397 GLU GLU A . n 
A 1 101 HIS 101 398 398 HIS HIS A . n 
A 1 102 PRO 102 399 399 PRO PRO A . n 
A 1 103 GLY 103 400 400 GLY GLY A . n 
A 1 104 LYS 104 401 401 LYS LYS A . n 
A 1 105 LEU 105 402 402 LEU LEU A . n 
A 1 106 LEU 106 403 403 LEU LEU A . n 
A 1 107 PHE 107 404 404 PHE PHE A . n 
A 1 108 ALA 108 405 405 ALA ALA A . n 
A 1 109 PRO 109 406 406 PRO PRO A . n 
A 1 110 ASN 110 407 407 ASN ASN A . n 
A 1 111 LEU 111 408 408 LEU LEU A . n 
A 1 112 LEU 112 409 409 LEU LEU A . n 
A 1 113 LEU 113 410 410 LEU LEU A . n 
A 1 114 ASP 114 411 411 ASP ASP A . n 
A 1 115 ARG 115 412 412 ARG ARG A . n 
A 1 116 ASN 116 413 413 ASN ASN A . n 
A 1 117 GLN 117 414 414 GLN GLN A . n 
A 1 118 GLY 118 415 415 GLY GLY A . n 
A 1 119 LYS 119 416 416 LYS LYS A . n 
A 1 120 CYS 120 417 417 CYS CYS A . n 
A 1 121 VAL 121 418 418 VAL VAL A . n 
A 1 122 GLU 122 419 419 GLU GLU A . n 
A 1 123 GLY 123 420 420 GLY GLY A . n 
A 1 124 MET 124 421 421 MET MET A . n 
A 1 125 VAL 125 422 422 VAL VAL A . n 
A 1 126 GLU 126 423 423 GLU GLU A . n 
A 1 127 ILE 127 424 424 ILE ILE A . n 
A 1 128 PHE 128 425 425 PHE PHE A . n 
A 1 129 ASP 129 426 426 ASP ASP A . n 
A 1 130 MET 130 427 427 MET MET A . n 
A 1 131 LEU 131 428 428 LEU LEU A . n 
A 1 132 LEU 132 429 429 LEU LEU A . n 
A 1 133 ALA 133 430 430 ALA ALA A . n 
A 1 134 THR 134 431 431 THR THR A . n 
A 1 135 SER 135 432 432 SER SER A . n 
A 1 136 SER 136 433 433 SER SER A . n 
A 1 137 ARG 137 434 434 ARG ARG A . n 
A 1 138 PHE 138 435 435 PHE PHE A . n 
A 1 139 ARG 139 436 436 ARG ARG A . n 
A 1 140 MET 140 437 437 MET MET A . n 
A 1 141 MET 141 438 438 MET MET A . n 
A 1 142 ASN 142 439 439 ASN ASN A . n 
A 1 143 LEU 143 440 440 LEU LEU A . n 
A 1 144 GLN 144 441 441 GLN GLN A . n 
A 1 145 GLY 145 442 442 GLY GLY A . n 
A 1 146 GLU 146 443 443 GLU GLU A . n 
A 1 147 GLU 147 444 444 GLU GLU A . n 
A 1 148 PHE 148 445 445 PHE PHE A . n 
A 1 149 VAL 149 446 446 VAL VAL A . n 
A 1 150 CYS 150 447 447 CYS CYS A . n 
A 1 151 LEU 151 448 448 LEU LEU A . n 
A 1 152 LYS 152 449 449 LYS LYS A . n 
A 1 153 SER 153 450 450 SER SER A . n 
A 1 154 ILE 154 451 451 ILE ILE A . n 
A 1 155 ILE 155 452 452 ILE ILE A . n 
A 1 156 LEU 156 453 453 LEU LEU A . n 
A 1 157 LEU 157 454 454 LEU LEU A . n 
A 1 158 ASN 158 455 455 ASN ASN A . n 
A 1 159 SER 159 456 456 SER SER A . n 
A 1 160 GLY 160 457 457 GLY GLY A . n 
A 1 161 VAL 161 458 458 VAL VAL A . n 
A 1 162 TYR 162 459 459 TYR TYR A . n 
A 1 163 THR 163 460 460 THR THR A . n 
A 1 164 PHE 164 461 461 PHE PHE A . n 
A 1 165 LEU 165 462 ?   ?   ?   A . n 
A 1 166 SER 166 463 ?   ?   ?   A . n 
A 1 167 SER 167 464 ?   ?   ?   A . n 
A 1 168 THR 168 465 ?   ?   ?   A . n 
A 1 169 LEU 169 466 ?   ?   ?   A . n 
A 1 170 LYS 170 467 ?   ?   ?   A . n 
A 1 171 SER 171 468 ?   ?   ?   A . n 
A 1 172 LEU 172 469 ?   ?   ?   A . n 
A 1 173 GLU 173 470 ?   ?   ?   A . n 
A 1 174 GLU 174 471 ?   ?   ?   A . n 
A 1 175 LYS 175 472 472 LYS LYS A . n 
A 1 176 ASP 176 473 473 ASP ASP A . n 
A 1 177 HIS 177 474 474 HIS HIS A . n 
A 1 178 ILE 178 475 475 ILE ILE A . n 
A 1 179 HIS 179 476 476 HIS HIS A . n 
A 1 180 ARG 180 477 477 ARG ARG A . n 
A 1 181 VAL 181 478 478 VAL VAL A . n 
A 1 182 LEU 182 479 479 LEU LEU A . n 
A 1 183 ASP 183 480 480 ASP ASP A . n 
A 1 184 LYS 184 481 481 LYS LYS A . n 
A 1 185 ILE 185 482 482 ILE ILE A . n 
A 1 186 THR 186 483 483 THR THR A . n 
A 1 187 ASP 187 484 484 ASP ASP A . n 
A 1 188 THR 188 485 485 THR THR A . n 
A 1 189 LEU 189 486 486 LEU LEU A . n 
A 1 190 ILE 190 487 487 ILE ILE A . n 
A 1 191 HIS 191 488 488 HIS HIS A . n 
A 1 192 LEU 192 489 489 LEU LEU A . n 
A 1 193 MET 193 490 490 MET MET A . n 
A 1 194 ALA 194 491 491 ALA ALA A . n 
A 1 195 LYS 195 492 492 LYS LYS A . n 
A 1 196 ALA 196 493 493 ALA ALA A . n 
A 1 197 GLY 197 494 494 GLY GLY A . n 
A 1 198 LEU 198 495 495 LEU LEU A . n 
A 1 199 THR 199 496 496 THR THR A . n 
A 1 200 LEU 200 497 497 LEU LEU A . n 
A 1 201 GLN 201 498 498 GLN GLN A . n 
A 1 202 GLN 202 499 499 GLN GLN A . n 
A 1 203 GLN 203 500 500 GLN GLN A . n 
A 1 204 HIS 204 501 501 HIS HIS A . n 
A 1 205 GLN 205 502 502 GLN GLN A . n 
A 1 206 ARG 206 503 503 ARG ARG A . n 
A 1 207 LEU 207 504 504 LEU LEU A . n 
A 1 208 ALA 208 505 505 ALA ALA A . n 
A 1 209 GLN 209 506 506 GLN GLN A . n 
A 1 210 LEU 210 507 507 LEU LEU A . n 
A 1 211 LEU 211 508 508 LEU LEU A . n 
A 1 212 LEU 212 509 509 LEU LEU A . n 
A 1 213 ILE 213 510 510 ILE ILE A . n 
A 1 214 LEU 214 511 511 LEU LEU A . n 
A 1 215 SER 215 512 512 SER SER A . n 
A 1 216 HIS 216 513 513 HIS HIS A . n 
A 1 217 ILE 217 514 514 ILE ILE A . n 
A 1 218 ARG 218 515 515 ARG ARG A . n 
A 1 219 HIS 219 516 516 HIS HIS A . n 
A 1 220 MET 220 517 517 MET MET A . n 
A 1 221 SER 221 518 518 SER SER A . n 
A 1 222 ASN 222 519 519 ASN ASN A . n 
A 1 223 LYS 223 520 520 LYS LYS A . n 
A 1 224 GLY 224 521 521 GLY GLY A . n 
A 1 225 MET 225 522 522 MET MET A . n 
A 1 226 GLU 226 523 523 GLU GLU A . n 
A 1 227 HIS 227 524 524 HIS HIS A . n 
A 1 228 LEU 228 525 525 LEU LEU A . n 
A 1 229 TYR 229 526 526 TYR TYR A . n 
A 1 230 SER 230 527 527 SER SER A . n 
A 1 231 MET 231 528 528 MET MET A . n 
A 1 232 LYS 232 529 529 LYS LYS A . n 
A 1 233 CYS 233 530 530 CYS CYS A . n 
A 1 234 LYS 234 531 ?   ?   ?   A . n 
A 1 235 ASN 235 532 ?   ?   ?   A . n 
A 1 236 VAL 236 533 ?   ?   ?   A . n 
A 1 237 VAL 237 534 ?   ?   ?   A . n 
A 1 238 PRO 238 535 535 PRO PRO A . n 
A 1 239 LEU 239 536 536 LEU LEU A . n 
A 1 240 SER 240 537 537 SER SER A . n 
A 1 241 ASP 241 538 538 ASP ASP A . n 
A 1 242 LEU 242 539 539 LEU LEU A . n 
A 1 243 LEU 243 540 540 LEU LEU A . n 
A 1 244 LEU 244 541 541 LEU LEU A . n 
A 1 245 GLU 245 542 542 GLU GLU A . n 
A 1 246 MET 246 543 543 MET MET A . n 
A 1 247 LEU 247 544 544 LEU LEU A . n 
A 1 248 ASP 248 545 545 ASP ASP A . n 
A 1 249 ALA 249 546 546 ALA ALA A . n 
A 1 250 HIS 250 547 547 HIS HIS A . n 
A 1 251 ARG 251 548 548 ARG ARG A . n 
A 1 252 LEU 252 549 ?   ?   ?   A . n 
A 1 253 HIS 253 550 ?   ?   ?   A . n 
A 1 254 ALA 254 551 ?   ?   ?   A . n 
A 1 255 PRO 255 552 ?   ?   ?   A . n 
A 1 256 THR 256 553 ?   ?   ?   A . n 
A 1 257 SER 257 554 ?   ?   ?   A . n 
B 1 1   ILE 1   298 ?   ?   ?   B . n 
B 1 2   LYS 2   299 ?   ?   ?   B . n 
B 1 3   ARG 3   300 ?   ?   ?   B . n 
B 1 4   SER 4   301 ?   ?   ?   B . n 
B 1 5   LYS 5   302 ?   ?   ?   B . n 
B 1 6   LYS 6   303 ?   ?   ?   B . n 
B 1 7   ASN 7   304 ?   ?   ?   B . n 
B 1 8   SER 8   305 ?   ?   ?   B . n 
B 1 9   LEU 9   306 306 LEU LEU B . n 
B 1 10  ALA 10  307 307 ALA ALA B . n 
B 1 11  LEU 11  308 308 LEU LEU B . n 
B 1 12  SER 12  309 309 SER SER B . n 
B 1 13  LEU 13  310 310 LEU LEU B . n 
B 1 14  THR 14  311 311 THR THR B . n 
B 1 15  ALA 15  312 312 ALA ALA B . n 
B 1 16  ASP 16  313 313 ASP ASP B . n 
B 1 17  GLN 17  314 314 GLN GLN B . n 
B 1 18  MET 18  315 315 MET MET B . n 
B 1 19  VAL 19  316 316 VAL VAL B . n 
B 1 20  SER 20  317 317 SER SER B . n 
B 1 21  ALA 21  318 318 ALA ALA B . n 
B 1 22  LEU 22  319 319 LEU LEU B . n 
B 1 23  LEU 23  320 320 LEU LEU B . n 
B 1 24  ASP 24  321 321 ASP ASP B . n 
B 1 25  ALA 25  322 322 ALA ALA B . n 
B 1 26  GLU 26  323 323 GLU GLU B . n 
B 1 27  PRO 27  324 324 PRO PRO B . n 
B 1 28  PRO 28  325 325 PRO PRO B . n 
B 1 29  ILE 29  326 326 ILE ILE B . n 
B 1 30  LEU 30  327 327 LEU LEU B . n 
B 1 31  TYR 31  328 328 TYR TYR B . n 
B 1 32  SER 32  329 329 SER SER B . n 
B 1 33  GLU 33  330 330 GLU GLU B . n 
B 1 34  TYR 34  331 331 TYR TYR B . n 
B 1 35  ASP 35  332 332 ASP ASP B . n 
B 1 36  PRO 36  333 333 PRO PRO B . n 
B 1 37  THR 37  334 334 THR THR B . n 
B 1 38  ARG 38  335 335 ARG ARG B . n 
B 1 39  PRO 39  336 336 PRO PRO B . n 
B 1 40  PHE 40  337 337 PHE PHE B . n 
B 1 41  SER 41  338 338 SER SER B . n 
B 1 42  GLU 42  339 339 GLU GLU B . n 
B 1 43  ALA 43  340 340 ALA ALA B . n 
B 1 44  SER 44  341 341 SER SER B . n 
B 1 45  MET 45  342 342 MET MET B . n 
B 1 46  MET 46  343 343 MET MET B . n 
B 1 47  GLY 47  344 344 GLY GLY B . n 
B 1 48  LEU 48  345 345 LEU LEU B . n 
B 1 49  LEU 49  346 346 LEU LEU B . n 
B 1 50  THR 50  347 347 THR THR B . n 
B 1 51  ASN 51  348 348 ASN ASN B . n 
B 1 52  LEU 52  349 349 LEU LEU B . n 
B 1 53  ALA 53  350 350 ALA ALA B . n 
B 1 54  ASP 54  351 351 ASP ASP B . n 
B 1 55  ARG 55  352 352 ARG ARG B . n 
B 1 56  GLU 56  353 353 GLU GLU B . n 
B 1 57  LEU 57  354 354 LEU LEU B . n 
B 1 58  VAL 58  355 355 VAL VAL B . n 
B 1 59  HIS 59  356 356 HIS HIS B . n 
B 1 60  MET 60  357 357 MET MET B . n 
B 1 61  ILE 61  358 358 ILE ILE B . n 
B 1 62  ASN 62  359 359 ASN ASN B . n 
B 1 63  TRP 63  360 360 TRP TRP B . n 
B 1 64  ALA 64  361 361 ALA ALA B . n 
B 1 65  LYS 65  362 362 LYS LYS B . n 
B 1 66  ARG 66  363 363 ARG ARG B . n 
B 1 67  VAL 67  364 364 VAL VAL B . n 
B 1 68  PRO 68  365 365 PRO PRO B . n 
B 1 69  GLY 69  366 366 GLY GLY B . n 
B 1 70  PHE 70  367 367 PHE PHE B . n 
B 1 71  VAL 71  368 368 VAL VAL B . n 
B 1 72  ASP 72  369 369 ASP ASP B . n 
B 1 73  LEU 73  370 370 LEU LEU B . n 
B 1 74  THR 74  371 371 THR THR B . n 
B 1 75  LEU 75  372 372 LEU LEU B . n 
B 1 76  HIS 76  373 373 HIS HIS B . n 
B 1 77  ASP 77  374 374 ASP ASP B . n 
B 1 78  GLN 78  375 375 GLN GLN B . n 
B 1 79  VAL 79  376 376 VAL VAL B . n 
B 1 80  HIS 80  377 377 HIS HIS B . n 
B 1 81  LEU 81  378 378 LEU LEU B . n 
B 1 82  LEU 82  379 379 LEU LEU B . n 
B 1 83  GLU 83  380 380 GLU GLU B . n 
B 1 84  CYS 84  381 381 CYS CYS B . n 
B 1 85  ALA 85  382 382 ALA ALA B . n 
B 1 86  TRP 86  383 383 TRP TRP B . n 
B 1 87  LEU 87  384 384 LEU LEU B . n 
B 1 88  GLU 88  385 385 GLU GLU B . n 
B 1 89  ILE 89  386 386 ILE ILE B . n 
B 1 90  LEU 90  387 387 LEU LEU B . n 
B 1 91  MET 91  388 388 MET MET B . n 
B 1 92  ILE 92  389 389 ILE ILE B . n 
B 1 93  GLY 93  390 390 GLY GLY B . n 
B 1 94  LEU 94  391 391 LEU LEU B . n 
B 1 95  VAL 95  392 392 VAL VAL B . n 
B 1 96  TRP 96  393 393 TRP TRP B . n 
B 1 97  ARG 97  394 394 ARG ARG B . n 
B 1 98  SER 98  395 395 SER SER B . n 
B 1 99  MET 99  396 396 MET MET B . n 
B 1 100 GLU 100 397 397 GLU GLU B . n 
B 1 101 HIS 101 398 398 HIS HIS B . n 
B 1 102 PRO 102 399 399 PRO PRO B . n 
B 1 103 GLY 103 400 400 GLY GLY B . n 
B 1 104 LYS 104 401 401 LYS LYS B . n 
B 1 105 LEU 105 402 402 LEU LEU B . n 
B 1 106 LEU 106 403 403 LEU LEU B . n 
B 1 107 PHE 107 404 404 PHE PHE B . n 
B 1 108 ALA 108 405 405 ALA ALA B . n 
B 1 109 PRO 109 406 406 PRO PRO B . n 
B 1 110 ASN 110 407 407 ASN ASN B . n 
B 1 111 LEU 111 408 408 LEU LEU B . n 
B 1 112 LEU 112 409 409 LEU LEU B . n 
B 1 113 LEU 113 410 410 LEU LEU B . n 
B 1 114 ASP 114 411 411 ASP ASP B . n 
B 1 115 ARG 115 412 412 ARG ARG B . n 
B 1 116 ASN 116 413 413 ASN ASN B . n 
B 1 117 GLN 117 414 414 GLN GLN B . n 
B 1 118 GLY 118 415 415 GLY GLY B . n 
B 1 119 LYS 119 416 416 LYS LYS B . n 
B 1 120 CYS 120 417 417 CYS CYS B . n 
B 1 121 VAL 121 418 418 VAL VAL B . n 
B 1 122 GLU 122 419 419 GLU GLU B . n 
B 1 123 GLY 123 420 420 GLY GLY B . n 
B 1 124 MET 124 421 421 MET MET B . n 
B 1 125 VAL 125 422 422 VAL VAL B . n 
B 1 126 GLU 126 423 423 GLU GLU B . n 
B 1 127 ILE 127 424 424 ILE ILE B . n 
B 1 128 PHE 128 425 425 PHE PHE B . n 
B 1 129 ASP 129 426 426 ASP ASP B . n 
B 1 130 MET 130 427 427 MET MET B . n 
B 1 131 LEU 131 428 428 LEU LEU B . n 
B 1 132 LEU 132 429 429 LEU LEU B . n 
B 1 133 ALA 133 430 430 ALA ALA B . n 
B 1 134 THR 134 431 431 THR THR B . n 
B 1 135 SER 135 432 432 SER SER B . n 
B 1 136 SER 136 433 433 SER SER B . n 
B 1 137 ARG 137 434 434 ARG ARG B . n 
B 1 138 PHE 138 435 435 PHE PHE B . n 
B 1 139 ARG 139 436 436 ARG ARG B . n 
B 1 140 MET 140 437 437 MET MET B . n 
B 1 141 MET 141 438 438 MET MET B . n 
B 1 142 ASN 142 439 439 ASN ASN B . n 
B 1 143 LEU 143 440 440 LEU LEU B . n 
B 1 144 GLN 144 441 441 GLN GLN B . n 
B 1 145 GLY 145 442 442 GLY GLY B . n 
B 1 146 GLU 146 443 443 GLU GLU B . n 
B 1 147 GLU 147 444 444 GLU GLU B . n 
B 1 148 PHE 148 445 445 PHE PHE B . n 
B 1 149 VAL 149 446 446 VAL VAL B . n 
B 1 150 CYS 150 447 447 CYS CYS B . n 
B 1 151 LEU 151 448 448 LEU LEU B . n 
B 1 152 LYS 152 449 449 LYS LYS B . n 
B 1 153 SER 153 450 450 SER SER B . n 
B 1 154 ILE 154 451 451 ILE ILE B . n 
B 1 155 ILE 155 452 452 ILE ILE B . n 
B 1 156 LEU 156 453 453 LEU LEU B . n 
B 1 157 LEU 157 454 454 LEU LEU B . n 
B 1 158 ASN 158 455 455 ASN ASN B . n 
B 1 159 SER 159 456 456 SER SER B . n 
B 1 160 GLY 160 457 457 GLY GLY B . n 
B 1 161 VAL 161 458 458 VAL VAL B . n 
B 1 162 TYR 162 459 459 TYR TYR B . n 
B 1 163 THR 163 460 ?   ?   ?   B . n 
B 1 164 PHE 164 461 ?   ?   ?   B . n 
B 1 165 LEU 165 462 ?   ?   ?   B . n 
B 1 166 SER 166 463 ?   ?   ?   B . n 
B 1 167 SER 167 464 ?   ?   ?   B . n 
B 1 168 THR 168 465 ?   ?   ?   B . n 
B 1 169 LEU 169 466 ?   ?   ?   B . n 
B 1 170 LYS 170 467 ?   ?   ?   B . n 
B 1 171 SER 171 468 ?   ?   ?   B . n 
B 1 172 LEU 172 469 ?   ?   ?   B . n 
B 1 173 GLU 173 470 470 GLU GLU B . n 
B 1 174 GLU 174 471 471 GLU GLU B . n 
B 1 175 LYS 175 472 472 LYS LYS B . n 
B 1 176 ASP 176 473 473 ASP ASP B . n 
B 1 177 HIS 177 474 474 HIS HIS B . n 
B 1 178 ILE 178 475 475 ILE ILE B . n 
B 1 179 HIS 179 476 476 HIS HIS B . n 
B 1 180 ARG 180 477 477 ARG ARG B . n 
B 1 181 VAL 181 478 478 VAL VAL B . n 
B 1 182 LEU 182 479 479 LEU LEU B . n 
B 1 183 ASP 183 480 480 ASP ASP B . n 
B 1 184 LYS 184 481 481 LYS LYS B . n 
B 1 185 ILE 185 482 482 ILE ILE B . n 
B 1 186 THR 186 483 483 THR THR B . n 
B 1 187 ASP 187 484 484 ASP ASP B . n 
B 1 188 THR 188 485 485 THR THR B . n 
B 1 189 LEU 189 486 486 LEU LEU B . n 
B 1 190 ILE 190 487 487 ILE ILE B . n 
B 1 191 HIS 191 488 488 HIS HIS B . n 
B 1 192 LEU 192 489 489 LEU LEU B . n 
B 1 193 MET 193 490 490 MET MET B . n 
B 1 194 ALA 194 491 491 ALA ALA B . n 
B 1 195 LYS 195 492 492 LYS LYS B . n 
B 1 196 ALA 196 493 493 ALA ALA B . n 
B 1 197 GLY 197 494 494 GLY GLY B . n 
B 1 198 LEU 198 495 495 LEU LEU B . n 
B 1 199 THR 199 496 496 THR THR B . n 
B 1 200 LEU 200 497 497 LEU LEU B . n 
B 1 201 GLN 201 498 498 GLN GLN B . n 
B 1 202 GLN 202 499 499 GLN GLN B . n 
B 1 203 GLN 203 500 500 GLN GLN B . n 
B 1 204 HIS 204 501 501 HIS HIS B . n 
B 1 205 GLN 205 502 502 GLN GLN B . n 
B 1 206 ARG 206 503 503 ARG ARG B . n 
B 1 207 LEU 207 504 504 LEU LEU B . n 
B 1 208 ALA 208 505 505 ALA ALA B . n 
B 1 209 GLN 209 506 506 GLN GLN B . n 
B 1 210 LEU 210 507 507 LEU LEU B . n 
B 1 211 LEU 211 508 508 LEU LEU B . n 
B 1 212 LEU 212 509 509 LEU LEU B . n 
B 1 213 ILE 213 510 510 ILE ILE B . n 
B 1 214 LEU 214 511 511 LEU LEU B . n 
B 1 215 SER 215 512 512 SER SER B . n 
B 1 216 HIS 216 513 513 HIS HIS B . n 
B 1 217 ILE 217 514 514 ILE ILE B . n 
B 1 218 ARG 218 515 515 ARG ARG B . n 
B 1 219 HIS 219 516 516 HIS HIS B . n 
B 1 220 MET 220 517 517 MET MET B . n 
B 1 221 SER 221 518 518 SER SER B . n 
B 1 222 ASN 222 519 519 ASN ASN B . n 
B 1 223 LYS 223 520 520 LYS LYS B . n 
B 1 224 GLY 224 521 521 GLY GLY B . n 
B 1 225 MET 225 522 522 MET MET B . n 
B 1 226 GLU 226 523 523 GLU GLU B . n 
B 1 227 HIS 227 524 524 HIS HIS B . n 
B 1 228 LEU 228 525 525 LEU LEU B . n 
B 1 229 TYR 229 526 526 TYR TYR B . n 
B 1 230 SER 230 527 527 SER SER B . n 
B 1 231 MET 231 528 528 MET MET B . n 
B 1 232 LYS 232 529 529 LYS LYS B . n 
B 1 233 CYS 233 530 530 CYS CYS B . n 
B 1 234 LYS 234 531 531 LYS LYS B . n 
B 1 235 ASN 235 532 532 ASN ASN B . n 
B 1 236 VAL 236 533 533 VAL VAL B . n 
B 1 237 VAL 237 534 ?   ?   ?   B . n 
B 1 238 PRO 238 535 535 PRO PRO B . n 
B 1 239 LEU 239 536 536 LEU LEU B . n 
B 1 240 SER 240 537 537 SER SER B . n 
B 1 241 ASP 241 538 538 ASP ASP B . n 
B 1 242 LEU 242 539 539 LEU LEU B . n 
B 1 243 LEU 243 540 540 LEU LEU B . n 
B 1 244 LEU 244 541 541 LEU LEU B . n 
B 1 245 GLU 245 542 542 GLU GLU B . n 
B 1 246 MET 246 543 543 MET MET B . n 
B 1 247 LEU 247 544 544 LEU LEU B . n 
B 1 248 ASP 248 545 545 ASP ASP B . n 
B 1 249 ALA 249 546 546 ALA ALA B . n 
B 1 250 HIS 250 547 547 HIS HIS B . n 
B 1 251 ARG 251 548 548 ARG ARG B . n 
B 1 252 LEU 252 549 ?   ?   ?   B . n 
B 1 253 HIS 253 550 ?   ?   ?   B . n 
B 1 254 ALA 254 551 ?   ?   ?   B . n 
B 1 255 PRO 255 552 ?   ?   ?   B . n 
B 1 256 THR 256 553 ?   ?   ?   B . n 
B 1 257 SER 257 554 ?   ?   ?   B . n 
C 2 1   LYS 1   686 ?   ?   ?   C . n 
C 2 2   HIS 2   687 687 HIS HIS C . n 
C 2 3   LYS 3   688 688 LYS LYS C . n 
C 2 4   ILE 4   689 689 ILE ILE C . n 
C 2 5   LEU 5   690 690 LEU LEU C . n 
C 2 6   HIS 6   691 691 HIS HIS C . n 
C 2 7   ARG 7   692 692 ARG ARG C . n 
C 2 8   LEU 8   693 693 LEU LEU C . n 
C 2 9   LEU 9   694 694 LEU LEU C . n 
C 2 10  GLN 10  695 695 GLN GLN C . n 
C 2 11  ASP 11  696 696 ASP ASP C . n 
C 2 12  SER 12  697 ?   ?   ?   C . n 
C 2 13  SER 13  698 ?   ?   ?   C . n 
C 2 14  SER 14  699 ?   ?   ?   C . n 
D 2 1   LYS 1   686 ?   ?   ?   D . n 
D 2 2   HIS 2   687 687 HIS HIS D . n 
D 2 3   LYS 3   688 688 LYS LYS D . n 
D 2 4   ILE 4   689 689 ILE ILE D . n 
D 2 5   LEU 5   690 690 LEU LEU D . n 
D 2 6   HIS 6   691 691 HIS HIS D . n 
D 2 7   ARG 7   692 692 ARG ARG D . n 
D 2 8   LEU 8   693 693 LEU LEU D . n 
D 2 9   LEU 9   694 694 LEU LEU D . n 
D 2 10  GLN 10  695 695 GLN GLN D . n 
D 2 11  ASP 11  696 696 ASP ASP D . n 
D 2 12  SER 12  697 ?   ?   ?   D . n 
D 2 13  SER 13  698 ?   ?   ?   D . n 
D 2 14  SER 14  699 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 5C9 1  601 1   5C9 UNK A . 
F 3 5C9 1  602 1   5C9 UNK A . 
G 3 5C9 1  601 1   5C9 UNK B . 
H 4 HOH 1  701 53  HOH HOH A . 
H 4 HOH 2  702 92  HOH HOH A . 
H 4 HOH 3  703 16  HOH HOH A . 
H 4 HOH 4  704 31  HOH HOH A . 
H 4 HOH 5  705 88  HOH HOH A . 
H 4 HOH 6  706 33  HOH HOH A . 
H 4 HOH 7  707 29  HOH HOH A . 
H 4 HOH 8  708 23  HOH HOH A . 
H 4 HOH 9  709 52  HOH HOH A . 
H 4 HOH 10 710 20  HOH HOH A . 
H 4 HOH 11 711 3   HOH HOH A . 
H 4 HOH 12 712 77  HOH HOH A . 
H 4 HOH 13 713 26  HOH HOH A . 
H 4 HOH 14 714 90  HOH HOH A . 
H 4 HOH 15 715 57  HOH HOH A . 
H 4 HOH 16 716 47  HOH HOH A . 
H 4 HOH 17 717 6   HOH HOH A . 
H 4 HOH 18 718 81  HOH HOH A . 
H 4 HOH 19 719 18  HOH HOH A . 
H 4 HOH 20 720 84  HOH HOH A . 
H 4 HOH 21 721 101 HOH HOH A . 
H 4 HOH 22 722 49  HOH HOH A . 
H 4 HOH 23 723 7   HOH HOH A . 
H 4 HOH 24 724 79  HOH HOH A . 
H 4 HOH 25 725 37  HOH HOH A . 
H 4 HOH 26 726 40  HOH HOH A . 
H 4 HOH 27 727 46  HOH HOH A . 
H 4 HOH 28 728 27  HOH HOH A . 
H 4 HOH 29 729 12  HOH HOH A . 
H 4 HOH 30 730 2   HOH HOH A . 
H 4 HOH 31 731 11  HOH HOH A . 
H 4 HOH 32 732 61  HOH HOH A . 
H 4 HOH 33 733 82  HOH HOH A . 
H 4 HOH 34 734 85  HOH HOH A . 
H 4 HOH 35 735 58  HOH HOH A . 
H 4 HOH 36 736 15  HOH HOH A . 
H 4 HOH 37 737 54  HOH HOH A . 
H 4 HOH 38 738 78  HOH HOH A . 
H 4 HOH 39 739 25  HOH HOH A . 
H 4 HOH 40 740 107 HOH HOH A . 
H 4 HOH 41 741 42  HOH HOH A . 
H 4 HOH 42 742 50  HOH HOH A . 
H 4 HOH 43 743 98  HOH HOH A . 
H 4 HOH 44 744 65  HOH HOH A . 
H 4 HOH 45 745 76  HOH HOH A . 
H 4 HOH 46 746 87  HOH HOH A . 
H 4 HOH 47 747 93  HOH HOH A . 
H 4 HOH 48 748 66  HOH HOH A . 
H 4 HOH 49 749 109 HOH HOH A . 
H 4 HOH 50 750 97  HOH HOH A . 
H 4 HOH 51 751 38  HOH HOH A . 
I 4 HOH 1  701 104 HOH HOH B . 
I 4 HOH 2  702 75  HOH HOH B . 
I 4 HOH 3  703 17  HOH HOH B . 
I 4 HOH 4  704 64  HOH HOH B . 
I 4 HOH 5  705 22  HOH HOH B . 
I 4 HOH 6  706 19  HOH HOH B . 
I 4 HOH 7  707 60  HOH HOH B . 
I 4 HOH 8  708 34  HOH HOH B . 
I 4 HOH 9  709 95  HOH HOH B . 
I 4 HOH 10 710 59  HOH HOH B . 
I 4 HOH 11 711 55  HOH HOH B . 
I 4 HOH 12 712 5   HOH HOH B . 
I 4 HOH 13 713 24  HOH HOH B . 
I 4 HOH 14 714 67  HOH HOH B . 
I 4 HOH 15 715 39  HOH HOH B . 
I 4 HOH 16 716 48  HOH HOH B . 
I 4 HOH 17 717 1   HOH HOH B . 
I 4 HOH 18 718 4   HOH HOH B . 
I 4 HOH 19 719 30  HOH HOH B . 
I 4 HOH 20 720 36  HOH HOH B . 
I 4 HOH 21 721 43  HOH HOH B . 
I 4 HOH 22 722 41  HOH HOH B . 
I 4 HOH 23 723 45  HOH HOH B . 
I 4 HOH 24 724 51  HOH HOH B . 
I 4 HOH 25 725 10  HOH HOH B . 
I 4 HOH 26 726 13  HOH HOH B . 
I 4 HOH 27 727 63  HOH HOH B . 
I 4 HOH 28 728 32  HOH HOH B . 
I 4 HOH 29 729 35  HOH HOH B . 
I 4 HOH 30 730 21  HOH HOH B . 
I 4 HOH 31 731 44  HOH HOH B . 
I 4 HOH 32 732 89  HOH HOH B . 
I 4 HOH 33 733 62  HOH HOH B . 
I 4 HOH 34 734 103 HOH HOH B . 
I 4 HOH 35 735 70  HOH HOH B . 
I 4 HOH 36 736 8   HOH HOH B . 
I 4 HOH 37 737 99  HOH HOH B . 
I 4 HOH 38 738 102 HOH HOH B . 
I 4 HOH 39 739 68  HOH HOH B . 
I 4 HOH 40 740 56  HOH HOH B . 
I 4 HOH 41 741 80  HOH HOH B . 
I 4 HOH 42 742 14  HOH HOH B . 
I 4 HOH 43 743 74  HOH HOH B . 
I 4 HOH 44 744 105 HOH HOH B . 
I 4 HOH 45 745 73  HOH HOH B . 
I 4 HOH 46 746 71  HOH HOH B . 
I 4 HOH 47 747 91  HOH HOH B . 
I 4 HOH 48 748 94  HOH HOH B . 
I 4 HOH 49 749 96  HOH HOH B . 
I 4 HOH 50 750 100 HOH HOH B . 
I 4 HOH 51 751 108 HOH HOH B . 
I 4 HOH 52 752 72  HOH HOH B . 
I 4 HOH 53 753 69  HOH HOH B . 
I 4 HOH 54 754 9   HOH HOH B . 
I 4 HOH 55 755 106 HOH HOH B . 
I 4 HOH 56 756 83  HOH HOH B . 
I 4 HOH 57 757 28  HOH HOH B . 
J 4 HOH 1  701 86  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5280  ? 
1 MORE         -28   ? 
1 'SSA (A^2)'  19710 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2016-05-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined -1.3876  -5.0685  5.1828   0.8207 ? -0.3529 ? -0.0657 ? 0.5247  ? -0.0934 ? 0.4471 ? 1.9587 ? 
0.8419  ? -2.0564 ? 7.0436 ? -2.0915 ? 2.3979 ? 0.7501  ? -0.8911 ? 0.8063  ? 0.9754  ? -0.9354 ? -0.4674 ? -0.8829 ? 1.1283  ? 
-0.0659 ? 
2  'X-RAY DIFFRACTION' ? refined -21.6196 -30.3630 6.5043   0.9298 ? -0.3024 ? 0.2673  ? 0.7655  ? -0.0591 ? 0.6817 ? 2.4544 ? 
2.3570  ? 2.1589  ? 4.4947 ? 2.6930  ? 2.2874 ? -0.1316 ? -0.3792 ? -1.0309 ? -0.1597 ? -0.3798 ? -0.2162 ? 1.1372  ? -1.1083 ? 
0.4156  ? 
3  'X-RAY DIFFRACTION' ? refined -15.7936 -18.5480 -1.1194  0.2985 ? -0.0029 ? 0.0201  ? 0.2316  ? -0.0114 ? 0.2362 ? 4.0922 ? 
0.8578  ? -2.0304 ? 4.4624 ? -1.3294 ? 4.3767 ? 0.1284  ? -0.0236 ? 0.3618  ? 0.1504  ? 0.0330  ? 0.2397  ? -0.0268 ? -0.3055 ? 
-0.0790 ? 
4  'X-RAY DIFFRACTION' ? refined -8.0798  -27.6600 -4.2256  0.5166 ? -0.0129 ? 0.0725  ? 0.2562  ? 0.0048  ? 0.2319 ? 3.4522 ? 
0.4931  ? -0.8339 ? 4.4564 ? -0.7205 ? 3.6131 ? -0.1046 ? -0.0568 ? -0.6050 ? 0.0450  ? -0.0697 ? -0.0894 ? 0.8541  ? 0.1596  ? 
0.1580  ? 
5  'X-RAY DIFFRACTION' ? refined -10.5163 -5.8756  -15.1954 0.9015 ? 0.0605  ? 0.1339  ? 0.8546  ? 0.0904  ? 0.6970 ? 8.5983 ? 
4.9630  ? -1.0781 ? 4.7875 ? -1.3006 ? 1.8908 ? 0.0824  ? 1.2535  ? 1.0725  ? -1.2784 ? 1.0318  ? -0.2813 ? -0.9640 ? -0.3222 ? 
-0.8892 ? 
6  'X-RAY DIFFRACTION' ? refined -1.4410  -15.8339 -8.1620  0.3608 ? -0.0107 ? 0.0168  ? 0.2665  ? 0.0239  ? 0.1834 ? 5.3491 ? 
1.3142  ? 0.0990  ? 2.3233 ? 0.1502  ? 4.9646 ? 0.2880  ? -0.3016 ? -0.0557 ? 0.1747  ? -0.2982 ? -0.2110 ? -0.0753 ? 0.4447  ? 
0.0707  ? 
7  'X-RAY DIFFRACTION' ? refined -27.6348 -17.6681 -9.3690  0.6705 ? -0.0356 ? -0.0008 ? 0.8114  ? -0.0584 ? 0.6592 ? 2.4858 ? 
1.8963  ? -0.5080 ? 2.3720 ? 1.1251  ? 5.4211 ? 0.3550  ? 0.8254  ? -0.7406 ? -0.0928 ? -0.4512 ? 1.3590  ? 0.3020  ? -2.2749 ? 
0.3156  ? 
8  'X-RAY DIFFRACTION' ? refined 3.9871   -17.4441 -35.3236 0.2438 ? 0.0431  ? 0.1440  ? 0.4915  ? 0.0605  ? 0.3093 ? 4.8461 ? 
0.6312  ? -0.1885 ? 3.5128 ? -0.8268 ? 5.0092 ? 0.1768  ? 0.7184  ? -0.6008 ? -0.4869 ? 0.1215  ? -0.1417 ? -0.0830 ? 0.8554  ? 
-0.1196 ? 
9  'X-RAY DIFFRACTION' ? refined -5.4074  -22.4011 -37.3175 0.4685 ? -0.1093 ? 0.0858  ? 0.3898  ? 0.0107  ? 0.2685 ? 2.3647 ? 
-1.2676 ? -0.2042 ? 6.8342 ? -0.7510 ? 7.1067 ? -0.4270 ? 0.7896  ? -0.2761 ? -0.5037 ? 0.2727  ? 0.1533  ? 0.8686  ? -0.4516 ? 
0.0623  ? 
10 'X-RAY DIFFRACTION' ? refined -1.5193  -20.4236 -29.2904 0.4373 ? -0.0141 ? 0.0608  ? 0.2197  ? -0.0034 ? 0.2274 ? 2.9928 ? 
-1.1939 ? -0.2562 ? 4.4011 ? -0.6782 ? 4.6808 ? -0.2211 ? 0.1338  ? -0.2513 ? 0.1683  ? 0.0195  ? -0.1205 ? 0.4389  ? 0.1337  ? 
0.1252  ? 
11 'X-RAY DIFFRACTION' ? refined -17.1864 -7.6856  -34.7743 0.4116 ? 0.4222  ? 0.1173  ? 1.4908  ? 0.5365  ? 0.7303 ? 2.3206 ? 
-0.7012 ? -2.5678 ? 4.6820 ? 3.1608  ? 4.0867 ? -0.5071 ? 0.0443  ? 0.0973  ? 0.2961  ? 0.4241  ? 1.7619  ? -0.8357 ? -1.7332 ? 
-0.7589 ? 
12 'X-RAY DIFFRACTION' ? refined -1.2542  -11.1420 -24.1220 0.3387 ? 0.0072  ? 0.0041  ? 0.2476  ? 0.0288  ? 0.1772 ? 6.2996 ? 
-0.9318 ? 0.4358  ? 5.3752 ? -1.4751 ? 7.3298 ? -0.1384 ? 0.0293  ? 0.3161  ? 0.3184  ? 0.1086  ? 0.2157  ? -0.6779 ? 0.0771  ? 
-0.0275 ? 
13 'X-RAY DIFFRACTION' ? refined 1.4327   -32.9019 -14.5924 1.6497 ? 0.3108  ? 0.0256  ? 1.1217  ? 0.1598  ? 0.6544 ? 7.9450 ? 
-3.3779 ? 2.9753  ? 5.6535 ? -4.4913 ? 6.0156 ? 0.0277  ? -1.5145 ? -0.3239 ? 1.2901  ? 0.3935  ? -1.0696 ? 0.4852  ? -0.1625 ? 
-0.0150 ? 
14 'X-RAY DIFFRACTION' ? refined 1.8226   -16.4129 -18.1870 0.2883 ? 0.0237  ? 0.0014  ? 0.2383  ? 0.0375  ? 0.1779 ? 5.7979 ? 
1.2350  ? -0.5118 ? 2.6632 ? 0.0256  ? 6.5250 ? -0.1160 ? 0.0996  ? 0.2295  ? 0.2039  ? -0.0778 ? -0.0630 ? 0.0496  ? 0.6553  ? 
0.1211  ? 
15 'X-RAY DIFFRACTION' ? refined -14.2725 -30.0289 -33.4752 0.9453 ? -0.3456 ? -0.1271 ? 0.6231  ? -0.0582 ? 0.7810 ? 8.5217 ? 
-1.8217 ? -0.8262 ? 9.8047 ? -0.5542 ? 8.8796 ? -0.0236 ? 0.2840  ? -0.2538 ? 0.7293  ? -0.2593 ? 1.8438  ? 0.7982  ? -1.1589 ? 
0.0525  ? 
16 'X-RAY DIFFRACTION' ? refined -25.7666 -5.6072  -1.4032  0.6443 ? 0.1959  ? 0.2053  ? 0.6133  ? 0.1091  ? 0.7363 ? 5.7637 ? 
5.1615  ? 5.9070  ? 4.6262 ? 5.2936  ? 6.0481 ? 0.7125  ? -0.3167 ? 2.1325  ? 0.0039  ? -0.6128 ? 0.4586  ? -0.9193 ? -1.4943 ? 
0.3975  ? 
17 'X-RAY DIFFRACTION' ? refined -1.0464  -37.6079 -34.9368 1.5420 ? 0.1221  ? 0.1959  ? -0.2050 ? -0.7040 ? 0.0128 ? 3.9417 ? 
3.9029  ? 3.4403  ? 5.2198 ? 2.2197  ? 4.0086 ? -0.2643 ? 0.9362  ? -1.3860 ? -0.4579 ? 0.4646  ? -0.4886 ? 1.0918  ? 0.4308  ? 
-0.6160 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? A 305 ? ? A 322 ? 
;chain 'A' and (resid 305:322)
;
2  'X-RAY DIFFRACTION' 2  ? ? A 323 ? ? A 338 ? 
;chain 'A' and (resid 323:338)
;
3  'X-RAY DIFFRACTION' 3  ? ? A 339 ? ? A 407 ? 
;chain 'A' and (resid 339:407)
;
4  'X-RAY DIFFRACTION' 4  ? ? A 408 ? ? A 455 ? 
;chain 'A' and (resid 408:455)
;
5  'X-RAY DIFFRACTION' 5  ? ? A 456 ? ? A 472 ? 
;chain 'A' and (resid 456:472)
;
6  'X-RAY DIFFRACTION' 6  ? ? A 473 ? ? A 528 ? 
;chain 'A' and (resid 473:528)
;
7  'X-RAY DIFFRACTION' 7  ? ? A 529 ? ? A 548 ? 
;chain 'A' and (resid 529:548)
;
8  'X-RAY DIFFRACTION' 8  ? ? B 306 ? ? B 338 ? 
;chain 'B' and (resid 306:338)
;
9  'X-RAY DIFFRACTION' 9  ? ? B 339 ? ? B 363 ? 
;chain 'B' and (resid 339:363)
;
10 'X-RAY DIFFRACTION' 10 ? ? B 364 ? ? B 407 ? 
;chain 'B' and (resid 364:407)
;
11 'X-RAY DIFFRACTION' 11 ? ? B 408 ? ? B 421 ? 
;chain 'B' and (resid 408:421)
;
12 'X-RAY DIFFRACTION' 12 ? ? B 422 ? ? B 455 ? 
;chain 'B' and (resid 422:455)
;
13 'X-RAY DIFFRACTION' 13 ? ? B 456 ? ? B 472 ? 
;chain 'B' and (resid 456:472)
;
14 'X-RAY DIFFRACTION' 14 ? ? B 473 ? ? B 530 ? 
;chain 'B' and (resid 473:530)
;
15 'X-RAY DIFFRACTION' 15 ? ? B 531 ? ? B 548 ? 
;chain 'B' and (resid 531:548)
;
16 'X-RAY DIFFRACTION' 16 ? ? C 687 ? ? C 696 ? 
;chain 'C' and (resid 687:696)
;
17 'X-RAY DIFFRACTION' 17 ? ? D 687 ? ? D 696 ? 
;chain 'D' and (resid 687:696)
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 734 ? ? O   B HOH 753 ? ? 2.00 
2 1 OE1 A GLU 542 ? ? O   A HOH 701 ? ? 2.06 
3 1 CE  B MET 528 ? ? C30 B 5C9 601 ? A 2.09 
4 1 OD1 B ASP 351 ? ? O   B HOH 701 ? ? 2.12 
5 1 O   B HOH 735 ? ? O   B HOH 739 ? ? 2.13 
6 1 SG  B CYS 381 ? ? O   A HOH 750 ? ? 2.17 
7 1 OG  B SER 456 ? ? O   B HOH 702 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 331 ? ? -37.32 134.13 
2 1 GLU A 419 ? ? -49.35 106.81 
3 1 LEU A 536 ? ? 65.17  125.14 
4 1 HIS A 547 ? ? -98.15 47.84  
5 1 GLU B 471 ? ? -98.12 41.21  
6 1 ASP B 473 ? ? 177.34 -43.02 
7 1 ASN B 532 ? ? 63.36  -36.91 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 306 ? CG  ? A LEU 9   CG  
2  1 Y 1 A LEU 306 ? CD1 ? A LEU 9   CD1 
3  1 Y 1 A LEU 306 ? CD2 ? A LEU 9   CD2 
4  1 Y 1 A ARG 335 ? CG  ? A ARG 38  CG  
5  1 Y 1 A ARG 335 ? CD  ? A ARG 38  CD  
6  1 Y 1 A ARG 335 ? NE  ? A ARG 38  NE  
7  1 Y 1 A ARG 335 ? CZ  ? A ARG 38  CZ  
8  1 Y 1 A ARG 335 ? NH1 ? A ARG 38  NH1 
9  1 Y 1 A ARG 335 ? NH2 ? A ARG 38  NH2 
10 1 Y 1 A GLU 423 ? CG  ? A GLU 126 CG  
11 1 Y 1 A GLU 423 ? CD  ? A GLU 126 CD  
12 1 Y 1 A GLU 423 ? OE1 ? A GLU 126 OE1 
13 1 Y 1 A GLU 423 ? OE2 ? A GLU 126 OE2 
14 1 Y 1 A HIS 524 ? CG  ? A HIS 227 CG  
15 1 Y 1 A HIS 524 ? ND1 ? A HIS 227 ND1 
16 1 Y 1 A HIS 524 ? CD2 ? A HIS 227 CD2 
17 1 Y 1 A HIS 524 ? CE1 ? A HIS 227 CE1 
18 1 Y 1 A HIS 524 ? NE2 ? A HIS 227 NE2 
19 1 Y 1 A LYS 529 ? CG  ? A LYS 232 CG  
20 1 Y 1 A LYS 529 ? CD  ? A LYS 232 CD  
21 1 Y 1 A LYS 529 ? CE  ? A LYS 232 CE  
22 1 Y 1 A LYS 529 ? NZ  ? A LYS 232 NZ  
23 1 Y 1 A ARG 548 ? CG  ? A ARG 251 CG  
24 1 Y 1 A ARG 548 ? CD  ? A ARG 251 CD  
25 1 Y 1 A ARG 548 ? NE  ? A ARG 251 NE  
26 1 Y 1 A ARG 548 ? CZ  ? A ARG 251 CZ  
27 1 Y 1 A ARG 548 ? NH1 ? A ARG 251 NH1 
28 1 Y 1 A ARG 548 ? NH2 ? A ARG 251 NH2 
29 1 Y 1 B LEU 306 ? CG  ? B LEU 9   CG  
30 1 Y 1 B LEU 306 ? CD1 ? B LEU 9   CD1 
31 1 Y 1 B LEU 306 ? CD2 ? B LEU 9   CD2 
32 1 Y 1 B ARG 335 ? CG  ? B ARG 38  CG  
33 1 Y 1 B ARG 335 ? CD  ? B ARG 38  CD  
34 1 Y 1 B ARG 335 ? NE  ? B ARG 38  NE  
35 1 Y 1 B ARG 335 ? CZ  ? B ARG 38  CZ  
36 1 Y 1 B ARG 335 ? NH1 ? B ARG 38  NH1 
37 1 Y 1 B ARG 335 ? NH2 ? B ARG 38  NH2 
38 1 Y 1 B PHE 337 ? CG  ? B PHE 40  CG  
39 1 Y 1 B PHE 337 ? CD1 ? B PHE 40  CD1 
40 1 Y 1 B PHE 337 ? CD2 ? B PHE 40  CD2 
41 1 Y 1 B PHE 337 ? CE1 ? B PHE 40  CE1 
42 1 Y 1 B PHE 337 ? CE2 ? B PHE 40  CE2 
43 1 Y 1 B PHE 337 ? CZ  ? B PHE 40  CZ  
44 1 Y 1 B GLU 419 ? CG  ? B GLU 122 CG  
45 1 Y 1 B GLU 419 ? CD  ? B GLU 122 CD  
46 1 Y 1 B GLU 419 ? OE1 ? B GLU 122 OE1 
47 1 Y 1 B GLU 419 ? OE2 ? B GLU 122 OE2 
48 1 Y 1 B LYS 472 ? CG  ? B LYS 175 CG  
49 1 Y 1 B LYS 472 ? CD  ? B LYS 175 CD  
50 1 Y 1 B LYS 472 ? CE  ? B LYS 175 CE  
51 1 Y 1 B LYS 472 ? NZ  ? B LYS 175 NZ  
52 1 Y 1 B ARG 477 ? CG  ? B ARG 180 CG  
53 1 Y 1 B ARG 477 ? CD  ? B ARG 180 CD  
54 1 Y 1 B ARG 477 ? NE  ? B ARG 180 NE  
55 1 Y 1 B ARG 477 ? CZ  ? B ARG 180 CZ  
56 1 Y 1 B ARG 477 ? NH1 ? B ARG 180 NH1 
57 1 Y 1 B ARG 477 ? NH2 ? B ARG 180 NH2 
58 1 Y 1 B LYS 481 ? CG  ? B LYS 184 CG  
59 1 Y 1 B LYS 481 ? CD  ? B LYS 184 CD  
60 1 Y 1 B LYS 481 ? CE  ? B LYS 184 CE  
61 1 Y 1 B LYS 481 ? NZ  ? B LYS 184 NZ  
62 1 Y 1 B HIS 524 ? CG  ? B HIS 227 CG  
63 1 Y 1 B HIS 524 ? ND1 ? B HIS 227 ND1 
64 1 Y 1 B HIS 524 ? CD2 ? B HIS 227 CD2 
65 1 Y 1 B HIS 524 ? CE1 ? B HIS 227 CE1 
66 1 Y 1 B HIS 524 ? NE2 ? B HIS 227 NE2 
67 1 Y 1 B TYR 526 ? CG  ? B TYR 229 CG  
68 1 Y 1 B TYR 526 ? CD1 ? B TYR 229 CD1 
69 1 Y 1 B TYR 526 ? CD2 ? B TYR 229 CD2 
70 1 Y 1 B TYR 526 ? CE1 ? B TYR 229 CE1 
71 1 Y 1 B TYR 526 ? CE2 ? B TYR 229 CE2 
72 1 Y 1 B TYR 526 ? CZ  ? B TYR 229 CZ  
73 1 Y 1 B TYR 526 ? OH  ? B TYR 229 OH  
74 1 Y 1 B LYS 531 ? CG  ? B LYS 234 CG  
75 1 Y 1 B LYS 531 ? CD  ? B LYS 234 CD  
76 1 Y 1 B LYS 531 ? CE  ? B LYS 234 CE  
77 1 Y 1 B LYS 531 ? NZ  ? B LYS 234 NZ  
78 1 Y 1 B ASN 532 ? CG  ? B ASN 235 CG  
79 1 Y 1 B ASN 532 ? OD1 ? B ASN 235 OD1 
80 1 Y 1 B ASN 532 ? ND2 ? B ASN 235 ND2 
81 1 Y 1 B ARG 548 ? CG  ? B ARG 251 CG  
82 1 Y 1 B ARG 548 ? CD  ? B ARG 251 CD  
83 1 Y 1 B ARG 548 ? NE  ? B ARG 251 NE  
84 1 Y 1 B ARG 548 ? CZ  ? B ARG 251 CZ  
85 1 Y 1 B ARG 548 ? NH1 ? B ARG 251 NH1 
86 1 Y 1 B ARG 548 ? NH2 ? B ARG 251 NH2 
87 1 Y 1 C HIS 687 ? CG  ? C HIS 2   CG  
88 1 Y 1 C HIS 687 ? ND1 ? C HIS 2   ND1 
89 1 Y 1 C HIS 687 ? CD2 ? C HIS 2   CD2 
90 1 Y 1 C HIS 687 ? CE1 ? C HIS 2   CE1 
91 1 Y 1 C HIS 687 ? NE2 ? C HIS 2   NE2 
92 1 Y 1 D HIS 687 ? CG  ? D HIS 2   CG  
93 1 Y 1 D HIS 687 ? ND1 ? D HIS 2   ND1 
94 1 Y 1 D HIS 687 ? CD2 ? D HIS 2   CD2 
95 1 Y 1 D HIS 687 ? CE1 ? D HIS 2   CE1 
96 1 Y 1 D HIS 687 ? NE2 ? D HIS 2   NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ILE 298 ? A ILE 1   
2  1 Y 1 A LYS 299 ? A LYS 2   
3  1 Y 1 A ARG 300 ? A ARG 3   
4  1 Y 1 A SER 301 ? A SER 4   
5  1 Y 1 A LYS 302 ? A LYS 5   
6  1 Y 1 A LYS 303 ? A LYS 6   
7  1 Y 1 A ASN 304 ? A ASN 7   
8  1 Y 1 A LEU 462 ? A LEU 165 
9  1 Y 1 A SER 463 ? A SER 166 
10 1 Y 1 A SER 464 ? A SER 167 
11 1 Y 1 A THR 465 ? A THR 168 
12 1 Y 1 A LEU 466 ? A LEU 169 
13 1 Y 1 A LYS 467 ? A LYS 170 
14 1 Y 1 A SER 468 ? A SER 171 
15 1 Y 1 A LEU 469 ? A LEU 172 
16 1 Y 1 A GLU 470 ? A GLU 173 
17 1 Y 1 A GLU 471 ? A GLU 174 
18 1 Y 1 A LYS 531 ? A LYS 234 
19 1 Y 1 A ASN 532 ? A ASN 235 
20 1 Y 1 A VAL 533 ? A VAL 236 
21 1 Y 1 A VAL 534 ? A VAL 237 
22 1 Y 1 A LEU 549 ? A LEU 252 
23 1 Y 1 A HIS 550 ? A HIS 253 
24 1 Y 1 A ALA 551 ? A ALA 254 
25 1 Y 1 A PRO 552 ? A PRO 255 
26 1 Y 1 A THR 553 ? A THR 256 
27 1 Y 1 A SER 554 ? A SER 257 
28 1 Y 1 B ILE 298 ? B ILE 1   
29 1 Y 1 B LYS 299 ? B LYS 2   
30 1 Y 1 B ARG 300 ? B ARG 3   
31 1 Y 1 B SER 301 ? B SER 4   
32 1 Y 1 B LYS 302 ? B LYS 5   
33 1 Y 1 B LYS 303 ? B LYS 6   
34 1 Y 1 B ASN 304 ? B ASN 7   
35 1 Y 1 B SER 305 ? B SER 8   
36 1 Y 1 B THR 460 ? B THR 163 
37 1 Y 1 B PHE 461 ? B PHE 164 
38 1 Y 1 B LEU 462 ? B LEU 165 
39 1 Y 1 B SER 463 ? B SER 166 
40 1 Y 1 B SER 464 ? B SER 167 
41 1 Y 1 B THR 465 ? B THR 168 
42 1 Y 1 B LEU 466 ? B LEU 169 
43 1 Y 1 B LYS 467 ? B LYS 170 
44 1 Y 1 B SER 468 ? B SER 171 
45 1 Y 1 B LEU 469 ? B LEU 172 
46 1 Y 1 B VAL 534 ? B VAL 237 
47 1 Y 1 B LEU 549 ? B LEU 252 
48 1 Y 1 B HIS 550 ? B HIS 253 
49 1 Y 1 B ALA 551 ? B ALA 254 
50 1 Y 1 B PRO 552 ? B PRO 255 
51 1 Y 1 B THR 553 ? B THR 256 
52 1 Y 1 B SER 554 ? B SER 257 
53 1 Y 1 C LYS 686 ? C LYS 1   
54 1 Y 1 C SER 697 ? C SER 12  
55 1 Y 1 C SER 698 ? C SER 13  
56 1 Y 1 C SER 699 ? C SER 14  
57 1 Y 1 D LYS 686 ? D LYS 1   
58 1 Y 1 D SER 697 ? D SER 12  
59 1 Y 1 D SER 698 ? D SER 13  
60 1 Y 1 D SER 699 ? D SER 14  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "4,4'-(2-{3-[(3-methylphenyl)amino]phenyl}but-1-ene-1,1-diyl)diphenol" 5C9 
4 water                                                                  HOH 
#