data_5DKD
# 
_entry.id   5DKD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DKD         
WWPDB D_1000213340 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DKD 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-03 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.pdbx_ordinal 
_audit_author.name 
1  'Tallant, C.'         
2  'Owen, D.R.'          
3  'Gerstenberger, B.S.' 
4  'Fedorov, O.'         
5  'Savitsky, P.'        
6  'Nunez-Alonso, G.'    
7  'Newman, J.A.'        
8  'Filippakopoulos, P.' 
9  'Burgess-Brown, N.'   
10 'von Delft, F.'       
11 'Arrowsmith, C.H.'    
12 'Edwards, A.M.'       
13 'Bountra, C.'         
14 'Muller, S.'          
15 'Knapp, S.'           
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Crystal structure of the bromodomain of human BRG1 (SMARCA4) in complex with PFI-3 chemical probe' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tallant, C.'         1  
primary 'Owen, D.R.'          2  
primary 'Gerstenberger, B.S.' 3  
primary 'Fedorov, O.'         4  
primary 'Savitsky, P.'        5  
primary 'Nunez-Alonso, G.'    6  
primary 'Newman, J.A.'        7  
primary 'Filippakopoulos, P.' 8  
primary 'Burgess-Brown, N.'   9  
primary 'von Delft, F.'       10 
primary 'Arrowsmith, C.H.'    11 
primary 'Edwards, A.M.'       12 
primary 'Bountra, C.'         13 
primary 'Muller, S.'          14 
primary 'Knapp, S.'           15 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   109.90 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5DKD 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     45.926 
_cell.length_a_esd                 ? 
_cell.length_b                     74.566 
_cell.length_b_esd                 ? 
_cell.length_c                     52.626 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5DKD 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcription activator BRG1'                                                                          
14230.447 2   3.6.4.- ? 'UNP residues 1418-1536' ? 
2 non-polymer syn 'ZINC ION'                                                                                              65.409 2 
?       ? ?                        ? 
3 non-polymer syn 1,2-ETHANEDIOL                                                                                          62.068 6 
?       ? ?                        ? 
4 non-polymer syn '(2E)-1-(2-hydroxyphenyl)-3-[(1R,4R)-5-(pyridin-2-yl)-2,5-diazabicyclo[2.2.1]hept-2-yl]prop-2-en-1-one' 321.373 
2   ?       ? ?                        ? 
5 water       nat water                                                                                                   18.015 
101 ?       ? ?                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ATP-dependent helicase SMARCA4,BRG1-associated factor 190A,BAF190A,Mitotic growth and transcription activator,Protein BRG-1,Protein brahma homolog 1,SNF2-beta,SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKD
VMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKD
VMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   LEU n 
1 4   SER n 
1 5   PRO n 
1 6   ASN n 
1 7   PRO n 
1 8   PRO n 
1 9   ASN n 
1 10  LEU n 
1 11  THR n 
1 12  LYS n 
1 13  LYS n 
1 14  MET n 
1 15  LYS n 
1 16  LYS n 
1 17  ILE n 
1 18  VAL n 
1 19  ASP n 
1 20  ALA n 
1 21  VAL n 
1 22  ILE n 
1 23  LYS n 
1 24  TYR n 
1 25  LYS n 
1 26  ASP n 
1 27  SER n 
1 28  SER n 
1 29  SER n 
1 30  GLY n 
1 31  ARG n 
1 32  GLN n 
1 33  LEU n 
1 34  SER n 
1 35  GLU n 
1 36  VAL n 
1 37  PHE n 
1 38  ILE n 
1 39  GLN n 
1 40  LEU n 
1 41  PRO n 
1 42  SER n 
1 43  ARG n 
1 44  LYS n 
1 45  GLU n 
1 46  LEU n 
1 47  PRO n 
1 48  GLU n 
1 49  TYR n 
1 50  TYR n 
1 51  GLU n 
1 52  LEU n 
1 53  ILE n 
1 54  ARG n 
1 55  LYS n 
1 56  PRO n 
1 57  VAL n 
1 58  ASP n 
1 59  PHE n 
1 60  LYS n 
1 61  LYS n 
1 62  ILE n 
1 63  LYS n 
1 64  GLU n 
1 65  ARG n 
1 66  ILE n 
1 67  ARG n 
1 68  ASN n 
1 69  HIS n 
1 70  LYS n 
1 71  TYR n 
1 72  ARG n 
1 73  SER n 
1 74  LEU n 
1 75  ASN n 
1 76  ASP n 
1 77  LEU n 
1 78  GLU n 
1 79  LYS n 
1 80  ASP n 
1 81  VAL n 
1 82  MET n 
1 83  LEU n 
1 84  LEU n 
1 85  CYS n 
1 86  GLN n 
1 87  ASN n 
1 88  ALA n 
1 89  GLN n 
1 90  THR n 
1 91  PHE n 
1 92  ASN n 
1 93  LEU n 
1 94  GLU n 
1 95  GLY n 
1 96  SER n 
1 97  LEU n 
1 98  ILE n 
1 99  TYR n 
1 100 GLU n 
1 101 ASP n 
1 102 SER n 
1 103 ILE n 
1 104 VAL n 
1 105 LEU n 
1 106 GLN n 
1 107 SER n 
1 108 VAL n 
1 109 PHE n 
1 110 THR n 
1 111 SER n 
1 112 VAL n 
1 113 ARG n 
1 114 GLN n 
1 115 LYS n 
1 116 ILE n 
1 117 GLU n 
1 118 LYS n 
1 119 GLU n 
1 120 ASP n 
1 121 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   121 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SMARCA4, BAF190A, BRG1, SNF2B, SNF2L4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SMCA4_HUMAN 
_struct_ref.pdbx_db_accession          P51532 
_struct_ref.pdbx_db_isoform            P51532-2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVM
LLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD
;
_struct_ref.pdbx_align_begin           1418 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DKD A 3 ? 121 ? P51532 1418 ? 1536 ? 1451 1569 
2 1 5DKD B 3 ? 121 ? P51532 1418 ? 1536 ? 1451 1569 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DKD SER A 1 ? UNP P51532 ? ? 'expression tag' 1449 1 
1 5DKD MET A 2 ? UNP P51532 ? ? 'expression tag' 1450 2 
2 5DKD SER B 1 ? UNP P51532 ? ? 'expression tag' 1449 3 
2 5DKD MET B 2 ? UNP P51532 ? ? 'expression tag' 1450 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5BW non-polymer         . '(2E)-1-(2-hydroxyphenyl)-3-[(1R,4R)-5-(pyridin-2-yl)-2,5-diazabicyclo[2.2.1]hept-2-yl]prop-2-en-1-one' 
?                 'C19 H19 N3 O2'  321.373 
ALA 'L-peptide linking' y ALANINE                                                                                                 
?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                                
?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                              
?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                         
?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                                
?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                                          
'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                                               
?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                         
?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                 
?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                               
?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                                   
?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                              
?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                 
?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                  
?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                              
?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                           
?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                 
?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                                  
?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                               
?                 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                                                                                                
?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                                  
?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                                                                                              
?                 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DKD 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.98 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.78 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M Bis Tris pH 7.2, 0.1 M ammonium acetate, 0.1 M ZnCl2, 15% PEG smear high (mixture from PEG8k to 20k)' 
_exptl_crystal_grow.pdbx_pH_range   7.2 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-04-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9207 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9207 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DKD 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.00 
_reflns.d_resolution_low                 29.78 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       21859 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.5 
_reflns.pdbx_Rmerge_I_obs                0.076 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.054 
_reflns.pdbx_netI_over_av_sigmaI         9.8 
_reflns.pdbx_netI_over_sigmaI            9.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        95.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.304 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            2.12 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.16 
_refine.aniso_B[2][2]                            -1.20 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -0.82 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               32.200 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.849 
_refine.correlation_coeff_Fo_to_Fc_free          0.829 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5DKD 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.00 
_refine.ls_d_res_low                             29.78 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20159 
_refine.ls_number_reflns_R_free                  1027 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.85 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.26920 
_refine.ls_R_factor_R_free                       0.29729 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.26773 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3UVD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.226 
_refine.pdbx_overall_ESU_R_Free                  0.195 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             9.907 
_refine.overall_SU_ML                            0.153 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1827 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         74 
_refine_hist.number_atoms_solvent             101 
_refine_hist.number_atoms_total               2002 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        29.78 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.015  0.020  1923 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  1954 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.741  2.029  2563 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.246  3.006  4508 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.168  5.000  218  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 31.766 24.419 86   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.667 15.000 401  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.155 15.000 14   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.107  0.200  286  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.009  0.020  2052 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  420  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.773  2.196  878  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.771  2.193  877  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.708  3.275  1094 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.707  3.279  1095 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.647  2.651  1045 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.647  2.651  1044 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.260  3.788  1470 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.897  18.104 2324 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.860  17.976 2297 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? 0.14 0.05 ? ? A 6793 'interatomic distance' 
'X-RAY DIFFRACTION' 2 1 2 ? 0.14 0.05 ? ? B 6793 'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.002 
_refine_ls_shell.d_res_low                        2.054 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_R_work             1479 
_refine_ls_shell.percent_reflns_obs               95.64 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.268 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.233 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 1457 A 1566 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 1457 B 1566 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     5DKD 
_struct.title                        
'Crystal structure of the bromodomain of human BRG1 (SMARCA4) in complex with PFI-3 chemical probe' 
_struct.pdbx_descriptor              'Transcription activator BRG1 (E.C.3.6.4.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DKD 
_struct_keywords.text            'SWI-SNF complex, chromatin remodeling, Brg associated factors (BAF), transcription, hydrolase' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 9  ? TYR A 24  ? ASN A 1457 TYR A 1472 1 ? 16 
HELX_P HELX_P2  AA2 SER A 34 ? ILE A 38  ? SER A 1482 ILE A 1486 5 ? 5  
HELX_P HELX_P3  AA3 LEU A 46 ? ILE A 53  ? LEU A 1494 ILE A 1501 1 ? 8  
HELX_P HELX_P4  AA4 ASP A 58 ? ASN A 68  ? ASP A 1506 ASN A 1516 1 ? 11 
HELX_P HELX_P5  AA5 SER A 73 ? ASN A 92  ? SER A 1521 ASN A 1540 1 ? 20 
HELX_P HELX_P6  AA6 SER A 96 ? LYS A 118 ? SER A 1544 LYS A 1566 1 ? 23 
HELX_P HELX_P7  AA7 LEU B 10 ? TYR B 24  ? LEU B 1458 TYR B 1472 1 ? 15 
HELX_P HELX_P8  AA8 SER B 34 ? ILE B 38  ? SER B 1482 ILE B 1486 5 ? 5  
HELX_P HELX_P9  AA9 LEU B 46 ? ILE B 53  ? LEU B 1494 ILE B 1501 1 ? 8  
HELX_P HELX_P10 AB1 ASP B 58 ? ASN B 68  ? ASP B 1506 ASN B 1516 1 ? 11 
HELX_P HELX_P11 AB2 SER B 73 ? ASN B 92  ? SER B 1521 ASN B 1540 1 ? 20 
HELX_P HELX_P12 AB3 SER B 96 ? LYS B 118 ? SER B 1544 LYS B 1566 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 69 ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 1517 A ZN  1601 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc2  metalc ? ? B HIS 69 ND1 ? ? ? 1_555 H ZN  . ZN ? ? B HIS 1517 B ZN  1601 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc3  metalc ? ? C ZN  .  ZN  ? ? ? 1_555 M HOH . O  ? ? A ZN  1601 A HOH 1740 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc4  metalc ? ? H ZN  .  ZN  ? ? ? 1_555 M HOH . O  ? ? B ZN  1601 A HOH 1735 1_555 ? ? ? ? ? ? ? 1.856 ? 
metalc5  metalc ? ? H ZN  .  ZN  ? ? ? 1_555 M HOH . O  ? ? B ZN  1601 A HOH 1709 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc6  metalc ? ? H ZN  .  ZN  ? ? ? 1_555 M HOH . O  ? ? B ZN  1601 A HOH 1714 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc7  metalc ? ? H ZN  .  ZN  ? ? ? 1_555 N HOH . O  ? ? B ZN  1601 B HOH 1741 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc8  metalc ? ? H ZN  .  ZN  ? ? ? 1_555 M HOH . O  ? ? B ZN  1601 A HOH 1750 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc9  metalc ? ? C ZN  .  ZN  ? ? ? 1_555 N HOH . O  ? ? A ZN  1601 B HOH 1719 1_554 ? ? ? ? ? ? ? 2.113 ? 
metalc10 metalc ? ? C ZN  .  ZN  ? ? ? 1_555 N HOH . O  ? ? A ZN  1601 B HOH 1747 1_554 ? ? ? ? ? ? ? 2.363 ? 
metalc11 metalc ? ? C ZN  .  ZN  ? ? ? 1_555 N HOH . O  ? ? A ZN  1601 B HOH 1712 1_554 ? ? ? ? ? ? ? 2.027 ? 
metalc12 metalc ? ? C ZN  .  ZN  ? ? ? 1_555 N HOH . O  ? ? A ZN  1601 B HOH 1723 1_554 ? ? ? ? ? ? ? 2.166 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  1601 ? 6 'binding site for residue ZN A 1601'  
AC2 Software A EDO 1602 ? 4 'binding site for residue EDO A 1602' 
AC3 Software A EDO 1603 ? 2 'binding site for residue EDO A 1603' 
AC4 Software A EDO 1604 ? 2 'binding site for residue EDO A 1604' 
AC5 Software A 5BW 1605 ? 9 'binding site for residue 5BW A 1605' 
AC6 Software B ZN  1601 ? 6 'binding site for residue ZN B 1601'  
AC7 Software B EDO 1602 ? 6 'binding site for residue EDO B 1602' 
AC8 Software B EDO 1603 ? 2 'binding site for residue EDO B 1603' 
AC9 Software B EDO 1604 ? 3 'binding site for residue EDO B 1604' 
AD1 Software B 5BW 1605 ? 9 'binding site for residue 5BW B 1605' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 HIS A 69 ? HIS A 1517 . ? 1_555 ? 
2  AC1 6 HOH M .  ? HOH A 1740 . ? 1_555 ? 
3  AC1 6 HOH N .  ? HOH B 1712 . ? 1_554 ? 
4  AC1 6 HOH N .  ? HOH B 1719 . ? 1_554 ? 
5  AC1 6 HOH N .  ? HOH B 1723 . ? 1_554 ? 
6  AC1 6 HOH N .  ? HOH B 1747 . ? 1_554 ? 
7  AC2 4 GLU A 64 ? GLU A 1512 . ? 1_555 ? 
8  AC2 4 ARG A 65 ? ARG A 1513 . ? 1_555 ? 
9  AC2 4 ASN A 68 ? ASN A 1516 . ? 1_555 ? 
10 AC2 4 LYS A 70 ? LYS A 1518 . ? 1_555 ? 
11 AC3 2 ASP A 58 ? ASP A 1506 . ? 1_555 ? 
12 AC3 2 LYS A 61 ? LYS A 1509 . ? 1_555 ? 
13 AC4 2 GLN A 39 ? GLN A 1487 . ? 1_555 ? 
14 AC4 2 EDO K .  ? EDO B 1604 . ? 1_554 ? 
15 AC5 9 VAL A 36 ? VAL A 1484 . ? 1_555 ? 
16 AC5 9 PHE A 37 ? PHE A 1485 . ? 1_555 ? 
17 AC5 9 LEU A 40 ? LEU A 1488 . ? 1_555 ? 
18 AC5 9 PRO A 41 ? PRO A 1489 . ? 1_555 ? 
19 AC5 9 TYR A 49 ? TYR A 1497 . ? 1_555 ? 
20 AC5 9 VAL A 57 ? VAL A 1505 . ? 1_555 ? 
21 AC5 9 ALA A 88 ? ALA A 1536 . ? 1_555 ? 
22 AC5 9 ASN A 92 ? ASN A 1540 . ? 1_555 ? 
23 AC5 9 ILE A 98 ? ILE A 1546 . ? 1_555 ? 
24 AC6 6 HOH M .  ? HOH A 1709 . ? 1_555 ? 
25 AC6 6 HOH M .  ? HOH A 1714 . ? 1_555 ? 
26 AC6 6 HOH M .  ? HOH A 1735 . ? 1_555 ? 
27 AC6 6 HOH M .  ? HOH A 1750 . ? 1_555 ? 
28 AC6 6 HIS B 69 ? HIS B 1517 . ? 1_555 ? 
29 AC6 6 HOH N .  ? HOH B 1741 . ? 1_555 ? 
30 AC7 6 ASN A 75 ? ASN A 1523 . ? 1_555 ? 
31 AC7 6 GLN B 39 ? GLN B 1487 . ? 1_555 ? 
32 AC7 6 LYS B 60 ? LYS B 1508 . ? 1_555 ? 
33 AC7 6 EDO J .  ? EDO B 1603 . ? 1_555 ? 
34 AC7 6 HOH N .  ? HOH B 1736 . ? 1_555 ? 
35 AC7 6 HOH N .  ? HOH B 1744 . ? 1_555 ? 
36 AC8 2 GLN B 39 ? GLN B 1487 . ? 1_555 ? 
37 AC8 2 EDO I .  ? EDO B 1602 . ? 1_555 ? 
38 AC9 3 EDO F .  ? EDO A 1604 . ? 1_556 ? 
39 AC9 3 ASN B 75 ? ASN B 1523 . ? 1_555 ? 
40 AC9 3 HOH N .  ? HOH B 1703 . ? 1_555 ? 
41 AD1 9 VAL B 36 ? VAL B 1484 . ? 1_555 ? 
42 AD1 9 PHE B 37 ? PHE B 1485 . ? 1_555 ? 
43 AD1 9 LEU B 40 ? LEU B 1488 . ? 1_555 ? 
44 AD1 9 PRO B 41 ? PRO B 1489 . ? 1_555 ? 
45 AD1 9 TYR B 49 ? TYR B 1497 . ? 1_555 ? 
46 AD1 9 VAL B 57 ? VAL B 1505 . ? 1_555 ? 
47 AD1 9 ALA B 88 ? ALA B 1536 . ? 1_555 ? 
48 AD1 9 ASN B 92 ? ASN B 1540 . ? 1_555 ? 
49 AD1 9 ILE B 98 ? ILE B 1546 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DKD 
_atom_sites.fract_transf_matrix[1][1]   0.021774 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007880 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013411 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020208 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 9   ? 3.109   2.477   16.232 1.00 59.26 ? 1457 ASN A N   1 
ATOM   2    C  CA  . ASN A 1 9   ? 1.941   2.307   17.173 1.00 61.49 ? 1457 ASN A CA  1 
ATOM   3    C  C   . ASN A 1 9   ? 2.292   2.446   18.666 1.00 56.09 ? 1457 ASN A C   1 
ATOM   4    O  O   . ASN A 1 9   ? 1.816   3.386   19.338 1.00 55.32 ? 1457 ASN A O   1 
ATOM   5    C  CB  . ASN A 1 9   ? 1.220   0.967   16.943 1.00 68.69 ? 1457 ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 9   ? 0.177   0.667   18.025 1.00 70.60 ? 1457 ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 9   ? -0.318  1.575   18.692 1.00 70.13 ? 1457 ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 9   ? -0.146  -0.613  18.208 1.00 70.47 ? 1457 ASN A ND2 1 
ATOM   9    N  N   . LEU A 1 10  ? 3.058   1.510   19.225 1.00 44.27 ? 1458 LEU A N   1 
ATOM   10   C  CA  . LEU A 1 10  ? 3.702   1.845   20.492 1.00 44.48 ? 1458 LEU A CA  1 
ATOM   11   C  C   . LEU A 1 10  ? 4.784   2.867   20.187 1.00 39.65 ? 1458 LEU A C   1 
ATOM   12   O  O   . LEU A 1 10  ? 4.877   3.857   20.883 1.00 38.91 ? 1458 LEU A O   1 
ATOM   13   C  CB  . LEU A 1 10  ? 4.287   0.653   21.222 1.00 44.27 ? 1458 LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 10  ? 4.440   0.962   22.717 1.00 49.43 ? 1458 LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 10  ? 3.073   1.171   23.367 1.00 51.34 ? 1458 LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 10  ? 5.215   -0.132  23.443 1.00 47.75 ? 1458 LEU A CD2 1 
ATOM   17   N  N   . THR A 1 11  ? 5.554   2.646   19.119 1.00 35.26 ? 1459 THR A N   1 
ATOM   18   C  CA  . THR A 1 11  ? 6.634   3.570   18.764 1.00 37.61 ? 1459 THR A CA  1 
ATOM   19   C  C   . THR A 1 11  ? 6.084   4.993   18.647 1.00 41.35 ? 1459 THR A C   1 
ATOM   20   O  O   . THR A 1 11  ? 6.669   5.920   19.194 1.00 40.54 ? 1459 THR A O   1 
ATOM   21   C  CB  . THR A 1 11  ? 7.391   3.122   17.491 1.00 36.12 ? 1459 THR A CB  1 
ATOM   22   O  OG1 . THR A 1 11  ? 8.067   1.883   17.764 1.00 37.16 ? 1459 THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 11  ? 8.435   4.150   17.042 1.00 37.03 ? 1459 THR A CG2 1 
ATOM   24   N  N   . LYS A 1 12  ? 4.942   5.148   17.973 1.00 41.99 ? 1460 LYS A N   1 
ATOM   25   C  CA  . LYS A 1 12  ? 4.372   6.466   17.682 1.00 40.71 ? 1460 LYS A CA  1 
ATOM   26   C  C   . LYS A 1 12  ? 3.792   7.170   18.879 1.00 36.87 ? 1460 LYS A C   1 
ATOM   27   O  O   . LYS A 1 12  ? 3.815   8.417   18.918 1.00 30.74 ? 1460 LYS A O   1 
ATOM   28   C  CB  . LYS A 1 12  ? 3.265   6.343   16.647 1.00 46.89 ? 1460 LYS A CB  1 
ATOM   29   C  CG  . LYS A 1 12  ? 2.618   7.666   16.244 1.00 50.44 ? 1460 LYS A CG  1 
ATOM   30   C  CD  . LYS A 1 12  ? 1.268   7.463   15.556 1.00 55.38 ? 1460 LYS A CD  1 
ATOM   31   C  CE  . LYS A 1 12  ? 1.235   6.290   14.574 1.00 57.95 ? 1460 LYS A CE  1 
ATOM   32   N  NZ  . LYS A 1 12  ? 2.292   6.309   13.511 1.00 59.68 ? 1460 LYS A NZ  1 
ATOM   33   N  N   . LYS A 1 13  ? 3.246   6.389   19.818 1.00 34.25 ? 1461 LYS A N   1 
ATOM   34   C  CA  . LYS A 1 13  ? 2.759   6.935   21.091 1.00 35.13 ? 1461 LYS A CA  1 
ATOM   35   C  C   . LYS A 1 13  ? 3.912   7.335   22.015 1.00 32.57 ? 1461 LYS A C   1 
ATOM   36   O  O   . LYS A 1 13  ? 3.796   8.312   22.743 1.00 30.67 ? 1461 LYS A O   1 
ATOM   37   C  CB  . LYS A 1 13  ? 1.834   5.997   21.865 1.00 39.75 ? 1461 LYS A CB  1 
ATOM   38   C  CG  . LYS A 1 13  ? 0.564   5.533   21.109 1.00 50.04 ? 1461 LYS A CG  1 
ATOM   39   C  CD  . LYS A 1 13  ? -0.352  6.624   20.567 1.00 53.43 ? 1461 LYS A CD  1 
ATOM   40   C  CE  . LYS A 1 13  ? -1.542  6.860   21.463 1.00 56.43 ? 1461 LYS A CE  1 
ATOM   41   N  NZ  . LYS A 1 13  ? -2.240  8.136   21.151 1.00 59.89 ? 1461 LYS A NZ  1 
ATOM   42   N  N   . MET A 1 14  ? 5.015   6.581   21.982 1.00 30.41 ? 1462 MET A N   1 
ATOM   43   C  CA  . MET A 1 14  ? 6.240   6.984   22.692 1.00 29.28 ? 1462 MET A CA  1 
ATOM   44   C  C   . MET A 1 14  ? 6.763   8.287   22.120 1.00 27.87 ? 1462 MET A C   1 
ATOM   45   O  O   . MET A 1 14  ? 7.058   9.214   22.865 1.00 24.34 ? 1462 MET A O   1 
ATOM   46   C  CB  . MET A 1 14  ? 7.327   5.914   22.676 1.00 27.73 ? 1462 MET A CB  1 
ATOM   47   C  CG  . MET A 1 14  ? 7.064   4.716   23.576 1.00 31.23 ? 1462 MET A CG  1 
ATOM   48   S  SD  . MET A 1 14  ? 8.297   3.429   23.229 1.00 36.62 ? 1462 MET A SD  1 
ATOM   49   C  CE  . MET A 1 14  ? 7.825   2.184   24.435 1.00 40.99 ? 1462 MET A CE  1 
ATOM   50   N  N   . LYS A 1 15  ? 6.822   8.375   20.801 1.00 29.35 ? 1463 LYS A N   1 
ATOM   51   C  CA  . LYS A 1 15  ? 7.213   9.627   20.132 1.00 32.70 ? 1463 LYS A CA  1 
ATOM   52   C  C   . LYS A 1 15  ? 6.389   10.824  20.547 1.00 33.05 ? 1463 LYS A C   1 
ATOM   53   O  O   . LYS A 1 15  ? 6.923   11.915  20.717 1.00 31.69 ? 1463 LYS A O   1 
ATOM   54   C  CB  . LYS A 1 15  ? 6.985   9.537   18.637 1.00 36.29 ? 1463 LYS A CB  1 
ATOM   55   C  CG  . LYS A 1 15  ? 8.021   8.796   17.865 1.00 41.51 ? 1463 LYS A CG  1 
ATOM   56   C  CD  . LYS A 1 15  ? 7.399   8.431   16.536 1.00 44.19 ? 1463 LYS A CD  1 
ATOM   57   C  CE  . LYS A 1 15  ? 8.265   7.543   15.700 1.00 45.76 ? 1463 LYS A CE  1 
ATOM   58   N  NZ  . LYS A 1 15  ? 7.453   6.883   14.635 1.00 50.90 ? 1463 LYS A NZ  1 
ATOM   59   N  N   . LYS A 1 16  ? 5.077   10.629  20.598 1.00 33.52 ? 1464 LYS A N   1 
ATOM   60   C  CA  . LYS A 1 16  ? 4.142   11.721  20.880 1.00 36.32 ? 1464 LYS A CA  1 
ATOM   61   C  C   . LYS A 1 16  ? 4.350   12.301  22.284 1.00 33.51 ? 1464 LYS A C   1 
ATOM   62   O  O   . LYS A 1 16  ? 4.264   13.523  22.499 1.00 29.53 ? 1464 LYS A O   1 
ATOM   63   C  CB  . LYS A 1 16  ? 2.716   11.177  20.853 1.00 39.41 ? 1464 LYS A CB  1 
ATOM   64   C  CG  . LYS A 1 16  ? 2.038   11.113  19.502 1.00 44.37 ? 1464 LYS A CG  1 
ATOM   65   C  CD  . LYS A 1 16  ? 0.519   11.108  19.696 1.00 47.03 ? 1464 LYS A CD  1 
ATOM   66   C  CE  . LYS A 1 16  ? -0.009  12.479  20.076 1.00 49.19 ? 1464 LYS A CE  1 
ATOM   67   N  NZ  . LYS A 1 16  ? -1.470  12.585  19.832 1.00 54.02 ? 1464 LYS A NZ  1 
ATOM   68   N  N   . ILE A 1 17  ? 4.498   11.383  23.239 1.00 28.56 ? 1465 ILE A N   1 
ATOM   69   C  CA  . ILE A 1 17  ? 4.732   11.710  24.629 1.00 27.85 ? 1465 ILE A CA  1 
ATOM   70   C  C   . ILE A 1 17  ? 6.088   12.487  24.769 1.00 28.41 ? 1465 ILE A C   1 
ATOM   71   O  O   . ILE A 1 17  ? 6.150   13.571  25.350 1.00 25.85 ? 1465 ILE A O   1 
ATOM   72   C  CB  . ILE A 1 17  ? 4.795   10.420  25.473 1.00 27.16 ? 1465 ILE A CB  1 
ATOM   73   C  CG1 . ILE A 1 17  ? 3.413   9.771   25.585 1.00 28.92 ? 1465 ILE A CG1 1 
ATOM   74   C  CG2 . ILE A 1 17  ? 5.367   10.703  26.863 1.00 26.54 ? 1465 ILE A CG2 1 
ATOM   75   C  CD1 . ILE A 1 17  ? 3.408   8.456   26.337 1.00 30.35 ? 1465 ILE A CD1 1 
ATOM   76   N  N   . VAL A 1 18  ? 7.155   11.955  24.172 1.00 27.34 ? 1466 VAL A N   1 
ATOM   77   C  CA  . VAL A 1 18  ? 8.436   12.639  24.262 1.00 27.58 ? 1466 VAL A CA  1 
ATOM   78   C  C   . VAL A 1 18  ? 8.445   13.979  23.570 1.00 28.15 ? 1466 VAL A C   1 
ATOM   79   O  O   . VAL A 1 18  ? 9.006   14.914  24.114 1.00 25.53 ? 1466 VAL A O   1 
ATOM   80   C  CB  . VAL A 1 18  ? 9.599   11.766  23.780 1.00 26.76 ? 1466 VAL A CB  1 
ATOM   81   C  CG1 . VAL A 1 18  ? 10.907  12.514  23.807 1.00 28.02 ? 1466 VAL A CG1 1 
ATOM   82   C  CG2 . VAL A 1 18  ? 9.730   10.594  24.678 1.00 26.08 ? 1466 VAL A CG2 1 
ATOM   83   N  N   . ASP A 1 19  ? 7.806   14.097  22.397 1.00 30.06 ? 1467 ASP A N   1 
ATOM   84   C  CA  . ASP A 1 19  ? 7.746   15.373  21.690 1.00 32.56 ? 1467 ASP A CA  1 
ATOM   85   C  C   . ASP A 1 19  ? 7.057   16.379  22.583 1.00 29.49 ? 1467 ASP A C   1 
ATOM   86   O  O   . ASP A 1 19  ? 7.481   17.531  22.655 1.00 29.32 ? 1467 ASP A O   1 
ATOM   87   C  CB  . ASP A 1 19  ? 6.952   15.296  20.373 1.00 37.72 ? 1467 ASP A CB  1 
ATOM   88   C  CG  . ASP A 1 19  ? 7.685   14.542  19.263 1.00 44.33 ? 1467 ASP A CG  1 
ATOM   89   O  OD1 . ASP A 1 19  ? 8.922   14.436  19.329 1.00 46.84 ? 1467 ASP A OD1 1 
ATOM   90   O  OD2 . ASP A 1 19  ? 7.012   14.055  18.307 1.00 53.15 ? 1467 ASP A OD2 1 
ATOM   91   N  N   . ALA A 1 20  ? 6.007   15.959  23.275 1.00 27.50 ? 1468 ALA A N   1 
ATOM   92   C  CA  . ALA A 1 20  ? 5.258   16.897  24.073 1.00 29.04 ? 1468 ALA A CA  1 
ATOM   93   C  C   . ALA A 1 20  ? 6.005   17.285  25.367 1.00 26.70 ? 1468 ALA A C   1 
ATOM   94   O  O   . ALA A 1 20  ? 5.934   18.420  25.818 1.00 27.97 ? 1468 ALA A O   1 
ATOM   95   C  CB  . ALA A 1 20  ? 3.859   16.351  24.373 1.00 30.20 ? 1468 ALA A CB  1 
ATOM   96   N  N   . VAL A 1 21  ? 6.709   16.355  25.973 1.00 26.67 ? 1469 VAL A N   1 
ATOM   97   C  CA  . VAL A 1 21  ? 7.567   16.721  27.128 1.00 26.55 ? 1469 VAL A CA  1 
ATOM   98   C  C   . VAL A 1 21  ? 8.691   17.677  26.692 1.00 26.11 ? 1469 VAL A C   1 
ATOM   99   O  O   . VAL A 1 21  ? 9.041   18.596  27.416 1.00 26.41 ? 1469 VAL A O   1 
ATOM   100  C  CB  . VAL A 1 21  ? 8.199   15.499  27.807 1.00 25.50 ? 1469 VAL A CB  1 
ATOM   101  C  CG1 . VAL A 1 21  ? 9.235   15.919  28.841 1.00 24.00 ? 1469 VAL A CG1 1 
ATOM   102  C  CG2 . VAL A 1 21  ? 7.135   14.610  28.434 1.00 26.27 ? 1469 VAL A CG2 1 
ATOM   103  N  N   . ILE A 1 22  ? 9.244   17.459  25.496 1.00 26.27 ? 1470 ILE A N   1 
ATOM   104  C  CA  . ILE A 1 22  ? 10.275  18.337  24.979 1.00 25.07 ? 1470 ILE A CA  1 
ATOM   105  C  C   . ILE A 1 22  ? 9.723   19.741  24.705 1.00 27.46 ? 1470 ILE A C   1 
ATOM   106  O  O   . ILE A 1 22  ? 10.330  20.734  25.087 1.00 25.33 ? 1470 ILE A O   1 
ATOM   107  C  CB  . ILE A 1 22  ? 10.923  17.723  23.739 1.00 25.34 ? 1470 ILE A CB  1 
ATOM   108  C  CG1 . ILE A 1 22  ? 11.795  16.533  24.189 1.00 25.84 ? 1470 ILE A CG1 1 
ATOM   109  C  CG2 . ILE A 1 22  ? 11.702  18.769  22.970 1.00 25.29 ? 1470 ILE A CG2 1 
ATOM   110  C  CD1 . ILE A 1 22  ? 12.470  15.813  23.038 1.00 27.55 ? 1470 ILE A CD1 1 
ATOM   111  N  N   . LYS A 1 23  ? 8.523   19.802  24.150 1.00 29.82 ? 1471 LYS A N   1 
ATOM   112  C  CA  . LYS A 1 23  ? 7.887   21.048  23.795 1.00 32.93 ? 1471 LYS A CA  1 
ATOM   113  C  C   . LYS A 1 23  ? 7.372   21.858  24.994 1.00 31.81 ? 1471 LYS A C   1 
ATOM   114  O  O   . LYS A 1 23  ? 7.131   23.094  24.892 1.00 32.66 ? 1471 LYS A O   1 
ATOM   115  C  CB  . LYS A 1 23  ? 6.675   20.752  22.881 1.00 38.55 ? 1471 LYS A CB  1 
ATOM   116  C  CG  . LYS A 1 23  ? 6.829   21.059  21.386 1.00 43.12 ? 1471 LYS A CG  1 
ATOM   117  C  CD  . LYS A 1 23  ? 5.448   21.293  20.758 1.00 48.74 ? 1471 LYS A CD  1 
ATOM   118  C  CE  . LYS A 1 23  ? 4.782   22.543  21.332 1.00 53.22 ? 1471 LYS A CE  1 
ATOM   119  N  NZ  . LYS A 1 23  ? 3.529   22.896  20.612 1.00 56.15 ? 1471 LYS A NZ  1 
ATOM   120  N  N   . TYR A 1 24  ? 7.184   21.191  26.128 1.00 29.72 ? 1472 TYR A N   1 
ATOM   121  C  CA  . TYR A 1 24  ? 6.581   21.843  27.282 1.00 29.39 ? 1472 TYR A CA  1 
ATOM   122  C  C   . TYR A 1 24  ? 7.256   23.157  27.695 1.00 30.88 ? 1472 TYR A C   1 
ATOM   123  O  O   . TYR A 1 24  ? 8.479   23.242  27.796 1.00 26.43 ? 1472 TYR A O   1 
ATOM   124  C  CB  . TYR A 1 24  ? 6.555   20.918  28.482 1.00 27.57 ? 1472 TYR A CB  1 
ATOM   125  C  CG  . TYR A 1 24  ? 5.999   21.580  29.702 1.00 29.27 ? 1472 TYR A CG  1 
ATOM   126  C  CD1 . TYR A 1 24  ? 4.599   21.692  29.901 1.00 32.71 ? 1472 TYR A CD1 1 
ATOM   127  C  CD2 . TYR A 1 24  ? 6.835   22.123  30.659 1.00 29.06 ? 1472 TYR A CD2 1 
ATOM   128  C  CE1 . TYR A 1 24  ? 4.084   22.329  31.039 1.00 32.52 ? 1472 TYR A CE1 1 
ATOM   129  C  CE2 . TYR A 1 24  ? 6.347   22.742  31.776 1.00 29.69 ? 1472 TYR A CE2 1 
ATOM   130  C  CZ  . TYR A 1 24  ? 4.971   22.843  31.982 1.00 33.11 ? 1472 TYR A CZ  1 
ATOM   131  O  OH  . TYR A 1 24  ? 4.510   23.473  33.133 1.00 33.37 ? 1472 TYR A OH  1 
ATOM   132  N  N   . LYS A 1 25  ? 6.428   24.155  27.987 1.00 32.24 ? 1473 LYS A N   1 
ATOM   133  C  CA  . LYS A 1 25  ? 6.885   25.474  28.381 1.00 36.35 ? 1473 LYS A CA  1 
ATOM   134  C  C   . LYS A 1 25  ? 6.326   25.849  29.742 1.00 36.72 ? 1473 LYS A C   1 
ATOM   135  O  O   . LYS A 1 25  ? 5.186   25.588  30.030 1.00 37.69 ? 1473 LYS A O   1 
ATOM   136  C  CB  . LYS A 1 25  ? 6.461   26.483  27.328 1.00 38.99 ? 1473 LYS A CB  1 
ATOM   137  C  CG  . LYS A 1 25  ? 6.944   26.081  25.934 1.00 39.78 ? 1473 LYS A CG  1 
ATOM   138  C  CD  . LYS A 1 25  ? 7.177   27.258  25.032 1.00 44.32 ? 1473 LYS A CD  1 
ATOM   139  C  CE  . LYS A 1 25  ? 7.734   26.809  23.697 1.00 48.55 ? 1473 LYS A CE  1 
ATOM   140  N  NZ  . LYS A 1 25  ? 8.343   27.978  23.018 1.00 50.46 ? 1473 LYS A NZ  1 
ATOM   141  N  N   . ASP A 1 26  ? 7.170   26.397  30.596 1.00 36.34 ? 1474 ASP A N   1 
ATOM   142  C  CA  . ASP A 1 26  ? 6.732   26.954  31.883 1.00 40.46 ? 1474 ASP A CA  1 
ATOM   143  C  C   . ASP A 1 26  ? 5.657   28.013  31.665 1.00 39.36 ? 1474 ASP A C   1 
ATOM   144  O  O   . ASP A 1 26  ? 5.791   28.849  30.782 1.00 37.67 ? 1474 ASP A O   1 
ATOM   145  C  CB  . ASP A 1 26  ? 7.960   27.563  32.558 1.00 39.77 ? 1474 ASP A CB  1 
ATOM   146  C  CG  . ASP A 1 26  ? 7.669   28.297  33.892 1.00 43.40 ? 1474 ASP A CG  1 
ATOM   147  O  OD1 . ASP A 1 26  ? 6.884   29.272  33.926 1.00 47.95 ? 1474 ASP A OD1 1 
ATOM   148  O  OD2 . ASP A 1 26  ? 8.317   27.967  34.904 1.00 45.68 ? 1474 ASP A OD2 1 
ATOM   149  N  N   . SER A 1 27  ? 4.626   27.984  32.501 1.00 43.98 ? 1475 SER A N   1 
ATOM   150  C  CA  . SER A 1 27  ? 3.429   28.843  32.369 1.00 48.72 ? 1475 SER A CA  1 
ATOM   151  C  C   . SER A 1 27  ? 3.689   30.345  32.275 1.00 48.80 ? 1475 SER A C   1 
ATOM   152  O  O   . SER A 1 27  ? 3.276   31.011  31.316 1.00 50.00 ? 1475 SER A O   1 
ATOM   153  C  CB  . SER A 1 27  ? 2.477   28.592  33.544 1.00 48.97 ? 1475 SER A CB  1 
ATOM   154  O  OG  . SER A 1 27  ? 2.290   27.207  33.706 1.00 51.39 ? 1475 SER A OG  1 
ATOM   155  N  N   . SER A 1 28  ? 4.362   30.868  33.287 1.00 48.86 ? 1476 SER A N   1 
ATOM   156  C  CA  . SER A 1 28  ? 4.539   32.307  33.410 1.00 48.59 ? 1476 SER A CA  1 
ATOM   157  C  C   . SER A 1 28  ? 5.642   32.752  32.483 1.00 45.49 ? 1476 SER A C   1 
ATOM   158  O  O   . SER A 1 28  ? 5.487   33.730  31.745 1.00 45.54 ? 1476 SER A O   1 
ATOM   159  C  CB  . SER A 1 28  ? 4.863   32.678  34.853 1.00 53.35 ? 1476 SER A CB  1 
ATOM   160  O  OG  . SER A 1 28  ? 4.779   34.092  35.078 1.00 58.73 ? 1476 SER A OG  1 
ATOM   161  N  N   . SER A 1 29  ? 6.757   32.017  32.510 1.00 40.37 ? 1477 SER A N   1 
ATOM   162  C  CA  . SER A 1 29  ? 7.910   32.399  31.733 1.00 36.60 ? 1477 SER A CA  1 
ATOM   163  C  C   . SER A 1 29  ? 7.747   32.034  30.280 1.00 34.93 ? 1477 SER A C   1 
ATOM   164  O  O   . SER A 1 29  ? 8.314   32.715  29.438 1.00 36.69 ? 1477 SER A O   1 
ATOM   165  C  CB  . SER A 1 29  ? 9.201   31.788  32.299 1.00 34.35 ? 1477 SER A CB  1 
ATOM   166  O  OG  . SER A 1 29  ? 9.096   30.379  32.412 1.00 32.94 ? 1477 SER A OG  1 
ATOM   167  N  N   . GLY A 1 30  ? 7.014   30.966  29.969 1.00 31.37 ? 1478 GLY A N   1 
ATOM   168  C  CA  . GLY A 1 30  ? 7.074   30.403  28.618 1.00 31.56 ? 1478 GLY A CA  1 
ATOM   169  C  C   . GLY A 1 30  ? 8.394   29.695  28.287 1.00 30.01 ? 1478 GLY A C   1 
ATOM   170  O  O   . GLY A 1 30  ? 8.625   29.329  27.148 1.00 29.95 ? 1478 GLY A O   1 
ATOM   171  N  N   . ARG A 1 31  ? 9.268   29.470  29.269 1.00 27.55 ? 1479 ARG A N   1 
ATOM   172  C  CA  . ARG A 1 31  ? 10.556  28.828  29.005 1.00 26.17 ? 1479 ARG A CA  1 
ATOM   173  C  C   . ARG A 1 31  ? 10.418  27.331  28.757 1.00 25.50 ? 1479 ARG A C   1 
ATOM   174  O  O   . ARG A 1 31  ? 9.699   26.606  29.460 1.00 23.83 ? 1479 ARG A O   1 
ATOM   175  C  CB  . ARG A 1 31  ? 11.559  29.094  30.138 1.00 26.40 ? 1479 ARG A CB  1 
ATOM   176  C  CG  . ARG A 1 31  ? 12.984  28.587  29.872 1.00 25.54 ? 1479 ARG A CG  1 
ATOM   177  C  CD  . ARG A 1 31  ? 13.965  29.099  30.923 1.00 25.32 ? 1479 ARG A CD  1 
ATOM   178  N  NE  . ARG A 1 31  ? 13.522  28.730  32.260 1.00 23.81 ? 1479 ARG A NE  1 
ATOM   179  C  CZ  . ARG A 1 31  ? 13.816  27.602  32.910 1.00 23.27 ? 1479 ARG A CZ  1 
ATOM   180  N  NH1 . ARG A 1 31  ? 14.611  26.683  32.382 1.00 22.80 ? 1479 ARG A NH1 1 
ATOM   181  N  NH2 . ARG A 1 31  ? 13.309  27.391  34.120 1.00 23.23 ? 1479 ARG A NH2 1 
ATOM   182  N  N   . GLN A 1 32  ? 11.108  26.861  27.729 1.00 25.45 ? 1480 GLN A N   1 
ATOM   183  C  CA  . GLN A 1 32  ? 11.086  25.450  27.395 1.00 26.10 ? 1480 GLN A CA  1 
ATOM   184  C  C   . GLN A 1 32  ? 12.042  24.673  28.275 1.00 23.34 ? 1480 GLN A C   1 
ATOM   185  O  O   . GLN A 1 32  ? 13.261  24.693  28.061 1.00 20.96 ? 1480 GLN A O   1 
ATOM   186  C  CB  . GLN A 1 32  ? 11.467  25.244  25.930 1.00 29.44 ? 1480 GLN A CB  1 
ATOM   187  C  CG  . GLN A 1 32  ? 11.459  23.775  25.527 1.00 32.93 ? 1480 GLN A CG  1 
ATOM   188  C  CD  . GLN A 1 32  ? 11.650  23.613  24.006 1.00 38.33 ? 1480 GLN A CD  1 
ATOM   189  O  OE1 . GLN A 1 32  ? 12.092  24.532  23.296 1.00 40.72 ? 1480 GLN A OE1 1 
ATOM   190  N  NE2 . GLN A 1 32  ? 11.327  22.452  23.515 1.00 41.02 ? 1480 GLN A NE2 1 
ATOM   191  N  N   . LEU A 1 33  ? 11.469  23.961  29.251 1.00 22.16 ? 1481 LEU A N   1 
ATOM   192  C  CA  . LEU A 1 33  ? 12.243  23.326  30.324 1.00 20.90 ? 1481 LEU A CA  1 
ATOM   193  C  C   . LEU A 1 33  ? 13.247  22.318  29.832 1.00 20.17 ? 1481 LEU A C   1 
ATOM   194  O  O   . LEU A 1 33  ? 14.343  22.248  30.383 1.00 19.56 ? 1481 LEU A O   1 
ATOM   195  C  CB  . LEU A 1 33  ? 11.302  22.681  31.344 1.00 21.87 ? 1481 LEU A CB  1 
ATOM   196  C  CG  . LEU A 1 33  ? 10.430  23.585  32.211 1.00 24.14 ? 1481 LEU A CG  1 
ATOM   197  C  CD1 . LEU A 1 33  ? 9.941   22.885  33.481 1.00 25.42 ? 1481 LEU A CD1 1 
ATOM   198  C  CD2 . LEU A 1 33  ? 11.064  24.938  32.499 1.00 24.20 ? 1481 LEU A CD2 1 
ATOM   199  N  N   . SER A 1 34  ? 12.893  21.539  28.787 1.00 19.37 ? 1482 SER A N   1 
ATOM   200  C  CA  . SER A 1 34  ? 13.770  20.477  28.270 1.00 19.60 ? 1482 SER A CA  1 
ATOM   201  C  C   . SER A 1 34  ? 15.096  20.936  27.647 1.00 19.02 ? 1482 SER A C   1 
ATOM   202  O  O   . SER A 1 34  ? 15.971  20.112  27.404 1.00 19.25 ? 1482 SER A O   1 
ATOM   203  C  CB  . SER A 1 34  ? 13.021  19.688  27.202 1.00 19.39 ? 1482 SER A CB  1 
ATOM   204  O  OG  . SER A 1 34  ? 12.763  20.538  26.086 1.00 18.56 ? 1482 SER A OG  1 
ATOM   205  N  N   . GLU A 1 35  ? 15.244  22.226  27.394 1.00 20.30 ? 1483 GLU A N   1 
ATOM   206  C  CA  . GLU A 1 35  ? 16.223  22.670  26.422 1.00 22.20 ? 1483 GLU A CA  1 
ATOM   207  C  C   . GLU A 1 35  ? 17.637  22.155  26.735 1.00 19.64 ? 1483 GLU A C   1 
ATOM   208  O  O   . GLU A 1 35  ? 18.297  21.591  25.871 1.00 17.54 ? 1483 GLU A O   1 
ATOM   209  C  CB  . GLU A 1 35  ? 16.168  24.184  26.278 1.00 26.38 ? 1483 GLU A CB  1 
ATOM   210  C  CG  . GLU A 1 35  ? 17.225  24.669  25.309 1.00 32.42 ? 1483 GLU A CG  1 
ATOM   211  C  CD  . GLU A 1 35  ? 17.055  26.107  24.918 1.00 40.83 ? 1483 GLU A CD  1 
ATOM   212  O  OE1 . GLU A 1 35  ? 17.406  26.423  23.757 1.00 48.36 ? 1483 GLU A OE1 1 
ATOM   213  O  OE2 . GLU A 1 35  ? 16.580  26.919  25.767 1.00 45.02 ? 1483 GLU A OE2 1 
ATOM   214  N  N   . VAL A 1 36  ? 18.085  22.292  27.980 1.00 18.37 ? 1484 VAL A N   1 
ATOM   215  C  CA  . VAL A 1 36  ? 19.417  21.873  28.334 1.00 17.92 ? 1484 VAL A CA  1 
ATOM   216  C  C   . VAL A 1 36  ? 19.627  20.340  28.334 1.00 17.54 ? 1484 VAL A C   1 
ATOM   217  O  O   . VAL A 1 36  ? 20.768  19.892  28.328 1.00 17.34 ? 1484 VAL A O   1 
ATOM   218  C  CB  . VAL A 1 36  ? 19.916  22.392  29.694 1.00 19.93 ? 1484 VAL A CB  1 
ATOM   219  C  CG1 . VAL A 1 36  ? 19.875  23.892  29.759 1.00 22.34 ? 1484 VAL A CG1 1 
ATOM   220  C  CG2 . VAL A 1 36  ? 19.168  21.766  30.877 1.00 17.99 ? 1484 VAL A CG2 1 
ATOM   221  N  N   . PHE A 1 37  ? 18.546  19.579  28.377 1.00 15.98 ? 1485 PHE A N   1 
ATOM   222  C  CA  . PHE A 1 37  ? 18.566  18.186  28.487 1.00 15.59 ? 1485 PHE A CA  1 
ATOM   223  C  C   . PHE A 1 37  ? 18.511  17.488  27.125 1.00 17.07 ? 1485 PHE A C   1 
ATOM   224  O  O   . PHE A 1 37  ? 18.488  16.248  27.082 1.00 17.05 ? 1485 PHE A O   1 
ATOM   225  C  CB  . PHE A 1 37  ? 17.382  17.716  29.338 1.00 15.94 ? 1485 PHE A CB  1 
ATOM   226  C  CG  . PHE A 1 37  ? 17.371  18.284  30.725 1.00 16.03 ? 1485 PHE A CG  1 
ATOM   227  C  CD1 . PHE A 1 37  ? 18.430  18.040  31.604 1.00 16.57 ? 1485 PHE A CD1 1 
ATOM   228  C  CD2 . PHE A 1 37  ? 16.414  19.177  31.100 1.00 17.24 ? 1485 PHE A CD2 1 
ATOM   229  C  CE1 . PHE A 1 37  ? 18.458  18.641  32.858 1.00 16.93 ? 1485 PHE A CE1 1 
ATOM   230  C  CE2 . PHE A 1 37  ? 16.429  19.781  32.358 1.00 17.64 ? 1485 PHE A CE2 1 
ATOM   231  C  CZ  . PHE A 1 37  ? 17.437  19.486  33.256 1.00 17.21 ? 1485 PHE A CZ  1 
ATOM   232  N  N   . ILE A 1 38  ? 18.445  18.235  26.017 1.00 17.56 ? 1486 ILE A N   1 
ATOM   233  C  CA  . ILE A 1 38  ? 18.267  17.600  24.729 1.00 19.13 ? 1486 ILE A CA  1 
ATOM   234  C  C   . ILE A 1 38  ? 19.531  16.837  24.368 1.00 19.16 ? 1486 ILE A C   1 
ATOM   235  O  O   . ILE A 1 38  ? 19.487  15.682  23.906 1.00 19.53 ? 1486 ILE A O   1 
ATOM   236  C  CB  . ILE A 1 38  ? 17.953  18.597  23.621 1.00 20.57 ? 1486 ILE A CB  1 
ATOM   237  C  CG1 . ILE A 1 38  ? 16.612  19.279  23.879 1.00 21.11 ? 1486 ILE A CG1 1 
ATOM   238  C  CG2 . ILE A 1 38  ? 17.956  17.888  22.245 1.00 22.10 ? 1486 ILE A CG2 1 
ATOM   239  C  CD1 . ILE A 1 38  ? 15.410  18.363  23.924 1.00 21.40 ? 1486 ILE A CD1 1 
ATOM   240  N  N   . GLN A 1 39  ? 20.660  17.485  24.641 1.00 20.62 ? 1487 GLN A N   1 
ATOM   241  C  CA  . GLN A 1 39  ? 21.918  16.986  24.255 1.00 21.91 ? 1487 GLN A CA  1 
ATOM   242  C  C   . GLN A 1 39  ? 23.010  17.280  25.253 1.00 22.73 ? 1487 GLN A C   1 
ATOM   243  O  O   . GLN A 1 39  ? 23.277  18.445  25.574 1.00 21.61 ? 1487 GLN A O   1 
ATOM   244  C  CB  . GLN A 1 39  ? 22.269  17.480  22.835 1.00 24.21 ? 1487 GLN A CB  1 
ATOM   245  C  CG  . GLN A 1 39  ? 23.133  16.427  22.147 1.00 27.67 ? 1487 GLN A CG  1 
ATOM   246  C  CD  . GLN A 1 39  ? 23.772  16.894  20.876 1.00 29.64 ? 1487 GLN A CD  1 
ATOM   247  O  OE1 . GLN A 1 39  ? 24.748  16.312  20.424 1.00 33.80 ? 1487 GLN A OE1 1 
ATOM   248  N  NE2 . GLN A 1 39  ? 23.243  17.951  20.309 1.00 30.53 ? 1487 GLN A NE2 1 
ATOM   249  N  N   . LEU A 1 40  ? 23.566  16.208  25.814 1.00 23.37 ? 1488 LEU A N   1 
ATOM   250  C  CA  . LEU A 1 40  ? 24.614  16.301  26.818 1.00 25.85 ? 1488 LEU A CA  1 
ATOM   251  C  C   . LEU A 1 40  ? 25.859  16.922  26.181 1.00 25.88 ? 1488 LEU A C   1 
ATOM   252  O  O   . LEU A 1 40  ? 26.151  16.617  25.017 1.00 25.64 ? 1488 LEU A O   1 
ATOM   253  C  CB  . LEU A 1 40  ? 24.973  14.897  27.372 1.00 28.31 ? 1488 LEU A CB  1 
ATOM   254  C  CG  . LEU A 1 40  ? 24.236  14.424  28.621 1.00 29.67 ? 1488 LEU A CG  1 
ATOM   255  C  CD1 . LEU A 1 40  ? 24.430  12.909  28.830 1.00 30.87 ? 1488 LEU A CD1 1 
ATOM   256  C  CD2 . LEU A 1 40  ? 24.722  15.208  29.840 1.00 31.10 ? 1488 LEU A CD2 1 
ATOM   257  N  N   . PRO A 1 41  ? 26.604  17.740  26.937 1.00 26.51 ? 1489 PRO A N   1 
ATOM   258  C  CA  . PRO A 1 41  ? 27.945  18.107  26.439 1.00 29.40 ? 1489 PRO A CA  1 
ATOM   259  C  C   . PRO A 1 41  ? 28.753  16.855  26.155 1.00 28.22 ? 1489 PRO A C   1 
ATOM   260  O  O   . PRO A 1 41  ? 28.534  15.813  26.826 1.00 25.91 ? 1489 PRO A O   1 
ATOM   261  C  CB  . PRO A 1 41  ? 28.551  18.888  27.589 1.00 30.00 ? 1489 PRO A CB  1 
ATOM   262  C  CG  . PRO A 1 41  ? 27.364  19.348  28.393 1.00 29.47 ? 1489 PRO A CG  1 
ATOM   263  C  CD  . PRO A 1 41  ? 26.362  18.259  28.294 1.00 27.79 ? 1489 PRO A CD  1 
ATOM   264  N  N   . SER A 1 42  ? 29.654  16.925  25.165 1.00 30.48 ? 1490 SER A N   1 
ATOM   265  C  CA  . SER A 1 42  ? 30.469  15.761  24.762 1.00 32.97 ? 1490 SER A CA  1 
ATOM   266  C  C   . SER A 1 42  ? 31.420  15.365  25.864 1.00 32.35 ? 1490 SER A C   1 
ATOM   267  O  O   . SER A 1 42  ? 31.671  16.135  26.781 1.00 30.35 ? 1490 SER A O   1 
ATOM   268  C  CB  . SER A 1 42  ? 31.282  16.069  23.494 1.00 34.97 ? 1490 SER A CB  1 
ATOM   269  O  OG  . SER A 1 42  ? 32.327  16.964  23.809 1.00 37.20 ? 1490 SER A OG  1 
ATOM   270  N  N   . ARG A 1 43  ? 31.943  14.159  25.769 1.00 35.37 ? 1491 ARG A N   1 
ATOM   271  C  CA  . ARG A 1 43  ? 32.999  13.694  26.688 1.00 39.69 ? 1491 ARG A CA  1 
ATOM   272  C  C   . ARG A 1 43  ? 34.192  14.634  26.791 1.00 40.88 ? 1491 ARG A C   1 
ATOM   273  O  O   . ARG A 1 43  ? 34.716  14.837  27.887 1.00 40.63 ? 1491 ARG A O   1 
ATOM   274  C  CB  . ARG A 1 43  ? 33.486  12.299  26.299 1.00 43.24 ? 1491 ARG A CB  1 
ATOM   275  C  CG  . ARG A 1 43  ? 32.756  11.222  27.072 1.00 47.25 ? 1491 ARG A CG  1 
ATOM   276  C  CD  . ARG A 1 43  ? 33.067  9.821   26.568 1.00 53.06 ? 1491 ARG A CD  1 
ATOM   277  N  NE  . ARG A 1 43  ? 32.307  8.819   27.321 1.00 54.34 ? 1491 ARG A NE  1 
ATOM   278  C  CZ  . ARG A 1 43  ? 31.143  8.293   26.949 1.00 54.41 ? 1491 ARG A CZ  1 
ATOM   279  N  NH1 . ARG A 1 43  ? 30.560  8.650   25.817 1.00 54.33 ? 1491 ARG A NH1 1 
ATOM   280  N  NH2 . ARG A 1 43  ? 30.555  7.388   27.717 1.00 55.79 ? 1491 ARG A NH2 1 
ATOM   281  N  N   . LYS A 1 44  ? 34.589  15.263  25.690 1.00 41.35 ? 1492 LYS A N   1 
ATOM   282  C  CA  . LYS A 1 44  ? 35.701  16.208  25.816 1.00 44.12 ? 1492 LYS A CA  1 
ATOM   283  C  C   . LYS A 1 44  ? 35.316  17.549  26.371 1.00 44.83 ? 1492 LYS A C   1 
ATOM   284  O  O   . LYS A 1 44  ? 36.150  18.220  26.955 1.00 45.27 ? 1492 LYS A O   1 
ATOM   285  C  CB  . LYS A 1 44  ? 36.556  16.391  24.574 1.00 48.48 ? 1492 LYS A CB  1 
ATOM   286  C  CG  . LYS A 1 44  ? 35.903  16.225  23.221 1.00 51.52 ? 1492 LYS A CG  1 
ATOM   287  C  CD  . LYS A 1 44  ? 36.989  16.234  22.136 1.00 55.94 ? 1492 LYS A CD  1 
ATOM   288  C  CE  . LYS A 1 44  ? 37.994  15.100  22.324 1.00 55.93 ? 1492 LYS A CE  1 
ATOM   289  N  NZ  . LYS A 1 44  ? 38.507  14.586  21.023 1.00 59.28 ? 1492 LYS A NZ  1 
ATOM   290  N  N   . GLU A 1 45  ? 34.073  17.963  26.177 1.00 44.63 ? 1493 GLU A N   1 
ATOM   291  C  CA  . GLU A 1 45  ? 33.614  19.229  26.720 1.00 44.05 ? 1493 GLU A CA  1 
ATOM   292  C  C   . GLU A 1 45  ? 33.452  19.136  28.230 1.00 40.25 ? 1493 GLU A C   1 
ATOM   293  O  O   . GLU A 1 45  ? 33.692  20.104  28.947 1.00 39.54 ? 1493 GLU A O   1 
ATOM   294  C  CB  . GLU A 1 45  ? 32.282  19.611  26.070 1.00 48.98 ? 1493 GLU A CB  1 
ATOM   295  C  CG  . GLU A 1 45  ? 32.422  20.038  24.599 1.00 54.23 ? 1493 GLU A CG  1 
ATOM   296  C  CD  . GLU A 1 45  ? 32.817  21.506  24.440 1.00 60.58 ? 1493 GLU A CD  1 
ATOM   297  O  OE1 . GLU A 1 45  ? 32.876  22.235  25.459 1.00 67.30 ? 1493 GLU A OE1 1 
ATOM   298  O  OE2 . GLU A 1 45  ? 33.076  21.949  23.290 1.00 69.64 ? 1493 GLU A OE2 1 
ATOM   299  N  N   . LEU A 1 46  ? 33.044  17.966  28.718 1.00 37.04 ? 1494 LEU A N   1 
ATOM   300  C  CA  . LEU A 1 46  ? 32.641  17.835  30.118 1.00 36.38 ? 1494 LEU A CA  1 
ATOM   301  C  C   . LEU A 1 46  ? 32.984  16.444  30.663 1.00 35.93 ? 1494 LEU A C   1 
ATOM   302  O  O   . LEU A 1 46  ? 32.092  15.641  30.966 1.00 34.31 ? 1494 LEU A O   1 
ATOM   303  C  CB  . LEU A 1 46  ? 31.144  18.130  30.240 1.00 35.13 ? 1494 LEU A CB  1 
ATOM   304  C  CG  . LEU A 1 46  ? 30.595  18.314  31.659 1.00 37.15 ? 1494 LEU A CG  1 
ATOM   305  C  CD1 . LEU A 1 46  ? 31.176  19.570  32.298 1.00 41.13 ? 1494 LEU A CD1 1 
ATOM   306  C  CD2 . LEU A 1 46  ? 29.090  18.388  31.652 1.00 36.04 ? 1494 LEU A CD2 1 
ATOM   307  N  N   . PRO A 1 47  ? 34.289  16.150  30.797 1.00 37.94 ? 1495 PRO A N   1 
ATOM   308  C  CA  . PRO A 1 47  ? 34.653  14.783  31.228 1.00 38.29 ? 1495 PRO A CA  1 
ATOM   309  C  C   . PRO A 1 47  ? 34.178  14.414  32.639 1.00 35.69 ? 1495 PRO A C   1 
ATOM   310  O  O   . PRO A 1 47  ? 33.914  13.245  32.898 1.00 34.74 ? 1495 PRO A O   1 
ATOM   311  C  CB  . PRO A 1 47  ? 36.207  14.763  31.115 1.00 40.14 ? 1495 PRO A CB  1 
ATOM   312  C  CG  . PRO A 1 47  ? 36.633  16.200  31.016 1.00 39.78 ? 1495 PRO A CG  1 
ATOM   313  C  CD  . PRO A 1 47  ? 35.466  16.965  30.433 1.00 39.00 ? 1495 PRO A CD  1 
ATOM   314  N  N   . GLU A 1 48  ? 34.061  15.408  33.519 1.00 36.09 ? 1496 GLU A N   1 
ATOM   315  C  CA  . GLU A 1 48  ? 33.527  15.225  34.860 1.00 38.12 ? 1496 GLU A CA  1 
ATOM   316  C  C   . GLU A 1 48  ? 32.160  14.509  34.838 1.00 35.99 ? 1496 GLU A C   1 
ATOM   317  O  O   . GLU A 1 48  ? 31.901  13.633  35.656 1.00 36.38 ? 1496 GLU A O   1 
ATOM   318  C  CB  . GLU A 1 48  ? 33.387  16.583  35.575 1.00 45.75 ? 1496 GLU A CB  1 
ATOM   319  C  CG  . GLU A 1 48  ? 32.657  16.509  36.897 1.00 51.98 ? 1496 GLU A CG  1 
ATOM   320  C  CD  . GLU A 1 48  ? 32.455  17.861  37.554 1.00 60.24 ? 1496 GLU A CD  1 
ATOM   321  O  OE1 . GLU A 1 48  ? 31.984  18.782  36.847 1.00 63.26 ? 1496 GLU A OE1 1 
ATOM   322  O  OE2 . GLU A 1 48  ? 32.749  17.998  38.769 1.00 65.05 ? 1496 GLU A OE2 1 
ATOM   323  N  N   . TYR A 1 49  ? 31.278  14.899  33.917 1.00 32.08 ? 1497 TYR A N   1 
ATOM   324  C  CA  . TYR A 1 49  ? 29.951  14.263  33.809 1.00 29.20 ? 1497 TYR A CA  1 
ATOM   325  C  C   . TYR A 1 49  ? 30.071  12.760  33.656 1.00 30.20 ? 1497 TYR A C   1 
ATOM   326  O  O   . TYR A 1 49  ? 29.369  12.001  34.315 1.00 26.58 ? 1497 TYR A O   1 
ATOM   327  C  CB  . TYR A 1 49  ? 29.133  14.831  32.635 1.00 26.95 ? 1497 TYR A CB  1 
ATOM   328  C  CG  . TYR A 1 49  ? 27.675  14.506  32.739 1.00 24.95 ? 1497 TYR A CG  1 
ATOM   329  C  CD1 . TYR A 1 49  ? 27.184  13.302  32.252 1.00 23.56 ? 1497 TYR A CD1 1 
ATOM   330  C  CD2 . TYR A 1 49  ? 26.772  15.397  33.341 1.00 24.40 ? 1497 TYR A CD2 1 
ATOM   331  C  CE1 . TYR A 1 49  ? 25.866  12.987  32.333 1.00 22.85 ? 1497 TYR A CE1 1 
ATOM   332  C  CE2 . TYR A 1 49  ? 25.424  15.071  33.441 1.00 23.01 ? 1497 TYR A CE2 1 
ATOM   333  C  CZ  . TYR A 1 49  ? 24.996  13.836  32.968 1.00 22.64 ? 1497 TYR A CZ  1 
ATOM   334  O  OH  . TYR A 1 49  ? 23.679  13.450  33.053 1.00 20.65 ? 1497 TYR A OH  1 
ATOM   335  N  N   . TYR A 1 50  ? 30.989  12.333  32.794 1.00 30.20 ? 1498 TYR A N   1 
ATOM   336  C  CA  . TYR A 1 50  ? 31.116  10.914  32.466 1.00 32.18 ? 1498 TYR A CA  1 
ATOM   337  C  C   . TYR A 1 50  ? 31.883  10.160  33.521 1.00 33.48 ? 1498 TYR A C   1 
ATOM   338  O  O   . TYR A 1 50  ? 31.756  8.961   33.591 1.00 34.54 ? 1498 TYR A O   1 
ATOM   339  C  CB  . TYR A 1 50  ? 31.733  10.734  31.098 1.00 31.95 ? 1498 TYR A CB  1 
ATOM   340  C  CG  . TYR A 1 50  ? 30.869  11.374  30.050 1.00 30.86 ? 1498 TYR A CG  1 
ATOM   341  C  CD1 . TYR A 1 50  ? 30.971  12.733  29.765 1.00 30.30 ? 1498 TYR A CD1 1 
ATOM   342  C  CD2 . TYR A 1 50  ? 29.905  10.646  29.401 1.00 32.16 ? 1498 TYR A CD2 1 
ATOM   343  C  CE1 . TYR A 1 50  ? 30.167  13.330  28.814 1.00 29.61 ? 1498 TYR A CE1 1 
ATOM   344  C  CE2 . TYR A 1 50  ? 29.079  11.237  28.452 1.00 32.04 ? 1498 TYR A CE2 1 
ATOM   345  C  CZ  . TYR A 1 50  ? 29.215  12.591  28.180 1.00 30.37 ? 1498 TYR A CZ  1 
ATOM   346  O  OH  . TYR A 1 50  ? 28.384  13.179  27.264 1.00 30.70 ? 1498 TYR A OH  1 
ATOM   347  N  N   . GLU A 1 51  ? 32.650  10.852  34.362 1.00 37.14 ? 1499 GLU A N   1 
ATOM   348  C  CA  . GLU A 1 51  ? 33.279  10.184  35.504 1.00 41.41 ? 1499 GLU A CA  1 
ATOM   349  C  C   . GLU A 1 51  ? 32.243  9.918   36.600 1.00 38.91 ? 1499 GLU A C   1 
ATOM   350  O  O   . GLU A 1 51  ? 32.226  8.840   37.189 1.00 39.11 ? 1499 GLU A O   1 
ATOM   351  C  CB  . GLU A 1 51  ? 34.478  10.976  36.045 1.00 46.25 ? 1499 GLU A CB  1 
ATOM   352  C  CG  . GLU A 1 51  ? 35.828  10.571  35.439 1.00 54.36 ? 1499 GLU A CG  1 
ATOM   353  C  CD  . GLU A 1 51  ? 36.939  11.604  35.655 1.00 60.51 ? 1499 GLU A CD  1 
ATOM   354  O  OE1 . GLU A 1 51  ? 37.226  12.402  34.713 1.00 60.75 ? 1499 GLU A OE1 1 
ATOM   355  O  OE2 . GLU A 1 51  ? 37.531  11.610  36.769 1.00 63.25 ? 1499 GLU A OE2 1 
ATOM   356  N  N   . LEU A 1 52  ? 31.368  10.887  36.849 1.00 36.60 ? 1500 LEU A N   1 
ATOM   357  C  CA  . LEU A 1 52  ? 30.419  10.796  37.945 1.00 36.35 ? 1500 LEU A CA  1 
ATOM   358  C  C   . LEU A 1 52  ? 29.193  9.958   37.605 1.00 34.34 ? 1500 LEU A C   1 
ATOM   359  O  O   . LEU A 1 52  ? 28.691  9.207   38.442 1.00 35.01 ? 1500 LEU A O   1 
ATOM   360  C  CB  . LEU A 1 52  ? 29.976  12.199  38.365 1.00 37.92 ? 1500 LEU A CB  1 
ATOM   361  C  CG  . LEU A 1 52  ? 28.896  12.191  39.454 1.00 43.66 ? 1500 LEU A CG  1 
ATOM   362  C  CD1 . LEU A 1 52  ? 29.395  11.573  40.771 1.00 43.70 ? 1500 LEU A CD1 1 
ATOM   363  C  CD2 . LEU A 1 52  ? 28.340  13.593  39.685 1.00 44.77 ? 1500 LEU A CD2 1 
ATOM   364  N  N   . ILE A 1 53  ? 28.698  10.100  36.389 1.00 30.07 ? 1501 ILE A N   1 
ATOM   365  C  CA  . ILE A 1 53  ? 27.441  9.542   36.016 1.00 29.77 ? 1501 ILE A CA  1 
ATOM   366  C  C   . ILE A 1 53  ? 27.652  8.210   35.303 1.00 31.99 ? 1501 ILE A C   1 
ATOM   367  O  O   . ILE A 1 53  ? 28.326  8.172   34.290 1.00 34.16 ? 1501 ILE A O   1 
ATOM   368  C  CB  . ILE A 1 53  ? 26.637  10.551  35.129 1.00 27.85 ? 1501 ILE A CB  1 
ATOM   369  C  CG1 . ILE A 1 53  ? 26.284  11.812  35.942 1.00 27.47 ? 1501 ILE A CG1 1 
ATOM   370  C  CG2 . ILE A 1 53  ? 25.419  9.895   34.506 1.00 26.81 ? 1501 ILE A CG2 1 
ATOM   371  C  CD1 . ILE A 1 53  ? 25.635  11.586  37.300 1.00 27.32 ? 1501 ILE A CD1 1 
ATOM   372  N  N   . ARG A 1 54  ? 27.005  7.162   35.817 1.00 33.86 ? 1502 ARG A N   1 
ATOM   373  C  CA  . ARG A 1 54  ? 27.155  5.780   35.309 1.00 36.81 ? 1502 ARG A CA  1 
ATOM   374  C  C   . ARG A 1 54  ? 26.443  5.498   33.980 1.00 34.38 ? 1502 ARG A C   1 
ATOM   375  O  O   . ARG A 1 54  ? 27.028  4.870   33.107 1.00 32.36 ? 1502 ARG A O   1 
ATOM   376  C  CB  . ARG A 1 54  ? 26.621  4.780   36.337 1.00 39.22 ? 1502 ARG A CB  1 
ATOM   377  C  CG  . ARG A 1 54  ? 27.259  4.794   37.723 1.00 41.58 ? 1502 ARG A CG  1 
ATOM   378  C  CD  . ARG A 1 54  ? 26.648  3.624   38.471 1.00 45.06 ? 1502 ARG A CD  1 
ATOM   379  N  NE  . ARG A 1 54  ? 26.625  3.753   39.934 1.00 49.35 ? 1502 ARG A NE  1 
ATOM   380  C  CZ  . ARG A 1 54  ? 26.457  2.707   40.759 1.00 52.38 ? 1502 ARG A CZ  1 
ATOM   381  N  NH1 . ARG A 1 54  ? 26.304  1.471   40.283 1.00 50.83 ? 1502 ARG A NH1 1 
ATOM   382  N  NH2 . ARG A 1 54  ? 26.466  2.883   42.076 1.00 56.64 ? 1502 ARG A NH2 1 
ATOM   383  N  N   . LYS A 1 55  ? 25.194  5.944   33.824 1.00 31.61 ? 1503 LYS A N   1 
ATOM   384  C  CA  . LYS A 1 55  ? 24.465  5.722   32.553 1.00 30.91 ? 1503 LYS A CA  1 
ATOM   385  C  C   . LYS A 1 55  ? 23.916  7.049   31.990 1.00 26.78 ? 1503 LYS A C   1 
ATOM   386  O  O   . LYS A 1 55  ? 22.714  7.340   32.100 1.00 24.85 ? 1503 LYS A O   1 
ATOM   387  C  CB  . LYS A 1 55  ? 23.309  4.746   32.709 1.00 34.40 ? 1503 LYS A CB  1 
ATOM   388  C  CG  . LYS A 1 55  ? 23.680  3.359   33.199 1.00 37.98 ? 1503 LYS A CG  1 
ATOM   389  C  CD  . LYS A 1 55  ? 22.503  2.438   33.087 1.00 42.62 ? 1503 LYS A CD  1 
ATOM   390  C  CE  . LYS A 1 55  ? 21.319  2.956   33.865 1.00 44.78 ? 1503 LYS A CE  1 
ATOM   391  N  NZ  . LYS A 1 55  ? 20.154  2.031   33.729 1.00 48.50 ? 1503 LYS A NZ  1 
ATOM   392  N  N   . PRO A 1 56  ? 24.793  7.820   31.358 1.00 25.98 ? 1504 PRO A N   1 
ATOM   393  C  CA  . PRO A 1 56  ? 24.401  9.092   30.769 1.00 25.66 ? 1504 PRO A CA  1 
ATOM   394  C  C   . PRO A 1 56  ? 23.323  8.921   29.736 1.00 24.13 ? 1504 PRO A C   1 
ATOM   395  O  O   . PRO A 1 56  ? 23.363  7.988   28.954 1.00 23.69 ? 1504 PRO A O   1 
ATOM   396  C  CB  . PRO A 1 56  ? 25.697  9.601   30.128 1.00 26.71 ? 1504 PRO A CB  1 
ATOM   397  C  CG  . PRO A 1 56  ? 26.806  8.801   30.768 1.00 28.42 ? 1504 PRO A CG  1 
ATOM   398  C  CD  . PRO A 1 56  ? 26.208  7.485   31.058 1.00 27.17 ? 1504 PRO A CD  1 
ATOM   399  N  N   . VAL A 1 57  ? 22.352  9.820   29.744 1.00 22.11 ? 1505 VAL A N   1 
ATOM   400  C  CA  . VAL A 1 57  ? 21.255  9.741   28.815 1.00 21.25 ? 1505 VAL A CA  1 
ATOM   401  C  C   . VAL A 1 57  ? 20.701  11.171  28.633 1.00 20.77 ? 1505 VAL A C   1 
ATOM   402  O  O   . VAL A 1 57  ? 20.706  11.981  29.562 1.00 20.83 ? 1505 VAL A O   1 
ATOM   403  C  CB  . VAL A 1 57  ? 20.174  8.739   29.294 1.00 22.21 ? 1505 VAL A CB  1 
ATOM   404  C  CG1 . VAL A 1 57  ? 19.647  9.085   30.682 1.00 22.11 ? 1505 VAL A CG1 1 
ATOM   405  C  CG2 . VAL A 1 57  ? 19.027  8.695   28.301 1.00 23.11 ? 1505 VAL A CG2 1 
ATOM   406  N  N   . ASP A 1 58  ? 20.345  11.509  27.392 1.00 19.17 ? 1506 ASP A N   1 
ATOM   407  C  CA  . ASP A 1 58  ? 19.749  12.812  27.100 1.00 18.12 ? 1506 ASP A CA  1 
ATOM   408  C  C   . ASP A 1 58  ? 18.500  12.599  26.206 1.00 17.03 ? 1506 ASP A C   1 
ATOM   409  O  O   . ASP A 1 58  ? 18.240  11.464  25.767 1.00 16.94 ? 1506 ASP A O   1 
ATOM   410  C  CB  . ASP A 1 58  ? 20.802  13.748  26.524 1.00 18.81 ? 1506 ASP A CB  1 
ATOM   411  C  CG  . ASP A 1 58  ? 21.546  13.184  25.340 1.00 18.97 ? 1506 ASP A CG  1 
ATOM   412  O  OD1 . ASP A 1 58  ? 21.020  12.268  24.681 1.00 19.25 ? 1506 ASP A OD1 1 
ATOM   413  O  OD2 . ASP A 1 58  ? 22.650  13.718  25.001 1.00 21.02 ? 1506 ASP A OD2 1 
ATOM   414  N  N   . PHE A 1 59  ? 17.682  13.613  25.984 1.00 15.96 ? 1507 PHE A N   1 
ATOM   415  C  CA  . PHE A 1 59  ? 16.532  13.385  25.181 1.00 16.75 ? 1507 PHE A CA  1 
ATOM   416  C  C   . PHE A 1 59  ? 16.818  12.908  23.742 1.00 18.59 ? 1507 PHE A C   1 
ATOM   417  O  O   . PHE A 1 59  ? 15.958  12.200  23.169 1.00 19.89 ? 1507 PHE A O   1 
ATOM   418  C  CB  . PHE A 1 59  ? 15.619  14.574  25.168 1.00 16.85 ? 1507 PHE A CB  1 
ATOM   419  C  CG  . PHE A 1 59  ? 14.819  14.702  26.379 1.00 17.61 ? 1507 PHE A CG  1 
ATOM   420  C  CD1 . PHE A 1 59  ? 13.831  13.792  26.622 1.00 19.02 ? 1507 PHE A CD1 1 
ATOM   421  C  CD2 . PHE A 1 59  ? 15.009  15.763  27.267 1.00 19.31 ? 1507 PHE A CD2 1 
ATOM   422  C  CE1 . PHE A 1 59  ? 13.032  13.872  27.776 1.00 21.36 ? 1507 PHE A CE1 1 
ATOM   423  C  CE2 . PHE A 1 59  ? 14.192  15.879  28.427 1.00 19.79 ? 1507 PHE A CE2 1 
ATOM   424  C  CZ  . PHE A 1 59  ? 13.232  14.930  28.688 1.00 19.82 ? 1507 PHE A CZ  1 
ATOM   425  N  N   . LYS A 1 60  ? 17.944  13.330  23.143 1.00 19.03 ? 1508 LYS A N   1 
ATOM   426  C  CA  . LYS A 1 60  ? 18.348  12.851  21.818 1.00 20.55 ? 1508 LYS A CA  1 
ATOM   427  C  C   . LYS A 1 60  ? 18.446  11.311  21.811 1.00 20.44 ? 1508 LYS A C   1 
ATOM   428  O  O   . LYS A 1 60  ? 17.983  10.659  20.881 1.00 20.16 ? 1508 LYS A O   1 
ATOM   429  C  CB  . LYS A 1 60  ? 19.706  13.456  21.411 1.00 22.78 ? 1508 LYS A CB  1 
ATOM   430  C  CG  . LYS A 1 60  ? 20.094  13.160  19.949 1.00 25.25 ? 1508 LYS A CG  1 
ATOM   431  C  CD  . LYS A 1 60  ? 21.305  13.964  19.508 1.00 27.10 ? 1508 LYS A CD  1 
ATOM   432  C  CE  . LYS A 1 60  ? 22.075  13.253  18.428 1.00 28.46 ? 1508 LYS A CE  1 
ATOM   433  N  NZ  . LYS A 1 60  ? 21.342  13.358  17.160 1.00 30.78 ? 1508 LYS A NZ  1 
ATOM   434  N  N   . LYS A 1 61  ? 19.113  10.772  22.825 1.00 19.50 ? 1509 LYS A N   1 
ATOM   435  C  CA  . LYS A 1 61  ? 19.249  9.316   23.025 1.00 19.59 ? 1509 LYS A CA  1 
ATOM   436  C  C   . LYS A 1 61  ? 17.941  8.634   23.227 1.00 18.69 ? 1509 LYS A C   1 
ATOM   437  O  O   . LYS A 1 61  ? 17.728  7.540   22.699 1.00 18.17 ? 1509 LYS A O   1 
ATOM   438  C  CB  . LYS A 1 61  ? 20.217  8.992   24.146 1.00 19.81 ? 1509 LYS A CB  1 
ATOM   439  C  CG  . LYS A 1 61  ? 20.499  7.494   24.313 1.00 23.63 ? 1509 LYS A CG  1 
ATOM   440  C  CD  . LYS A 1 61  ? 21.203  6.843   23.135 1.00 26.42 ? 1509 LYS A CD  1 
ATOM   441  C  CE  . LYS A 1 61  ? 22.674  6.717   23.401 1.00 30.37 ? 1509 LYS A CE  1 
ATOM   442  N  NZ  . LYS A 1 61  ? 23.376  6.337   22.150 1.00 33.71 ? 1509 LYS A NZ  1 
ATOM   443  N  N   . ILE A 1 62  ? 17.060  9.244   24.021 1.00 17.47 ? 1510 ILE A N   1 
ATOM   444  C  CA  . ILE A 1 62  ? 15.771  8.656   24.265 1.00 17.42 ? 1510 ILE A CA  1 
ATOM   445  C  C   . ILE A 1 62  ? 15.005  8.570   22.945 1.00 19.00 ? 1510 ILE A C   1 
ATOM   446  O  O   . ILE A 1 62  ? 14.418  7.537   22.678 1.00 18.30 ? 1510 ILE A O   1 
ATOM   447  C  CB  . ILE A 1 62  ? 14.991  9.386   25.349 1.00 17.59 ? 1510 ILE A CB  1 
ATOM   448  C  CG1 . ILE A 1 62  ? 15.683  9.115   26.691 1.00 17.40 ? 1510 ILE A CG1 1 
ATOM   449  C  CG2 . ILE A 1 62  ? 13.507  8.981   25.360 1.00 17.69 ? 1510 ILE A CG2 1 
ATOM   450  C  CD1 . ILE A 1 62  ? 15.116  9.940   27.836 1.00 18.89 ? 1510 ILE A CD1 1 
ATOM   451  N  N   . LYS A 1 63  ? 15.040  9.617   22.106 1.00 18.98 ? 1511 LYS A N   1 
ATOM   452  C  CA  . LYS A 1 63  ? 14.379  9.577   20.812 1.00 21.56 ? 1511 LYS A CA  1 
ATOM   453  C  C   . LYS A 1 63  ? 14.945  8.510   19.888 1.00 20.33 ? 1511 LYS A C   1 
ATOM   454  O  O   . LYS A 1 63  ? 14.209  7.920   19.091 1.00 20.53 ? 1511 LYS A O   1 
ATOM   455  C  CB  . LYS A 1 63  ? 14.510  10.940  20.086 1.00 23.16 ? 1511 LYS A CB  1 
ATOM   456  C  CG  . LYS A 1 63  ? 13.619  12.024  20.647 1.00 27.50 ? 1511 LYS A CG  1 
ATOM   457  C  CD  . LYS A 1 63  ? 13.829  13.341  19.918 1.00 31.39 ? 1511 LYS A CD  1 
ATOM   458  C  CE  . LYS A 1 63  ? 12.567  14.163  19.924 1.00 36.00 ? 1511 LYS A CE  1 
ATOM   459  N  NZ  . LYS A 1 63  ? 12.693  15.514  19.251 1.00 40.21 ? 1511 LYS A NZ  1 
ATOM   460  N  N   . GLU A 1 64  ? 16.253  8.304   19.967 1.00 21.26 ? 1512 GLU A N   1 
ATOM   461  C  CA  . GLU A 1 64  ? 16.963  7.224   19.208 1.00 23.65 ? 1512 GLU A CA  1 
ATOM   462  C  C   . GLU A 1 64  ? 16.566  5.817   19.667 1.00 22.54 ? 1512 GLU A C   1 
ATOM   463  O  O   . GLU A 1 64  ? 16.306  4.918   18.836 1.00 21.72 ? 1512 GLU A O   1 
ATOM   464  C  CB  . GLU A 1 64  ? 18.486  7.426   19.338 1.00 28.07 ? 1512 GLU A CB  1 
ATOM   465  C  CG  . GLU A 1 64  ? 19.440  6.277   18.973 1.00 33.09 ? 1512 GLU A CG  1 
ATOM   466  C  CD  . GLU A 1 64  ? 20.900  6.754   18.843 1.00 41.45 ? 1512 GLU A CD  1 
ATOM   467  O  OE1 . GLU A 1 64  ? 21.169  7.971   19.173 1.00 43.25 ? 1512 GLU A OE1 1 
ATOM   468  O  OE2 . GLU A 1 64  ? 21.769  5.951   18.373 1.00 46.07 ? 1512 GLU A OE2 1 
ATOM   469  N  N   . ARG A 1 65  ? 16.432  5.643   20.985 1.00 20.67 ? 1513 ARG A N   1 
ATOM   470  C  CA  . ARG A 1 65  ? 15.986  4.352   21.540 1.00 20.54 ? 1513 ARG A CA  1 
ATOM   471  C  C   . ARG A 1 65  ? 14.529  4.036   21.152 1.00 20.24 ? 1513 ARG A C   1 
ATOM   472  O  O   . ARG A 1 65  ? 14.174  2.896   20.852 1.00 18.26 ? 1513 ARG A O   1 
ATOM   473  C  CB  . ARG A 1 65  ? 16.186  4.327   23.041 1.00 21.01 ? 1513 ARG A CB  1 
ATOM   474  C  CG  . ARG A 1 65  ? 17.638  4.333   23.401 1.00 23.91 ? 1513 ARG A CG  1 
ATOM   475  C  CD  . ARG A 1 65  ? 17.886  4.251   24.897 1.00 25.65 ? 1513 ARG A CD  1 
ATOM   476  N  NE  . ARG A 1 65  ? 19.347  4.226   25.089 1.00 29.76 ? 1513 ARG A NE  1 
ATOM   477  C  CZ  . ARG A 1 65  ? 19.990  4.533   26.220 1.00 32.94 ? 1513 ARG A CZ  1 
ATOM   478  N  NH1 . ARG A 1 65  ? 19.332  4.988   27.301 1.00 31.55 ? 1513 ARG A NH1 1 
ATOM   479  N  NH2 . ARG A 1 65  ? 21.308  4.440   26.230 1.00 33.13 ? 1513 ARG A NH2 1 
ATOM   480  N  N   . ILE A 1 66  ? 13.705  5.084   21.083 1.00 19.71 ? 1514 ILE A N   1 
ATOM   481  C  CA  . ILE A 1 66  ? 12.364  4.942   20.542 1.00 19.33 ? 1514 ILE A CA  1 
ATOM   482  C  C   . ILE A 1 66  ? 12.419  4.493   19.070 1.00 20.34 ? 1514 ILE A C   1 
ATOM   483  O  O   . ILE A 1 66  ? 11.903  3.451   18.742 1.00 20.89 ? 1514 ILE A O   1 
ATOM   484  C  CB  . ILE A 1 66  ? 11.558  6.241   20.648 1.00 19.20 ? 1514 ILE A CB  1 
ATOM   485  C  CG1 . ILE A 1 66  ? 11.207  6.514   22.134 1.00 19.54 ? 1514 ILE A CG1 1 
ATOM   486  C  CG2 . ILE A 1 66  ? 10.283  6.198   19.819 1.00 19.14 ? 1514 ILE A CG2 1 
ATOM   487  C  CD1 . ILE A 1 66  ? 10.684  7.925   22.375 1.00 19.50 ? 1514 ILE A CD1 1 
ATOM   488  N  N   . ARG A 1 67  ? 13.024  5.297   18.211 1.00 20.11 ? 1515 ARG A N   1 
ATOM   489  C  CA  . ARG A 1 67  ? 13.136  5.000   16.773 1.00 21.06 ? 1515 ARG A CA  1 
ATOM   490  C  C   . ARG A 1 67  ? 13.761  3.628   16.550 1.00 19.90 ? 1515 ARG A C   1 
ATOM   491  O  O   . ARG A 1 67  ? 13.413  2.982   15.636 1.00 20.66 ? 1515 ARG A O   1 
ATOM   492  C  CB  . ARG A 1 67  ? 13.962  6.110   16.147 1.00 22.98 ? 1515 ARG A CB  1 
ATOM   493  C  CG  . ARG A 1 67  ? 14.192  6.087   14.679 1.00 26.21 ? 1515 ARG A CG  1 
ATOM   494  C  CD  . ARG A 1 67  ? 15.379  6.976   14.330 1.00 28.22 ? 1515 ARG A CD  1 
ATOM   495  N  NE  . ARG A 1 67  ? 16.582  6.218   14.672 1.00 30.37 ? 1515 ARG A NE  1 
ATOM   496  C  CZ  . ARG A 1 67  ? 17.765  6.761   14.898 1.00 31.80 ? 1515 ARG A CZ  1 
ATOM   497  N  NH1 . ARG A 1 67  ? 17.925  8.081   14.836 1.00 31.71 ? 1515 ARG A NH1 1 
ATOM   498  N  NH2 . ARG A 1 67  ? 18.779  5.984   15.217 1.00 32.61 ? 1515 ARG A NH2 1 
ATOM   499  N  N   . ASN A 1 68  ? 14.644  3.164   17.424 1.00 21.15 ? 1516 ASN A N   1 
ATOM   500  C  CA  . ASN A 1 68  ? 15.325  1.873   17.280 1.00 22.05 ? 1516 ASN A CA  1 
ATOM   501  C  C   . ASN A 1 68  ? 14.618  0.685   17.986 1.00 22.13 ? 1516 ASN A C   1 
ATOM   502  O  O   . ASN A 1 68  ? 15.219  -0.380  18.137 1.00 22.55 ? 1516 ASN A O   1 
ATOM   503  C  CB  . ASN A 1 68  ? 16.774  1.924   17.815 1.00 23.23 ? 1516 ASN A CB  1 
ATOM   504  C  CG  . ASN A 1 68  ? 17.719  2.822   17.036 1.00 24.96 ? 1516 ASN A CG  1 
ATOM   505  O  OD1 . ASN A 1 68  ? 18.852  3.063   17.494 1.00 25.09 ? 1516 ASN A OD1 1 
ATOM   506  N  ND2 . ASN A 1 68  ? 17.323  3.254   15.833 1.00 26.15 ? 1516 ASN A ND2 1 
ATOM   507  N  N   . HIS A 1 69  ? 13.387  0.888   18.453 1.00 22.10 ? 1517 HIS A N   1 
ATOM   508  C  CA  . HIS A 1 69  ? 12.587  -0.116  19.163 1.00 23.05 ? 1517 HIS A CA  1 
ATOM   509  C  C   . HIS A 1 69  ? 13.263  -0.727  20.381 1.00 24.12 ? 1517 HIS A C   1 
ATOM   510  O  O   . HIS A 1 69  ? 13.196  -1.957  20.619 1.00 23.38 ? 1517 HIS A O   1 
ATOM   511  C  CB  . HIS A 1 69  ? 12.163  -1.220  18.219 1.00 22.32 ? 1517 HIS A CB  1 
ATOM   512  C  CG  . HIS A 1 69  ? 11.123  -0.793  17.259 1.00 23.29 ? 1517 HIS A CG  1 
ATOM   513  N  ND1 . HIS A 1 69  ? 10.121  -1.622  16.846 1.00 23.70 ? 1517 HIS A ND1 1 
ATOM   514  C  CD2 . HIS A 1 69  ? 10.925  0.388   16.624 1.00 25.06 ? 1517 HIS A CD2 1 
ATOM   515  C  CE1 . HIS A 1 69  ? 9.340   -0.983  16.004 1.00 25.48 ? 1517 HIS A CE1 1 
ATOM   516  N  NE2 . HIS A 1 69  ? 9.798   0.247   15.870 1.00 25.76 ? 1517 HIS A NE2 1 
ATOM   517  N  N   . LYS A 1 70  ? 13.857  0.130   21.194 1.00 24.89 ? 1518 LYS A N   1 
ATOM   518  C  CA  . LYS A 1 70  ? 14.587  -0.372  22.324 1.00 26.96 ? 1518 LYS A CA  1 
ATOM   519  C  C   . LYS A 1 70  ? 13.751  -0.421  23.574 1.00 28.91 ? 1518 LYS A C   1 
ATOM   520  O  O   . LYS A 1 70  ? 14.216  -0.975  24.578 1.00 32.82 ? 1518 LYS A O   1 
ATOM   521  C  CB  . LYS A 1 70  ? 15.852  0.441   22.598 1.00 27.34 ? 1518 LYS A CB  1 
ATOM   522  C  CG  . LYS A 1 70  ? 16.899  0.438   21.508 1.00 29.35 ? 1518 LYS A CG  1 
ATOM   523  C  CD  . LYS A 1 70  ? 17.393  -0.969  21.212 1.00 31.69 ? 1518 LYS A CD  1 
ATOM   524  C  CE  . LYS A 1 70  ? 18.887  -0.948  20.938 1.00 35.21 ? 1518 LYS A CE  1 
ATOM   525  N  NZ  . LYS A 1 70  ? 19.309  -2.111  20.119 1.00 38.31 ? 1518 LYS A NZ  1 
ATOM   526  N  N   . TYR A 1 71  ? 12.584  0.211   23.559 1.00 27.72 ? 1519 TYR A N   1 
ATOM   527  C  CA  . TYR A 1 71  ? 11.676  0.184   24.688 1.00 26.84 ? 1519 TYR A CA  1 
ATOM   528  C  C   . TYR A 1 71  ? 10.545  -0.764  24.380 1.00 30.76 ? 1519 TYR A C   1 
ATOM   529  O  O   . TYR A 1 71  ? 9.896   -0.688  23.324 1.00 36.11 ? 1519 TYR A O   1 
ATOM   530  C  CB  . TYR A 1 71  ? 11.099  1.541   25.020 1.00 25.19 ? 1519 TYR A CB  1 
ATOM   531  C  CG  . TYR A 1 71  ? 12.101  2.597   25.338 1.00 23.17 ? 1519 TYR A CG  1 
ATOM   532  C  CD1 . TYR A 1 71  ? 13.067  2.411   26.339 1.00 20.35 ? 1519 TYR A CD1 1 
ATOM   533  C  CD2 . TYR A 1 71  ? 12.073  3.817   24.665 1.00 22.28 ? 1519 TYR A CD2 1 
ATOM   534  C  CE1 . TYR A 1 71  ? 13.957  3.402   26.660 1.00 19.83 ? 1519 TYR A CE1 1 
ATOM   535  C  CE2 . TYR A 1 71  ? 13.002  4.784   24.946 1.00 20.51 ? 1519 TYR A CE2 1 
ATOM   536  C  CZ  . TYR A 1 71  ? 13.947  4.584   25.946 1.00 19.88 ? 1519 TYR A CZ  1 
ATOM   537  O  OH  . TYR A 1 71  ? 14.879  5.573   26.211 1.00 16.82 ? 1519 TYR A OH  1 
ATOM   538  N  N   . ARG A 1 72  ? 10.332  -1.676  25.311 1.00 32.40 ? 1520 ARG A N   1 
ATOM   539  C  CA  . ARG A 1 72  ? 9.310   -2.669  25.179 1.00 36.79 ? 1520 ARG A CA  1 
ATOM   540  C  C   . ARG A 1 72  ? 7.983   -2.116  25.689 1.00 34.25 ? 1520 ARG A C   1 
ATOM   541  O  O   . ARG A 1 72  ? 6.971   -2.542  25.200 1.00 31.26 ? 1520 ARG A O   1 
ATOM   542  C  CB  . ARG A 1 72  ? 9.767   -3.902  25.964 1.00 42.97 ? 1520 ARG A CB  1 
ATOM   543  C  CG  . ARG A 1 72  ? 8.820   -5.073  25.966 1.00 54.53 ? 1520 ARG A CG  1 
ATOM   544  C  CD  . ARG A 1 72  ? 9.081   -5.892  27.207 1.00 62.72 ? 1520 ARG A CD  1 
ATOM   545  N  NE  . ARG A 1 72  ? 8.553   -7.224  27.028 1.00 69.39 ? 1520 ARG A NE  1 
ATOM   546  C  CZ  . ARG A 1 72  ? 9.183   -8.200  26.379 1.00 79.48 ? 1520 ARG A CZ  1 
ATOM   547  N  NH1 . ARG A 1 72  ? 10.401  -8.017  25.856 1.00 78.08 ? 1520 ARG A NH1 1 
ATOM   548  N  NH2 . ARG A 1 72  ? 8.589   -9.384  26.266 1.00 85.15 ? 1520 ARG A NH2 1 
ATOM   549  N  N   . SER A 1 73  ? 7.995   -1.231  26.710 1.00 32.57 ? 1521 SER A N   1 
ATOM   550  C  CA  . SER A 1 73  ? 6.757   -0.691  27.315 1.00 31.57 ? 1521 SER A CA  1 
ATOM   551  C  C   . SER A 1 73  ? 6.873   0.807   27.558 1.00 30.38 ? 1521 SER A C   1 
ATOM   552  O  O   . SER A 1 73  ? 7.959   1.332   27.563 1.00 32.55 ? 1521 SER A O   1 
ATOM   553  C  CB  . SER A 1 73  ? 6.425   -1.353  28.659 1.00 34.40 ? 1521 SER A CB  1 
ATOM   554  O  OG  . SER A 1 73  ? 7.523   -1.291  29.545 1.00 36.43 ? 1521 SER A OG  1 
ATOM   555  N  N   . LEU A 1 74  ? 5.747   1.490   27.712 1.00 28.96 ? 1522 LEU A N   1 
ATOM   556  C  CA  . LEU A 1 74  ? 5.738   2.861   28.208 1.00 30.16 ? 1522 LEU A CA  1 
ATOM   557  C  C   . LEU A 1 74  ? 6.477   2.955   29.566 1.00 27.09 ? 1522 LEU A C   1 
ATOM   558  O  O   . LEU A 1 74  ? 7.142   3.966   29.846 1.00 24.30 ? 1522 LEU A O   1 
ATOM   559  C  CB  . LEU A 1 74  ? 4.321   3.405   28.309 1.00 32.50 ? 1522 LEU A CB  1 
ATOM   560  C  CG  . LEU A 1 74  ? 3.592   3.693   26.998 1.00 32.80 ? 1522 LEU A CG  1 
ATOM   561  C  CD1 . LEU A 1 74  ? 2.249   4.395   27.219 1.00 31.16 ? 1522 LEU A CD1 1 
ATOM   562  C  CD2 . LEU A 1 74  ? 4.435   4.565   26.095 1.00 33.09 ? 1522 LEU A CD2 1 
ATOM   563  N  N   . ASN A 1 75  ? 6.412   1.898   30.365 1.00 25.13 ? 1523 ASN A N   1 
ATOM   564  C  CA  . ASN A 1 75  ? 7.228   1.812   31.575 1.00 26.09 ? 1523 ASN A CA  1 
ATOM   565  C  C   . ASN A 1 75  ? 8.750   1.865   31.365 1.00 26.47 ? 1523 ASN A C   1 
ATOM   566  O  O   . ASN A 1 75  ? 9.460   2.508   32.155 1.00 25.51 ? 1523 ASN A O   1 
ATOM   567  C  CB  . ASN A 1 75  ? 6.881   0.559   32.392 1.00 27.12 ? 1523 ASN A CB  1 
ATOM   568  C  CG  . ASN A 1 75  ? 5.536   0.689   33.093 1.00 28.54 ? 1523 ASN A CG  1 
ATOM   569  O  OD1 . ASN A 1 75  ? 4.917   1.762   33.070 1.00 26.85 ? 1523 ASN A OD1 1 
ATOM   570  N  ND2 . ASN A 1 75  ? 5.090   -0.390  33.746 1.00 30.45 ? 1523 ASN A ND2 1 
ATOM   571  N  N   . ASP A 1 76  ? 9.243   1.189   30.340 1.00 22.99 ? 1524 ASP A N   1 
ATOM   572  C  CA  . ASP A 1 76  ? 10.628  1.311   30.010 1.00 26.61 ? 1524 ASP A CA  1 
ATOM   573  C  C   . ASP A 1 76  ? 10.969  2.698   29.510 1.00 22.76 ? 1524 ASP A C   1 
ATOM   574  O  O   . ASP A 1 76  ? 12.035  3.156   29.825 1.00 23.66 ? 1524 ASP A O   1 
ATOM   575  C  CB  . ASP A 1 76  ? 11.037  0.263   28.999 1.00 29.74 ? 1524 ASP A CB  1 
ATOM   576  C  CG  . ASP A 1 76  ? 10.762  -1.140  29.503 1.00 35.34 ? 1524 ASP A CG  1 
ATOM   577  O  OD1 . ASP A 1 76  ? 11.282  -1.495  30.571 1.00 39.81 ? 1524 ASP A OD1 1 
ATOM   578  O  OD2 . ASP A 1 76  ? 10.009  -1.877  28.849 1.00 44.34 ? 1524 ASP A OD2 1 
ATOM   579  N  N   . LEU A 1 77  ? 10.112  3.346   28.719 1.00 21.85 ? 1525 LEU A N   1 
ATOM   580  C  CA  . LEU A 1 77  ? 10.341  4.759   28.365 1.00 22.05 ? 1525 LEU A CA  1 
ATOM   581  C  C   . LEU A 1 77  ? 10.421  5.639   29.628 1.00 21.97 ? 1525 LEU A C   1 
ATOM   582  O  O   . LEU A 1 77  ? 11.407  6.352   29.816 1.00 21.70 ? 1525 LEU A O   1 
ATOM   583  C  CB  . LEU A 1 77  ? 9.239   5.309   27.453 1.00 21.86 ? 1525 LEU A CB  1 
ATOM   584  C  CG  . LEU A 1 77  ? 9.342   6.783   27.111 1.00 22.53 ? 1525 LEU A CG  1 
ATOM   585  C  CD1 . LEU A 1 77  ? 10.723  7.189   26.614 1.00 20.13 ? 1525 LEU A CD1 1 
ATOM   586  C  CD2 . LEU A 1 77  ? 8.286   7.103   26.052 1.00 25.41 ? 1525 LEU A CD2 1 
ATOM   587  N  N   . GLU A 1 78  ? 9.430   5.529   30.518 1.00 21.66 ? 1526 GLU A N   1 
ATOM   588  C  CA  . GLU A 1 78  ? 9.409   6.326   31.737 1.00 21.75 ? 1526 GLU A CA  1 
ATOM   589  C  C   . GLU A 1 78  ? 10.701  6.150   32.542 1.00 22.71 ? 1526 GLU A C   1 
ATOM   590  O  O   . GLU A 1 78  ? 11.294  7.101   33.060 1.00 22.03 ? 1526 GLU A O   1 
ATOM   591  C  CB  . GLU A 1 78  ? 8.202   5.925   32.594 1.00 23.15 ? 1526 GLU A CB  1 
ATOM   592  C  CG  . GLU A 1 78  ? 8.155   6.597   33.944 1.00 23.52 ? 1526 GLU A CG  1 
ATOM   593  C  CD  . GLU A 1 78  ? 6.790   6.545   34.618 1.00 28.06 ? 1526 GLU A CD  1 
ATOM   594  O  OE1 . GLU A 1 78  ? 5.714   6.553   33.927 1.00 29.97 ? 1526 GLU A OE1 1 
ATOM   595  O  OE2 . GLU A 1 78  ? 6.814   6.544   35.862 1.00 28.88 ? 1526 GLU A OE2 1 
ATOM   596  N  N   . LYS A 1 79  ? 11.142  4.910   32.647 1.00 23.81 ? 1527 LYS A N   1 
ATOM   597  C  CA  . LYS A 1 79  ? 12.348  4.604   33.373 1.00 25.33 ? 1527 LYS A CA  1 
ATOM   598  C  C   . LYS A 1 79  ? 13.587  5.357   32.876 1.00 24.82 ? 1527 LYS A C   1 
ATOM   599  O  O   . LYS A 1 79  ? 14.389  5.848   33.671 1.00 21.48 ? 1527 LYS A O   1 
ATOM   600  C  CB  . LYS A 1 79  ? 12.565  3.128   33.253 1.00 28.80 ? 1527 LYS A CB  1 
ATOM   601  C  CG  . LYS A 1 79  ? 13.807  2.607   33.883 1.00 32.89 ? 1527 LYS A CG  1 
ATOM   602  C  CD  . LYS A 1 79  ? 13.585  1.120   34.124 1.00 36.20 ? 1527 LYS A CD  1 
ATOM   603  C  CE  . LYS A 1 79  ? 13.975  0.755   35.533 1.00 40.03 ? 1527 LYS A CE  1 
ATOM   604  N  NZ  . LYS A 1 79  ? 15.461  0.745   35.499 1.00 47.48 ? 1527 LYS A NZ  1 
ATOM   605  N  N   . ASP A 1 80  ? 13.707  5.522   31.561 1.00 22.28 ? 1528 ASP A N   1 
ATOM   606  C  CA  . ASP A 1 80  ? 14.848  6.226   31.036 1.00 21.78 ? 1528 ASP A CA  1 
ATOM   607  C  C   . ASP A 1 80  ? 14.713  7.737   31.247 1.00 19.90 ? 1528 ASP A C   1 
ATOM   608  O  O   . ASP A 1 80  ? 15.705  8.433   31.457 1.00 19.00 ? 1528 ASP A O   1 
ATOM   609  C  CB  . ASP A 1 80  ? 15.007  5.906   29.531 1.00 22.99 ? 1528 ASP A CB  1 
ATOM   610  C  CG  . ASP A 1 80  ? 16.379  5.355   29.191 1.00 26.14 ? 1528 ASP A CG  1 
ATOM   611  O  OD1 . ASP A 1 80  ? 17.112  4.983   30.139 1.00 28.91 ? 1528 ASP A OD1 1 
ATOM   612  O  OD2 . ASP A 1 80  ? 16.712  5.270   27.967 1.00 24.22 ? 1528 ASP A OD2 1 
ATOM   613  N  N   . VAL A 1 81  ? 13.511  8.274   31.092 1.00 19.07 ? 1529 VAL A N   1 
ATOM   614  C  CA  . VAL A 1 81  ? 13.276  9.688   31.421 1.00 18.60 ? 1529 VAL A CA  1 
ATOM   615  C  C   . VAL A 1 81  ? 13.584  9.974   32.899 1.00 17.64 ? 1529 VAL A C   1 
ATOM   616  O  O   . VAL A 1 81  ? 14.216  10.980  33.208 1.00 16.11 ? 1529 VAL A O   1 
ATOM   617  C  CB  . VAL A 1 81  ? 11.836  10.120  31.096 1.00 20.11 ? 1529 VAL A CB  1 
ATOM   618  C  CG1 . VAL A 1 81  ? 11.554  11.529  31.561 1.00 21.44 ? 1529 VAL A CG1 1 
ATOM   619  C  CG2 . VAL A 1 81  ? 11.553  10.028  29.607 1.00 22.22 ? 1529 VAL A CG2 1 
ATOM   620  N  N   . MET A 1 82  ? 13.091  9.129   33.812 1.00 18.67 ? 1530 MET A N   1 
ATOM   621  C  CA  . MET A 1 82  ? 13.324  9.357   35.210 1.00 20.00 ? 1530 MET A CA  1 
ATOM   622  C  C   . MET A 1 82  ? 14.825  9.253   35.523 1.00 20.63 ? 1530 MET A C   1 
ATOM   623  O  O   . MET A 1 82  ? 15.335  9.951   36.384 1.00 22.12 ? 1530 MET A O   1 
ATOM   624  C  CB  . MET A 1 82  ? 12.520  8.372   36.067 1.00 22.46 ? 1530 MET A CB  1 
ATOM   625  C  CG  . MET A 1 82  ? 11.019  8.558   35.910 1.00 24.94 ? 1530 MET A CG  1 
ATOM   626  S  SD  . MET A 1 82  ? 10.516  10.233  36.346 1.00 26.35 ? 1530 MET A SD  1 
ATOM   627  C  CE  . MET A 1 82  ? 8.827   10.337  35.790 1.00 28.30 ? 1530 MET A CE  1 
ATOM   628  N  N   . LEU A 1 83  ? 15.532  8.364   34.837 1.00 21.92 ? 1531 LEU A N   1 
ATOM   629  C  CA  . LEU A 1 83  ? 16.987  8.303   34.947 1.00 21.46 ? 1531 LEU A CA  1 
ATOM   630  C  C   . LEU A 1 83  ? 17.703  9.584   34.447 1.00 19.30 ? 1531 LEU A C   1 
ATOM   631  O  O   . LEU A 1 83  ? 18.656  10.003  35.067 1.00 19.97 ? 1531 LEU A O   1 
ATOM   632  C  CB  . LEU A 1 83  ? 17.481  7.112   34.191 1.00 23.32 ? 1531 LEU A CB  1 
ATOM   633  C  CG  . LEU A 1 83  ? 18.991  6.797   34.144 1.00 25.36 ? 1531 LEU A CG  1 
ATOM   634  C  CD1 . LEU A 1 83  ? 19.513  6.460   35.525 1.00 24.17 ? 1531 LEU A CD1 1 
ATOM   635  C  CD2 . LEU A 1 83  ? 19.166  5.595   33.205 1.00 26.54 ? 1531 LEU A CD2 1 
ATOM   636  N  N   . LEU A 1 84  ? 17.326  10.136  33.296 1.00 17.51 ? 1532 LEU A N   1 
ATOM   637  C  CA  . LEU A 1 84  ? 17.871  11.410  32.862 1.00 16.78 ? 1532 LEU A CA  1 
ATOM   638  C  C   . LEU A 1 84  ? 17.712  12.426  33.999 1.00 16.76 ? 1532 LEU A C   1 
ATOM   639  O  O   . LEU A 1 84  ? 18.633  13.125  34.368 1.00 16.60 ? 1532 LEU A O   1 
ATOM   640  C  CB  . LEU A 1 84  ? 17.090  11.903  31.635 1.00 16.43 ? 1532 LEU A CB  1 
ATOM   641  C  CG  . LEU A 1 84  ? 17.596  13.128  30.893 1.00 15.94 ? 1532 LEU A CG  1 
ATOM   642  C  CD1 . LEU A 1 84  ? 17.028  13.079  29.474 1.00 17.24 ? 1532 LEU A CD1 1 
ATOM   643  C  CD2 . LEU A 1 84  ? 17.215  14.444  31.560 1.00 15.91 ? 1532 LEU A CD2 1 
ATOM   644  N  N   . CYS A 1 85  ? 16.543  12.491  34.592 1.00 17.18 ? 1533 CYS A N   1 
ATOM   645  C  CA  . CYS A 1 85  ? 16.319  13.468  35.649 1.00 18.33 ? 1533 CYS A CA  1 
ATOM   646  C  C   . CYS A 1 85  ? 17.154  13.162  36.894 1.00 18.19 ? 1533 CYS A C   1 
ATOM   647  O  O   . CYS A 1 85  ? 17.767  14.066  37.476 1.00 17.74 ? 1533 CYS A O   1 
ATOM   648  C  CB  . CYS A 1 85  ? 14.820  13.601  35.980 1.00 20.24 ? 1533 CYS A CB  1 
ATOM   649  S  SG  . CYS A 1 85  ? 13.800  14.131  34.595 1.00 23.32 ? 1533 CYS A SG  1 
ATOM   650  N  N   . GLN A 1 86  ? 17.205  11.903  37.288 1.00 18.70 ? 1534 GLN A N   1 
ATOM   651  C  CA  . GLN A 1 86  ? 18.079  11.495  38.401 1.00 21.30 ? 1534 GLN A CA  1 
ATOM   652  C  C   . GLN A 1 86  ? 19.536  11.885  38.181 1.00 19.80 ? 1534 GLN A C   1 
ATOM   653  O  O   . GLN A 1 86  ? 20.202  12.376  39.062 1.00 19.94 ? 1534 GLN A O   1 
ATOM   654  C  CB  . GLN A 1 86  ? 17.985  9.973   38.577 1.00 23.80 ? 1534 GLN A CB  1 
ATOM   655  C  CG  . GLN A 1 86  ? 18.817  9.384   39.688 1.00 28.84 ? 1534 GLN A CG  1 
ATOM   656  C  CD  . GLN A 1 86  ? 18.861  7.848   39.623 1.00 35.29 ? 1534 GLN A CD  1 
ATOM   657  O  OE1 . GLN A 1 86  ? 17.942  7.207   39.143 1.00 38.34 ? 1534 GLN A OE1 1 
ATOM   658  N  NE2 . GLN A 1 86  ? 19.987  7.264   40.045 1.00 41.76 ? 1534 GLN A NE2 1 
ATOM   659  N  N   . ASN A 1 87  ? 20.027  11.639  36.983 1.00 18.69 ? 1535 ASN A N   1 
ATOM   660  C  CA  . ASN A 1 87  ? 21.376  11.982  36.598 1.00 18.94 ? 1535 ASN A CA  1 
ATOM   661  C  C   . ASN A 1 87  ? 21.605  13.497  36.674 1.00 17.94 ? 1535 ASN A C   1 
ATOM   662  O  O   . ASN A 1 87  ? 22.627  13.956  37.188 1.00 16.99 ? 1535 ASN A O   1 
ATOM   663  C  CB  . ASN A 1 87  ? 21.658  11.516  35.153 1.00 18.43 ? 1535 ASN A CB  1 
ATOM   664  C  CG  . ASN A 1 87  ? 21.867  10.020  35.027 1.00 19.88 ? 1535 ASN A CG  1 
ATOM   665  O  OD1 . ASN A 1 87  ? 22.056  9.343   36.028 1.00 18.63 ? 1535 ASN A OD1 1 
ATOM   666  N  ND2 . ASN A 1 87  ? 21.915  9.502   33.745 1.00 19.42 ? 1535 ASN A ND2 1 
ATOM   667  N  N   . ALA A 1 88  ? 20.635  14.275  36.210 1.00 17.46 ? 1536 ALA A N   1 
ATOM   668  C  CA  . ALA A 1 88  ? 20.717  15.720  36.393 1.00 16.86 ? 1536 ALA A CA  1 
ATOM   669  C  C   . ALA A 1 88  ? 20.797  16.125  37.841 1.00 17.64 ? 1536 ALA A C   1 
ATOM   670  O  O   . ALA A 1 88  ? 21.534  17.063  38.140 1.00 17.87 ? 1536 ALA A O   1 
ATOM   671  C  CB  . ALA A 1 88  ? 19.560  16.456  35.700 1.00 16.50 ? 1536 ALA A CB  1 
ATOM   672  N  N   . GLN A 1 89  ? 20.045  15.467  38.719 1.00 17.89 ? 1537 GLN A N   1 
ATOM   673  C  CA  . GLN A 1 89  ? 20.057  15.825  40.138 1.00 18.85 ? 1537 GLN A CA  1 
ATOM   674  C  C   . GLN A 1 89  ? 21.349  15.384  40.856 1.00 19.92 ? 1537 GLN A C   1 
ATOM   675  O  O   . GLN A 1 89  ? 21.763  15.976  41.880 1.00 19.70 ? 1537 GLN A O   1 
ATOM   676  C  CB  . GLN A 1 89  ? 18.822  15.283  40.834 1.00 19.64 ? 1537 GLN A CB  1 
ATOM   677  C  CG  . GLN A 1 89  ? 17.538  16.006  40.394 1.00 20.29 ? 1537 GLN A CG  1 
ATOM   678  C  CD  . GLN A 1 89  ? 16.326  15.081  40.429 1.00 21.38 ? 1537 GLN A CD  1 
ATOM   679  O  OE1 . GLN A 1 89  ? 16.172  14.324  41.369 1.00 22.76 ? 1537 GLN A OE1 1 
ATOM   680  N  NE2 . GLN A 1 89  ? 15.464  15.147  39.418 1.00 20.24 ? 1537 GLN A NE2 1 
ATOM   681  N  N   . THR A 1 90  ? 22.018  14.377  40.308 1.00 20.98 ? 1538 THR A N   1 
ATOM   682  C  CA  . THR A 1 90  ? 23.304  13.918  40.848 1.00 22.13 ? 1538 THR A CA  1 
ATOM   683  C  C   . THR A 1 90  ? 24.436  14.849  40.429 1.00 21.95 ? 1538 THR A C   1 
ATOM   684  O  O   . THR A 1 90  ? 25.250  15.211  41.260 1.00 21.64 ? 1538 THR A O   1 
ATOM   685  C  CB  . THR A 1 90  ? 23.611  12.504  40.340 1.00 22.80 ? 1538 THR A CB  1 
ATOM   686  O  OG1 . THR A 1 90  ? 22.608  11.610  40.849 1.00 24.09 ? 1538 THR A OG1 1 
ATOM   687  C  CG2 . THR A 1 90  ? 25.012  12.046  40.770 1.00 24.21 ? 1538 THR A CG2 1 
ATOM   688  N  N   . PHE A 1 91  ? 24.489  15.242  39.148 1.00 21.93 ? 1539 PHE A N   1 
ATOM   689  C  CA  . PHE A 1 91  ? 25.548  16.100  38.628 1.00 22.48 ? 1539 PHE A CA  1 
ATOM   690  C  C   . PHE A 1 91  ? 25.447  17.558  39.085 1.00 23.03 ? 1539 PHE A C   1 
ATOM   691  O  O   . PHE A 1 91  ? 26.477  18.175  39.386 1.00 22.79 ? 1539 PHE A O   1 
ATOM   692  C  CB  . PHE A 1 91  ? 25.645  16.034  37.092 1.00 22.65 ? 1539 PHE A CB  1 
ATOM   693  C  CG  . PHE A 1 91  ? 26.767  16.846  36.535 1.00 24.99 ? 1539 PHE A CG  1 
ATOM   694  C  CD1 . PHE A 1 91  ? 28.091  16.424  36.692 1.00 25.96 ? 1539 PHE A CD1 1 
ATOM   695  C  CD2 . PHE A 1 91  ? 26.522  18.054  35.888 1.00 24.52 ? 1539 PHE A CD2 1 
ATOM   696  C  CE1 . PHE A 1 91  ? 29.135  17.181  36.196 1.00 27.57 ? 1539 PHE A CE1 1 
ATOM   697  C  CE2 . PHE A 1 91  ? 27.569  18.824  35.410 1.00 26.02 ? 1539 PHE A CE2 1 
ATOM   698  C  CZ  . PHE A 1 91  ? 28.876  18.387  35.564 1.00 27.15 ? 1539 PHE A CZ  1 
ATOM   699  N  N   . ASN A 1 92  ? 24.236  18.121  39.094 1.00 21.30 ? 1540 ASN A N   1 
ATOM   700  C  CA  . ASN A 1 92  ? 24.051  19.524  39.384 1.00 20.75 ? 1540 ASN A CA  1 
ATOM   701  C  C   . ASN A 1 92  ? 23.655  19.701  40.835 1.00 22.79 ? 1540 ASN A C   1 
ATOM   702  O  O   . ASN A 1 92  ? 23.114  18.813  41.430 1.00 21.97 ? 1540 ASN A O   1 
ATOM   703  C  CB  . ASN A 1 92  ? 22.985  20.142  38.459 1.00 19.28 ? 1540 ASN A CB  1 
ATOM   704  C  CG  . ASN A 1 92  ? 23.321  19.966  36.978 1.00 18.35 ? 1540 ASN A CG  1 
ATOM   705  O  OD1 . ASN A 1 92  ? 24.080  20.735  36.389 1.00 17.92 ? 1540 ASN A OD1 1 
ATOM   706  N  ND2 . ASN A 1 92  ? 22.747  18.937  36.364 1.00 18.24 ? 1540 ASN A ND2 1 
ATOM   707  N  N   . LEU A 1 93  ? 23.902  20.873  41.396 1.00 24.99 ? 1541 LEU A N   1 
ATOM   708  C  CA  . LEU A 1 93  ? 23.598  21.101  42.822 1.00 26.66 ? 1541 LEU A CA  1 
ATOM   709  C  C   . LEU A 1 93  ? 22.111  21.323  43.094 1.00 23.90 ? 1541 LEU A C   1 
ATOM   710  O  O   . LEU A 1 93  ? 21.409  21.966  42.311 1.00 22.86 ? 1541 LEU A O   1 
ATOM   711  C  CB  . LEU A 1 93  ? 24.371  22.350  43.300 1.00 32.74 ? 1541 LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 93  ? 25.877  22.075  43.568 1.00 38.01 ? 1541 LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 93  ? 26.763  22.657  42.476 1.00 41.00 ? 1541 LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 93  ? 26.354  22.584  44.929 1.00 39.19 ? 1541 LEU A CD2 1 
ATOM   715  N  N   . GLU A 1 94  ? 21.642  20.827  44.226 1.00 23.35 ? 1542 GLU A N   1 
ATOM   716  C  CA  . GLU A 1 94  ? 20.316  21.079  44.727 1.00 22.40 ? 1542 GLU A CA  1 
ATOM   717  C  C   . GLU A 1 94  ? 20.259  22.599  45.002 1.00 21.69 ? 1542 GLU A C   1 
ATOM   718  O  O   . GLU A 1 94  ? 21.179  23.140  45.582 1.00 22.66 ? 1542 GLU A O   1 
ATOM   719  C  CB  . GLU A 1 94  ? 20.055  20.221  45.986 1.00 23.62 ? 1542 GLU A CB  1 
ATOM   720  C  CG  . GLU A 1 94  ? 18.664  20.332  46.568 1.00 25.62 ? 1542 GLU A CG  1 
ATOM   721  C  CD  . GLU A 1 94  ? 18.281  19.257  47.602 1.00 29.45 ? 1542 GLU A CD  1 
ATOM   722  O  OE1 . GLU A 1 94  ? 19.137  18.436  48.057 1.00 33.17 ? 1542 GLU A OE1 1 
ATOM   723  O  OE2 . GLU A 1 94  ? 17.081  19.277  47.997 1.00 29.36 ? 1542 GLU A OE2 1 
ATOM   724  N  N   . GLY A 1 95  ? 19.216  23.279  44.532 1.00 19.67 ? 1543 GLY A N   1 
ATOM   725  C  CA  . GLY A 1 95  ? 19.158  24.740  44.574 1.00 19.27 ? 1543 GLY A CA  1 
ATOM   726  C  C   . GLY A 1 95  ? 19.490  25.434  43.245 1.00 18.50 ? 1543 GLY A C   1 
ATOM   727  O  O   . GLY A 1 95  ? 19.337  26.637  43.148 1.00 18.25 ? 1543 GLY A O   1 
ATOM   728  N  N   . SER A 1 96  ? 19.995  24.678  42.262 1.00 17.87 ? 1544 SER A N   1 
ATOM   729  C  CA  . SER A 1 96  ? 20.262  25.207  40.945 1.00 17.87 ? 1544 SER A CA  1 
ATOM   730  C  C   . SER A 1 96  ? 18.978  25.131  40.106 1.00 16.99 ? 1544 SER A C   1 
ATOM   731  O  O   . SER A 1 96  ? 18.085  24.308  40.362 1.00 16.63 ? 1544 SER A O   1 
ATOM   732  C  CB  . SER A 1 96  ? 21.466  24.509  40.272 1.00 18.20 ? 1544 SER A CB  1 
ATOM   733  O  OG  . SER A 1 96  ? 21.209  23.139  39.912 1.00 19.00 ? 1544 SER A OG  1 
ATOM   734  N  N   . LEU A 1 97  ? 18.876  26.021  39.115 1.00 16.16 ? 1545 LEU A N   1 
ATOM   735  C  CA  . LEU A 1 97  ? 17.755  25.956  38.193 1.00 15.78 ? 1545 LEU A CA  1 
ATOM   736  C  C   . LEU A 1 97  ? 17.708  24.629  37.429 1.00 16.14 ? 1545 LEU A C   1 
ATOM   737  O  O   . LEU A 1 97  ? 16.627  24.047  37.243 1.00 15.88 ? 1545 LEU A O   1 
ATOM   738  C  CB  . LEU A 1 97  ? 17.815  27.138  37.217 1.00 15.56 ? 1545 LEU A CB  1 
ATOM   739  C  CG  . LEU A 1 97  ? 16.694  27.257  36.233 1.00 15.03 ? 1545 LEU A CG  1 
ATOM   740  C  CD1 . LEU A 1 97  ? 15.362  27.368  36.928 1.00 15.05 ? 1545 LEU A CD1 1 
ATOM   741  C  CD2 . LEU A 1 97  ? 16.959  28.467  35.357 1.00 15.57 ? 1545 LEU A CD2 1 
ATOM   742  N  N   . ILE A 1 98  ? 18.855  24.168  36.958 1.00 16.48 ? 1546 ILE A N   1 
ATOM   743  C  CA  . ILE A 1 98  ? 18.848  22.963  36.106 1.00 16.66 ? 1546 ILE A CA  1 
ATOM   744  C  C   . ILE A 1 98  ? 18.330  21.783  36.901 1.00 15.55 ? 1546 ILE A C   1 
ATOM   745  O  O   . ILE A 1 98  ? 17.502  20.995  36.430 1.00 14.91 ? 1546 ILE A O   1 
ATOM   746  C  CB  . ILE A 1 98  ? 20.248  22.689  35.505 1.00 17.69 ? 1546 ILE A CB  1 
ATOM   747  C  CG1 . ILE A 1 98  ? 20.234  21.352  34.758 1.00 17.89 ? 1546 ILE A CG1 1 
ATOM   748  C  CG2 . ILE A 1 98  ? 21.367  22.676  36.575 1.00 18.76 ? 1546 ILE A CG2 1 
ATOM   749  C  CD1 . ILE A 1 98  ? 21.353  21.243  33.721 1.00 19.06 ? 1546 ILE A CD1 1 
ATOM   750  N  N   . TYR A 1 99  ? 18.819  21.660  38.126 1.00 15.47 ? 1547 TYR A N   1 
ATOM   751  C  CA  . TYR A 1 99  ? 18.337  20.619  39.043 1.00 16.69 ? 1547 TYR A CA  1 
ATOM   752  C  C   . TYR A 1 99  ? 16.819  20.657  39.148 1.00 16.28 ? 1547 TYR A C   1 
ATOM   753  O  O   . TYR A 1 99  ? 16.164  19.641  39.026 1.00 16.65 ? 1547 TYR A O   1 
ATOM   754  C  CB  . TYR A 1 99  ? 18.944  20.867  40.428 1.00 18.10 ? 1547 TYR A CB  1 
ATOM   755  C  CG  . TYR A 1 99  ? 18.682  19.852  41.487 1.00 19.52 ? 1547 TYR A CG  1 
ATOM   756  C  CD1 . TYR A 1 99  ? 17.491  19.872  42.186 1.00 21.18 ? 1547 TYR A CD1 1 
ATOM   757  C  CD2 . TYR A 1 99  ? 19.689  18.953  41.888 1.00 20.00 ? 1547 TYR A CD2 1 
ATOM   758  C  CE1 . TYR A 1 99  ? 17.288  19.025  43.231 1.00 23.38 ? 1547 TYR A CE1 1 
ATOM   759  C  CE2 . TYR A 1 99  ? 19.459  18.037  42.908 1.00 23.09 ? 1547 TYR A CE2 1 
ATOM   760  C  CZ  . TYR A 1 99  ? 18.235  18.083  43.564 1.00 23.89 ? 1547 TYR A CZ  1 
ATOM   761  O  OH  . TYR A 1 99  ? 17.942  17.241  44.608 1.00 27.62 ? 1547 TYR A OH  1 
ATOM   762  N  N   . GLU A 1 100 ? 16.258  21.847  39.327 1.00 15.97 ? 1548 GLU A N   1 
ATOM   763  C  CA  . GLU A 1 100 ? 14.841  21.960  39.565 1.00 16.67 ? 1548 GLU A CA  1 
ATOM   764  C  C   . GLU A 1 100 ? 14.079  21.664  38.261 1.00 15.66 ? 1548 GLU A C   1 
ATOM   765  O  O   . GLU A 1 100 ? 12.991  21.109  38.279 1.00 15.87 ? 1548 GLU A O   1 
ATOM   766  C  CB  . GLU A 1 100 ? 14.460  23.375  40.118 1.00 16.87 ? 1548 GLU A CB  1 
ATOM   767  C  CG  . GLU A 1 100 ? 13.174  23.361  40.950 1.00 18.58 ? 1548 GLU A CG  1 
ATOM   768  C  CD  . GLU A 1 100 ? 13.299  22.514  42.217 1.00 20.24 ? 1548 GLU A CD  1 
ATOM   769  O  OE1 . GLU A 1 100 ? 14.429  22.304  42.723 1.00 20.99 ? 1548 GLU A OE1 1 
ATOM   770  O  OE2 . GLU A 1 100 ? 12.267  21.990  42.674 1.00 23.26 ? 1548 GLU A OE2 1 
ATOM   771  N  N   . ASP A 1 101 ? 14.595  22.131  37.143 1.00 16.09 ? 1549 ASP A N   1 
ATOM   772  C  CA  . ASP A 1 101 ? 13.963  21.809  35.883 1.00 16.42 ? 1549 ASP A CA  1 
ATOM   773  C  C   . ASP A 1 101 ? 13.817  20.277  35.746 1.00 15.65 ? 1549 ASP A C   1 
ATOM   774  O  O   . ASP A 1 101 ? 12.819  19.829  35.241 1.00 16.09 ? 1549 ASP A O   1 
ATOM   775  C  CB  . ASP A 1 101 ? 14.724  22.424  34.726 1.00 16.97 ? 1549 ASP A CB  1 
ATOM   776  C  CG  . ASP A 1 101 ? 14.500  23.965  34.636 1.00 19.41 ? 1549 ASP A CG  1 
ATOM   777  O  OD1 . ASP A 1 101 ? 13.524  24.514  35.193 1.00 21.15 ? 1549 ASP A OD1 1 
ATOM   778  O  OD2 . ASP A 1 101 ? 15.279  24.650  33.959 1.00 21.72 ? 1549 ASP A OD2 1 
ATOM   779  N  N   . SER A 1 102 ? 14.802  19.501  36.203 1.00 15.16 ? 1550 SER A N   1 
ATOM   780  C  CA  . SER A 1 102 ? 14.773  18.065  36.058 1.00 15.40 ? 1550 SER A CA  1 
ATOM   781  C  C   . SER A 1 102 ? 13.693  17.528  36.981 1.00 15.37 ? 1550 SER A C   1 
ATOM   782  O  O   . SER A 1 102 ? 12.969  16.603  36.629 1.00 15.36 ? 1550 SER A O   1 
ATOM   783  C  CB  . SER A 1 102 ? 16.142  17.457  36.367 1.00 14.35 ? 1550 SER A CB  1 
ATOM   784  O  OG  . SER A 1 102 ? 16.291  17.424  37.760 1.00 15.03 ? 1550 SER A OG  1 
ATOM   785  N  N   . ILE A 1 103 ? 13.533  18.148  38.138 1.00 16.39 ? 1551 ILE A N   1 
ATOM   786  C  CA  . ILE A 1 103 ? 12.508  17.753  39.081 1.00 18.34 ? 1551 ILE A CA  1 
ATOM   787  C  C   . ILE A 1 103 ? 11.129  17.924  38.435 1.00 18.22 ? 1551 ILE A C   1 
ATOM   788  O  O   . ILE A 1 103 ? 10.303  17.006  38.429 1.00 17.52 ? 1551 ILE A O   1 
ATOM   789  C  CB  . ILE A 1 103 ? 12.552  18.580  40.380 1.00 20.38 ? 1551 ILE A CB  1 
ATOM   790  C  CG1 . ILE A 1 103 ? 13.788  18.253  41.265 1.00 21.95 ? 1551 ILE A CG1 1 
ATOM   791  C  CG2 . ILE A 1 103 ? 11.262  18.425  41.162 1.00 21.54 ? 1551 ILE A CG2 1 
ATOM   792  C  CD1 . ILE A 1 103 ? 13.831  16.893  41.881 1.00 22.81 ? 1551 ILE A CD1 1 
ATOM   793  N  N   . VAL A 1 104 ? 10.892  19.106  37.876 1.00 18.03 ? 1552 VAL A N   1 
ATOM   794  C  CA  . VAL A 1 104 ? 9.578   19.441  37.250 1.00 18.35 ? 1552 VAL A CA  1 
ATOM   795  C  C   . VAL A 1 104 ? 9.259   18.568  36.033 1.00 19.16 ? 1552 VAL A C   1 
ATOM   796  O  O   . VAL A 1 104 ? 8.137   18.222  35.814 1.00 20.48 ? 1552 VAL A O   1 
ATOM   797  C  CB  . VAL A 1 104 ? 9.593   20.923  36.832 1.00 18.82 ? 1552 VAL A CB  1 
ATOM   798  C  CG1 . VAL A 1 104 ? 8.420   21.224  35.940 1.00 19.84 ? 1552 VAL A CG1 1 
ATOM   799  C  CG2 . VAL A 1 104 ? 9.557   21.806  38.091 1.00 19.10 ? 1552 VAL A CG2 1 
ATOM   800  N  N   . LEU A 1 105 ? 10.280  18.192  35.259 1.00 18.30 ? 1553 LEU A N   1 
ATOM   801  C  CA  . LEU A 1 105 ? 10.092  17.372  34.108 1.00 18.78 ? 1553 LEU A CA  1 
ATOM   802  C  C   . LEU A 1 105 ? 9.661   15.962  34.463 1.00 19.01 ? 1553 LEU A C   1 
ATOM   803  O  O   . LEU A 1 105 ? 8.968   15.330  33.689 1.00 20.11 ? 1553 LEU A O   1 
ATOM   804  C  CB  . LEU A 1 105 ? 11.359  17.345  33.250 1.00 18.86 ? 1553 LEU A CB  1 
ATOM   805  C  CG  . LEU A 1 105 ? 11.479  18.633  32.407 1.00 20.73 ? 1553 LEU A CG  1 
ATOM   806  C  CD1 . LEU A 1 105 ? 12.880  18.801  31.832 1.00 21.02 ? 1553 LEU A CD1 1 
ATOM   807  C  CD2 . LEU A 1 105 ? 10.422  18.689  31.327 1.00 21.68 ? 1553 LEU A CD2 1 
ATOM   808  N  N   . GLN A 1 106 ? 10.014  15.480  35.639 1.00 19.32 ? 1554 GLN A N   1 
ATOM   809  C  CA  . GLN A 1 106 ? 9.377   14.262  36.164 1.00 21.41 ? 1554 GLN A CA  1 
ATOM   810  C  C   . GLN A 1 106 ? 7.819   14.322  36.115 1.00 22.51 ? 1554 GLN A C   1 
ATOM   811  O  O   . GLN A 1 106 ? 7.192   13.399  35.629 1.00 23.13 ? 1554 GLN A O   1 
ATOM   812  C  CB  . GLN A 1 106 ? 9.886   13.943  37.566 1.00 20.97 ? 1554 GLN A CB  1 
ATOM   813  C  CG  . GLN A 1 106 ? 11.399  13.710  37.599 1.00 19.98 ? 1554 GLN A CG  1 
ATOM   814  C  CD  . GLN A 1 106 ? 12.028  13.749  38.963 1.00 20.61 ? 1554 GLN A CD  1 
ATOM   815  O  OE1 . GLN A 1 106 ? 13.157  13.333  39.138 1.00 21.22 ? 1554 GLN A OE1 1 
ATOM   816  N  NE2 . GLN A 1 106 ? 11.337  14.262  39.920 1.00 24.24 ? 1554 GLN A NE2 1 
ATOM   817  N  N   . SER A 1 107 ? 7.197   15.393  36.591 1.00 23.93 ? 1555 SER A N   1 
ATOM   818  C  CA  . SER A 1 107 ? 5.726   15.416  36.555 1.00 26.00 ? 1555 SER A CA  1 
ATOM   819  C  C   . SER A 1 107 ? 5.169   15.819  35.206 1.00 26.20 ? 1555 SER A C   1 
ATOM   820  O  O   . SER A 1 107 ? 4.083   15.413  34.858 1.00 27.12 ? 1555 SER A O   1 
ATOM   821  C  CB  . SER A 1 107 ? 5.142   16.265  37.664 1.00 26.92 ? 1555 SER A CB  1 
ATOM   822  O  OG  . SER A 1 107 ? 5.925   17.339  37.891 1.00 28.09 ? 1555 SER A OG  1 
ATOM   823  N  N   . VAL A 1 108 ? 5.915   16.584  34.424 1.00 26.85 ? 1556 VAL A N   1 
ATOM   824  C  CA  . VAL A 1 108 ? 5.514   16.850  33.073 1.00 26.30 ? 1556 VAL A CA  1 
ATOM   825  C  C   . VAL A 1 108 ? 5.402   15.486  32.356 1.00 26.70 ? 1556 VAL A C   1 
ATOM   826  O  O   . VAL A 1 108 ? 4.406   15.236  31.664 1.00 26.21 ? 1556 VAL A O   1 
ATOM   827  C  CB  . VAL A 1 108 ? 6.507   17.796  32.382 1.00 27.02 ? 1556 VAL A CB  1 
ATOM   828  C  CG1 . VAL A 1 108 ? 6.158   18.012  30.911 1.00 27.92 ? 1556 VAL A CG1 1 
ATOM   829  C  CG2 . VAL A 1 108 ? 6.535   19.149  33.096 1.00 27.02 ? 1556 VAL A CG2 1 
ATOM   830  N  N   . PHE A 1 109 ? 6.392   14.606  32.533 1.00 25.06 ? 1557 PHE A N   1 
ATOM   831  C  CA  . PHE A 1 109 ? 6.358   13.335  31.850 1.00 26.48 ? 1557 PHE A CA  1 
ATOM   832  C  C   . PHE A 1 109 ? 5.104   12.562  32.230 1.00 29.29 ? 1557 PHE A C   1 
ATOM   833  O  O   . PHE A 1 109 ? 4.376   12.091  31.359 1.00 29.37 ? 1557 PHE A O   1 
ATOM   834  C  CB  . PHE A 1 109 ? 7.552   12.437  32.158 1.00 25.63 ? 1557 PHE A CB  1 
ATOM   835  C  CG  . PHE A 1 109 ? 7.464   11.111  31.467 1.00 25.56 ? 1557 PHE A CG  1 
ATOM   836  C  CD1 . PHE A 1 109 ? 7.868   10.982  30.137 1.00 26.78 ? 1557 PHE A CD1 1 
ATOM   837  C  CD2 . PHE A 1 109 ? 6.931   10.001  32.116 1.00 26.45 ? 1557 PHE A CD2 1 
ATOM   838  C  CE1 . PHE A 1 109 ? 7.764   9.759   29.481 1.00 25.65 ? 1557 PHE A CE1 1 
ATOM   839  C  CE2 . PHE A 1 109 ? 6.828   8.788   31.476 1.00 25.39 ? 1557 PHE A CE2 1 
ATOM   840  C  CZ  . PHE A 1 109 ? 7.237   8.666   30.151 1.00 27.86 ? 1557 PHE A CZ  1 
ATOM   841  N  N   . THR A 1 110 ? 4.889   12.384  33.522 1.00 29.41 ? 1558 THR A N   1 
ATOM   842  C  CA  . THR A 1 110 ? 3.737   11.574  33.975 1.00 33.70 ? 1558 THR A CA  1 
ATOM   843  C  C   . THR A 1 110 ? 2.372   12.136  33.537 1.00 34.40 ? 1558 THR A C   1 
ATOM   844  O  O   . THR A 1 110 ? 1.456   11.364  33.223 1.00 34.76 ? 1558 THR A O   1 
ATOM   845  C  CB  . THR A 1 110 ? 3.741   11.418  35.494 1.00 32.75 ? 1558 THR A CB  1 
ATOM   846  O  OG1 . THR A 1 110 ? 3.940   12.696  36.076 1.00 34.37 ? 1558 THR A OG1 1 
ATOM   847  C  CG2 . THR A 1 110 ? 4.890   10.514  35.922 1.00 33.62 ? 1558 THR A CG2 1 
ATOM   848  N  N   . SER A 1 111 ? 2.248   13.459  33.523 1.00 33.09 ? 1559 SER A N   1 
ATOM   849  C  CA  . SER A 1 111 ? 1.048   14.130  33.010 1.00 35.17 ? 1559 SER A CA  1 
ATOM   850  C  C   . SER A 1 111 ? 0.822   13.915  31.527 1.00 34.78 ? 1559 SER A C   1 
ATOM   851  O  O   . SER A 1 111 ? -0.275  13.545  31.087 1.00 36.80 ? 1559 SER A O   1 
ATOM   852  C  CB  . SER A 1 111 ? 1.187   15.635  33.194 1.00 36.80 ? 1559 SER A CB  1 
ATOM   853  O  OG  . SER A 1 111 ? 0.822   15.946  34.496 1.00 41.41 ? 1559 SER A OG  1 
ATOM   854  N  N   . VAL A 1 112 ? 1.856   14.181  30.749 1.00 32.48 ? 1560 VAL A N   1 
ATOM   855  C  CA  . VAL A 1 112 ? 1.777   13.955  29.318 1.00 31.58 ? 1560 VAL A CA  1 
ATOM   856  C  C   . VAL A 1 112 ? 1.427   12.478  29.036 1.00 32.76 ? 1560 VAL A C   1 
ATOM   857  O  O   . VAL A 1 112 ? 0.482   12.188  28.265 1.00 35.71 ? 1560 VAL A O   1 
ATOM   858  C  CB  . VAL A 1 112 ? 3.063   14.387  28.604 1.00 29.80 ? 1560 VAL A CB  1 
ATOM   859  C  CG1 . VAL A 1 112 ? 3.069   13.884  27.173 1.00 29.35 ? 1560 VAL A CG1 1 
ATOM   860  C  CG2 . VAL A 1 112 ? 3.211   15.909  28.623 1.00 30.45 ? 1560 VAL A CG2 1 
ATOM   861  N  N   . ARG A 1 113 ? 2.142   11.557  29.681 1.00 32.17 ? 1561 ARG A N   1 
ATOM   862  C  CA  . ARG A 1 113 ? 1.871   10.135  29.510 1.00 31.21 ? 1561 ARG A CA  1 
ATOM   863  C  C   . ARG A 1 113 ? 0.410   9.801   29.703 1.00 34.14 ? 1561 ARG A C   1 
ATOM   864  O  O   . ARG A 1 113 ? -0.169  9.113   28.866 1.00 32.15 ? 1561 ARG A O   1 
ATOM   865  C  CB  . ARG A 1 113 ? 2.715   9.259   30.435 1.00 31.47 ? 1561 ARG A CB  1 
ATOM   866  C  CG  . ARG A 1 113 ? 2.381   7.771   30.315 1.00 33.12 ? 1561 ARG A CG  1 
ATOM   867  C  CD  . ARG A 1 113 ? 3.181   6.878   31.250 1.00 34.84 ? 1561 ARG A CD  1 
ATOM   868  N  NE  . ARG A 1 113 ? 2.702   5.492   31.170 1.00 34.67 ? 1561 ARG A NE  1 
ATOM   869  C  CZ  . ARG A 1 113 ? 3.315   4.421   31.694 1.00 35.94 ? 1561 ARG A CZ  1 
ATOM   870  N  NH1 . ARG A 1 113 ? 4.456   4.513   32.385 1.00 35.86 ? 1561 ARG A NH1 1 
ATOM   871  N  NH2 . ARG A 1 113 ? 2.768   3.220   31.532 1.00 34.65 ? 1561 ARG A NH2 1 
ATOM   872  N  N   . GLN A 1 114 ? -0.169  10.269  30.817 1.00 38.20 ? 1562 GLN A N   1 
ATOM   873  C  CA  . GLN A 1 114 ? -1.572  9.990   31.175 1.00 40.71 ? 1562 GLN A CA  1 
ATOM   874  C  C   . GLN A 1 114 ? -2.540  10.503  30.114 1.00 43.92 ? 1562 GLN A C   1 
ATOM   875  O  O   . GLN A 1 114 ? -3.474  9.795   29.710 1.00 47.95 ? 1562 GLN A O   1 
ATOM   876  C  CB  . GLN A 1 114 ? -1.982  10.611  32.495 1.00 43.47 ? 1562 GLN A CB  1 
ATOM   877  C  CG  . GLN A 1 114 ? -3.419  11.135  32.347 1.00 51.38 ? 1562 GLN A CG  1 
ATOM   878  C  CD  . GLN A 1 114 ? -4.277  11.122  33.588 1.00 53.33 ? 1562 GLN A CD  1 
ATOM   879  O  OE1 . GLN A 1 114 ? -3.989  11.800  34.564 1.00 59.88 ? 1562 GLN A OE1 1 
ATOM   880  N  NE2 . GLN A 1 114 ? -5.378  10.376  33.533 1.00 57.76 ? 1562 GLN A NE2 1 
ATOM   881  N  N   . LYS A 1 115 ? -2.382  11.766  29.744 1.00 45.14 ? 1563 LYS A N   1 
ATOM   882  C  CA  . LYS A 1 115 ? -3.258  12.382  28.748 1.00 47.20 ? 1563 LYS A CA  1 
ATOM   883  C  C   . LYS A 1 115 ? -3.261  11.522  27.505 1.00 48.14 ? 1563 LYS A C   1 
ATOM   884  O  O   . LYS A 1 115 ? -4.318  11.069  27.056 1.00 47.17 ? 1563 LYS A O   1 
ATOM   885  C  CB  . LYS A 1 115 ? -2.811  13.808  28.430 1.00 48.21 ? 1563 LYS A CB  1 
ATOM   886  C  CG  . LYS A 1 115 ? -3.644  14.897  29.085 1.00 51.16 ? 1563 LYS A CG  1 
ATOM   887  C  CD  . LYS A 1 115 ? -2.801  16.123  29.455 1.00 54.79 ? 1563 LYS A CD  1 
ATOM   888  C  CE  . LYS A 1 115 ? -1.731  16.485  28.425 1.00 55.91 ? 1563 LYS A CE  1 
ATOM   889  N  NZ  . LYS A 1 115 ? -2.240  16.648  27.038 1.00 58.53 ? 1563 LYS A NZ  1 
ATOM   890  N  N   . ILE A 1 116 ? -2.058  11.221  27.022 1.00 48.63 ? 1564 ILE A N   1 
ATOM   891  C  CA  . ILE A 1 116 ? -1.885  10.443  25.802 1.00 49.48 ? 1564 ILE A CA  1 
ATOM   892  C  C   . ILE A 1 116 ? -2.433  9.018   25.918 1.00 50.78 ? 1564 ILE A C   1 
ATOM   893  O  O   . ILE A 1 116 ? -3.093  8.546   24.982 1.00 51.56 ? 1564 ILE A O   1 
ATOM   894  C  CB  . ILE A 1 116 ? -0.415  10.396  25.354 1.00 49.06 ? 1564 ILE A CB  1 
ATOM   895  C  CG1 . ILE A 1 116 ? 0.082   11.799  24.988 1.00 48.85 ? 1564 ILE A CG1 1 
ATOM   896  C  CG2 . ILE A 1 116 ? -0.234  9.442   24.183 1.00 48.63 ? 1564 ILE A CG2 1 
ATOM   897  C  CD1 . ILE A 1 116 ? -0.677  12.480  23.866 1.00 50.50 ? 1564 ILE A CD1 1 
ATOM   898  N  N   . GLU A 1 117 ? -2.201  8.358   27.055 1.00 48.60 ? 1565 GLU A N   1 
ATOM   899  C  CA  . GLU A 1 117 ? -2.798  7.032   27.323 1.00 49.36 ? 1565 GLU A CA  1 
ATOM   900  C  C   . GLU A 1 117 ? -4.336  7.002   27.262 1.00 51.59 ? 1565 GLU A C   1 
ATOM   901  O  O   . GLU A 1 117 ? -4.903  5.938   27.025 1.00 46.24 ? 1565 GLU A O   1 
ATOM   902  C  CB  . GLU A 1 117 ? -2.341  6.450   28.670 1.00 48.74 ? 1565 GLU A CB  1 
ATOM   903  C  CG  . GLU A 1 117 ? -1.137  5.529   28.522 1.00 49.05 ? 1565 GLU A CG  1 
ATOM   904  C  CD  . GLU A 1 117 ? -0.643  4.933   29.835 1.00 49.50 ? 1565 GLU A CD  1 
ATOM   905  O  OE1 . GLU A 1 117 ? -0.082  3.826   29.795 1.00 50.46 ? 1565 GLU A OE1 1 
ATOM   906  O  OE2 . GLU A 1 117 ? -0.808  5.554   30.903 1.00 48.65 ? 1565 GLU A OE2 1 
ATOM   907  N  N   . LYS A 1 118 ? -4.982  8.159   27.440 1.00 51.87 ? 1566 LYS A N   1 
ATOM   908  C  CA  . LYS A 1 118 ? -6.424  8.304   27.353 1.00 55.61 ? 1566 LYS A CA  1 
ATOM   909  C  C   . LYS A 1 118 ? -6.763  8.915   26.006 1.00 52.70 ? 1566 LYS A C   1 
ATOM   910  O  O   . LYS A 1 118 ? -7.673  8.449   25.358 1.00 50.85 ? 1566 LYS A O   1 
ATOM   911  C  CB  . LYS A 1 118 ? -6.952  9.198   28.463 1.00 58.64 ? 1566 LYS A CB  1 
ATOM   912  C  CG  . LYS A 1 118 ? -6.948  8.533   29.805 1.00 62.57 ? 1566 LYS A CG  1 
ATOM   913  C  CD  . LYS A 1 118 ? -7.126  9.540   30.932 1.00 66.48 ? 1566 LYS A CD  1 
ATOM   914  C  CE  . LYS A 1 118 ? -8.445  10.308  30.832 1.00 71.63 ? 1566 LYS A CE  1 
ATOM   915  N  NZ  . LYS A 1 118 ? -8.638  11.296  31.941 1.00 74.70 ? 1566 LYS A NZ  1 
ATOM   916  N  N   . ASN B 1 9   ? 20.278  15.233  53.753 1.00 58.21 ? 1457 ASN B N   1 
ATOM   917  C  CA  . ASN B 1 9   ? 19.794  15.349  52.348 1.00 57.00 ? 1457 ASN B CA  1 
ATOM   918  C  C   . ASN B 1 9   ? 18.455  14.631  52.263 1.00 53.95 ? 1457 ASN B C   1 
ATOM   919  O  O   . ASN B 1 9   ? 18.387  13.392  52.183 1.00 46.88 ? 1457 ASN B O   1 
ATOM   920  C  CB  . ASN B 1 9   ? 20.832  14.807  51.366 1.00 59.92 ? 1457 ASN B CB  1 
ATOM   921  C  CG  . ASN B 1 9   ? 21.906  15.850  51.023 1.00 64.18 ? 1457 ASN B CG  1 
ATOM   922  O  OD1 . ASN B 1 9   ? 22.400  15.911  49.891 1.00 65.12 ? 1457 ASN B OD1 1 
ATOM   923  N  ND2 . ASN B 1 9   ? 22.261  16.686  51.997 1.00 65.43 ? 1457 ASN B ND2 1 
ATOM   924  N  N   . LEU B 1 10  ? 17.403  15.448  52.300 1.00 46.21 ? 1458 LEU B N   1 
ATOM   925  C  CA  . LEU B 1 10  ? 16.098  15.030  52.815 1.00 44.46 ? 1458 LEU B CA  1 
ATOM   926  C  C   . LEU B 1 10  ? 15.445  14.046  51.875 1.00 40.24 ? 1458 LEU B C   1 
ATOM   927  O  O   . LEU B 1 10  ? 14.913  13.053  52.339 1.00 39.79 ? 1458 LEU B O   1 
ATOM   928  C  CB  . LEU B 1 10  ? 15.172  16.225  53.043 1.00 44.07 ? 1458 LEU B CB  1 
ATOM   929  C  CG  . LEU B 1 10  ? 14.119  15.950  54.098 1.00 49.26 ? 1458 LEU B CG  1 
ATOM   930  C  CD1 . LEU B 1 10  ? 14.769  15.713  55.460 1.00 51.60 ? 1458 LEU B CD1 1 
ATOM   931  C  CD2 . LEU B 1 10  ? 13.077  17.075  54.198 1.00 50.49 ? 1458 LEU B CD2 1 
ATOM   932  N  N   . THR B 1 11  ? 15.513  14.302  50.566 1.00 36.17 ? 1459 THR B N   1 
ATOM   933  C  CA  . THR B 1 11  ? 14.888  13.401  49.587 1.00 37.00 ? 1459 THR B CA  1 
ATOM   934  C  C   . THR B 1 11  ? 15.355  11.944  49.784 1.00 39.00 ? 1459 THR B C   1 
ATOM   935  O  O   . THR B 1 11  ? 14.517  11.037  49.868 1.00 37.07 ? 1459 THR B O   1 
ATOM   936  C  CB  . THR B 1 11  ? 15.109  13.869  48.138 1.00 38.63 ? 1459 THR B CB  1 
ATOM   937  O  OG1 . THR B 1 11  ? 14.460  15.133  47.942 1.00 41.41 ? 1459 THR B OG1 1 
ATOM   938  C  CG2 . THR B 1 11  ? 14.539  12.877  47.132 1.00 38.93 ? 1459 THR B CG2 1 
ATOM   939  N  N   . LYS B 1 12  ? 16.662  11.738  49.933 1.00 40.48 ? 1460 LYS B N   1 
ATOM   940  C  CA  . LYS B 1 12  ? 17.237  10.380  50.003 1.00 40.64 ? 1460 LYS B CA  1 
ATOM   941  C  C   . LYS B 1 12  ? 16.907  9.657   51.275 1.00 39.63 ? 1460 LYS B C   1 
ATOM   942  O  O   . LYS B 1 12  ? 16.841  8.427   51.302 1.00 37.17 ? 1460 LYS B O   1 
ATOM   943  C  CB  . LYS B 1 12  ? 18.754  10.437  49.823 1.00 44.37 ? 1460 LYS B CB  1 
ATOM   944  C  CG  . LYS B 1 12  ? 19.196  11.125  48.535 1.00 43.26 ? 1460 LYS B CG  1 
ATOM   945  N  N   . LYS B 1 13  ? 16.742  10.430  52.345 1.00 38.72 ? 1461 LYS B N   1 
ATOM   946  C  CA  . LYS B 1 13  ? 16.383  9.875   53.630 1.00 39.79 ? 1461 LYS B CA  1 
ATOM   947  C  C   . LYS B 1 13  ? 14.880  9.521   53.715 1.00 36.31 ? 1461 LYS B C   1 
ATOM   948  O  O   . LYS B 1 13  ? 14.498  8.576   54.405 1.00 34.13 ? 1461 LYS B O   1 
ATOM   949  C  CB  . LYS B 1 13  ? 16.810  10.851  54.732 1.00 43.79 ? 1461 LYS B CB  1 
ATOM   950  C  CG  . LYS B 1 13  ? 15.848  10.997  55.891 1.00 46.22 ? 1461 LYS B CG  1 
ATOM   951  C  CD  . LYS B 1 13  ? 16.438  11.436  57.250 1.00 49.94 ? 1461 LYS B CD  1 
ATOM   952  C  CE  . LYS B 1 13  ? 17.970  11.298  57.427 1.00 49.78 ? 1461 LYS B CE  1 
ATOM   953  N  NZ  . LYS B 1 13  ? 18.562  12.649  57.590 1.00 53.61 ? 1461 LYS B NZ  1 
ATOM   954  N  N   . MET B 1 14  ? 14.048  10.306  53.042 1.00 34.75 ? 1462 MET B N   1 
ATOM   955  C  CA  . MET B 1 14  ? 12.646  9.960   52.875 1.00 32.74 ? 1462 MET B CA  1 
ATOM   956  C  C   . MET B 1 14  ? 12.562  8.660   52.085 1.00 31.73 ? 1462 MET B C   1 
ATOM   957  O  O   . MET B 1 14  ? 11.843  7.752   52.490 1.00 27.14 ? 1462 MET B O   1 
ATOM   958  C  CB  . MET B 1 14  ? 11.840  11.070  52.201 1.00 32.26 ? 1462 MET B CB  1 
ATOM   959  C  CG  . MET B 1 14  ? 11.502  12.270  53.086 1.00 35.81 ? 1462 MET B CG  1 
ATOM   960  S  SD  . MET B 1 14  ? 10.771  13.588  52.060 1.00 38.50 ? 1462 MET B SD  1 
ATOM   961  C  CE  . MET B 1 14  ? 10.410  14.813  53.308 1.00 42.02 ? 1462 MET B CE  1 
ATOM   962  N  N   . LYS B 1 15  ? 13.311  8.567   50.989 1.00 32.41 ? 1463 LYS B N   1 
ATOM   963  C  CA  . LYS B 1 15  ? 13.391  7.326   50.207 1.00 35.74 ? 1463 LYS B CA  1 
ATOM   964  C  C   . LYS B 1 15  ? 13.773  6.118   51.029 1.00 34.73 ? 1463 LYS B C   1 
ATOM   965  O  O   . LYS B 1 15  ? 13.227  5.044   50.843 1.00 32.94 ? 1463 LYS B O   1 
ATOM   966  C  CB  . LYS B 1 15  ? 14.476  7.397   49.141 1.00 38.47 ? 1463 LYS B CB  1 
ATOM   967  C  CG  . LYS B 1 15  ? 14.145  8.145   47.897 1.00 43.24 ? 1463 LYS B CG  1 
ATOM   968  C  CD  . LYS B 1 15  ? 15.436  8.331   47.066 1.00 46.51 ? 1463 LYS B CD  1 
ATOM   969  C  CE  . LYS B 1 15  ? 15.548  9.716   46.482 1.00 47.71 ? 1463 LYS B CE  1 
ATOM   970  N  NZ  . LYS B 1 15  ? 16.897  9.962   45.886 1.00 52.49 ? 1463 LYS B NZ  1 
ATOM   971  N  N   . LYS B 1 16  ? 14.781  6.299   51.870 1.00 34.41 ? 1464 LYS B N   1 
ATOM   972  C  CA  . LYS B 1 16  ? 15.359  5.216   52.663 1.00 36.81 ? 1464 LYS B CA  1 
ATOM   973  C  C   . LYS B 1 16  ? 14.338  4.639   53.658 1.00 34.64 ? 1464 LYS B C   1 
ATOM   974  O  O   . LYS B 1 16  ? 14.256  3.432   53.873 1.00 33.08 ? 1464 LYS B O   1 
ATOM   975  C  CB  . LYS B 1 16  ? 16.542  5.806   53.442 1.00 41.90 ? 1464 LYS B CB  1 
ATOM   976  C  CG  . LYS B 1 16  ? 17.669  4.862   53.762 1.00 45.02 ? 1464 LYS B CG  1 
ATOM   977  C  CD  . LYS B 1 16  ? 18.854  5.685   54.218 1.00 45.87 ? 1464 LYS B CD  1 
ATOM   978  C  CE  . LYS B 1 16  ? 19.992  4.804   54.697 1.00 47.70 ? 1464 LYS B CE  1 
ATOM   979  N  NZ  . LYS B 1 16  ? 19.543  3.806   55.689 1.00 46.74 ? 1464 LYS B NZ  1 
ATOM   980  N  N   . ILE B 1 17  ? 13.594  5.541   54.302 1.00 33.21 ? 1465 ILE B N   1 
ATOM   981  C  CA  . ILE B 1 17  ? 12.503  5.203   55.248 1.00 31.09 ? 1465 ILE B CA  1 
ATOM   982  C  C   . ILE B 1 17  ? 11.368  4.464   54.524 1.00 30.25 ? 1465 ILE B C   1 
ATOM   983  O  O   . ILE B 1 17  ? 10.930  3.377   54.928 1.00 29.22 ? 1465 ILE B O   1 
ATOM   984  C  CB  . ILE B 1 17  ? 11.938  6.497   55.893 1.00 29.71 ? 1465 ILE B CB  1 
ATOM   985  C  CG1 . ILE B 1 17  ? 12.963  7.114   56.874 1.00 32.58 ? 1465 ILE B CG1 1 
ATOM   986  C  CG2 . ILE B 1 17  ? 10.615  6.241   56.605 1.00 28.80 ? 1465 ILE B CG2 1 
ATOM   987  C  CD1 . ILE B 1 17  ? 12.521  8.444   57.483 1.00 31.26 ? 1465 ILE B CD1 1 
ATOM   988  N  N   . VAL B 1 18  ? 10.909  5.035   53.418 1.00 28.54 ? 1466 VAL B N   1 
ATOM   989  C  CA  . VAL B 1 18  ? 9.860   4.379   52.679 1.00 27.94 ? 1466 VAL B CA  1 
ATOM   990  C  C   . VAL B 1 18  ? 10.269  3.006   52.131 1.00 28.53 ? 1466 VAL B C   1 
ATOM   991  O  O   . VAL B 1 18  ? 9.461   2.107   52.180 1.00 25.25 ? 1466 VAL B O   1 
ATOM   992  C  CB  . VAL B 1 18  ? 9.280   5.258   51.581 1.00 28.15 ? 1466 VAL B CB  1 
ATOM   993  C  CG1 . VAL B 1 18  ? 8.242   4.518   50.761 1.00 27.64 ? 1466 VAL B CG1 1 
ATOM   994  C  CG2 . VAL B 1 18  ? 8.631   6.450   52.197 1.00 27.63 ? 1466 VAL B CG2 1 
ATOM   995  N  N   . ASP B 1 19  ? 11.498  2.857   51.622 1.00 29.33 ? 1467 ASP B N   1 
ATOM   996  C  CA  . ASP B 1 19  ? 11.959  1.569   51.098 1.00 32.09 ? 1467 ASP B CA  1 
ATOM   997  C  C   . ASP B 1 19  ? 11.921  0.563   52.211 1.00 30.05 ? 1467 ASP B C   1 
ATOM   998  O  O   . ASP B 1 19  ? 11.539  -0.582  52.008 1.00 31.17 ? 1467 ASP B O   1 
ATOM   999  C  CB  . ASP B 1 19  ? 13.406  1.626   50.563 1.00 37.88 ? 1467 ASP B CB  1 
ATOM   1000 C  CG  . ASP B 1 19  ? 13.544  2.392   49.256 1.00 43.73 ? 1467 ASP B CG  1 
ATOM   1001 O  OD1 . ASP B 1 19  ? 12.523  2.523   48.535 1.00 46.26 ? 1467 ASP B OD1 1 
ATOM   1002 O  OD2 . ASP B 1 19  ? 14.688  2.864   48.941 1.00 49.26 ? 1467 ASP B OD2 1 
ATOM   1003 N  N   . ALA B 1 20  ? 12.302  0.981   53.407 1.00 29.84 ? 1468 ALA B N   1 
ATOM   1004 C  CA  . ALA B 1 20  ? 12.385  0.045   54.488 1.00 30.35 ? 1468 ALA B CA  1 
ATOM   1005 C  C   . ALA B 1 20  ? 10.998  -0.341  55.018 1.00 29.50 ? 1468 ALA B C   1 
ATOM   1006 O  O   . ALA B 1 20  ? 10.759  -1.500  55.404 1.00 26.67 ? 1468 ALA B O   1 
ATOM   1007 C  CB  . ALA B 1 20  ? 13.288  0.583   55.588 1.00 30.97 ? 1468 ALA B CB  1 
ATOM   1008 N  N   . VAL B 1 21  ? 10.066  0.604   55.053 1.00 28.44 ? 1469 VAL B N   1 
ATOM   1009 C  CA  . VAL B 1 21  ? 8.684   0.252   55.424 1.00 25.72 ? 1469 VAL B CA  1 
ATOM   1010 C  C   . VAL B 1 21  ? 8.081   -0.697  54.373 1.00 26.68 ? 1469 VAL B C   1 
ATOM   1011 O  O   . VAL B 1 21  ? 7.325   -1.602  54.706 1.00 27.99 ? 1469 VAL B O   1 
ATOM   1012 C  CB  . VAL B 1 21  ? 7.778   1.493   55.550 1.00 25.34 ? 1469 VAL B CB  1 
ATOM   1013 C  CG1 . VAL B 1 21  ? 6.318   1.101   55.687 1.00 23.98 ? 1469 VAL B CG1 1 
ATOM   1014 C  CG2 . VAL B 1 21  ? 8.212   2.374   56.709 1.00 25.92 ? 1469 VAL B CG2 1 
ATOM   1015 N  N   . ILE B 1 22  ? 8.366   -0.447  53.102 1.00 26.43 ? 1470 ILE B N   1 
ATOM   1016 C  CA  . ILE B 1 22  ? 7.860   -1.304  52.059 1.00 28.06 ? 1470 ILE B CA  1 
ATOM   1017 C  C   . ILE B 1 22  ? 8.428   -2.723  52.193 1.00 28.88 ? 1470 ILE B C   1 
ATOM   1018 O  O   . ILE B 1 22  ? 7.726   -3.699  52.097 1.00 27.67 ? 1470 ILE B O   1 
ATOM   1019 C  CB  . ILE B 1 22  ? 8.185   -0.691  50.697 1.00 28.02 ? 1470 ILE B CB  1 
ATOM   1020 C  CG1 . ILE B 1 22  ? 7.253   0.500   50.485 1.00 29.06 ? 1470 ILE B CG1 1 
ATOM   1021 C  CG2 . ILE B 1 22  ? 8.070   -1.720  49.587 1.00 29.75 ? 1470 ILE B CG2 1 
ATOM   1022 C  CD1 . ILE B 1 22  ? 7.483   1.233   49.160 1.00 29.39 ? 1470 ILE B CD1 1 
ATOM   1023 N  N   . LYS B 1 23  ? 9.710   -2.811  52.461 1.00 34.11 ? 1471 LYS B N   1 
ATOM   1024 C  CA  . LYS B 1 23  ? 10.392  -4.064  52.493 1.00 37.12 ? 1471 LYS B CA  1 
ATOM   1025 C  C   . LYS B 1 23  ? 10.070  -4.905  53.762 1.00 35.07 ? 1471 LYS B C   1 
ATOM   1026 O  O   . LYS B 1 23  ? 10.322  -6.140  53.805 1.00 35.60 ? 1471 LYS B O   1 
ATOM   1027 C  CB  . LYS B 1 23  ? 11.873  -3.754  52.307 1.00 41.65 ? 1471 LYS B CB  1 
ATOM   1028 C  CG  . LYS B 1 23  ? 12.782  -4.803  52.852 1.00 49.13 ? 1471 LYS B CG  1 
ATOM   1029 C  CD  . LYS B 1 23  ? 12.746  -6.081  52.044 1.00 55.99 ? 1471 LYS B CD  1 
ATOM   1030 C  CE  . LYS B 1 23  ? 13.503  -7.175  52.789 1.00 61.78 ? 1471 LYS B CE  1 
ATOM   1031 N  NZ  . LYS B 1 23  ? 14.892  -6.732  53.127 1.00 66.32 ? 1471 LYS B NZ  1 
ATOM   1032 N  N   . TYR B 1 24  ? 9.504   -4.254  54.777 1.00 31.52 ? 1472 TYR B N   1 
ATOM   1033 C  CA  . TYR B 1 24  ? 9.266   -4.891  56.054 1.00 31.63 ? 1472 TYR B CA  1 
ATOM   1034 C  C   . TYR B 1 24  ? 8.478   -6.175  55.947 1.00 31.53 ? 1472 TYR B C   1 
ATOM   1035 O  O   . TYR B 1 24  ? 7.438   -6.234  55.322 1.00 31.90 ? 1472 TYR B O   1 
ATOM   1036 C  CB  . TYR B 1 24  ? 8.559   -3.936  57.023 1.00 32.62 ? 1472 TYR B CB  1 
ATOM   1037 C  CG  . TYR B 1 24  ? 8.246   -4.578  58.320 1.00 33.08 ? 1472 TYR B CG  1 
ATOM   1038 C  CD1 . TYR B 1 24  ? 9.224   -4.693  59.323 1.00 36.03 ? 1472 TYR B CD1 1 
ATOM   1039 C  CD2 . TYR B 1 24  ? 6.991   -5.117  58.559 1.00 34.41 ? 1472 TYR B CD2 1 
ATOM   1040 C  CE1 . TYR B 1 24  ? 8.940   -5.325  60.526 1.00 35.14 ? 1472 TYR B CE1 1 
ATOM   1041 C  CE2 . TYR B 1 24  ? 6.700   -5.756  59.752 1.00 35.30 ? 1472 TYR B CE2 1 
ATOM   1042 C  CZ  . TYR B 1 24  ? 7.682   -5.853  60.729 1.00 36.49 ? 1472 TYR B CZ  1 
ATOM   1043 O  OH  . TYR B 1 24  ? 7.374   -6.484  61.912 1.00 38.19 ? 1472 TYR B OH  1 
ATOM   1044 N  N   . LYS B 1 25  ? 8.948   -7.195  56.649 1.00 34.76 ? 1473 LYS B N   1 
ATOM   1045 C  CA  . LYS B 1 25  ? 8.289   -8.500  56.679 1.00 35.45 ? 1473 LYS B CA  1 
ATOM   1046 C  C   . LYS B 1 25  ? 7.899   -8.857  58.097 1.00 37.08 ? 1473 LYS B C   1 
ATOM   1047 O  O   . LYS B 1 25  ? 8.644   -8.610  59.031 1.00 42.71 ? 1473 LYS B O   1 
ATOM   1048 C  CB  . LYS B 1 25  ? 9.232   -9.542  56.104 1.00 38.20 ? 1473 LYS B CB  1 
ATOM   1049 C  CG  . LYS B 1 25  ? 9.720   -9.147  54.724 1.00 39.31 ? 1473 LYS B CG  1 
ATOM   1050 C  CD  . LYS B 1 25  ? 10.060  -10.332 53.871 1.00 45.26 ? 1473 LYS B CD  1 
ATOM   1051 C  CE  . LYS B 1 25  ? 10.433  -9.886  52.474 1.00 49.31 ? 1473 LYS B CE  1 
ATOM   1052 N  NZ  . LYS B 1 25  ? 10.312  -11.042 51.550 1.00 51.25 ? 1473 LYS B NZ  1 
ATOM   1053 N  N   . ASP B 1 26  ? 6.708   -9.387  58.263 1.00 36.53 ? 1474 ASP B N   1 
ATOM   1054 C  CA  . ASP B 1 26  ? 6.280   -9.943  59.540 1.00 40.06 ? 1474 ASP B CA  1 
ATOM   1055 C  C   . ASP B 1 26  ? 7.211   -11.062 59.989 1.00 40.38 ? 1474 ASP B C   1 
ATOM   1056 O  O   . ASP B 1 26  ? 7.590   -11.902 59.200 1.00 39.04 ? 1474 ASP B O   1 
ATOM   1057 C  CB  . ASP B 1 26  ? 4.881   -10.488 59.400 1.00 42.52 ? 1474 ASP B CB  1 
ATOM   1058 C  CG  . ASP B 1 26  ? 4.293   -10.904 60.746 1.00 51.01 ? 1474 ASP B CG  1 
ATOM   1059 O  OD1 . ASP B 1 26  ? 5.018   -10.793 61.778 1.00 56.09 ? 1474 ASP B OD1 1 
ATOM   1060 O  OD2 . ASP B 1 26  ? 3.104   -11.284 60.768 1.00 49.47 ? 1474 ASP B OD2 1 
ATOM   1061 N  N   . SER B 1 27  ? 7.563   -11.058 61.265 1.00 45.09 ? 1475 SER B N   1 
ATOM   1062 C  CA  . SER B 1 27  ? 8.560   -11.977 61.856 1.00 47.05 ? 1475 SER B CA  1 
ATOM   1063 C  C   . SER B 1 27  ? 8.355   -13.452 61.618 1.00 47.13 ? 1475 SER B C   1 
ATOM   1064 O  O   . SER B 1 27  ? 9.221   -14.164 61.104 1.00 46.79 ? 1475 SER B O   1 
ATOM   1065 C  CB  . SER B 1 27  ? 8.448   -11.851 63.366 1.00 48.40 ? 1475 SER B CB  1 
ATOM   1066 O  OG  . SER B 1 27  ? 7.075   -11.784 63.731 1.00 43.02 ? 1475 SER B OG  1 
ATOM   1067 N  N   . SER B 1 28  ? 7.195   -13.906 62.058 1.00 47.96 ? 1476 SER B N   1 
ATOM   1068 C  CA  . SER B 1 28  ? 6.881   -15.331 62.074 1.00 47.95 ? 1476 SER B CA  1 
ATOM   1069 C  C   . SER B 1 28  ? 6.484   -15.787 60.677 1.00 44.84 ? 1476 SER B C   1 
ATOM   1070 O  O   . SER B 1 28  ? 6.993   -16.796 60.181 1.00 45.18 ? 1476 SER B O   1 
ATOM   1071 C  CB  . SER B 1 28  ? 5.767   -15.598 63.064 1.00 48.15 ? 1476 SER B CB  1 
ATOM   1072 O  OG  . SER B 1 28  ? 5.640   -16.989 63.342 1.00 53.72 ? 1476 SER B OG  1 
ATOM   1073 N  N   . SER B 1 29  ? 5.628   -15.011 60.022 1.00 38.88 ? 1477 SER B N   1 
ATOM   1074 C  CA  . SER B 1 29  ? 5.173   -15.374 58.696 1.00 36.76 ? 1477 SER B CA  1 
ATOM   1075 C  C   . SER B 1 29  ? 6.185   -15.032 57.612 1.00 37.17 ? 1477 SER B C   1 
ATOM   1076 O  O   . SER B 1 29  ? 6.232   -15.714 56.599 1.00 40.92 ? 1477 SER B O   1 
ATOM   1077 C  CB  . SER B 1 29  ? 3.834   -14.716 58.388 1.00 33.51 ? 1477 SER B CB  1 
ATOM   1078 O  OG  . SER B 1 29  ? 3.910   -13.316 58.544 1.00 34.07 ? 1477 SER B OG  1 
ATOM   1079 N  N   . GLY B 1 30  ? 7.005   -14.003 57.817 1.00 34.56 ? 1478 GLY B N   1 
ATOM   1080 C  CA  . GLY B 1 30  ? 7.805   -13.472 56.703 1.00 35.50 ? 1478 GLY B CA  1 
ATOM   1081 C  C   . GLY B 1 30  ? 6.987   -12.723 55.648 1.00 33.42 ? 1478 GLY B C   1 
ATOM   1082 O  O   . GLY B 1 30  ? 7.526   -12.329 54.623 1.00 33.48 ? 1478 GLY B O   1 
ATOM   1083 N  N   . ARG B 1 31  ? 5.701   -12.478 55.899 1.00 30.69 ? 1479 ARG B N   1 
ATOM   1084 C  CA  . ARG B 1 31  ? 4.880   -11.810 54.917 1.00 28.79 ? 1479 ARG B CA  1 
ATOM   1085 C  C   . ARG B 1 31  ? 5.227   -10.313 54.841 1.00 27.91 ? 1479 ARG B C   1 
ATOM   1086 O  O   . ARG B 1 31  ? 5.382   -9.610  55.852 1.00 27.33 ? 1479 ARG B O   1 
ATOM   1087 C  CB  . ARG B 1 31  ? 3.409   -12.033 55.209 1.00 27.70 ? 1479 ARG B CB  1 
ATOM   1088 C  CG  . ARG B 1 31  ? 2.483   -11.464 54.139 1.00 27.81 ? 1479 ARG B CG  1 
ATOM   1089 C  CD  . ARG B 1 31  ? 1.046   -11.932 54.320 1.00 28.25 ? 1479 ARG B CD  1 
ATOM   1090 N  NE  . ARG B 1 31  ? 0.557   -11.570 55.643 1.00 26.88 ? 1479 ARG B NE  1 
ATOM   1091 C  CZ  . ARG B 1 31  ? -0.077  -10.445 55.950 1.00 26.04 ? 1479 ARG B CZ  1 
ATOM   1092 N  NH1 . ARG B 1 31  ? -0.351  -9.545  55.027 1.00 26.35 ? 1479 ARG B NH1 1 
ATOM   1093 N  NH2 . ARG B 1 31  ? -0.474  -10.237 57.186 1.00 24.73 ? 1479 ARG B NH2 1 
ATOM   1094 N  N   . GLN B 1 32  ? 5.343   -9.819  53.621 1.00 26.91 ? 1480 GLN B N   1 
ATOM   1095 C  CA  . GLN B 1 32  ? 5.587   -8.415  53.397 1.00 25.67 ? 1480 GLN B CA  1 
ATOM   1096 C  C   . GLN B 1 32  ? 4.284   -7.635  53.506 1.00 24.83 ? 1480 GLN B C   1 
ATOM   1097 O  O   . GLN B 1 32  ? 3.472   -7.602  52.564 1.00 23.31 ? 1480 GLN B O   1 
ATOM   1098 C  CB  . GLN B 1 32  ? 6.183   -8.186  52.010 1.00 27.02 ? 1480 GLN B CB  1 
ATOM   1099 C  CG  . GLN B 1 32  ? 6.455   -6.712  51.752 1.00 28.37 ? 1480 GLN B CG  1 
ATOM   1100 C  CD  . GLN B 1 32  ? 7.115   -6.438  50.425 1.00 32.46 ? 1480 GLN B CD  1 
ATOM   1101 O  OE1 . GLN B 1 32  ? 8.043   -7.130  50.017 1.00 35.60 ? 1480 GLN B OE1 1 
ATOM   1102 N  NE2 . GLN B 1 32  ? 6.656   -5.394  49.763 1.00 32.11 ? 1480 GLN B NE2 1 
ATOM   1103 N  N   . LEU B 1 33  ? 4.118   -6.962  54.638 1.00 23.71 ? 1481 LEU B N   1 
ATOM   1104 C  CA  . LEU B 1 33  ? 2.867   -6.258  54.950 1.00 22.96 ? 1481 LEU B CA  1 
ATOM   1105 C  C   . LEU B 1 33  ? 2.433   -5.215  53.907 1.00 21.17 ? 1481 LEU B C   1 
ATOM   1106 O  O   . LEU B 1 33  ? 1.237   -5.101  53.636 1.00 19.87 ? 1481 LEU B O   1 
ATOM   1107 C  CB  . LEU B 1 33  ? 2.961   -5.586  56.305 1.00 23.63 ? 1481 LEU B CB  1 
ATOM   1108 C  CG  . LEU B 1 33  ? 2.557   -6.388  57.539 1.00 26.33 ? 1481 LEU B CG  1 
ATOM   1109 C  CD1 . LEU B 1 33  ? 2.781   -7.894  57.477 1.00 26.96 ? 1481 LEU B CD1 1 
ATOM   1110 C  CD2 . LEU B 1 33  ? 3.097   -5.763  58.808 1.00 26.82 ? 1481 LEU B CD2 1 
ATOM   1111 N  N   . SER B 1 34  ? 3.380   -4.448  53.362 1.00 20.75 ? 1482 SER B N   1 
ATOM   1112 C  CA  . SER B 1 34  ? 3.068   -3.370  52.409 1.00 21.44 ? 1482 SER B CA  1 
ATOM   1113 C  C   . SER B 1 34  ? 2.434   -3.819  51.063 1.00 21.90 ? 1482 SER B C   1 
ATOM   1114 O  O   . SER B 1 34  ? 1.925   -2.971  50.335 1.00 21.56 ? 1482 SER B O   1 
ATOM   1115 C  CB  . SER B 1 34  ? 4.342   -2.607  52.058 1.00 21.95 ? 1482 SER B CB  1 
ATOM   1116 O  OG  . SER B 1 34  ? 5.218   -3.457  51.355 1.00 22.14 ? 1482 SER B OG  1 
ATOM   1117 N  N   . GLU B 1 35  ? 2.420   -5.129  50.763 1.00 22.65 ? 1483 GLU B N   1 
ATOM   1118 C  CA  . GLU B 1 35  ? 2.239   -5.581  49.372 1.00 24.35 ? 1483 GLU B CA  1 
ATOM   1119 C  C   . GLU B 1 35  ? 1.005   -5.001  48.744 1.00 21.10 ? 1483 GLU B C   1 
ATOM   1120 O  O   . GLU B 1 35  ? 1.061   -4.430  47.677 1.00 20.42 ? 1483 GLU B O   1 
ATOM   1121 C  CB  . GLU B 1 35  ? 2.197   -7.117  49.225 1.00 26.85 ? 1483 GLU B CB  1 
ATOM   1122 C  CG  . GLU B 1 35  ? 3.508   -7.770  49.573 1.00 32.69 ? 1483 GLU B CG  1 
ATOM   1123 C  CD  . GLU B 1 35  ? 3.448   -9.312  49.716 1.00 40.20 ? 1483 GLU B CD  1 
ATOM   1124 O  OE1 . GLU B 1 35  ? 2.736   -9.878  50.636 1.00 44.15 ? 1483 GLU B OE1 1 
ATOM   1125 O  OE2 . GLU B 1 35  ? 4.176   -9.963  48.909 1.00 42.33 ? 1483 GLU B OE2 1 
ATOM   1126 N  N   . VAL B 1 36  ? -0.115  -5.134  49.420 1.00 18.95 ? 1484 VAL B N   1 
ATOM   1127 C  CA  . VAL B 1 36  ? -1.359  -4.683  48.868 1.00 19.18 ? 1484 VAL B CA  1 
ATOM   1128 C  C   . VAL B 1 36  ? -1.474  -3.143  48.736 1.00 19.49 ? 1484 VAL B C   1 
ATOM   1129 O  O   . VAL B 1 36  ? -2.347  -2.649  48.033 1.00 19.58 ? 1484 VAL B O   1 
ATOM   1130 C  CB  . VAL B 1 36  ? -2.535  -5.333  49.594 1.00 20.14 ? 1484 VAL B CB  1 
ATOM   1131 C  CG1 . VAL B 1 36  ? -2.832  -4.665  50.922 1.00 18.09 ? 1484 VAL B CG1 1 
ATOM   1132 C  CG2 . VAL B 1 36  ? -3.763  -5.383  48.692 1.00 22.03 ? 1484 VAL B CG2 1 
ATOM   1133 N  N   . PHE B 1 37  ? -0.602  -2.398  49.425 1.00 19.60 ? 1485 PHE B N   1 
ATOM   1134 C  CA  . PHE B 1 37  ? -0.699  -0.985  49.513 1.00 18.59 ? 1485 PHE B CA  1 
ATOM   1135 C  C   . PHE B 1 37  ? 0.238   -0.295  48.511 1.00 19.80 ? 1485 PHE B C   1 
ATOM   1136 O  O   . PHE B 1 37  ? 0.291   0.923   48.477 1.00 18.12 ? 1485 PHE B O   1 
ATOM   1137 C  CB  . PHE B 1 37  ? -0.350  -0.536  50.914 1.00 19.16 ? 1485 PHE B CB  1 
ATOM   1138 C  CG  . PHE B 1 37  ? -1.241  -1.116  51.978 1.00 19.59 ? 1485 PHE B CG  1 
ATOM   1139 C  CD1 . PHE B 1 37  ? -2.587  -0.815  52.019 1.00 20.45 ? 1485 PHE B CD1 1 
ATOM   1140 C  CD2 . PHE B 1 37  ? -0.750  -2.029  52.876 1.00 20.63 ? 1485 PHE B CD2 1 
ATOM   1141 C  CE1 . PHE B 1 37  ? -3.423  -1.400  52.962 1.00 20.76 ? 1485 PHE B CE1 1 
ATOM   1142 C  CE2 . PHE B 1 37  ? -1.577  -2.611  53.831 1.00 21.32 ? 1485 PHE B CE2 1 
ATOM   1143 C  CZ  . PHE B 1 37  ? -2.919  -2.249  53.910 1.00 20.49 ? 1485 PHE B CZ  1 
ATOM   1144 N  N   . ILE B 1 38  ? 0.955   -1.058  47.698 1.00 19.33 ? 1486 ILE B N   1 
ATOM   1145 C  CA  . ILE B 1 38  ? 1.912   -0.447  46.810 1.00 22.72 ? 1486 ILE B CA  1 
ATOM   1146 C  C   . ILE B 1 38  ? 1.175   0.348   45.727 1.00 23.69 ? 1486 ILE B C   1 
ATOM   1147 O  O   . ILE B 1 38  ? 1.548   1.482   45.396 1.00 24.01 ? 1486 ILE B O   1 
ATOM   1148 C  CB  . ILE B 1 38  ? 2.845   -1.465  46.145 1.00 24.36 ? 1486 ILE B CB  1 
ATOM   1149 C  CG1 . ILE B 1 38  ? 3.697   -2.185  47.196 1.00 25.41 ? 1486 ILE B CG1 1 
ATOM   1150 C  CG2 . ILE B 1 38  ? 3.736   -0.770  45.099 1.00 27.95 ? 1486 ILE B CG2 1 
ATOM   1151 C  CD1 . ILE B 1 38  ? 4.614   -1.290  47.996 1.00 25.52 ? 1486 ILE B CD1 1 
ATOM   1152 N  N   . GLN B 1 39  ? 0.118   -0.259  45.229 1.00 25.86 ? 1487 GLN B N   1 
ATOM   1153 C  CA  . GLN B 1 39  ? -0.613  0.281   44.122 1.00 29.48 ? 1487 GLN B CA  1 
ATOM   1154 C  C   . GLN B 1 39  ? -2.082  0.018   44.251 1.00 27.02 ? 1487 GLN B C   1 
ATOM   1155 O  O   . GLN B 1 39  ? -2.500  -1.130  44.312 1.00 29.32 ? 1487 GLN B O   1 
ATOM   1156 C  CB  . GLN B 1 39  ? -0.093  -0.266  42.777 1.00 34.34 ? 1487 GLN B CB  1 
ATOM   1157 C  CG  . GLN B 1 39  ? 1.423   -0.480  42.719 1.00 38.29 ? 1487 GLN B CG  1 
ATOM   1158 C  CD  . GLN B 1 39  ? 1.997   -0.474  41.317 1.00 47.75 ? 1487 GLN B CD  1 
ATOM   1159 O  OE1 . GLN B 1 39  ? 3.206   -0.262  41.129 1.00 54.94 ? 1487 GLN B OE1 1 
ATOM   1160 N  NE2 . GLN B 1 39  ? 1.134   -0.658  40.321 1.00 45.43 ? 1487 GLN B NE2 1 
ATOM   1161 N  N   . LEU B 1 40  ? -2.847  1.084   44.325 1.00 28.06 ? 1488 LEU B N   1 
ATOM   1162 C  CA  . LEU B 1 40  ? -4.303  1.027   44.394 1.00 32.52 ? 1488 LEU B CA  1 
ATOM   1163 C  C   . LEU B 1 40  ? -4.866  0.434   43.098 1.00 34.57 ? 1488 LEU B C   1 
ATOM   1164 O  O   . LEU B 1 40  ? -4.320  0.702   42.025 1.00 40.06 ? 1488 LEU B O   1 
ATOM   1165 C  CB  . LEU B 1 40  ? -4.897  2.441   44.590 1.00 33.86 ? 1488 LEU B CB  1 
ATOM   1166 C  CG  . LEU B 1 40  ? -5.118  2.893   46.025 1.00 35.36 ? 1488 LEU B CG  1 
ATOM   1167 C  CD1 . LEU B 1 40  ? -5.374  4.389   46.063 1.00 36.64 ? 1488 LEU B CD1 1 
ATOM   1168 C  CD2 . LEU B 1 40  ? -6.283  2.123   46.640 1.00 35.50 ? 1488 LEU B CD2 1 
ATOM   1169 N  N   . PRO B 1 41  ? -5.951  -0.355  43.189 1.00 35.06 ? 1489 PRO B N   1 
ATOM   1170 C  CA  . PRO B 1 41  ? -6.656  -0.707  41.949 1.00 37.00 ? 1489 PRO B CA  1 
ATOM   1171 C  C   . PRO B 1 41  ? -7.064  0.570   41.207 1.00 38.78 ? 1489 PRO B C   1 
ATOM   1172 O  O   . PRO B 1 41  ? -7.306  1.608   41.865 1.00 35.63 ? 1489 PRO B O   1 
ATOM   1173 C  CB  . PRO B 1 41  ? -7.896  -1.475  42.449 1.00 37.14 ? 1489 PRO B CB  1 
ATOM   1174 C  CG  . PRO B 1 41  ? -7.503  -1.972  43.803 1.00 35.76 ? 1489 PRO B CG  1 
ATOM   1175 C  CD  . PRO B 1 41  ? -6.632  -0.896  44.378 1.00 33.59 ? 1489 PRO B CD  1 
ATOM   1176 N  N   . SER B 1 42  ? -7.129  0.503   39.867 1.00 38.99 ? 1490 SER B N   1 
ATOM   1177 C  CA  . SER B 1 42  ? -7.491  1.678   39.046 1.00 39.25 ? 1490 SER B CA  1 
ATOM   1178 C  C   . SER B 1 42  ? -8.936  2.068   39.300 1.00 38.76 ? 1490 SER B C   1 
ATOM   1179 O  O   . SER B 1 42  ? -9.713  1.282   39.843 1.00 38.08 ? 1490 SER B O   1 
ATOM   1180 C  CB  . SER B 1 42  ? -7.329  1.380   37.548 1.00 40.43 ? 1490 SER B CB  1 
ATOM   1181 O  OG  . SER B 1 42  ? -8.344  0.501   37.124 1.00 41.03 ? 1490 SER B OG  1 
ATOM   1182 N  N   . ARG B 1 43  ? -9.286  3.285   38.917 1.00 40.08 ? 1491 ARG B N   1 
ATOM   1183 C  CA  . ARG B 1 43  ? -10.668 3.753   38.990 1.00 42.06 ? 1491 ARG B CA  1 
ATOM   1184 C  C   . ARG B 1 43  ? -11.648 2.822   38.320 1.00 43.40 ? 1491 ARG B C   1 
ATOM   1185 O  O   . ARG B 1 43  ? -12.745 2.615   38.835 1.00 41.05 ? 1491 ARG B O   1 
ATOM   1186 C  CB  . ARG B 1 43  ? -10.813 5.146   38.378 1.00 45.08 ? 1491 ARG B CB  1 
ATOM   1187 C  CG  . ARG B 1 43  ? -10.745 6.229   39.417 1.00 46.32 ? 1491 ARG B CG  1 
ATOM   1188 C  CD  . ARG B 1 43  ? -10.757 7.608   38.796 1.00 49.58 ? 1491 ARG B CD  1 
ATOM   1189 N  NE  . ARG B 1 43  ? -10.493 8.600   39.833 1.00 53.06 ? 1491 ARG B NE  1 
ATOM   1190 C  CZ  . ARG B 1 43  ? -9.273  8.971   40.221 1.00 53.51 ? 1491 ARG B CZ  1 
ATOM   1191 N  NH1 . ARG B 1 43  ? -8.186  8.471   39.646 1.00 55.64 ? 1491 ARG B NH1 1 
ATOM   1192 N  NH2 . ARG B 1 43  ? -9.134  9.870   41.179 1.00 56.26 ? 1491 ARG B NH2 1 
ATOM   1193 N  N   . LYS B 1 44  ? -11.238 2.237   37.198 1.00 46.46 ? 1492 LYS B N   1 
ATOM   1194 C  CA  . LYS B 1 44  ? -12.053 1.298   36.451 1.00 50.54 ? 1492 LYS B CA  1 
ATOM   1195 C  C   . LYS B 1 44  ? -12.252 -0.022  37.179 1.00 51.48 ? 1492 LYS B C   1 
ATOM   1196 O  O   . LYS B 1 44  ? -13.327 -0.635  37.119 1.00 55.86 ? 1492 LYS B O   1 
ATOM   1197 C  CB  . LYS B 1 44  ? -11.375 1.008   35.101 1.00 52.92 ? 1492 LYS B CB  1 
ATOM   1198 C  CG  . LYS B 1 44  ? -11.674 2.012   34.002 1.00 56.44 ? 1492 LYS B CG  1 
ATOM   1199 C  CD  . LYS B 1 44  ? -11.044 1.564   32.691 1.00 59.72 ? 1492 LYS B CD  1 
ATOM   1200 C  CE  . LYS B 1 44  ? -11.569 0.205   32.239 1.00 62.67 ? 1492 LYS B CE  1 
ATOM   1201 N  NZ  . LYS B 1 44  ? -11.624 0.107   30.751 1.00 66.70 ? 1492 LYS B NZ  1 
ATOM   1202 N  N   . GLU B 1 45  ? -11.199 -0.483  37.828 1.00 50.10 ? 1493 GLU B N   1 
ATOM   1203 C  CA  . GLU B 1 45  ? -11.236 -1.750  38.545 1.00 48.05 ? 1493 GLU B CA  1 
ATOM   1204 C  C   . GLU B 1 45  ? -12.099 -1.649  39.813 1.00 46.92 ? 1493 GLU B C   1 
ATOM   1205 O  O   . GLU B 1 45  ? -12.758 -2.609  40.200 1.00 44.76 ? 1493 GLU B O   1 
ATOM   1206 C  CB  . GLU B 1 45  ? -9.804  -2.166  38.913 1.00 49.83 ? 1493 GLU B CB  1 
ATOM   1207 C  CG  . GLU B 1 45  ? -8.909  -2.535  37.742 1.00 53.67 ? 1493 GLU B CG  1 
ATOM   1208 C  CD  . GLU B 1 45  ? -7.443  -2.794  38.118 1.00 56.77 ? 1493 GLU B CD  1 
ATOM   1209 O  OE1 . GLU B 1 45  ? -7.013  -2.499  39.259 1.00 56.83 ? 1493 GLU B OE1 1 
ATOM   1210 O  OE2 . GLU B 1 45  ? -6.713  -3.331  37.258 1.00 57.49 ? 1493 GLU B OE2 1 
ATOM   1211 N  N   . LEU B 1 46  ? -12.069 -0.491  40.469 1.00 43.87 ? 1494 LEU B N   1 
ATOM   1212 C  CA  . LEU B 1 46  ? -12.636 -0.362  41.812 1.00 41.88 ? 1494 LEU B CA  1 
ATOM   1213 C  C   . LEU B 1 46  ? -13.214 1.032   42.040 1.00 40.86 ? 1494 LEU B C   1 
ATOM   1214 O  O   . LEU B 1 46  ? -12.687 1.824   42.844 1.00 40.22 ? 1494 LEU B O   1 
ATOM   1215 C  CB  . LEU B 1 46  ? -11.552 -0.680  42.855 1.00 39.06 ? 1494 LEU B CB  1 
ATOM   1216 C  CG  . LEU B 1 46  ? -12.030 -0.875  44.294 1.00 38.59 ? 1494 LEU B CG  1 
ATOM   1217 C  CD1 . LEU B 1 46  ? -12.927 -2.109  44.415 1.00 39.09 ? 1494 LEU B CD1 1 
ATOM   1218 C  CD2 . LEU B 1 46  ? -10.862 -0.993  45.247 1.00 38.28 ? 1494 LEU B CD2 1 
ATOM   1219 N  N   . PRO B 1 47  ? -14.305 1.350   41.330 1.00 42.98 ? 1495 PRO B N   1 
ATOM   1220 C  CA  . PRO B 1 47  ? -14.810 2.730   41.442 1.00 43.60 ? 1495 PRO B CA  1 
ATOM   1221 C  C   . PRO B 1 47  ? -15.313 3.095   42.850 1.00 42.35 ? 1495 PRO B C   1 
ATOM   1222 O  O   . PRO B 1 47  ? -15.269 4.265   43.228 1.00 42.51 ? 1495 PRO B O   1 
ATOM   1223 C  CB  . PRO B 1 47  ? -15.935 2.795   40.379 1.00 45.05 ? 1495 PRO B CB  1 
ATOM   1224 C  CG  . PRO B 1 47  ? -16.241 1.357   40.032 1.00 46.35 ? 1495 PRO B CG  1 
ATOM   1225 C  CD  . PRO B 1 47  ? -15.001 0.567   40.285 1.00 43.82 ? 1495 PRO B CD  1 
ATOM   1226 N  N   . GLU B 1 48  ? -15.780 2.102   43.605 1.00 42.53 ? 1496 GLU B N   1 
ATOM   1227 C  CA  . GLU B 1 48  ? -16.252 2.290   44.978 1.00 43.18 ? 1496 GLU B CA  1 
ATOM   1228 C  C   . GLU B 1 48  ? -15.198 2.962   45.839 1.00 41.79 ? 1496 GLU B C   1 
ATOM   1229 O  O   . GLU B 1 48  ? -15.500 3.869   46.627 1.00 43.82 ? 1496 GLU B O   1 
ATOM   1230 C  CB  . GLU B 1 48  ? -16.591 0.930   45.605 1.00 47.13 ? 1496 GLU B CB  1 
ATOM   1231 C  CG  . GLU B 1 48  ? -17.489 0.022   44.733 1.00 52.08 ? 1496 GLU B CG  1 
ATOM   1232 C  CD  . GLU B 1 48  ? -16.714 -0.928  43.807 1.00 55.38 ? 1496 GLU B CD  1 
ATOM   1233 O  OE1 . GLU B 1 48  ? -16.296 -2.024  44.251 1.00 60.67 ? 1496 GLU B OE1 1 
ATOM   1234 O  OE2 . GLU B 1 48  ? -16.551 -0.605  42.611 1.00 57.35 ? 1496 GLU B OE2 1 
ATOM   1235 N  N   . TYR B 1 49  ? -13.948 2.542   45.672 1.00 36.90 ? 1497 TYR B N   1 
ATOM   1236 C  CA  . TYR B 1 49  ? -12.847 3.158   46.413 1.00 35.47 ? 1497 TYR B CA  1 
ATOM   1237 C  C   . TYR B 1 49  ? -12.822 4.673   46.234 1.00 36.46 ? 1497 TYR B C   1 
ATOM   1238 O  O   . TYR B 1 49  ? -12.661 5.415   47.196 1.00 36.85 ? 1497 TYR B O   1 
ATOM   1239 C  CB  . TYR B 1 49  ? -11.472 2.563   46.013 1.00 32.15 ? 1497 TYR B CB  1 
ATOM   1240 C  CG  . TYR B 1 49  ? -10.392 2.879   47.013 1.00 30.55 ? 1497 TYR B CG  1 
ATOM   1241 C  CD1 . TYR B 1 49  ? -9.690  4.075   46.948 1.00 28.06 ? 1497 TYR B CD1 1 
ATOM   1242 C  CD2 . TYR B 1 49  ? -10.090 1.988   48.060 1.00 28.84 ? 1497 TYR B CD2 1 
ATOM   1243 C  CE1 . TYR B 1 49  ? -8.699  4.377   47.862 1.00 27.52 ? 1497 TYR B CE1 1 
ATOM   1244 C  CE2 . TYR B 1 49  ? -9.095  2.296   49.001 1.00 27.49 ? 1497 TYR B CE2 1 
ATOM   1245 C  CZ  . TYR B 1 49  ? -8.437  3.513   48.913 1.00 26.14 ? 1497 TYR B CZ  1 
ATOM   1246 O  OH  . TYR B 1 49  ? -7.471  3.876   49.798 1.00 24.23 ? 1497 TYR B OH  1 
ATOM   1247 N  N   . TYR B 1 50  ? -12.956 5.124   44.995 1.00 38.03 ? 1498 TYR B N   1 
ATOM   1248 C  CA  . TYR B 1 50  ? -12.794 6.539   44.680 1.00 39.55 ? 1498 TYR B CA  1 
ATOM   1249 C  C   . TYR B 1 50  ? -14.006 7.342   45.022 1.00 41.72 ? 1498 TYR B C   1 
ATOM   1250 O  O   . TYR B 1 50  ? -13.913 8.531   45.161 1.00 45.45 ? 1498 TYR B O   1 
ATOM   1251 C  CB  . TYR B 1 50  ? -12.402 6.719   43.229 1.00 39.14 ? 1498 TYR B CB  1 
ATOM   1252 C  CG  . TYR B 1 50  ? -11.078 6.056   42.958 1.00 37.06 ? 1498 TYR B CG  1 
ATOM   1253 C  CD1 . TYR B 1 50  ? -11.000 4.704   42.660 1.00 37.40 ? 1498 TYR B CD1 1 
ATOM   1254 C  CD2 . TYR B 1 50  ? -9.895  6.768   43.073 1.00 36.60 ? 1498 TYR B CD2 1 
ATOM   1255 C  CE1 . TYR B 1 50  ? -9.779  4.091   42.439 1.00 35.03 ? 1498 TYR B CE1 1 
ATOM   1256 C  CE2 . TYR B 1 50  ? -8.671  6.171   42.845 1.00 34.23 ? 1498 TYR B CE2 1 
ATOM   1257 C  CZ  . TYR B 1 50  ? -8.624  4.837   42.526 1.00 33.62 ? 1498 TYR B CZ  1 
ATOM   1258 O  OH  . TYR B 1 50  ? -7.405  4.259   42.313 1.00 32.60 ? 1498 TYR B OH  1 
ATOM   1259 N  N   . GLU B 1 51  ? -15.150 6.701   45.164 1.00 48.63 ? 1499 GLU B N   1 
ATOM   1260 C  CA  . GLU B 1 51  ? -16.331 7.399   45.671 1.00 51.51 ? 1499 GLU B CA  1 
ATOM   1261 C  C   . GLU B 1 51  ? -16.254 7.633   47.156 1.00 51.36 ? 1499 GLU B C   1 
ATOM   1262 O  O   . GLU B 1 51  ? -16.599 8.719   47.624 1.00 55.81 ? 1499 GLU B O   1 
ATOM   1263 C  CB  . GLU B 1 51  ? -17.610 6.655   45.322 1.00 54.76 ? 1499 GLU B CB  1 
ATOM   1264 C  CG  . GLU B 1 51  ? -18.080 7.057   43.946 1.00 58.98 ? 1499 GLU B CG  1 
ATOM   1265 C  CD  . GLU B 1 51  ? -17.885 5.947   42.954 1.00 62.28 ? 1499 GLU B CD  1 
ATOM   1266 O  OE1 . GLU B 1 51  ? -18.504 4.866   43.164 1.00 61.62 ? 1499 GLU B OE1 1 
ATOM   1267 O  OE2 . GLU B 1 51  ? -17.108 6.163   41.992 1.00 62.43 ? 1499 GLU B OE2 1 
ATOM   1268 N  N   . LEU B 1 52  ? -15.764 6.641   47.895 1.00 47.24 ? 1500 LEU B N   1 
ATOM   1269 C  CA  . LEU B 1 52  ? -15.711 6.738   49.345 1.00 43.64 ? 1500 LEU B CA  1 
ATOM   1270 C  C   . LEU B 1 52  ? -14.519 7.536   49.833 1.00 41.80 ? 1500 LEU B C   1 
ATOM   1271 O  O   . LEU B 1 52  ? -14.629 8.301   50.785 1.00 45.46 ? 1500 LEU B O   1 
ATOM   1272 C  CB  . LEU B 1 52  ? -15.665 5.348   49.955 1.00 43.74 ? 1500 LEU B CB  1 
ATOM   1273 C  CG  . LEU B 1 52  ? -15.512 5.354   51.480 1.00 45.44 ? 1500 LEU B CG  1 
ATOM   1274 C  CD1 . LEU B 1 52  ? -16.699 6.011   52.184 1.00 44.68 ? 1500 LEU B CD1 1 
ATOM   1275 C  CD2 . LEU B 1 52  ? -15.272 3.938   51.990 1.00 46.23 ? 1500 LEU B CD2 1 
ATOM   1276 N  N   . ILE B 1 53  ? -13.377 7.355   49.200 1.00 38.42 ? 1501 ILE B N   1 
ATOM   1277 C  CA  . ILE B 1 53  ? -12.125 7.889   49.716 1.00 39.31 ? 1501 ILE B CA  1 
ATOM   1278 C  C   . ILE B 1 53  ? -11.773 9.183   48.999 1.00 44.34 ? 1501 ILE B C   1 
ATOM   1279 O  O   . ILE B 1 53  ? -11.671 9.223   47.789 1.00 45.75 ? 1501 ILE B O   1 
ATOM   1280 C  CB  . ILE B 1 53  ? -10.984 6.859   49.548 1.00 36.67 ? 1501 ILE B CB  1 
ATOM   1281 C  CG1 . ILE B 1 53  ? -11.258 5.610   50.406 1.00 35.26 ? 1501 ILE B CG1 1 
ATOM   1282 C  CG2 . ILE B 1 53  ? -9.633  7.485   49.840 1.00 36.10 ? 1501 ILE B CG2 1 
ATOM   1283 C  CD1 . ILE B 1 53  ? -11.622 5.845   51.867 1.00 35.17 ? 1501 ILE B CD1 1 
ATOM   1284 N  N   . ARG B 1 54  ? -11.582 10.250  49.751 1.00 47.49 ? 1502 ARG B N   1 
ATOM   1285 C  CA  . ARG B 1 54  ? -11.398 11.546  49.111 1.00 49.05 ? 1502 ARG B CA  1 
ATOM   1286 C  C   . ARG B 1 54  ? -9.965  11.875  48.717 1.00 43.66 ? 1502 ARG B C   1 
ATOM   1287 O  O   . ARG B 1 54  ? -9.784  12.591  47.759 1.00 41.48 ? 1502 ARG B O   1 
ATOM   1288 C  CB  . ARG B 1 54  ? -12.004 12.657  49.960 1.00 57.36 ? 1502 ARG B CB  1 
ATOM   1289 C  CG  . ARG B 1 54  ? -13.537 12.627  49.978 1.00 63.81 ? 1502 ARG B CG  1 
ATOM   1290 C  CD  . ARG B 1 54  ? -14.175 13.999  50.100 1.00 72.73 ? 1502 ARG B CD  1 
ATOM   1291 N  NE  . ARG B 1 54  ? -13.952 14.538  51.441 1.00 80.26 ? 1502 ARG B NE  1 
ATOM   1292 C  CZ  . ARG B 1 54  ? -12.940 15.332  51.809 1.00 81.38 ? 1502 ARG B CZ  1 
ATOM   1293 N  NH1 . ARG B 1 54  ? -12.017 15.740  50.943 1.00 82.62 ? 1502 ARG B NH1 1 
ATOM   1294 N  NH2 . ARG B 1 54  ? -12.854 15.734  53.073 1.00 85.34 ? 1502 ARG B NH2 1 
ATOM   1295 N  N   . LYS B 1 55  ? -8.950  11.376  49.417 1.00 37.59 ? 1503 LYS B N   1 
ATOM   1296 C  CA  . LYS B 1 55  ? -7.568  11.598  48.963 1.00 36.75 ? 1503 LYS B CA  1 
ATOM   1297 C  C   . LYS B 1 55  ? -6.796  10.268  48.862 1.00 34.37 ? 1503 LYS B C   1 
ATOM   1298 O  O   . LYS B 1 55  ? -5.948  9.971   49.706 1.00 30.30 ? 1503 LYS B O   1 
ATOM   1299 C  CB  . LYS B 1 55  ? -6.834  12.563  49.880 1.00 38.68 ? 1503 LYS B CB  1 
ATOM   1300 C  CG  . LYS B 1 55  ? -7.573  13.885  50.131 1.00 40.97 ? 1503 LYS B CG  1 
ATOM   1301 C  CD  . LYS B 1 55  ? -7.033  14.631  51.351 1.00 44.02 ? 1503 LYS B CD  1 
ATOM   1302 C  CE  . LYS B 1 55  ? -5.519  14.525  51.533 1.00 46.25 ? 1503 LYS B CE  1 
ATOM   1303 N  NZ  . LYS B 1 55  ? -5.044  15.360  52.682 1.00 49.03 ? 1503 LYS B NZ  1 
ATOM   1304 N  N   . PRO B 1 56  ? -7.086  9.495   47.811 1.00 32.14 ? 1504 PRO B N   1 
ATOM   1305 C  CA  . PRO B 1 56  ? -6.459  8.202   47.608 1.00 31.49 ? 1504 PRO B CA  1 
ATOM   1306 C  C   . PRO B 1 56  ? -4.962  8.334   47.495 1.00 29.97 ? 1504 PRO B C   1 
ATOM   1307 O  O   . PRO B 1 56  ? -4.459  9.247   46.863 1.00 27.13 ? 1504 PRO B O   1 
ATOM   1308 C  CB  . PRO B 1 56  ? -7.067  7.702   46.293 1.00 33.42 ? 1504 PRO B CB  1 
ATOM   1309 C  CG  . PRO B 1 56  ? -8.297  8.535   46.077 1.00 36.45 ? 1504 PRO B CG  1 
ATOM   1310 C  CD  . PRO B 1 56  ? -7.971  9.860   46.683 1.00 35.79 ? 1504 PRO B CD  1 
ATOM   1311 N  N   . VAL B 1 57  ? -4.250  7.431   48.146 1.00 26.88 ? 1505 VAL B N   1 
ATOM   1312 C  CA  . VAL B 1 57  ? -2.822  7.476   48.131 1.00 25.32 ? 1505 VAL B CA  1 
ATOM   1313 C  C   . VAL B 1 57  ? -2.308  6.047   48.321 1.00 24.51 ? 1505 VAL B C   1 
ATOM   1314 O  O   . VAL B 1 57  ? -2.922  5.234   49.029 1.00 22.55 ? 1505 VAL B O   1 
ATOM   1315 C  CB  . VAL B 1 57  ? -2.278  8.475   49.181 1.00 25.63 ? 1505 VAL B CB  1 
ATOM   1316 C  CG1 . VAL B 1 57  ? -2.753  8.137   50.576 1.00 24.28 ? 1505 VAL B CG1 1 
ATOM   1317 C  CG2 . VAL B 1 57  ? -0.765  8.518   49.128 1.00 26.28 ? 1505 VAL B CG2 1 
ATOM   1318 N  N   . ASP B 1 58  ? -1.258  5.708   47.576 1.00 23.65 ? 1506 ASP B N   1 
ATOM   1319 C  CA  . ASP B 1 58  ? -0.642  4.395   47.714 1.00 23.20 ? 1506 ASP B CA  1 
ATOM   1320 C  C   . ASP B 1 58  ? 0.895   4.579   47.816 1.00 20.24 ? 1506 ASP B C   1 
ATOM   1321 O  O   . ASP B 1 58  ? 1.389   5.683   47.688 1.00 19.39 ? 1506 ASP B O   1 
ATOM   1322 C  CB  . ASP B 1 58  ? -1.121  3.470   46.601 1.00 24.25 ? 1506 ASP B CB  1 
ATOM   1323 C  CG  . ASP B 1 58  ? -0.952  4.057   45.191 1.00 26.79 ? 1506 ASP B CG  1 
ATOM   1324 O  OD1 . ASP B 1 58  ? -0.101  4.954   44.998 1.00 25.70 ? 1506 ASP B OD1 1 
ATOM   1325 O  OD2 . ASP B 1 58  ? -1.592  3.505   44.242 1.00 28.43 ? 1506 ASP B OD2 1 
ATOM   1326 N  N   . PHE B 1 59  ? 1.631   3.538   48.122 1.00 18.22 ? 1507 PHE B N   1 
ATOM   1327 C  CA  . PHE B 1 59  ? 3.038   3.759   48.271 1.00 19.03 ? 1507 PHE B CA  1 
ATOM   1328 C  C   . PHE B 1 59  ? 3.745   4.214   46.985 1.00 19.89 ? 1507 PHE B C   1 
ATOM   1329 O  O   . PHE B 1 59  ? 4.773   4.931   47.106 1.00 20.43 ? 1507 PHE B O   1 
ATOM   1330 C  CB  . PHE B 1 59  ? 3.728   2.557   48.834 1.00 18.91 ? 1507 PHE B CB  1 
ATOM   1331 C  CG  . PHE B 1 59  ? 3.587   2.427   50.286 1.00 19.43 ? 1507 PHE B CG  1 
ATOM   1332 C  CD1 . PHE B 1 59  ? 4.205   3.306   51.093 1.00 20.31 ? 1507 PHE B CD1 1 
ATOM   1333 C  CD2 . PHE B 1 59  ? 2.865   1.364   50.853 1.00 20.77 ? 1507 PHE B CD2 1 
ATOM   1334 C  CE1 . PHE B 1 59  ? 4.078   3.210   52.499 1.00 23.06 ? 1507 PHE B CE1 1 
ATOM   1335 C  CE2 . PHE B 1 59  ? 2.739   1.255   52.254 1.00 22.00 ? 1507 PHE B CE2 1 
ATOM   1336 C  CZ  . PHE B 1 59  ? 3.345   2.174   53.068 1.00 20.27 ? 1507 PHE B CZ  1 
ATOM   1337 N  N   . LYS B 1 60  ? 3.243   3.800   45.800 1.00 20.86 ? 1508 LYS B N   1 
ATOM   1338 C  CA  . LYS B 1 60  ? 3.778   4.288   44.520 1.00 22.48 ? 1508 LYS B CA  1 
ATOM   1339 C  C   . LYS B 1 60  ? 3.717   5.836   44.438 1.00 23.11 ? 1508 LYS B C   1 
ATOM   1340 O  O   . LYS B 1 60  ? 4.678   6.491   44.059 1.00 24.28 ? 1508 LYS B O   1 
ATOM   1341 C  CB  . LYS B 1 60  ? 2.998   3.703   43.352 1.00 24.65 ? 1508 LYS B CB  1 
ATOM   1342 C  CG  . LYS B 1 60  ? 3.671   3.997   41.983 1.00 25.85 ? 1508 LYS B CG  1 
ATOM   1343 C  CD  . LYS B 1 60  ? 3.058   3.140   40.900 1.00 29.54 ? 1508 LYS B CD  1 
ATOM   1344 C  CE  . LYS B 1 60  ? 3.618   3.398   39.476 1.00 31.16 ? 1508 LYS B CE  1 
ATOM   1345 N  NZ  . LYS B 1 60  ? 3.931   4.806   39.168 1.00 34.90 ? 1508 LYS B NZ  1 
ATOM   1346 N  N   . LYS B 1 61  ? 2.559   6.396   44.782 1.00 23.40 ? 1509 LYS B N   1 
ATOM   1347 C  CA  . LYS B 1 61  ? 2.357   7.857   44.874 1.00 25.27 ? 1509 LYS B CA  1 
ATOM   1348 C  C   . LYS B 1 61  ? 3.253   8.510   45.891 1.00 22.69 ? 1509 LYS B C   1 
ATOM   1349 O  O   . LYS B 1 61  ? 3.786   9.606   45.643 1.00 21.98 ? 1509 LYS B O   1 
ATOM   1350 C  CB  . LYS B 1 61  ? 0.898   8.201   45.161 1.00 28.00 ? 1509 LYS B CB  1 
ATOM   1351 C  CG  . LYS B 1 61  ? 0.551   9.690   45.078 1.00 33.44 ? 1509 LYS B CG  1 
ATOM   1352 C  CD  . LYS B 1 61  ? 0.481   10.139  43.612 1.00 39.50 ? 1509 LYS B CD  1 
ATOM   1353 C  CE  . LYS B 1 61  ? 0.230   11.626  43.405 1.00 45.74 ? 1509 LYS B CE  1 
ATOM   1354 N  NZ  . LYS B 1 61  ? 1.496   12.414  43.287 1.00 51.14 ? 1509 LYS B NZ  1 
ATOM   1355 N  N   . ILE B 1 62  ? 3.418   7.891   47.056 1.00 22.00 ? 1510 ILE B N   1 
ATOM   1356 C  CA  . ILE B 1 62  ? 4.288   8.462   48.081 1.00 20.96 ? 1510 ILE B CA  1 
ATOM   1357 C  C   . ILE B 1 62  ? 5.715   8.522   47.545 1.00 22.05 ? 1510 ILE B C   1 
ATOM   1358 O  O   . ILE B 1 62  ? 6.352   9.531   47.713 1.00 20.75 ? 1510 ILE B O   1 
ATOM   1359 C  CB  . ILE B 1 62  ? 4.190   7.756   49.412 1.00 21.32 ? 1510 ILE B CB  1 
ATOM   1360 C  CG1 . ILE B 1 62  ? 2.809   8.035   49.999 1.00 23.19 ? 1510 ILE B CG1 1 
ATOM   1361 C  CG2 . ILE B 1 62  ? 5.334   8.142   50.362 1.00 20.30 ? 1510 ILE B CG2 1 
ATOM   1362 C  CD1 . ILE B 1 62  ? 2.504   7.204   51.250 1.00 23.75 ? 1510 ILE B CD1 1 
ATOM   1363 N  N   . LYS B 1 63  ? 6.184   7.487   46.847 1.00 23.96 ? 1511 LYS B N   1 
ATOM   1364 C  CA  . LYS B 1 63  ? 7.534   7.515   46.270 1.00 26.55 ? 1511 LYS B CA  1 
ATOM   1365 C  C   . LYS B 1 63  ? 7.688   8.607   45.209 1.00 25.56 ? 1511 LYS B C   1 
ATOM   1366 O  O   . LYS B 1 63  ? 8.757   9.182   45.049 1.00 26.13 ? 1511 LYS B O   1 
ATOM   1367 C  CB  . LYS B 1 63  ? 7.875   6.155   45.627 1.00 29.11 ? 1511 LYS B CB  1 
ATOM   1368 C  CG  . LYS B 1 63  ? 8.221   5.048   46.629 1.00 33.44 ? 1511 LYS B CG  1 
ATOM   1369 C  CD  . LYS B 1 63  ? 8.440   3.693   45.921 1.00 40.09 ? 1511 LYS B CD  1 
ATOM   1370 C  CE  . LYS B 1 63  ? 7.081   3.090   45.547 1.00 44.40 ? 1511 LYS B CE  1 
ATOM   1371 N  NZ  . LYS B 1 63  ? 7.108   1.788   44.778 1.00 49.00 ? 1511 LYS B NZ  1 
ATOM   1372 N  N   . GLU B 1 64  ? 6.627   8.831   44.462 1.00 26.78 ? 1512 GLU B N   1 
ATOM   1373 C  CA  . GLU B 1 64  ? 6.570   9.908   43.437 1.00 29.94 ? 1512 GLU B CA  1 
ATOM   1374 C  C   . GLU B 1 64  ? 6.588   11.322  44.056 1.00 27.06 ? 1512 GLU B C   1 
ATOM   1375 O  O   . GLU B 1 64  ? 7.316   12.218  43.585 1.00 26.99 ? 1512 GLU B O   1 
ATOM   1376 C  CB  . GLU B 1 64  ? 5.322   9.685   42.564 1.00 35.13 ? 1512 GLU B CB  1 
ATOM   1377 C  CG  . GLU B 1 64  ? 4.810   10.844  41.688 1.00 42.41 ? 1512 GLU B CG  1 
ATOM   1378 C  CD  . GLU B 1 64  ? 3.765   10.363  40.688 1.00 48.90 ? 1512 GLU B CD  1 
ATOM   1379 O  OE1 . GLU B 1 64  ? 3.475   11.078  39.700 1.00 56.70 ? 1512 GLU B OE1 1 
ATOM   1380 O  OE2 . GLU B 1 64  ? 3.244   9.235   40.881 1.00 54.34 ? 1512 GLU B OE2 1 
ATOM   1381 N  N   . ARG B 1 65  ? 5.850   11.508  45.149 1.00 24.17 ? 1513 ARG B N   1 
ATOM   1382 C  CA  . ARG B 1 65  ? 5.839   12.800  45.863 1.00 24.68 ? 1513 ARG B CA  1 
ATOM   1383 C  C   . ARG B 1 65  ? 7.202   13.108  46.507 1.00 22.79 ? 1513 ARG B C   1 
ATOM   1384 O  O   . ARG B 1 65  ? 7.675   14.228  46.487 1.00 21.84 ? 1513 ARG B O   1 
ATOM   1385 C  CB  . ARG B 1 65  ? 4.746   12.824  46.870 1.00 25.14 ? 1513 ARG B CB  1 
ATOM   1386 C  CG  . ARG B 1 65  ? 3.368   12.818  46.217 1.00 28.20 ? 1513 ARG B CG  1 
ATOM   1387 C  CD  . ARG B 1 65  ? 2.263   12.926  47.285 1.00 29.97 ? 1513 ARG B CD  1 
ATOM   1388 N  NE  . ARG B 1 65  ? 0.868   12.804  46.913 1.00 34.35 ? 1513 ARG B NE  1 
ATOM   1389 C  CZ  . ARG B 1 65  ? 0.205   13.494  45.991 1.00 43.17 ? 1513 ARG B CZ  1 
ATOM   1390 N  NH1 . ARG B 1 65  ? 0.798   14.414  45.172 1.00 47.57 ? 1513 ARG B NH1 1 
ATOM   1391 N  NH2 . ARG B 1 65  ? -1.099  13.223  45.849 1.00 40.39 ? 1513 ARG B NH2 1 
ATOM   1392 N  N   . ILE B 1 66  ? 7.877   12.055  46.958 1.00 21.95 ? 1514 ILE B N   1 
ATOM   1393 C  CA  . ILE B 1 66  ? 9.253   12.166  47.384 1.00 22.23 ? 1514 ILE B CA  1 
ATOM   1394 C  C   . ILE B 1 66  ? 10.148  12.616  46.205 1.00 23.13 ? 1514 ILE B C   1 
ATOM   1395 O  O   . ILE B 1 66  ? 10.757  13.642  46.290 1.00 21.51 ? 1514 ILE B O   1 
ATOM   1396 C  CB  . ILE B 1 66  ? 9.811   10.858  47.964 1.00 21.05 ? 1514 ILE B CB  1 
ATOM   1397 C  CG1 . ILE B 1 66  ? 9.170   10.550  49.330 1.00 21.96 ? 1514 ILE B CG1 1 
ATOM   1398 C  CG2 . ILE B 1 66  ? 11.309  10.900  48.144 1.00 22.00 ? 1514 ILE B CG2 1 
ATOM   1399 C  CD1 . ILE B 1 66  ? 9.388   9.153   49.827 1.00 20.05 ? 1514 ILE B CD1 1 
ATOM   1400 N  N   . ARG B 1 67  ? 10.222  11.818  45.160 1.00 22.89 ? 1515 ARG B N   1 
ATOM   1401 C  CA  . ARG B 1 67  ? 11.050  12.116  43.990 1.00 25.84 ? 1515 ARG B CA  1 
ATOM   1402 C  C   . ARG B 1 67  ? 10.732  13.499  43.427 1.00 25.94 ? 1515 ARG B C   1 
ATOM   1403 O  O   . ARG B 1 67  ? 11.611  14.151  42.945 1.00 27.41 ? 1515 ARG B O   1 
ATOM   1404 C  CB  . ARG B 1 67  ? 10.811  11.021  42.975 1.00 26.24 ? 1515 ARG B CB  1 
ATOM   1405 C  CG  . ARG B 1 67  ? 11.549  11.076  41.673 1.00 30.26 ? 1515 ARG B CG  1 
ATOM   1406 C  CD  . ARG B 1 67  ? 10.818  10.211  40.660 1.00 31.54 ? 1515 ARG B CD  1 
ATOM   1407 N  NE  . ARG B 1 67  ? 9.643   10.928  40.179 1.00 33.22 ? 1515 ARG B NE  1 
ATOM   1408 C  CZ  . ARG B 1 67  ? 8.585   10.365  39.588 1.00 35.34 ? 1515 ARG B CZ  1 
ATOM   1409 N  NH1 . ARG B 1 67  ? 8.522   9.051   39.417 1.00 32.37 ? 1515 ARG B NH1 1 
ATOM   1410 N  NH2 . ARG B 1 67  ? 7.580   11.131  39.152 1.00 36.30 ? 1515 ARG B NH2 1 
ATOM   1411 N  N   . ASN B 1 68  ? 9.483   13.957  43.543 1.00 26.14 ? 1516 ASN B N   1 
ATOM   1412 C  CA  . ASN B 1 68  ? 9.043   15.272  43.032 1.00 25.01 ? 1516 ASN B CA  1 
ATOM   1413 C  C   . ASN B 1 68  ? 9.122   16.433  44.045 1.00 25.17 ? 1516 ASN B C   1 
ATOM   1414 O  O   . ASN B 1 68  ? 8.546   17.502  43.797 1.00 25.11 ? 1516 ASN B O   1 
ATOM   1415 C  CB  . ASN B 1 68  ? 7.593   15.218  42.484 1.00 25.83 ? 1516 ASN B CB  1 
ATOM   1416 C  CG  . ASN B 1 68  ? 7.398   14.327  41.229 1.00 27.23 ? 1516 ASN B CG  1 
ATOM   1417 O  OD1 . ASN B 1 68  ? 8.355   13.934  40.527 1.00 28.92 ? 1516 ASN B OD1 1 
ATOM   1418 N  ND2 . ASN B 1 68  ? 6.107   14.069  40.891 1.00 26.24 ? 1516 ASN B ND2 1 
ATOM   1419 N  N   . HIS B 1 69  ? 9.834   16.234  45.165 1.00 24.64 ? 1517 HIS B N   1 
ATOM   1420 C  CA  . HIS B 1 69  ? 10.031  17.221  46.215 1.00 25.69 ? 1517 HIS B CA  1 
ATOM   1421 C  C   . HIS B 1 69  ? 8.732   17.833  46.745 1.00 27.69 ? 1517 HIS B C   1 
ATOM   1422 O  O   . HIS B 1 69  ? 8.651   19.056  46.986 1.00 27.79 ? 1517 HIS B O   1 
ATOM   1423 C  CB  . HIS B 1 69  ? 10.971  18.321  45.749 1.00 24.62 ? 1517 HIS B CB  1 
ATOM   1424 C  CG  . HIS B 1 69  ? 12.386  17.875  45.644 1.00 24.83 ? 1517 HIS B CG  1 
ATOM   1425 N  ND1 . HIS B 1 69  ? 13.436  18.690  45.958 1.00 24.80 ? 1517 HIS B ND1 1 
ATOM   1426 C  CD2 . HIS B 1 69  ? 12.930  16.687  45.274 1.00 24.23 ? 1517 HIS B CD2 1 
ATOM   1427 C  CE1 . HIS B 1 69  ? 14.573  18.037  45.787 1.00 25.29 ? 1517 HIS B CE1 1 
ATOM   1428 N  NE2 . HIS B 1 69  ? 14.287  16.808  45.404 1.00 24.95 ? 1517 HIS B NE2 1 
ATOM   1429 N  N   . LYS B 1 70  ? 7.733   16.975  46.984 1.00 29.20 ? 1518 LYS B N   1 
ATOM   1430 C  CA  . LYS B 1 70  ? 6.470   17.490  47.410 1.00 30.56 ? 1518 LYS B CA  1 
ATOM   1431 C  C   . LYS B 1 70  ? 6.334   17.538  48.898 1.00 31.33 ? 1518 LYS B C   1 
ATOM   1432 O  O   . LYS B 1 70  ? 5.339   18.078  49.380 1.00 34.09 ? 1518 LYS B O   1 
ATOM   1433 C  CB  . LYS B 1 70  ? 5.316   16.692  46.831 1.00 32.83 ? 1518 LYS B CB  1 
ATOM   1434 C  CG  . LYS B 1 70  ? 5.177   16.735  45.320 1.00 35.53 ? 1518 LYS B CG  1 
ATOM   1435 C  CD  . LYS B 1 70  ? 5.008   18.159  44.830 1.00 36.61 ? 1518 LYS B CD  1 
ATOM   1436 C  CE  . LYS B 1 70  ? 3.860   18.263  43.879 1.00 39.23 ? 1518 LYS B CE  1 
ATOM   1437 N  NZ  . LYS B 1 70  ? 3.970   17.291  42.770 1.00 41.44 ? 1518 LYS B NZ  1 
ATOM   1438 N  N   . TYR B 1 71  ? 7.252   16.901  49.633 1.00 31.84 ? 1519 TYR B N   1 
ATOM   1439 C  CA  . TYR B 1 71  ? 7.249   16.929  51.099 1.00 30.35 ? 1519 TYR B CA  1 
ATOM   1440 C  C   . TYR B 1 71  ? 8.333   17.868  51.570 1.00 34.15 ? 1519 TYR B C   1 
ATOM   1441 O  O   . TYR B 1 71  ? 9.513   17.761  51.167 1.00 34.46 ? 1519 TYR B O   1 
ATOM   1442 C  CB  . TYR B 1 71  ? 7.490   15.542  51.717 1.00 28.90 ? 1519 TYR B CB  1 
ATOM   1443 C  CG  . TYR B 1 71  ? 6.499   14.490  51.331 1.00 26.84 ? 1519 TYR B CG  1 
ATOM   1444 C  CD1 . TYR B 1 71  ? 5.128   14.700  51.479 1.00 25.91 ? 1519 TYR B CD1 1 
ATOM   1445 C  CD2 . TYR B 1 71  ? 6.926   13.268  50.793 1.00 25.55 ? 1519 TYR B CD2 1 
ATOM   1446 C  CE1 . TYR B 1 71  ? 4.215   13.731  51.142 1.00 24.66 ? 1519 TYR B CE1 1 
ATOM   1447 C  CE2 . TYR B 1 71  ? 6.024   12.334  50.385 1.00 23.38 ? 1519 TYR B CE2 1 
ATOM   1448 C  CZ  . TYR B 1 71  ? 4.674   12.547  50.561 1.00 25.17 ? 1519 TYR B CZ  1 
ATOM   1449 O  OH  . TYR B 1 71  ? 3.760   11.556  50.196 1.00 24.21 ? 1519 TYR B OH  1 
ATOM   1450 N  N   . ARG B 1 72  ? 7.922   18.786  52.433 1.00 35.40 ? 1520 ARG B N   1 
ATOM   1451 C  CA  . ARG B 1 72  ? 8.809   19.755  53.006 1.00 38.94 ? 1520 ARG B CA  1 
ATOM   1452 C  C   . ARG B 1 72  ? 9.504   19.170  54.227 1.00 39.06 ? 1520 ARG B C   1 
ATOM   1453 O  O   . ARG B 1 72  ? 10.624  19.551  54.483 1.00 36.99 ? 1520 ARG B O   1 
ATOM   1454 C  CB  . ARG B 1 72  ? 7.991   21.007  53.367 1.00 44.75 ? 1520 ARG B CB  1 
ATOM   1455 C  CG  . ARG B 1 72  ? 8.753   22.189  53.948 1.00 51.51 ? 1520 ARG B CG  1 
ATOM   1456 C  CD  . ARG B 1 72  ? 7.839   23.076  54.824 1.00 56.11 ? 1520 ARG B CD  1 
ATOM   1457 N  NE  . ARG B 1 72  ? 7.671   22.432  56.135 1.00 59.76 ? 1520 ARG B NE  1 
ATOM   1458 C  CZ  . ARG B 1 72  ? 6.654   21.646  56.484 1.00 66.93 ? 1520 ARG B CZ  1 
ATOM   1459 N  NH1 . ARG B 1 72  ? 5.641   21.414  55.648 1.00 71.02 ? 1520 ARG B NH1 1 
ATOM   1460 N  NH2 . ARG B 1 72  ? 6.640   21.093  57.694 1.00 67.60 ? 1520 ARG B NH2 1 
ATOM   1461 N  N   . SER B 1 73  ? 8.847   18.264  54.999 1.00 38.10 ? 1521 SER B N   1 
ATOM   1462 C  CA  . SER B 1 73  ? 9.434   17.683  56.241 1.00 35.41 ? 1521 SER B CA  1 
ATOM   1463 C  C   . SER B 1 73  ? 9.200   16.177  56.320 1.00 34.13 ? 1521 SER B C   1 
ATOM   1464 O  O   . SER B 1 73  ? 8.347   15.672  55.640 1.00 33.21 ? 1521 SER B O   1 
ATOM   1465 C  CB  . SER B 1 73  ? 8.852   18.319  57.505 1.00 36.83 ? 1521 SER B CB  1 
ATOM   1466 O  OG  . SER B 1 73  ? 7.437   18.287  57.517 1.00 40.47 ? 1521 SER B OG  1 
ATOM   1467 N  N   . LEU B 1 74  ? 9.963   15.476  57.150 1.00 33.61 ? 1522 LEU B N   1 
ATOM   1468 C  CA  . LEU B 1 74  ? 9.617   14.088  57.517 1.00 31.89 ? 1522 LEU B CA  1 
ATOM   1469 C  C   . LEU B 1 74  ? 8.176   14.016  58.112 1.00 30.52 ? 1522 LEU B C   1 
ATOM   1470 O  O   . LEU B 1 74  ? 7.474   13.028  57.916 1.00 25.74 ? 1522 LEU B O   1 
ATOM   1471 C  CB  . LEU B 1 74  ? 10.644  13.519  58.495 1.00 34.45 ? 1522 LEU B CB  1 
ATOM   1472 C  CG  . LEU B 1 74  ? 12.042  13.201  57.942 1.00 34.52 ? 1522 LEU B CG  1 
ATOM   1473 C  CD1 . LEU B 1 74  ? 12.913  12.463  58.948 1.00 33.63 ? 1522 LEU B CD1 1 
ATOM   1474 C  CD2 . LEU B 1 74  ? 11.954  12.361  56.688 1.00 34.41 ? 1522 LEU B CD2 1 
ATOM   1475 N  N   . ASN B 1 75  ? 7.736   15.066  58.805 1.00 29.73 ? 1523 ASN B N   1 
ATOM   1476 C  CA  . ASN B 1 75  ? 6.335   15.148  59.254 1.00 30.72 ? 1523 ASN B CA  1 
ATOM   1477 C  C   . ASN B 1 75  ? 5.309   15.138  58.142 1.00 29.06 ? 1523 ASN B C   1 
ATOM   1478 O  O   . ASN B 1 75  ? 4.245   14.522  58.290 1.00 27.61 ? 1523 ASN B O   1 
ATOM   1479 C  CB  . ASN B 1 75  ? 6.103   16.392  60.114 1.00 33.03 ? 1523 ASN B CB  1 
ATOM   1480 C  CG  . ASN B 1 75  ? 6.666   16.231  61.511 1.00 34.28 ? 1523 ASN B CG  1 
ATOM   1481 O  OD1 . ASN B 1 75  ? 7.200   15.169  61.860 1.00 32.21 ? 1523 ASN B OD1 1 
ATOM   1482 N  ND2 . ASN B 1 75  ? 6.609   17.303  62.301 1.00 35.20 ? 1523 ASN B ND2 1 
ATOM   1483 N  N   . ASP B 1 76  ? 5.579   15.846  57.049 1.00 25.85 ? 1524 ASP B N   1 
ATOM   1484 C  CA  . ASP B 1 76  ? 4.701   15.768  55.905 1.00 27.09 ? 1524 ASP B CA  1 
ATOM   1485 C  C   . ASP B 1 76  ? 4.748   14.394  55.260 1.00 24.20 ? 1524 ASP B C   1 
ATOM   1486 O  O   . ASP B 1 76  ? 3.715   13.953  54.806 1.00 22.85 ? 1524 ASP B O   1 
ATOM   1487 C  CB  . ASP B 1 76  ? 5.041   16.814  54.848 1.00 31.76 ? 1524 ASP B CB  1 
ATOM   1488 C  CG  . ASP B 1 76  ? 4.944   18.205  55.403 1.00 37.90 ? 1524 ASP B CG  1 
ATOM   1489 O  OD1 . ASP B 1 76  ? 3.862   18.544  55.916 1.00 42.09 ? 1524 ASP B OD1 1 
ATOM   1490 O  OD2 . ASP B 1 76  ? 5.964   18.917  55.403 1.00 45.38 ? 1524 ASP B OD2 1 
ATOM   1491 N  N   . LEU B 1 77  ? 5.915   13.726  55.206 1.00 22.10 ? 1525 LEU B N   1 
ATOM   1492 C  CA  . LEU B 1 77  ? 5.917   12.315  54.749 1.00 22.42 ? 1525 LEU B CA  1 
ATOM   1493 C  C   . LEU B 1 77  ? 5.016   11.459  55.661 1.00 23.15 ? 1525 LEU B C   1 
ATOM   1494 O  O   . LEU B 1 77  ? 4.142   10.744  55.178 1.00 21.63 ? 1525 LEU B O   1 
ATOM   1495 C  CB  . LEU B 1 77  ? 7.321   11.744  54.723 1.00 22.55 ? 1525 LEU B CB  1 
ATOM   1496 C  CG  . LEU B 1 77  ? 7.444   10.285  54.383 1.00 23.51 ? 1525 LEU B CG  1 
ATOM   1497 C  CD1 . LEU B 1 77  ? 6.686   9.919   53.113 1.00 22.17 ? 1525 LEU B CD1 1 
ATOM   1498 C  CD2 . LEU B 1 77  ? 8.931   9.917   54.231 1.00 24.44 ? 1525 LEU B CD2 1 
ATOM   1499 N  N   . GLU B 1 78  ? 5.225   11.554  56.967 1.00 22.81 ? 1526 GLU B N   1 
ATOM   1500 C  CA  . GLU B 1 78  ? 4.476   10.728  57.923 1.00 24.99 ? 1526 GLU B CA  1 
ATOM   1501 C  C   . GLU B 1 78  ? 2.972   10.932  57.757 1.00 26.84 ? 1526 GLU B C   1 
ATOM   1502 O  O   . GLU B 1 78  ? 2.178   9.984   57.745 1.00 25.49 ? 1526 GLU B O   1 
ATOM   1503 C  CB  . GLU B 1 78  ? 4.902   11.101  59.342 1.00 25.37 ? 1526 GLU B CB  1 
ATOM   1504 C  CG  . GLU B 1 78  ? 4.076   10.442  60.426 1.00 26.76 ? 1526 GLU B CG  1 
ATOM   1505 C  CD  . GLU B 1 78  ? 4.709   10.483  61.800 1.00 29.83 ? 1526 GLU B CD  1 
ATOM   1506 O  OE1 . GLU B 1 78  ? 5.984   10.429  61.922 1.00 27.68 ? 1526 GLU B OE1 1 
ATOM   1507 O  OE2 . GLU B 1 78  ? 3.891   10.538  62.769 1.00 30.11 ? 1526 GLU B OE2 1 
ATOM   1508 N  N   . LYS B 1 79  ? 2.575   12.194  57.608 1.00 27.28 ? 1527 LYS B N   1 
ATOM   1509 C  CA  . LYS B 1 79  ? 1.198   12.517  57.392 1.00 27.52 ? 1527 LYS B CA  1 
ATOM   1510 C  C   . LYS B 1 79  ? 0.594   11.723  56.231 1.00 26.71 ? 1527 LYS B C   1 
ATOM   1511 O  O   . LYS B 1 79  ? -0.543  11.301  56.282 1.00 23.41 ? 1527 LYS B O   1 
ATOM   1512 C  CB  . LYS B 1 79  ? 1.094   14.028  57.179 1.00 32.78 ? 1527 LYS B CB  1 
ATOM   1513 C  CG  . LYS B 1 79  ? -0.300  14.568  56.898 1.00 36.25 ? 1527 LYS B CG  1 
ATOM   1514 C  CD  . LYS B 1 79  ? -0.465  16.094  57.054 1.00 38.91 ? 1527 LYS B CD  1 
ATOM   1515 C  CE  . LYS B 1 79  ? -0.219  16.768  55.690 1.00 42.66 ? 1527 LYS B CE  1 
ATOM   1516 N  NZ  . LYS B 1 79  ? 0.386   18.157  55.645 1.00 43.06 ? 1527 LYS B NZ  1 
ATOM   1517 N  N   . ASP B 1 80  ? 1.328   11.577  55.129 1.00 26.05 ? 1528 ASP B N   1 
ATOM   1518 C  CA  . ASP B 1 80  ? 0.751   10.931  53.954 1.00 25.87 ? 1528 ASP B CA  1 
ATOM   1519 C  C   . ASP B 1 80  ? 0.712   9.408   54.142 1.00 23.52 ? 1528 ASP B C   1 
ATOM   1520 O  O   . ASP B 1 80  ? -0.210  8.756   53.682 1.00 22.44 ? 1528 ASP B O   1 
ATOM   1521 C  CB  . ASP B 1 80  ? 1.574   11.267  52.694 1.00 27.49 ? 1528 ASP B CB  1 
ATOM   1522 C  CG  . ASP B 1 80  ? 0.728   11.825  51.556 1.00 30.54 ? 1528 ASP B CG  1 
ATOM   1523 O  OD1 . ASP B 1 80  ? -0.420  12.246  51.822 1.00 32.84 ? 1528 ASP B OD1 1 
ATOM   1524 O  OD2 . ASP B 1 80  ? 1.238   11.886  50.394 1.00 27.84 ? 1528 ASP B OD2 1 
ATOM   1525 N  N   . VAL B 1 81  ? 1.731   8.844   54.780 1.00 21.73 ? 1529 VAL B N   1 
ATOM   1526 C  CA  . VAL B 1 81  ? 1.667   7.436   55.186 1.00 21.75 ? 1529 VAL B CA  1 
ATOM   1527 C  C   . VAL B 1 81  ? 0.490   7.172   56.125 1.00 20.79 ? 1529 VAL B C   1 
ATOM   1528 O  O   . VAL B 1 81  ? -0.241  6.205   55.940 1.00 20.00 ? 1529 VAL B O   1 
ATOM   1529 C  CB  . VAL B 1 81  ? 2.968   6.992   55.845 1.00 22.22 ? 1529 VAL B CB  1 
ATOM   1530 C  CG1 . VAL B 1 81  ? 2.865   5.578   56.378 1.00 24.40 ? 1529 VAL B CG1 1 
ATOM   1531 C  CG2 . VAL B 1 81  ? 4.117   7.071   54.847 1.00 23.84 ? 1529 VAL B CG2 1 
ATOM   1532 N  N   . MET B 1 82  ? 0.314   8.003   57.156 1.00 21.50 ? 1530 MET B N   1 
ATOM   1533 C  CA  . MET B 1 82  ? -0.767  7.787   58.091 1.00 22.96 ? 1530 MET B CA  1 
ATOM   1534 C  C   . MET B 1 82  ? -2.127  7.954   57.386 1.00 22.44 ? 1530 MET B C   1 
ATOM   1535 O  O   . MET B 1 82  ? -3.066  7.255   57.684 1.00 23.11 ? 1530 MET B O   1 
ATOM   1536 C  CB  . MET B 1 82  ? -0.655  8.753   59.299 1.00 26.27 ? 1530 MET B CB  1 
ATOM   1537 C  CG  . MET B 1 82  ? 0.596   8.547   60.132 1.00 27.74 ? 1530 MET B CG  1 
ATOM   1538 S  SD  . MET B 1 82  ? 0.645   6.855   60.762 1.00 28.23 ? 1530 MET B SD  1 
ATOM   1539 C  CE  . MET B 1 82  ? 2.319   6.720   61.352 1.00 30.52 ? 1530 MET B CE  1 
ATOM   1540 N  N   . LEU B 1 83  ? -2.239  8.885   56.443 1.00 21.64 ? 1531 LEU B N   1 
ATOM   1541 C  CA  . LEU B 1 83  ? -3.428  8.948   55.605 1.00 23.16 ? 1531 LEU B CA  1 
ATOM   1542 C  C   . LEU B 1 83  ? -3.696  7.667   54.735 1.00 21.70 ? 1531 LEU B C   1 
ATOM   1543 O  O   . LEU B 1 83  ? -4.837  7.272   54.595 1.00 20.77 ? 1531 LEU B O   1 
ATOM   1544 C  CB  . LEU B 1 83  ? -3.321  10.132  54.695 1.00 25.20 ? 1531 LEU B CB  1 
ATOM   1545 C  CG  . LEU B 1 83  ? -4.417  10.482  53.693 1.00 26.90 ? 1531 LEU B CG  1 
ATOM   1546 C  CD1 . LEU B 1 83  ? -5.702  10.830  54.436 1.00 26.44 ? 1531 LEU B CD1 1 
ATOM   1547 C  CD2 . LEU B 1 83  ? -3.922  11.689  52.882 1.00 26.10 ? 1531 LEU B CD2 1 
ATOM   1548 N  N   . LEU B 1 84  ? -2.667  7.095   54.086 1.00 19.51 ? 1532 LEU B N   1 
ATOM   1549 C  CA  . LEU B 1 84  ? -2.840  5.827   53.388 1.00 18.94 ? 1532 LEU B CA  1 
ATOM   1550 C  C   . LEU B 1 84  ? -3.481  4.825   54.366 1.00 16.91 ? 1532 LEU B C   1 
ATOM   1551 O  O   . LEU B 1 84  ? -4.412  4.165   54.060 1.00 16.44 ? 1532 LEU B O   1 
ATOM   1552 C  CB  . LEU B 1 84  ? -1.458  5.307   52.907 1.00 18.95 ? 1532 LEU B CB  1 
ATOM   1553 C  CG  . LEU B 1 84  ? -1.385  4.074   52.014 1.00 18.59 ? 1532 LEU B CG  1 
ATOM   1554 C  CD1 . LEU B 1 84  ? -0.028  4.078   51.308 1.00 19.28 ? 1532 LEU B CD1 1 
ATOM   1555 C  CD2 . LEU B 1 84  ? -1.578  2.768   52.761 1.00 19.41 ? 1532 LEU B CD2 1 
ATOM   1556 N  N   . CYS B 1 85  ? -2.977  4.745   55.577 1.00 17.42 ? 1533 CYS B N   1 
ATOM   1557 C  CA  . CYS B 1 85  ? -3.477  3.745   56.504 1.00 18.14 ? 1533 CYS B CA  1 
ATOM   1558 C  C   . CYS B 1 85  ? -4.894  4.072   56.943 1.00 18.32 ? 1533 CYS B C   1 
ATOM   1559 O  O   . CYS B 1 85  ? -5.748  3.192   56.982 1.00 17.57 ? 1533 CYS B O   1 
ATOM   1560 C  CB  . CYS B 1 85  ? -2.503  3.581   57.694 1.00 19.96 ? 1533 CYS B CB  1 
ATOM   1561 S  SG  . CYS B 1 85  ? -0.822  3.006   57.244 1.00 21.07 ? 1533 CYS B SG  1 
ATOM   1562 N  N   . GLN B 1 86  ? -5.160  5.343   57.232 1.00 17.94 ? 1534 GLN B N   1 
ATOM   1563 C  CA  . GLN B 1 86  ? -6.519  5.781   57.559 1.00 21.23 ? 1534 GLN B CA  1 
ATOM   1564 C  C   . GLN B 1 86  ? -7.526  5.473   56.463 1.00 20.88 ? 1534 GLN B C   1 
ATOM   1565 O  O   . GLN B 1 86  ? -8.600  4.937   56.710 1.00 21.29 ? 1534 GLN B O   1 
ATOM   1566 C  CB  . GLN B 1 86  ? -6.513  7.295   57.788 1.00 24.17 ? 1534 GLN B CB  1 
ATOM   1567 C  CG  . GLN B 1 86  ? -7.854  7.859   58.179 1.00 29.18 ? 1534 GLN B CG  1 
ATOM   1568 C  CD  . GLN B 1 86  ? -7.733  9.327   58.595 1.00 32.09 ? 1534 GLN B CD  1 
ATOM   1569 O  OE1 . GLN B 1 86  ? -6.825  10.042  58.183 1.00 37.86 ? 1534 GLN B OE1 1 
ATOM   1570 N  NE2 . GLN B 1 86  ? -8.640  9.766   59.442 1.00 36.30 ? 1534 GLN B NE2 1 
ATOM   1571 N  N   . ASN B 1 87  ? -7.149  5.756   55.230 1.00 20.38 ? 1535 ASN B N   1 
ATOM   1572 C  CA  . ASN B 1 87  ? -7.940  5.366   54.070 1.00 21.28 ? 1535 ASN B CA  1 
ATOM   1573 C  C   . ASN B 1 87  ? -8.198  3.865   53.992 1.00 20.44 ? 1535 ASN B C   1 
ATOM   1574 O  O   . ASN B 1 87  ? -9.310  3.417   53.708 1.00 21.74 ? 1535 ASN B O   1 
ATOM   1575 C  CB  . ASN B 1 87  ? -7.246  5.801   52.760 1.00 21.22 ? 1535 ASN B CB  1 
ATOM   1576 C  CG  . ASN B 1 87  ? -7.286  7.301   52.522 1.00 22.22 ? 1535 ASN B CG  1 
ATOM   1577 O  OD1 . ASN B 1 87  ? -8.048  8.000   53.161 1.00 22.07 ? 1535 ASN B OD1 1 
ATOM   1578 N  ND2 . ASN B 1 87  ? -6.470  7.794   51.547 1.00 22.53 ? 1535 ASN B ND2 1 
ATOM   1579 N  N   . ALA B 1 88  ? -7.171  3.050   54.204 1.00 20.32 ? 1536 ALA B N   1 
ATOM   1580 C  CA  . ALA B 1 88  ? -7.381  1.589   54.232 1.00 18.64 ? 1536 ALA B CA  1 
ATOM   1581 C  C   . ALA B 1 88  ? -8.346  1.176   55.310 1.00 19.56 ? 1536 ALA B C   1 
ATOM   1582 O  O   . ALA B 1 88  ? -9.121  0.244   55.093 1.00 19.89 ? 1536 ALA B O   1 
ATOM   1583 C  CB  . ALA B 1 88  ? -6.068  0.835   54.410 1.00 18.43 ? 1536 ALA B CB  1 
ATOM   1584 N  N   . GLN B 1 89  ? -8.318  1.837   56.463 1.00 20.03 ? 1537 GLN B N   1 
ATOM   1585 C  CA  . GLN B 1 89  ? -9.242  1.490   57.575 1.00 21.24 ? 1537 GLN B CA  1 
ATOM   1586 C  C   . GLN B 1 89  ? -10.688 1.966   57.323 1.00 23.78 ? 1537 GLN B C   1 
ATOM   1587 O  O   . GLN B 1 89  ? -11.651 1.422   57.868 1.00 25.96 ? 1537 GLN B O   1 
ATOM   1588 C  CB  . GLN B 1 89  ? -8.690  2.027   58.910 1.00 21.01 ? 1537 GLN B CB  1 
ATOM   1589 C  CG  . GLN B 1 89  ? -7.443  1.287   59.400 1.00 20.97 ? 1537 GLN B CG  1 
ATOM   1590 C  CD  . GLN B 1 89  ? -6.514  2.155   60.212 1.00 22.48 ? 1537 GLN B CD  1 
ATOM   1591 O  OE1 . GLN B 1 89  ? -6.966  2.941   61.033 1.00 22.40 ? 1537 GLN B OE1 1 
ATOM   1592 N  NE2 . GLN B 1 89  ? -5.205  2.053   59.976 1.00 21.86 ? 1537 GLN B NE2 1 
ATOM   1593 N  N   . THR B 1 90  ? -10.840 2.963   56.463 1.00 26.03 ? 1538 THR B N   1 
ATOM   1594 C  CA  . THR B 1 90  ? -12.152 3.458   56.072 1.00 26.84 ? 1538 THR B CA  1 
ATOM   1595 C  C   . THR B 1 90  ? -12.791 2.585   55.020 1.00 26.71 ? 1538 THR B C   1 
ATOM   1596 O  O   . THR B 1 90  ? -13.954 2.240   55.141 1.00 29.85 ? 1538 THR B O   1 
ATOM   1597 C  CB  . THR B 1 90  ? -12.009 4.871   55.527 1.00 26.55 ? 1538 THR B CB  1 
ATOM   1598 O  OG1 . THR B 1 90  ? -11.575 5.702   56.605 1.00 27.47 ? 1538 THR B OG1 1 
ATOM   1599 C  CG2 . THR B 1 90  ? -13.355 5.387   54.958 1.00 28.80 ? 1538 THR B CG2 1 
ATOM   1600 N  N   . PHE B 1 91  ? -12.032 2.201   53.998 1.00 27.82 ? 1539 PHE B N   1 
ATOM   1601 C  CA  . PHE B 1 91  ? -12.519 1.324   52.921 1.00 26.15 ? 1539 PHE B CA  1 
ATOM   1602 C  C   . PHE B 1 91  ? -12.754 -0.120  53.319 1.00 26.73 ? 1539 PHE B C   1 
ATOM   1603 O  O   . PHE B 1 91  ? -13.748 -0.723  52.892 1.00 27.31 ? 1539 PHE B O   1 
ATOM   1604 C  CB  . PHE B 1 91  ? -11.589 1.361   51.687 1.00 26.41 ? 1539 PHE B CB  1 
ATOM   1605 C  CG  . PHE B 1 91  ? -12.126 0.564   50.519 1.00 27.09 ? 1539 PHE B CG  1 
ATOM   1606 C  CD1 . PHE B 1 91  ? -13.259 0.996   49.829 1.00 28.85 ? 1539 PHE B CD1 1 
ATOM   1607 C  CD2 . PHE B 1 91  ? -11.550 -0.634  50.146 1.00 26.78 ? 1539 PHE B CD2 1 
ATOM   1608 C  CE1 . PHE B 1 91  ? -13.793 0.244   48.791 1.00 28.67 ? 1539 PHE B CE1 1 
ATOM   1609 C  CE2 . PHE B 1 91  ? -12.092 -1.401  49.127 1.00 27.70 ? 1539 PHE B CE2 1 
ATOM   1610 C  CZ  . PHE B 1 91  ? -13.215 -0.952  48.439 1.00 29.00 ? 1539 PHE B CZ  1 
ATOM   1611 N  N   . ASN B 1 92  ? -11.846 -0.701  54.108 1.00 25.19 ? 1540 ASN B N   1 
ATOM   1612 C  CA  . ASN B 1 92  ? -11.912 -2.115  54.434 1.00 25.06 ? 1540 ASN B CA  1 
ATOM   1613 C  C   . ASN B 1 92  ? -12.516 -2.298  55.819 1.00 26.08 ? 1540 ASN B C   1 
ATOM   1614 O  O   . ASN B 1 92  ? -12.457 -1.420  56.624 1.00 25.96 ? 1540 ASN B O   1 
ATOM   1615 C  CB  . ASN B 1 92  ? -10.509 -2.767  54.382 1.00 23.25 ? 1540 ASN B CB  1 
ATOM   1616 C  CG  . ASN B 1 92  ? -9.844  -2.598  53.028 1.00 23.07 ? 1540 ASN B CG  1 
ATOM   1617 O  OD1 . ASN B 1 92  ? -10.059 -3.370  52.093 1.00 22.35 ? 1540 ASN B OD1 1 
ATOM   1618 N  ND2 . ASN B 1 92  ? -9.007  -1.571  52.916 1.00 22.68 ? 1540 ASN B ND2 1 
ATOM   1619 N  N   . LEU B 1 93  ? -13.082 -3.456  56.081 1.00 27.50 ? 1541 LEU B N   1 
ATOM   1620 C  CA  . LEU B 1 93  ? -13.772 -3.694  57.350 1.00 28.59 ? 1541 LEU B CA  1 
ATOM   1621 C  C   . LEU B 1 93  ? -12.805 -3.940  58.506 1.00 26.08 ? 1541 LEU B C   1 
ATOM   1622 O  O   . LEU B 1 93  ? -11.777 -4.599  58.351 1.00 23.69 ? 1541 LEU B O   1 
ATOM   1623 C  CB  . LEU B 1 93  ? -14.688 -4.911  57.213 1.00 33.03 ? 1541 LEU B CB  1 
ATOM   1624 C  CG  . LEU B 1 93  ? -15.988 -4.705  56.435 1.00 38.29 ? 1541 LEU B CG  1 
ATOM   1625 C  CD1 . LEU B 1 93  ? -16.847 -5.958  56.481 1.00 38.20 ? 1541 LEU B CD1 1 
ATOM   1626 C  CD2 . LEU B 1 93  ? -16.762 -3.510  56.976 1.00 40.24 ? 1541 LEU B CD2 1 
ATOM   1627 N  N   . GLU B 1 94  ? -13.156 -3.416  59.674 1.00 24.89 ? 1542 GLU B N   1 
ATOM   1628 C  CA  . GLU B 1 94  ? -12.458 -3.715  60.900 1.00 24.16 ? 1542 GLU B CA  1 
ATOM   1629 C  C   . GLU B 1 94  ? -12.602 -5.254  61.113 1.00 23.73 ? 1542 GLU B C   1 
ATOM   1630 O  O   . GLU B 1 94  ? -13.713 -5.781  60.947 1.00 23.90 ? 1542 GLU B O   1 
ATOM   1631 C  CB  . GLU B 1 94  ? -13.053 -2.881  62.055 1.00 25.12 ? 1542 GLU B CB  1 
ATOM   1632 C  CG  . GLU B 1 94  ? -12.355 -3.063  63.398 1.00 26.96 ? 1542 GLU B CG  1 
ATOM   1633 C  CD  . GLU B 1 94  ? -12.706 -1.994  64.462 1.00 31.24 ? 1542 GLU B CD  1 
ATOM   1634 O  OE1 . GLU B 1 94  ? -13.634 -1.145  64.262 1.00 32.94 ? 1542 GLU B OE1 1 
ATOM   1635 O  OE2 . GLU B 1 94  ? -12.034 -2.046  65.532 1.00 30.69 ? 1542 GLU B OE2 1 
ATOM   1636 N  N   . GLY B 1 95  ? -11.503 -5.956  61.441 1.00 20.07 ? 1543 GLY B N   1 
ATOM   1637 C  CA  . GLY B 1 95  ? -11.533 -7.408  61.518 1.00 19.60 ? 1543 GLY B CA  1 
ATOM   1638 C  C   . GLY B 1 95  ? -10.992 -8.093  60.257 1.00 19.05 ? 1543 GLY B C   1 
ATOM   1639 O  O   . GLY B 1 95  ? -10.786 -9.284  60.274 1.00 18.44 ? 1543 GLY B O   1 
ATOM   1640 N  N   . SER B 1 96  ? -10.735 -7.321  59.193 1.00 18.50 ? 1544 SER B N   1 
ATOM   1641 C  CA  . SER B 1 96  ? -10.106 -7.865  57.994 1.00 18.69 ? 1544 SER B CA  1 
ATOM   1642 C  C   . SER B 1 96  ? -8.588  -7.818  58.171 1.00 17.32 ? 1544 SER B C   1 
ATOM   1643 O  O   . SER B 1 96  ? -8.051  -7.031  58.947 1.00 16.77 ? 1544 SER B O   1 
ATOM   1644 C  CB  . SER B 1 96  ? -10.592 -7.149  56.727 1.00 19.26 ? 1544 SER B CB  1 
ATOM   1645 O  OG  . SER B 1 96  ? -10.126 -5.791  56.635 1.00 18.86 ? 1544 SER B OG  1 
ATOM   1646 N  N   . LEU B 1 97  ? -7.894  -8.716  57.474 1.00 17.37 ? 1545 LEU B N   1 
ATOM   1647 C  CA  . LEU B 1 97  ? -6.460  -8.697  57.475 1.00 16.28 ? 1545 LEU B CA  1 
ATOM   1648 C  C   . LEU B 1 97  ? -5.902  -7.382  56.938 1.00 16.40 ? 1545 LEU B C   1 
ATOM   1649 O  O   . LEU B 1 97  ? -4.955  -6.854  57.488 1.00 16.77 ? 1545 LEU B O   1 
ATOM   1650 C  CB  . LEU B 1 97  ? -5.909  -9.881  56.656 1.00 16.23 ? 1545 LEU B CB  1 
ATOM   1651 C  CG  . LEU B 1 97  ? -4.429  -10.063 56.632 1.00 15.29 ? 1545 LEU B CG  1 
ATOM   1652 C  CD1 . LEU B 1 97  ? -3.850  -10.187 58.008 1.00 15.03 ? 1545 LEU B CD1 1 
ATOM   1653 C  CD2 . LEU B 1 97  ? -4.068  -11.302 55.782 1.00 15.87 ? 1545 LEU B CD2 1 
ATOM   1654 N  N   . ILE B 1 98  ? -6.441  -6.896  55.828 1.00 17.03 ? 1546 ILE B N   1 
ATOM   1655 C  CA  . ILE B 1 98  ? -5.879  -5.701  55.182 1.00 17.22 ? 1546 ILE B CA  1 
ATOM   1656 C  C   . ILE B 1 98  ? -5.981  -4.525  56.135 1.00 15.89 ? 1546 ILE B C   1 
ATOM   1657 O  O   . ILE B 1 98  ? -5.056  -3.740  56.301 1.00 14.91 ? 1546 ILE B O   1 
ATOM   1658 C  CB  . ILE B 1 98  ? -6.571  -5.406  53.823 1.00 18.97 ? 1546 ILE B CB  1 
ATOM   1659 C  CG1 . ILE B 1 98  ? -6.082  -4.067  53.259 1.00 19.05 ? 1546 ILE B CG1 1 
ATOM   1660 C  CG2 . ILE B 1 98  ? -8.125  -5.366  53.937 1.00 20.51 ? 1546 ILE B CG2 1 
ATOM   1661 C  CD1 . ILE B 1 98  ? -6.284  -3.919  51.749 1.00 21.26 ? 1546 ILE B CD1 1 
ATOM   1662 N  N   . TYR B 1 99  ? -7.125  -4.401  56.776 1.00 16.26 ? 1547 TYR B N   1 
ATOM   1663 C  CA  . TYR B 1 99  ? -7.317  -3.349  57.814 1.00 17.22 ? 1547 TYR B CA  1 
ATOM   1664 C  C   . TYR B 1 99  ? -6.212  -3.436  58.824 1.00 16.74 ? 1547 TYR B C   1 
ATOM   1665 O  O   . TYR B 1 99  ? -5.608  -2.419  59.181 1.00 16.93 ? 1547 TYR B O   1 
ATOM   1666 C  CB  . TYR B 1 99  ? -8.657  -3.557  58.474 1.00 19.05 ? 1547 TYR B CB  1 
ATOM   1667 C  CG  . TYR B 1 99  ? -9.107  -2.554  59.465 1.00 20.49 ? 1547 TYR B CG  1 
ATOM   1668 C  CD1 . TYR B 1 99  ? -8.649  -2.594  60.749 1.00 22.70 ? 1547 TYR B CD1 1 
ATOM   1669 C  CD2 . TYR B 1 99  ? -10.104 -1.624  59.143 1.00 22.43 ? 1547 TYR B CD2 1 
ATOM   1670 C  CE1 . TYR B 1 99  ? -9.133  -1.749  61.699 1.00 24.60 ? 1547 TYR B CE1 1 
ATOM   1671 C  CE2 . TYR B 1 99  ? -10.561 -0.726  60.103 1.00 25.47 ? 1547 TYR B CE2 1 
ATOM   1672 C  CZ  . TYR B 1 99  ? -10.049 -0.788  61.369 1.00 25.65 ? 1547 TYR B CZ  1 
ATOM   1673 O  OH  . TYR B 1 99  ? -10.459 0.044   62.395 1.00 29.93 ? 1547 TYR B OH  1 
ATOM   1674 N  N   . GLU B 1 100 ? -5.934  -4.649  59.315 1.00 16.68 ? 1548 GLU B N   1 
ATOM   1675 C  CA  . GLU B 1 100 ? -4.984  -4.795  60.391 1.00 17.15 ? 1548 GLU B CA  1 
ATOM   1676 C  C   . GLU B 1 100 ? -3.569  -4.524  59.899 1.00 16.50 ? 1548 GLU B C   1 
ATOM   1677 O  O   . GLU B 1 100 ? -2.735  -3.970  60.610 1.00 15.64 ? 1548 GLU B O   1 
ATOM   1678 C  CB  . GLU B 1 100 ? -5.065  -6.203  61.055 1.00 18.11 ? 1548 GLU B CB  1 
ATOM   1679 C  CG  . GLU B 1 100 ? -4.568  -6.181  62.496 1.00 19.88 ? 1548 GLU B CG  1 
ATOM   1680 C  CD  . GLU B 1 100 ? -5.435  -5.285  63.409 1.00 20.62 ? 1548 GLU B CD  1 
ATOM   1681 O  OE1 . GLU B 1 100 ? -6.617  -5.057  63.083 1.00 20.53 ? 1548 GLU B OE1 1 
ATOM   1682 O  OE2 . GLU B 1 100 ? -4.930  -4.831  64.449 1.00 22.27 ? 1548 GLU B OE2 1 
ATOM   1683 N  N   . ASP B 1 101 ? -3.279  -4.945  58.671 1.00 16.49 ? 1549 ASP B N   1 
ATOM   1684 C  CA  . ASP B 1 101 ? -2.001  -4.641  58.088 1.00 16.50 ? 1549 ASP B CA  1 
ATOM   1685 C  C   . ASP B 1 101 ? -1.748  -3.134  58.046 1.00 15.42 ? 1549 ASP B C   1 
ATOM   1686 O  O   . ASP B 1 101 ? -0.651  -2.716  58.368 1.00 15.82 ? 1549 ASP B O   1 
ATOM   1687 C  CB  . ASP B 1 101 ? -1.857  -5.290  56.714 1.00 17.53 ? 1549 ASP B CB  1 
ATOM   1688 C  CG  . ASP B 1 101 ? -1.656  -6.815  56.818 1.00 20.16 ? 1549 ASP B CG  1 
ATOM   1689 O  OD1 . ASP B 1 101 ? -1.311  -7.352  57.885 1.00 21.34 ? 1549 ASP B OD1 1 
ATOM   1690 O  OD2 . ASP B 1 101 ? -1.847  -7.511  55.795 1.00 23.89 ? 1549 ASP B OD2 1 
ATOM   1691 N  N   . SER B 1 102 ? -2.766  -2.331  57.773 1.00 14.99 ? 1550 SER B N   1 
ATOM   1692 C  CA  . SER B 1 102 ? -2.619  -0.889  57.734 1.00 16.13 ? 1550 SER B CA  1 
ATOM   1693 C  C   . SER B 1 102 ? -2.347  -0.361  59.144 1.00 15.89 ? 1550 SER B C   1 
ATOM   1694 O  O   . SER B 1 102 ? -1.558  0.545   59.337 1.00 15.48 ? 1550 SER B O   1 
ATOM   1695 C  CB  . SER B 1 102 ? -3.856  -0.246  57.138 1.00 15.89 ? 1550 SER B CB  1 
ATOM   1696 O  OG  . SER B 1 102 ? -4.868  -0.190  58.127 1.00 17.03 ? 1550 SER B OG  1 
ATOM   1697 N  N   . ILE B 1 103 ? -2.987  -0.968  60.139 1.00 18.07 ? 1551 ILE B N   1 
ATOM   1698 C  CA  . ILE B 1 103 ? -2.776  -0.601  61.543 1.00 19.52 ? 1551 ILE B CA  1 
ATOM   1699 C  C   . ILE B 1 103 ? -1.305  -0.795  61.929 1.00 19.49 ? 1551 ILE B C   1 
ATOM   1700 O  O   . ILE B 1 103 ? -0.632  0.134   62.387 1.00 18.55 ? 1551 ILE B O   1 
ATOM   1701 C  CB  . ILE B 1 103 ? -3.650  -1.429  62.509 1.00 21.43 ? 1551 ILE B CB  1 
ATOM   1702 C  CG1 . ILE B 1 103 ? -5.161  -1.086  62.425 1.00 22.70 ? 1551 ILE B CG1 1 
ATOM   1703 C  CG2 . ILE B 1 103 ? -3.117  -1.272  63.939 1.00 22.35 ? 1551 ILE B CG2 1 
ATOM   1704 C  CD1 . ILE B 1 103 ? -5.548  0.289   62.875 1.00 24.74 ? 1551 ILE B CD1 1 
ATOM   1705 N  N   . VAL B 1 104 ? -0.788  -1.987  61.659 1.00 18.74 ? 1552 VAL B N   1 
ATOM   1706 C  CA  . VAL B 1 104 ? 0.586   -2.348  61.933 1.00 18.62 ? 1552 VAL B CA  1 
ATOM   1707 C  C   . VAL B 1 104 ? 1.622   -1.524  61.197 1.00 20.09 ? 1552 VAL B C   1 
ATOM   1708 O  O   . VAL B 1 104 ? 2.653   -1.192  61.760 1.00 19.86 ? 1552 VAL B O   1 
ATOM   1709 C  CB  . VAL B 1 104 ? 0.821   -3.837  61.610 1.00 19.56 ? 1552 VAL B CB  1 
ATOM   1710 C  CG1 . VAL B 1 104 ? 2.297   -4.167  61.643 1.00 21.04 ? 1552 VAL B CG1 1 
ATOM   1711 C  CG2 . VAL B 1 104 ? 0.050   -4.710  62.613 1.00 19.45 ? 1552 VAL B CG2 1 
ATOM   1712 N  N   . LEU B 1 105 ? 1.331   -1.136  59.974 1.00 19.28 ? 1553 LEU B N   1 
ATOM   1713 C  CA  . LEU B 1 105 ? 2.244   -0.305  59.234 1.00 20.17 ? 1553 LEU B CA  1 
ATOM   1714 C  C   . LEU B 1 105 ? 2.404   1.098   59.815 1.00 19.91 ? 1553 LEU B C   1 
ATOM   1715 O  O   . LEU B 1 105 ? 3.432   1.695   59.654 1.00 19.92 ? 1553 LEU B O   1 
ATOM   1716 C  CB  . LEU B 1 105 ? 1.827   -0.249  57.773 1.00 20.18 ? 1553 LEU B CB  1 
ATOM   1717 C  CG  . LEU B 1 105 ? 2.240   -1.557  57.021 1.00 21.54 ? 1553 LEU B CG  1 
ATOM   1718 C  CD1 . LEU B 1 105 ? 1.493   -1.688  55.706 1.00 21.46 ? 1553 LEU B CD1 1 
ATOM   1719 C  CD2 . LEU B 1 105 ? 3.748   -1.635  56.842 1.00 20.90 ? 1553 LEU B CD2 1 
ATOM   1720 N  N   . GLN B 1 106 ? 1.382   1.614   60.489 1.00 20.01 ? 1554 GLN B N   1 
ATOM   1721 C  CA  . GLN B 1 106 ? 1.551   2.836   61.283 1.00 21.80 ? 1554 GLN B CA  1 
ATOM   1722 C  C   . GLN B 1 106 ? 2.763   2.747   62.226 1.00 22.72 ? 1554 GLN B C   1 
ATOM   1723 O  O   . GLN B 1 106 ? 3.596   3.647   62.236 1.00 23.84 ? 1554 GLN B O   1 
ATOM   1724 C  CB  . GLN B 1 106 ? 0.285   3.158   62.053 1.00 21.28 ? 1554 GLN B CB  1 
ATOM   1725 C  CG  . GLN B 1 106 ? -0.901  3.400   61.131 1.00 20.41 ? 1554 GLN B CG  1 
ATOM   1726 C  CD  . GLN B 1 106 ? -2.244  3.386   61.792 1.00 19.20 ? 1554 GLN B CD  1 
ATOM   1727 O  OE1 . GLN B 1 106 ? -3.222  3.811   61.207 1.00 20.10 ? 1554 GLN B OE1 1 
ATOM   1728 N  NE2 . GLN B 1 106 ? -2.319  2.900   62.968 1.00 21.19 ? 1554 GLN B NE2 1 
ATOM   1729 N  N   . SER B 1 107 ? 2.929   1.656   62.959 1.00 22.99 ? 1555 SER B N   1 
ATOM   1730 C  CA  . SER B 1 107 ? 4.078   1.599   63.872 1.00 24.61 ? 1555 SER B CA  1 
ATOM   1731 C  C   . SER B 1 107 ? 5.392   1.156   63.205 1.00 25.25 ? 1555 SER B C   1 
ATOM   1732 O  O   . SER B 1 107 ? 6.442   1.541   63.638 1.00 26.21 ? 1555 SER B O   1 
ATOM   1733 C  CB  . SER B 1 107 ? 3.772   0.763   65.099 1.00 25.11 ? 1555 SER B CB  1 
ATOM   1734 O  OG  . SER B 1 107 ? 3.007   -0.304  64.746 1.00 25.91 ? 1555 SER B OG  1 
ATOM   1735 N  N   . VAL B 1 108 ? 5.313   0.412   62.116 1.00 24.84 ? 1556 VAL B N   1 
ATOM   1736 C  CA  . VAL B 1 108 ? 6.475   0.156   61.299 1.00 24.33 ? 1556 VAL B CA  1 
ATOM   1737 C  C   . VAL B 1 108 ? 7.039   1.473   60.801 1.00 24.62 ? 1556 VAL B C   1 
ATOM   1738 O  O   . VAL B 1 108 ? 8.245   1.701   60.922 1.00 26.13 ? 1556 VAL B O   1 
ATOM   1739 C  CB  . VAL B 1 108 ? 6.140   -0.798  60.143 1.00 24.46 ? 1556 VAL B CB  1 
ATOM   1740 C  CG1 . VAL B 1 108 ? 7.332   -1.031  59.230 1.00 25.15 ? 1556 VAL B CG1 1 
ATOM   1741 C  CG2 . VAL B 1 108 ? 5.631   -2.124  60.671 1.00 24.56 ? 1556 VAL B CG2 1 
ATOM   1742 N  N   . PHE B 1 109 ? 6.186   2.372   60.329 1.00 23.52 ? 1557 PHE B N   1 
ATOM   1743 C  CA  . PHE B 1 109 ? 6.660   3.639   59.840 1.00 24.99 ? 1557 PHE B CA  1 
ATOM   1744 C  C   . PHE B 1 109 ? 7.398   4.398   60.923 1.00 29.67 ? 1557 PHE B C   1 
ATOM   1745 O  O   . PHE B 1 109 ? 8.533   4.838   60.721 1.00 28.53 ? 1557 PHE B O   1 
ATOM   1746 C  CB  . PHE B 1 109 ? 5.549   4.549   59.336 1.00 24.33 ? 1557 PHE B CB  1 
ATOM   1747 C  CG  . PHE B 1 109 ? 6.070   5.871   58.864 1.00 24.70 ? 1557 PHE B CG  1 
ATOM   1748 C  CD1 . PHE B 1 109 ? 6.593   6.010   57.564 1.00 25.01 ? 1557 PHE B CD1 1 
ATOM   1749 C  CD2 . PHE B 1 109 ? 6.106   6.961   59.725 1.00 26.09 ? 1557 PHE B CD2 1 
ATOM   1750 C  CE1 . PHE B 1 109 ? 7.118   7.235   57.145 1.00 25.89 ? 1557 PHE B CE1 1 
ATOM   1751 C  CE2 . PHE B 1 109 ? 6.639   8.178   59.320 1.00 26.86 ? 1557 PHE B CE2 1 
ATOM   1752 C  CZ  . PHE B 1 109 ? 7.166   8.299   58.025 1.00 27.99 ? 1557 PHE B CZ  1 
ATOM   1753 N  N   . THR B 1 110 ? 6.740   4.593   62.064 1.00 30.47 ? 1558 THR B N   1 
ATOM   1754 C  CA  . THR B 1 110 ? 7.367   5.375   63.159 1.00 32.90 ? 1558 THR B CA  1 
ATOM   1755 C  C   . THR B 1 110 ? 8.691   4.793   63.676 1.00 33.29 ? 1558 THR B C   1 
ATOM   1756 O  O   . THR B 1 110 ? 9.612   5.551   64.001 1.00 33.77 ? 1558 THR B O   1 
ATOM   1757 C  CB  . THR B 1 110 ? 6.390   5.547   64.327 1.00 32.43 ? 1558 THR B CB  1 
ATOM   1758 O  OG1 . THR B 1 110 ? 5.817   4.275   64.629 1.00 34.64 ? 1558 THR B OG1 1 
ATOM   1759 C  CG2 . THR B 1 110 ? 5.272   6.475   63.943 1.00 32.90 ? 1558 THR B CG2 1 
ATOM   1760 N  N   . SER B 1 111 ? 8.779   3.466   63.750 1.00 32.05 ? 1559 SER B N   1 
ATOM   1761 C  CA  . SER B 1 111 ? 10.010  2.763   64.114 1.00 32.79 ? 1559 SER B CA  1 
ATOM   1762 C  C   . SER B 1 111 ? 11.114  2.962   63.096 1.00 32.16 ? 1559 SER B C   1 
ATOM   1763 O  O   . SER B 1 111 ? 12.250  3.326   63.439 1.00 34.29 ? 1559 SER B O   1 
ATOM   1764 C  CB  . SER B 1 111 ? 9.761   1.263   64.151 1.00 33.69 ? 1559 SER B CB  1 
ATOM   1765 O  OG  . SER B 1 111 ? 9.198   0.911   65.360 1.00 40.64 ? 1559 SER B OG  1 
ATOM   1766 N  N   . VAL B 1 112 ? 10.801  2.693   61.844 1.00 29.90 ? 1560 VAL B N   1 
ATOM   1767 C  CA  . VAL B 1 112 ? 11.782  2.918   60.782 1.00 30.13 ? 1560 VAL B CA  1 
ATOM   1768 C  C   . VAL B 1 112 ? 12.258  4.378   60.801 1.00 31.90 ? 1560 VAL B C   1 
ATOM   1769 O  O   . VAL B 1 112 ? 13.486  4.646   60.796 1.00 33.98 ? 1560 VAL B O   1 
ATOM   1770 C  CB  . VAL B 1 112 ? 11.231  2.540   59.396 1.00 28.42 ? 1560 VAL B CB  1 
ATOM   1771 C  CG1 . VAL B 1 112 ? 12.129  3.034   58.282 1.00 28.07 ? 1560 VAL B CG1 1 
ATOM   1772 C  CG2 . VAL B 1 112 ? 11.072  1.024   59.298 1.00 28.05 ? 1560 VAL B CG2 1 
ATOM   1773 N  N   . ARG B 1 113 ? 11.310  5.323   60.833 1.00 33.74 ? 1561 ARG B N   1 
ATOM   1774 C  CA  . ARG B 1 113 ? 11.670  6.753   60.884 1.00 33.17 ? 1561 ARG B CA  1 
ATOM   1775 C  C   . ARG B 1 113 ? 12.681  7.048   61.971 1.00 37.19 ? 1561 ARG B C   1 
ATOM   1776 O  O   . ARG B 1 113 ? 13.676  7.709   61.703 1.00 36.33 ? 1561 ARG B O   1 
ATOM   1777 C  CB  . ARG B 1 113 ? 10.450  7.651   61.066 1.00 32.95 ? 1561 ARG B CB  1 
ATOM   1778 C  CG  . ARG B 1 113 ? 10.817  9.129   61.207 1.00 34.36 ? 1561 ARG B CG  1 
ATOM   1779 C  CD  . ARG B 1 113 ? 9.621   10.038  61.439 1.00 35.03 ? 1561 ARG B CD  1 
ATOM   1780 N  NE  . ARG B 1 113 ? 10.059  11.410  61.671 1.00 35.36 ? 1561 ARG B NE  1 
ATOM   1781 C  CZ  . ARG B 1 113 ? 9.269   12.489  61.750 1.00 37.72 ? 1561 ARG B CZ  1 
ATOM   1782 N  NH1 . ARG B 1 113 ? 7.956   12.420  61.582 1.00 36.51 ? 1561 ARG B NH1 1 
ATOM   1783 N  NH2 . ARG B 1 113 ? 9.815   13.686  61.976 1.00 39.51 ? 1561 ARG B NH2 1 
ATOM   1784 N  N   . GLN B 1 114 ? 12.399  6.585   63.193 1.00 42.07 ? 1562 GLN B N   1 
ATOM   1785 C  CA  . GLN B 1 114 ? 13.230  6.859   64.375 1.00 48.17 ? 1562 GLN B CA  1 
ATOM   1786 C  C   . GLN B 1 114 ? 14.631  6.302   64.255 1.00 53.85 ? 1562 GLN B C   1 
ATOM   1787 O  O   . GLN B 1 114 ? 15.631  6.981   64.520 1.00 57.33 ? 1562 GLN B O   1 
ATOM   1788 C  CB  . GLN B 1 114 ? 12.620  6.226   65.583 1.00 50.14 ? 1562 GLN B CB  1 
ATOM   1789 C  CG  . GLN B 1 114 ? 11.677  7.130   66.340 1.00 54.88 ? 1562 GLN B CG  1 
ATOM   1790 C  CD  . GLN B 1 114 ? 10.914  6.382   67.404 1.00 57.69 ? 1562 GLN B CD  1 
ATOM   1791 O  OE1 . GLN B 1 114 ? 11.503  5.719   68.254 1.00 60.93 ? 1562 GLN B OE1 1 
ATOM   1792 N  NE2 . GLN B 1 114 ? 9.589   6.481   67.361 1.00 59.38 ? 1562 GLN B NE2 1 
ATOM   1793 N  N   . LYS B 1 115 ? 14.708  5.050   63.872 1.00 53.24 ? 1563 LYS B N   1 
ATOM   1794 C  CA  . LYS B 1 115 ? 15.987  4.466   63.662 1.00 57.41 ? 1563 LYS B CA  1 
ATOM   1795 C  C   . LYS B 1 115 ? 16.798  5.292   62.688 1.00 56.14 ? 1563 LYS B C   1 
ATOM   1796 O  O   . LYS B 1 115 ? 17.932  5.621   62.967 1.00 59.89 ? 1563 LYS B O   1 
ATOM   1797 C  CB  . LYS B 1 115 ? 15.820  3.108   63.084 1.00 59.85 ? 1563 LYS B CB  1 
ATOM   1798 C  CG  . LYS B 1 115 ? 17.083  2.288   63.171 1.00 64.47 ? 1563 LYS B CG  1 
ATOM   1799 C  CD  . LYS B 1 115 ? 16.839  0.864   62.749 1.00 68.85 ? 1563 LYS B CD  1 
ATOM   1800 C  CE  . LYS B 1 115 ? 16.115  0.828   61.416 1.00 69.71 ? 1563 LYS B CE  1 
ATOM   1801 N  NZ  . LYS B 1 115 ? 15.970  -0.568  60.949 1.00 75.13 ? 1563 LYS B NZ  1 
ATOM   1802 N  N   . ILE B 1 116 ? 16.218  5.597   61.532 1.00 54.59 ? 1564 ILE B N   1 
ATOM   1803 C  CA  . ILE B 1 116 ? 16.913  6.333   60.471 1.00 55.03 ? 1564 ILE B CA  1 
ATOM   1804 C  C   . ILE B 1 116 ? 17.319  7.735   60.916 1.00 56.17 ? 1564 ILE B C   1 
ATOM   1805 O  O   . ILE B 1 116 ? 18.431  8.189   60.594 1.00 54.29 ? 1564 ILE B O   1 
ATOM   1806 C  CB  . ILE B 1 116 ? 16.069  6.412   59.177 1.00 53.14 ? 1564 ILE B CB  1 
ATOM   1807 C  CG1 . ILE B 1 116 ? 15.871  5.016   58.551 1.00 53.71 ? 1564 ILE B CG1 1 
ATOM   1808 C  CG2 . ILE B 1 116 ? 16.702  7.353   58.157 1.00 54.39 ? 1564 ILE B CG2 1 
ATOM   1809 C  CD1 . ILE B 1 116 ? 17.141  4.289   58.183 1.00 54.84 ? 1564 ILE B CD1 1 
ATOM   1810 N  N   . GLU B 1 117 ? 16.435  8.407   61.649 1.00 54.20 ? 1565 GLU B N   1 
ATOM   1811 C  CA  . GLU B 1 117 ? 16.756  9.719   62.226 1.00 58.92 ? 1565 GLU B CA  1 
ATOM   1812 C  C   . GLU B 1 117 ? 18.015  9.740   63.106 1.00 63.16 ? 1565 GLU B C   1 
ATOM   1813 O  O   . GLU B 1 117 ? 18.575  10.803  63.341 1.00 67.65 ? 1565 GLU B O   1 
ATOM   1814 C  CB  . GLU B 1 117 ? 15.550  10.323  62.973 1.00 57.19 ? 1565 GLU B CB  1 
ATOM   1815 C  CG  . GLU B 1 117 ? 14.730  11.262  62.084 1.00 57.92 ? 1565 GLU B CG  1 
ATOM   1816 C  CD  . GLU B 1 117 ? 13.520  11.888  62.764 1.00 58.22 ? 1565 GLU B CD  1 
ATOM   1817 O  OE1 . GLU B 1 117 ? 12.809  11.192  63.519 1.00 55.57 ? 1565 GLU B OE1 1 
ATOM   1818 O  OE2 . GLU B 1 117 ? 13.279  13.094  62.524 1.00 58.90 ? 1565 GLU B OE2 1 
ATOM   1819 N  N   . LYS B 1 118 ? 18.474  8.588   63.582 1.00 65.08 ? 1566 LYS B N   1 
ATOM   1820 C  CA  . LYS B 1 118 ? 19.768  8.554   64.298 1.00 66.95 ? 1566 LYS B CA  1 
ATOM   1821 C  C   . LYS B 1 118 ? 21.003  8.856   63.407 1.00 65.26 ? 1566 LYS B C   1 
ATOM   1822 O  O   . LYS B 1 118 ? 21.489  8.028   62.635 1.00 63.26 ? 1566 LYS B O   1 
ATOM   1823 C  CB  . LYS B 1 118 ? 19.906  7.218   65.032 1.00 68.56 ? 1566 LYS B CB  1 
ATOM   1824 C  CG  . LYS B 1 118 ? 18.771  6.978   66.066 1.00 67.70 ? 1566 LYS B CG  1 
ATOM   1825 C  CD  . LYS B 1 118 ? 19.238  7.124   67.511 1.00 70.49 ? 1566 LYS B CD  1 
ATOM   1826 C  CE  . LYS B 1 118 ? 19.835  8.506   67.784 1.00 73.86 ? 1566 LYS B CE  1 
ATOM   1827 N  NZ  . LYS B 1 118 ? 20.331  8.665   69.186 1.00 74.37 ? 1566 LYS B NZ  1 
HETATM 1828 ZN ZN  . ZN  C 2 .   ? 9.772   -3.527  17.195 1.00 21.78 ? 1601 ZN  A ZN  1 
HETATM 1829 C  C1  . EDO D 3 .   ? 20.725  3.075   21.368 1.00 39.70 ? 1602 EDO A C1  1 
HETATM 1830 O  O1  . EDO D 3 .   ? 19.800  2.857   20.330 1.00 26.29 ? 1602 EDO A O1  1 
HETATM 1831 C  C2  . EDO D 3 .   ? 20.298  2.014   22.373 1.00 39.75 ? 1602 EDO A C2  1 
HETATM 1832 O  O2  . EDO D 3 .   ? 20.819  2.382   23.613 1.00 42.34 ? 1602 EDO A O2  1 
HETATM 1833 C  C1  . EDO E 3 .   ? 24.554  10.212  24.319 1.00 38.44 ? 1603 EDO A C1  1 
HETATM 1834 O  O1  . EDO E 3 .   ? 23.661  10.187  25.453 1.00 34.57 ? 1603 EDO A O1  1 
HETATM 1835 C  C2  . EDO E 3 .   ? 24.141  11.215  23.237 1.00 38.33 ? 1603 EDO A C2  1 
HETATM 1836 O  O2  . EDO E 3 .   ? 22.726  11.221  22.915 1.00 35.87 ? 1603 EDO A O2  1 
HETATM 1837 C  C1  . EDO F 3 .   ? 22.863  20.996  19.002 1.00 44.07 ? 1604 EDO A C1  1 
HETATM 1838 O  O1  . EDO F 3 .   ? 22.620  22.236  19.658 1.00 46.12 ? 1604 EDO A O1  1 
HETATM 1839 C  C2  . EDO F 3 .   ? 22.832  21.237  17.498 1.00 43.89 ? 1604 EDO A C2  1 
HETATM 1840 O  O2  . EDO F 3 .   ? 24.075  20.745  16.972 1.00 34.64 ? 1604 EDO A O2  1 
HETATM 1841 C  CAW . 5BW G 4 .   ? 29.392  22.588  30.905 1.00 32.94 ? 1605 5BW A CAW 1 
HETATM 1842 C  CAV . 5BW G 4 .   ? 30.403  22.449  29.951 1.00 34.12 ? 1605 5BW A CAV 1 
HETATM 1843 C  CAU . 5BW G 4 .   ? 30.094  22.458  28.587 1.00 33.36 ? 1605 5BW A CAU 1 
HETATM 1844 C  CAT . 5BW G 4 .   ? 28.755  22.633  28.198 1.00 39.80 ? 1605 5BW A CAT 1 
HETATM 1845 N  NAS . 5BW G 4 .   ? 27.751  22.799  29.202 1.00 34.40 ? 1605 5BW A NAS 1 
HETATM 1846 C  CAR . 5BW G 4 .   ? 28.068  22.770  30.508 1.00 29.31 ? 1605 5BW A CAR 1 
HETATM 1847 N  NAO . 5BW G 4 .   ? 27.089  22.880  31.406 1.00 28.50 ? 1605 5BW A NAO 1 
HETATM 1848 C  CAN . 5BW G 4 .   ? 27.198  22.460  32.805 1.00 29.00 ? 1605 5BW A CAN 1 
HETATM 1849 C  CAM . 5BW G 4 .   ? 25.704  22.213  33.090 1.00 29.52 ? 1605 5BW A CAM 1 
HETATM 1850 C  CAX . 5BW G 4 .   ? 25.063  23.455  32.615 1.00 28.64 ? 1605 5BW A CAX 1 
HETATM 1851 C  CAP . 5BW G 4 .   ? 25.514  23.176  31.199 1.00 28.17 ? 1605 5BW A CAP 1 
HETATM 1852 C  CAQ . 5BW G 4 .   ? 24.739  21.921  30.968 1.00 26.95 ? 1605 5BW A CAQ 1 
HETATM 1853 N  NAL . 5BW G 4 .   ? 25.263  21.158  32.124 1.00 28.27 ? 1605 5BW A NAL 1 
HETATM 1854 C  CAK . 5BW G 4 .   ? 24.554  20.195  32.724 1.00 26.05 ? 1605 5BW A CAK 1 
HETATM 1855 C  CAH . 5BW G 4 .   ? 23.863  19.164  31.875 1.00 23.72 ? 1605 5BW A CAH 1 
HETATM 1856 C  CAG . 5BW G 4 .   ? 23.108  18.046  32.503 1.00 19.84 ? 1605 5BW A CAG 1 
HETATM 1857 O  OAI . 5BW G 4 .   ? 23.226  17.853  33.717 1.00 20.50 ? 1605 5BW A OAI 1 
HETATM 1858 C  CAE . 5BW G 4 .   ? 22.385  17.156  31.655 1.00 18.39 ? 1605 5BW A CAE 1 
HETATM 1859 C  CAF . 5BW G 4 .   ? 22.183  17.366  30.291 1.00 16.77 ? 1605 5BW A CAF 1 
HETATM 1860 C  CAA . 5BW G 4 .   ? 21.496  16.441  29.522 1.00 15.90 ? 1605 5BW A CAA 1 
HETATM 1861 C  CAB . 5BW G 4 .   ? 20.992  15.278  30.109 1.00 17.75 ? 1605 5BW A CAB 1 
HETATM 1862 C  CAC . 5BW G 4 .   ? 21.150  15.098  31.476 1.00 17.32 ? 1605 5BW A CAC 1 
HETATM 1863 C  CAD . 5BW G 4 .   ? 21.878  15.971  32.190 1.00 16.87 ? 1605 5BW A CAD 1 
HETATM 1864 O  OAJ . 5BW G 4 .   ? 22.061  15.735  33.497 1.00 18.40 ? 1605 5BW A OAJ 1 
HETATM 1865 ZN ZN  . ZN  H 2 .   ? 13.402  20.744  46.435 1.00 21.98 ? 1601 ZN  B ZN  1 
HETATM 1866 C  C1  . EDO I 3 .   ? 4.895   -0.987  38.762 1.00 43.19 ? 1602 EDO B C1  1 
HETATM 1867 O  O1  . EDO I 3 .   ? 5.128   0.354   39.184 1.00 40.28 ? 1602 EDO B O1  1 
HETATM 1868 C  C2  . EDO I 3 .   ? 4.597   -1.001  37.269 1.00 45.89 ? 1602 EDO B C2  1 
HETATM 1869 O  O2  . EDO I 3 .   ? 3.447   -0.184  36.982 1.00 48.60 ? 1602 EDO B O2  1 
HETATM 1870 C  C1  . EDO J 3 .   ? 1.782   -3.461  39.287 1.00 38.43 ? 1603 EDO B C1  1 
HETATM 1871 O  O1  . EDO J 3 .   ? 1.763   -4.876  39.456 1.00 40.11 ? 1603 EDO B O1  1 
HETATM 1872 C  C2  . EDO J 3 .   ? 1.575   -2.991  37.861 1.00 37.68 ? 1603 EDO B C2  1 
HETATM 1873 O  O2  . EDO J 3 .   ? 2.304   -3.746  36.888 1.00 36.25 ? 1603 EDO B O2  1 
HETATM 1874 C  C1  . EDO K 3 .   ? 3.727   18.172  65.429 1.00 46.00 ? 1604 EDO B C1  1 
HETATM 1875 O  O1  . EDO K 3 .   ? 2.856   17.690  66.462 1.00 45.71 ? 1604 EDO B O1  1 
HETATM 1876 C  C2  . EDO K 3 .   ? 5.188   18.135  65.863 1.00 42.45 ? 1604 EDO B C2  1 
HETATM 1877 O  O2  . EDO K 3 .   ? 5.723   16.827  65.708 1.00 42.07 ? 1604 EDO B O2  1 
HETATM 1878 C  CAW . 5BW L 4 .   ? -10.502 -5.176  44.286 1.00 38.92 ? 1605 5BW B CAW 1 
HETATM 1879 C  CAV . 5BW L 4 .   ? -10.564 -5.097  42.898 1.00 39.89 ? 1605 5BW B CAV 1 
HETATM 1880 C  CAU . 5BW L 4 .   ? -9.417  -5.194  42.119 1.00 39.64 ? 1605 5BW B CAU 1 
HETATM 1881 C  CAT . 5BW L 4 .   ? -8.199  -5.391  42.755 1.00 43.59 ? 1605 5BW B CAT 1 
HETATM 1882 N  NAS . 5BW L 4 .   ? -8.148  -5.489  44.174 1.00 40.22 ? 1605 5BW B NAS 1 
HETATM 1883 C  CAR . 5BW L 4 .   ? -9.272  -5.377  44.909 1.00 35.42 ? 1605 5BW B CAR 1 
HETATM 1884 N  NAO . 5BW L 4 .   ? -9.175  -5.438  46.224 1.00 32.95 ? 1605 5BW B NAO 1 
HETATM 1885 C  CAN . 5BW L 4 .   ? -10.142 -4.976  47.229 1.00 33.49 ? 1605 5BW B CAN 1 
HETATM 1886 C  CAM . 5BW L 4 .   ? -9.191  -4.857  48.438 1.00 33.15 ? 1605 5BW B CAM 1 
HETATM 1887 C  CAX . 5BW L 4 .   ? -8.431  -6.127  48.415 1.00 33.73 ? 1605 5BW B CAX 1 
HETATM 1888 C  CAP . 5BW L 4 .   ? -7.906  -5.800  47.030 1.00 33.50 ? 1605 5BW B CAP 1 
HETATM 1889 C  CAQ . 5BW L 4 .   ? -7.125  -4.568  47.351 1.00 33.13 ? 1605 5BW B CAQ 1 
HETATM 1890 N  NAL . 5BW L 4 .   ? -8.217  -3.824  48.023 1.00 32.39 ? 1605 5BW B NAL 1 
HETATM 1891 C  CAK . 5BW L 4 .   ? -8.019  -2.882  48.956 1.00 31.78 ? 1605 5BW B CAK 1 
HETATM 1892 C  CAH . 5BW L 4 .   ? -6.910  -1.890  48.803 1.00 26.41 ? 1605 5BW B CAH 1 
HETATM 1893 C  CAG . 5BW L 4 .   ? -6.812  -0.712  49.729 1.00 25.09 ? 1605 5BW B CAG 1 
HETATM 1894 O  OAI . 5BW L 4 .   ? -7.691  -0.479  50.571 1.00 25.41 ? 1605 5BW B OAI 1 
HETATM 1895 C  CAE . 5BW L 4 .   ? -5.682  0.142   49.579 1.00 23.16 ? 1605 5BW B CAE 1 
HETATM 1896 C  CAF . 5BW L 4 .   ? -4.626  -0.105  48.689 1.00 22.68 ? 1605 5BW B CAF 1 
HETATM 1897 C  CAA . 5BW L 4 .   ? -3.545  0.785   48.621 1.00 22.62 ? 1605 5BW B CAA 1 
HETATM 1898 C  CAB . 5BW L 4 .   ? -3.518  1.933   49.418 1.00 20.87 ? 1605 5BW B CAB 1 
HETATM 1899 C  CAC . 5BW L 4 .   ? -4.554  2.174   50.331 1.00 22.27 ? 1605 5BW B CAC 1 
HETATM 1900 C  CAD . 5BW L 4 .   ? -5.620  1.293   50.353 1.00 21.88 ? 1605 5BW B CAD 1 
HETATM 1901 O  OAJ . 5BW L 4 .   ? -6.647  1.514   51.168 1.00 23.24 ? 1605 5BW B OAJ 1 
HETATM 1902 O  O   . HOH M 5 .   ? 9.345   -3.808  29.890 1.00 42.53 ? 1701 HOH A O   1 
HETATM 1903 O  O   . HOH M 5 .   ? 13.607  22.181  23.929 1.00 32.02 ? 1702 HOH A O   1 
HETATM 1904 O  O   . HOH M 5 .   ? 5.537   -3.906  26.724 1.00 42.31 ? 1703 HOH A O   1 
HETATM 1905 O  O   . HOH M 5 .   ? 19.926  16.123  45.645 1.00 42.88 ? 1704 HOH A O   1 
HETATM 1906 O  O   . HOH M 5 .   ? 8.408   25.603  35.730 1.00 33.41 ? 1705 HOH A O   1 
HETATM 1907 O  O   . HOH M 5 .   ? 28.993  18.050  39.723 1.00 41.61 ? 1706 HOH A O   1 
HETATM 1908 O  O   . HOH M 5 .   ? 16.361  23.763  30.046 1.00 17.02 ? 1707 HOH A O   1 
HETATM 1909 O  O   . HOH M 5 .   ? 7.726   17.534  39.689 1.00 26.90 ? 1708 HOH A O   1 
HETATM 1910 O  O   . HOH M 5 .   ? 15.053  20.805  47.567 1.00 25.57 ? 1709 HOH A O   1 
HETATM 1911 O  O   . HOH M 5 .   ? 15.477  26.218  29.980 1.00 26.06 ? 1710 HOH A O   1 
HETATM 1912 O  O   . HOH M 5 .   ? 14.942  5.329   36.157 1.00 18.70 ? 1711 HOH A O   1 
HETATM 1913 O  O   . HOH M 5 .   ? 23.332  19.905  27.815 1.00 17.97 ? 1712 HOH A O   1 
HETATM 1914 O  O   . HOH M 5 .   ? 17.743  11.501  18.395 1.00 28.66 ? 1713 HOH A O   1 
HETATM 1915 O  O   . HOH M 5 .   ? 14.993  21.585  45.227 1.00 19.33 ? 1714 HOH A O   1 
HETATM 1916 O  O   . HOH M 5 .   ? 14.233  1.707   30.289 1.00 29.27 ? 1715 HOH A O   1 
HETATM 1917 O  O   . HOH M 5 .   ? 22.114  11.597  31.913 1.00 19.71 ? 1716 HOH A O   1 
HETATM 1918 O  O   . HOH M 5 .   ? 10.119  21.176  28.314 1.00 23.73 ? 1717 HOH A O   1 
HETATM 1919 O  O   . HOH M 5 .   ? 11.919  9.007   18.189 1.00 29.70 ? 1718 HOH A O   1 
HETATM 1920 O  O   . HOH M 5 .   ? 14.006  10.832  38.602 1.00 23.36 ? 1719 HOH A O   1 
HETATM 1921 O  O   . HOH M 5 .   ? 5.634   29.753  36.299 1.00 30.34 ? 1720 HOH A O   1 
HETATM 1922 O  O   . HOH M 5 .   ? 3.818   23.953  27.225 1.00 46.58 ? 1721 HOH A O   1 
HETATM 1923 O  O   . HOH M 5 .   ? 16.717  3.050   32.024 1.00 29.84 ? 1722 HOH A O   1 
HETATM 1924 O  O   . HOH M 5 .   ? 31.194  12.882  23.469 1.00 38.84 ? 1723 HOH A O   1 
HETATM 1925 O  O   . HOH M 5 .   ? 20.768  20.571  25.217 1.00 25.51 ? 1724 HOH A O   1 
HETATM 1926 O  O   . HOH M 5 .   ? 18.390  28.629  44.814 1.00 17.30 ? 1725 HOH A O   1 
HETATM 1927 O  O   . HOH M 5 .   ? 23.403  6.929   35.894 1.00 22.98 ? 1726 HOH A O   1 
HETATM 1928 O  O   . HOH M 5 .   ? 17.088  23.074  42.673 1.00 14.12 ? 1727 HOH A O   1 
HETATM 1929 O  O   . HOH M 5 .   ? 7.925   28.864  37.520 1.00 40.08 ? 1728 HOH A O   1 
HETATM 1930 O  O   . HOH M 5 .   ? 12.294  28.441  25.741 1.00 30.99 ? 1729 HOH A O   1 
HETATM 1931 O  O   . HOH M 5 .   ? 2.178   35.122  34.871 1.00 39.44 ? 1730 HOH A O   1 
HETATM 1932 O  O   . HOH M 5 .   ? 25.164  22.938  39.893 1.00 26.30 ? 1731 HOH A O   1 
HETATM 1933 O  O   . HOH M 5 .   ? 17.069  -2.089  16.782 1.00 30.02 ? 1732 HOH A O   1 
HETATM 1934 O  O   . HOH M 5 .   ? 9.947   -1.254  20.496 1.00 30.77 ? 1733 HOH A O   1 
HETATM 1935 O  O   . HOH M 5 .   ? 9.169   2.867   35.021 1.00 36.12 ? 1734 HOH A O   1 
HETATM 1936 O  O   . HOH M 5 .   ? 11.943  21.427  45.513 1.00 22.07 ? 1735 HOH A O   1 
HETATM 1937 O  O   . HOH M 5 .   ? 34.594  9.317   29.057 1.00 44.96 ? 1736 HOH A O   1 
HETATM 1938 O  O   . HOH M 5 .   ? 25.285  19.749  23.867 1.00 29.90 ? 1737 HOH A O   1 
HETATM 1939 O  O   . HOH M 5 .   ? 16.242  -3.121  24.480 1.00 44.99 ? 1738 HOH A O   1 
HETATM 1940 O  O   . HOH M 5 .   ? 12.758  -1.770  27.134 1.00 43.35 ? 1739 HOH A O   1 
HETATM 1941 O  O   . HOH M 5 .   ? 9.693   -3.529  19.212 1.00 30.30 ? 1740 HOH A O   1 
HETATM 1942 O  O   . HOH M 5 .   ? 11.265  28.886  35.910 1.00 32.96 ? 1741 HOH A O   1 
HETATM 1943 O  O   . HOH M 5 .   ? 25.095  7.450   38.507 1.00 32.23 ? 1742 HOH A O   1 
HETATM 1944 O  O   . HOH M 5 .   ? 6.927   -4.949  29.016 1.00 43.86 ? 1743 HOH A O   1 
HETATM 1945 O  O   . HOH M 5 .   ? 6.360   3.202   36.655 1.00 32.05 ? 1744 HOH A O   1 
HETATM 1946 O  O   . HOH M 5 .   ? 26.605  18.328  42.927 1.00 39.52 ? 1745 HOH A O   1 
HETATM 1947 O  O   . HOH M 5 .   ? 17.609  1.136   25.598 1.00 48.01 ? 1746 HOH A O   1 
HETATM 1948 O  O   . HOH M 5 .   ? 10.479  5.081   36.201 1.00 29.80 ? 1747 HOH A O   1 
HETATM 1949 O  O   . HOH M 5 .   ? 20.587  22.074  49.308 1.00 39.07 ? 1748 HOH A O   1 
HETATM 1950 O  O   . HOH M 5 .   ? 17.386  13.802  17.546 1.00 37.02 ? 1749 HOH A O   1 
HETATM 1951 O  O   . HOH M 5 .   ? 13.455  23.010  46.774 1.00 24.16 ? 1750 HOH A O   1 
HETATM 1952 O  O   . HOH M 5 .   ? 22.206  4.397   36.854 1.00 32.67 ? 1751 HOH A O   1 
HETATM 1953 O  O   . HOH M 5 .   ? 15.406  24.126  47.161 1.00 43.22 ? 1752 HOH A O   1 
HETATM 1954 O  O   . HOH N 5 .   ? 0.007   0.833   39.711 1.00 39.20 ? 1701 HOH B O   1 
HETATM 1955 O  O   . HOH N 5 .   ? -5.315  -2.526  35.942 1.00 57.45 ? 1702 HOH B O   1 
HETATM 1956 O  O   . HOH N 5 .   ? 2.469   17.328  68.961 1.00 43.34 ? 1703 HOH B O   1 
HETATM 1957 O  O   . HOH N 5 .   ? 5.877   -4.268  54.712 1.00 24.52 ? 1704 HOH B O   1 
HETATM 1958 O  O   . HOH N 5 .   ? -0.170  -6.574  52.014 1.00 21.81 ? 1705 HOH B O   1 
HETATM 1959 O  O   . HOH N 5 .   ? -2.569  11.888  57.815 1.00 26.92 ? 1706 HOH B O   1 
HETATM 1960 O  O   . HOH N 5 .   ? -11.150 -11.207 62.014 1.00 18.17 ? 1707 HOH B O   1 
HETATM 1961 O  O   . HOH N 5 .   ? -0.400  -3.381  45.752 1.00 28.60 ? 1708 HOH B O   1 
HETATM 1962 O  O   . HOH N 5 .   ? -5.518  5.645   49.829 1.00 20.80 ? 1709 HOH B O   1 
HETATM 1963 O  O   . HOH N 5 .   ? -2.584  -6.866  53.348 1.00 33.34 ? 1710 HOH B O   1 
HETATM 1964 O  O   . HOH N 5 .   ? 9.205   15.396  48.682 1.00 30.85 ? 1711 HOH B O   1 
HETATM 1965 O  O   . HOH N 5 .   ? -10.159 -3.643  66.527 1.00 26.70 ? 1712 HOH B O   1 
HETATM 1966 O  O   . HOH N 5 .   ? 14.178  13.487  43.179 1.00 22.38 ? 1713 HOH B O   1 
HETATM 1967 O  O   . HOH N 5 .   ? 4.854   19.070  61.339 1.00 42.97 ? 1714 HOH B O   1 
HETATM 1968 O  O   . HOH N 5 .   ? 13.050  2.922   66.003 1.00 43.60 ? 1715 HOH B O   1 
HETATM 1969 O  O   . HOH N 5 .   ? -16.094 -4.672  61.689 1.00 35.89 ? 1716 HOH B O   1 
HETATM 1970 O  O   . HOH N 5 .   ? -1.254  14.165  53.588 1.00 32.13 ? 1717 HOH B O   1 
HETATM 1971 O  O   . HOH N 5 .   ? -0.184  5.879   42.421 1.00 32.00 ? 1718 HOH B O   1 
HETATM 1972 O  O   . HOH N 5 .   ? -8.658  -4.280  64.773 1.00 19.33 ? 1719 HOH B O   1 
HETATM 1973 O  O   . HOH N 5 .   ? -8.676  -5.901  61.416 1.00 15.94 ? 1720 HOH B O   1 
HETATM 1974 O  O   . HOH N 5 .   ? -11.359 9.965   45.124 1.00 40.07 ? 1721 HOH B O   1 
HETATM 1975 O  O   . HOH N 5 .   ? 17.399  6.153   49.786 1.00 36.10 ? 1722 HOH B O   1 
HETATM 1976 O  O   . HOH N 5 .   ? -6.257  -4.574  66.894 1.00 20.42 ? 1723 HOH B O   1 
HETATM 1977 O  O   . HOH N 5 .   ? 5.360   -11.338 51.274 1.00 30.74 ? 1724 HOH B O   1 
HETATM 1978 O  O   . HOH N 5 .   ? -4.286  -2.677  46.003 1.00 25.61 ? 1725 HOH B O   1 
HETATM 1979 O  O   . HOH N 5 .   ? -9.100  10.536  52.124 1.00 32.18 ? 1726 HOH B O   1 
HETATM 1980 O  O   . HOH N 5 .   ? 11.742  -6.983  57.241 1.00 43.10 ? 1727 HOH B O   1 
HETATM 1981 O  O   . HOH N 5 .   ? 11.524  18.346  49.152 1.00 37.79 ? 1728 HOH B O   1 
HETATM 1982 O  O   . HOH N 5 .   ? -0.390  -7.431  60.645 1.00 41.66 ? 1729 HOH B O   1 
HETATM 1983 O  O   . HOH N 5 .   ? 12.962  -3.172  56.347 1.00 40.60 ? 1730 HOH B O   1 
HETATM 1984 O  O   . HOH N 5 .   ? 3.852   14.205  42.827 1.00 24.61 ? 1731 HOH B O   1 
HETATM 1985 O  O   . HOH N 5 .   ? -13.167 -5.641  54.037 1.00 26.91 ? 1732 HOH B O   1 
HETATM 1986 O  O   . HOH N 5 .   ? 8.053   -4.956  47.144 1.00 37.26 ? 1733 HOH B O   1 
HETATM 1987 O  O   . HOH N 5 .   ? -0.063  -11.854 59.708 1.00 30.26 ? 1734 HOH B O   1 
HETATM 1988 O  O   . HOH N 5 .   ? -10.974 9.004   57.616 1.00 44.70 ? 1735 HOH B O   1 
HETATM 1989 O  O   . HOH N 5 .   ? 6.177   0.256   42.074 1.00 44.50 ? 1736 HOH B O   1 
HETATM 1990 O  O   . HOH N 5 .   ? -11.978 10.370  52.822 1.00 49.48 ? 1737 HOH B O   1 
HETATM 1991 O  O   . HOH N 5 .   ? -14.061 -0.447  59.112 1.00 53.36 ? 1738 HOH B O   1 
HETATM 1992 O  O   . HOH N 5 .   ? 8.907   20.302  59.821 1.00 41.32 ? 1739 HOH B O   1 
HETATM 1993 O  O   . HOH N 5 .   ? -6.224  6.197   61.274 1.00 32.90 ? 1740 HOH B O   1 
HETATM 1994 O  O   . HOH N 5 .   ? 11.978  20.871  48.068 1.00 28.53 ? 1741 HOH B O   1 
HETATM 1995 O  O   . HOH N 5 .   ? 7.191   3.129   41.670 1.00 43.66 ? 1742 HOH B O   1 
HETATM 1996 O  O   . HOH N 5 .   ? 14.504  10.697  43.432 1.00 32.99 ? 1743 HOH B O   1 
HETATM 1997 O  O   . HOH N 5 .   ? 6.367   -3.156  38.123 1.00 45.97 ? 1744 HOH B O   1 
HETATM 1998 O  O   . HOH N 5 .   ? -2.836  -4.367  37.696 1.00 42.63 ? 1745 HOH B O   1 
HETATM 1999 O  O   . HOH N 5 .   ? 8.621   23.186  47.418 1.00 40.74 ? 1746 HOH B O   1 
HETATM 2000 O  O   . HOH N 5 .   ? -8.292  -5.874  66.908 1.00 19.09 ? 1747 HOH B O   1 
HETATM 2001 O  O   . HOH N 5 .   ? 0.999   -13.799 48.393 1.00 38.48 ? 1748 HOH B O   1 
HETATM 2002 O  O   . HOH N 5 .   ? -5.180  13.002  61.651 1.00 52.97 ? 1749 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 9   ? 0.7818 0.6878 0.7821 0.0237  -0.0164 -0.0522 1457 ASN A N   
2    C CA  . ASN A 9   ? 0.7957 0.7155 0.8249 0.0196  -0.0152 -0.0601 1457 ASN A CA  
3    C C   . ASN A 9   ? 0.7194 0.6539 0.7577 0.0132  -0.0019 -0.0576 1457 ASN A C   
4    O O   . ASN A 9   ? 0.7020 0.6452 0.7545 0.0117  -0.0011 -0.0615 1457 ASN A O   
5    C CB  . ASN A 9   ? 0.8840 0.8031 0.9227 0.0184  -0.0175 -0.0649 1457 ASN A CB  
6    C CG  . ASN A 9   ? 0.8936 0.8275 0.9611 0.0121  -0.0123 -0.0723 1457 ASN A CG  
7    O OD1 . ASN A 9   ? 0.8792 0.8229 0.9625 0.0103  -0.0106 -0.0767 1457 ASN A OD1 
8    N ND2 . ASN A 9   ? 0.8894 0.8245 0.9633 0.0084  -0.0089 -0.0738 1457 ASN A ND2 
9    N N   . LEU A 10  ? 0.5718 0.5080 0.6022 0.0097  0.0076  -0.0519 1458 LEU A N   
10   C CA  . LEU A 10  ? 0.5716 0.5163 0.6021 0.0051  0.0184  -0.0476 1458 LEU A CA  
11   C C   . LEU A 10  ? 0.5167 0.4576 0.5319 0.0086  0.0179  -0.0414 1458 LEU A C   
12   O O   . LEU A 10  ? 0.5037 0.4509 0.5236 0.0073  0.0206  -0.0411 1458 LEU A O   
13   C CB  . LEU A 10  ? 0.5707 0.5159 0.5955 0.0006  0.0270  -0.0432 1458 LEU A CB  
14   C CG  . LEU A 10  ? 0.6318 0.5852 0.6612 -0.0054 0.0367  -0.0418 1458 LEU A CG  
15   C CD1 . LEU A 10  ? 0.6458 0.6082 0.6966 -0.0103 0.0389  -0.0505 1458 LEU A CD1 
16   C CD2 . LEU A 10  ? 0.6153 0.5650 0.6340 -0.0092 0.0434  -0.0362 1458 LEU A CD2 
17   N N   . THR A 11  ? 0.4708 0.4010 0.4679 0.0129  0.0148  -0.0370 1459 THR A N   
18   C CA  . THR A 11  ? 0.5069 0.4327 0.4891 0.0152  0.0159  -0.0311 1459 THR A CA  
19   C C   . THR A 11  ? 0.5527 0.4783 0.5399 0.0167  0.0095  -0.0339 1459 THR A C   
20   O O   . THR A 11  ? 0.5415 0.4710 0.5277 0.0156  0.0131  -0.0306 1459 THR A O   
21   C CB  . THR A 11  ? 0.4990 0.4123 0.4611 0.0191  0.0141  -0.0277 1459 THR A CB  
22   O OG1 . THR A 11  ? 0.5125 0.4275 0.4717 0.0180  0.0205  -0.0252 1459 THR A OG1 
23   C CG2 . THR A 11  ? 0.5173 0.4252 0.4643 0.0204  0.0162  -0.0224 1459 THR A CG2 
24   N N   . LYS A 12  ? 0.5602 0.4808 0.5541 0.0194  -0.0009 -0.0405 1460 LYS A N   
25   C CA  . LYS A 12  ? 0.5441 0.4610 0.5416 0.0220  -0.0101 -0.0440 1460 LYS A CA  
26   C C   . LYS A 12  ? 0.4835 0.4148 0.5026 0.0191  -0.0074 -0.0486 1460 LYS A C   
27   O O   . LYS A 12  ? 0.4062 0.3361 0.4254 0.0206  -0.0117 -0.0488 1460 LYS A O   
28   C CB  . LYS A 12  ? 0.6248 0.5314 0.6253 0.0262  -0.0240 -0.0510 1460 LYS A CB  
29   C CG  . LYS A 12  ? 0.6709 0.5706 0.6747 0.0299  -0.0367 -0.0555 1460 LYS A CG  
30   C CD  . LYS A 12  ? 0.7313 0.6249 0.7479 0.0338  -0.0515 -0.0654 1460 LYS A CD  
31   C CE  . LYS A 12  ? 0.7722 0.6538 0.7758 0.0360  -0.0554 -0.0650 1460 LYS A CE  
32   N NZ  . LYS A 12  ? 0.8122 0.6746 0.7805 0.0382  -0.0558 -0.0564 1460 LYS A NZ  
33   N N   . LYS A 13  ? 0.4404 0.3839 0.4767 0.0148  -0.0005 -0.0528 1461 LYS A N   
34   C CA  . LYS A 13  ? 0.4407 0.3981 0.4959 0.0109  0.0052  -0.0574 1461 LYS A CA  
35   C C   . LYS A 13  ? 0.4103 0.3717 0.4555 0.0081  0.0150  -0.0498 1461 LYS A C   
36   O O   . LYS A 13  ? 0.3813 0.3492 0.4345 0.0072  0.0163  -0.0518 1461 LYS A O   
37   C CB  . LYS A 13  ? 0.4893 0.4571 0.5638 0.0057  0.0115  -0.0642 1461 LYS A CB  
38   C CG  . LYS A 13  ? 0.6147 0.5811 0.7054 0.0076  0.0022  -0.0737 1461 LYS A CG  
39   C CD  . LYS A 13  ? 0.6529 0.6185 0.7583 0.0127  -0.0108 -0.0824 1461 LYS A CD  
40   C CE  . LYS A 13  ? 0.6753 0.6565 0.8123 0.0090  -0.0074 -0.0943 1461 LYS A CE  
41   N NZ  . LYS A 13  ? 0.7140 0.6956 0.8657 0.0143  -0.0197 -0.1027 1461 LYS A NZ  
42   N N   . MET A 14  ? 0.3896 0.3469 0.4186 0.0072  0.0209  -0.0417 1462 MET A N   
43   C CA  . MET A 14  ? 0.3780 0.3371 0.3972 0.0057  0.0279  -0.0345 1462 MET A CA  
44   C C   . MET A 14  ? 0.3645 0.3184 0.3758 0.0092  0.0226  -0.0315 1462 MET A C   
45   O O   . MET A 14  ? 0.3171 0.2759 0.3316 0.0082  0.0247  -0.0306 1462 MET A O   
46   C CB  . MET A 14  ? 0.3640 0.3194 0.3700 0.0049  0.0336  -0.0278 1462 MET A CB  
47   C CG  . MET A 14  ? 0.4056 0.3646 0.4161 0.0002  0.0399  -0.0289 1462 MET A CG  
48   S SD  . MET A 14  ? 0.4814 0.4332 0.4765 0.0012  0.0427  -0.0223 1462 MET A SD  
49   C CE  . MET A 14  ? 0.5349 0.4882 0.5344 -0.0052 0.0486  -0.0237 1462 MET A CE  
50   N N   . LYS A 15  ? 0.3907 0.3334 0.3909 0.0131  0.0154  -0.0303 1463 LYS A N   
51   C CA  . LYS A 15  ? 0.4394 0.3734 0.4293 0.0157  0.0096  -0.0276 1463 LYS A CA  
52   C C   . LYS A 15  ? 0.4382 0.3758 0.4415 0.0165  0.0032  -0.0331 1463 LYS A C   
53   O O   . LYS A 15  ? 0.4229 0.3590 0.4221 0.0166  0.0025  -0.0299 1463 LYS A O   
54   C CB  . LYS A 15  ? 0.4949 0.4132 0.4705 0.0194  0.0008  -0.0277 1463 LYS A CB  
55   C CG  . LYS A 15  ? 0.5702 0.4802 0.5265 0.0196  0.0059  -0.0216 1463 LYS A CG  
56   C CD  . LYS A 15  ? 0.6130 0.5079 0.5578 0.0232  -0.0035 -0.0244 1463 LYS A CD  
57   C CE  . LYS A 15  ? 0.6422 0.5285 0.5680 0.0238  0.0015  -0.0201 1463 LYS A CE  
58   N NZ  . LYS A 15  ? 0.7139 0.5875 0.6322 0.0273  -0.0078 -0.0244 1463 LYS A NZ  
59   N N   . LYS A 16  ? 0.4373 0.3789 0.4573 0.0173  -0.0023 -0.0419 1464 LYS A N   
60   C CA  . LYS A 16  ? 0.4662 0.4114 0.5023 0.0190  -0.0101 -0.0496 1464 LYS A CA  
61   C C   . LYS A 16  ? 0.4225 0.3810 0.4695 0.0157  -0.0018 -0.0502 1464 LYS A C   
62   O O   . LYS A 16  ? 0.3707 0.3293 0.4220 0.0173  -0.0067 -0.0520 1464 LYS A O   
63   C CB  . LYS A 16  ? 0.4963 0.4471 0.5537 0.0197  -0.0149 -0.0605 1464 LYS A CB  
64   C CG  . LYS A 16  ? 0.5650 0.5019 0.6189 0.0248  -0.0295 -0.0644 1464 LYS A CG  
65   C CD  . LYS A 16  ? 0.5859 0.5314 0.6694 0.0260  -0.0366 -0.0780 1464 LYS A CD  
66   C CE  . LYS A 16  ? 0.6071 0.5563 0.7055 0.0283  -0.0438 -0.0847 1464 LYS A CE  
67   N NZ  . LYS A 16  ? 0.6580 0.6106 0.7838 0.0316  -0.0556 -0.0989 1464 LYS A NZ  
68   N N   . ILE A 17  ? 0.3551 0.3233 0.4066 0.0111  0.0097  -0.0496 1465 ILE A N   
69   C CA  . ILE A 17  ? 0.3406 0.3191 0.3983 0.0073  0.0186  -0.0498 1465 ILE A CA  
70   C C   . ILE A 17  ? 0.3543 0.3284 0.3968 0.0079  0.0200  -0.0408 1465 ILE A C   
71   O O   . ILE A 17  ? 0.3192 0.2965 0.3665 0.0082  0.0188  -0.0420 1465 ILE A O   
72   C CB  . ILE A 17  ? 0.3300 0.3140 0.3880 0.0019  0.0299  -0.0490 1465 ILE A CB  
73   C CG1 . ILE A 17  ? 0.3439 0.3344 0.4203 -0.0002 0.0308  -0.0589 1465 ILE A CG1 
74   C CG2 . ILE A 17  ? 0.3210 0.3105 0.3767 -0.0018 0.0389  -0.0466 1465 ILE A CG2 
75   C CD1 . ILE A 17  ? 0.3617 0.3548 0.4363 -0.0064 0.0415  -0.0578 1465 ILE A CD1 
76   N N   . VAL A 18  ? 0.3486 0.3154 0.3745 0.0083  0.0220  -0.0325 1466 VAL A N   
77   C CA  . VAL A 18  ? 0.3565 0.3201 0.3713 0.0083  0.0239  -0.0249 1466 VAL A CA  
78   C C   . VAL A 18  ? 0.3673 0.3235 0.3785 0.0112  0.0153  -0.0244 1466 VAL A C   
79   O O   . VAL A 18  ? 0.3335 0.2913 0.3449 0.0106  0.0158  -0.0220 1466 VAL A O   
80   C CB  . VAL A 18  ? 0.3524 0.3111 0.3531 0.0079  0.0289  -0.0176 1466 VAL A CB  
81   C CG1 . VAL A 18  ? 0.3718 0.3281 0.3645 0.0077  0.0310  -0.0110 1466 VAL A CG1 
82   C CG2 . VAL A 18  ? 0.3410 0.3056 0.3443 0.0050  0.0363  -0.0175 1466 VAL A CG2 
83   N N   . ASP A 19  ? 0.3961 0.3425 0.4034 0.0142  0.0063  -0.0267 1467 ASP A N   
84   C CA  . ASP A 19  ? 0.4336 0.3690 0.4345 0.0167  -0.0036 -0.0262 1467 ASP A CA  
85   C C   . ASP A 19  ? 0.3864 0.3297 0.4044 0.0174  -0.0076 -0.0327 1467 ASP A C   
86   O O   . ASP A 19  ? 0.3867 0.3258 0.4012 0.0179  -0.0113 -0.0301 1467 ASP A O   
87   C CB  . ASP A 19  ? 0.5059 0.4274 0.4999 0.0203  -0.0150 -0.0293 1467 ASP A CB  
88   C CG  . ASP A 19  ? 0.6010 0.5102 0.5731 0.0201  -0.0124 -0.0228 1467 ASP A CG  
89   O OD1 . ASP A 19  ? 0.6362 0.5457 0.5976 0.0174  -0.0032 -0.0154 1467 ASP A OD1 
90   O OD2 . ASP A 19  ? 0.7179 0.6171 0.6844 0.0227  -0.0199 -0.0258 1467 ASP A OD2 
91   N N   . ALA A 20  ? 0.3509 0.3058 0.3880 0.0172  -0.0064 -0.0414 1468 ALA A N   
92   C CA  . ALA A 20  ? 0.3619 0.3248 0.4167 0.0181  -0.0098 -0.0494 1468 ALA A CA  
93   C C   . ALA A 20  ? 0.3289 0.3006 0.3848 0.0150  -0.0006 -0.0465 1468 ALA A C   
94   O O   . ALA A 20  ? 0.3425 0.3156 0.4044 0.0162  -0.0047 -0.0491 1468 ALA A O   
95   C CB  . ALA A 20  ? 0.3659 0.3388 0.4427 0.0182  -0.0103 -0.0612 1468 ALA A CB  
96   N N   . VAL A 21  ? 0.3291 0.3053 0.3788 0.0113  0.0104  -0.0415 1469 VAL A N   
97   C CA  . VAL A 21  ? 0.3269 0.3079 0.3740 0.0088  0.0173  -0.0377 1469 VAL A CA  
98   C C   . VAL A 21  ? 0.3278 0.3006 0.3635 0.0102  0.0131  -0.0299 1469 VAL A C   
99   O O   . VAL A 21  ? 0.3300 0.3049 0.3683 0.0101  0.0126  -0.0297 1469 VAL A O   
100  C CB  . VAL A 21  ? 0.3148 0.2989 0.3551 0.0050  0.0280  -0.0334 1469 VAL A CB  
101  C CG1 . VAL A 21  ? 0.2972 0.2825 0.3322 0.0034  0.0322  -0.0288 1469 VAL A CG1 
102  C CG2 . VAL A 21  ? 0.3186 0.3101 0.3691 0.0020  0.0338  -0.0408 1469 VAL A CG2 
103  N N   . ILE A 22  ? 0.3376 0.3003 0.3602 0.0110  0.0107  -0.0238 1470 ILE A N   
104  C CA  . ILE A 22  ? 0.3291 0.2830 0.3404 0.0110  0.0081  -0.0167 1470 ILE A CA  
105  C C   . ILE A 22  ? 0.3604 0.3080 0.3749 0.0135  -0.0028 -0.0199 1470 ILE A C   
106  O O   . ILE A 22  ? 0.3341 0.2804 0.3479 0.0129  -0.0042 -0.0171 1470 ILE A O   
107  C CB  . ILE A 22  ? 0.3411 0.2850 0.3366 0.0106  0.0097  -0.0105 1470 ILE A CB  
108  C CG1 . ILE A 22  ? 0.3457 0.2963 0.3395 0.0084  0.0203  -0.0067 1470 ILE A CG1 
109  C CG2 . ILE A 22  ? 0.3487 0.2804 0.3317 0.0100  0.0061  -0.0045 1470 ILE A CG2 
110  C CD1 . ILE A 22  ? 0.3747 0.3172 0.3546 0.0081  0.0234  -0.0019 1470 ILE A CD1 
111  N N   . LYS A 23  ? 0.3895 0.3337 0.4095 0.0164  -0.0114 -0.0267 1471 LYS A N   
112  C CA  . LYS A 23  ? 0.4305 0.3667 0.4539 0.0196  -0.0242 -0.0309 1471 LYS A CA  
113  C C   . LYS A 23  ? 0.4064 0.3538 0.4483 0.0207  -0.0256 -0.0384 1471 LYS A C   
114  O O   . LYS A 23  ? 0.4185 0.3594 0.4629 0.0232  -0.0361 -0.0409 1471 LYS A O   
115  C CB  . LYS A 23  ? 0.5028 0.4323 0.5295 0.0232  -0.0344 -0.0378 1471 LYS A CB  
116  C CG  . LYS A 23  ? 0.5752 0.4825 0.5806 0.0248  -0.0445 -0.0328 1471 LYS A CG  
117  C CD  . LYS A 23  ? 0.6460 0.5458 0.6600 0.0299  -0.0601 -0.0425 1471 LYS A CD  
118  C CE  . LYS A 23  ? 0.6961 0.5986 0.7271 0.0330  -0.0703 -0.0503 1471 LYS A CE  
119  N NZ  . LYS A 23  ? 0.7338 0.6263 0.7731 0.0387  -0.0882 -0.0600 1471 LYS A NZ  
120  N N   . TYR A 24  ? 0.3710 0.3336 0.4244 0.0186  -0.0155 -0.0424 1472 TYR A N   
121  C CA  . TYR A 24  ? 0.3577 0.3309 0.4280 0.0193  -0.0152 -0.0510 1472 TYR A CA  
122  C C   . TYR A 24  ? 0.3788 0.3483 0.4462 0.0200  -0.0195 -0.0480 1472 TYR A C   
123  O O   . TYR A 24  ? 0.3278 0.2936 0.3828 0.0177  -0.0154 -0.0386 1472 TYR A O   
124  C CB  . TYR A 24  ? 0.3285 0.3146 0.4041 0.0155  -0.0017 -0.0532 1472 TYR A CB  
125  C CG  . TYR A 24  ? 0.3421 0.3380 0.4319 0.0154  0.0003  -0.0621 1472 TYR A CG  
126  C CD1 . TYR A 24  ? 0.3760 0.3803 0.4865 0.0169  -0.0015 -0.0755 1472 TYR A CD1 
127  C CD2 . TYR A 24  ? 0.3411 0.3378 0.4253 0.0141  0.0040  -0.0584 1472 TYR A CD2 
128  C CE1 . TYR A 24  ? 0.3660 0.3797 0.4899 0.0167  0.0016  -0.0848 1472 TYR A CE1 
129  C CE2 . TYR A 24  ? 0.3428 0.3472 0.4378 0.0142  0.0062  -0.0668 1472 TYR A CE2 
130  C CZ  . TYR A 24  ? 0.3768 0.3899 0.4913 0.0153  0.0058  -0.0802 1472 TYR A CZ  
131  O OH  . TYR A 24  ? 0.3739 0.3949 0.4989 0.0151  0.0095  -0.0894 1472 TYR A OH  
132  N N   . LYS A 25  ? 0.3905 0.3620 0.4721 0.0233  -0.0279 -0.0570 1473 LYS A N   
133  C CA  . LYS A 25  ? 0.4441 0.4117 0.5253 0.0246  -0.0339 -0.0559 1473 LYS A CA  
134  C C   . LYS A 25  ? 0.4387 0.4197 0.5366 0.0252  -0.0300 -0.0659 1473 LYS A C   
135  O O   . LYS A 25  ? 0.4423 0.4326 0.5568 0.0264  -0.0290 -0.0772 1473 LYS A O   
136  C CB  . LYS A 25  ? 0.4826 0.4360 0.5625 0.0287  -0.0504 -0.0574 1473 LYS A CB  
137  C CG  . LYS A 25  ? 0.5047 0.4423 0.5645 0.0276  -0.0536 -0.0480 1473 LYS A CG  
138  C CD  . LYS A 25  ? 0.5728 0.4907 0.6202 0.0292  -0.0674 -0.0437 1473 LYS A CD  
139  C CE  . LYS A 25  ? 0.6400 0.5408 0.6636 0.0270  -0.0680 -0.0341 1473 LYS A CE  
140  N NZ  . LYS A 25  ? 0.6767 0.5572 0.6832 0.0260  -0.0772 -0.0270 1473 LYS A NZ  
141  N N   . ASP A 26  ? 0.4351 0.4170 0.5284 0.0238  -0.0268 -0.0620 1474 ASP A N   
142  C CA  . ASP A 26  ? 0.4800 0.4715 0.5857 0.0246  -0.0241 -0.0714 1474 ASP A CA  
143  C C   . ASP A 26  ? 0.4603 0.4520 0.5832 0.0298  -0.0365 -0.0828 1474 ASP A C   
144  O O   . ASP A 26  ? 0.4441 0.4237 0.5633 0.0328  -0.0497 -0.0797 1474 ASP A O   
145  C CB  . ASP A 26  ? 0.4760 0.4637 0.5713 0.0233  -0.0230 -0.0637 1474 ASP A CB  
146  C CG  . ASP A 26  ? 0.5167 0.5113 0.6210 0.0245  -0.0216 -0.0725 1474 ASP A CG  
147  O OD1 . ASP A 26  ? 0.5693 0.5651 0.6872 0.0285  -0.0303 -0.0819 1474 ASP A OD1 
148  O OD2 . ASP A 26  ? 0.5474 0.5443 0.6439 0.0217  -0.0130 -0.0697 1474 ASP A OD2 
149  N N   . SER A 27  ? 0.5084 0.5128 0.6495 0.0306  -0.0319 -0.0963 1475 SER A N   
150  C CA  . SER A 27  ? 0.5601 0.5678 0.7233 0.0360  -0.0429 -0.1105 1475 SER A CA  
151  C C   . SER A 27  ? 0.5639 0.5624 0.7278 0.0405  -0.0575 -0.1108 1475 SER A C   
152  O O   . SER A 27  ? 0.5811 0.5695 0.7492 0.0451  -0.0733 -0.1129 1475 SER A O   
153  C CB  . SER A 27  ? 0.5511 0.5759 0.7334 0.0347  -0.0315 -0.1253 1475 SER A CB  
154  O OG  . SER A 27  ? 0.5803 0.6120 0.7600 0.0294  -0.0174 -0.1243 1475 SER A OG  
155  N N   . SER A 28  ? 0.5658 0.5661 0.7245 0.0393  -0.0529 -0.1088 1476 SER A N   
156  C CA  . SER A 28  ? 0.5637 0.5568 0.7255 0.0435  -0.0658 -0.1108 1476 SER A CA  
157  C C   . SER A 28  ? 0.5368 0.5123 0.6790 0.0427  -0.0748 -0.0957 1476 SER A C   
158  O O   . SER A 28  ? 0.5414 0.5045 0.6843 0.0464  -0.0906 -0.0960 1476 SER A O   
159  C CB  . SER A 28  ? 0.6212 0.6219 0.7839 0.0425  -0.0576 -0.1145 1476 SER A CB  
160  O OG  . SER A 28  ? 0.6882 0.6843 0.8588 0.0474  -0.0704 -0.1201 1476 SER A OG  
161  N N   . SER A 29  ? 0.4785 0.4521 0.6030 0.0375  -0.0646 -0.0829 1477 SER A N   
162  C CA  . SER A 29  ? 0.4416 0.4003 0.5486 0.0354  -0.0698 -0.0690 1477 SER A CA  
163  C C   . SER A 29  ? 0.4273 0.3745 0.5253 0.0352  -0.0756 -0.0638 1477 SER A C   
164  O O   . SER A 29  ? 0.4591 0.3902 0.5447 0.0345  -0.0845 -0.0558 1477 SER A O   
165  C CB  . SER A 29  ? 0.4164 0.3776 0.5108 0.0304  -0.0575 -0.0586 1477 SER A CB  
166  O OG  . SER A 29  ? 0.3966 0.3663 0.4885 0.0276  -0.0449 -0.0578 1477 SER A OG  
167  N N   . GLY A 30  ? 0.3784 0.3323 0.4810 0.0351  -0.0703 -0.0680 1478 GLY A N   
168  C CA  . GLY A 30  ? 0.3891 0.3314 0.4786 0.0341  -0.0734 -0.0612 1478 GLY A CA  
169  C C   . GLY A 30  ? 0.3774 0.3154 0.4473 0.0286  -0.0630 -0.0471 1478 GLY A C   
170  O O   . GLY A 30  ? 0.3852 0.3116 0.4411 0.0272  -0.0648 -0.0405 1478 GLY A O   
171  N N   . ARG A 31  ? 0.3437 0.2904 0.4126 0.0256  -0.0523 -0.0432 1479 ARG A N   
172  C CA  . ARG A 31  ? 0.3320 0.2758 0.3863 0.0208  -0.0432 -0.0313 1479 ARG A CA  
173  C C   . ARG A 31  ? 0.3225 0.2725 0.3736 0.0191  -0.0332 -0.0303 1479 ARG A C   
174  O O   . ARG A 31  ? 0.2942 0.2560 0.3550 0.0196  -0.0273 -0.0375 1479 ARG A O   
175  C CB  . ARG A 31  ? 0.3326 0.2823 0.3881 0.0188  -0.0374 -0.0281 1479 ARG A CB  
176  C CG  . ARG A 31  ? 0.3264 0.2732 0.3707 0.0144  -0.0297 -0.0170 1479 ARG A CG  
177  C CD  . ARG A 31  ? 0.3215 0.2715 0.3689 0.0132  -0.0280 -0.0146 1479 ARG A CD  
178  N NE  . ARG A 31  ? 0.2963 0.2572 0.3509 0.0148  -0.0237 -0.0218 1479 ARG A NE  
179  C CZ  . ARG A 31  ? 0.2881 0.2557 0.3403 0.0132  -0.0142 -0.0211 1479 ARG A CZ  
180  N NH1 . ARG A 31  ? 0.2847 0.2513 0.3301 0.0105  -0.0082 -0.0140 1479 ARG A NH1 
181  N NH2 . ARG A 31  ? 0.2843 0.2585 0.3398 0.0140  -0.0107 -0.0280 1479 ARG A NH2 
182  N N   . GLN A 32  ? 0.3296 0.2708 0.3666 0.0166  -0.0309 -0.0216 1480 GLN A N   
183  C CA  . GLN A 32  ? 0.3377 0.2831 0.3705 0.0151  -0.0222 -0.0200 1480 GLN A CA  
184  C C   . GLN A 32  ? 0.2999 0.2545 0.3322 0.0121  -0.0106 -0.0160 1480 GLN A C   
185  O O   . GLN A 32  ? 0.2737 0.2245 0.2982 0.0095  -0.0069 -0.0080 1480 GLN A O   
186  C CB  . GLN A 32  ? 0.3903 0.3216 0.4067 0.0137  -0.0241 -0.0130 1480 GLN A CB  
187  C CG  . GLN A 32  ? 0.4348 0.3698 0.4466 0.0126  -0.0158 -0.0116 1480 GLN A CG  
188  C CD  . GLN A 32  ? 0.5144 0.4335 0.5084 0.0118  -0.0185 -0.0062 1480 GLN A CD  
189  O OE1 . GLN A 32  ? 0.5534 0.4581 0.5355 0.0104  -0.0238 -0.0013 1480 GLN A OE1 
190  N NE2 . GLN A 32  ? 0.5492 0.4694 0.5398 0.0121  -0.0147 -0.0071 1480 GLN A NE2 
191  N N   . LEU A 33  ? 0.2785 0.2442 0.3190 0.0124  -0.0048 -0.0220 1481 LEU A N   
192  C CA  . LEU A 33  ? 0.2608 0.2331 0.3001 0.0101  0.0039  -0.0196 1481 LEU A CA  
193  C C   . LEU A 33  ? 0.2552 0.2255 0.2854 0.0077  0.0103  -0.0118 1481 LEU A C   
194  O O   . LEU A 33  ? 0.2479 0.2189 0.2761 0.0063  0.0135  -0.0073 1481 LEU A O   
195  C CB  . LEU A 33  ? 0.2678 0.2491 0.3139 0.0098  0.0093  -0.0276 1481 LEU A CB  
196  C CG  . LEU A 33  ? 0.2913 0.2774 0.3483 0.0115  0.0061  -0.0370 1481 LEU A CG  
197  C CD1 . LEU A 33  ? 0.3044 0.2981 0.3633 0.0092  0.0154  -0.0430 1481 LEU A CD1 
198  C CD2 . LEU A 33  ? 0.2933 0.2753 0.3508 0.0131  -0.0008 -0.0351 1481 LEU A CD2 
199  N N   . SER A 34  ? 0.2478 0.2152 0.2731 0.0077  0.0114  -0.0109 1482 SER A N   
200  C CA  . SER A 34  ? 0.2538 0.2197 0.2711 0.0059  0.0179  -0.0048 1482 SER A CA  
201  C C   . SER A 34  ? 0.2504 0.2105 0.2618 0.0043  0.0186  0.0026  1482 SER A C   
202  O O   . SER A 34  ? 0.2542 0.2150 0.2621 0.0028  0.0247  0.0066  1482 SER A O   
203  C CB  . SER A 34  ? 0.2536 0.2162 0.2665 0.0067  0.0176  -0.0061 1482 SER A CB  
204  O OG  . SER A 34  ? 0.2485 0.2009 0.2558 0.0078  0.0101  -0.0052 1482 SER A OG  
205  N N   . GLU A 35  ? 0.2687 0.2229 0.2798 0.0042  0.0127  0.0040  1483 GLU A N   
206  C CA  . GLU A 35  ? 0.2983 0.2439 0.3013 0.0016  0.0137  0.0106  1483 GLU A CA  
207  C C   . GLU A 35  ? 0.2631 0.2139 0.2691 -0.0007 0.0217  0.0148  1483 GLU A C   
208  O O   . GLU A 35  ? 0.2395 0.1874 0.2395 -0.0027 0.0276  0.0184  1483 GLU A O   
209  C CB  . GLU A 35  ? 0.3541 0.2915 0.3565 0.0013  0.0056  0.0113  1483 GLU A CB  
210  C CG  . GLU A 35  ? 0.4372 0.3645 0.4300 -0.0028 0.0082  0.0185  1483 GLU A CG  
211  C CD  . GLU A 35  ? 0.5496 0.4643 0.5372 -0.0038 -0.0006 0.0200  1483 GLU A CD  
212  O OE1 . GLU A 35  ? 0.6546 0.5551 0.6275 -0.0073 0.0000  0.0250  1483 GLU A OE1 
213  O OE2 . GLU A 35  ? 0.5985 0.5162 0.5955 -0.0012 -0.0081 0.0160  1483 GLU A OE2 
214  N N   . VAL A 36  ? 0.2415 0.1994 0.2570 -0.0002 0.0216  0.0136  1484 VAL A N   
215  C CA  . VAL A 36  ? 0.2325 0.1947 0.2534 -0.0017 0.0268  0.0165  1484 VAL A CA  
216  C C   . VAL A 36  ? 0.2266 0.1932 0.2464 -0.0011 0.0329  0.0161  1484 VAL A C   
217  O O   . VAL A 36  ? 0.2216 0.1909 0.2463 -0.0021 0.0371  0.0180  1484 VAL A O   
218  C CB  . VAL A 36  ? 0.2535 0.2199 0.2837 -0.0009 0.0233  0.0152  1484 VAL A CB  
219  C CG1 . VAL A 36  ? 0.2846 0.2468 0.3173 -0.0014 0.0169  0.0156  1484 VAL A CG1 
220  C CG2 . VAL A 36  ? 0.2277 0.1981 0.2576 0.0014  0.0222  0.0105  1484 VAL A CG2 
221  N N   . PHE A 37  ? 0.2081 0.1755 0.2234 0.0004  0.0329  0.0129  1485 PHE A N   
222  C CA  . PHE A 37  ? 0.2028 0.1730 0.2163 0.0010  0.0373  0.0121  1485 PHE A CA  
223  C C   . PHE A 37  ? 0.2252 0.1919 0.2315 0.0006  0.0412  0.0137  1485 PHE A C   
224  O O   . PHE A 37  ? 0.2248 0.1933 0.2294 0.0012  0.0446  0.0129  1485 PHE A O   
225  C CB  . PHE A 37  ? 0.2068 0.1792 0.2194 0.0020  0.0359  0.0074  1485 PHE A CB  
226  C CG  . PHE A 37  ? 0.2061 0.1804 0.2225 0.0022  0.0331  0.0052  1485 PHE A CG  
227  C CD1 . PHE A 37  ? 0.2122 0.1866 0.2304 0.0022  0.0331  0.0069  1485 PHE A CD1 
228  C CD2 . PHE A 37  ? 0.2204 0.1954 0.2390 0.0028  0.0295  0.0012  1485 PHE A CD2 
229  C CE1 . PHE A 37  ? 0.2167 0.1905 0.2359 0.0026  0.0296  0.0049  1485 PHE A CE1 
230  C CE2 . PHE A 37  ? 0.2245 0.2003 0.2453 0.0031  0.0271  -0.0012 1485 PHE A CE2 
231  C CZ  . PHE A 37  ? 0.2199 0.1944 0.2395 0.0029  0.0273  0.0007  1485 PHE A CZ  
232  N N   . ILE A 38  ? 0.2356 0.1957 0.2358 -0.0005 0.0404  0.0158  1486 ILE A N   
233  C CA  . ILE A 38  ? 0.2609 0.2151 0.2507 -0.0008 0.0434  0.0167  1486 ILE A CA  
234  C C   . ILE A 38  ? 0.2599 0.2167 0.2512 -0.0021 0.0514  0.0189  1486 ILE A C   
235  O O   . ILE A 38  ? 0.2658 0.2228 0.2532 -0.0011 0.0551  0.0179  1486 ILE A O   
236  C CB  . ILE A 38  ? 0.2866 0.2292 0.2655 -0.0021 0.0401  0.0188  1486 ILE A CB  
237  C CG1 . ILE A 38  ? 0.2942 0.2341 0.2737 0.0001  0.0306  0.0151  1486 ILE A CG1 
238  C CG2 . ILE A 38  ? 0.3137 0.2477 0.2783 -0.0027 0.0440  0.0201  1486 ILE A CG2 
239  C CD1 . ILE A 38  ? 0.2967 0.2392 0.2771 0.0028  0.0284  0.0101  1486 ILE A CD1 
240  N N   . GLN A 39  ? 0.2750 0.2343 0.2740 -0.0042 0.0537  0.0209  1487 GLN A N   
241  C CA  . GLN A 39  ? 0.2886 0.2511 0.2927 -0.0058 0.0614  0.0218  1487 GLN A CA  
242  C C   . GLN A 39  ? 0.2909 0.2611 0.3115 -0.0061 0.0612  0.0215  1487 GLN A C   
243  O O   . GLN A 39  ? 0.2755 0.2449 0.3007 -0.0079 0.0584  0.0229  1487 GLN A O   
244  C CB  . GLN A 39  ? 0.3244 0.2781 0.3173 -0.0097 0.0673  0.0246  1487 GLN A CB  
245  C CG  . GLN A 39  ? 0.3669 0.3234 0.3609 -0.0103 0.0768  0.0234  1487 GLN A CG  
246  C CD  . GLN A 39  ? 0.3978 0.3463 0.3819 -0.0154 0.0856  0.0257  1487 GLN A CD  
247  O OE1 . GLN A 39  ? 0.4473 0.4000 0.4368 -0.0170 0.0951  0.0240  1487 GLN A OE1 
248  N NE2 . GLN A 39  ? 0.4182 0.3542 0.3875 -0.0182 0.0825  0.0290  1487 GLN A NE2 
249  N N   . LEU A 40  ? 0.2940 0.2705 0.3232 -0.0038 0.0623  0.0191  1488 LEU A N   
250  C CA  . LEU A 40  ? 0.3180 0.3006 0.3634 -0.0031 0.0601  0.0178  1488 LEU A CA  
251  C C   . LEU A 40  ? 0.3137 0.2991 0.3701 -0.0067 0.0664  0.0184  1488 LEU A C   
252  O O   . LEU A 40  ? 0.3125 0.2967 0.3648 -0.0090 0.0749  0.0186  1488 LEU A O   
253  C CB  . LEU A 40  ? 0.3463 0.3323 0.3970 0.0002  0.0591  0.0148  1488 LEU A CB  
254  C CG  . LEU A 40  ? 0.3661 0.3495 0.4116 0.0029  0.0516  0.0138  1488 LEU A CG  
255  C CD1 . LEU A 40  ? 0.3815 0.3645 0.4267 0.0055  0.0512  0.0116  1488 LEU A CD1 
256  C CD2 . LEU A 40  ? 0.3813 0.3650 0.4350 0.0034  0.0449  0.0135  1488 LEU A CD2 
257  N N   . PRO A 41  ? 0.3161 0.3047 0.3864 -0.0075 0.0629  0.0182  1489 PRO A N   
258  C CA  . PRO A 41  ? 0.3458 0.3393 0.4318 -0.0112 0.0699  0.0173  1489 PRO A CA  
259  C C   . PRO A 41  ? 0.3251 0.3252 0.4219 -0.0094 0.0754  0.0130  1489 PRO A C   
260  O O   . PRO A 41  ? 0.2954 0.2966 0.3923 -0.0045 0.0698  0.0107  1489 PRO A O   
261  C CB  . PRO A 41  ? 0.3472 0.3438 0.4489 -0.0105 0.0622  0.0165  1489 PRO A CB  
262  C CG  . PRO A 41  ? 0.3467 0.3375 0.4352 -0.0081 0.0530  0.0183  1489 PRO A CG  
263  C CD  . PRO A 41  ? 0.3312 0.3195 0.4050 -0.0051 0.0530  0.0178  1489 PRO A CD  
264  N N   . SER A 42  ? 0.3499 0.3535 0.4548 -0.0136 0.0865  0.0116  1490 SER A N   
265  C CA  . SER A 42  ? 0.3748 0.3856 0.4920 -0.0120 0.0930  0.0062  1490 SER A CA  
266  C C   . SER A 42  ? 0.3559 0.3750 0.4982 -0.0079 0.0857  0.0010  1490 SER A C   
267  O O   . SER A 42  ? 0.3271 0.3468 0.4790 -0.0076 0.0779  0.0016  1490 SER A O   
268  C CB  . SER A 42  ? 0.3980 0.4110 0.5195 -0.0185 0.1082  0.0049  1490 SER A CB  
269  O OG  . SER A 42  ? 0.4169 0.4361 0.5604 -0.0222 0.1100  0.0034  1490 SER A OG  
270  N N   . ARG A 43  ? 0.3889 0.4132 0.5415 -0.0043 0.0871  -0.0043 1491 ARG A N   
271  C CA  . ARG A 43  ? 0.4326 0.4638 0.6114 0.0000  0.0794  -0.0107 1491 ARG A CA  
272  C C   . ARG A 43  ? 0.4360 0.4755 0.6416 -0.0034 0.0821  -0.0140 1491 ARG A C   
273  O O   . ARG A 43  ? 0.4270 0.4679 0.6486 -0.0002 0.0706  -0.0164 1491 ARG A O   
274  C CB  . ARG A 43  ? 0.4729 0.5087 0.6609 0.0038  0.0822  -0.0172 1491 ARG A CB  
275  C CG  . ARG A 43  ? 0.5309 0.5589 0.7052 0.0100  0.0704  -0.0164 1491 ARG A CG  
276  C CD  . ARG A 43  ? 0.6021 0.6325 0.7813 0.0138  0.0729  -0.0221 1491 ARG A CD  
277  N NE  . ARG A 43  ? 0.6268 0.6473 0.7903 0.0187  0.0614  -0.0205 1491 ARG A NE  
278  C CZ  . ARG A 43  ? 0.6383 0.6515 0.7773 0.0185  0.0632  -0.0163 1491 ARG A CZ  
279  N NH1 . ARG A 43  ? 0.6416 0.6553 0.7674 0.0144  0.0744  -0.0133 1491 ARG A NH1 
280  N NH2 . ARG A 43  ? 0.6628 0.6669 0.7898 0.0221  0.0531  -0.0153 1491 ARG A NH2 
281  N N   . LYS A 44  ? 0.4396 0.4829 0.6484 -0.0104 0.0967  -0.0138 1492 LYS A N   
282  C CA  . LYS A 44  ? 0.4633 0.5143 0.6986 -0.0148 0.0997  -0.0168 1492 LYS A CA  
283  C C   . LYS A 44  ? 0.4767 0.5216 0.7049 -0.0177 0.0933  -0.0106 1492 LYS A C   
284  O O   . LYS A 44  ? 0.4727 0.5228 0.7242 -0.0188 0.0892  -0.0133 1492 LYS A O   
285  C CB  . LYS A 44  ? 0.5118 0.5703 0.7597 -0.0222 0.1186  -0.0207 1492 LYS A CB  
286  C CG  . LYS A 44  ? 0.5620 0.6133 0.7821 -0.0269 0.1326  -0.0168 1492 LYS A CG  
287  C CD  . LYS A 44  ? 0.6096 0.6692 0.8464 -0.0340 0.1519  -0.0231 1492 LYS A CD  
288  C CE  . LYS A 44  ? 0.5940 0.6681 0.8627 -0.0287 0.1527  -0.0347 1492 LYS A CE  
289  N NZ  . LYS A 44  ? 0.6343 0.7130 0.9048 -0.0335 0.1725  -0.0405 1492 LYS A NZ  
290  N N   . GLU A 45  ? 0.4879 0.5217 0.6858 -0.0188 0.0919  -0.0029 1493 GLU A N   
291  C CA  . GLU A 45  ? 0.4853 0.5126 0.6756 -0.0208 0.0847  0.0023  1493 GLU A CA  
292  C C   . GLU A 45  ? 0.4360 0.4621 0.6310 -0.0140 0.0680  0.0013  1493 GLU A C   
293  O O   . GLU A 45  ? 0.4245 0.4497 0.6280 -0.0146 0.0607  0.0021  1493 GLU A O   
294  C CB  . GLU A 45  ? 0.5625 0.5782 0.7203 -0.0230 0.0868  0.0094  1493 GLU A CB  
295  C CG  . GLU A 45  ? 0.6337 0.6452 0.7814 -0.0311 0.1019  0.0119  1493 GLU A CG  
296  C CD  . GLU A 45  ? 0.7142 0.7219 0.8658 -0.0383 0.1043  0.0152  1493 GLU A CD  
297  O OE1 . GLU A 45  ? 0.7956 0.8042 0.9572 -0.0365 0.0934  0.0157  1493 GLU A OE1 
298  O OE2 . GLU A 45  ? 0.8334 0.8357 0.9766 -0.0463 0.1171  0.0173  1493 GLU A OE2 
299  N N   . LEU A 46  ? 0.3982 0.4227 0.5862 -0.0077 0.0618  -0.0004 1494 LEU A N   
300  C CA  . LEU A 46  ? 0.3934 0.4122 0.5764 -0.0020 0.0467  -0.0003 1494 LEU A CA  
301  C C   . LEU A 46  ? 0.3857 0.4048 0.5745 0.0040  0.0403  -0.0052 1494 LEU A C   
302  O O   . LEU A 46  ? 0.3742 0.3862 0.5432 0.0071  0.0365  -0.0035 1494 LEU A O   
303  C CB  . LEU A 46  ? 0.3903 0.3998 0.5444 -0.0020 0.0444  0.0054  1494 LEU A CB  
304  C CG  . LEU A 46  ? 0.4213 0.4236 0.5666 0.0019  0.0312  0.0060  1494 LEU A CG  
305  C CD1 . LEU A 46  ? 0.4673 0.4698 0.6256 0.0008  0.0249  0.0058  1494 LEU A CD1 
306  C CD2 . LEU A 46  ? 0.4179 0.4134 0.5377 0.0018  0.0313  0.0098  1494 LEU A CD2 
307  N N   . PRO A 47  ? 0.3992 0.4259 0.6162 0.0057  0.0385  -0.0119 1495 PRO A N   
308  C CA  . PRO A 47  ? 0.4020 0.4277 0.6250 0.0119  0.0314  -0.0171 1495 PRO A CA  
309  C C   . PRO A 47  ? 0.3784 0.3910 0.5866 0.0173  0.0150  -0.0159 1495 PRO A C   
310  O O   . PRO A 47  ? 0.3718 0.3781 0.5699 0.0212  0.0102  -0.0170 1495 PRO A O   
311  C CB  . PRO A 47  ? 0.4090 0.4462 0.6700 0.0125  0.0318  -0.0257 1495 PRO A CB  
312  C CG  . PRO A 47  ? 0.3983 0.4405 0.6723 0.0069  0.0357  -0.0244 1495 PRO A CG  
313  C CD  . PRO A 47  ? 0.3998 0.4365 0.6454 0.0016  0.0440  -0.0156 1495 PRO A CD  
314  N N   . GLU A 48  ? 0.3863 0.3935 0.5913 0.0170  0.0068  -0.0136 1496 GLU A N   
315  C CA  . GLU A 48  ? 0.4231 0.4159 0.6093 0.0209  -0.0070 -0.0120 1496 GLU A CA  
316  C C   . GLU A 48  ? 0.4093 0.3936 0.5643 0.0207  -0.0039 -0.0074 1496 GLU A C   
317  O O   . GLU A 48  ? 0.4228 0.3955 0.5638 0.0241  -0.0127 -0.0078 1496 GLU A O   
318  C CB  . GLU A 48  ? 0.5217 0.5109 0.7056 0.0194  -0.0126 -0.0096 1496 GLU A CB  
319  C CG  . GLU A 48  ? 0.6142 0.5873 0.7735 0.0223  -0.0242 -0.0076 1496 GLU A CG  
320  C CD  . GLU A 48  ? 0.7209 0.6907 0.8770 0.0211  -0.0290 -0.0058 1496 GLU A CD  
321  O OE1 . GLU A 48  ? 0.7570 0.7338 0.9127 0.0168  -0.0198 -0.0026 1496 GLU A OE1 
322  O OE2 . GLU A 48  ? 0.7868 0.7453 0.9393 0.0246  -0.0426 -0.0077 1496 GLU A OE2 
323  N N   . TYR A 49  ? 0.3620 0.3509 0.5057 0.0163  0.0078  -0.0032 1497 TYR A N   
324  C CA  . TYR A 49  ? 0.3364 0.3189 0.4541 0.0158  0.0112  0.0002  1497 TYR A CA  
325  C C   . TYR A 49  ? 0.3507 0.3305 0.4660 0.0187  0.0105  -0.0020 1497 TYR A C   
326  O O   . TYR A 49  ? 0.3147 0.2838 0.4112 0.0200  0.0056  -0.0008 1497 TYR A O   
327  C CB  . TYR A 49  ? 0.3085 0.2967 0.4186 0.0114  0.0232  0.0038  1497 TYR A CB  
328  C CG  . TYR A 49  ? 0.2934 0.2751 0.3795 0.0107  0.0245  0.0067  1497 TYR A CG  
329  C CD1 . TYR A 49  ? 0.2794 0.2595 0.3561 0.0114  0.0283  0.0065  1497 TYR A CD1 
330  C CD2 . TYR A 49  ? 0.2918 0.2692 0.3660 0.0095  0.0219  0.0088  1497 TYR A CD2 
331  C CE1 . TYR A 49  ? 0.2784 0.2535 0.3362 0.0104  0.0298  0.0084  1497 TYR A CE1 
332  C CE2 . TYR A 49  ? 0.2819 0.2548 0.3375 0.0086  0.0239  0.0100  1497 TYR A CE2 
333  C CZ  . TYR A 49  ? 0.2801 0.2519 0.3281 0.0090  0.0277  0.0098  1497 TYR A CZ  
334  O OH  . TYR A 49  ? 0.2614 0.2294 0.2937 0.0077  0.0299  0.0103  1497 TYR A OH  
335  N N   . TYR A 50  ? 0.3411 0.3303 0.4761 0.0193  0.0156  -0.0058 1498 TYR A N   
336  C CA  . TYR A 50  ? 0.3668 0.3546 0.5013 0.0222  0.0157  -0.0087 1498 TYR A CA  
337  C C   . TYR A 50  ? 0.3836 0.3631 0.5252 0.0275  0.0014  -0.0130 1498 TYR A C   
338  O O   . TYR A 50  ? 0.4017 0.3745 0.5358 0.0302  -0.0021 -0.0143 1498 TYR A O   
339  C CB  . TYR A 50  ? 0.3541 0.3545 0.5053 0.0208  0.0277  -0.0119 1498 TYR A CB  
340  C CG  . TYR A 50  ? 0.3436 0.3473 0.4815 0.0157  0.0401  -0.0071 1498 TYR A CG  
341  C CD1 . TYR A 50  ? 0.3335 0.3416 0.4761 0.0114  0.0450  -0.0047 1498 TYR A CD1 
342  C CD2 . TYR A 50  ? 0.3673 0.3677 0.4868 0.0153  0.0453  -0.0049 1498 TYR A CD2 
343  C CE1 . TYR A 50  ? 0.3296 0.3375 0.4578 0.0070  0.0544  -0.0003 1498 TYR A CE1 
344  C CE2 . TYR A 50  ? 0.3700 0.3710 0.4763 0.0112  0.0545  -0.0009 1498 TYR A CE2 
345  C CZ  . TYR A 50  ? 0.3466 0.3506 0.4565 0.0072  0.0585  0.0014  1498 TYR A CZ  
346  O OH  . TYR A 50  ? 0.3566 0.3582 0.4516 0.0035  0.0655  0.0053  1498 TYR A OH  
347  N N   . GLU A 51  ? 0.4262 0.4041 0.5807 0.0291  -0.0080 -0.0151 1499 GLU A N   
348  C CA  . GLU A 51  ? 0.4838 0.4492 0.6404 0.0346  -0.0247 -0.0189 1499 GLU A CA  
349  C C   . GLU A 51  ? 0.4698 0.4158 0.5926 0.0344  -0.0324 -0.0139 1499 GLU A C   
350  O O   . GLU A 51  ? 0.4812 0.4130 0.5918 0.0374  -0.0417 -0.0148 1499 GLU A O   
351  C CB  . GLU A 51  ? 0.5352 0.5041 0.7179 0.0368  -0.0337 -0.0237 1499 GLU A CB  
352  C CG  . GLU A 51  ? 0.6215 0.6032 0.8406 0.0397  -0.0335 -0.0324 1499 GLU A CG  
353  C CD  . GLU A 51  ? 0.6859 0.6767 0.9362 0.0398  -0.0374 -0.0373 1499 GLU A CD  
354  O OE1 . GLU A 51  ? 0.6778 0.6848 0.9456 0.0348  -0.0233 -0.0377 1499 GLU A OE1 
355  O OE2 . GLU A 51  ? 0.7222 0.7024 0.9785 0.0446  -0.0550 -0.0408 1499 GLU A OE2 
356  N N   . LEU A 52  ? 0.4460 0.3909 0.5534 0.0305  -0.0279 -0.0090 1500 LEU A N   
357  C CA  . LEU A 52  ? 0.4587 0.3863 0.5358 0.0295  -0.0335 -0.0053 1500 LEU A CA  
358  C C   . LEU A 52  ? 0.4422 0.3657 0.4966 0.0266  -0.0254 -0.0019 1500 LEU A C   
359  O O   . LEU A 52  ? 0.4641 0.3706 0.4955 0.0264  -0.0311 -0.0005 1500 LEU A O   
360  C CB  . LEU A 52  ? 0.4798 0.4088 0.5520 0.0268  -0.0319 -0.0029 1500 LEU A CB  
361  C CG  . LEU A 52  ? 0.5685 0.4810 0.6091 0.0249  -0.0348 0.0000  1500 LEU A CG  
362  C CD1 . LEU A 52  ? 0.5808 0.4717 0.6078 0.0282  -0.0503 -0.0016 1500 LEU A CD1 
363  C CD2 . LEU A 52  ? 0.5821 0.4988 0.6198 0.0223  -0.0312 0.0015  1500 LEU A CD2 
364  N N   . ILE A 53  ? 0.3817 0.3193 0.4415 0.0239  -0.0123 -0.0005 1501 ILE A N   
365  C CA  . ILE A 53  ? 0.3849 0.3204 0.4258 0.0208  -0.0044 0.0023  1501 ILE A CA  
366  C C   . ILE A 53  ? 0.4117 0.3478 0.4557 0.0226  -0.0028 0.0007  1501 ILE A C   
367  O O   . ILE A 53  ? 0.4288 0.3771 0.4919 0.0239  0.0021  -0.0017 1501 ILE A O   
368  C CB  . ILE A 53  ? 0.3560 0.3038 0.3982 0.0171  0.0071  0.0046  1501 ILE A CB  
369  C CG1 . ILE A 53  ? 0.3537 0.2992 0.3906 0.0155  0.0045  0.0058  1501 ILE A CG1 
370  C CG2 . ILE A 53  ? 0.3476 0.2954 0.3756 0.0146  0.0150  0.0064  1501 ILE A CG2 
371  C CD1 . ILE A 53  ? 0.3644 0.2944 0.3790 0.0148  -0.0013 0.0064  1501 ILE A CD1 
372  N N   . ARG A 54  ? 0.4467 0.3691 0.4704 0.0220  -0.0059 0.0020  1502 ARG A N   
373  C CA  . ARG A 54  ? 0.4850 0.4045 0.5089 0.0240  -0.0067 0.0004  1502 ARG A CA  
374  C C   . ARG A 54  ? 0.4502 0.3808 0.4751 0.0220  0.0055  0.0012  1502 ARG A C   
375  O O   . ARG A 54  ? 0.4181 0.3552 0.4559 0.0247  0.0075  -0.0017 1502 ARG A O   
376  C CB  . ARG A 54  ? 0.5309 0.4293 0.5297 0.0229  -0.0142 0.0022  1502 ARG A CB  
377  C CG  . ARG A 54  ? 0.5696 0.4502 0.5599 0.0250  -0.0285 0.0016  1502 ARG A CG  
378  C CD  . ARG A 54  ? 0.6304 0.4886 0.5928 0.0228  -0.0336 0.0039  1502 ARG A CD  
379  N NE  . ARG A 54  ? 0.6999 0.5357 0.6392 0.0215  -0.0435 0.0055  1502 ARG A NE  
380  C CZ  . ARG A 54  ? 0.7552 0.5658 0.6691 0.0201  -0.0519 0.0071  1502 ARG A CZ  
381  N NH1 . ARG A 54  ? 0.7383 0.5442 0.6487 0.0202  -0.0521 0.0072  1502 ARG A NH1 
382  N NH2 . ARG A 54  ? 0.8246 0.6126 0.7146 0.0186  -0.0607 0.0085  1502 ARG A NH2 
383  N N   . LYS A 55  ? 0.4189 0.3511 0.4308 0.0177  0.0130  0.0043  1503 LYS A N   
384  C CA  . LYS A 55  ? 0.4071 0.3481 0.4191 0.0161  0.0230  0.0048  1503 LYS A CA  
385  C C   . LYS A 55  ? 0.3504 0.3016 0.3654 0.0135  0.0304  0.0064  1503 LYS A C   
386  O O   . LYS A 55  ? 0.3302 0.2799 0.3337 0.0104  0.0336  0.0079  1503 LYS A O   
387  C CB  . LYS A 55  ? 0.4604 0.3923 0.4543 0.0135  0.0242  0.0063  1503 LYS A CB  
388  C CG  . LYS A 55  ? 0.5124 0.4313 0.4994 0.0153  0.0167  0.0054  1503 LYS A CG  
389  C CD  . LYS A 55  ? 0.5786 0.4906 0.5501 0.0119  0.0201  0.0068  1503 LYS A CD  
390  C CE  . LYS A 55  ? 0.6125 0.5198 0.5691 0.0063  0.0236  0.0089  1503 LYS A CE  
391  N NZ  . LYS A 55  ? 0.6655 0.5671 0.6099 0.0022  0.0278  0.0095  1503 LYS A NZ  
392  N N   . PRO A 56  ? 0.3317 0.2925 0.3626 0.0147  0.0329  0.0054  1504 PRO A N   
393  C CA  . PRO A 56  ? 0.3245 0.2926 0.3576 0.0122  0.0387  0.0071  1504 PRO A CA  
394  C C   . PRO A 56  ? 0.3078 0.2773 0.3317 0.0104  0.0454  0.0081  1504 PRO A C   
395  O O   . PRO A 56  ? 0.3024 0.2722 0.3255 0.0115  0.0483  0.0070  1504 PRO A O   
396  C CB  . PRO A 56  ? 0.3288 0.3054 0.3805 0.0131  0.0414  0.0054  1504 PRO A CB  
397  C CG  . PRO A 56  ? 0.3477 0.3219 0.4102 0.0168  0.0344  0.0020  1504 PRO A CG  
398  C CD  . PRO A 56  ? 0.3393 0.3047 0.3883 0.0180  0.0311  0.0019  1504 PRO A CD  
399  N N   . VAL A 57  ? 0.2841 0.2541 0.3016 0.0081  0.0468  0.0096  1505 VAL A N   
400  C CA  . VAL A 57  ? 0.2757 0.2460 0.2855 0.0068  0.0510  0.0099  1505 VAL A CA  
401  C C   . VAL A 57  ? 0.2691 0.2414 0.2786 0.0051  0.0513  0.0109  1505 VAL A C   
402  O O   . VAL A 57  ? 0.2691 0.2415 0.2807 0.0046  0.0479  0.0110  1505 VAL A O   
403  C CB  . VAL A 57  ? 0.2931 0.2581 0.2926 0.0060  0.0498  0.0089  1505 VAL A CB  
404  C CG1 . VAL A 57  ? 0.2948 0.2559 0.2892 0.0042  0.0466  0.0087  1505 VAL A CG1 
405  C CG2 . VAL A 57  ? 0.3060 0.2716 0.3003 0.0051  0.0529  0.0083  1505 VAL A CG2 
406  N N   . ASP A 58  ? 0.2497 0.2223 0.2562 0.0046  0.0547  0.0115  1506 ASP A N   
407  C CA  . ASP A 58  ? 0.2371 0.2092 0.2419 0.0032  0.0534  0.0123  1506 ASP A CA  
408  C C   . ASP A 58  ? 0.2275 0.1960 0.2235 0.0033  0.0534  0.0111  1506 ASP A C   
409  O O   . ASP A 58  ? 0.2282 0.1952 0.2201 0.0042  0.0551  0.0101  1506 ASP A O   
410  C CB  . ASP A 58  ? 0.2439 0.2169 0.2537 0.0020  0.0557  0.0145  1506 ASP A CB  
411  C CG  . ASP A 58  ? 0.2465 0.2190 0.2551 0.0017  0.0621  0.0150  1506 ASP A CG  
412  O OD1 . ASP A 58  ? 0.2536 0.2234 0.2545 0.0027  0.0638  0.0140  1506 ASP A OD1 
413  O OD2 . ASP A 58  ? 0.2695 0.2441 0.2850 0.0000  0.0661  0.0160  1506 ASP A OD2 
414  N N   . PHE A 59  ? 0.2153 0.1817 0.2093 0.0029  0.0501  0.0106  1507 PHE A N   
415  C CA  . PHE A 59  ? 0.2288 0.1912 0.2165 0.0036  0.0482  0.0085  1507 PHE A CA  
416  C C   . PHE A 59  ? 0.2572 0.2134 0.2355 0.0040  0.0509  0.0101  1507 PHE A C   
417  O O   . PHE A 59  ? 0.2765 0.2294 0.2498 0.0052  0.0494  0.0079  1507 PHE A O   
418  C CB  . PHE A 59  ? 0.2305 0.1908 0.2190 0.0037  0.0425  0.0067  1507 PHE A CB  
419  C CG  . PHE A 59  ? 0.2357 0.2015 0.2317 0.0036  0.0405  0.0027  1507 PHE A CG  
420  C CD1 . PHE A 59  ? 0.2523 0.2203 0.2499 0.0036  0.0412  -0.0013 1507 PHE A CD1 
421  C CD2 . PHE A 59  ? 0.2545 0.2230 0.2560 0.0032  0.0383  0.0024  1507 PHE A CD2 
422  C CE1 . PHE A 59  ? 0.2781 0.2510 0.2821 0.0024  0.0413  -0.0059 1507 PHE A CE1 
423  C CE2 . PHE A 59  ? 0.2572 0.2302 0.2644 0.0029  0.0375  -0.0023 1507 PHE A CE2 
424  C CZ  . PHE A 59  ? 0.2565 0.2318 0.2647 0.0021  0.0398  -0.0065 1507 PHE A CZ  
425  N N   . LYS A 60  ? 0.2642 0.2183 0.2402 0.0027  0.0550  0.0133  1508 LYS A N   
426  C CA  . LYS A 60  ? 0.2891 0.2368 0.2547 0.0024  0.0597  0.0144  1508 LYS A CA  
427  C C   . LYS A 60  ? 0.2863 0.2371 0.2531 0.0044  0.0626  0.0123  1508 LYS A C   
428  O O   . LYS A 60  ? 0.2880 0.2327 0.2450 0.0055  0.0628  0.0112  1508 LYS A O   
429  C CB  . LYS A 60  ? 0.3173 0.2646 0.2837 -0.0002 0.0663  0.0172  1508 LYS A CB  
430  C CG  . LYS A 60  ? 0.3561 0.2946 0.3084 -0.0016 0.0727  0.0181  1508 LYS A CG  
431  C CD  . LYS A 60  ? 0.3800 0.3171 0.3325 -0.0059 0.0804  0.0206  1508 LYS A CD  
432  C CE  . LYS A 60  ? 0.4007 0.3347 0.3459 -0.0073 0.0905  0.0196  1508 LYS A CE  
433  N NZ  . LYS A 60  ? 0.4438 0.3612 0.3644 -0.0081 0.0896  0.0209  1508 LYS A NZ  
434  N N   . LYS A 61  ? 0.2681 0.2267 0.2460 0.0048  0.0640  0.0117  1509 LYS A N   
435  C CA  . LYS A 61  ? 0.2679 0.2284 0.2477 0.0067  0.0651  0.0097  1509 LYS A CA  
436  C C   . LYS A 61  ? 0.2586 0.2170 0.2344 0.0074  0.0610  0.0077  1509 LYS A C   
437  O O   . LYS A 61  ? 0.2543 0.2099 0.2258 0.0088  0.0617  0.0062  1509 LYS A O   
438  C CB  . LYS A 61  ? 0.2649 0.2314 0.2562 0.0072  0.0650  0.0095  1509 LYS A CB  
439  C CG  . LYS A 61  ? 0.3128 0.2792 0.3055 0.0093  0.0650  0.0074  1509 LYS A CG  
440  C CD  . LYS A 61  ? 0.3488 0.3147 0.3404 0.0108  0.0704  0.0059  1509 LYS A CD  
441  C CE  . LYS A 61  ? 0.3923 0.3639 0.3975 0.0118  0.0730  0.0043  1509 LYS A CE  
442  N NZ  . LYS A 61  ? 0.4345 0.4067 0.4394 0.0123  0.0805  0.0019  1509 LYS A NZ  
443  N N   . ILE A 62  ? 0.2418 0.2015 0.2202 0.0064  0.0570  0.0070  1510 ILE A N   
444  C CA  . ILE A 62  ? 0.2418 0.2007 0.2193 0.0062  0.0543  0.0041  1510 ILE A CA  
445  C C   . ILE A 62  ? 0.2662 0.2191 0.2364 0.0075  0.0522  0.0027  1510 ILE A C   
446  O O   . ILE A 62  ? 0.2586 0.2096 0.2271 0.0082  0.0515  0.0005  1510 ILE A O   
447  C CB  . ILE A 62  ? 0.2409 0.2033 0.2241 0.0045  0.0518  0.0023  1510 ILE A CB  
448  C CG1 . ILE A 62  ? 0.2366 0.2015 0.2228 0.0032  0.0533  0.0035  1510 ILE A CG1 
449  C CG2 . ILE A 62  ? 0.2415 0.2039 0.2264 0.0037  0.0498  -0.0020 1510 ILE A CG2 
450  C CD1 . ILE A 62  ? 0.2534 0.2209 0.2433 0.0014  0.0519  0.0017  1510 ILE A CD1 
451  N N   . LYS A 63  ? 0.2695 0.2176 0.2341 0.0078  0.0506  0.0039  1511 LYS A N   
452  C CA  . LYS A 63  ? 0.3087 0.2474 0.2629 0.0093  0.0471  0.0027  1511 LYS A CA  
453  C C   . LYS A 63  ? 0.2977 0.2317 0.2429 0.0105  0.0511  0.0033  1511 LYS A C   
454  O O   . LYS A 63  ? 0.3049 0.2320 0.2430 0.0122  0.0477  0.0010  1511 LYS A O   
455  C CB  . LYS A 63  ? 0.3345 0.2652 0.2803 0.0088  0.0445  0.0050  1511 LYS A CB  
456  C CG  . LYS A 63  ? 0.3866 0.3186 0.3394 0.0088  0.0376  0.0029  1511 LYS A CG  
457  C CD  . LYS A 63  ? 0.4427 0.3643 0.3854 0.0082  0.0341  0.0057  1511 LYS A CD  
458  C CE  . LYS A 63  ? 0.5013 0.4190 0.4473 0.0099  0.0235  0.0017  1511 LYS A CE  
459  N NZ  . LYS A 63  ? 0.5628 0.4674 0.4975 0.0094  0.0178  0.0044  1511 LYS A NZ  
460  N N   . GLU A 64  ? 0.3079 0.2453 0.2543 0.0099  0.0579  0.0055  1512 GLU A N   
461  C CA  . GLU A 64  ? 0.3409 0.2759 0.2817 0.0113  0.0630  0.0049  1512 GLU A CA  
462  C C   . GLU A 64  ? 0.3242 0.2620 0.2700 0.0129  0.0613  0.0023  1512 GLU A C   
463  O O   . GLU A 64  ? 0.3182 0.2504 0.2565 0.0148  0.0608  0.0003  1512 GLU A O   
464  C CB  . GLU A 64  ? 0.3932 0.3335 0.3396 0.0101  0.0706  0.0064  1512 GLU A CB  
465  C CG  . GLU A 64  ? 0.4553 0.3978 0.4038 0.0118  0.0764  0.0043  1512 GLU A CG  
466  C CD  . GLU A 64  ? 0.5573 0.5047 0.5126 0.0101  0.0845  0.0046  1512 GLU A CD  
467  O OE1 . GLU A 64  ? 0.5784 0.5276 0.5372 0.0074  0.0851  0.0072  1512 GLU A OE1 
468  O OE2 . GLU A 64  ? 0.6141 0.5636 0.5724 0.0115  0.0905  0.0016  1512 GLU A OE2 
469  N N   . ARG A 65  ? 0.2945 0.2394 0.2512 0.0119  0.0597  0.0022  1513 ARG A N   
470  C CA  . ARG A 65  ? 0.2918 0.2371 0.2515 0.0122  0.0579  0.0003  1513 ARG A CA  
471  C C   . ARG A 65  ? 0.2902 0.2315 0.2470 0.0122  0.0533  -0.0024 1513 ARG A C   
472  O O   . ARG A 65  ? 0.2670 0.2050 0.2218 0.0131  0.0520  -0.0043 1513 ARG A O   
473  C CB  . ARG A 65  ? 0.2933 0.2436 0.2610 0.0103  0.0575  0.0011  1513 ARG A CB  
474  C CG  . ARG A 65  ? 0.3276 0.2809 0.3000 0.0112  0.0600  0.0026  1513 ARG A CG  
475  C CD  . ARG A 65  ? 0.3474 0.3023 0.3249 0.0098  0.0579  0.0035  1513 ARG A CD  
476  N NE  . ARG A 65  ? 0.3964 0.3537 0.3805 0.0116  0.0587  0.0039  1513 ARG A NE  
477  C CZ  . ARG A 65  ? 0.4345 0.3929 0.4240 0.0113  0.0562  0.0047  1513 ARG A CZ  
478  N NH1 . ARG A 65  ? 0.4184 0.3751 0.4051 0.0087  0.0537  0.0058  1513 ARG A NH1 
479  N NH2 . ARG A 65  ? 0.4331 0.3941 0.4315 0.0135  0.0563  0.0038  1513 ARG A NH2 
480  N N   . ILE A 66  ? 0.2833 0.2243 0.2410 0.0114  0.0500  -0.0032 1514 ILE A N   
481  C CA  . ILE A 66  ? 0.2801 0.2171 0.2374 0.0120  0.0445  -0.0069 1514 ILE A CA  
482  C C   . ILE A 66  ? 0.3004 0.2274 0.2450 0.0151  0.0426  -0.0075 1514 ILE A C   
483  O O   . ILE A 66  ? 0.3085 0.2325 0.2524 0.0161  0.0404  -0.0100 1514 ILE A O   
484  C CB  . ILE A 66  ? 0.2766 0.2144 0.2383 0.0115  0.0400  -0.0086 1514 ILE A CB  
485  C CG1 . ILE A 66  ? 0.2735 0.2209 0.2479 0.0084  0.0419  -0.0099 1514 ILE A CG1 
486  C CG2 . ILE A 66  ? 0.2780 0.2098 0.2395 0.0134  0.0323  -0.0133 1514 ILE A CG2 
487  C CD1 . ILE A 66  ? 0.2704 0.2200 0.2505 0.0082  0.0383  -0.0116 1514 ILE A CD1 
488  N N   . ARG A 67  ? 0.3032 0.2240 0.2369 0.0160  0.0436  -0.0051 1515 ARG A N   
489  C CA  . ARG A 67  ? 0.3249 0.2333 0.2419 0.0184  0.0426  -0.0055 1515 ARG A CA  
490  C C   . ARG A 67  ? 0.3106 0.2196 0.2258 0.0198  0.0471  -0.0063 1515 ARG A C   
491  O O   . ARG A 67  ? 0.3264 0.2266 0.2319 0.0221  0.0444  -0.0084 1515 ARG A O   
492  C CB  . ARG A 67  ? 0.3552 0.2574 0.2603 0.0173  0.0462  -0.0019 1515 ARG A CB  
493  C CG  . ARG A 67  ? 0.4085 0.2952 0.2919 0.0185  0.0468  -0.0016 1515 ARG A CG  
494  C CD  . ARG A 67  ? 0.4379 0.3218 0.3124 0.0155  0.0552  0.0022  1515 ARG A CD  
495  N NE  . ARG A 67  ? 0.4586 0.3531 0.3419 0.0151  0.0653  0.0020  1515 ARG A NE  
496  C CZ  . ARG A 67  ? 0.4732 0.3736 0.3612 0.0123  0.0740  0.0042  1515 ARG A CZ  
497  N NH1 . ARG A 67  ? 0.4749 0.3713 0.3582 0.0092  0.0744  0.0075  1515 ARG A NH1 
498  N NH2 . ARG A 67  ? 0.4765 0.3868 0.3755 0.0128  0.0813  0.0025  1515 ARG A NH2 
499  N N   . ASN A 68  ? 0.3200 0.2384 0.2449 0.0188  0.0528  -0.0051 1516 ASN A N   
500  C CA  . ASN A 68  ? 0.3312 0.2501 0.2562 0.0207  0.0561  -0.0065 1516 ASN A CA  
501  C C   . ASN A 68  ? 0.3290 0.2499 0.2619 0.0207  0.0519  -0.0085 1516 ASN A C   
502  O O   . ASN A 68  ? 0.3334 0.2550 0.2683 0.0220  0.0535  -0.0094 1516 ASN A O   
503  C CB  . ASN A 68  ? 0.3412 0.2678 0.2736 0.0202  0.0630  -0.0050 1516 ASN A CB  
504  C CG  . ASN A 68  ? 0.3659 0.2908 0.2916 0.0195  0.0697  -0.0037 1516 ASN A CG  
505  O OD1 . ASN A 68  ? 0.3620 0.2943 0.2968 0.0187  0.0752  -0.0030 1516 ASN A OD1 
506  N ND2 . ASN A 68  ? 0.3901 0.3041 0.2993 0.0197  0.0695  -0.0036 1516 ASN A ND2 
507  N N   . HIS A 69  ? 0.3266 0.2483 0.2647 0.0188  0.0469  -0.0096 1517 HIS A N   
508  C CA  . HIS A 69  ? 0.3357 0.2587 0.2813 0.0171  0.0441  -0.0116 1517 HIS A CA  
509  C C   . HIS A 69  ? 0.3458 0.2732 0.2972 0.0150  0.0472  -0.0098 1517 HIS A C   
510  O O   . HIS A 69  ? 0.3374 0.2616 0.2891 0.0148  0.0458  -0.0107 1517 HIS A O   
511  C CB  . HIS A 69  ? 0.3310 0.2462 0.2708 0.0197  0.0404  -0.0146 1517 HIS A CB  
512  C CG  . HIS A 69  ? 0.3468 0.2557 0.2823 0.0212  0.0344  -0.0175 1517 HIS A CG  
513  N ND1 . HIS A 69  ? 0.3531 0.2571 0.2903 0.0220  0.0285  -0.0214 1517 HIS A ND1 
514  C CD2 . HIS A 69  ? 0.3725 0.2777 0.3018 0.0223  0.0321  -0.0172 1517 HIS A CD2 
515  C CE1 . HIS A 69  ? 0.3791 0.2768 0.3123 0.0239  0.0220  -0.0239 1517 HIS A CE1 
516  N NE2 . HIS A 69  ? 0.3846 0.2821 0.3120 0.0241  0.0238  -0.0213 1517 HIS A NE2 
517  N N   . LYS A 70  ? 0.3524 0.2853 0.3077 0.0134  0.0500  -0.0072 1518 LYS A N   
518  C CA  . LYS A 70  ? 0.3771 0.3115 0.3357 0.0121  0.0513  -0.0054 1518 LYS A CA  
519  C C   . LYS A 70  ? 0.4005 0.3355 0.3625 0.0072  0.0508  -0.0053 1518 LYS A C   
520  O O   . LYS A 70  ? 0.4512 0.3834 0.4121 0.0055  0.0507  -0.0038 1518 LYS A O   
521  C CB  . LYS A 70  ? 0.3795 0.3184 0.3407 0.0132  0.0542  -0.0031 1518 LYS A CB  
522  C CG  . LYS A 70  ? 0.4057 0.3447 0.3648 0.0169  0.0572  -0.0037 1518 LYS A CG  
523  C CD  . LYS A 70  ? 0.4367 0.3720 0.3950 0.0197  0.0563  -0.0060 1518 LYS A CD  
524  C CE  . LYS A 70  ? 0.4783 0.4174 0.4419 0.0225  0.0602  -0.0071 1518 LYS A CE  
525  N NZ  . LYS A 70  ? 0.5194 0.4551 0.4811 0.0263  0.0606  -0.0108 1518 LYS A NZ  
526  N N   . TYR A 71  ? 0.3834 0.3209 0.3489 0.0049  0.0504  -0.0074 1519 TYR A N   
527  C CA  . TYR A 71  ? 0.3703 0.3092 0.3400 -0.0003 0.0517  -0.0087 1519 TYR A CA  
528  C C   . TYR A 71  ? 0.4202 0.3560 0.3924 -0.0024 0.0503  -0.0122 1519 TYR A C   
529  O O   . TYR A 71  ? 0.4870 0.4230 0.4620 0.0000  0.0471  -0.0153 1519 TYR A O   
530  C CB  . TYR A 71  ? 0.3451 0.2905 0.3211 -0.0018 0.0527  -0.0102 1519 TYR A CB  
531  C CG  . TYR A 71  ? 0.3190 0.2675 0.2939 -0.0002 0.0536  -0.0070 1519 TYR A CG  
532  C CD1 . TYR A 71  ? 0.2850 0.2317 0.2563 -0.0012 0.0551  -0.0038 1519 TYR A CD1 
533  C CD2 . TYR A 71  ? 0.3059 0.2575 0.2829 0.0021  0.0520  -0.0073 1519 TYR A CD2 
534  C CE1 . TYR A 71  ? 0.2770 0.2268 0.2494 0.0000  0.0553  -0.0015 1519 TYR A CE1 
535  C CE2 . TYR A 71  ? 0.2827 0.2368 0.2595 0.0030  0.0530  -0.0043 1519 TYR A CE2 
536  C CZ  . TYR A 71  ? 0.2751 0.2292 0.2508 0.0020  0.0548  -0.0016 1519 TYR A CZ  
537  O OH  . TYR A 71  ? 0.2349 0.1918 0.2124 0.0030  0.0551  0.0007  1519 TYR A OH  
538  N N   . ARG A 72  ? 0.4431 0.3746 0.4132 -0.0072 0.0523  -0.0118 1520 ARG A N   
539  C CA  . ARG A 72  ? 0.4989 0.4269 0.4720 -0.0105 0.0518  -0.0149 1520 ARG A CA  
540  C C   . ARG A 72  ? 0.4610 0.3953 0.4451 -0.0159 0.0552  -0.0196 1520 ARG A C   
541  O O   . ARG A 72  ? 0.4201 0.3551 0.4124 -0.0172 0.0537  -0.0242 1520 ARG A O   
542  C CB  . ARG A 72  ? 0.5835 0.5016 0.5474 -0.0138 0.0524  -0.0119 1520 ARG A CB  
543  C CG  . ARG A 72  ? 0.7314 0.6438 0.6967 -0.0185 0.0523  -0.0143 1520 ARG A CG  
544  C CD  . ARG A 72  ? 0.8424 0.7438 0.7966 -0.0247 0.0545  -0.0110 1520 ARG A CD  
545  N NE  . ARG A 72  ? 0.9304 0.8230 0.8829 -0.0280 0.0528  -0.0119 1520 ARG A NE  
546  C CZ  . ARG A 72  ? 1.0624 0.9477 1.0098 -0.0232 0.0466  -0.0107 1520 ARG A CZ  
547  N NH1 . ARG A 72  ? 1.0454 0.9317 0.9896 -0.0152 0.0425  -0.0088 1520 ARG A NH1 
548  N NH2 . ARG A 72  ? 1.1374 1.0142 1.0837 -0.0269 0.0449  -0.0118 1520 ARG A NH2 
549  N N   . SER A 73  ? 0.4380 0.3765 0.4230 -0.0191 0.0597  -0.0193 1521 SER A N   
550  C CA  . SER A 73  ? 0.4190 0.3644 0.4158 -0.0246 0.0644  -0.0250 1521 SER A CA  
551  C C   . SER A 73  ? 0.3999 0.3530 0.4013 -0.0225 0.0648  -0.0259 1521 SER A C   
552  O O   . SER A 73  ? 0.4303 0.3823 0.4239 -0.0187 0.0630  -0.0211 1521 SER A O   
553  C CB  . SER A 73  ? 0.4586 0.3986 0.4498 -0.0336 0.0720  -0.0248 1521 SER A CB  
554  O OG  . SER A 73  ? 0.4918 0.4246 0.4675 -0.0341 0.0730  -0.0188 1521 SER A OG  
555  N N   . LEU A 74  ? 0.3742 0.3356 0.3903 -0.0248 0.0667  -0.0328 1522 LEU A N   
556  C CA  . LEU A 74  ? 0.3855 0.3537 0.4064 -0.0240 0.0678  -0.0346 1522 LEU A CA  
557  C C   . LEU A 74  ? 0.3522 0.3164 0.3604 -0.0281 0.0739  -0.0301 1522 LEU A C   
558  O O   . LEU A 74  ? 0.3172 0.2833 0.3224 -0.0252 0.0726  -0.0278 1522 LEU A O   
559  C CB  . LEU A 74  ? 0.4054 0.3831 0.4463 -0.0266 0.0695  -0.0443 1522 LEU A CB  
560  C CG  . LEU A 74  ? 0.4034 0.3845 0.4580 -0.0211 0.0605  -0.0497 1522 LEU A CG  
561  C CD1 . LEU A 74  ? 0.3715 0.3631 0.4493 -0.0229 0.0611  -0.0608 1522 LEU A CD1 
562  C CD2 . LEU A 74  ? 0.4110 0.3888 0.4574 -0.0134 0.0522  -0.0450 1522 LEU A CD2 
563  N N   . ASN A 75  ? 0.3330 0.2897 0.3321 -0.0345 0.0795  -0.0287 1523 ASN A N   
564  C CA  . ASN A 75  ? 0.3537 0.3016 0.3359 -0.0377 0.0829  -0.0236 1523 ASN A CA  
565  C C   . ASN A 75  ? 0.3642 0.3064 0.3351 -0.0315 0.0764  -0.0162 1523 ASN A C   
566  O O   . ASN A 75  ? 0.3553 0.2951 0.3188 -0.0311 0.0764  -0.0136 1523 ASN A O   
567  C CB  . ASN A 75  ? 0.3743 0.3109 0.3451 -0.0462 0.0889  -0.0229 1523 ASN A CB  
568  C CG  . ASN A 75  ? 0.3878 0.3292 0.3673 -0.0547 0.0990  -0.0304 1523 ASN A CG  
569  O OD1 . ASN A 75  ? 0.3572 0.3109 0.3519 -0.0537 0.1010  -0.0366 1523 ASN A OD1 
570  N ND2 . ASN A 75  ? 0.4184 0.3497 0.3886 -0.0636 0.1058  -0.0303 1523 ASN A ND2 
571  N N   . ASP A 76  ? 0.3210 0.2610 0.2913 -0.0269 0.0710  -0.0137 1524 ASP A N   
572  C CA  . ASP A 76  ? 0.3697 0.3070 0.3341 -0.0209 0.0658  -0.0085 1524 ASP A CA  
573  C C   . ASP A 76  ? 0.3154 0.2617 0.2873 -0.0160 0.0637  -0.0088 1524 ASP A C   
574  O O   . ASP A 76  ? 0.3286 0.2737 0.2965 -0.0136 0.0619  -0.0053 1524 ASP A O   
575  C CB  . ASP A 76  ? 0.4112 0.3446 0.3739 -0.0172 0.0618  -0.0070 1524 ASP A CB  
576  C CG  . ASP A 76  ? 0.4885 0.4112 0.4428 -0.0220 0.0627  -0.0063 1524 ASP A CG  
577  O OD1 . ASP A 76  ? 0.5523 0.4653 0.4949 -0.0250 0.0630  -0.0033 1524 ASP A OD1 
578  O OD2 . ASP A 76  ? 0.6012 0.5236 0.5598 -0.0230 0.0626  -0.0089 1524 ASP A OD2 
579  N N   . LEU A 77  ? 0.2978 0.2517 0.2805 -0.0146 0.0630  -0.0129 1525 LEU A N   
580  C CA  . LEU A 77  ? 0.2965 0.2565 0.2846 -0.0109 0.0605  -0.0131 1525 LEU A CA  
581  C C   . LEU A 77  ? 0.2950 0.2571 0.2828 -0.0135 0.0633  -0.0135 1525 LEU A C   
582  O O   . LEU A 77  ? 0.2925 0.2545 0.2775 -0.0110 0.0614  -0.0100 1525 LEU A O   
583  C CB  . LEU A 77  ? 0.2888 0.2540 0.2877 -0.0092 0.0576  -0.0185 1525 LEU A CB  
584  C CG  . LEU A 77  ? 0.2945 0.2636 0.2978 -0.0059 0.0539  -0.0190 1525 LEU A CG  
585  C CD1 . LEU A 77  ? 0.2679 0.2339 0.2630 -0.0023 0.0521  -0.0127 1525 LEU A CD1 
586  C CD2 . LEU A 77  ? 0.3278 0.2980 0.3395 -0.0034 0.0485  -0.0243 1525 LEU A CD2 
587  N N   . GLU A 78  ? 0.2897 0.2530 0.2800 -0.0190 0.0683  -0.0180 1526 GLU A N   
588  C CA  . GLU A 78  ? 0.2912 0.2554 0.2795 -0.0218 0.0717  -0.0192 1526 GLU A CA  
589  C C   . GLU A 78  ? 0.3111 0.2665 0.2851 -0.0216 0.0705  -0.0130 1526 GLU A C   
590  O O   . GLU A 78  ? 0.3028 0.2588 0.2754 -0.0199 0.0688  -0.0118 1526 GLU A O   
591  C CB  . GLU A 78  ? 0.3081 0.2728 0.2986 -0.0291 0.0796  -0.0252 1526 GLU A CB  
592  C CG  . GLU A 78  ? 0.3151 0.2784 0.2998 -0.0330 0.0847  -0.0270 1526 GLU A CG  
593  C CD  . GLU A 78  ? 0.3689 0.3364 0.3607 -0.0401 0.0940  -0.0353 1526 GLU A CD  
594  O OE1 . GLU A 78  ? 0.3838 0.3609 0.3939 -0.0402 0.0948  -0.0421 1526 GLU A OE1 
595  O OE2 . GLU A 78  ? 0.3858 0.3465 0.3649 -0.0455 0.1005  -0.0356 1526 GLU A OE2 
596  N N   . LYS A 79  ? 0.3315 0.2777 0.2952 -0.0230 0.0703  -0.0096 1527 LYS A N   
597  C CA  . LYS A 79  ? 0.3583 0.2944 0.3093 -0.0222 0.0671  -0.0045 1527 LYS A CA  
598  C C   . LYS A 79  ? 0.3490 0.2890 0.3050 -0.0157 0.0613  -0.0014 1527 LYS A C   
599  O O   . LYS A 79  ? 0.3095 0.2456 0.2607 -0.0149 0.0587  0.0005  1527 LYS A O   
600  C CB  . LYS A 79  ? 0.4085 0.3348 0.3509 -0.0235 0.0659  -0.0021 1527 LYS A CB  
601  C CG  . LYS A 79  ? 0.4683 0.3824 0.3986 -0.0219 0.0605  0.0023  1527 LYS A CG  
602  C CD  . LYS A 79  ? 0.5187 0.4197 0.4371 -0.0257 0.0604  0.0036  1527 LYS A CD  
603  C CE  . LYS A 79  ? 0.5797 0.4628 0.4782 -0.0298 0.0586  0.0061  1527 LYS A CE  
604  N NZ  . LYS A 79  ? 0.6754 0.5545 0.5741 -0.0230 0.0489  0.0090  1527 LYS A NZ  
605  N N   . ASP A 80  ? 0.3113 0.2585 0.2767 -0.0115 0.0596  -0.0013 1528 ASP A N   
606  C CA  . ASP A 80  ? 0.3021 0.2529 0.2723 -0.0067 0.0561  0.0012  1528 ASP A CA  
607  C C   . ASP A 80  ? 0.2742 0.2312 0.2504 -0.0062 0.0558  0.0001  1528 ASP A C   
608  O O   . ASP A 80  ? 0.2620 0.2196 0.2400 -0.0041 0.0532  0.0023  1528 ASP A O   
609  C CB  . ASP A 80  ? 0.3149 0.2690 0.2897 -0.0032 0.0555  0.0015  1528 ASP A CB  
610  C CG  . ASP A 80  ? 0.3556 0.3074 0.3302 0.0000  0.0535  0.0042  1528 ASP A CG  
611  O OD1 . ASP A 80  ? 0.3936 0.3399 0.3647 -0.0001 0.0511  0.0055  1528 ASP A OD1 
612  O OD2 . ASP A 80  ? 0.3294 0.2837 0.3068 0.0029  0.0541  0.0043  1528 ASP A OD2 
613  N N   . VAL A 81  ? 0.2605 0.2224 0.2417 -0.0078 0.0577  -0.0039 1529 VAL A N   
614  C CA  . VAL A 81  ? 0.2510 0.2178 0.2378 -0.0074 0.0567  -0.0059 1529 VAL A CA  
615  C C   . VAL A 81  ? 0.2422 0.2050 0.2227 -0.0097 0.0575  -0.0058 1529 VAL A C   
616  O O   . VAL A 81  ? 0.2218 0.1857 0.2044 -0.0078 0.0545  -0.0046 1529 VAL A O   
617  C CB  . VAL A 81  ? 0.2654 0.2379 0.2606 -0.0084 0.0578  -0.0119 1529 VAL A CB  
618  C CG1 . VAL A 81  ? 0.2786 0.2556 0.2801 -0.0078 0.0562  -0.0150 1529 VAL A CG1 
619  C CG2 . VAL A 81  ? 0.2902 0.2641 0.2898 -0.0055 0.0547  -0.0121 1529 VAL A CG2 
620  N N   . MET A 82  ? 0.2603 0.2170 0.2319 -0.0141 0.0615  -0.0072 1530 MET A N   
621  C CA  . MET A 82  ? 0.2829 0.2326 0.2443 -0.0167 0.0623  -0.0072 1530 MET A CA  
622  C C   . MET A 82  ? 0.2953 0.2377 0.2506 -0.0136 0.0560  -0.0019 1530 MET A C   
623  O O   . MET A 82  ? 0.3168 0.2555 0.2680 -0.0131 0.0532  -0.0016 1530 MET A O   
624  C CB  . MET A 82  ? 0.3208 0.2623 0.2702 -0.0232 0.0686  -0.0093 1530 MET A CB  
625  C CG  . MET A 82  ? 0.3461 0.2962 0.3052 -0.0268 0.0755  -0.0163 1530 MET A CG  
626  S SD  . MET A 82  ? 0.3575 0.3169 0.3269 -0.0257 0.0763  -0.0222 1530 MET A SD  
627  C CE  . MET A 82  ? 0.3718 0.3436 0.3596 -0.0280 0.0818  -0.0315 1530 MET A CE  
628  N N   . LEU A 83  ? 0.3124 0.2526 0.2680 -0.0113 0.0534  0.0012  1531 LEU A N   
629  C CA  . LEU A 83  ? 0.3077 0.2438 0.2635 -0.0075 0.0470  0.0046  1531 LEU A CA  
630  C C   . LEU A 83  ? 0.2731 0.2181 0.2420 -0.0038 0.0443  0.0053  1531 LEU A C   
631  O O   . LEU A 83  ? 0.2825 0.2242 0.2519 -0.0020 0.0394  0.0065  1531 LEU A O   
632  C CB  . LEU A 83  ? 0.3318 0.2657 0.2884 -0.0057 0.0457  0.0064  1531 LEU A CB  
633  C CG  . LEU A 83  ? 0.3573 0.2881 0.3180 -0.0014 0.0392  0.0084  1531 LEU A CG  
634  C CD1 . LEU A 83  ? 0.3511 0.2676 0.2995 -0.0021 0.0331  0.0092  1531 LEU A CD1 
635  C CD2 . LEU A 83  ? 0.3716 0.3024 0.3344 0.0002  0.0397  0.0085  1531 LEU A CD2 
636  N N   . LEU A 84  ? 0.2440 0.1985 0.2225 -0.0027 0.0467  0.0046  1532 LEU A N   
637  C CA  . LEU A 84  ? 0.2295 0.1903 0.2177 -0.0005 0.0447  0.0054  1532 LEU A CA  
638  C C   . LEU A 84  ? 0.2303 0.1896 0.2168 -0.0014 0.0425  0.0040  1532 LEU A C   
639  O O   . LEU A 84  ? 0.2270 0.1859 0.2176 0.0002  0.0384  0.0053  1532 LEU A O   
640  C CB  . LEU A 84  ? 0.2213 0.1883 0.2147 -0.0002 0.0470  0.0044  1532 LEU A CB  
641  C CG  . LEU A 84  ? 0.2113 0.1821 0.2119 0.0012  0.0454  0.0059  1532 LEU A CG  
642  C CD1 . LEU A 84  ? 0.2275 0.1995 0.2279 0.0017  0.0470  0.0058  1532 LEU A CD1 
643  C CD2 . LEU A 84  ? 0.2096 0.1819 0.2130 0.0009  0.0426  0.0042  1532 LEU A CD2 
644  N N   . CYS A 85  ? 0.2376 0.1961 0.2189 -0.0041 0.0455  0.0005  1533 CYS A N   
645  C CA  . CYS A 85  ? 0.2533 0.2105 0.2325 -0.0049 0.0442  -0.0019 1533 CYS A CA  
646  C C   . CYS A 85  ? 0.2589 0.2052 0.2270 -0.0052 0.0406  -0.0002 1533 CYS A C   
647  O O   . CYS A 85  ? 0.2532 0.1980 0.2228 -0.0035 0.0358  0.0000  1533 CYS A O   
648  C CB  . CYS A 85  ? 0.2770 0.2370 0.2550 -0.0081 0.0497  -0.0075 1533 CYS A CB  
649  S SG  . CYS A 85  ? 0.3076 0.2785 0.2999 -0.0067 0.0505  -0.0108 1533 CYS A SG  
650  N N   . GLN A 86  ? 0.2723 0.2095 0.2287 -0.0071 0.0416  0.0009  1534 GLN A N   
651  C CA  . GLN A 86  ? 0.3141 0.2374 0.2578 -0.0069 0.0358  0.0027  1534 GLN A CA  
652  C C   . GLN A 86  ? 0.2910 0.2156 0.2455 -0.0020 0.0277  0.0051  1534 GLN A C   
653  O O   . GLN A 86  ? 0.2963 0.2138 0.2473 -0.0006 0.0213  0.0052  1534 GLN A O   
654  C CB  . GLN A 86  ? 0.3539 0.2662 0.2843 -0.0093 0.0368  0.0042  1534 GLN A CB  
655  C CG  . GLN A 86  ? 0.4292 0.3231 0.3432 -0.0091 0.0293  0.0061  1534 GLN A CG  
656  C CD  . GLN A 86  ? 0.5181 0.4011 0.4214 -0.0106 0.0285  0.0080  1534 GLN A CD  
657  O OE1 . GLN A 86  ? 0.5562 0.4422 0.4580 -0.0141 0.0357  0.0074  1534 GLN A OE1 
658  N NE2 . GLN A 86  ? 0.6062 0.4764 0.5041 -0.0075 0.0183  0.0099  1534 GLN A NE2 
659  N N   . ASN A 87  ? 0.2695 0.2029 0.2376 0.0002  0.0282  0.0066  1535 ASN A N   
660  C CA  . ASN A 87  ? 0.2667 0.2039 0.2489 0.0040  0.0229  0.0079  1535 ASN A CA  
661  C C   . ASN A 87  ? 0.2488 0.1921 0.2406 0.0048  0.0211  0.0075  1535 ASN A C   
662  O O   . ASN A 87  ? 0.2356 0.1765 0.2335 0.0070  0.0143  0.0076  1535 ASN A O   
663  C CB  . ASN A 87  ? 0.2533 0.1997 0.2471 0.0052  0.0270  0.0088  1535 ASN A CB  
664  C CG  . ASN A 87  ? 0.2754 0.2159 0.2641 0.0058  0.0264  0.0091  1535 ASN A CG  
665  O OD1 . ASN A 87  ? 0.2673 0.1955 0.2448 0.0058  0.0211  0.0090  1535 ASN A OD1 
666  N ND2 . ASN A 87  ? 0.2647 0.2124 0.2607 0.0067  0.0310  0.0092  1535 ASN A ND2 
667  N N   . ALA A 88  ? 0.2397 0.1901 0.2332 0.0032  0.0260  0.0065  1536 ALA A N   
668  C CA  . ALA A 88  ? 0.2287 0.1828 0.2291 0.0038  0.0234  0.0058  1536 ALA A CA  
669  C C   . ALA A 88  ? 0.2445 0.1897 0.2359 0.0039  0.0182  0.0041  1536 ALA A C   
670  O O   . ALA A 88  ? 0.2448 0.1903 0.2438 0.0057  0.0126  0.0043  1536 ALA A O   
671  C CB  . ALA A 88  ? 0.2209 0.1820 0.2238 0.0025  0.0278  0.0042  1536 ALA A CB  
672  N N   . GLN A 89  ? 0.2561 0.1927 0.2309 0.0017  0.0203  0.0024  1537 GLN A N   
673  C CA  . GLN A 89  ? 0.2764 0.2017 0.2380 0.0013  0.0161  0.0005  1537 GLN A CA  
674  C C   . GLN A 89  ? 0.2955 0.2088 0.2525 0.0038  0.0065  0.0023  1537 GLN A C   
675  O O   . GLN A 89  ? 0.2980 0.2021 0.2485 0.0050  -0.0003 0.0012  1537 GLN A O   
676  C CB  . GLN A 89  ? 0.2946 0.2132 0.2382 -0.0030 0.0231  -0.0023 1537 GLN A CB  
677  C CG  . GLN A 89  ? 0.2964 0.2268 0.2474 -0.0047 0.0305  -0.0065 1537 GLN A CG  
678  C CD  . GLN A 89  ? 0.3135 0.2431 0.2557 -0.0094 0.0399  -0.0091 1537 GLN A CD  
679  O OE1 . GLN A 89  ? 0.3414 0.2581 0.2650 -0.0129 0.0422  -0.0094 1537 GLN A OE1 
680  N NE2 . GLN A 89  ? 0.2907 0.2325 0.2455 -0.0098 0.0448  -0.0113 1537 GLN A NE2 
681  N N   . THR A 90  ? 0.3075 0.2203 0.2691 0.0051  0.0049  0.0046  1538 THR A N   
682  C CA  . THR A 90  ? 0.3254 0.2279 0.2874 0.0083  -0.0056 0.0053  1538 THR A CA  
683  C C   . THR A 90  ? 0.3121 0.2242 0.2975 0.0118  -0.0111 0.0051  1538 THR A C   
684  O O   . THR A 90  ? 0.3108 0.2146 0.2969 0.0143  -0.0211 0.0041  1538 THR A O   
685  C CB  . THR A 90  ? 0.3348 0.2347 0.2965 0.0088  -0.0055 0.0066  1538 THR A CB  
686  O OG1 . THR A 90  ? 0.3627 0.2512 0.3013 0.0049  -0.0011 0.0069  1538 THR A OG1 
687  C CG2 . THR A 90  ? 0.3538 0.2446 0.3211 0.0132  -0.0179 0.0061  1538 THR A CG2 
688  N N   . PHE A 91  ? 0.3004 0.2286 0.3042 0.0115  -0.0047 0.0060  1539 PHE A N   
689  C CA  . PHE A 91  ? 0.2967 0.2341 0.3230 0.0133  -0.0075 0.0059  1539 PHE A CA  
690  C C   . PHE A 91  ? 0.3024 0.2409 0.3315 0.0131  -0.0105 0.0053  1539 PHE A C   
691  O O   . PHE A 91  ? 0.2950 0.2335 0.3373 0.0151  -0.0178 0.0044  1539 PHE A O   
692  C CB  . PHE A 91  ? 0.2895 0.2407 0.3303 0.0121  0.0012  0.0072  1539 PHE A CB  
693  C CG  . PHE A 91  ? 0.3088 0.2686 0.3719 0.0125  0.0002  0.0070  1539 PHE A CG  
694  C CD1 . PHE A 91  ? 0.3158 0.2759 0.3947 0.0151  -0.0055 0.0048  1539 PHE A CD1 
695  C CD2 . PHE A 91  ? 0.2985 0.2653 0.3679 0.0101  0.0045  0.0085  1539 PHE A CD2 
696  C CE1 . PHE A 91  ? 0.3256 0.2945 0.4275 0.0146  -0.0051 0.0038  1539 PHE A CE1 
697  C CE2 . PHE A 91  ? 0.3087 0.2821 0.3978 0.0093  0.0044  0.0085  1539 PHE A CE2 
698  C CZ  . PHE A 91  ? 0.3166 0.2919 0.4229 0.0112  0.0004  0.0060  1539 PHE A CZ  
699  N N   . ASN A 92  ? 0.2833 0.2234 0.3025 0.0109  -0.0052 0.0050  1540 ASN A N   
700  C CA  . ASN A 92  ? 0.2744 0.2164 0.2974 0.0109  -0.0078 0.0040  1540 ASN A CA  
701  C C   . ASN A 92  ? 0.3102 0.2399 0.3159 0.0115  -0.0129 0.0013  1540 ASN A C   
702  O O   . ASN A 92  ? 0.3086 0.2294 0.2965 0.0104  -0.0109 0.0006  1540 ASN A O   
703  C CB  . ASN A 92  ? 0.2521 0.2032 0.2771 0.0088  -0.0002 0.0042  1540 ASN A CB  
704  C CG  . ASN A 92  ? 0.2333 0.1934 0.2704 0.0077  0.0052  0.0070  1540 ASN A CG  
705  O OD1 . ASN A 92  ? 0.2216 0.1864 0.2726 0.0073  0.0042  0.0086  1540 ASN A OD1 
706  N ND2 . ASN A 92  ? 0.2334 0.1951 0.2644 0.0067  0.0115  0.0075  1540 ASN A ND2 
707  N N   . LEU A 93  ? 0.3373 0.2653 0.3468 0.0129  -0.0190 -0.0001 1541 LEU A N   
708  C CA  . LEU A 93  ? 0.3691 0.2836 0.3603 0.0136  -0.0241 -0.0031 1541 LEU A CA  
709  C C   . LEU A 93  ? 0.3386 0.2536 0.3160 0.0111  -0.0161 -0.0063 1541 LEU A C   
710  O O   . LEU A 93  ? 0.3182 0.2447 0.3055 0.0102  -0.0108 -0.0072 1541 LEU A O   
711  C CB  . LEU A 93  ? 0.4431 0.3560 0.4446 0.0162  -0.0340 -0.0043 1541 LEU A CB  
712  C CG  . LEU A 93  ? 0.5082 0.4157 0.5203 0.0192  -0.0448 -0.0033 1541 LEU A CG  
713  C CD1 . LEU A 93  ? 0.5318 0.4533 0.5726 0.0191  -0.0447 -0.0015 1541 LEU A CD1 
714  C CD2 . LEU A 93  ? 0.5313 0.4236 0.5338 0.0221  -0.0572 -0.0061 1541 LEU A CD2 
715  N N   . GLU A 94  ? 0.3438 0.2451 0.2983 0.0098  -0.0155 -0.0087 1542 GLU A N   
716  C CA  . GLU A 94  ? 0.3362 0.2368 0.2778 0.0071  -0.0076 -0.0135 1542 GLU A CA  
717  C C   . GLU A 94  ? 0.3232 0.2275 0.2733 0.0095  -0.0122 -0.0169 1542 GLU A C   
718  O O   . GLU A 94  ? 0.3377 0.2346 0.2884 0.0124  -0.0223 -0.0164 1542 GLU A O   
719  C CB  . GLU A 94  ? 0.3679 0.2492 0.2801 0.0045  -0.0063 -0.0149 1542 GLU A CB  
720  C CG  . GLU A 94  ? 0.3985 0.2786 0.2963 0.0003  0.0045  -0.0208 1542 GLU A CG  
721  C CD  . GLU A 94  ? 0.4639 0.3246 0.3306 -0.0044 0.0095  -0.0215 1542 GLU A CD  
722  O OE1 . GLU A 94  ? 0.5215 0.3654 0.3732 -0.0039 0.0020  -0.0173 1542 GLU A OE1 
723  O OE2 . GLU A 94  ? 0.4656 0.3270 0.3226 -0.0090 0.0210  -0.0270 1542 GLU A OE2 
724  N N   . GLY A 95  ? 0.2910 0.2067 0.2494 0.0087  -0.0060 -0.0207 1543 GLY A N   
725  C CA  . GLY A 95  ? 0.2806 0.2010 0.2503 0.0113  -0.0112 -0.0238 1543 GLY A CA  
726  C C   . GLY A 95  ? 0.2590 0.1919 0.2518 0.0126  -0.0140 -0.0204 1543 GLY A C   
727  O O   . GLY A 95  ? 0.2515 0.1879 0.2537 0.0144  -0.0182 -0.0227 1543 GLY A O   
728  N N   . SER A 96  ? 0.2471 0.1846 0.2471 0.0116  -0.0118 -0.0148 1544 SER A N   
729  C CA  . SER A 96  ? 0.2382 0.1851 0.2556 0.0117  -0.0124 -0.0113 1544 SER A CA  
730  C C   . SER A 96  ? 0.2239 0.1785 0.2430 0.0103  -0.0054 -0.0136 1544 SER A C   
731  O O   . SER A 96  ? 0.2224 0.1772 0.2323 0.0088  0.0014  -0.0167 1544 SER A O   
732  C CB  . SER A 96  ? 0.2395 0.1875 0.2644 0.0112  -0.0131 -0.0053 1544 SER A CB  
733  O OG  . SER A 96  ? 0.2516 0.2003 0.2697 0.0096  -0.0062 -0.0039 1544 SER A OG  
734  N N   . LEU A 97  ? 0.2078 0.1675 0.2386 0.0107  -0.0077 -0.0124 1545 LEU A N   
735  C CA  . LEU A 97  ? 0.2003 0.1655 0.2336 0.0101  -0.0035 -0.0145 1545 LEU A CA  
736  C C   . LEU A 97  ? 0.2051 0.1727 0.2352 0.0082  0.0034  -0.0112 1545 LEU A C   
737  O O   . LEU A 97  ? 0.2017 0.1724 0.2290 0.0074  0.0086  -0.0148 1545 LEU A O   
738  C CB  . LEU A 97  ? 0.1940 0.1600 0.2373 0.0108  -0.0091 -0.0127 1545 LEU A CB  
739  C CG  . LEU A 97  ? 0.1854 0.1543 0.2312 0.0110  -0.0082 -0.0152 1545 LEU A CG  
740  C CD1 . LEU A 97  ? 0.1844 0.1566 0.2306 0.0126  -0.0069 -0.0245 1545 LEU A CD1 
741  C CD2 . LEU A 97  ? 0.1916 0.1565 0.2432 0.0112  -0.0155 -0.0122 1545 LEU A CD2 
742  N N   . ILE A 98  ? 0.2091 0.1757 0.2412 0.0074  0.0034  -0.0051 1546 ILE A N   
743  C CA  . ILE A 98  ? 0.2115 0.1802 0.2412 0.0060  0.0096  -0.0022 1546 ILE A CA  
744  C C   . ILE A 98  ? 0.2016 0.1684 0.2208 0.0052  0.0142  -0.0048 1546 ILE A C   
745  O O   . ILE A 98  ? 0.1937 0.1629 0.2097 0.0041  0.0197  -0.0061 1546 ILE A O   
746  C CB  . ILE A 98  ? 0.2226 0.1912 0.2583 0.0053  0.0094  0.0035  1546 ILE A CB  
747  C CG1 . ILE A 98  ? 0.2256 0.1960 0.2579 0.0044  0.0158  0.0054  1546 ILE A CG1 
748  C CG2 . ILE A 98  ? 0.2367 0.2017 0.2744 0.0064  0.0046  0.0039  1546 ILE A CG2 
749  C CD1 . ILE A 98  ? 0.2372 0.2095 0.2773 0.0033  0.0178  0.0099  1546 ILE A CD1 
750  N N   . TYR A 99  ? 0.2048 0.1655 0.2173 0.0057  0.0116  -0.0056 1547 TYR A N   
751  C CA  . TYR A 99  ? 0.2271 0.1819 0.2252 0.0040  0.0157  -0.0080 1547 TYR A CA  
752  C C   . TYR A 99  ? 0.2215 0.1800 0.2167 0.0023  0.0219  -0.0139 1547 TYR A C   
753  O O   . TYR A 99  ? 0.2281 0.1869 0.2176 0.0000  0.0283  -0.0149 1547 TYR A O   
754  C CB  . TYR A 99  ? 0.2514 0.1961 0.2400 0.0049  0.0102  -0.0090 1547 TYR A CB  
755  C CG  . TYR A 99  ? 0.2796 0.2132 0.2488 0.0028  0.0130  -0.0104 1547 TYR A CG  
756  C CD1 . TYR A 99  ? 0.3049 0.2364 0.2631 0.0001  0.0195  -0.0159 1547 TYR A CD1 
757  C CD2 . TYR A 99  ? 0.2917 0.2151 0.2529 0.0034  0.0085  -0.0067 1547 TYR A CD2 
758  C CE1 . TYR A 99  ? 0.3442 0.2627 0.2812 -0.0029 0.0226  -0.0170 1547 TYR A CE1 
759  C CE2 . TYR A 99  ? 0.3430 0.2521 0.2823 0.0009  0.0099  -0.0075 1547 TYR A CE2 
760  C CZ  . TYR A 99  ? 0.3584 0.2647 0.2844 -0.0027 0.0178  -0.0123 1547 TYR A CZ  
761  O OH  . TYR A 99  ? 0.4194 0.3094 0.3205 -0.0064 0.0207  -0.0132 1547 TYR A OH  
762  N N   . GLU A 100 ? 0.2145 0.1764 0.2157 0.0036  0.0197  -0.0185 1548 GLU A N   
763  C CA  . GLU A 100 ? 0.2217 0.1880 0.2234 0.0022  0.0252  -0.0262 1548 GLU A CA  
764  C C   . GLU A 100 ? 0.2029 0.1772 0.2146 0.0021  0.0278  -0.0267 1548 GLU A C   
765  O O   . GLU A 100 ? 0.2042 0.1822 0.2163 0.0000  0.0342  -0.0319 1548 GLU A O   
766  C CB  . GLU A 100 ? 0.2219 0.1898 0.2293 0.0045  0.0209  -0.0322 1548 GLU A CB  
767  C CG  . GLU A 100 ? 0.2438 0.2138 0.2482 0.0025  0.0282  -0.0420 1548 GLU A CG  
768  C CD  . GLU A 100 ? 0.2750 0.2348 0.2590 -0.0011 0.0344  -0.0425 1548 GLU A CD  
769  O OE1 . GLU A 100 ? 0.2917 0.2413 0.2644 -0.0005 0.0295  -0.0366 1548 GLU A OE1 
770  O OE2 . GLU A 100 ? 0.3145 0.2755 0.2937 -0.0049 0.0441  -0.0488 1548 GLU A OE2 
771  N N   . ASP A 101 ? 0.2050 0.1813 0.2249 0.0041  0.0226  -0.0220 1549 ASP A N   
772  C CA  . ASP A 101 ? 0.2059 0.1863 0.2316 0.0042  0.0238  -0.0220 1549 ASP A CA  
773  C C   . ASP A 101 ? 0.1985 0.1786 0.2174 0.0016  0.0308  -0.0204 1549 ASP A C   
774  O O   . ASP A 101 ? 0.2017 0.1856 0.2241 0.0009  0.0339  -0.0241 1549 ASP A O   
775  C CB  . ASP A 101 ? 0.2120 0.1908 0.2420 0.0056  0.0181  -0.0160 1549 ASP A CB  
776  C CG  . ASP A 101 ? 0.2405 0.2188 0.2779 0.0079  0.0104  -0.0186 1549 ASP A CG  
777  O OD1 . ASP A 101 ? 0.2601 0.2412 0.3023 0.0091  0.0091  -0.0263 1549 ASP A OD1 
778  O OD2 . ASP A 101 ? 0.2706 0.2451 0.3095 0.0081  0.0057  -0.0133 1549 ASP A OD2 
779  N N   . SER A 102 ? 0.1970 0.1719 0.2070 0.0006  0.0322  -0.0154 1550 SER A N   
780  C CA  . SER A 102 ? 0.2030 0.1759 0.2061 -0.0014 0.0374  -0.0134 1550 SER A CA  
781  C C   . SER A 102 ? 0.2050 0.1770 0.2016 -0.0048 0.0439  -0.0194 1550 SER A C   
782  O O   . SER A 102 ? 0.2046 0.1782 0.2006 -0.0070 0.0491  -0.0210 1550 SER A O   
783  C CB  . SER A 102 ? 0.1940 0.1606 0.1906 -0.0011 0.0353  -0.0075 1550 SER A CB  
784  O OG  . SER A 102 ? 0.2086 0.1678 0.1948 -0.0022 0.0348  -0.0091 1550 SER A OG  
785  N N   . ILE A 103 ? 0.2204 0.1897 0.2124 -0.0055 0.0441  -0.0233 1551 ILE A N   
786  C CA  . ILE A 103 ? 0.2481 0.2158 0.2329 -0.0097 0.0521  -0.0297 1551 ILE A CA  
787  C C   . ILE A 103 ? 0.2380 0.2166 0.2376 -0.0102 0.0560  -0.0371 1551 ILE A C   
788  O O   . ILE A 103 ? 0.2289 0.2090 0.2277 -0.0141 0.0635  -0.0403 1551 ILE A O   
789  C CB  . ILE A 103 ? 0.2780 0.2407 0.2554 -0.0100 0.0517  -0.0337 1551 ILE A CB  
790  C CG1 . ILE A 103 ? 0.3085 0.2572 0.2683 -0.0099 0.0474  -0.0278 1551 ILE A CG1 
791  C CG2 . ILE A 103 ? 0.2934 0.2575 0.2675 -0.0146 0.0618  -0.0427 1551 ILE A CG2 
792  C CD1 . ILE A 103 ? 0.3297 0.2666 0.2704 -0.0144 0.0525  -0.0256 1551 ILE A CD1 
793  N N   . VAL A 104 ? 0.2286 0.2139 0.2423 -0.0063 0.0501  -0.0400 1552 VAL A N   
794  C CA  . VAL A 104 ? 0.2240 0.2189 0.2542 -0.0056 0.0508  -0.0483 1552 VAL A CA  
795  C C   . VAL A 104 ? 0.2319 0.2292 0.2669 -0.0056 0.0508  -0.0461 1552 VAL A C   
796  O O   . VAL A 104 ? 0.2434 0.2465 0.2881 -0.0071 0.0546  -0.0531 1552 VAL A O   
797  C CB  . VAL A 104 ? 0.2251 0.2230 0.2669 -0.0006 0.0413  -0.0505 1552 VAL A CB  
798  C CG1 . VAL A 104 ? 0.2298 0.2351 0.2887 0.0013  0.0383  -0.0578 1552 VAL A CG1 
799  C CG2 . VAL A 104 ? 0.2294 0.2267 0.2695 -0.0005 0.0419  -0.0559 1552 VAL A CG2 
800  N N   . LEU A 105 ? 0.2247 0.2172 0.2533 -0.0041 0.0469  -0.0369 1553 LEU A N   
801  C CA  . LEU A 105 ? 0.2300 0.2229 0.2604 -0.0038 0.0466  -0.0345 1553 LEU A CA  
802  C C   . LEU A 105 ? 0.2351 0.2271 0.2598 -0.0082 0.0549  -0.0355 1553 LEU A C   
803  O O   . LEU A 105 ? 0.2463 0.2410 0.2768 -0.0086 0.0558  -0.0376 1553 LEU A O   
804  C CB  . LEU A 105 ? 0.2348 0.2226 0.2592 -0.0015 0.0419  -0.0252 1553 LEU A CB  
805  C CG  . LEU A 105 ? 0.2564 0.2440 0.2872 0.0020  0.0336  -0.0245 1553 LEU A CG  
806  C CD1 . LEU A 105 ? 0.2637 0.2463 0.2885 0.0029  0.0310  -0.0157 1553 LEU A CD1 
807  C CD2 . LEU A 105 ? 0.2654 0.2544 0.3038 0.0037  0.0300  -0.0288 1553 LEU A CD2 
808  N N   . GLN A 106 ? 0.2449 0.2317 0.2575 -0.0118 0.0603  -0.0343 1554 GLN A N   
809  C CA  . GLN A 106 ? 0.2742 0.2587 0.2805 -0.0174 0.0691  -0.0367 1554 GLN A CA  
810  C C   . GLN A 106 ? 0.2800 0.2738 0.3013 -0.0199 0.0746  -0.0472 1554 GLN A C   
811  O O   . GLN A 106 ? 0.2859 0.2814 0.3112 -0.0222 0.0779  -0.0489 1554 GLN A O   
812  C CB  . GLN A 106 ? 0.2781 0.2525 0.2662 -0.0212 0.0735  -0.0347 1554 GLN A CB  
813  C CG  . GLN A 106 ? 0.2725 0.2377 0.2488 -0.0185 0.0670  -0.0255 1554 GLN A CG  
814  C CD  . GLN A 106 ? 0.2902 0.2437 0.2491 -0.0204 0.0672  -0.0238 1554 GLN A CD  
815  O OE1 . GLN A 106 ? 0.3042 0.2487 0.2534 -0.0189 0.0620  -0.0176 1554 GLN A OE1 
816  N NE2 . GLN A 106 ? 0.3375 0.2904 0.2928 -0.0234 0.0723  -0.0300 1554 GLN A NE2 
817  N N   . SER A 107 ? 0.2925 0.2925 0.3239 -0.0192 0.0750  -0.0551 1555 SER A N   
818  C CA  . SER A 107 ? 0.3094 0.3194 0.3587 -0.0215 0.0803  -0.0667 1555 SER A CA  
819  C C   . SER A 107 ? 0.3034 0.3204 0.3717 -0.0162 0.0713  -0.0700 1555 SER A C   
820  O O   . SER A 107 ? 0.3078 0.3315 0.3909 -0.0177 0.0739  -0.0777 1555 SER A O   
821  C CB  . SER A 107 ? 0.3180 0.3324 0.3721 -0.0233 0.0859  -0.0761 1555 SER A CB  
822  O OG  . SER A 107 ? 0.3353 0.3468 0.3850 -0.0188 0.0786  -0.0729 1555 SER A OG  
823  N N   . VAL A 108 ? 0.3129 0.3270 0.3801 -0.0102 0.0604  -0.0641 1556 VAL A N   
824  C CA  . VAL A 108 ? 0.3016 0.3173 0.3801 -0.0056 0.0510  -0.0654 1556 VAL A CA  
825  C C   . VAL A 108 ? 0.3088 0.3220 0.3836 -0.0075 0.0534  -0.0620 1556 VAL A C   
826  O O   . VAL A 108 ? 0.2965 0.3139 0.3852 -0.0067 0.0509  -0.0686 1556 VAL A O   
827  C CB  . VAL A 108 ? 0.3150 0.3243 0.3870 -0.0005 0.0405  -0.0577 1556 VAL A CB  
828  C CG1 . VAL A 108 ? 0.3255 0.3318 0.4033 0.0037  0.0304  -0.0578 1556 VAL A CG1 
829  C CG2 . VAL A 108 ? 0.3127 0.3241 0.3898 0.0014  0.0373  -0.0617 1556 VAL A CG2 
830  N N   . PHE A 109 ? 0.2961 0.3025 0.3535 -0.0098 0.0574  -0.0528 1557 PHE A N   
831  C CA  . PHE A 109 ? 0.3165 0.3198 0.3698 -0.0111 0.0589  -0.0496 1557 PHE A CA  
832  C C   . PHE A 109 ? 0.3466 0.3555 0.4105 -0.0161 0.0665  -0.0582 1557 PHE A C   
833  O O   . PHE A 109 ? 0.3434 0.3546 0.4176 -0.0152 0.0636  -0.0618 1557 PHE A O   
834  C CB  . PHE A 109 ? 0.3146 0.3098 0.3493 -0.0130 0.0623  -0.0399 1557 PHE A CB  
835  C CG  . PHE A 109 ? 0.3160 0.3080 0.3473 -0.0141 0.0635  -0.0375 1557 PHE A CG  
836  C CD1 . PHE A 109 ? 0.3328 0.3219 0.3627 -0.0097 0.0568  -0.0334 1557 PHE A CD1 
837  C CD2 . PHE A 109 ? 0.3284 0.3192 0.3571 -0.0200 0.0715  -0.0398 1557 PHE A CD2 
838  C CE1 . PHE A 109 ? 0.3207 0.3064 0.3473 -0.0103 0.0575  -0.0318 1557 PHE A CE1 
839  C CE2 . PHE A 109 ? 0.3171 0.3044 0.3432 -0.0210 0.0718  -0.0378 1557 PHE A CE2 
840  C CZ  . PHE A 109 ? 0.3491 0.3344 0.3749 -0.0157 0.0644  -0.0341 1557 PHE A CZ  
841  N N   . THR A 110 ? 0.3491 0.3590 0.4093 -0.0218 0.0764  -0.0612 1558 THR A N   
842  C CA  . THR A 110 ? 0.3989 0.4134 0.4680 -0.0285 0.0862  -0.0693 1558 THR A CA  
843  C C   . THR A 110 ? 0.3945 0.4212 0.4912 -0.0270 0.0842  -0.0822 1558 THR A C   
844  O O   . THR A 110 ? 0.3934 0.4243 0.5027 -0.0301 0.0875  -0.0881 1558 THR A O   
845  C CB  . THR A 110 ? 0.3919 0.4031 0.4492 -0.0357 0.0982  -0.0708 1558 THR A CB  
846  O OG1 . THR A 110 ? 0.4111 0.4249 0.4697 -0.0329 0.0963  -0.0735 1558 THR A OG1 
847  C CG2 . THR A 110 ? 0.4165 0.4135 0.4473 -0.0381 0.0997  -0.0594 1558 THR A CG2 
848  N N   . SER A 111 ? 0.3728 0.4045 0.4799 -0.0221 0.0780  -0.0869 1559 SER A N   
849  C CA  . SER A 111 ? 0.3865 0.4286 0.5211 -0.0188 0.0724  -0.0995 1559 SER A CA  
850  C C   . SER A 111 ? 0.3799 0.4196 0.5218 -0.0133 0.0601  -0.0985 1559 SER A C   
851  O O   . SER A 111 ? 0.3967 0.4427 0.5587 -0.0137 0.0589  -0.1079 1559 SER A O   
852  C CB  . SER A 111 ? 0.4046 0.4490 0.5447 -0.0135 0.0652  -0.1026 1559 SER A CB  
853  O OG  . SER A 111 ? 0.4598 0.5101 0.6034 -0.0181 0.0763  -0.1100 1559 SER A OG  
854  N N   . VAL A 112 ? 0.3595 0.3893 0.4850 -0.0083 0.0508  -0.0877 1560 VAL A N   
855  C CA  . VAL A 112 ? 0.3499 0.3738 0.4759 -0.0034 0.0394  -0.0854 1560 VAL A CA  
856  C C   . VAL A 112 ? 0.3651 0.3885 0.4909 -0.0073 0.0447  -0.0851 1560 VAL A C   
857  O O   . VAL A 112 ? 0.3967 0.4220 0.5381 -0.0055 0.0387  -0.0923 1560 VAL A O   
858  C CB  . VAL A 112 ? 0.3383 0.3506 0.4434 0.0007  0.0319  -0.0732 1560 VAL A CB  
859  C CG1 . VAL A 112 ? 0.3373 0.3409 0.4369 0.0043  0.0232  -0.0699 1560 VAL A CG1 
860  C CG2 . VAL A 112 ? 0.3458 0.3572 0.4540 0.0051  0.0237  -0.0747 1560 VAL A CG2 
861  N N   . ARG A 113 ? 0.3644 0.3843 0.4736 -0.0125 0.0548  -0.0775 1561 ARG A N   
862  C CA  . ARG A 113 ? 0.3534 0.3715 0.4608 -0.0167 0.0600  -0.0767 1561 ARG A CA  
863  C C   . ARG A 113 ? 0.3791 0.4070 0.5109 -0.0206 0.0642  -0.0895 1561 ARG A C   
864  O O   . ARG A 113 ? 0.3511 0.3785 0.4918 -0.0197 0.0597  -0.0925 1561 ARG A O   
865  C CB  . ARG A 113 ? 0.3653 0.3776 0.4526 -0.0225 0.0704  -0.0685 1561 ARG A CB  
866  C CG  . ARG A 113 ? 0.3879 0.3971 0.4732 -0.0274 0.0755  -0.0679 1561 ARG A CG  
867  C CD  . ARG A 113 ? 0.4197 0.4202 0.4837 -0.0332 0.0841  -0.0601 1561 ARG A CD  
868  N NE  . ARG A 113 ? 0.4188 0.4159 0.4826 -0.0385 0.0887  -0.0607 1561 ARG A NE  
869  C CZ  . ARG A 113 ? 0.4447 0.4311 0.4896 -0.0431 0.0936  -0.0538 1561 ARG A CZ  
870  N NH1 . ARG A 113 ? 0.4533 0.4312 0.4780 -0.0430 0.0943  -0.0458 1561 ARG A NH1 
871  N NH2 . ARG A 113 ? 0.4288 0.4120 0.4755 -0.0479 0.0968  -0.0551 1561 ARG A NH2 
872  N N   . GLN A 114 ? 0.4238 0.4606 0.5669 -0.0252 0.0734  -0.0977 1562 GLN A N   
873  C CA  . GLN A 114 ? 0.4431 0.4913 0.6123 -0.0303 0.0806  -0.1116 1562 GLN A CA  
874  C C   . GLN A 114 ? 0.4726 0.5271 0.6687 -0.0237 0.0674  -0.1220 1562 GLN A C   
875  O O   . GLN A 114 ? 0.5159 0.5751 0.7306 -0.0257 0.0674  -0.1297 1562 GLN A O   
876  C CB  . GLN A 114 ? 0.4728 0.5294 0.6494 -0.0356 0.0926  -0.1196 1562 GLN A CB  
877  C CG  . GLN A 114 ? 0.5557 0.6272 0.7692 -0.0347 0.0912  -0.1372 1562 GLN A CG  
878  C CD  . GLN A 114 ? 0.5719 0.6543 0.7999 -0.0437 0.1086  -0.1491 1562 GLN A CD  
879  O OE1 . GLN A 114 ? 0.6574 0.7406 0.8770 -0.0456 0.1158  -0.1498 1562 GLN A OE1 
880  N NE2 . GLN A 114 ? 0.6174 0.7085 0.8687 -0.0495 0.1155  -0.1597 1562 GLN A NE2 
881  N N   . LYS A 115 ? 0.4870 0.5413 0.6866 -0.0162 0.0561  -0.1233 1563 LYS A N   
882  C CA  . LYS A 115 ? 0.5045 0.5615 0.7273 -0.0090 0.0408  -0.1332 1563 LYS A CA  
883  C C   . LYS A 115 ? 0.5213 0.5691 0.7387 -0.0061 0.0313  -0.1288 1563 LYS A C   
884  O O   . LYS A 115 ? 0.4996 0.5524 0.7399 -0.0060 0.0275  -0.1391 1563 LYS A O   
885  C CB  . LYS A 115 ? 0.5204 0.5726 0.7386 -0.0013 0.0282  -0.1314 1563 LYS A CB  
886  C CG  . LYS A 115 ? 0.5452 0.6094 0.7891 -0.0001 0.0280  -0.1455 1563 LYS A CG  
887  C CD  . LYS A 115 ? 0.5974 0.6571 0.8271 0.0034  0.0244  -0.1398 1563 LYS A CD  
888  C CE  . LYS A 115 ? 0.6256 0.6686 0.8299 0.0092  0.0113  -0.1259 1563 LYS A CE  
889  N NZ  . LYS A 115 ? 0.6594 0.6939 0.8703 0.0160  -0.0065 -0.1289 1563 LYS A NZ  
890  N N   . ILE A 116 ? 0.5418 0.5765 0.7294 -0.0043 0.0289  -0.1141 1564 ILE A N   
891  C CA  . ILE A 116 ? 0.5596 0.5834 0.7370 -0.0010 0.0201  -0.1088 1564 ILE A CA  
892  C C   . ILE A 116 ? 0.5724 0.5997 0.7573 -0.0070 0.0281  -0.1116 1564 ILE A C   
893  O O   . ILE A 116 ? 0.5798 0.6042 0.7750 -0.0041 0.0188  -0.1164 1564 ILE A O   
894  C CB  . ILE A 116 ? 0.5696 0.5800 0.7143 0.0012  0.0185  -0.0933 1564 ILE A CB  
895  C CG1 . ILE A 116 ? 0.5714 0.5759 0.7085 0.0071  0.0086  -0.0905 1564 ILE A CG1 
896  C CG2 . ILE A 116 ? 0.5716 0.5712 0.7046 0.0037  0.0121  -0.0885 1564 ILE A CG2 
897  C CD1 . ILE A 116 ? 0.5912 0.5891 0.7383 0.0142  -0.0088 -0.0974 1564 ILE A CD1 
898  N N   . GLU A 117 ? 0.5451 0.5770 0.7244 -0.0153 0.0443  -0.1090 1565 GLU A N   
899  C CA  . GLU A 117 ? 0.5511 0.5859 0.7382 -0.0226 0.0534  -0.1122 1565 GLU A CA  
900  C C   . GLU A 117 ? 0.5632 0.6102 0.7865 -0.0245 0.0527  -0.1286 1565 GLU A C   
901  O O   . GLU A 117 ? 0.4923 0.5399 0.7247 -0.0284 0.0549  -0.1318 1565 GLU A O   
902  C CB  . GLU A 117 ? 0.5478 0.5830 0.7208 -0.0321 0.0708  -0.1071 1565 GLU A CB  
903  C CG  . GLU A 117 ? 0.5662 0.5880 0.7092 -0.0326 0.0718  -0.0929 1565 GLU A CG  
904  C CD  . GLU A 117 ? 0.5788 0.5970 0.7048 -0.0414 0.0864  -0.0875 1565 GLU A CD  
905  O OE1 . GLU A 117 ? 0.5999 0.6083 0.7089 -0.0440 0.0883  -0.0796 1565 GLU A OE1 
906  O OE2 . GLU A 117 ? 0.5656 0.5890 0.6937 -0.0456 0.0952  -0.0912 1565 GLU A OE2 
907  N N   . LYS A 118 ? 0.5564 0.6130 0.8013 -0.0214 0.0488  -0.1393 1566 LYS A N   
908  C CA  . LYS A 118 ? 0.5865 0.6560 0.8701 -0.0218 0.0464  -0.1567 1566 LYS A CA  
909  C C   . LYS A 118 ? 0.5485 0.6120 0.8418 -0.0107 0.0239  -0.1609 1566 LYS A C   
910  O O   . LYS A 118 ? 0.5169 0.5826 0.8323 -0.0093 0.0162  -0.1701 1566 LYS A O   
911  C CB  . LYS A 118 ? 0.6137 0.6975 0.9166 -0.0252 0.0563  -0.1676 1566 LYS A CB  
912  C CG  . LYS A 118 ? 0.6636 0.7529 0.9609 -0.0375 0.0791  -0.1672 1566 LYS A CG  
913  C CD  . LYS A 118 ? 0.7071 0.8064 1.0124 -0.0400 0.0892  -0.1746 1566 LYS A CD  
914  C CE  . LYS A 118 ? 0.7523 0.8681 1.1012 -0.0372 0.0848  -0.1949 1566 LYS A CE  
915  N NZ  . LYS A 118 ? 0.7847 0.9109 1.1423 -0.0395 0.0951  -0.2034 1566 LYS A NZ  
916  N N   . ASN B 9   ? 0.7704 0.7446 0.6966 -0.1304 0.0731  -0.0042 1457 ASN B N   
917  C CA  . ASN B 9   ? 0.7663 0.7179 0.6813 -0.1208 0.0814  -0.0092 1457 ASN B CA  
918  C C   . ASN B 9   ? 0.7323 0.6754 0.6418 -0.1101 0.0775  -0.0094 1457 ASN B C   
919  O O   . ASN B 9   ? 0.6342 0.5870 0.5597 -0.1030 0.0745  -0.0049 1457 ASN B O   
920  C CB  . ASN B 9   ? 0.7959 0.7526 0.7280 -0.1179 0.0882  -0.0071 1457 ASN B CB  
921  C CG  . ASN B 9   ? 0.8512 0.8062 0.7808 -0.1275 0.0954  -0.0096 1457 ASN B CG  
922  O OD1 . ASN B 9   ? 0.8661 0.8120 0.7958 -0.1253 0.1048  -0.0118 1457 ASN B OD1 
923  N ND2 . ASN B 9   ? 0.8659 0.8285 0.7916 -0.1392 0.0916  -0.0097 1457 ASN B ND2 
924  N N   . LEU B 10  ? 0.6474 0.5724 0.5357 -0.1094 0.0779  -0.0144 1458 LEU B N   
925  C CA  . LEU B 10  ? 0.6276 0.5498 0.5115 -0.1035 0.0723  -0.0143 1458 LEU B CA  
926  C C   . LEU B 10  ? 0.5753 0.4908 0.4626 -0.0917 0.0718  -0.0129 1458 LEU B C   
927  O O   . LEU B 10  ? 0.5634 0.4881 0.4601 -0.0870 0.0661  -0.0095 1458 LEU B O   
928  C CB  . LEU B 10  ? 0.6355 0.5395 0.4993 -0.1054 0.0746  -0.0200 1458 LEU B CB  
929  C CG  . LEU B 10  ? 0.7003 0.6081 0.5629 -0.1044 0.0695  -0.0199 1458 LEU B CG  
930  C CD1 . LEU B 10  ? 0.7206 0.6495 0.5904 -0.1151 0.0648  -0.0172 1458 LEU B CD1 
931  C CD2 . LEU B 10  ? 0.7280 0.6158 0.5743 -0.1041 0.0738  -0.0257 1458 LEU B CD2 
932  N N   . THR B 11  ? 0.5321 0.4314 0.4106 -0.0881 0.0778  -0.0154 1459 THR B N   
933  C CA  . THR B 11  ? 0.5457 0.4364 0.4236 -0.0787 0.0776  -0.0149 1459 THR B CA  
934  C C   . THR B 11  ? 0.5578 0.4660 0.4577 -0.0752 0.0755  -0.0105 1459 THR B C   
935  O O   . THR B 11  ? 0.5318 0.4409 0.4355 -0.0688 0.0707  -0.0088 1459 THR B O   
936  C CB  . THR B 11  ? 0.5776 0.4491 0.4411 -0.0782 0.0849  -0.0179 1459 THR B CB  
937  O OG1 . THR B 11  ? 0.6251 0.4789 0.4693 -0.0798 0.0854  -0.0203 1459 THR B OG1 
938  C CG2 . THR B 11  ? 0.5852 0.4479 0.4459 -0.0708 0.0846  -0.0177 1459 THR B CG2 
939  N N   . LYS B 12  ? 0.5663 0.4889 0.4826 -0.0797 0.0789  -0.0082 1460 LYS B N   
940  C CA  . LYS B 12  ? 0.5548 0.4932 0.4961 -0.0758 0.0786  -0.0033 1460 LYS B CA  
941  C C   . LYS B 12  ? 0.5314 0.4876 0.4867 -0.0753 0.0689  0.0026  1460 LYS B C   
942  O O   . LYS B 12  ? 0.4922 0.4559 0.4640 -0.0695 0.0670  0.0067  1460 LYS B O   
943  C CB  . LYS B 12  ? 0.5923 0.5424 0.5510 -0.0806 0.0853  -0.0015 1460 LYS B CB  
944  C CG  . LYS B 12  ? 0.5887 0.5212 0.5335 -0.0822 0.0964  -0.0075 1460 LYS B CG  
945  N N   . LYS B 13  ? 0.5202 0.4825 0.4684 -0.0824 0.0635  0.0032  1461 LYS B N   
946  C CA  . LYS B 13  ? 0.5257 0.5036 0.4823 -0.0842 0.0542  0.0087  1461 LYS B CA  
947  C C   . LYS B 13  ? 0.4888 0.4563 0.4343 -0.0776 0.0506  0.0068  1461 LYS B C   
948  O O   . LYS B 13  ? 0.4540 0.4325 0.4103 -0.0753 0.0443  0.0119  1461 LYS B O   
949  C CB  . LYS B 13  ? 0.5754 0.5625 0.5258 -0.0965 0.0510  0.0091  1461 LYS B CB  
950  C CG  . LYS B 13  ? 0.6093 0.5980 0.5486 -0.1002 0.0447  0.0089  1461 LYS B CG  
951  C CD  . LYS B 13  ? 0.6513 0.6561 0.5900 -0.1142 0.0390  0.0122  1461 LYS B CD  
952  C CE  . LYS B 13  ? 0.6361 0.6609 0.5941 -0.1216 0.0366  0.0192  1461 LYS B CE  
953  N NZ  . LYS B 13  ? 0.6906 0.7114 0.6347 -0.1335 0.0402  0.0140  1461 LYS B NZ  
954  N N   . MET B 14  ? 0.4826 0.4297 0.4080 -0.0749 0.0542  0.0003  1462 MET B N   
955  C CA  . MET B 14  ? 0.4631 0.3998 0.3809 -0.0677 0.0513  -0.0011 1462 MET B CA  
956  C C   . MET B 14  ? 0.4469 0.3830 0.3755 -0.0597 0.0513  0.0010  1462 MET B C   
957  O O   . MET B 14  ? 0.3848 0.3259 0.3203 -0.0556 0.0461  0.0039  1462 MET B O   
958  C CB  . MET B 14  ? 0.4709 0.3863 0.3683 -0.0662 0.0547  -0.0069 1462 MET B CB  
959  C CG  . MET B 14  ? 0.5204 0.4329 0.4070 -0.0726 0.0553  -0.0100 1462 MET B CG  
960  S SD  . MET B 14  ? 0.5698 0.4558 0.4371 -0.0698 0.0604  -0.0151 1462 MET B SD  
961  C CE  . MET B 14  ? 0.6177 0.5017 0.4770 -0.0772 0.0628  -0.0191 1462 MET B CE  
962  N N   . LYS B 15  ? 0.4573 0.3868 0.3870 -0.0584 0.0579  -0.0007 1463 LYS B N   
963  C CA  . LYS B 15  ? 0.4968 0.4244 0.4367 -0.0522 0.0603  0.0001  1463 LYS B CA  
964  C C   . LYS B 15  ? 0.4693 0.4161 0.4341 -0.0505 0.0564  0.0069  1463 LYS B C   
965  O O   . LYS B 15  ? 0.4450 0.3903 0.4163 -0.0448 0.0547  0.0082  1463 LYS B O   
966  C CB  . LYS B 15  ? 0.5328 0.4545 0.4744 -0.0533 0.0702  -0.0026 1463 LYS B CB  
967  C CG  . LYS B 15  ? 0.6087 0.5079 0.5262 -0.0536 0.0755  -0.0087 1463 LYS B CG  
968  C CD  . LYS B 15  ? 0.6501 0.5466 0.5706 -0.0570 0.0866  -0.0111 1463 LYS B CD  
969  C CE  . LYS B 15  ? 0.6773 0.5593 0.5759 -0.0622 0.0905  -0.0150 1463 LYS B CE  
970  N NZ  . LYS B 15  ? 0.7359 0.6186 0.6400 -0.0667 0.1016  -0.0169 1463 LYS B NZ  
971  N N   . LYS B 16  ? 0.4545 0.4191 0.4338 -0.0561 0.0550  0.0117  1464 LYS B N   
972  C CA  . LYS B 16  ? 0.4692 0.4541 0.4753 -0.0555 0.0506  0.0204  1464 LYS B CA  
973  C C   . LYS B 16  ? 0.4396 0.4307 0.4458 -0.0543 0.0412  0.0246  1464 LYS B C   
974  O O   . LYS B 16  ? 0.4116 0.4099 0.4350 -0.0497 0.0384  0.0303  1464 LYS B O   
975  C CB  . LYS B 16  ? 0.5239 0.5267 0.5412 -0.0642 0.0488  0.0253  1464 LYS B CB  
976  C CG  . LYS B 16  ? 0.5458 0.5687 0.5961 -0.0637 0.0478  0.0348  1464 LYS B CG  
977  C CD  . LYS B 16  ? 0.5492 0.5865 0.6070 -0.0732 0.0472  0.0380  1464 LYS B CD  
978  C CE  . LYS B 16  ? 0.5521 0.6133 0.6468 -0.0736 0.0440  0.0499  1464 LYS B CE  
979  N NZ  . LYS B 16  ? 0.5316 0.6055 0.6386 -0.0720 0.0333  0.0596  1464 LYS B NZ  
980  N N   . ILE B 17  ? 0.4289 0.4167 0.4163 -0.0589 0.0373  0.0219  1465 ILE B N   
981  C CA  . ILE B 17  ? 0.4022 0.3936 0.3854 -0.0589 0.0301  0.0242  1465 ILE B CA  
982  C C   . ILE B 17  ? 0.3971 0.3754 0.3769 -0.0500 0.0305  0.0214  1465 ILE B C   
983  O O   . ILE B 17  ? 0.3783 0.3628 0.3691 -0.0467 0.0261  0.0263  1465 ILE B O   
984  C CB  . ILE B 17  ? 0.3933 0.3797 0.3557 -0.0658 0.0295  0.0193  1465 ILE B CB  
985  C CG1 . ILE B 17  ? 0.4240 0.4252 0.3884 -0.0772 0.0272  0.0226  1465 ILE B CG1 
986  C CG2 . ILE B 17  ? 0.3844 0.3694 0.3403 -0.0645 0.0252  0.0192  1465 ILE B CG2 
987  C CD1 . ILE B 17  ? 0.4170 0.4109 0.3598 -0.0853 0.0289  0.0163  1465 ILE B CD1 
988  N N   . VAL B 18  ? 0.3867 0.3465 0.3511 -0.0467 0.0354  0.0142  1466 VAL B N   
989  C CA  . VAL B 18  ? 0.3847 0.3323 0.3446 -0.0399 0.0348  0.0120  1466 VAL B CA  
990  C C   . VAL B 18  ? 0.3863 0.3353 0.3622 -0.0351 0.0368  0.0145  1466 VAL B C   
991  O O   . VAL B 18  ? 0.3439 0.2917 0.3236 -0.0311 0.0334  0.0159  1466 VAL B O   
992  C CB  . VAL B 18  ? 0.4007 0.3284 0.3403 -0.0384 0.0381  0.0053  1466 VAL B CB  
993  C CG1 . VAL B 18  ? 0.3997 0.3158 0.3347 -0.0328 0.0361  0.0038  1466 VAL B CG1 
994  C CG2 . VAL B 18  ? 0.3989 0.3242 0.3264 -0.0416 0.0362  0.0034  1466 VAL B CG2 
995  N N   . ASP B 19  ? 0.3923 0.3435 0.3784 -0.0355 0.0433  0.0147  1467 ASP B N   
996  C CA  . ASP B 19  ? 0.4213 0.3727 0.4250 -0.0309 0.0477  0.0164  1467 ASP B CA  
997  C C   . ASP B 19  ? 0.3829 0.3510 0.4077 -0.0296 0.0410  0.0252  1467 ASP B C   
998  O O   . ASP B 19  ? 0.3950 0.3600 0.4292 -0.0248 0.0412  0.0266  1467 ASP B O   
999  C CB  . ASP B 19  ? 0.4894 0.4438 0.5060 -0.0320 0.0569  0.0161  1467 ASP B CB  
1000 C CG  . ASP B 19  ? 0.5766 0.5120 0.5727 -0.0333 0.0657  0.0073  1467 ASP B CG  
1001 O OD1 . ASP B 19  ? 0.6216 0.5398 0.5962 -0.0320 0.0648  0.0020  1467 ASP B OD1 
1002 O OD2 . ASP B 19  ? 0.6438 0.5820 0.6457 -0.0363 0.0730  0.0065  1467 ASP B OD2 
1003 N N   . ALA B 20  ? 0.3724 0.3575 0.4036 -0.0348 0.0349  0.0315  1468 ALA B N   
1004 C CA  . ALA B 20  ? 0.3667 0.3686 0.4177 -0.0349 0.0279  0.0415  1468 ALA B CA  
1005 C C   . ALA B 20  ? 0.3601 0.3590 0.4016 -0.0336 0.0214  0.0418  1468 ALA B C   
1006 O O   . ALA B 20  ? 0.3174 0.3218 0.3738 -0.0306 0.0180  0.0481  1468 ALA B O   
1007 C CB  . ALA B 20  ? 0.3653 0.3867 0.4246 -0.0428 0.0226  0.0489  1468 ALA B CB  
1008 N N   . VAL B 21  ? 0.3572 0.3473 0.3760 -0.0358 0.0203  0.0356  1469 VAL B N   
1009 C CA  . VAL B 21  ? 0.3264 0.3127 0.3378 -0.0341 0.0156  0.0351  1469 VAL B CA  
1010 C C   . VAL B 21  ? 0.3424 0.3155 0.3558 -0.0269 0.0181  0.0320  1469 VAL B C   
1011 O O   . VAL B 21  ? 0.3564 0.3310 0.3758 -0.0247 0.0142  0.0351  1469 VAL B O   
1012 C CB  . VAL B 21  ? 0.3315 0.3098 0.3213 -0.0368 0.0155  0.0287  1469 VAL B CB  
1013 C CG1 . VAL B 21  ? 0.3176 0.2907 0.3028 -0.0338 0.0122  0.0276  1469 VAL B CG1 
1014 C CG2 . VAL B 21  ? 0.3367 0.3262 0.3218 -0.0454 0.0136  0.0306  1469 VAL B CG2 
1015 N N   . ILE B 22  ? 0.3463 0.3055 0.3523 -0.0246 0.0246  0.0255  1470 ILE B N   
1016 C CA  . ILE B 22  ? 0.3722 0.3173 0.3766 -0.0200 0.0274  0.0217  1470 ILE B CA  
1017 C C   . ILE B 22  ? 0.3727 0.3239 0.4006 -0.0168 0.0293  0.0270  1470 ILE B C   
1018 O O   . ILE B 22  ? 0.3575 0.3043 0.3894 -0.0141 0.0276  0.0276  1470 ILE B O   
1019 C CB  . ILE B 22  ? 0.3822 0.3110 0.3714 -0.0202 0.0346  0.0139  1470 ILE B CB  
1020 C CG1 . ILE B 22  ? 0.4056 0.3257 0.3726 -0.0220 0.0311  0.0099  1470 ILE B CG1 
1021 C CG2 . ILE B 22  ? 0.4088 0.3235 0.3979 -0.0174 0.0398  0.0099  1470 ILE B CG2 
1022 C CD1 . ILE B 22  ? 0.4216 0.3246 0.3703 -0.0233 0.0367  0.0034  1470 ILE B CD1 
1023 N N   . LYS B 23  ? 0.4296 0.3915 0.4748 -0.0174 0.0327  0.0316  1471 LYS B N   
1024 C CA  . LYS B 23  ? 0.4574 0.4244 0.5284 -0.0137 0.0360  0.0372  1471 LYS B CA  
1025 C C   . LYS B 23  ? 0.4210 0.4030 0.5085 -0.0135 0.0271  0.0479  1471 LYS B C   
1026 O O   . LYS B 23  ? 0.4198 0.4035 0.5291 -0.0095 0.0288  0.0533  1471 LYS B O   
1027 C CB  . LYS B 23  ? 0.5073 0.4817 0.5933 -0.0145 0.0427  0.0390  1471 LYS B CB  
1028 C CG  . LYS B 23  ? 0.5859 0.5745 0.7061 -0.0117 0.0432  0.0494  1471 LYS B CG  
1029 C CD  . LYS B 23  ? 0.6728 0.6485 0.8060 -0.0055 0.0519  0.0468  1471 LYS B CD  
1030 C CE  . LYS B 23  ? 0.7284 0.7197 0.8992 -0.0020 0.0505  0.0596  1471 LYS B CE  
1031 N NZ  . LYS B 23  ? 0.7728 0.7814 0.9654 -0.0036 0.0518  0.0667  1471 LYS B NZ  
1032 N N   . TYR B 24  ? 0.3765 0.3678 0.4534 -0.0182 0.0186  0.0509  1472 TYR B N   
1033 C CA  . TYR B 24  ? 0.3689 0.3750 0.4577 -0.0202 0.0101  0.0614  1472 TYR B CA  
1034 C C   . TYR B 24  ? 0.3671 0.3669 0.4639 -0.0157 0.0092  0.0632  1472 TYR B C   
1035 O O   . TYR B 24  ? 0.3813 0.3671 0.4635 -0.0138 0.0106  0.0556  1472 TYR B O   
1036 C CB  . TYR B 24  ? 0.3856 0.3978 0.4557 -0.0269 0.0035  0.0612  1472 TYR B CB  
1037 C CG  . TYR B 24  ? 0.3843 0.4101 0.4625 -0.0305 -0.0046 0.0714  1472 TYR B CG  
1038 C CD1 . TYR B 24  ? 0.4107 0.4550 0.5030 -0.0359 -0.0102 0.0829  1472 TYR B CD1 
1039 C CD2 . TYR B 24  ? 0.4047 0.4256 0.4771 -0.0293 -0.0072 0.0707  1472 TYR B CD2 
1040 C CE1 . TYR B 24  ? 0.3936 0.4499 0.4916 -0.0404 -0.0184 0.0935  1472 TYR B CE1 
1041 C CE2 . TYR B 24  ? 0.4098 0.4424 0.4888 -0.0332 -0.0141 0.0805  1472 TYR B CE2 
1042 C CZ  . TYR B 24  ? 0.4153 0.4651 0.5059 -0.0390 -0.0197 0.0920  1472 TYR B CZ  
1043 O OH  . TYR B 24  ? 0.4318 0.4926 0.5265 -0.0441 -0.0272 0.1025  1472 TYR B OH  
1044 N N   . LYS B 25  ? 0.3963 0.4075 0.5169 -0.0147 0.0059  0.0746  1473 LYS B N   
1045 C CA  . LYS B 25  ? 0.4032 0.4093 0.5343 -0.0108 0.0050  0.0779  1473 LYS B CA  
1046 C C   . LYS B 25  ? 0.4173 0.4382 0.5533 -0.0153 -0.0050 0.0893  1473 LYS B C   
1047 O O   . LYS B 25  ? 0.4802 0.5178 0.6246 -0.0199 -0.0107 0.0991  1473 LYS B O   
1048 C CB  . LYS B 25  ? 0.4301 0.4331 0.5882 -0.0049 0.0123  0.0813  1473 LYS B CB  
1049 C CG  . LYS B 25  ? 0.4511 0.4393 0.6029 -0.0020 0.0238  0.0696  1473 LYS B CG  
1050 C CD  . LYS B 25  ? 0.5248 0.5002 0.6946 0.0038  0.0341  0.0675  1473 LYS B CD  
1051 C CE  . LYS B 25  ? 0.5857 0.5443 0.7433 0.0047  0.0464  0.0544  1473 LYS B CE  
1052 N NZ  . LYS B 25  ? 0.6142 0.5541 0.7788 0.0086  0.0569  0.0485  1473 LYS B NZ  
1053 N N   . ASP B 26  ? 0.4148 0.4296 0.5435 -0.0150 -0.0075 0.0881  1474 ASP B N   
1054 C CA  . ASP B 26  ? 0.4537 0.4804 0.5877 -0.0192 -0.0159 0.0992  1474 ASP B CA  
1055 C C   . ASP B 26  ? 0.4446 0.4809 0.6085 -0.0171 -0.0183 0.1134  1474 ASP B C   
1056 O O   . ASP B 26  ? 0.4249 0.4522 0.6063 -0.0102 -0.0120 0.1128  1474 ASP B O   
1057 C CB  . ASP B 26  ? 0.4913 0.5076 0.6165 -0.0180 -0.0161 0.0947  1474 ASP B CB  
1058 C CG  . ASP B 26  ? 0.5948 0.6224 0.7206 -0.0237 -0.0239 0.1047  1474 ASP B CG  
1059 O OD1 . ASP B 26  ? 0.6521 0.6952 0.7839 -0.0292 -0.0297 0.1157  1474 ASP B OD1 
1060 O OD2 . ASP B 26  ? 0.5798 0.6010 0.6986 -0.0238 -0.0243 0.1016  1474 ASP B OD2 
1061 N N   . SER B 27  ? 0.4967 0.5505 0.6659 -0.0236 -0.0273 0.1265  1475 SER B N   
1062 C CA  . SER B 27  ? 0.5070 0.5739 0.7066 -0.0228 -0.0323 0.1434  1475 SER B CA  
1063 C C   . SER B 27  ? 0.5032 0.5623 0.7251 -0.0159 -0.0300 0.1492  1475 SER B C   
1064 O O   . SER B 27  ? 0.4903 0.5476 0.7398 -0.0091 -0.0250 0.1537  1475 SER B O   
1065 C CB  . SER B 27  ? 0.5206 0.6044 0.7137 -0.0333 -0.0442 0.1562  1475 SER B CB  
1066 O OG  . SER B 27  ? 0.4623 0.5395 0.6325 -0.0371 -0.0451 0.1503  1475 SER B OG  
1067 N N   . SER B 28  ? 0.5189 0.5735 0.7296 -0.0184 -0.0332 0.1493  1476 SER B N   
1068 C CA  . SER B 28  ? 0.5145 0.5627 0.7445 -0.0139 -0.0327 0.1566  1476 SER B CA  
1069 C C   . SER B 28  ? 0.4822 0.5086 0.7127 -0.0059 -0.0212 0.1425  1476 SER B C   
1070 O O   . SER B 28  ? 0.4808 0.4996 0.7360 0.0006  -0.0153 0.1458  1476 SER B O   
1071 C CB  . SER B 28  ? 0.5205 0.5720 0.7367 -0.0206 -0.0400 0.1614  1476 SER B CB  
1072 O OG  . SER B 28  ? 0.5849 0.6338 0.8224 -0.0178 -0.0417 0.1726  1476 SER B OG  
1073 N N   . SER B 29  ? 0.4193 0.4351 0.6228 -0.0070 -0.0176 0.1269  1477 SER B N   
1074 C CA  . SER B 29  ? 0.4010 0.3959 0.5999 -0.0019 -0.0081 0.1135  1477 SER B CA  
1075 C C   . SER B 29  ? 0.4067 0.3943 0.6111 0.0026  0.0014  0.1059  1477 SER B C   
1076 O O   . SER B 29  ? 0.4578 0.4286 0.6683 0.0071  0.0107  0.0987  1477 SER B O   
1077 C CB  . SER B 29  ? 0.3720 0.3592 0.5420 -0.0053 -0.0093 0.1015  1477 SER B CB  
1078 O OG  . SER B 29  ? 0.3828 0.3772 0.5344 -0.0088 -0.0114 0.0969  1477 SER B OG  
1079 N N   . GLY B 30  ? 0.3707 0.3699 0.5724 0.0007  0.0000  0.1071  1478 GLY B N   
1080 C CA  . GLY B 30  ? 0.3856 0.3765 0.5864 0.0039  0.0097  0.0975  1478 GLY B CA  
1081 C C   . GLY B 30  ? 0.3750 0.3494 0.5454 0.0027  0.0142  0.0809  1478 GLY B C   
1082 O O   . GLY B 30  ? 0.3805 0.3451 0.5462 0.0045  0.0229  0.0719  1478 GLY B O   
1083 N N   . ARG B 31  ? 0.3478 0.3199 0.4981 -0.0006 0.0081  0.0774  1479 ARG B N   
1084 C CA  . ARG B 31  ? 0.3372 0.2948 0.4617 -0.0017 0.0107  0.0639  1479 ARG B CA  
1085 C C   . ARG B 31  ? 0.3299 0.2924 0.4381 -0.0043 0.0101  0.0595  1479 ARG B C   
1086 O O   . ARG B 31  ? 0.3179 0.2957 0.4247 -0.0077 0.0042  0.0654  1479 ARG B O   
1087 C CB  . ARG B 31  ? 0.3281 0.2832 0.4410 -0.0042 0.0045  0.0626  1479 ARG B CB  
1088 C CG  . ARG B 31  ? 0.3422 0.2826 0.4316 -0.0054 0.0057  0.0504  1479 ARG B CG  
1089 C CD  . ARG B 31  ? 0.3506 0.2882 0.4344 -0.0075 0.0001  0.0498  1479 ARG B CD  
1090 N NE  . ARG B 31  ? 0.3275 0.2812 0.4126 -0.0101 -0.0067 0.0571  1479 ARG B NE  
1091 C CZ  . ARG B 31  ? 0.3198 0.2788 0.3907 -0.0126 -0.0101 0.0545  1479 ARG B CZ  
1092 N NH1 . ARG B 31  ? 0.3319 0.2821 0.3872 -0.0123 -0.0088 0.0459  1479 ARG B NH1 
1093 N NH2 . ARG B 31  ? 0.2982 0.2706 0.3707 -0.0158 -0.0144 0.0606  1479 ARG B NH2 
1094 N N   . GLN B 32  ? 0.3265 0.2748 0.4210 -0.0035 0.0168  0.0489  1480 GLN B N   
1095 C CA  . GLN B 32  ? 0.3159 0.2655 0.3937 -0.0059 0.0170  0.0440  1480 GLN B CA  
1096 C C   . GLN B 32  ? 0.3131 0.2605 0.3697 -0.0086 0.0108  0.0398  1480 GLN B C   
1097 O O   . GLN B 32  ? 0.3035 0.2366 0.3455 -0.0086 0.0115  0.0323  1480 GLN B O   
1098 C CB  . GLN B 32  ? 0.3409 0.2750 0.4107 -0.0048 0.0268  0.0346  1480 GLN B CB  
1099 C CG  . GLN B 32  ? 0.3637 0.2980 0.4159 -0.0074 0.0271  0.0301  1480 GLN B CG  
1100 C CD  . GLN B 32  ? 0.4235 0.3429 0.4667 -0.0074 0.0371  0.0216  1480 GLN B CD  
1101 O OE1 . GLN B 32  ? 0.4593 0.3756 0.5177 -0.0052 0.0460  0.0213  1480 GLN B OE1 
1102 N NE2 . GLN B 32  ? 0.4303 0.3402 0.4492 -0.0101 0.0363  0.0149  1480 GLN B NE2 
1103 N N   . LEU B 33  ? 0.2948 0.2563 0.3497 -0.0116 0.0050  0.0448  1481 LEU B N   
1104 C CA  . LEU B 33  ? 0.2903 0.2516 0.3302 -0.0139 0.0002  0.0420  1481 LEU B CA  
1105 C C   . LEU B 33  ? 0.2784 0.2270 0.2990 -0.0137 0.0020  0.0329  1481 LEU B C   
1106 O O   . LEU B 33  ? 0.2666 0.2093 0.2788 -0.0137 -0.0011 0.0300  1481 LEU B O   
1107 C CB  . LEU B 33  ? 0.2938 0.2706 0.3333 -0.0184 -0.0035 0.0474  1481 LEU B CB  
1108 C CG  . LEU B 33  ? 0.3206 0.3091 0.3704 -0.0209 -0.0085 0.0560  1481 LEU B CG  
1109 C CD1 . LEU B 33  ? 0.3227 0.3109 0.3908 -0.0178 -0.0090 0.0622  1481 LEU B CD1 
1110 C CD2 . LEU B 33  ? 0.3223 0.3259 0.3708 -0.0272 -0.0113 0.0619  1481 LEU B CD2 
1111 N N   . SER B 34  ? 0.2762 0.2213 0.2909 -0.0140 0.0067  0.0296  1482 SER B N   
1112 C CA  . SER B 34  ? 0.2952 0.2282 0.2909 -0.0145 0.0082  0.0224  1482 SER B CA  
1113 C C   . SER B 34  ? 0.3103 0.2260 0.2958 -0.0134 0.0087  0.0168  1482 SER B C   
1114 O O   . SER B 34  ? 0.3144 0.2207 0.2840 -0.0144 0.0074  0.0126  1482 SER B O   
1115 C CB  . SER B 34  ? 0.3031 0.2353 0.2956 -0.0156 0.0140  0.0203  1482 SER B CB  
1116 O OG  . SER B 34  ? 0.3045 0.2313 0.3055 -0.0139 0.0202  0.0194  1482 SER B OG  
1117 N N   . GLU B 35  ? 0.3183 0.2296 0.3125 -0.0123 0.0102  0.0171  1483 GLU B N   
1118 C CA  . GLU B 35  ? 0.3498 0.2428 0.3323 -0.0133 0.0134  0.0105  1483 GLU B CA  
1119 C C   . GLU B 35  ? 0.3173 0.2019 0.2823 -0.0154 0.0068  0.0075  1483 GLU B C   
1120 O O   . GLU B 35  ? 0.3188 0.1907 0.2664 -0.0178 0.0082  0.0028  1483 GLU B O   
1121 C CB  . GLU B 35  ? 0.3792 0.2674 0.3734 -0.0125 0.0160  0.0107  1483 GLU B CB  
1122 C CG  . GLU B 35  ? 0.4448 0.3383 0.4588 -0.0098 0.0238  0.0138  1483 GLU B CG  
1123 C CD  . GLU B 35  ? 0.5351 0.4260 0.5662 -0.0081 0.0262  0.0162  1483 GLU B CD  
1124 O OE1 . GLU B 35  ? 0.5785 0.4787 0.6200 -0.0074 0.0194  0.0225  1483 GLU B OE1 
1125 O OE2 . GLU B 35  ? 0.5648 0.4435 0.5998 -0.0075 0.0362  0.0116  1483 GLU B OE2 
1126 N N   . VAL B 36  ? 0.2858 0.1780 0.2562 -0.0150 -0.0005 0.0112  1484 VAL B N   
1127 C CA  . VAL B 36  ? 0.2944 0.1807 0.2534 -0.0167 -0.0076 0.0100  1484 VAL B CA  
1128 C C   . VAL B 36  ? 0.3020 0.1880 0.2504 -0.0165 -0.0093 0.0097  1484 VAL B C   
1129 O O   . VAL B 36  ? 0.3089 0.1879 0.2471 -0.0179 -0.0150 0.0093  1484 VAL B O   
1130 C CB  . VAL B 36  ? 0.2997 0.1946 0.2706 -0.0163 -0.0140 0.0140  1484 VAL B CB  
1131 C CG1 . VAL B 36  ? 0.2652 0.1758 0.2461 -0.0143 -0.0154 0.0185  1484 VAL B CG1 
1132 C CG2 . VAL B 36  ? 0.3298 0.2160 0.2913 -0.0191 -0.0214 0.0126  1484 VAL B CG2 
1133 N N   . PHE B 37  ? 0.2997 0.1935 0.2514 -0.0153 -0.0047 0.0106  1485 PHE B N   
1134 C CA  . PHE B 37  ? 0.2894 0.1834 0.2336 -0.0151 -0.0052 0.0104  1485 PHE B CA  
1135 C C   . PHE B 37  ? 0.3136 0.1959 0.2428 -0.0168 -0.0003 0.0066  1485 PHE B C   
1136 O O   . PHE B 37  ? 0.2954 0.1757 0.2173 -0.0170 0.0000  0.0063  1485 PHE B O   
1137 C CB  . PHE B 37  ? 0.2882 0.1968 0.2428 -0.0146 -0.0029 0.0131  1485 PHE B CB  
1138 C CG  . PHE B 37  ? 0.2856 0.2055 0.2530 -0.0140 -0.0065 0.0168  1485 PHE B CG  
1139 C CD1 . PHE B 37  ? 0.2960 0.2159 0.2648 -0.0130 -0.0111 0.0176  1485 PHE B CD1 
1140 C CD2 . PHE B 37  ? 0.2913 0.2218 0.2706 -0.0146 -0.0053 0.0203  1485 PHE B CD2 
1141 C CE1 . PHE B 37  ? 0.2925 0.2226 0.2735 -0.0130 -0.0133 0.0207  1485 PHE B CE1 
1142 C CE2 . PHE B 37  ? 0.2934 0.2335 0.2830 -0.0149 -0.0083 0.0240  1485 PHE B CE2 
1143 C CZ  . PHE B 37  ? 0.2829 0.2228 0.2727 -0.0143 -0.0117 0.0236  1485 PHE B CZ  
1144 N N   . ILE B 38  ? 0.3121 0.1856 0.2368 -0.0184 0.0042  0.0034  1486 ILE B N   
1145 C CA  . ILE B 38  ? 0.3632 0.2260 0.2741 -0.0207 0.0105  -0.0004 1486 ILE B CA  
1146 C C   . ILE B 38  ? 0.3869 0.2357 0.2775 -0.0234 0.0055  -0.0015 1486 ILE B C   
1147 O O   . ILE B 38  ? 0.3962 0.2398 0.2760 -0.0245 0.0074  -0.0021 1486 ILE B O   
1148 C CB  . ILE B 38  ? 0.3862 0.2415 0.2976 -0.0220 0.0188  -0.0044 1486 ILE B CB  
1149 C CG1 . ILE B 38  ? 0.3869 0.2568 0.3216 -0.0190 0.0233  -0.0013 1486 ILE B CG1 
1150 C CG2 . ILE B 38  ? 0.4416 0.2840 0.3361 -0.0254 0.0262  -0.0091 1486 ILE B CG2 
1151 C CD1 . ILE B 38  ? 0.3819 0.2639 0.3237 -0.0185 0.0260  0.0011  1486 ILE B CD1 
1152 N N   . GLN B 39  ? 0.4175 0.2608 0.3040 -0.0248 -0.0014 -0.0009 1487 GLN B N   
1153 C CA  . GLN B 39  ? 0.4740 0.3043 0.3418 -0.0286 -0.0080 -0.0005 1487 GLN B CA  
1154 C C   . GLN B 39  ? 0.4394 0.2739 0.3133 -0.0282 -0.0192 0.0038  1487 GLN B C   
1155 O O   . GLN B 39  ? 0.4660 0.3020 0.3459 -0.0292 -0.0212 0.0031  1487 GLN B O   
1156 C CB  . GLN B 39  ? 0.5483 0.3608 0.3955 -0.0351 -0.0036 -0.0061 1487 GLN B CB  
1157 C CG  . GLN B 39  ? 0.5990 0.4089 0.4468 -0.0353 0.0100  -0.0113 1487 GLN B CG  
1158 C CD  . GLN B 39  ? 0.7337 0.5238 0.5567 -0.0424 0.0164  -0.0171 1487 GLN B CD  
1159 O OE1 . GLN B 39  ? 0.8263 0.6134 0.6476 -0.0430 0.0277  -0.0209 1487 GLN B OE1 
1160 N NE2 . GLN B 39  ? 0.7154 0.4922 0.5184 -0.0489 0.0091  -0.0176 1487 GLN B NE2 
1161 N N   . LEU B 40  ? 0.4516 0.2882 0.3262 -0.0265 -0.0259 0.0085  1488 LEU B N   
1162 C CA  . LEU B 40  ? 0.5036 0.3451 0.3868 -0.0257 -0.0369 0.0139  1488 LEU B CA  
1163 C C   . LEU B 40  ? 0.5393 0.3683 0.4059 -0.0328 -0.0450 0.0141  1488 LEU B C   
1164 O O   . LEU B 40  ? 0.6211 0.4353 0.4654 -0.0382 -0.0436 0.0118  1488 LEU B O   
1165 C CB  . LEU B 40  ? 0.5181 0.3621 0.4062 -0.0223 -0.0409 0.0193  1488 LEU B CB  
1166 C CG  . LEU B 40  ? 0.5250 0.3838 0.4344 -0.0161 -0.0368 0.0205  1488 LEU B CG  
1167 C CD1 . LEU B 40  ? 0.5416 0.3980 0.4524 -0.0133 -0.0370 0.0239  1488 LEU B CD1 
1168 C CD2 . LEU B 40  ? 0.5169 0.3871 0.4446 -0.0144 -0.0423 0.0235  1488 LEU B CD2 
1169 N N   . PRO B 41  ? 0.5405 0.3748 0.4165 -0.0340 -0.0531 0.0168  1489 PRO B N   
1170 C CA  . PRO B 41  ? 0.5744 0.3975 0.4337 -0.0422 -0.0634 0.0184  1489 PRO B CA  
1171 C C   . PRO B 41  ? 0.6024 0.4196 0.4513 -0.0438 -0.0718 0.0249  1489 PRO B C   
1172 O O   . PRO B 41  ? 0.5546 0.3804 0.4186 -0.0368 -0.0720 0.0297  1489 PRO B O   
1173 C CB  . PRO B 41  ? 0.5661 0.4008 0.4443 -0.0416 -0.0718 0.0222  1489 PRO B CB  
1174 C CG  . PRO B 41  ? 0.5374 0.3849 0.4362 -0.0349 -0.0624 0.0196  1489 PRO B CG  
1175 C CD  . PRO B 41  ? 0.5083 0.3588 0.4091 -0.0292 -0.0541 0.0190  1489 PRO B CD  
1176 N N   . SER B 42  ? 0.6188 0.4206 0.4418 -0.0534 -0.0782 0.0252  1490 SER B N   
1177 C CA  . SER B 42  ? 0.6286 0.4231 0.4393 -0.0562 -0.0875 0.0329  1490 SER B CA  
1178 C C   . SER B 42  ? 0.6111 0.4180 0.4434 -0.0530 -0.1018 0.0438  1490 SER B C   
1179 O O   . SER B 42  ? 0.5926 0.4110 0.4432 -0.0516 -0.1056 0.0446  1490 SER B O   
1180 C CB  . SER B 42  ? 0.6616 0.4368 0.4375 -0.0696 -0.0924 0.0313  1490 SER B CB  
1181 O OG  . SER B 42  ? 0.6696 0.4455 0.4438 -0.0768 -0.1043 0.0338  1490 SER B OG  
1182 N N   . ARG B 43  ? 0.6286 0.4333 0.4607 -0.0517 -0.1090 0.0526  1491 ARG B N   
1183 C CA  . ARG B 43  ? 0.6428 0.4582 0.4969 -0.0489 -0.1232 0.0647  1491 ARG B CA  
1184 C C   . ARG B 43  ? 0.6606 0.4773 0.5110 -0.0580 -0.1378 0.0689  1491 ARG B C   
1185 O O   . ARG B 43  ? 0.6169 0.4485 0.4943 -0.0544 -0.1453 0.0749  1491 ARG B O   
1186 C CB  . ARG B 43  ? 0.6849 0.4934 0.5346 -0.0483 -0.1300 0.0747  1491 ARG B CB  
1187 C CG  . ARG B 43  ? 0.6894 0.5060 0.5643 -0.0360 -0.1212 0.0763  1491 ARG B CG  
1188 C CD  . ARG B 43  ? 0.7356 0.5428 0.6053 -0.0353 -0.1261 0.0856  1491 ARG B CD  
1189 N NE  . ARG B 43  ? 0.7712 0.5831 0.6615 -0.0244 -0.1141 0.0841  1491 ARG B NE  
1190 C CZ  . ARG B 43  ? 0.7828 0.5883 0.6616 -0.0228 -0.0993 0.0749  1491 ARG B CZ  
1191 N NH1 . ARG B 43  ? 0.8233 0.6179 0.6726 -0.0301 -0.0941 0.0670  1491 ARG B NH1 
1192 N NH2 . ARG B 43  ? 0.8101 0.6198 0.7074 -0.0143 -0.0892 0.0736  1491 ARG B NH2 
1193 N N   . LYS B 44  ? 0.7158 0.5166 0.5326 -0.0705 -0.1407 0.0649  1492 LYS B N   
1194 C CA  . LYS B 44  ? 0.7717 0.5704 0.5782 -0.0821 -0.1541 0.0673  1492 LYS B CA  
1195 C C   . LYS B 44  ? 0.7760 0.5833 0.5965 -0.0811 -0.1488 0.0596  1492 LYS B C   
1196 O O   . LYS B 44  ? 0.8250 0.6407 0.6567 -0.0854 -0.1607 0.0645  1492 LYS B O   
1197 C CB  . LYS B 44  ? 0.8242 0.6002 0.5863 -0.0970 -0.1546 0.0622  1492 LYS B CB  
1198 C CG  . LYS B 44  ? 0.8783 0.6449 0.6211 -0.1047 -0.1687 0.0737  1492 LYS B CG  
1199 C CD  . LYS B 44  ? 0.9434 0.6867 0.6390 -0.1217 -0.1681 0.0673  1492 LYS B CD  
1200 C CE  . LYS B 44  ? 0.9861 0.7258 0.6690 -0.1345 -0.1742 0.0624  1492 LYS B CE  
1201 N NZ  . LYS B 44  ? 1.0585 0.7782 0.6973 -0.1546 -0.1846 0.0641  1492 LYS B NZ  
1202 N N   . GLU B 45  ? 0.7595 0.5646 0.5793 -0.0761 -0.1314 0.0482  1493 GLU B N   
1203 C CA  . GLU B 45  ? 0.7272 0.5388 0.5595 -0.0748 -0.1248 0.0411  1493 GLU B CA  
1204 C C   . GLU B 45  ? 0.6928 0.5263 0.5637 -0.0642 -0.1266 0.0467  1493 GLU B C   
1205 O O   . GLU B 45  ? 0.6583 0.4998 0.5425 -0.0657 -0.1294 0.0462  1493 GLU B O   
1206 C CB  . GLU B 45  ? 0.7551 0.5591 0.5790 -0.0717 -0.1060 0.0293  1493 GLU B CB  
1207 C CG  . GLU B 45  ? 0.8230 0.6049 0.6112 -0.0825 -0.1003 0.0213  1493 GLU B CG  
1208 C CD  . GLU B 45  ? 0.8652 0.6414 0.6502 -0.0780 -0.0810 0.0111  1493 GLU B CD  
1209 O OE1 . GLU B 45  ? 0.8540 0.6432 0.6618 -0.0668 -0.0731 0.0112  1493 GLU B OE1 
1210 O OE2 . GLU B 45  ? 0.8887 0.6471 0.6485 -0.0865 -0.0734 0.0028  1493 GLU B OE2 
1211 N N   . LEU B 46  ? 0.6456 0.4876 0.5334 -0.0542 -0.1235 0.0513  1494 LEU B N   
1212 C CA  . LEU B 46  ? 0.6028 0.4636 0.5248 -0.0440 -0.1198 0.0538  1494 LEU B CA  
1213 C C   . LEU B 46  ? 0.5813 0.4494 0.5215 -0.0368 -0.1238 0.0630  1494 LEU B C   
1214 O O   . LEU B 46  ? 0.5692 0.4403 0.5183 -0.0285 -0.1128 0.0609  1494 LEU B O   
1215 C CB  . LEU B 46  ? 0.5653 0.4282 0.4904 -0.0379 -0.1028 0.0446  1494 LEU B CB  
1216 C CG  . LEU B 46  ? 0.5436 0.4241 0.4985 -0.0302 -0.0974 0.0452  1494 LEU B CG  
1217 C CD1 . LEU B 46  ? 0.5439 0.4315 0.5096 -0.0343 -0.1036 0.0461  1494 LEU B CD1 
1218 C CD2 . LEU B 46  ? 0.5392 0.4212 0.4939 -0.0256 -0.0824 0.0380  1494 LEU B CD2 
1219 N N   . PRO B 47  ? 0.6053 0.4759 0.5518 -0.0403 -0.1396 0.0737  1495 PRO B N   
1220 C CA  . PRO B 47  ? 0.6053 0.4809 0.5703 -0.0330 -0.1431 0.0834  1495 PRO B CA  
1221 C C   . PRO B 47  ? 0.5719 0.4639 0.5731 -0.0217 -0.1339 0.0837  1495 PRO B C   
1222 O O   . PRO B 47  ? 0.5697 0.4623 0.5831 -0.0141 -0.1285 0.0867  1495 PRO B O   
1223 C CB  . PRO B 47  ? 0.6226 0.4994 0.5896 -0.0402 -0.1638 0.0961  1495 PRO B CB  
1224 C CG  . PRO B 47  ? 0.6425 0.5196 0.5990 -0.0503 -0.1701 0.0922  1495 PRO B CG  
1225 C CD  . PRO B 47  ? 0.6213 0.4882 0.5554 -0.0520 -0.1551 0.0777  1495 PRO B CD  
1226 N N   . GLU B 48  ? 0.5651 0.4688 0.5817 -0.0213 -0.1314 0.0804  1496 GLU B N   
1227 C CA  . GLU B 48  ? 0.5580 0.4767 0.6058 -0.0125 -0.1214 0.0795  1496 GLU B CA  
1228 C C   . GLU B 48  ? 0.5433 0.4581 0.5862 -0.0064 -0.1047 0.0718  1496 GLU B C   
1229 O O   . GLU B 48  ? 0.5602 0.4811 0.6237 0.0009  -0.0971 0.0732  1496 GLU B O   
1230 C CB  . GLU B 48  ? 0.6022 0.5304 0.6580 -0.0153 -0.1197 0.0751  1496 GLU B CB  
1231 C CG  . GLU B 48  ? 0.6643 0.5947 0.7198 -0.0240 -0.1358 0.0806  1496 GLU B CG  
1232 C CD  . GLU B 48  ? 0.7227 0.6379 0.7435 -0.0341 -0.1391 0.0744  1496 GLU B CD  
1233 O OE1 . GLU B 48  ? 0.7918 0.7063 0.8069 -0.0364 -0.1320 0.0665  1496 GLU B OE1 
1234 O OE2 . GLU B 48  ? 0.7588 0.6621 0.7579 -0.0405 -0.1486 0.0776  1496 GLU B OE2 
1235 N N   . TYR B 49  ? 0.4939 0.3982 0.5098 -0.0100 -0.0985 0.0635  1497 TYR B N   
1236 C CA  . TYR B 49  ? 0.4792 0.3800 0.4885 -0.0058 -0.0840 0.0566  1497 TYR B CA  
1237 C C   . TYR B 49  ? 0.4925 0.3878 0.5049 -0.0012 -0.0824 0.0607  1497 TYR B C   
1238 O O   . TYR B 49  ? 0.4924 0.3912 0.5163 0.0042  -0.0713 0.0580  1497 TYR B O   
1239 C CB  . TYR B 49  ? 0.4503 0.3399 0.4312 -0.0108 -0.0791 0.0488  1497 TYR B CB  
1240 C CG  . TYR B 49  ? 0.4303 0.3212 0.4091 -0.0074 -0.0647 0.0419  1497 TYR B CG  
1241 C CD1 . TYR B 49  ? 0.4039 0.2875 0.3745 -0.0052 -0.0590 0.0409  1497 TYR B CD1 
1242 C CD2 . TYR B 49  ? 0.4034 0.3034 0.3891 -0.0070 -0.0574 0.0372  1497 TYR B CD2 
1243 C CE1 . TYR B 49  ? 0.3972 0.2825 0.3655 -0.0036 -0.0467 0.0348  1497 TYR B CE1 
1244 C CE2 . TYR B 49  ? 0.3861 0.2884 0.3696 -0.0053 -0.0458 0.0321  1497 TYR B CE2 
1245 C CZ  . TYR B 49  ? 0.3740 0.2695 0.3493 -0.0037 -0.0407 0.0308  1497 TYR B CZ  
1246 O OH  . TYR B 49  ? 0.3501 0.2479 0.3225 -0.0034 -0.0303 0.0262  1497 TYR B OH  
1247 N N   . TYR B 50  ? 0.5197 0.4051 0.5201 -0.0044 -0.0934 0.0672  1498 TYR B N   
1248 C CA  . TYR B 50  ? 0.5419 0.4191 0.5416 -0.0008 -0.0923 0.0717  1498 TYR B CA  
1249 C C   . TYR B 50  ? 0.5557 0.4416 0.5878 0.0059  -0.0953 0.0807  1498 TYR B C   
1250 O O   . TYR B 50  ? 0.6023 0.4833 0.6413 0.0110  -0.0901 0.0830  1498 TYR B O   
1251 C CB  . TYR B 50  ? 0.5508 0.4130 0.5231 -0.0078 -0.1025 0.0758  1498 TYR B CB  
1252 C CG  . TYR B 50  ? 0.5378 0.3902 0.4799 -0.0137 -0.0955 0.0656  1498 TYR B CG  
1253 C CD1 . TYR B 50  ? 0.5458 0.3985 0.4767 -0.0202 -0.0986 0.0612  1498 TYR B CD1 
1254 C CD2 . TYR B 50  ? 0.5398 0.3831 0.4675 -0.0126 -0.0844 0.0600  1498 TYR B CD2 
1255 C CE1 . TYR B 50  ? 0.5266 0.3702 0.4339 -0.0247 -0.0905 0.0519  1498 TYR B CE1 
1256 C CE2 . TYR B 50  ? 0.5201 0.3558 0.4245 -0.0175 -0.0772 0.0512  1498 TYR B CE2 
1257 C CZ  . TYR B 50  ? 0.5154 0.3513 0.4107 -0.0231 -0.0799 0.0473  1498 TYR B CZ  
1258 O OH  . TYR B 50  ? 0.5116 0.3397 0.3874 -0.0271 -0.0712 0.0387  1498 TYR B OH  
1259 N N   . GLU B 51  ? 0.6316 0.5303 0.6856 0.0061  -0.1030 0.0858  1499 GLU B N   
1260 C CA  . GLU B 51  ? 0.6521 0.5616 0.7433 0.0137  -0.1031 0.0936  1499 GLU B CA  
1261 C C   . GLU B 51  ? 0.6421 0.5588 0.7505 0.0199  -0.0848 0.0853  1499 GLU B C   
1262 O O   . GLU B 51  ? 0.6917 0.6083 0.8204 0.0268  -0.0770 0.0876  1499 GLU B O   
1263 C CB  . GLU B 51  ? 0.6823 0.6046 0.7936 0.0113  -0.1175 0.1024  1499 GLU B CB  
1264 C CG  . GLU B 51  ? 0.7390 0.6558 0.8460 0.0073  -0.1363 0.1156  1499 GLU B CG  
1265 C CD  . GLU B 51  ? 0.7922 0.7039 0.8703 -0.0044 -0.1494 0.1151  1499 GLU B CD  
1266 O OE1 . GLU B 51  ? 0.7771 0.6997 0.8644 -0.0079 -0.1539 0.1142  1499 GLU B OE1 
1267 O OE2 . GLU B 51  ? 0.8099 0.7061 0.8559 -0.0104 -0.1540 0.1149  1499 GLU B OE2 
1268 N N   . LEU B 52  ? 0.5915 0.5128 0.6904 0.0169  -0.0774 0.0758  1500 LEU B N   
1269 C CA  . LEU B 52  ? 0.5392 0.4678 0.6511 0.0206  -0.0609 0.0682  1500 LEU B CA  
1270 C C   . LEU B 52  ? 0.5250 0.4435 0.6195 0.0213  -0.0476 0.0602  1500 LEU B C   
1271 O O   . LEU B 52  ? 0.5666 0.4864 0.6742 0.0252  -0.0345 0.0566  1500 LEU B O   
1272 C CB  . LEU B 52  ? 0.5384 0.4762 0.6471 0.0163  -0.0594 0.0629  1500 LEU B CB  
1273 C CG  . LEU B 52  ? 0.5550 0.4997 0.6718 0.0178  -0.0429 0.0551  1500 LEU B CG  
1274 C CD1 . LEU B 52  ? 0.5313 0.4847 0.6814 0.0235  -0.0360 0.0580  1500 LEU B CD1 
1275 C CD2 . LEU B 52  ? 0.5651 0.5168 0.6743 0.0128  -0.0427 0.0509  1500 LEU B CD2 
1276 N N   . ILE B 53  ? 0.4954 0.4036 0.5606 0.0168  -0.0500 0.0568  1501 ILE B N   
1277 C CA  . ILE B 53  ? 0.5150 0.4157 0.5626 0.0159  -0.0378 0.0486  1501 ILE B CA  
1278 C C   . ILE B 53  ? 0.5858 0.4729 0.6258 0.0177  -0.0381 0.0517  1501 ILE B C   
1279 O O   . ILE B 53  ? 0.6106 0.4895 0.6379 0.0155  -0.0490 0.0572  1501 ILE B O   
1280 C CB  . ILE B 53  ? 0.4905 0.3892 0.5133 0.0099  -0.0385 0.0428  1501 ILE B CB  
1281 C CG1 . ILE B 53  ? 0.4657 0.3772 0.4967 0.0082  -0.0367 0.0400  1501 ILE B CG1 
1282 C CG2 . ILE B 53  ? 0.4919 0.3829 0.4967 0.0083  -0.0284 0.0362  1501 ILE B CG2 
1283 C CD1 . ILE B 53  ? 0.4558 0.3770 0.5035 0.0103  -0.0250 0.0365  1501 ILE B CD1 
1284 N N   . ARG B 54  ? 0.6247 0.5084 0.6712 0.0209  -0.0256 0.0480  1502 ARG B N   
1285 C CA  . ARG B 54  ? 0.6500 0.5202 0.6934 0.0233  -0.0254 0.0519  1502 ARG B CA  
1286 C C   . ARG B 54  ? 0.5956 0.4538 0.6095 0.0186  -0.0221 0.0468  1502 ARG B C   
1287 O O   . ARG B 54  ? 0.5748 0.4212 0.5798 0.0187  -0.0273 0.0521  1502 ARG B O   
1288 C CB  . ARG B 54  ? 0.7475 0.6171 0.8147 0.0292  -0.0134 0.0512  1502 ARG B CB  
1289 C CG  . ARG B 54  ? 0.8147 0.6939 0.9159 0.0352  -0.0184 0.0598  1502 ARG B CG  
1290 C CD  . ARG B 54  ? 0.9218 0.7943 1.0474 0.0423  -0.0113 0.0643  1502 ARG B CD  
1291 N NE  . ARG B 54  ? 1.0159 0.8869 1.1465 0.0429  0.0090  0.0532  1502 ARG B NE  
1292 C CZ  . ARG B 54  ? 1.0403 0.8991 1.1525 0.0402  0.0207  0.0450  1502 ARG B CZ  
1293 N NH1 . ARG B 54  ? 1.0678 0.9146 1.1568 0.0376  0.0151  0.0467  1502 ARG B NH1 
1294 N NH2 . ARG B 54  ? 1.0893 0.9475 1.2057 0.0390  0.0388  0.0348  1502 ARG B NH2 
1295 N N   . LYS B 55  ? 0.5225 0.3837 0.5220 0.0144  -0.0140 0.0376  1503 LYS B N   
1296 C CA  . LYS B 55  ? 0.5237 0.3751 0.4973 0.0096  -0.0116 0.0334  1503 LYS B CA  
1297 C C   . LYS B 55  ? 0.4965 0.3536 0.4555 0.0047  -0.0143 0.0295  1503 LYS B C   
1298 O O   . LYS B 55  ? 0.4449 0.3073 0.3987 0.0018  -0.0063 0.0228  1503 LYS B O   
1299 C CB  . LYS B 55  ? 0.5505 0.3980 0.5211 0.0087  0.0024  0.0263  1503 LYS B CB  
1300 C CG  . LYS B 55  ? 0.5763 0.4168 0.5633 0.0137  0.0084  0.0287  1503 LYS B CG  
1301 C CD  . LYS B 55  ? 0.6160 0.4547 0.6019 0.0114  0.0243  0.0195  1503 LYS B CD  
1302 C CE  . LYS B 55  ? 0.6527 0.4898 0.6147 0.0040  0.0286  0.0126  1503 LYS B CE  
1303 N NZ  . LYS B 55  ? 0.6895 0.5239 0.6491 0.0001  0.0430  0.0042  1503 LYS B NZ  
1304 N N   . PRO B 56  ? 0.4711 0.3263 0.4236 0.0031  -0.0257 0.0340  1504 PRO B N   
1305 C CA  . PRO B 56  ? 0.4658 0.3243 0.4065 -0.0012 -0.0277 0.0304  1504 PRO B CA  
1306 C C   . PRO B 56  ? 0.4548 0.3071 0.3767 -0.0050 -0.0204 0.0246  1504 PRO B C   
1307 O O   . PRO B 56  ? 0.4268 0.2676 0.3365 -0.0061 -0.0189 0.0251  1504 PRO B O   
1308 C CB  . PRO B 56  ? 0.4945 0.3470 0.4281 -0.0035 -0.0406 0.0364  1504 PRO B CB  
1309 C CG  . PRO B 56  ? 0.5276 0.3798 0.4772 0.0006  -0.0474 0.0448  1504 PRO B CG  
1310 C CD  . PRO B 56  ? 0.5189 0.3672 0.4736 0.0043  -0.0374 0.0432  1504 PRO B CD  
1311 N N   . VAL B 57  ? 0.4130 0.2736 0.3345 -0.0069 -0.0156 0.0197  1505 VAL B N   
1312 C CA  . VAL B 57  ? 0.3987 0.2563 0.3071 -0.0104 -0.0086 0.0149  1505 VAL B CA  
1313 C C   . VAL B 57  ? 0.3855 0.2506 0.2951 -0.0123 -0.0083 0.0125  1505 VAL B C   
1314 O O   . VAL B 57  ? 0.3529 0.2285 0.2754 -0.0109 -0.0103 0.0135  1505 VAL B O   
1315 C CB  . VAL B 57  ? 0.4004 0.2612 0.3120 -0.0105 0.0005  0.0116  1505 VAL B CB  
1316 C CG1 . VAL B 57  ? 0.3735 0.2482 0.3005 -0.0096 0.0035  0.0105  1505 VAL B CG1 
1317 C CG2 . VAL B 57  ? 0.4130 0.2723 0.3129 -0.0148 0.0068  0.0075  1505 VAL B CG2 
1318 N N   . ASP B 58  ? 0.3813 0.2396 0.2777 -0.0154 -0.0057 0.0099  1506 ASP B N   
1319 C CA  . ASP B 58  ? 0.3726 0.2365 0.2722 -0.0167 -0.0036 0.0077  1506 ASP B CA  
1320 C C   . ASP B 58  ? 0.3365 0.2007 0.2315 -0.0191 0.0050  0.0043  1506 ASP B C   
1321 O O   . ASP B 58  ? 0.3300 0.1892 0.2173 -0.0204 0.0086  0.0032  1506 ASP B O   
1322 C CB  . ASP B 58  ? 0.3914 0.2466 0.2832 -0.0185 -0.0093 0.0080  1506 ASP B CB  
1323 C CG  . ASP B 58  ? 0.4363 0.2745 0.3071 -0.0221 -0.0108 0.0075  1506 ASP B CG  
1324 O OD1 . ASP B 58  ? 0.4272 0.2599 0.2891 -0.0233 -0.0050 0.0059  1506 ASP B OD1 
1325 O OD2 . ASP B 58  ? 0.4630 0.2927 0.3245 -0.0250 -0.0174 0.0085  1506 ASP B OD2 
1326 N N   . PHE B 59  ? 0.3061 0.1773 0.2086 -0.0196 0.0083  0.0032  1507 PHE B N   
1327 C CA  . PHE B 59  ? 0.3155 0.1893 0.2179 -0.0217 0.0159  0.0012  1507 PHE B CA  
1328 C C   . PHE B 59  ? 0.3370 0.1959 0.2228 -0.0244 0.0206  -0.0020 1507 PHE B C   
1329 O O   . PHE B 59  ? 0.3441 0.2041 0.2280 -0.0266 0.0267  -0.0034 1507 PHE B O   
1330 C CB  . PHE B 59  ? 0.3055 0.1902 0.2227 -0.0212 0.0185  0.0022  1507 PHE B CB  
1331 C CG  . PHE B 59  ? 0.3018 0.2029 0.2333 -0.0208 0.0164  0.0059  1507 PHE B CG  
1332 C CD1 . PHE B 59  ? 0.3101 0.2189 0.2426 -0.0235 0.0189  0.0063  1507 PHE B CD1 
1333 C CD2 . PHE B 59  ? 0.3125 0.2210 0.2555 -0.0189 0.0119  0.0089  1507 PHE B CD2 
1334 C CE1 . PHE B 59  ? 0.3367 0.2602 0.2791 -0.0251 0.0169  0.0095  1507 PHE B CE1 
1335 C CE2 . PHE B 59  ? 0.3194 0.2429 0.2734 -0.0199 0.0102  0.0127  1507 PHE B CE2 
1336 C CZ  . PHE B 59  ? 0.2955 0.2263 0.2483 -0.0234 0.0126  0.0129  1507 PHE B CZ  
1337 N N   . LYS B 60  ? 0.3581 0.2033 0.2312 -0.0256 0.0179  -0.0032 1508 LYS B N   
1338 C CA  . LYS B 60  ? 0.3906 0.2196 0.2437 -0.0298 0.0220  -0.0062 1508 LYS B CA  
1339 C C   . LYS B 60  ? 0.4037 0.2272 0.2469 -0.0306 0.0212  -0.0046 1508 LYS B C   
1340 O O   . LYS B 60  ? 0.4233 0.2411 0.2578 -0.0336 0.0280  -0.0068 1508 LYS B O   
1341 C CB  . LYS B 60  ? 0.4278 0.2428 0.2658 -0.0326 0.0169  -0.0069 1508 LYS B CB  
1342 C CG  . LYS B 60  ? 0.4570 0.2538 0.2712 -0.0389 0.0227  -0.0108 1508 LYS B CG  
1343 C CD  . LYS B 60  ? 0.5135 0.2969 0.3119 -0.0437 0.0190  -0.0127 1508 LYS B CD  
1344 C CE  . LYS B 60  ? 0.5502 0.3132 0.3203 -0.0520 0.0248  -0.0168 1508 LYS B CE  
1345 N NZ  . LYS B 60  ? 0.6038 0.3608 0.3615 -0.0538 0.0252  -0.0143 1508 LYS B NZ  
1346 N N   . LYS B 61  ? 0.4059 0.2310 0.2522 -0.0280 0.0133  -0.0005 1509 LYS B N   
1347 C CA  . LYS B 61  ? 0.4327 0.2530 0.2743 -0.0276 0.0128  0.0015  1509 LYS B CA  
1348 C C   . LYS B 61  ? 0.3944 0.2236 0.2439 -0.0279 0.0203  -0.0006 1509 LYS B C   
1349 O O   . LYS B 61  ? 0.3910 0.2125 0.2314 -0.0302 0.0245  -0.0013 1509 LYS B O   
1350 C CB  . LYS B 61  ? 0.4641 0.2860 0.3136 -0.0237 0.0041  0.0065  1509 LYS B CB  
1351 C CG  . LYS B 61  ? 0.5368 0.3507 0.3829 -0.0227 0.0035  0.0095  1509 LYS B CG  
1352 C CD  . LYS B 61  ? 0.6261 0.4225 0.4520 -0.0262 -0.0006 0.0127  1509 LYS B CD  
1353 C CE  . LYS B 61  ? 0.7097 0.4961 0.5320 -0.0254 -0.0011 0.0169  1509 LYS B CE  
1354 N NZ  . LYS B 61  ? 0.7843 0.5637 0.5950 -0.0292 0.0084  0.0130  1509 LYS B NZ  
1355 N N   . ILE B 62  ? 0.3750 0.2200 0.2406 -0.0265 0.0215  -0.0011 1510 ILE B N   
1356 C CA  . ILE B 62  ? 0.3567 0.2111 0.2284 -0.0287 0.0275  -0.0027 1510 ILE B CA  
1357 C C   . ILE B 62  ? 0.3734 0.2252 0.2392 -0.0326 0.0345  -0.0054 1510 ILE B C   
1358 O O   . ILE B 62  ? 0.3590 0.2089 0.2202 -0.0358 0.0391  -0.0068 1510 ILE B O   
1359 C CB  . ILE B 62  ? 0.3501 0.2218 0.2380 -0.0279 0.0263  -0.0016 1510 ILE B CB  
1360 C CG1 . ILE B 62  ? 0.3716 0.2448 0.2647 -0.0249 0.0219  0.0000  1510 ILE B CG1 
1361 C CG2 . ILE B 62  ? 0.3320 0.2145 0.2246 -0.0325 0.0316  -0.0027 1510 ILE B CG2 
1362 C CD1 . ILE B 62  ? 0.3687 0.2576 0.2758 -0.0247 0.0202  0.0014  1510 ILE B CD1 
1363 N N   . LYS B 63  ? 0.3980 0.2483 0.2638 -0.0327 0.0364  -0.0064 1511 LYS B N   
1364 C CA  . LYS B 63  ? 0.4329 0.2803 0.2952 -0.0363 0.0448  -0.0092 1511 LYS B CA  
1365 C C   . LYS B 63  ? 0.4332 0.2631 0.2749 -0.0396 0.0478  -0.0108 1511 LYS B C   
1366 O O   . LYS B 63  ? 0.4417 0.2704 0.2804 -0.0434 0.0551  -0.0128 1511 LYS B O   
1367 C CB  . LYS B 63  ? 0.4646 0.3106 0.3308 -0.0355 0.0479  -0.0108 1511 LYS B CB  
1368 C CG  . LYS B 63  ? 0.5057 0.3695 0.3954 -0.0329 0.0478  -0.0085 1511 LYS B CG  
1369 C CD  . LYS B 63  ? 0.5899 0.4491 0.4840 -0.0316 0.0518  -0.0104 1511 LYS B CD  
1370 C CE  . LYS B 63  ? 0.6497 0.5008 0.5361 -0.0298 0.0443  -0.0103 1511 LYS B CE  
1371 N NZ  . LYS B 63  ? 0.7107 0.5536 0.5974 -0.0298 0.0482  -0.0134 1511 LYS B NZ  
1372 N N   . GLU B 64  ? 0.4573 0.2742 0.2856 -0.0387 0.0417  -0.0093 1512 GLU B N   
1373 C CA  . GLU B 64  ? 0.5103 0.3094 0.3179 -0.0421 0.0422  -0.0088 1512 GLU B CA  
1374 C C   . GLU B 64  ? 0.4736 0.2725 0.2820 -0.0423 0.0431  -0.0074 1512 GLU B C   
1375 O O   . GLU B 64  ? 0.4796 0.2692 0.2766 -0.0465 0.0488  -0.0086 1512 GLU B O   
1376 C CB  . GLU B 64  ? 0.5838 0.3713 0.3796 -0.0413 0.0329  -0.0054 1512 GLU B CB  
1377 C CG  . GLU B 64  ? 0.6876 0.4583 0.4652 -0.0436 0.0286  -0.0013 1512 GLU B CG  
1378 C CD  . GLU B 64  ? 0.7774 0.5379 0.5424 -0.0451 0.0187  0.0025  1512 GLU B CD  
1379 O OE1 . GLU B 64  ? 0.8877 0.6327 0.6340 -0.0489 0.0145  0.0066  1512 GLU B OE1 
1380 O OE2 . GLU B 64  ? 0.8411 0.6089 0.6145 -0.0432 0.0146  0.0018  1512 GLU B OE2 
1381 N N   . ARG B 65  ? 0.4294 0.2379 0.2511 -0.0385 0.0389  -0.0057 1513 ARG B N   
1382 C CA  . ARG B 65  ? 0.4355 0.2433 0.2589 -0.0392 0.0415  -0.0057 1513 ARG B CA  
1383 C C   . ARG B 65  ? 0.4075 0.2237 0.2344 -0.0442 0.0497  -0.0095 1513 ARG B C   
1384 O O   . ARG B 65  ? 0.4003 0.2093 0.2202 -0.0479 0.0545  -0.0108 1513 ARG B O   
1385 C CB  . ARG B 65  ? 0.4344 0.2499 0.2709 -0.0349 0.0371  -0.0041 1513 ARG B CB  
1386 C CG  . ARG B 65  ? 0.4764 0.2833 0.3116 -0.0302 0.0287  0.0007  1513 ARG B CG  
1387 C CD  . ARG B 65  ? 0.4908 0.3059 0.3421 -0.0257 0.0263  0.0020  1513 ARG B CD  
1388 N NE  . ARG B 65  ? 0.5452 0.3572 0.4026 -0.0208 0.0180  0.0074  1513 ARG B NE  
1389 C CZ  . ARG B 65  ? 0.6632 0.4619 0.5150 -0.0191 0.0128  0.0128  1513 ARG B CZ  
1390 N NH1 . ARG B 65  ? 0.7288 0.5130 0.5653 -0.0223 0.0152  0.0138  1513 ARG B NH1 
1391 N NH2 . ARG B 65  ? 0.6238 0.4244 0.4863 -0.0146 0.0044  0.0184  1513 ARG B NH2 
1392 N N   . ILE B 66  ? 0.3882 0.2191 0.2264 -0.0448 0.0511  -0.0107 1514 ILE B N   
1393 C CA  . ILE B 66  ? 0.3869 0.2272 0.2305 -0.0500 0.0577  -0.0127 1514 ILE B CA  
1394 C C   . ILE B 66  ? 0.4068 0.2346 0.2373 -0.0538 0.0645  -0.0146 1514 ILE B C   
1395 O O   . ILE B 66  ? 0.3891 0.2134 0.2144 -0.0585 0.0691  -0.0161 1514 ILE B O   
1396 C CB  . ILE B 66  ? 0.3601 0.2184 0.2211 -0.0492 0.0573  -0.0117 1514 ILE B CB  
1397 C CG1 . ILE B 66  ? 0.3630 0.2354 0.2360 -0.0478 0.0517  -0.0096 1514 ILE B CG1 
1398 C CG2 . ILE B 66  ? 0.3663 0.2343 0.2353 -0.0544 0.0637  -0.0124 1514 ILE B CG2 
1399 C CD1 . ILE B 66  ? 0.3279 0.2158 0.2178 -0.0458 0.0490  -0.0067 1514 ILE B CD1 
1400 N N   . ARG B 67  ? 0.4078 0.2289 0.2329 -0.0527 0.0656  -0.0151 1515 ARG B N   
1401 C CA  . ARG B 67  ? 0.4541 0.2623 0.2653 -0.0572 0.0733  -0.0174 1515 ARG B CA  
1402 C C   . ARG B 67  ? 0.4675 0.2583 0.2596 -0.0600 0.0731  -0.0165 1515 ARG B C   
1403 O O   . ARG B 67  ? 0.4912 0.2753 0.2749 -0.0652 0.0805  -0.0182 1515 ARG B O   
1404 C CB  . ARG B 67  ? 0.4639 0.2644 0.2685 -0.0559 0.0737  -0.0185 1515 ARG B CB  
1405 C CG  . ARG B 67  ? 0.5253 0.3110 0.3133 -0.0612 0.0826  -0.0218 1515 ARG B CG  
1406 C CD  . ARG B 67  ? 0.5504 0.3234 0.3243 -0.0610 0.0797  -0.0226 1515 ARG B CD  
1407 N NE  . ARG B 67  ? 0.5825 0.3417 0.3379 -0.0613 0.0699  -0.0184 1515 ARG B NE  
1408 C CZ  . ARG B 67  ? 0.6155 0.3666 0.3606 -0.0607 0.0617  -0.0165 1515 ARG B CZ  
1409 N NH1 . ARG B 67  ? 0.5755 0.3292 0.3251 -0.0600 0.0629  -0.0196 1515 ARG B NH1 
1410 N NH2 . ARG B 67  ? 0.6361 0.3759 0.3671 -0.0612 0.0521  -0.0110 1515 ARG B NH2 
1411 N N   . ASN B 68  ? 0.4737 0.2579 0.2615 -0.0564 0.0651  -0.0132 1516 ASN B N   
1412 C CA  . ASN B 68  ? 0.4701 0.2371 0.2428 -0.0578 0.0639  -0.0105 1516 ASN B CA  
1413 C C   . ASN B 68  ? 0.4691 0.2386 0.2484 -0.0587 0.0663  -0.0112 1516 ASN B C   
1414 O O   . ASN B 68  ? 0.4757 0.2313 0.2471 -0.0583 0.0648  -0.0084 1516 ASN B O   
1415 C CB  . ASN B 68  ? 0.4859 0.2429 0.2523 -0.0534 0.0536  -0.0052 1516 ASN B CB  
1416 C CG  . ASN B 68  ? 0.5115 0.2596 0.2634 -0.0551 0.0504  -0.0042 1516 ASN B CG  
1417 O OD1 . ASN B 68  ? 0.5376 0.2815 0.2795 -0.0602 0.0578  -0.0080 1516 ASN B OD1 
1418 N ND2 . ASN B 68  ? 0.5011 0.2448 0.2508 -0.0518 0.0397  0.0008  1516 ASN B ND2 
1419 N N   . HIS B 69  ? 0.4520 0.2385 0.2454 -0.0607 0.0701  -0.0145 1517 HIS B N   
1420 C CA  . HIS B 69  ? 0.4627 0.2525 0.2607 -0.0639 0.0733  -0.0166 1517 HIS B CA  
1421 C C   . HIS B 69  ? 0.4892 0.2730 0.2896 -0.0594 0.0693  -0.0150 1517 HIS B C   
1422 O O   . HIS B 69  ? 0.4954 0.2689 0.2915 -0.0617 0.0733  -0.0160 1517 HIS B O   
1423 C CB  . HIS B 69  ? 0.4566 0.2354 0.2432 -0.0707 0.0809  -0.0183 1517 HIS B CB  
1424 C CG  . HIS B 69  ? 0.4545 0.2439 0.2450 -0.0763 0.0868  -0.0208 1517 HIS B CG  
1425 N ND1 . HIS B 69  ? 0.4537 0.2448 0.2437 -0.0841 0.0936  -0.0234 1517 HIS B ND1 
1426 C CD2 . HIS B 69  ? 0.4414 0.2405 0.2388 -0.0753 0.0877  -0.0209 1517 HIS B CD2 
1427 C CE1 . HIS B 69  ? 0.4533 0.2562 0.2512 -0.0874 0.0979  -0.0244 1517 HIS B CE1 
1428 N NE2 . HIS B 69  ? 0.4455 0.2534 0.2491 -0.0818 0.0949  -0.0230 1517 HIS B NE2 
1429 N N   . LYS B 70  ? 0.5032 0.2938 0.3124 -0.0531 0.0625  -0.0127 1518 LYS B N   
1430 C CA  . LYS B 70  ? 0.5204 0.3059 0.3348 -0.0483 0.0595  -0.0108 1518 LYS B CA  
1431 C C   . LYS B 70  ? 0.5222 0.3200 0.3479 -0.0497 0.0622  -0.0145 1518 LYS B C   
1432 O O   . LYS B 70  ? 0.5569 0.3500 0.3882 -0.0464 0.0625  -0.0143 1518 LYS B O   
1433 C CB  . LYS B 70  ? 0.5483 0.3329 0.3661 -0.0414 0.0505  -0.0059 1518 LYS B CB  
1434 C CG  . LYS B 70  ? 0.5922 0.3618 0.3956 -0.0411 0.0462  -0.0013 1518 LYS B CG  
1435 C CD  . LYS B 70  ? 0.6149 0.3664 0.4096 -0.0419 0.0481  0.0016  1518 LYS B CD  
1436 C CE  . LYS B 70  ? 0.6529 0.3931 0.4442 -0.0376 0.0387  0.0098  1518 LYS B CE  
1437 N NZ  . LYS B 70  ? 0.6860 0.4241 0.4643 -0.0398 0.0330  0.0118  1518 LYS B NZ  
1438 N N   . TYR B 71  ? 0.5217 0.3357 0.3520 -0.0546 0.0639  -0.0173 1519 TYR B N   
1439 C CA  . TYR B 71  ? 0.4964 0.3227 0.3341 -0.0586 0.0661  -0.0206 1519 TYR B CA  
1440 C C   . TYR B 71  ? 0.5470 0.3723 0.3780 -0.0682 0.0730  -0.0249 1519 TYR B C   
1441 O O   . TYR B 71  ? 0.5505 0.3799 0.3789 -0.0729 0.0745  -0.0248 1519 TYR B O   
1442 C CB  . TYR B 71  ? 0.4677 0.3142 0.3160 -0.0587 0.0613  -0.0190 1519 TYR B CB  
1443 C CG  . TYR B 71  ? 0.4384 0.2872 0.2938 -0.0505 0.0546  -0.0153 1519 TYR B CG  
1444 C CD1 . TYR B 71  ? 0.4275 0.2705 0.2865 -0.0450 0.0525  -0.0143 1519 TYR B CD1 
1445 C CD2 . TYR B 71  ? 0.4182 0.2746 0.2780 -0.0484 0.0508  -0.0127 1519 TYR B CD2 
1446 C CE1 . TYR B 71  ? 0.4083 0.2543 0.2743 -0.0385 0.0458  -0.0107 1519 TYR B CE1 
1447 C CE2 . TYR B 71  ? 0.3889 0.2457 0.2535 -0.0421 0.0449  -0.0098 1519 TYR B CE2 
1448 C CZ  . TYR B 71  ? 0.4122 0.2644 0.2795 -0.0374 0.0417  -0.0086 1519 TYR B CZ  
1449 O OH  . TYR B 71  ? 0.3975 0.2516 0.2707 -0.0320 0.0350  -0.0054 1519 TYR B OH  
1450 N N   . ARG B 72  ? 0.5653 0.3851 0.3943 -0.0717 0.0781  -0.0289 1520 ARG B N   
1451 C CA  . ARG B 72  ? 0.6136 0.4310 0.4349 -0.0822 0.0850  -0.0339 1520 ARG B CA  
1452 C C   . ARG B 72  ? 0.6071 0.4449 0.4320 -0.0910 0.0835  -0.0354 1520 ARG B C   
1453 O O   . ARG B 72  ? 0.5807 0.4232 0.4014 -0.1006 0.0859  -0.0373 1520 ARG B O   
1454 C CB  . ARG B 72  ? 0.6944 0.4943 0.5115 -0.0823 0.0924  -0.0382 1520 ARG B CB  
1455 C CG  . ARG B 72  ? 0.7858 0.5782 0.5928 -0.0938 0.1012  -0.0447 1520 ARG B CG  
1456 C CD  . ARG B 72  ? 0.8485 0.6286 0.6545 -0.0952 0.1097  -0.0507 1520 ARG B CD  
1457 N NE  . ARG B 72  ? 0.8888 0.6847 0.6970 -0.1009 0.1091  -0.0538 1520 ARG B NE  
1458 C CZ  . ARG B 72  ? 0.9739 0.7770 0.7918 -0.0939 0.1057  -0.0518 1520 ARG B CZ  
1459 N NH1 . ARG B 72  ? 1.0246 0.8212 0.8525 -0.0807 0.1023  -0.0467 1520 ARG B NH1 
1460 N NH2 . ARG B 72  ? 0.9781 0.7952 0.7952 -0.1010 0.1054  -0.0544 1520 ARG B NH2 
1461 N N   . SER B 73  ? 0.5882 0.4384 0.4210 -0.0886 0.0790  -0.0340 1521 SER B N   
1462 C CA  . SER B 73  ? 0.5467 0.4166 0.3821 -0.0980 0.0763  -0.0339 1521 SER B CA  
1463 C C   . SER B 73  ? 0.5208 0.4070 0.3688 -0.0921 0.0679  -0.0277 1521 SER B C   
1464 O O   . SER B 73  ? 0.5091 0.3903 0.3623 -0.0816 0.0653  -0.0254 1521 SER B O   
1465 C CB  . SER B 73  ? 0.5681 0.4348 0.3964 -0.1055 0.0818  -0.0399 1521 SER B CB  
1466 O OG  . SER B 73  ? 0.6157 0.4737 0.4480 -0.0966 0.0837  -0.0408 1521 SER B OG  
1467 N N   . LEU B 74  ? 0.5061 0.4116 0.3594 -0.0994 0.0632  -0.0246 1522 LEU B N   
1468 C CA  . LEU B 74  ? 0.4753 0.3959 0.3405 -0.0950 0.0558  -0.0187 1522 LEU B CA  
1469 C C   . LEU B 74  ? 0.4601 0.3758 0.3236 -0.0914 0.0569  -0.0209 1522 LEU B C   
1470 O O   . LEU B 74  ? 0.3951 0.3149 0.2679 -0.0833 0.0523  -0.0170 1522 LEU B O   
1471 C CB  . LEU B 74  ? 0.4988 0.4406 0.3696 -0.1053 0.0504  -0.0139 1522 LEU B CB  
1472 C CG  . LEU B 74  ? 0.4927 0.4449 0.3738 -0.1069 0.0479  -0.0091 1522 LEU B CG  
1473 C CD1 . LEU B 74  ? 0.4700 0.4457 0.3618 -0.1157 0.0404  -0.0017 1522 LEU B CD1 
1474 C CD2 . LEU B 74  ? 0.4888 0.4376 0.3810 -0.0943 0.0472  -0.0062 1522 LEU B CD2 
1475 N N   . ASN B 75  ? 0.4570 0.3630 0.3094 -0.0977 0.0641  -0.0275 1523 ASN B N   
1476 C CA  . ASN B 75  ? 0.4718 0.3709 0.3245 -0.0935 0.0678  -0.0305 1523 ASN B CA  
1477 C C   . ASN B 75  ? 0.4523 0.3390 0.3125 -0.0796 0.0678  -0.0293 1523 ASN B C   
1478 O O   . ASN B 75  ? 0.4305 0.3195 0.2989 -0.0733 0.0658  -0.0276 1523 ASN B O   
1479 C CB  . ASN B 75  ? 0.5090 0.3969 0.3488 -0.1029 0.0782  -0.0391 1523 ASN B CB  
1480 C CG  . ASN B 75  ? 0.5237 0.4245 0.3542 -0.1182 0.0777  -0.0404 1523 ASN B CG  
1481 O OD1 . ASN B 75  ? 0.4896 0.4088 0.3254 -0.1210 0.0685  -0.0335 1523 ASN B OD1 
1482 N ND2 . ASN B 75  ? 0.5435 0.4341 0.3596 -0.1291 0.0875  -0.0490 1523 ASN B ND2 
1483 N N   . ASP B 76  ? 0.4172 0.2907 0.2743 -0.0756 0.0696  -0.0299 1524 ASP B N   
1484 C CA  . ASP B 76  ? 0.4343 0.2973 0.2974 -0.0637 0.0672  -0.0269 1524 ASP B CA  
1485 C C   . ASP B 76  ? 0.3917 0.2649 0.2628 -0.0575 0.0581  -0.0207 1524 ASP B C   
1486 O O   . ASP B 76  ? 0.3732 0.2436 0.2513 -0.0494 0.0545  -0.0180 1524 ASP B O   
1487 C CB  . ASP B 76  ? 0.5016 0.3476 0.3573 -0.0621 0.0705  -0.0277 1524 ASP B CB  
1488 C CG  . ASP B 76  ? 0.5861 0.4192 0.4348 -0.0675 0.0805  -0.0340 1524 ASP B CG  
1489 O OD1 . ASP B 76  ? 0.6393 0.4668 0.4932 -0.0646 0.0850  -0.0363 1524 ASP B OD1 
1490 O OD2 . ASP B 76  ? 0.6854 0.5145 0.5244 -0.0754 0.0845  -0.0370 1524 ASP B OD2 
1491 N N   . LEU B 77  ? 0.3611 0.2457 0.2328 -0.0615 0.0549  -0.0184 1525 LEU B N   
1492 C CA  . LEU B 77  ? 0.3588 0.2529 0.2401 -0.0560 0.0478  -0.0132 1525 LEU B CA  
1493 C C   . LEU B 77  ? 0.3617 0.2662 0.2516 -0.0545 0.0443  -0.0112 1525 LEU B C   
1494 O O   . LEU B 77  ? 0.3407 0.2439 0.2370 -0.0470 0.0401  -0.0086 1525 LEU B O   
1495 C CB  . LEU B 77  ? 0.3553 0.2612 0.2401 -0.0605 0.0463  -0.0107 1525 LEU B CB  
1496 C CG  . LEU B 77  ? 0.3603 0.2758 0.2569 -0.0556 0.0409  -0.0058 1525 LEU B CG  
1497 C CD1 . LEU B 77  ? 0.3480 0.2510 0.2431 -0.0469 0.0392  -0.0055 1525 LEU B CD1 
1498 C CD2 . LEU B 77  ? 0.3667 0.2921 0.2698 -0.0595 0.0416  -0.0034 1525 LEU B CD2 
1499 N N   . GLU B 78  ? 0.3545 0.2689 0.2431 -0.0626 0.0459  -0.0124 1526 GLU B N   
1500 C CA  . GLU B 78  ? 0.3765 0.3014 0.2715 -0.0630 0.0432  -0.0102 1526 GLU B CA  
1501 C C   . GLU B 78  ? 0.4019 0.3173 0.3003 -0.0558 0.0453  -0.0121 1526 GLU B C   
1502 O O   . GLU B 78  ? 0.3801 0.3006 0.2878 -0.0506 0.0408  -0.0087 1526 GLU B O   
1503 C CB  . GLU B 78  ? 0.3810 0.3141 0.2686 -0.0753 0.0461  -0.0123 1526 GLU B CB  
1504 C CG  . GLU B 78  ? 0.3948 0.3365 0.2852 -0.0777 0.0450  -0.0109 1526 GLU B CG  
1505 C CD  . GLU B 78  ? 0.4329 0.3859 0.3145 -0.0919 0.0451  -0.0107 1526 GLU B CD  
1506 O OE1 . GLU B 78  ? 0.4031 0.3653 0.2832 -0.0988 0.0410  -0.0073 1526 GLU B OE1 
1507 O OE2 . GLU B 78  ? 0.4380 0.3911 0.3147 -0.0966 0.0491  -0.0134 1526 GLU B OE2 
1508 N N   . LYS B 79  ? 0.4141 0.3155 0.3067 -0.0556 0.0522  -0.0171 1527 LYS B N   
1509 C CA  . LYS B 79  ? 0.4179 0.3103 0.3173 -0.0483 0.0546  -0.0180 1527 LYS B CA  
1510 C C   . LYS B 79  ? 0.4051 0.2963 0.3134 -0.0384 0.0464  -0.0124 1527 LYS B C   
1511 O O   . LYS B 79  ? 0.3593 0.2521 0.2779 -0.0332 0.0443  -0.0105 1527 LYS B O   
1512 C CB  . LYS B 79  ? 0.4919 0.3679 0.3854 -0.0488 0.0630  -0.0229 1527 LYS B CB  
1513 C CG  . LYS B 79  ? 0.5359 0.4013 0.4400 -0.0406 0.0662  -0.0229 1527 LYS B CG  
1514 C CD  . LYS B 79  ? 0.5760 0.4253 0.4768 -0.0422 0.0773  -0.0285 1527 LYS B CD  
1515 C CE  . LYS B 79  ? 0.6289 0.4645 0.5271 -0.0368 0.0743  -0.0250 1527 LYS B CE  
1516 N NZ  . LYS B 79  ? 0.6425 0.4628 0.5306 -0.0415 0.0831  -0.0298 1527 LYS B NZ  
1517 N N   . ASP B 80  ? 0.3997 0.2867 0.3033 -0.0364 0.0422  -0.0102 1528 ASP B N   
1518 C CA  . ASP B 80  ? 0.3972 0.2802 0.3052 -0.0289 0.0350  -0.0058 1528 ASP B CA  
1519 C C   . ASP B 80  ? 0.3607 0.2564 0.2763 -0.0279 0.0289  -0.0025 1528 ASP B C   
1520 O O   . ASP B 80  ? 0.3449 0.2403 0.2673 -0.0228 0.0236  0.0003  1528 ASP B O   
1521 C CB  . ASP B 80  ? 0.4248 0.2972 0.3223 -0.0286 0.0339  -0.0053 1528 ASP B CB  
1522 C CG  . ASP B 80  ? 0.4689 0.3269 0.3645 -0.0230 0.0307  -0.0026 1528 ASP B CG  
1523 O OD1 . ASP B 80  ? 0.4959 0.3514 0.4003 -0.0192 0.0307  -0.0015 1528 ASP B OD1 
1524 O OD2 . ASP B 80  ? 0.4411 0.2900 0.3265 -0.0231 0.0285  -0.0013 1528 ASP B OD2 
1525 N N   . VAL B 81  ? 0.3345 0.2413 0.2497 -0.0332 0.0294  -0.0023 1529 VAL B N   
1526 C CA  . VAL B 81  ? 0.3274 0.2468 0.2521 -0.0327 0.0245  0.0014  1529 VAL B CA  
1527 C C   . VAL B 81  ? 0.3108 0.2361 0.2429 -0.0322 0.0243  0.0019  1529 VAL B C   
1528 O O   . VAL B 81  ? 0.2969 0.2254 0.2374 -0.0282 0.0195  0.0050  1529 VAL B O   
1529 C CB  . VAL B 81  ? 0.3290 0.2604 0.2546 -0.0388 0.0247  0.0031  1529 VAL B CB  
1530 C CG1 . VAL B 81  ? 0.3487 0.2927 0.2855 -0.0383 0.0198  0.0082  1529 VAL B CG1 
1531 C CG2 . VAL B 81  ? 0.3523 0.2791 0.2744 -0.0386 0.0257  0.0028  1529 VAL B CG2 
1532 N N   . MET B 82  ? 0.3206 0.2470 0.2492 -0.0373 0.0304  -0.0014 1530 MET B N   
1533 C CA  . MET B 82  ? 0.3351 0.2667 0.2703 -0.0378 0.0324  -0.0017 1530 MET B CA  
1534 C C   . MET B 82  ? 0.3282 0.2519 0.2725 -0.0295 0.0314  -0.0012 1530 MET B C   
1535 O O   . MET B 82  ? 0.3313 0.2607 0.2858 -0.0272 0.0293  0.0008  1530 MET B O   
1536 C CB  . MET B 82  ? 0.3799 0.3114 0.3068 -0.0463 0.0413  -0.0069 1530 MET B CB  
1537 C CG  . MET B 82  ? 0.3980 0.3396 0.3161 -0.0564 0.0405  -0.0060 1530 MET B CG  
1538 S SD  . MET B 82  ? 0.3957 0.3544 0.3224 -0.0580 0.0324  0.0017  1530 MET B SD  
1539 C CE  . MET B 82  ? 0.4231 0.3931 0.3432 -0.0683 0.0290  0.0054  1530 MET B CE  
1540 N N   . LEU B 83  ? 0.3232 0.2341 0.2649 -0.0254 0.0323  -0.0024 1531 LEU B N   
1541 C CA  . LEU B 83  ? 0.3411 0.2459 0.2927 -0.0177 0.0284  0.0003  1531 LEU B CA  
1542 C C   . LEU B 83  ? 0.3201 0.2282 0.2761 -0.0140 0.0180  0.0054  1531 LEU B C   
1543 O O   . LEU B 83  ? 0.3037 0.2140 0.2714 -0.0100 0.0141  0.0083  1531 LEU B O   
1544 C CB  . LEU B 83  ? 0.3735 0.2639 0.3198 -0.0150 0.0297  -0.0001 1531 LEU B CB  
1545 C CG  . LEU B 83  ? 0.3948 0.2769 0.3501 -0.0078 0.0246  0.0044  1531 LEU B CG  
1546 C CD1 . LEU B 83  ? 0.3821 0.2671 0.3551 -0.0046 0.0294  0.0043  1531 LEU B CD1 
1547 C CD2 . LEU B 83  ? 0.3930 0.2603 0.3384 -0.0074 0.0264  0.0042  1531 LEU B CD2 
1548 N N   . LEU B 84  ? 0.2956 0.2028 0.2427 -0.0154 0.0144  0.0061  1532 LEU B N   
1549 C CA  . LEU B 84  ? 0.2867 0.1960 0.2367 -0.0134 0.0068  0.0094  1532 LEU B CA  
1550 C C   . LEU B 84  ? 0.2529 0.1747 0.2149 -0.0139 0.0056  0.0112  1532 LEU B C   
1551 O O   . LEU B 84  ? 0.2438 0.1668 0.2138 -0.0112 0.0005  0.0138  1532 LEU B O   
1552 C CB  . LEU B 84  ? 0.2901 0.1984 0.2312 -0.0159 0.0069  0.0087  1532 LEU B CB  
1553 C CG  . LEU B 84  ? 0.2863 0.1925 0.2273 -0.0146 0.0016  0.0104  1532 LEU B CG  
1554 C CD1 . LEU B 84  ? 0.3003 0.2008 0.2315 -0.0166 0.0048  0.0084  1532 LEU B CD1 
1555 C CD2 . LEU B 84  ? 0.2891 0.2068 0.2415 -0.0149 -0.0003 0.0128  1532 LEU B CD2 
1556 N N   . CYS B 85  ? 0.2562 0.1872 0.2184 -0.0184 0.0103  0.0102  1533 CYS B N   
1557 C CA  . CYS B 85  ? 0.2584 0.2007 0.2298 -0.0201 0.0091  0.0126  1533 CYS B CA  
1558 C C   . CYS B 85  ? 0.2570 0.2006 0.2384 -0.0181 0.0113  0.0122  1533 CYS B C   
1559 O O   . CYS B 85  ? 0.2424 0.1910 0.2341 -0.0163 0.0073  0.0151  1533 CYS B O   
1560 C CB  . CYS B 85  ? 0.2796 0.2318 0.2469 -0.0271 0.0125  0.0129  1533 CYS B CB  
1561 S SG  . CYS B 85  ? 0.2943 0.2486 0.2574 -0.0288 0.0097  0.0153  1533 CYS B SG  
1562 N N   . GLN B 86  ? 0.2545 0.1929 0.2343 -0.0182 0.0182  0.0085  1534 GLN B N   
1563 C CA  . GLN B 86  ? 0.2917 0.2302 0.2844 -0.0153 0.0220  0.0080  1534 GLN B CA  
1564 C C   . GLN B 86  ? 0.2844 0.2200 0.2889 -0.0085 0.0138  0.0123  1534 GLN B C   
1565 O O   . GLN B 86  ? 0.2826 0.2247 0.3015 -0.0068 0.0123  0.0147  1534 GLN B O   
1566 C CB  . GLN B 86  ? 0.3330 0.2626 0.3226 -0.0156 0.0313  0.0031  1534 GLN B CB  
1567 C CG  . GLN B 86  ? 0.3913 0.3202 0.3971 -0.0122 0.0378  0.0021  1534 GLN B CG  
1568 C CD  . GLN B 86  ? 0.4327 0.3517 0.4349 -0.0137 0.0498  -0.0037 1534 GLN B CD  
1569 O OE1 . GLN B 86  ? 0.5128 0.4232 0.5022 -0.0151 0.0505  -0.0056 1534 GLN B OE1 
1570 N NE2 . GLN B 86  ? 0.4820 0.4016 0.4956 -0.0140 0.0604  -0.0071 1534 GLN B NE2 
1571 N N   . ASN B 87  ? 0.2835 0.2098 0.2810 -0.0058 0.0081  0.0138  1535 ASN B N   
1572 C CA  . ASN B 87  ? 0.2937 0.2168 0.2977 -0.0016 -0.0018 0.0187  1535 ASN B CA  
1573 C C   . ASN B 87  ? 0.2794 0.2098 0.2873 -0.0029 -0.0086 0.0212  1535 ASN B C   
1574 O O   . ASN B 87  ? 0.2904 0.2242 0.3111 -0.0008 -0.0144 0.0249  1535 ASN B O   
1575 C CB  . ASN B 87  ? 0.3021 0.2127 0.2915 -0.0011 -0.0066 0.0195  1535 ASN B CB  
1576 C CG  . ASN B 87  ? 0.3183 0.2194 0.3065 0.0011  -0.0024 0.0190  1535 ASN B CG  
1577 O OD1 . ASN B 87  ? 0.3113 0.2141 0.3129 0.0035  0.0031  0.0188  1535 ASN B OD1 
1578 N ND2 . ASN B 87  ? 0.3312 0.2209 0.3036 0.0002  -0.0044 0.0190  1535 ASN B ND2 
1579 N N   . ALA B 88  ? 0.2802 0.2130 0.2786 -0.0063 -0.0082 0.0198  1536 ALA B N   
1580 C CA  . ALA B 88  ? 0.2553 0.1941 0.2587 -0.0075 -0.0132 0.0222  1536 ALA B CA  
1581 C C   . ALA B 88  ? 0.2584 0.2082 0.2764 -0.0081 -0.0110 0.0236  1536 ALA B C   
1582 O O   . ALA B 88  ? 0.2584 0.2117 0.2854 -0.0078 -0.0166 0.0265  1536 ALA B O   
1583 C CB  . ALA B 88  ? 0.2552 0.1952 0.2499 -0.0105 -0.0118 0.0213  1536 ALA B CB  
1584 N N   . GLN B 89  ? 0.2622 0.2170 0.2818 -0.0101 -0.0025 0.0213  1537 GLN B N   
1585 C CA  . GLN B 89  ? 0.2700 0.2347 0.3021 -0.0118 0.0016  0.0220  1537 GLN B CA  
1586 C C   . GLN B 89  ? 0.2962 0.2614 0.3456 -0.0075 0.0015  0.0232  1537 GLN B C   
1587 O O   . GLN B 89  ? 0.3165 0.2899 0.3798 -0.0080 0.0024  0.0250  1537 GLN B O   
1588 C CB  . GLN B 89  ? 0.2683 0.2369 0.2930 -0.0174 0.0117  0.0185  1537 GLN B CB  
1589 C CG  . GLN B 89  ? 0.2701 0.2431 0.2833 -0.0227 0.0102  0.0200  1537 GLN B CG  
1590 C CD  . GLN B 89  ? 0.2937 0.2665 0.2938 -0.0286 0.0172  0.0165  1537 GLN B CD  
1591 O OE1 . GLN B 89  ? 0.2929 0.2659 0.2922 -0.0318 0.0259  0.0126  1537 GLN B OE1 
1592 N NE2 . GLN B 89  ? 0.2894 0.2615 0.2796 -0.0305 0.0144  0.0174  1537 GLN B NE2 
1593 N N   . THR B 90  ? 0.3273 0.2842 0.3773 -0.0032 0.0000  0.0233  1538 THR B N   
1594 C CA  . THR B 90  ? 0.3309 0.2885 0.4003 0.0015  -0.0019 0.0264  1538 THR B CA  
1595 C C   . THR B 90  ? 0.3267 0.2855 0.4025 0.0028  -0.0150 0.0320  1538 THR B C   
1596 O O   . THR B 90  ? 0.3575 0.3241 0.4526 0.0041  -0.0174 0.0354  1538 THR B O   
1597 C CB  . THR B 90  ? 0.3312 0.2785 0.3987 0.0053  0.0005  0.0257  1538 THR B CB  
1598 O OG1 . THR B 90  ? 0.3449 0.2908 0.4078 0.0031  0.0141  0.0197  1538 THR B OG1 
1599 C CG2 . THR B 90  ? 0.3517 0.2999 0.4425 0.0111  -0.0036 0.0314  1538 THR B CG2 
1600 N N   . PHE B 91  ? 0.3488 0.2998 0.4083 0.0016  -0.0230 0.0327  1539 PHE B N   
1601 C CA  . PHE B 91  ? 0.3279 0.2774 0.3880 0.0006  -0.0355 0.0369  1539 PHE B CA  
1602 C C   . PHE B 91  ? 0.3314 0.2884 0.3957 -0.0027 -0.0377 0.0373  1539 PHE B C   
1603 O O   . PHE B 91  ? 0.3337 0.2946 0.4094 -0.0034 -0.0457 0.0412  1539 PHE B O   
1604 C CB  . PHE B 91  ? 0.3428 0.2794 0.3812 -0.0009 -0.0413 0.0362  1539 PHE B CB  
1605 C CG  . PHE B 91  ? 0.3535 0.2864 0.3892 -0.0037 -0.0537 0.0399  1539 PHE B CG  
1606 C CD1 . PHE B 91  ? 0.3717 0.3054 0.4189 -0.0025 -0.0630 0.0462  1539 PHE B CD1 
1607 C CD2 . PHE B 91  ? 0.3551 0.2839 0.3783 -0.0080 -0.0560 0.0373  1539 PHE B CD2 
1608 C CE1 . PHE B 91  ? 0.3716 0.3025 0.4149 -0.0071 -0.0754 0.0497  1539 PHE B CE1 
1609 C CE2 . PHE B 91  ? 0.3696 0.2940 0.3888 -0.0122 -0.0665 0.0396  1539 PHE B CE2 
1610 C CZ  . PHE B 91  ? 0.3829 0.3084 0.4106 -0.0125 -0.0768 0.0458  1539 PHE B CZ  
1611 N N   . ASN B 92  ? 0.3140 0.2730 0.3698 -0.0052 -0.0315 0.0341  1540 ASN B N   
1612 C CA  . ASN B 92  ? 0.3098 0.2738 0.3683 -0.0085 -0.0336 0.0351  1540 ASN B CA  
1613 C C   . ASN B 92  ? 0.3142 0.2902 0.3864 -0.0096 -0.0267 0.0357  1540 ASN B C   
1614 O O   . ASN B 92  ? 0.3113 0.2901 0.3848 -0.0090 -0.0184 0.0336  1540 ASN B O   
1615 C CB  . ASN B 92  ? 0.2939 0.2527 0.3368 -0.0107 -0.0319 0.0329  1540 ASN B CB  
1616 C CG  . ASN B 92  ? 0.3010 0.2468 0.3287 -0.0104 -0.0364 0.0312  1540 ASN B CG  
1617 O OD1 . ASN B 92  ? 0.2952 0.2347 0.3192 -0.0124 -0.0430 0.0316  1540 ASN B OD1 
1618 N ND2 . ASN B 92  ? 0.3011 0.2419 0.3185 -0.0091 -0.0321 0.0288  1540 ASN B ND2 
1619 N N   . LEU B 93  ? 0.3274 0.3092 0.4082 -0.0121 -0.0296 0.0381  1541 LEU B N   
1620 C CA  . LEU B 93  ? 0.3332 0.3261 0.4268 -0.0142 -0.0230 0.0391  1541 LEU B CA  
1621 C C   . LEU B 93  ? 0.3039 0.2997 0.3873 -0.0179 -0.0157 0.0381  1541 LEU B C   
1622 O O   . LEU B 93  ? 0.2785 0.2705 0.3509 -0.0194 -0.0182 0.0387  1541 LEU B O   
1623 C CB  . LEU B 93  ? 0.3837 0.3815 0.4897 -0.0164 -0.0291 0.0427  1541 LEU B CB  
1624 C CG  . LEU B 93  ? 0.4439 0.4443 0.5664 -0.0145 -0.0361 0.0453  1541 LEU B CG  
1625 C CD1 . LEU B 93  ? 0.4368 0.4432 0.5714 -0.0183 -0.0410 0.0486  1541 LEU B CD1 
1626 C CD2 . LEU B 93  ? 0.4613 0.4682 0.5994 -0.0111 -0.0288 0.0451  1541 LEU B CD2 
1627 N N   . GLU B 94  ? 0.2852 0.2877 0.3727 -0.0201 -0.0064 0.0367  1542 GLU B N   
1628 C CA  . GLU B 94  ? 0.2776 0.2846 0.3556 -0.0260 -0.0004 0.0370  1542 GLU B CA  
1629 C C   . GLU B 94  ? 0.2692 0.2804 0.3519 -0.0291 -0.0054 0.0422  1542 GLU B C   
1630 O O   . GLU B 94  ? 0.2654 0.2802 0.3624 -0.0286 -0.0077 0.0439  1542 GLU B O   
1631 C CB  . GLU B 94  ? 0.2870 0.2991 0.3682 -0.0292 0.0113  0.0337  1542 GLU B CB  
1632 C CG  . GLU B 94  ? 0.3134 0.3297 0.3810 -0.0376 0.0176  0.0340  1542 GLU B CG  
1633 C CD  . GLU B 94  ? 0.3685 0.3859 0.4325 -0.0423 0.0313  0.0284  1542 GLU B CD  
1634 O OE1 . GLU B 94  ? 0.3864 0.4020 0.4632 -0.0380 0.0377  0.0243  1542 GLU B OE1 
1635 O OE2 . GLU B 94  ? 0.3659 0.3858 0.4144 -0.0510 0.0356  0.0284  1542 GLU B OE2 
1636 N N   . GLY B 95  ? 0.2263 0.2372 0.2990 -0.0321 -0.0074 0.0452  1543 GLY B N   
1637 C CA  . GLY B 95  ? 0.2181 0.2306 0.2960 -0.0342 -0.0123 0.0506  1543 GLY B CA  
1638 C C   . GLY B 95  ? 0.2144 0.2179 0.2914 -0.0303 -0.0198 0.0510  1543 GLY B C   
1639 O O   . GLY B 95  ? 0.2059 0.2084 0.2864 -0.0317 -0.0229 0.0551  1543 GLY B O   
1640 N N   . SER B 96  ? 0.2119 0.2077 0.2834 -0.0260 -0.0218 0.0466  1544 SER B N   
1641 C CA  . SER B 96  ? 0.2192 0.2046 0.2860 -0.0236 -0.0269 0.0457  1544 SER B CA  
1642 C C   . SER B 96  ? 0.2055 0.1890 0.2633 -0.0235 -0.0245 0.0464  1544 SER B C   
1643 O O   . SER B 96  ? 0.1986 0.1873 0.2510 -0.0250 -0.0203 0.0464  1544 SER B O   
1644 C CB  . SER B 96  ? 0.2300 0.2077 0.2939 -0.0205 -0.0309 0.0417  1544 SER B CB  
1645 O OG  . SER B 96  ? 0.2283 0.2042 0.2840 -0.0182 -0.0276 0.0386  1544 SER B OG  
1646 N N   . LEU B 97  ? 0.2089 0.1848 0.2661 -0.0225 -0.0267 0.0470  1545 LEU B N   
1647 C CA  . LEU B 97  ? 0.1972 0.1713 0.2498 -0.0216 -0.0243 0.0479  1545 LEU B CA  
1648 C C   . LEU B 97  ? 0.2039 0.1740 0.2452 -0.0197 -0.0222 0.0429  1545 LEU B C   
1649 O O   . LEU B 97  ? 0.2081 0.1829 0.2458 -0.0207 -0.0193 0.0440  1545 LEU B O   
1650 C CB  . LEU B 97  ? 0.1986 0.1630 0.2547 -0.0202 -0.0251 0.0482  1545 LEU B CB  
1651 C CG  . LEU B 97  ? 0.1869 0.1500 0.2439 -0.0187 -0.0219 0.0501  1545 LEU B CG  
1652 C CD1 . LEU B 97  ? 0.1770 0.1533 0.2408 -0.0211 -0.0216 0.0581  1545 LEU B CD1 
1653 C CD2 . LEU B 97  ? 0.1963 0.1476 0.2590 -0.0172 -0.0206 0.0493  1545 LEU B CD2 
1654 N N   . ILE B 98  ? 0.2167 0.1779 0.2524 -0.0178 -0.0243 0.0380  1546 ILE B N   
1655 C CA  . ILE B 98  ? 0.2249 0.1801 0.2492 -0.0161 -0.0225 0.0338  1546 ILE B CA  
1656 C C   . ILE B 98  ? 0.2059 0.1692 0.2288 -0.0169 -0.0190 0.0336  1546 ILE B C   
1657 O O   . ILE B 98  ? 0.1958 0.1591 0.2114 -0.0173 -0.0154 0.0322  1546 ILE B O   
1658 C CB  . ILE B 98  ? 0.2529 0.1970 0.2706 -0.0149 -0.0269 0.0302  1546 ILE B CB  
1659 C CG1 . ILE B 98  ? 0.2598 0.1979 0.2658 -0.0135 -0.0251 0.0269  1546 ILE B CG1 
1660 C CG2 . ILE B 98  ? 0.2679 0.2166 0.2946 -0.0151 -0.0316 0.0318  1546 ILE B CG2 
1661 C CD1 . ILE B 98  ? 0.2961 0.2206 0.2910 -0.0137 -0.0294 0.0241  1546 ILE B CD1 
1662 N N   . TYR B 99  ? 0.2059 0.1757 0.2362 -0.0177 -0.0190 0.0347  1547 TYR B N   
1663 C CA  . TYR B 99  ? 0.2161 0.1926 0.2454 -0.0195 -0.0134 0.0336  1547 TYR B CA  
1664 C C   . TYR B 99  ? 0.2096 0.1925 0.2338 -0.0238 -0.0100 0.0357  1547 TYR B C   
1665 O O   . TYR B 99  ? 0.2147 0.1979 0.2305 -0.0257 -0.0058 0.0332  1547 TYR B O   
1666 C CB  . TYR B 99  ? 0.2332 0.2166 0.2739 -0.0206 -0.0125 0.0350  1547 TYR B CB  
1667 C CG  . TYR B 99  ? 0.2496 0.2381 0.2908 -0.0227 -0.0049 0.0327  1547 TYR B CG  
1668 C CD1 . TYR B 99  ? 0.2769 0.2724 0.3130 -0.0287 0.0002  0.0336  1547 TYR B CD1 
1669 C CD2 . TYR B 99  ? 0.2724 0.2586 0.3209 -0.0193 -0.0027 0.0300  1547 TYR B CD2 
1670 C CE1 . TYR B 99  ? 0.3003 0.2990 0.3353 -0.0322 0.0088  0.0304  1547 TYR B CE1 
1671 C CE2 . TYR B 99  ? 0.3091 0.2987 0.3599 -0.0213 0.0067  0.0270  1547 TYR B CE2 
1672 C CZ  . TYR B 99  ? 0.3125 0.3074 0.3548 -0.0282 0.0131  0.0264  1547 TYR B CZ  
1673 O OH  . TYR B 99  ? 0.3663 0.3631 0.4076 -0.0322 0.0241  0.0222  1547 TYR B OH  
1674 N N   . GLU B 100 ? 0.2051 0.1935 0.2350 -0.0261 -0.0124 0.0411  1548 GLU B N   
1675 C CA  . GLU B 100 ? 0.2093 0.2060 0.2363 -0.0312 -0.0110 0.0454  1548 GLU B CA  
1676 C C   . GLU B 100 ? 0.2036 0.1975 0.2256 -0.0302 -0.0112 0.0453  1548 GLU B C   
1677 O O   . GLU B 100 ? 0.1929 0.1925 0.2088 -0.0347 -0.0094 0.0465  1548 GLU B O   
1678 C CB  . GLU B 100 ? 0.2162 0.2194 0.2524 -0.0338 -0.0142 0.0531  1548 GLU B CB  
1679 C CG  . GLU B 100 ? 0.2363 0.2505 0.2684 -0.0417 -0.0131 0.0587  1548 GLU B CG  
1680 C CD  . GLU B 100 ? 0.2470 0.2648 0.2714 -0.0470 -0.0072 0.0547  1548 GLU B CD  
1681 O OE1 . GLU B 100 ? 0.2456 0.2599 0.2745 -0.0439 -0.0047 0.0502  1548 GLU B OE1 
1682 O OE2 . GLU B 100 ? 0.2691 0.2931 0.2837 -0.0548 -0.0049 0.0563  1548 GLU B OE2 
1683 N N   . ASP B 101 ? 0.2058 0.1906 0.2300 -0.0251 -0.0131 0.0436  1549 ASP B N   
1684 C CA  . ASP B 101 ? 0.2084 0.1895 0.2288 -0.0239 -0.0117 0.0425  1549 ASP B CA  
1685 C C   . ASP B 101 ? 0.1994 0.1785 0.2079 -0.0251 -0.0082 0.0373  1549 ASP B C   
1686 O O   . ASP B 101 ? 0.2041 0.1872 0.2095 -0.0278 -0.0066 0.0384  1549 ASP B O   
1687 C CB  . ASP B 101 ? 0.2248 0.1941 0.2469 -0.0192 -0.0124 0.0399  1549 ASP B CB  
1688 C CG  . ASP B 101 ? 0.2534 0.2239 0.2885 -0.0185 -0.0140 0.0453  1549 ASP B CG  
1689 O OD1 . ASP B 101 ? 0.2619 0.2432 0.3057 -0.0210 -0.0152 0.0525  1549 ASP B OD1 
1690 O OD2 . ASP B 101 ? 0.3039 0.2635 0.3402 -0.0159 -0.0140 0.0424  1549 ASP B OD2 
1691 N N   . SER B 102 ? 0.1973 0.1711 0.2011 -0.0236 -0.0071 0.0326  1550 SER B N   
1692 C CA  . SER B 102 ? 0.2163 0.1864 0.2102 -0.0244 -0.0031 0.0279  1550 SER B CA  
1693 C C   . SER B 102 ? 0.2113 0.1908 0.2013 -0.0312 0.0006  0.0286  1550 SER B C   
1694 O O   . SER B 102 ? 0.2092 0.1882 0.1907 -0.0344 0.0038  0.0263  1550 SER B O   
1695 C CB  . SER B 102 ? 0.2157 0.1784 0.2096 -0.0208 -0.0031 0.0243  1550 SER B CB  
1696 O OG  . SER B 102 ? 0.2258 0.1953 0.2258 -0.0227 -0.0010 0.0249  1550 SER B OG  
1697 N N   . ILE B 103 ? 0.2345 0.2222 0.2296 -0.0345 0.0003  0.0319  1551 ILE B N   
1698 C CA  . ILE B 103 ? 0.2522 0.2485 0.2409 -0.0430 0.0037  0.0330  1551 ILE B CA  
1699 C C   . ILE B 103 ? 0.2505 0.2537 0.2360 -0.0481 0.0010  0.0378  1551 ILE B C   
1700 O O   . ILE B 103 ? 0.2417 0.2462 0.2167 -0.0540 0.0040  0.0354  1551 ILE B O   
1701 C CB  . ILE B 103 ? 0.2719 0.2759 0.2662 -0.0466 0.0034  0.0369  1551 ILE B CB  
1702 C CG1 . ILE B 103 ? 0.2877 0.2877 0.2870 -0.0435 0.0077  0.0323  1551 ILE B CG1 
1703 C CG2 . ILE B 103 ? 0.2838 0.2969 0.2682 -0.0577 0.0053  0.0398  1551 ILE B CG2 
1704 C CD1 . ILE B 103 ? 0.3173 0.3135 0.3091 -0.0463 0.0167  0.0253  1551 ILE B CD1 
1705 N N   . VAL B 104 ? 0.2363 0.2434 0.2323 -0.0455 -0.0045 0.0445  1552 VAL B N   
1706 C CA  . VAL B 104 ? 0.2310 0.2460 0.2304 -0.0488 -0.0079 0.0510  1552 VAL B CA  
1707 C C   . VAL B 104 ? 0.2525 0.2631 0.2477 -0.0474 -0.0059 0.0472  1552 VAL B C   
1708 O O   . VAL B 104 ? 0.2476 0.2663 0.2405 -0.0536 -0.0069 0.0505  1552 VAL B O   
1709 C CB  . VAL B 104 ? 0.2367 0.2540 0.2523 -0.0442 -0.0127 0.0585  1552 VAL B CB  
1710 C CG1 . VAL B 104 ? 0.2502 0.2747 0.2745 -0.0453 -0.0154 0.0654  1552 VAL B CG1 
1711 C CG2 . VAL B 104 ? 0.2316 0.2559 0.2513 -0.0481 -0.0155 0.0648  1552 VAL B CG2 
1712 N N   . LEU B 105 ? 0.2469 0.2453 0.2401 -0.0405 -0.0032 0.0406  1553 LEU B N   
1713 C CA  . LEU B 105 ? 0.2619 0.2547 0.2496 -0.0396 -0.0004 0.0367  1553 LEU B CA  
1714 C C   . LEU B 105 ? 0.2632 0.2560 0.2372 -0.0460 0.0035  0.0321  1553 LEU B C   
1715 O O   . LEU B 105 ? 0.2643 0.2576 0.2347 -0.0487 0.0049  0.0312  1553 LEU B O   
1716 C CB  . LEU B 105 ? 0.2673 0.2458 0.2535 -0.0320 0.0010  0.0313  1553 LEU B CB  
1717 C CG  . LEU B 105 ? 0.2813 0.2578 0.2792 -0.0273 -0.0008 0.0346  1553 LEU B CG  
1718 C CD1 . LEU B 105 ? 0.2866 0.2485 0.2801 -0.0219 -0.0004 0.0294  1553 LEU B CD1 
1719 C CD2 . LEU B 105 ? 0.2698 0.2505 0.2737 -0.0282 0.0010  0.0371  1553 LEU B CD2 
1720 N N   . GLN B 106 ? 0.2671 0.2587 0.2344 -0.0488 0.0062  0.0288  1554 GLN B N   
1721 C CA  . GLN B 106 ? 0.2941 0.2858 0.2483 -0.0569 0.0112  0.0243  1554 GLN B CA  
1722 C C   . GLN B 106 ? 0.3025 0.3067 0.2537 -0.0669 0.0082  0.0297  1554 GLN B C   
1723 O O   . GLN B 106 ? 0.3198 0.3230 0.2629 -0.0718 0.0105  0.0269  1554 GLN B O   
1724 C CB  . GLN B 106 ? 0.2895 0.2794 0.2395 -0.0593 0.0158  0.0207  1554 GLN B CB  
1725 C CG  . GLN B 106 ? 0.2804 0.2593 0.2358 -0.0499 0.0181  0.0164  1554 GLN B CG  
1726 C CD  . GLN B 106 ? 0.2638 0.2432 0.2225 -0.0503 0.0221  0.0146  1554 GLN B CD  
1727 O OE1 . GLN B 106 ? 0.2759 0.2475 0.2400 -0.0440 0.0246  0.0112  1554 GLN B OE1 
1728 N NE2 . GLN B 106 ? 0.2867 0.2753 0.2432 -0.0578 0.0226  0.0173  1554 GLN B NE2 
1729 N N   . SER B 107 ? 0.2994 0.3157 0.2582 -0.0702 0.0024  0.0383  1555 SER B N   
1730 C CA  . SER B 107 ? 0.3162 0.3457 0.2730 -0.0806 -0.0021 0.0453  1555 SER B CA  
1731 C C   . SER B 107 ? 0.3177 0.3530 0.2885 -0.0771 -0.0065 0.0513  1555 SER B C   
1732 O O   . SER B 107 ? 0.3276 0.3714 0.2967 -0.0849 -0.0090 0.0547  1555 SER B O   
1733 C CB  . SER B 107 ? 0.3187 0.3594 0.2759 -0.0881 -0.0069 0.0534  1555 SER B CB  
1734 O OG  . SER B 107 ? 0.3252 0.3644 0.2948 -0.0798 -0.0087 0.0564  1555 SER B OG  
1735 N N   . VAL B 108 ? 0.3098 0.3395 0.2942 -0.0660 -0.0067 0.0518  1556 VAL B N   
1736 C CA  . VAL B 108 ? 0.2987 0.3300 0.2957 -0.0618 -0.0072 0.0546  1556 VAL B CA  
1737 C C   . VAL B 108 ? 0.3082 0.3331 0.2940 -0.0639 -0.0021 0.0470  1556 VAL B C   
1738 O O   . VAL B 108 ? 0.3229 0.3563 0.3137 -0.0685 -0.0035 0.0508  1556 VAL B O   
1739 C CB  . VAL B 108 ? 0.2992 0.3216 0.3084 -0.0504 -0.0059 0.0538  1556 VAL B CB  
1740 C CG1 . VAL B 108 ? 0.3039 0.3258 0.3257 -0.0461 -0.0036 0.0551  1556 VAL B CG1 
1741 C CG2 . VAL B 108 ? 0.2944 0.3229 0.3157 -0.0488 -0.0107 0.0617  1556 VAL B CG2 
1742 N N   . PHE B 109 ? 0.3037 0.3145 0.2753 -0.0615 0.0033  0.0374  1557 PHE B N   
1743 C CA  . PHE B 109 ? 0.3287 0.3315 0.2892 -0.0635 0.0085  0.0305  1557 PHE B CA  
1744 C C   . PHE B 109 ? 0.3876 0.3999 0.3398 -0.0759 0.0078  0.0316  1557 PHE B C   
1745 O O   . PHE B 109 ? 0.3714 0.3874 0.3250 -0.0796 0.0082  0.0324  1557 PHE B O   
1746 C CB  . PHE B 109 ? 0.3300 0.3166 0.2776 -0.0597 0.0140  0.0215  1557 PHE B CB  
1747 C CG  . PHE B 109 ? 0.3414 0.3189 0.2779 -0.0622 0.0194  0.0153  1557 PHE B CG  
1748 C CD1 . PHE B 109 ? 0.3479 0.3166 0.2857 -0.0565 0.0215  0.0134  1557 PHE B CD1 
1749 C CD2 . PHE B 109 ? 0.3634 0.3404 0.2871 -0.0712 0.0231  0.0112  1557 PHE B CD2 
1750 C CE1 . PHE B 109 ? 0.3654 0.3255 0.2926 -0.0595 0.0266  0.0082  1557 PHE B CE1 
1751 C CE2 . PHE B 109 ? 0.3796 0.3476 0.2933 -0.0741 0.0283  0.0056  1557 PHE B CE2 
1752 C CZ  . PHE B 109 ? 0.3957 0.3558 0.3119 -0.0680 0.0297  0.0047  1557 PHE B CZ  
1753 N N   . THR B 110 ? 0.4000 0.4155 0.3421 -0.0834 0.0075  0.0311  1558 THR B N   
1754 C CA  . THR B 110 ? 0.4326 0.4553 0.3620 -0.0978 0.0072  0.0311  1558 THR B CA  
1755 C C   . THR B 110 ? 0.4278 0.4690 0.3680 -0.1050 -0.0012 0.0420  1558 THR B C   
1756 O O   . THR B 110 ? 0.4343 0.4804 0.3681 -0.1147 -0.0016 0.0417  1558 THR B O   
1757 C CB  . THR B 110 ? 0.4314 0.4536 0.3471 -0.1057 0.0094  0.0285  1558 THR B CB  
1758 O OG1 . THR B 110 ? 0.4534 0.4829 0.3799 -0.1018 0.0041  0.0358  1558 THR B OG1 
1759 C CG2 . THR B 110 ? 0.4465 0.4512 0.3524 -0.1009 0.0193  0.0172  1558 THR B CG2 
1760 N N   . SER B 111 ? 0.4027 0.4542 0.3606 -0.1004 -0.0080 0.0522  1559 SER B N   
1761 C CA  . SER B 111 ? 0.4003 0.4701 0.3755 -0.1046 -0.0166 0.0648  1559 SER B CA  
1762 C C   . SER B 111 ? 0.3876 0.4577 0.3763 -0.0994 -0.0144 0.0646  1559 SER B C   
1763 O O   . SER B 111 ? 0.4093 0.4913 0.4022 -0.1079 -0.0181 0.0695  1559 SER B O   
1764 C CB  . SER B 111 ? 0.4029 0.4794 0.3976 -0.0974 -0.0222 0.0749  1559 SER B CB  
1765 O OG  . SER B 111 ? 0.4914 0.5748 0.4776 -0.1060 -0.0273 0.0801  1559 SER B OG  
1766 N N   . VAL B 112 ? 0.3609 0.4184 0.3566 -0.0865 -0.0086 0.0594  1560 VAL B N   
1767 C CA  . VAL B 112 ? 0.3611 0.4163 0.3674 -0.0817 -0.0042 0.0576  1560 VAL B CA  
1768 C C   . VAL B 112 ? 0.3904 0.4416 0.3800 -0.0900 -0.0002 0.0505  1560 VAL B C   
1769 O O   . VAL B 112 ? 0.4102 0.4716 0.4092 -0.0952 -0.0013 0.0544  1560 VAL B O   
1770 C CB  . VAL B 112 ? 0.3440 0.3825 0.3531 -0.0685 0.0025  0.0511  1560 VAL B CB  
1771 C CG1 . VAL B 112 ? 0.3405 0.3728 0.3531 -0.0656 0.0092  0.0467  1560 VAL B CG1 
1772 C CG2 . VAL B 112 ? 0.3311 0.3741 0.3605 -0.0611 -0.0007 0.0587  1560 VAL B CG2 
1773 N N   . ARG B 113 ? 0.4260 0.4627 0.3932 -0.0916 0.0047  0.0405  1561 ARG B N   
1774 C CA  . ARG B 113 ? 0.4265 0.4568 0.3768 -0.0997 0.0096  0.0330  1561 ARG B CA  
1775 C C   . ARG B 113 ? 0.4720 0.5191 0.4218 -0.1145 0.0038  0.0389  1561 ARG B C   
1776 O O   . ARG B 113 ? 0.4599 0.5095 0.4107 -0.1194 0.0054  0.0380  1561 ARG B O   
1777 C CB  . ARG B 113 ? 0.4363 0.4504 0.3651 -0.1005 0.0155  0.0230  1561 ARG B CB  
1778 C CG  . ARG B 113 ? 0.4626 0.4687 0.3742 -0.1097 0.0214  0.0152  1561 ARG B CG  
1779 C CD  . ARG B 113 ? 0.4826 0.4721 0.3762 -0.1102 0.0287  0.0056  1561 ARG B CD  
1780 N NE  . ARG B 113 ? 0.4945 0.4762 0.3725 -0.1202 0.0347  -0.0015 1561 ARG B NE  
1781 C CZ  . ARG B 113 ? 0.5351 0.4996 0.3982 -0.1214 0.0436  -0.0109 1561 ARG B CZ  
1782 N NH1 . ARG B 113 ? 0.5233 0.4772 0.3865 -0.1127 0.0474  -0.0143 1561 ARG B NH1 
1783 N NH2 . ARG B 113 ? 0.5646 0.5221 0.4143 -0.1315 0.0492  -0.0171 1561 ARG B NH2 
1784 N N   . GLN B 114 ? 0.5311 0.5894 0.4778 -0.1225 -0.0029 0.0450  1562 GLN B N   
1785 C CA  . GLN B 114 ? 0.6046 0.6790 0.5464 -0.1394 -0.0102 0.0513  1562 GLN B CA  
1786 C C   . GLN B 114 ? 0.6619 0.7555 0.6286 -0.1407 -0.0177 0.0633  1562 GLN B C   
1787 O O   . GLN B 114 ? 0.7036 0.8056 0.6689 -0.1517 -0.0200 0.0648  1562 GLN B O   
1788 C CB  . GLN B 114 ? 0.6291 0.7115 0.5645 -0.1466 -0.0167 0.0574  1562 GLN B CB  
1789 C CG  . GLN B 114 ? 0.7028 0.7730 0.6090 -0.1560 -0.0104 0.0468  1562 GLN B CG  
1790 C CD  . GLN B 114 ? 0.7386 0.8146 0.6386 -0.1613 -0.0150 0.0521  1562 GLN B CD  
1791 O OE1 . GLN B 114 ? 0.7720 0.8657 0.6771 -0.1708 -0.0259 0.0645  1562 GLN B OE1 
1792 N NE2 . GLN B 114 ? 0.7682 0.8296 0.6582 -0.1555 -0.0069 0.0435  1562 GLN B NE2 
1793 N N   . LYS B 115 ? 0.6436 0.7443 0.6348 -0.1298 -0.0214 0.0721  1563 LYS B N   
1794 C CA  . LYS B 115 ? 0.6812 0.7991 0.7009 -0.1288 -0.0267 0.0835  1563 LYS B CA  
1795 C C   . LYS B 115 ? 0.6658 0.7783 0.6887 -0.1269 -0.0190 0.0767  1563 LYS B C   
1796 O O   . LYS B 115 ? 0.7053 0.8324 0.7379 -0.1359 -0.0232 0.0826  1563 LYS B O   
1797 C CB  . LYS B 115 ? 0.7033 0.8224 0.7480 -0.1144 -0.0270 0.0900  1563 LYS B CB  
1798 C CG  . LYS B 115 ? 0.7433 0.8835 0.8225 -0.1140 -0.0340 0.1051  1563 LYS B CG  
1799 C CD  . LYS B 115 ? 0.7906 0.9308 0.8946 -0.1006 -0.0338 0.1119  1563 LYS B CD  
1800 C CE  . LYS B 115 ? 0.8112 0.9284 0.9090 -0.0869 -0.0211 0.0984  1563 LYS B CE  
1801 N NZ  . LYS B 115 ? 0.8721 0.9881 0.9941 -0.0748 -0.0199 0.1042  1563 LYS B NZ  
1802 N N   . ILE B 116 ? 0.6556 0.7476 0.6709 -0.1158 -0.0081 0.0652  1564 ILE B N   
1803 C CA  . ILE B 116 ? 0.6633 0.7474 0.6802 -0.1132 0.0004  0.0585  1564 ILE B CA  
1804 C C   . ILE B 116 ? 0.6847 0.7675 0.6818 -0.1269 0.0015  0.0528  1564 ILE B C   
1805 O O   . ILE B 116 ? 0.6555 0.7450 0.6620 -0.1313 0.0032  0.0541  1564 ILE B O   
1806 C CB  . ILE B 116 ? 0.6503 0.7107 0.6579 -0.1001 0.0107  0.0477  1564 ILE B CB  
1807 C CG1 . ILE B 116 ? 0.6505 0.7111 0.6790 -0.0873 0.0111  0.0524  1564 ILE B CG1 
1808 C CG2 . ILE B 116 ? 0.6712 0.7212 0.6739 -0.0998 0.0198  0.0402  1564 ILE B CG2 
1809 C CD1 . ILE B 116 ? 0.6497 0.7243 0.7093 -0.0844 0.0116  0.0608  1564 ILE B CD1 
1810 N N   . GLU B 117 ? 0.6714 0.7453 0.6423 -0.1341 0.0016  0.0464  1565 GLU B N   
1811 C CA  . GLU B 117 ? 0.7390 0.8103 0.6891 -0.1490 0.0031  0.0404  1565 GLU B CA  
1812 C C   . GLU B 117 ? 0.7817 0.8765 0.7415 -0.1642 -0.0065 0.0505  1565 GLU B C   
1813 O O   . GLU B 117 ? 0.8430 0.9369 0.7902 -0.1765 -0.0048 0.0460  1565 GLU B O   
1814 C CB  . GLU B 117 ? 0.7310 0.7888 0.6532 -0.1545 0.0060  0.0319  1565 GLU B CB  
1815 C CG  . GLU B 117 ? 0.7541 0.7860 0.6603 -0.1467 0.0181  0.0186  1565 GLU B CG  
1816 C CD  . GLU B 117 ? 0.7704 0.7882 0.6535 -0.1508 0.0231  0.0099  1565 GLU B CD  
1817 O OE1 . GLU B 117 ? 0.7354 0.7585 0.6174 -0.1513 0.0191  0.0132  1565 GLU B OE1 
1818 O OE2 . GLU B 117 ? 0.7901 0.7906 0.6570 -0.1534 0.0320  -0.0002 1565 GLU B OE2 
1819 N N   . LYS B 118 ? 0.7913 0.9072 0.7743 -0.1639 -0.0170 0.0648  1566 LYS B N   
1820 C CA  . LYS B 118 ? 0.8018 0.9423 0.7995 -0.1776 -0.0277 0.0768  1566 LYS B CA  
1821 C C   . LYS B 118 ? 0.7711 0.9180 0.7904 -0.1753 -0.0238 0.0780  1566 LYS B C   
1822 O O   . LYS B 118 ? 0.7335 0.8869 0.7828 -0.1630 -0.0221 0.0842  1566 LYS B O   
1823 C CB  . LYS B 118 ? 0.8081 0.9694 0.8275 -0.1773 -0.0406 0.0935  1566 LYS B CB  
1824 C CG  . LYS B 118 ? 0.8066 0.9633 0.8024 -0.1831 -0.0450 0.0930  1566 LYS B CG  
1825 C CD  . LYS B 118 ? 0.8395 1.0142 0.8246 -0.2047 -0.0583 0.1027  1566 LYS B CD  
1826 C CE  . LYS B 118 ? 0.8898 1.0625 0.8541 -0.2215 -0.0562 0.0948  1566 LYS B CE  
1827 N NZ  . LYS B 118 ? 0.8948 1.0849 0.8460 -0.2450 -0.0699 0.1041  1566 LYS B NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1449 ?    ?   ?   A . n 
A 1 2   MET 2   1450 ?    ?   ?   A . n 
A 1 3   LEU 3   1451 ?    ?   ?   A . n 
A 1 4   SER 4   1452 ?    ?   ?   A . n 
A 1 5   PRO 5   1453 ?    ?   ?   A . n 
A 1 6   ASN 6   1454 ?    ?   ?   A . n 
A 1 7   PRO 7   1455 ?    ?   ?   A . n 
A 1 8   PRO 8   1456 ?    ?   ?   A . n 
A 1 9   ASN 9   1457 1457 ASN ASN A . n 
A 1 10  LEU 10  1458 1458 LEU LEU A . n 
A 1 11  THR 11  1459 1459 THR THR A . n 
A 1 12  LYS 12  1460 1460 LYS LYS A . n 
A 1 13  LYS 13  1461 1461 LYS LYS A . n 
A 1 14  MET 14  1462 1462 MET MET A . n 
A 1 15  LYS 15  1463 1463 LYS LYS A . n 
A 1 16  LYS 16  1464 1464 LYS LYS A . n 
A 1 17  ILE 17  1465 1465 ILE ILE A . n 
A 1 18  VAL 18  1466 1466 VAL VAL A . n 
A 1 19  ASP 19  1467 1467 ASP ASP A . n 
A 1 20  ALA 20  1468 1468 ALA ALA A . n 
A 1 21  VAL 21  1469 1469 VAL VAL A . n 
A 1 22  ILE 22  1470 1470 ILE ILE A . n 
A 1 23  LYS 23  1471 1471 LYS LYS A . n 
A 1 24  TYR 24  1472 1472 TYR TYR A . n 
A 1 25  LYS 25  1473 1473 LYS LYS A . n 
A 1 26  ASP 26  1474 1474 ASP ASP A . n 
A 1 27  SER 27  1475 1475 SER SER A . n 
A 1 28  SER 28  1476 1476 SER SER A . n 
A 1 29  SER 29  1477 1477 SER SER A . n 
A 1 30  GLY 30  1478 1478 GLY GLY A . n 
A 1 31  ARG 31  1479 1479 ARG ARG A . n 
A 1 32  GLN 32  1480 1480 GLN GLN A . n 
A 1 33  LEU 33  1481 1481 LEU LEU A . n 
A 1 34  SER 34  1482 1482 SER SER A . n 
A 1 35  GLU 35  1483 1483 GLU GLU A . n 
A 1 36  VAL 36  1484 1484 VAL VAL A . n 
A 1 37  PHE 37  1485 1485 PHE PHE A . n 
A 1 38  ILE 38  1486 1486 ILE ILE A . n 
A 1 39  GLN 39  1487 1487 GLN GLN A . n 
A 1 40  LEU 40  1488 1488 LEU LEU A . n 
A 1 41  PRO 41  1489 1489 PRO PRO A . n 
A 1 42  SER 42  1490 1490 SER SER A . n 
A 1 43  ARG 43  1491 1491 ARG ARG A . n 
A 1 44  LYS 44  1492 1492 LYS LYS A . n 
A 1 45  GLU 45  1493 1493 GLU GLU A . n 
A 1 46  LEU 46  1494 1494 LEU LEU A . n 
A 1 47  PRO 47  1495 1495 PRO PRO A . n 
A 1 48  GLU 48  1496 1496 GLU GLU A . n 
A 1 49  TYR 49  1497 1497 TYR TYR A . n 
A 1 50  TYR 50  1498 1498 TYR TYR A . n 
A 1 51  GLU 51  1499 1499 GLU GLU A . n 
A 1 52  LEU 52  1500 1500 LEU LEU A . n 
A 1 53  ILE 53  1501 1501 ILE ILE A . n 
A 1 54  ARG 54  1502 1502 ARG ARG A . n 
A 1 55  LYS 55  1503 1503 LYS LYS A . n 
A 1 56  PRO 56  1504 1504 PRO PRO A . n 
A 1 57  VAL 57  1505 1505 VAL VAL A . n 
A 1 58  ASP 58  1506 1506 ASP ASP A . n 
A 1 59  PHE 59  1507 1507 PHE PHE A . n 
A 1 60  LYS 60  1508 1508 LYS LYS A . n 
A 1 61  LYS 61  1509 1509 LYS LYS A . n 
A 1 62  ILE 62  1510 1510 ILE ILE A . n 
A 1 63  LYS 63  1511 1511 LYS LYS A . n 
A 1 64  GLU 64  1512 1512 GLU GLU A . n 
A 1 65  ARG 65  1513 1513 ARG ARG A . n 
A 1 66  ILE 66  1514 1514 ILE ILE A . n 
A 1 67  ARG 67  1515 1515 ARG ARG A . n 
A 1 68  ASN 68  1516 1516 ASN ASN A . n 
A 1 69  HIS 69  1517 1517 HIS HIS A . n 
A 1 70  LYS 70  1518 1518 LYS LYS A . n 
A 1 71  TYR 71  1519 1519 TYR TYR A . n 
A 1 72  ARG 72  1520 1520 ARG ARG A . n 
A 1 73  SER 73  1521 1521 SER SER A . n 
A 1 74  LEU 74  1522 1522 LEU LEU A . n 
A 1 75  ASN 75  1523 1523 ASN ASN A . n 
A 1 76  ASP 76  1524 1524 ASP ASP A . n 
A 1 77  LEU 77  1525 1525 LEU LEU A . n 
A 1 78  GLU 78  1526 1526 GLU GLU A . n 
A 1 79  LYS 79  1527 1527 LYS LYS A . n 
A 1 80  ASP 80  1528 1528 ASP ASP A . n 
A 1 81  VAL 81  1529 1529 VAL VAL A . n 
A 1 82  MET 82  1530 1530 MET MET A . n 
A 1 83  LEU 83  1531 1531 LEU LEU A . n 
A 1 84  LEU 84  1532 1532 LEU LEU A . n 
A 1 85  CYS 85  1533 1533 CYS CYS A . n 
A 1 86  GLN 86  1534 1534 GLN GLN A . n 
A 1 87  ASN 87  1535 1535 ASN ASN A . n 
A 1 88  ALA 88  1536 1536 ALA ALA A . n 
A 1 89  GLN 89  1537 1537 GLN GLN A . n 
A 1 90  THR 90  1538 1538 THR THR A . n 
A 1 91  PHE 91  1539 1539 PHE PHE A . n 
A 1 92  ASN 92  1540 1540 ASN ASN A . n 
A 1 93  LEU 93  1541 1541 LEU LEU A . n 
A 1 94  GLU 94  1542 1542 GLU GLU A . n 
A 1 95  GLY 95  1543 1543 GLY GLY A . n 
A 1 96  SER 96  1544 1544 SER SER A . n 
A 1 97  LEU 97  1545 1545 LEU LEU A . n 
A 1 98  ILE 98  1546 1546 ILE ILE A . n 
A 1 99  TYR 99  1547 1547 TYR TYR A . n 
A 1 100 GLU 100 1548 1548 GLU GLU A . n 
A 1 101 ASP 101 1549 1549 ASP ASP A . n 
A 1 102 SER 102 1550 1550 SER SER A . n 
A 1 103 ILE 103 1551 1551 ILE ILE A . n 
A 1 104 VAL 104 1552 1552 VAL VAL A . n 
A 1 105 LEU 105 1553 1553 LEU LEU A . n 
A 1 106 GLN 106 1554 1554 GLN GLN A . n 
A 1 107 SER 107 1555 1555 SER SER A . n 
A 1 108 VAL 108 1556 1556 VAL VAL A . n 
A 1 109 PHE 109 1557 1557 PHE PHE A . n 
A 1 110 THR 110 1558 1558 THR THR A . n 
A 1 111 SER 111 1559 1559 SER SER A . n 
A 1 112 VAL 112 1560 1560 VAL VAL A . n 
A 1 113 ARG 113 1561 1561 ARG ARG A . n 
A 1 114 GLN 114 1562 1562 GLN GLN A . n 
A 1 115 LYS 115 1563 1563 LYS LYS A . n 
A 1 116 ILE 116 1564 1564 ILE ILE A . n 
A 1 117 GLU 117 1565 1565 GLU GLU A . n 
A 1 118 LYS 118 1566 1566 LYS LYS A . n 
A 1 119 GLU 119 1567 ?    ?   ?   A . n 
A 1 120 ASP 120 1568 ?    ?   ?   A . n 
A 1 121 ASP 121 1569 ?    ?   ?   A . n 
B 1 1   SER 1   1449 ?    ?   ?   B . n 
B 1 2   MET 2   1450 ?    ?   ?   B . n 
B 1 3   LEU 3   1451 ?    ?   ?   B . n 
B 1 4   SER 4   1452 ?    ?   ?   B . n 
B 1 5   PRO 5   1453 ?    ?   ?   B . n 
B 1 6   ASN 6   1454 ?    ?   ?   B . n 
B 1 7   PRO 7   1455 ?    ?   ?   B . n 
B 1 8   PRO 8   1456 ?    ?   ?   B . n 
B 1 9   ASN 9   1457 1457 ASN ASN B . n 
B 1 10  LEU 10  1458 1458 LEU LEU B . n 
B 1 11  THR 11  1459 1459 THR THR B . n 
B 1 12  LYS 12  1460 1460 LYS LYS B . n 
B 1 13  LYS 13  1461 1461 LYS LYS B . n 
B 1 14  MET 14  1462 1462 MET MET B . n 
B 1 15  LYS 15  1463 1463 LYS LYS B . n 
B 1 16  LYS 16  1464 1464 LYS LYS B . n 
B 1 17  ILE 17  1465 1465 ILE ILE B . n 
B 1 18  VAL 18  1466 1466 VAL VAL B . n 
B 1 19  ASP 19  1467 1467 ASP ASP B . n 
B 1 20  ALA 20  1468 1468 ALA ALA B . n 
B 1 21  VAL 21  1469 1469 VAL VAL B . n 
B 1 22  ILE 22  1470 1470 ILE ILE B . n 
B 1 23  LYS 23  1471 1471 LYS LYS B . n 
B 1 24  TYR 24  1472 1472 TYR TYR B . n 
B 1 25  LYS 25  1473 1473 LYS LYS B . n 
B 1 26  ASP 26  1474 1474 ASP ASP B . n 
B 1 27  SER 27  1475 1475 SER SER B . n 
B 1 28  SER 28  1476 1476 SER SER B . n 
B 1 29  SER 29  1477 1477 SER SER B . n 
B 1 30  GLY 30  1478 1478 GLY GLY B . n 
B 1 31  ARG 31  1479 1479 ARG ARG B . n 
B 1 32  GLN 32  1480 1480 GLN GLN B . n 
B 1 33  LEU 33  1481 1481 LEU LEU B . n 
B 1 34  SER 34  1482 1482 SER SER B . n 
B 1 35  GLU 35  1483 1483 GLU GLU B . n 
B 1 36  VAL 36  1484 1484 VAL VAL B . n 
B 1 37  PHE 37  1485 1485 PHE PHE B . n 
B 1 38  ILE 38  1486 1486 ILE ILE B . n 
B 1 39  GLN 39  1487 1487 GLN GLN B . n 
B 1 40  LEU 40  1488 1488 LEU LEU B . n 
B 1 41  PRO 41  1489 1489 PRO PRO B . n 
B 1 42  SER 42  1490 1490 SER SER B . n 
B 1 43  ARG 43  1491 1491 ARG ARG B . n 
B 1 44  LYS 44  1492 1492 LYS LYS B . n 
B 1 45  GLU 45  1493 1493 GLU GLU B . n 
B 1 46  LEU 46  1494 1494 LEU LEU B . n 
B 1 47  PRO 47  1495 1495 PRO PRO B . n 
B 1 48  GLU 48  1496 1496 GLU GLU B . n 
B 1 49  TYR 49  1497 1497 TYR TYR B . n 
B 1 50  TYR 50  1498 1498 TYR TYR B . n 
B 1 51  GLU 51  1499 1499 GLU GLU B . n 
B 1 52  LEU 52  1500 1500 LEU LEU B . n 
B 1 53  ILE 53  1501 1501 ILE ILE B . n 
B 1 54  ARG 54  1502 1502 ARG ARG B . n 
B 1 55  LYS 55  1503 1503 LYS LYS B . n 
B 1 56  PRO 56  1504 1504 PRO PRO B . n 
B 1 57  VAL 57  1505 1505 VAL VAL B . n 
B 1 58  ASP 58  1506 1506 ASP ASP B . n 
B 1 59  PHE 59  1507 1507 PHE PHE B . n 
B 1 60  LYS 60  1508 1508 LYS LYS B . n 
B 1 61  LYS 61  1509 1509 LYS LYS B . n 
B 1 62  ILE 62  1510 1510 ILE ILE B . n 
B 1 63  LYS 63  1511 1511 LYS LYS B . n 
B 1 64  GLU 64  1512 1512 GLU GLU B . n 
B 1 65  ARG 65  1513 1513 ARG ARG B . n 
B 1 66  ILE 66  1514 1514 ILE ILE B . n 
B 1 67  ARG 67  1515 1515 ARG ARG B . n 
B 1 68  ASN 68  1516 1516 ASN ASN B . n 
B 1 69  HIS 69  1517 1517 HIS HIS B . n 
B 1 70  LYS 70  1518 1518 LYS LYS B . n 
B 1 71  TYR 71  1519 1519 TYR TYR B . n 
B 1 72  ARG 72  1520 1520 ARG ARG B . n 
B 1 73  SER 73  1521 1521 SER SER B . n 
B 1 74  LEU 74  1522 1522 LEU LEU B . n 
B 1 75  ASN 75  1523 1523 ASN ASN B . n 
B 1 76  ASP 76  1524 1524 ASP ASP B . n 
B 1 77  LEU 77  1525 1525 LEU LEU B . n 
B 1 78  GLU 78  1526 1526 GLU GLU B . n 
B 1 79  LYS 79  1527 1527 LYS LYS B . n 
B 1 80  ASP 80  1528 1528 ASP ASP B . n 
B 1 81  VAL 81  1529 1529 VAL VAL B . n 
B 1 82  MET 82  1530 1530 MET MET B . n 
B 1 83  LEU 83  1531 1531 LEU LEU B . n 
B 1 84  LEU 84  1532 1532 LEU LEU B . n 
B 1 85  CYS 85  1533 1533 CYS CYS B . n 
B 1 86  GLN 86  1534 1534 GLN GLN B . n 
B 1 87  ASN 87  1535 1535 ASN ASN B . n 
B 1 88  ALA 88  1536 1536 ALA ALA B . n 
B 1 89  GLN 89  1537 1537 GLN GLN B . n 
B 1 90  THR 90  1538 1538 THR THR B . n 
B 1 91  PHE 91  1539 1539 PHE PHE B . n 
B 1 92  ASN 92  1540 1540 ASN ASN B . n 
B 1 93  LEU 93  1541 1541 LEU LEU B . n 
B 1 94  GLU 94  1542 1542 GLU GLU B . n 
B 1 95  GLY 95  1543 1543 GLY GLY B . n 
B 1 96  SER 96  1544 1544 SER SER B . n 
B 1 97  LEU 97  1545 1545 LEU LEU B . n 
B 1 98  ILE 98  1546 1546 ILE ILE B . n 
B 1 99  TYR 99  1547 1547 TYR TYR B . n 
B 1 100 GLU 100 1548 1548 GLU GLU B . n 
B 1 101 ASP 101 1549 1549 ASP ASP B . n 
B 1 102 SER 102 1550 1550 SER SER B . n 
B 1 103 ILE 103 1551 1551 ILE ILE B . n 
B 1 104 VAL 104 1552 1552 VAL VAL B . n 
B 1 105 LEU 105 1553 1553 LEU LEU B . n 
B 1 106 GLN 106 1554 1554 GLN GLN B . n 
B 1 107 SER 107 1555 1555 SER SER B . n 
B 1 108 VAL 108 1556 1556 VAL VAL B . n 
B 1 109 PHE 109 1557 1557 PHE PHE B . n 
B 1 110 THR 110 1558 1558 THR THR B . n 
B 1 111 SER 111 1559 1559 SER SER B . n 
B 1 112 VAL 112 1560 1560 VAL VAL B . n 
B 1 113 ARG 113 1561 1561 ARG ARG B . n 
B 1 114 GLN 114 1562 1562 GLN GLN B . n 
B 1 115 LYS 115 1563 1563 LYS LYS B . n 
B 1 116 ILE 116 1564 1564 ILE ILE B . n 
B 1 117 GLU 117 1565 1565 GLU GLU B . n 
B 1 118 LYS 118 1566 1566 LYS LYS B . n 
B 1 119 GLU 119 1567 ?    ?   ?   B . n 
B 1 120 ASP 120 1568 ?    ?   ?   B . n 
B 1 121 ASP 121 1569 ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  1601 2   ZN  ZN  A . 
D 3 EDO 1  1602 1   EDO EDO A . 
E 3 EDO 1  1603 5   EDO EDO A . 
F 3 EDO 1  1604 6   EDO EDO A . 
G 4 5BW 1  1605 1   5BW DRG A . 
H 2 ZN  1  1601 1   ZN  ZN  B . 
I 3 EDO 1  1602 2   EDO EDO B . 
J 3 EDO 1  1603 3   EDO EDO B . 
K 3 EDO 1  1604 4   EDO EDO B . 
L 4 5BW 1  1605 2   5BW DRG B . 
M 5 HOH 1  1701 68  HOH HOH A . 
M 5 HOH 2  1702 69  HOH HOH A . 
M 5 HOH 3  1703 15  HOH HOH A . 
M 5 HOH 4  1704 94  HOH HOH A . 
M 5 HOH 5  1705 18  HOH HOH A . 
M 5 HOH 6  1706 24  HOH HOH A . 
M 5 HOH 7  1707 37  HOH HOH A . 
M 5 HOH 8  1708 82  HOH HOH A . 
M 5 HOH 9  1709 72  HOH HOH A . 
M 5 HOH 10 1710 35  HOH HOH A . 
M 5 HOH 11 1711 14  HOH HOH A . 
M 5 HOH 12 1712 30  HOH HOH A . 
M 5 HOH 13 1713 93  HOH HOH A . 
M 5 HOH 14 1714 22  HOH HOH A . 
M 5 HOH 15 1715 20  HOH HOH A . 
M 5 HOH 16 1716 2   HOH HOH A . 
M 5 HOH 17 1717 39  HOH HOH A . 
M 5 HOH 18 1718 25  HOH HOH A . 
M 5 HOH 19 1719 95  HOH HOH A . 
M 5 HOH 20 1720 10  HOH HOH A . 
M 5 HOH 21 1721 38  HOH HOH A . 
M 5 HOH 22 1722 17  HOH HOH A . 
M 5 HOH 23 1723 7   HOH HOH A . 
M 5 HOH 24 1724 5   HOH HOH A . 
M 5 HOH 25 1725 6   HOH HOH A . 
M 5 HOH 26 1726 4   HOH HOH A . 
M 5 HOH 27 1727 3   HOH HOH A . 
M 5 HOH 28 1728 80  HOH HOH A . 
M 5 HOH 29 1729 21  HOH HOH A . 
M 5 HOH 30 1730 60  HOH HOH A . 
M 5 HOH 31 1731 70  HOH HOH A . 
M 5 HOH 32 1732 92  HOH HOH A . 
M 5 HOH 33 1733 79  HOH HOH A . 
M 5 HOH 34 1734 45  HOH HOH A . 
M 5 HOH 35 1735 54  HOH HOH A . 
M 5 HOH 36 1736 71  HOH HOH A . 
M 5 HOH 37 1737 31  HOH HOH A . 
M 5 HOH 38 1738 96  HOH HOH A . 
M 5 HOH 39 1739 13  HOH HOH A . 
M 5 HOH 40 1740 78  HOH HOH A . 
M 5 HOH 41 1741 90  HOH HOH A . 
M 5 HOH 42 1742 85  HOH HOH A . 
M 5 HOH 43 1743 27  HOH HOH A . 
M 5 HOH 44 1744 47  HOH HOH A . 
M 5 HOH 45 1745 84  HOH HOH A . 
M 5 HOH 46 1746 43  HOH HOH A . 
M 5 HOH 47 1747 44  HOH HOH A . 
M 5 HOH 48 1748 75  HOH HOH A . 
M 5 HOH 49 1749 66  HOH HOH A . 
M 5 HOH 50 1750 73  HOH HOH A . 
M 5 HOH 51 1751 67  HOH HOH A . 
M 5 HOH 52 1752 74  HOH HOH A . 
N 5 HOH 1  1701 61  HOH HOH B . 
N 5 HOH 2  1702 57  HOH HOH B . 
N 5 HOH 3  1703 89  HOH HOH B . 
N 5 HOH 4  1704 51  HOH HOH B . 
N 5 HOH 5  1705 50  HOH HOH B . 
N 5 HOH 6  1706 12  HOH HOH B . 
N 5 HOH 7  1707 9   HOH HOH B . 
N 5 HOH 8  1708 1   HOH HOH B . 
N 5 HOH 9  1709 8   HOH HOH B . 
N 5 HOH 10 1710 49  HOH HOH B . 
N 5 HOH 11 1711 81  HOH HOH B . 
N 5 HOH 12 1712 77  HOH HOH B . 
N 5 HOH 13 1713 23  HOH HOH B . 
N 5 HOH 14 1714 28  HOH HOH B . 
N 5 HOH 15 1715 36  HOH HOH B . 
N 5 HOH 16 1716 53  HOH HOH B . 
N 5 HOH 17 1717 26  HOH HOH B . 
N 5 HOH 18 1718 19  HOH HOH B . 
N 5 HOH 19 1719 76  HOH HOH B . 
N 5 HOH 20 1720 52  HOH HOH B . 
N 5 HOH 21 1721 11  HOH HOH B . 
N 5 HOH 22 1722 29  HOH HOH B . 
N 5 HOH 23 1723 56  HOH HOH B . 
N 5 HOH 24 1724 59  HOH HOH B . 
N 5 HOH 25 1725 32  HOH HOH B . 
N 5 HOH 26 1726 88  HOH HOH B . 
N 5 HOH 27 1727 100 HOH HOH B . 
N 5 HOH 28 1728 64  HOH HOH B . 
N 5 HOH 29 1729 91  HOH HOH B . 
N 5 HOH 30 1730 101 HOH HOH B . 
N 5 HOH 31 1731 42  HOH HOH B . 
N 5 HOH 32 1732 58  HOH HOH B . 
N 5 HOH 33 1733 16  HOH HOH B . 
N 5 HOH 34 1734 83  HOH HOH B . 
N 5 HOH 35 1735 86  HOH HOH B . 
N 5 HOH 36 1736 87  HOH HOH B . 
N 5 HOH 37 1737 33  HOH HOH B . 
N 5 HOH 38 1738 48  HOH HOH B . 
N 5 HOH 39 1739 65  HOH HOH B . 
N 5 HOH 40 1740 34  HOH HOH B . 
N 5 HOH 41 1741 55  HOH HOH B . 
N 5 HOH 42 1742 46  HOH HOH B . 
N 5 HOH 43 1743 98  HOH HOH B . 
N 5 HOH 44 1744 62  HOH HOH B . 
N 5 HOH 45 1745 99  HOH HOH B . 
N 5 HOH 46 1746 40  HOH HOH B . 
N 5 HOH 47 1747 97  HOH HOH B . 
N 5 HOH 48 1748 41  HOH HOH B . 
N 5 HOH 49 1749 63  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,M 
2 1 B,H,I,J,K,L,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 69 ? A HIS 1517 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1740 ? 1_555 100.7 ? 
2  ND1 ? A HIS 69 ? A HIS 1517 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1719 ? 1_554 103.2 ? 
3  O   ? M HOH .  ? A HOH 1740 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1719 ? 1_554 153.0 ? 
4  ND1 ? A HIS 69 ? A HIS 1517 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1747 ? 1_554 171.9 ? 
5  O   ? M HOH .  ? A HOH 1740 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1747 ? 1_554 84.2  ? 
6  O   ? N HOH .  ? B HOH 1719 ? 1_554 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1747 ? 1_554 73.6  ? 
7  ND1 ? A HIS 69 ? A HIS 1517 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1712 ? 1_554 102.6 ? 
8  O   ? M HOH .  ? A HOH 1740 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1712 ? 1_554 92.0  ? 
9  O   ? N HOH .  ? B HOH 1719 ? 1_554 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1712 ? 1_554 70.6  ? 
10 O   ? N HOH .  ? B HOH 1747 ? 1_554 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1712 ? 1_554 83.5  ? 
11 ND1 ? A HIS 69 ? A HIS 1517 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1723 ? 1_554 109.3 ? 
12 O   ? M HOH .  ? A HOH 1740 ? 1_555 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1723 ? 1_554 86.2  ? 
13 O   ? N HOH .  ? B HOH 1719 ? 1_554 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1723 ? 1_554 97.5  ? 
14 O   ? N HOH .  ? B HOH 1747 ? 1_554 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1723 ? 1_554 64.3  ? 
15 O   ? N HOH .  ? B HOH 1712 ? 1_554 ZN ? C ZN . ? A ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1723 ? 1_554 147.7 ? 
16 ND1 ? B HIS 69 ? B HIS 1517 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1735 ? 1_555 105.0 ? 
17 ND1 ? B HIS 69 ? B HIS 1517 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1709 ? 1_555 98.3  ? 
18 O   ? M HOH .  ? A HOH 1735 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1709 ? 1_555 156.6 ? 
19 ND1 ? B HIS 69 ? B HIS 1517 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1714 ? 1_555 103.9 ? 
20 O   ? M HOH .  ? A HOH 1735 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1714 ? 1_555 99.1  ? 
21 O   ? M HOH .  ? A HOH 1709 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1714 ? 1_555 72.4  ? 
22 ND1 ? B HIS 69 ? B HIS 1517 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1741 ? 1_555 103.8 ? 
23 O   ? M HOH .  ? A HOH 1735 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1741 ? 1_555 80.6  ? 
24 O   ? M HOH .  ? A HOH 1709 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1741 ? 1_555 96.5  ? 
25 O   ? M HOH .  ? A HOH 1714 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? N HOH . ? B HOH 1741 ? 1_555 151.4 ? 
26 ND1 ? B HIS 69 ? B HIS 1517 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1750 ? 1_555 174.9 ? 
27 O   ? M HOH .  ? A HOH 1735 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1750 ? 1_555 74.2  ? 
28 O   ? M HOH .  ? A HOH 1709 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1750 ? 1_555 82.4  ? 
29 O   ? M HOH .  ? A HOH 1714 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1750 ? 1_555 71.4  ? 
30 O   ? N HOH .  ? B HOH 1741 ? 1_555 ZN ? H ZN . ? B ZN 1601 ? 1_555 O ? M HOH . ? A HOH 1750 ? 1_555 81.1  ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-10-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' 'Chain A' refined 14.4062 12.9203 29.2681 0.0539 ? 0.0004  ? 0.0470 ? 0.0274 ? -0.0019 ? 0.0540 ? 0.5040 ? 
0.1599 ? 0.4800  ? 2.0513 ? 0.7407  ? 0.6872 ? -0.0218 ? -0.0156 ? 0.0552  ? -0.0107 ? -0.0920 ? 0.0495 ? 0.0321  ? -0.0356 ? 
0.1137  ? 
2 'X-RAY DIFFRACTION' 'Chain B' refined 1.9528  4.1867  52.7679 0.0977 ? -0.0228 ? 0.0128 ? 0.0144 ? 0.0081  ? 0.0334 ? 1.2854 ? 
0.9947 ? -0.4224 ? 1.8019 ? -0.3813 ? 0.8299 ? 0.0788  ? -0.1140 ? -0.0676 ? -0.1557 ? -0.0305 ? 0.0269 ? -0.1221 ? 0.0616  ? 
-0.0483 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? B 1457 ? ? B 1566 ? ? 
2 'X-RAY DIFFRACTION' 2 ? ? B 1457 ? ? B 1566 ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0073 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NE2 B GLN 1487 ? ? O B HOH 1701 ? ? 1.97 
2 1 OE2 B GLU 1493 ? ? O B HOH 1702 ? ? 2.08 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              1513 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              1513 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              1513 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.02 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.28 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B LYS 1460 ? CD ? B LYS 12 CD 
2 1 Y 1 B LYS 1460 ? CE ? B LYS 12 CE 
3 1 Y 1 B LYS 1460 ? NZ ? B LYS 12 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1449 ? A SER 1   
2  1 Y 1 A MET 1450 ? A MET 2   
3  1 Y 1 A LEU 1451 ? A LEU 3   
4  1 Y 1 A SER 1452 ? A SER 4   
5  1 Y 1 A PRO 1453 ? A PRO 5   
6  1 Y 1 A ASN 1454 ? A ASN 6   
7  1 Y 1 A PRO 1455 ? A PRO 7   
8  1 Y 1 A PRO 1456 ? A PRO 8   
9  1 Y 1 A GLU 1567 ? A GLU 119 
10 1 Y 1 A ASP 1568 ? A ASP 120 
11 1 Y 1 A ASP 1569 ? A ASP 121 
12 1 Y 1 B SER 1449 ? B SER 1   
13 1 Y 1 B MET 1450 ? B MET 2   
14 1 Y 1 B LEU 1451 ? B LEU 3   
15 1 Y 1 B SER 1452 ? B SER 4   
16 1 Y 1 B PRO 1453 ? B PRO 5   
17 1 Y 1 B ASN 1454 ? B ASN 6   
18 1 Y 1 B PRO 1455 ? B PRO 7   
19 1 Y 1 B PRO 1456 ? B PRO 8   
20 1 Y 1 B GLU 1567 ? B GLU 119 
21 1 Y 1 B ASP 1568 ? B ASP 120 
22 1 Y 1 B ASP 1569 ? B ASP 121 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                                                                              ZN  
3 1,2-ETHANEDIOL                                                                                          EDO 
4 '(2E)-1-(2-hydroxyphenyl)-3-[(1R,4R)-5-(pyridin-2-yl)-2,5-diazabicyclo[2.2.1]hept-2-yl]prop-2-en-1-one' 5BW 
5 water                                                                                                   HOH 
#