data_5DLF
# 
_entry.id   5DLF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DLF         
WWPDB D_1000213376 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5DLG 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DLF 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patra, A.'       1 
'OFlaherty, D.K.' 2 
'Egli, M.'        3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem Sci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-6520 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                4896 
_citation.page_last                 4904 
_citation.title                     'Lesion Orientation ofO4-Alkylthymidine Influences Replication by Human DNA Polymeraseeta.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1039/C6SC00666C 
_citation.pdbx_database_id_PubMed   27574558 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 
;O'Flaherty, D.K.
;
1 ? 
primary 'Patra, A.'        2 ? 
primary 'Su, Y.'           3 ? 
primary 'Guengerich, F.P.' 4 ? 
primary 'Egli, M.'         5 ? 
primary 'Wilds, C.J.'      6 ? 
# 
_cell.entry_id           5DLF 
_cell.length_a           99.026 
_cell.length_b           99.026 
_cell.length_c           82.166 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5DLF 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                    48617.707 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*C*AP*TP*(5DB)P*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3651.418  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ? ? 
4 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                           40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                                92.094    1   ?       ? ? ? 
7 water       nat water                                                   18.015    494 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no yes '(DC)(DA)(DT)(5DB)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATXATGACGCT T ? 
3 polydeoxyribonucleotide no no  '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   5DB n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'synthetic construct' ? 32630 'Chemically Synthesized' 
3 1 sample 1 8  'synthetic construct' ? 32630 'Chemically Synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5DLF       5DLF   ? 2 ? 1 
3 PDB 5DLF       5DLF   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DLF A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5DLF T 1 ? 12  ? 5DLF   1 ? 12  ? 1 12  
3 3 5DLF P 1 ? 8   ? 5DLF   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DLF GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5DLF PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5DLF HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5DB 'DNA linking'       . '1-(2-deoxy-5-O-phosphono-beta-D-erythro-pentofuranosyl)-4-methoxy-5-methylpyrimidin-2(1H)-one' ? 
'C11 H17 N2 O8 P'   336.235 
ALA 'L-peptide linking' y ALANINE                                                                                         ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                        ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                      ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                 ? 
'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                                                                                   ? 'Ca 2' 
40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                                        ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                            ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                             ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                            ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                    ? 
'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                                                                                       ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                 ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                         ? 
'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                                                                        
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                       ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                           ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                      ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                         ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                          ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                      ? 
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                   ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                         ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                          ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                       ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                      ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                        ? 
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                                          ? 
'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DLF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.13 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.15 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M MES pH 5.5, 5mM magnesium chloride, 18% PEG 2000 MME' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-08-15 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Diamond [111' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DLF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.97 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       32497 
_reflns.number_obs                       32497 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       0 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.7 
_reflns.pdbx_Rmerge_I_obs                0.165 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.165 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.298 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.97 
_reflns_shell.d_res_low                   2.00 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.130 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.834 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5DLF 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30920 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.513 
_refine.ls_d_res_high                            1.97 
_refine.ls_percent_reflns_obs                    99.90 
_refine.ls_R_factor_obs                          0.16620 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16368 
_refine.ls_R_factor_R_free                       0.21707 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  1538 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.922 
_refine.B_iso_mean                               23.758 
_refine.aniso_B[1][1]                            -0.13 
_refine.aniso_B[2][2]                            -0.13 
_refine.aniso_B[3][3]                            0.42 
_refine.aniso_B[1][2]                            -0.07 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      4O3N 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.184 
_refine.pdbx_overall_ESU_R_Free                  0.162 
_refine.overall_SU_ML                            0.122 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.509 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   384 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             494 
_refine_hist.number_atoms_total               4281 
_refine_hist.d_res_high                       1.97 
_refine_hist.d_res_low                        49.513 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.018  ? 3928  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 3623  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.713  1.885  ? 5379  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.334  3.000  ? 8354  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.182  5.000  ? 434   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.723 23.718 ? 156   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.315 15.000 ? 645   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.257 15.000 ? 31    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.098  0.200  ? 583   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 4140  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 888   'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.155  2.108  ? 1727  'X-RAY DIFFRACTION' ? 
r_mcbond_other               2.153  2.106  ? 1726  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.482  3.143  ? 2158  'X-RAY DIFFRACTION' ? 
r_mcangle_other              3.482  3.144  ? 2159  'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.897  2.484  ? 2201  'X-RAY DIFFRACTION' ? 
r_scbond_other               2.897  2.484  ? 2201  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              4.382  3.622  ? 3220  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       7.694  39.911 ? 16975 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         7.690  39.823 ? 16925 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.969 
_refine_ls_shell.d_res_low                        2.020 
_refine_ls_shell.number_reflns_R_work             2304 
_refine_ls_shell.R_factor_R_work                  0.230 
_refine_ls_shell.percent_reflns_obs               99.38 
_refine_ls_shell.R_factor_R_free                  0.282 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             104 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5DLF 
_struct.title                        'Crystal Structure of Human DNA Polymerase Eta Inserting dATP Opposite O4-Methylhymidine' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DLF 
_struct_keywords.text            
;Catalytic Domain, DNA Damage, DNA-Directed DNA Polymerase, Adenosine Triphosphate, Y-family polymerase, trans-lesion synthesis (TLS), DNA Binding, O4-Alkylthymidine, O4-Methylthymidine, Transferase-DNA complex
;
_struct_keywords.pdbx_keywords   Transferase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? SER A 180 ? GLN A 162 SER A 177 1 ? 16 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 AB2 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P12 AB3 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P13 AB4 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P14 AB5 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P15 AB6 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P16 AB7 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA ? ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc2  metalc ?    ? A MET 17  O     ? ? ? 1_555 E CA  . CA ? ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc3  metalc ?    ? A ASP 118 OD1   ? ? ? 1_555 E CA  . CA ? ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.214 ? 
covale1  covale both ? B DT  3   "O3'" ? ? ? 1_555 B 5DB 4 P  ? ? T DT  3   T 5DB 4   1_555 ? ? ? ? ? ? ?            1.617 ? 
covale2  covale one  ? B 5DB 4   "O3'" ? ? ? 1_555 B DA  5 P  ? ? T 5DB 4   T DA  5   1_555 ? ? ? ? ? ? ?            1.627 ? 
metalc4  metalc ?    ? D DTP .   O1G   ? ? ? 1_555 E CA  . CA ? ? A DTP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc5  metalc ?    ? D DTP .   O1B   ? ? ? 1_555 E CA  . CA ? ? A DTP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.249 ? 
metalc6  metalc ?    ? D DTP .   O1A   ? ? ? 1_555 E CA  . CA ? ? A DTP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.308 ? 
hydrog1  hydrog ?    ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3 ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4 ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.50  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -8.40 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -9.68 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? THR A 430 ? GLU A 414 THR A 427 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? THR A 430 ? GLU A 414 THR A 427 
AA5 3 GLN A 368 ? VAL A 375 ? GLN A 365 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
AA6 1 ARG A 364 ? VAL A 365 ? ARG A 361 VAL A 362 
AA6 2 SER A 433 ? ALA A 434 ? SER A 430 ALA A 431 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O THR A 423 ? O THR A 420 N ARG A 374 ? N ARG A 371 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
AA6 1 2 N VAL A 365 ? N VAL A 362 O SER A 433 ? O SER A 430 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A DTP 501 ? 22 'binding site for residue DTP A 501' 
AC2 Software A CA  502 ? 4  'binding site for residue CA A 502'  
AC3 Software A GOL 503 ? 10 'binding site for residue GOL A 503' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 22 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 22 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 22 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 22 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 22 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 22 ILE A 51  ? ILE A 48  . ? 1_555 ? 
8  AC1 22 ALA A 52  ? ALA A 49  . ? 1_555 ? 
9  AC1 22 TYR A 55  ? TYR A 52  . ? 1_555 ? 
10 AC1 22 ARG A 58  ? ARG A 55  . ? 1_555 ? 
11 AC1 22 ARG A 64  ? ARG A 61  . ? 1_555 ? 
12 AC1 22 ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC1 22 LYS A 234 ? LYS A 231 . ? 1_555 ? 
14 AC1 22 CA  E .   ? CA  A 502 . ? 1_555 ? 
15 AC1 22 HOH G .   ? HOH A 635 . ? 1_555 ? 
16 AC1 22 HOH G .   ? HOH A 636 . ? 1_555 ? 
17 AC1 22 HOH G .   ? HOH A 640 . ? 1_555 ? 
18 AC1 22 HOH G .   ? HOH A 643 . ? 1_555 ? 
19 AC1 22 HOH G .   ? HOH A 689 . ? 1_555 ? 
20 AC1 22 DT  C 8   ? DT  P 8   . ? 1_555 ? 
21 AC1 22 HOH I .   ? HOH P 108 . ? 1_555 ? 
22 AC1 22 DA  B 5   ? DA  T 5   . ? 1_555 ? 
23 AC2 4  ASP A 16  ? ASP A 13  . ? 1_555 ? 
24 AC2 4  MET A 17  ? MET A 14  . ? 1_555 ? 
25 AC2 4  ASP A 118 ? ASP A 115 . ? 1_555 ? 
26 AC2 4  DTP D .   ? DTP A 501 . ? 1_555 ? 
27 AC3 10 ARG A 27  ? ARG A 24  . ? 6_665 ? 
28 AC3 10 PRO A 247 ? PRO A 244 . ? 1_555 ? 
29 AC3 10 PHE A 250 ? PHE A 247 . ? 1_555 ? 
30 AC3 10 SER A 251 ? SER A 248 . ? 1_555 ? 
31 AC3 10 GLY A 279 ? GLY A 276 . ? 1_555 ? 
32 AC3 10 GLU A 280 ? GLU A 277 . ? 1_555 ? 
33 AC3 10 HOH G .   ? HOH A 617 . ? 1_555 ? 
34 AC3 10 HOH G .   ? HOH A 658 . ? 1_555 ? 
35 AC3 10 HOH G .   ? HOH A 698 . ? 1_555 ? 
36 AC3 10 HOH G .   ? HOH A 716 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DLF 
_atom_sites.fract_transf_matrix[1][1]   0.010098 
_atom_sites.fract_transf_matrix[1][2]   0.005830 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011661 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012170 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? -3.577  74.695 -4.706  1.00 74.11  ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? -4.414  75.886 -5.078  1.00 72.98  ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? -5.266  75.665 -6.321  1.00 64.71  ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? -6.197  74.855 -6.260  1.00 56.52  ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? -4.948  76.365 -7.450  1.00 62.49  ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? -5.725  76.237 -8.709  1.00 61.43  ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? -5.562  74.909 -9.486  1.00 59.27  ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? -6.279  74.681 -10.464 1.00 58.45  ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? -5.214  77.417 -9.565  1.00 61.21  ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? -3.824  77.657 -9.084  1.00 61.02  ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? -3.827  77.316 -7.612  1.00 61.18  ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? -4.628  74.051 -9.082  1.00 56.63  ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? -4.375  72.784 -9.802  1.00 53.89  ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? -4.662  71.552 -8.945  1.00 53.66  ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? -4.348  70.433 -9.348  1.00 49.72  ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? -2.928  72.776 -10.344 1.00 50.04  ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? -2.543  74.064 -10.996 1.00 44.42  ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? -3.159  74.527 -12.140 1.00 44.81  ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? -1.654  75.020 -10.633 1.00 43.13  ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? -2.657  75.705 -12.467 1.00 44.54  ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? -1.742  76.026 -11.569 1.00 43.27  ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? -5.280  71.752 -7.780  1.00 57.78  ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? -5.567  70.638 -6.862  1.00 64.73  ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? -6.984  70.096 -7.090  1.00 56.85  ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? -7.981  70.785 -6.800  1.00 49.50  ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? -5.398  71.059 -5.385  1.00 73.07  ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? -4.110  70.600 -4.714  1.00 78.20  ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? -3.602  68.890 -4.988  1.00 82.58  ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? -2.170  69.028 -6.060  1.00 75.69  ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? -7.080  68.876 -7.627  1.00 49.74  ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? -8.389  68.292 -7.931  1.00 45.21  ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? -9.066  67.838 -6.625  1.00 36.86  ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? -8.417  67.348 -5.712  1.00 35.16  ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? -8.287  67.170 -8.958  1.00 47.06  ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? -10.358 68.118 -6.518  1.00 29.74  ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? -11.095 67.972 -5.252  1.00 24.88  ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? -12.113 66.845 -5.247  1.00 20.70  ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? -12.861 66.717 -4.291  1.00 19.20  ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? -11.811 69.285 -4.915  1.00 25.40  ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? -12.828 69.551 -5.906  1.00 24.21  ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? -10.738 70.475 -4.851  1.00 24.97  ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? -12.141 66.031 -6.309  1.00 19.31  ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? -13.015 64.853 -6.358  1.00 17.26  ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? -14.495 65.161 -6.348  1.00 15.60  ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? -15.271 64.444 -5.714  1.00 13.20  ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? -14.854 66.268 -7.002  1.00 14.24  ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? -16.203 66.810 -7.014  1.00 15.47  ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? -16.827 66.793 -8.427  1.00 15.33  ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? -17.782 67.467 -8.697  1.00 15.99  ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? -16.177 68.223 -6.499  1.00 15.94  ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? -15.969 68.349 -4.994  1.00 16.71  ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? -15.911 69.795 -4.520  1.00 15.76  ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? -14.905 70.468 -4.747  1.00 18.88  ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? -16.925 70.253 -3.828  1.00 15.33  ? 5    GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? -16.340 65.925 -9.262  1.00 17.73  ? 6    ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? -16.692 65.885 -10.680 1.00 19.95  ? 6    ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? -17.938 65.062 -11.001 1.00 17.88  ? 6    ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? -18.583 65.332 -11.979 1.00 19.99  ? 6    ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? -15.487 65.329 -11.490 1.00 21.25  ? 6    ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? -14.948 63.995 -10.916 1.00 23.73  ? 6    ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? -14.616 63.914 -9.709  1.00 24.57  ? 6    ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? -14.890 62.978 -11.675 1.00 29.18  ? 6    ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? -18.283 64.087 -10.180 1.00 16.13  ? 7    ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? -19.488 63.224 -10.383 1.00 14.01  ? 7    ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? -20.514 63.348 -9.252  1.00 12.47  ? 7    ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? -20.184 63.803 -8.148  1.00 12.38  ? 7    ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? -19.060 61.763 -10.455 1.00 13.91  ? 7    ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? -18.227 61.386 -11.664 1.00 13.93  ? 7    ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? -17.797 59.938 -11.487 1.00 13.94  ? 7    ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? -16.905 59.747 -10.341 1.00 13.50  ? 7    ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? -16.722 58.609 -9.669  1.00 14.87  ? 7    ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? -15.817 58.541 -8.699  1.00 14.29  ? 7    ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? -17.379 57.497 -9.989  1.00 16.83  ? 7    ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? -21.758 62.949 -9.519  1.00 11.11  ? 8    VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? -22.757 62.714 -8.477  1.00 10.19  ? 8    VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? -23.080 61.227 -8.539  1.00 11.22  ? 8    VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? -23.482 60.719 -9.620  1.00 11.43  ? 8    VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? -24.008 63.578 -8.675  1.00 10.76  ? 8    VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? -25.081 63.291 -7.639  1.00 10.94  ? 8    VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? -23.693 65.051 -8.746  1.00 10.94  ? 8    VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? -22.907 60.537 -7.406  1.00 10.54  ? 9    VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? -23.020 59.075 -7.299  1.00 10.47  ? 9    VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? -23.927 58.759 -6.124  1.00 11.42  ? 9    VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? -23.833 59.367 -5.053  1.00 10.78  ? 9    VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? -21.653 58.417 -7.123  1.00 10.15  ? 9    VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? -21.765 56.937 -6.896  1.00 10.53  ? 9    VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? -20.830 58.585 -8.372  1.00 10.31  ? 9    VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? -24.844 57.808 -6.300  1.00 10.73  ? 10   ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? -25.676 57.380 -5.203  1.00 9.92   ? 10   ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? -25.504 55.947 -5.017  1.00 10.34  ? 10   ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? -25.108 55.260 -5.960  1.00 10.24  ? 10   ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? -27.157 57.698 -5.492  1.00 10.29  ? 10   ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? -25.745 55.489 -3.788  1.00 10.10  ? 11   LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? -25.809 54.074 -3.477  1.00 10.44  ? 11   LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? -27.184 53.837 -2.855  1.00 11.32  ? 11   LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? -27.501 54.428 -1.764  1.00 10.43  ? 11   LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? -24.705 53.667 -2.519  1.00 10.92  ? 11   LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? -24.471 52.155 -2.137  1.00 12.09  ? 11   LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? -25.268 51.784 -0.915  1.00 11.30  ? 11   LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? -24.819 51.194 -3.298  1.00 12.23  ? 11   LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? -28.012 53.026 -3.534  1.00 10.10  ? 12   VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? -29.289 52.643 -2.998  1.00 10.11  ? 12   VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? -29.253 51.256 -2.380  1.00 10.31  ? 12   VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? -28.722 50.325 -2.976  1.00 10.12  ? 12   VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? -30.369 52.715 -4.052  1.00 10.90  ? 12   VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? -31.725 52.299 -3.514  1.00 10.97  ? 12   VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? -30.446 54.135 -4.565  1.00 12.01  ? 12   VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? -29.781 51.121 -1.170  1.00 9.98   ? 13   ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? -29.711 49.902 -0.411  1.00 10.41  ? 13   ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? -31.082 49.552 0.204   1.00 9.38   ? 13   ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? -31.618 50.258 1.058   1.00 8.43   ? 13   ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? -28.628 50.117 0.666   1.00 11.66  ? 13   ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? -28.237 48.838 1.410   1.00 14.03  ? 13   ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? -28.935 47.806 1.332   1.00 12.15  ? 13   ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? -27.143 48.864 2.064   1.00 18.89  ? 13   ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? -31.637 48.416 -0.180  1.00 9.09   ? 14   MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? -32.968 48.018 0.290   1.00 9.56   ? 14   MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? -32.847 47.702 1.797   1.00 8.90   ? 14   MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? -31.866 47.133 2.223   1.00 9.30   ? 14   MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? -33.456 46.766 -0.453  1.00 10.59  ? 14   MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? -33.460 46.900 -1.960  1.00 10.97  ? 14   MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? -34.299 48.362 -2.506  1.00 12.54  ? 14   MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? -35.938 48.127 -1.968  1.00 12.92  ? 14   MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? -33.772 48.173 2.562   1.00 8.32   ? 15   ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? -33.782 47.957 3.999   1.00 8.88   ? 15   ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? -34.206 46.505 4.264   1.00 8.91   ? 15   ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? -35.185 46.026 3.643   1.00 8.21   ? 15   ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? -34.819 48.879 4.655   1.00 8.08   ? 15   ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? -34.453 50.395 4.585   1.00 8.38   ? 15   ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? -33.276 50.731 4.586   1.00 7.79   ? 15   ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? -35.366 51.250 4.576   1.00 7.66   ? 15   ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? -33.521 45.854 5.211   1.00 8.86   ? 16   CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? -33.783 44.445 5.656   1.00 9.23   ? 16   CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? -34.443 43.604 4.557   1.00 8.68   ? 16   CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? -35.620 43.187 4.641   1.00 8.09   ? 16   CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? -34.603 44.397 6.978   1.00 9.64   ? 16   CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? -36.111 45.373 7.006   1.00 11.94  ? 16   CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? -33.728 43.479 3.458   1.00 8.48   ? 17   PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? -34.366 43.161 2.198   1.00 8.15   ? 17   PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? -35.198 41.855 2.185   1.00 7.81   ? 17   PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? -36.387 41.902 1.817   1.00 6.82   ? 17   PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? -33.350 43.209 1.049   1.00 8.28   ? 17   PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? -33.943 42.993 -0.280  1.00 8.65   ? 17   PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? -35.062 43.712 -0.689  1.00 8.50   ? 17   PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? -33.457 41.995 -1.083  1.00 9.32   ? 17   PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? -35.637 43.470 -1.942  1.00 9.52   ? 17   PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? -34.033 41.765 -2.356  1.00 9.82   ? 17   PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? -35.115 42.495 -2.775  1.00 9.30   ? 17   PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? -34.617 40.741 2.605   1.00 7.48   ? 18   PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? -35.368 39.455 2.569   1.00 8.32   ? 18   PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? -36.604 39.545 3.508   1.00 8.16   ? 18   PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? -37.655 38.996 3.215   1.00 8.56   ? 18   PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? -34.498 38.258 2.918   1.00 8.45   ? 18   PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? -33.479 37.875 1.871   1.00 9.31   ? 18   PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? -33.090 38.728 0.855   1.00 9.14   ? 18   PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? -32.814 36.658 1.975   1.00 10.24  ? 18   PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? -32.112 38.387 -0.061  1.00 10.02  ? 18   PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? -31.803 36.305 1.040   1.00 11.07  ? 18   PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? -31.474 37.175 0.009   1.00 10.98  ? 18   PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? -36.457 40.286 4.616   1.00 7.80   ? 19   VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? -37.576 40.550 5.507   1.00 7.89   ? 19   VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? -38.718 41.285 4.779   1.00 7.87   ? 19   VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? -39.900 40.826 4.846   1.00 6.82   ? 19   VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? -37.138 41.279 6.767   1.00 7.77   ? 19   VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? -38.319 41.807 7.533   1.00 7.86   ? 19   VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? -36.343 40.328 7.675   1.00 8.34   ? 19   VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? -38.375 42.345 4.028   1.00 7.63   ? 20   GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? -39.411 43.067 3.291   1.00 7.87   ? 20   GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? -40.113 42.194 2.239   1.00 7.66   ? 20   GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? -41.334 42.394 2.044   1.00 8.79   ? 20   GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? -38.911 44.323 2.623   1.00 8.11   ? 20   GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? -38.617 45.462 3.543   1.00 8.75   ? 20   GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? -38.511 46.756 2.795   1.00 9.99   ? 20   GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? -39.529 47.409 2.544   1.00 10.29  ? 20   GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? -37.279 47.155 2.417   1.00 11.08  ? 20   GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? -39.378 41.334 1.569   1.00 6.89   ? 21   VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? -39.958 40.437 0.535   1.00 7.02   ? 21   VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? -41.013 39.509 1.212   1.00 7.35   ? 21   VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? -42.135 39.339 0.708   1.00 6.51   ? 21   VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? -38.885 39.587 -0.191  1.00 6.73   ? 21   VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? -39.406 38.587 -1.201  1.00 6.62   ? 21   VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? -37.878 40.462 -0.923  1.00 6.98   ? 21   VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? -40.637 38.944 2.346   1.00 7.24   ? 22   GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? -41.553 38.118 3.102   1.00 7.69   ? 22   GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? -42.744 38.875 3.733   1.00 7.43   ? 22   GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? -43.863 38.352 3.790   1.00 7.02   ? 22   GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? -40.801 37.295 4.175   1.00 8.30   ? 22   GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? -39.763 36.369 3.605   1.00 8.63   ? 22   GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? -40.322 35.268 2.711   1.00 8.97   ? 22   GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? -41.458 34.867 2.939   1.00 9.46   ? 22   GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? -39.608 34.729 1.846   1.00 9.32   ? 22   GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? -42.524 40.112 4.162   1.00 7.39   ? 23   GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? -43.589 40.924 4.748   1.00 7.66   ? 23   GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? -44.571 41.442 3.672   1.00 7.46   ? 23   GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? -45.740 41.564 3.914   1.00 6.63   ? 23   GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? -43.027 42.168 5.438   1.00 7.86   ? 23   GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? -42.261 41.856 6.706   1.00 8.16   ? 23   GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? -41.657 43.074 7.346   1.00 8.60   ? 23   GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? -41.097 43.916 6.658   1.00 9.21   ? 23   GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? -41.780 43.192 8.685   1.00 8.61   ? 23   GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? -44.077 41.724 2.478   1.00 7.64   ? 24   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? -45.012 42.041 1.340   1.00 8.89   ? 24   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? -45.949 40.851 1.094   1.00 9.51   ? 24   ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? -47.181 41.017 0.981   1.00 8.93   ? 24   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? -44.235 42.349 0.049   1.00 8.62   ? 24   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? -45.172 42.773 -1.088  1.00 9.25   ? 24   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? -44.448 43.249 -2.330  1.00 8.56   ? 24   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? -43.759 42.155 -3.022  1.00 8.52   ? 24   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? -43.096 42.302 -4.147  1.00 8.16   ? 24   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? -43.056 43.482 -4.759  1.00 7.97   ? 24   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? -42.511 41.278 -4.687  1.00 8.40   ? 24   ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? -45.340 39.656 1.047   1.00 10.01  ? 25   GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? -46.090 38.445 0.797   1.00 10.56  ? 25   GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? -47.075 38.095 1.896   1.00 10.50  ? 25   GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? -48.182 37.605 1.597   1.00 10.88  ? 25   GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? -45.135 37.268 0.594   1.00 11.41  ? 25   GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? -45.801 35.963 0.175   1.00 12.74  ? 25   GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? -44.807 34.793 0.077   1.00 14.61  ? 25   GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? -43.780 34.871 -0.560  1.00 14.39  ? 25   GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? -45.104 33.736 0.807   1.00 16.02  ? 25   GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? -46.653 38.244 3.159   1.00 10.99  ? 26   ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? -47.459 37.892 4.300   1.00 11.12  ? 26   ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? -47.701 39.093 5.177   1.00 10.39  ? 26   ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? -46.842 39.433 6.040   1.00 9.38   ? 26   ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? -46.814 36.768 5.114   1.00 12.08  ? 26   ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? -47.721 36.277 6.282   1.00 13.96  ? 26   ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? -48.776 36.863 6.680   1.00 12.64  ? 26   ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? -47.263 35.195 6.873   1.00 14.84  ? 26   ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? -48.853 39.750 4.985   1.00 9.81   ? 27   PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? -49.186 40.916 5.769   1.00 10.43  ? 27   PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? -49.104 40.742 7.283   1.00 10.92  ? 27   PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? -48.836 41.710 7.975   1.00 10.27  ? 27   PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? -50.630 41.196 5.370   1.00 10.67  ? 27   PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? -50.739 40.695 3.994   1.00 9.98   ? 27   PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? -49.851 39.497 3.927   1.00 9.81   ? 27   PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? -49.329 39.547 7.801   1.00 12.41  ? 28   HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? -49.172 39.305 9.255   1.00 15.09  ? 28   HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? -47.778 39.572 9.786   1.00 14.77  ? 28   HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? -47.596 39.734 10.983  1.00 15.14  ? 28   HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? -49.495 37.845 9.632   1.00 18.59  ? 28   HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? -50.930 37.488 9.502   1.00 21.61  ? 28   HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? -51.937 38.282 9.995   1.00 24.25  ? 28   HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? -51.534 36.421 8.940   1.00 25.55  ? 28   HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? -53.099 37.737 9.718   1.00 25.22  ? 28   HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? -52.880 36.607 9.079   1.00 26.20  ? 28   HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? -46.762 39.593 8.926   1.00 13.02  ? 29   LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? -45.411 39.945 9.384   1.00 11.89  ? 29   LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? -45.078 41.465 9.404   1.00 11.49  ? 29   LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? -44.028 41.860 9.951   1.00 10.29  ? 29   LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? -44.381 39.180 8.565   1.00 12.03  ? 29   LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? -44.617 37.646 8.459   1.00 13.10  ? 29   LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? -43.551 37.046 7.527   1.00 12.52  ? 29   LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? -44.708 36.887 9.808   1.00 14.48  ? 29   LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? -45.937 42.311 8.822   1.00 10.72  ? 30   ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? -45.621 43.707 8.614   1.00 11.45  ? 30   ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? -45.602 44.390 9.957   1.00 13.37  ? 30   ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? -46.418 44.047 10.808  1.00 12.55  ? 30   ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? -46.655 44.418 7.708   1.00 11.33  ? 30   ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? -46.636 43.864 6.285   1.00 11.23  ? 30   ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? -47.730 44.337 5.402   1.00 11.44  ? 30   ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? -47.739 43.648 4.105   1.00 11.46  ? 30   ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? -48.454 44.073 3.065   1.00 12.24  ? 30   ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? -49.261 45.125 3.178   1.00 11.86  ? 30   ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? -48.452 43.404 1.921   1.00 12.72  ? 30   ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? -44.661 45.322 10.145  1.00 14.60  ? 31   ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? -44.537 46.071 11.447  1.00 17.60  ? 31   ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? -44.415 45.196 12.698  1.00 17.45  ? 31   ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? -45.054 45.469 13.753  1.00 20.12  ? 31   ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? -45.735 47.019 11.632  1.00 19.78  ? 31   ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? -45.961 47.880 10.414  1.00 22.89  ? 31   ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? -45.083 48.612 9.990   1.00 25.53  ? 31   ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? -47.130 47.743 9.806   1.00 25.34  ? 31   ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? -43.672 44.107 12.563  1.00 16.12  ? 32   LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? -43.394 43.177 13.636  1.00 16.44  ? 32   LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? -41.902 42.917 13.729  1.00 13.99  ? 32   LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? -41.217 43.033 12.724  1.00 12.62  ? 32   LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? -44.085 41.834 13.347  1.00 19.32  ? 32   LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? -45.628 41.891 13.256  1.00 22.15  ? 32   LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? -46.266 41.920 14.601  1.00 25.11  ? 32   LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? -47.785 41.831 14.459  1.00 30.43  ? 32   LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? -48.393 42.440 15.667  1.00 33.63  ? 32   LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? -41.417 42.510 14.916  1.00 13.30  ? 33   PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? -40.085 41.963 14.982  1.00 12.24  ? 33   PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? -40.113 40.625 14.227  1.00 11.58  ? 33   PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? -40.811 39.670 14.639  1.00 11.23  ? 33   PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? -39.845 41.758 16.477  1.00 13.76  ? 33   PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? -41.213 41.691 17.106  1.00 14.42  ? 33   PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? -42.090 42.516 16.238  1.00 13.87  ? 33   PRO A CD    1 
ATOM   289  N  N     A CYS A 1 37  ? -39.365 40.552 13.150  0.58 10.33  ? 34   CYS A N     1 
ATOM   290  N  N     B CYS A 1 37  ? -39.347 40.568 13.139  0.42 10.62  ? 34   CYS A N     1 
ATOM   291  C  CA    A CYS A 1 37  ? -39.320 39.335 12.413  0.58 10.38  ? 34   CYS A CA    1 
ATOM   292  C  CA    B CYS A 1 37  ? -39.394 39.484 12.166  0.42 10.60  ? 34   CYS A CA    1 
ATOM   293  C  C     A CYS A 1 37  ? -38.001 39.129 11.725  0.58 10.21  ? 34   CYS A C     1 
ATOM   294  C  C     B CYS A 1 37  ? -37.972 39.129 11.766  0.42 10.34  ? 34   CYS A C     1 
ATOM   295  O  O     A CYS A 1 37  ? -37.222 40.055 11.576  0.58 11.07  ? 34   CYS A O     1 
ATOM   296  O  O     B CYS A 1 37  ? -37.083 39.959 11.880  0.42 10.90  ? 34   CYS A O     1 
ATOM   297  C  CB    A CYS A 1 37  ? -40.503 39.233 11.443  0.58 10.10  ? 34   CYS A CB    1 
ATOM   298  C  CB    B CYS A 1 37  ? -40.221 39.914 10.934  0.42 10.48  ? 34   CYS A CB    1 
ATOM   299  S  SG    A CYS A 1 37  ? -40.474 40.489 10.175  0.58 9.47   ? 34   CYS A SG    1 
ATOM   300  S  SG    B CYS A 1 37  ? -40.653 38.622 9.725   0.42 10.44  ? 34   CYS A SG    1 
ATOM   301  N  N     . ALA A 1 38  ? -37.753 37.885 11.352  1.00 10.30  ? 35   ALA A N     1 
ATOM   302  C  CA    . ALA A 1 38  ? -36.524 37.476 10.721  1.00 9.73   ? 35   ALA A CA    1 
ATOM   303  C  C     . ALA A 1 38  ? -36.768 36.445 9.688   1.00 9.30   ? 35   ALA A C     1 
ATOM   304  O  O     . ALA A 1 38  ? -37.747 35.670 9.775   1.00 8.05   ? 35   ALA A O     1 
ATOM   305  C  CB    . ALA A 1 38  ? -35.484 36.937 11.699  1.00 10.02  ? 35   ALA A CB    1 
ATOM   306  N  N     . VAL A 1 39  ? -35.820 36.365 8.761   1.00 9.01   ? 36   VAL A N     1 
ATOM   307  C  CA    . VAL A 1 39  ? -35.845 35.339 7.740   1.00 9.11   ? 36   VAL A CA    1 
ATOM   308  C  C     . VAL A 1 39  ? -34.761 34.326 8.076   1.00 9.71   ? 36   VAL A C     1 
ATOM   309  O  O     . VAL A 1 39  ? -33.619 34.721 8.358   1.00 9.96   ? 36   VAL A O     1 
ATOM   310  C  CB    . VAL A 1 39  ? -35.619 35.927 6.336   1.00 9.14   ? 36   VAL A CB    1 
ATOM   311  C  CG1   . VAL A 1 39  ? -35.468 34.801 5.280   1.00 9.47   ? 36   VAL A CG1   1 
ATOM   312  C  CG2   . VAL A 1 39  ? -36.779 36.850 5.966   1.00 9.17   ? 36   VAL A CG2   1 
ATOM   313  N  N     . VAL A 1 40  ? -35.119 33.047 8.081   1.00 9.10   ? 37   VAL A N     1 
ATOM   314  C  CA    . VAL A 1 40  ? -34.224 31.944 8.490   1.00 10.21  ? 37   VAL A CA    1 
ATOM   315  C  C     . VAL A 1 40  ? -34.066 30.911 7.380   1.00 10.21  ? 37   VAL A C     1 
ATOM   316  O  O     . VAL A 1 40  ? -34.919 30.796 6.473   1.00 11.87  ? 37   VAL A O     1 
ATOM   317  C  CB    . VAL A 1 40  ? -34.700 31.193 9.817   1.00 10.21  ? 37   VAL A CB    1 
ATOM   318  C  CG1   . VAL A 1 40  ? -34.790 32.207 10.944  1.00 9.96   ? 37   VAL A CG1   1 
ATOM   319  C  CG2   . VAL A 1 40  ? -36.011 30.446 9.624   1.00 9.52   ? 37   VAL A CG2   1 
ATOM   320  N  N     . GLN A 1 41  ? -32.991 30.154 7.457   1.00 11.50  ? 38   GLN A N     1 
ATOM   321  C  CA    . GLN A 1 41  ? -32.814 28.992 6.600   1.00 12.23  ? 38   GLN A CA    1 
ATOM   322  C  C     . GLN A 1 41  ? -32.454 27.777 7.428   1.00 12.54  ? 38   GLN A C     1 
ATOM   323  O  O     . GLN A 1 41  ? -31.741 27.908 8.418   1.00 11.61  ? 38   GLN A O     1 
ATOM   324  C  CB    . GLN A 1 41  ? -31.739 29.265 5.542   1.00 12.75  ? 38   GLN A CB    1 
ATOM   325  C  CG    . GLN A 1 41  ? -30.327 29.578 6.032   1.00 14.16  ? 38   GLN A CG    1 
ATOM   326  C  CD    . GLN A 1 41  ? -29.414 30.117 4.925   1.00 14.62  ? 38   GLN A CD    1 
ATOM   327  O  OE1   . GLN A 1 41  ? -29.822 30.316 3.783   1.00 15.57  ? 38   GLN A OE1   1 
ATOM   328  N  NE2   . GLN A 1 41  ? -28.186 30.367 5.270   1.00 16.58  ? 38   GLN A NE2   1 
ATOM   329  N  N     . TYR A 1 42  ? -32.974 26.598 7.037   1.00 13.20  ? 39   TYR A N     1 
ATOM   330  C  CA    . TYR A 1 42  ? -32.690 25.297 7.724   1.00 13.97  ? 39   TYR A CA    1 
ATOM   331  C  C     . TYR A 1 42  ? -33.267 25.243 9.125   1.00 15.18  ? 39   TYR A C     1 
ATOM   332  O  O     . TYR A 1 42  ? -32.584 25.253 10.131  1.00 15.18  ? 39   TYR A O     1 
ATOM   333  C  CB    . TYR A 1 42  ? -31.215 24.986 7.738   1.00 13.95  ? 39   TYR A CB    1 
ATOM   334  C  CG    . TYR A 1 42  ? -30.575 25.012 6.358   1.00 13.95  ? 39   TYR A CG    1 
ATOM   335  C  CD1   . TYR A 1 42  ? -31.080 24.214 5.327   1.00 14.05  ? 39   TYR A CD1   1 
ATOM   336  C  CD2   . TYR A 1 42  ? -29.465 25.772 6.097   1.00 13.71  ? 39   TYR A CD2   1 
ATOM   337  C  CE1   . TYR A 1 42  ? -30.491 24.207 4.072   1.00 14.05  ? 39   TYR A CE1   1 
ATOM   338  C  CE2   . TYR A 1 42  ? -28.881 25.760 4.844   1.00 14.09  ? 39   TYR A CE2   1 
ATOM   339  C  CZ    . TYR A 1 42  ? -29.380 24.974 3.851   1.00 13.66  ? 39   TYR A CZ    1 
ATOM   340  O  OH    . TYR A 1 42  ? -28.782 24.944 2.627   1.00 14.18  ? 39   TYR A OH    1 
ATOM   341  N  N     . LYS A 1 43  ? -34.578 25.125 9.145   1.00 18.05  ? 40   LYS A N     1 
ATOM   342  C  CA    . LYS A 1 43  ? -35.406 25.050 10.362  1.00 20.41  ? 40   LYS A CA    1 
ATOM   343  C  C     . LYS A 1 43  ? -34.977 24.102 11.484  1.00 21.17  ? 40   LYS A C     1 
ATOM   344  O  O     . LYS A 1 43  ? -35.126 24.399 12.688  1.00 18.66  ? 40   LYS A O     1 
ATOM   345  C  CB    . LYS A 1 43  ? -36.848 24.720 9.924   1.00 24.52  ? 40   LYS A CB    1 
ATOM   346  C  CG    . LYS A 1 43  ? -37.890 25.212 10.865  1.00 27.96  ? 40   LYS A CG    1 
ATOM   347  C  CD    . LYS A 1 43  ? -37.851 26.742 11.082  1.00 26.55  ? 40   LYS A CD    1 
ATOM   348  C  CE    . LYS A 1 43  ? -38.320 26.986 12.476  1.00 25.42  ? 40   LYS A CE    1 
ATOM   349  N  NZ    . LYS A 1 43  ? -38.032 28.305 12.922  1.00 25.19  ? 40   LYS A NZ    1 
ATOM   350  N  N     . SER A 1 44  ? -34.406 22.964 11.107  1.00 22.24  ? 41   SER A N     1 
ATOM   351  C  CA    . SER A 1 44  ? -34.136 21.925 12.091  1.00 23.14  ? 41   SER A CA    1 
ATOM   352  C  C     . SER A 1 44  ? -32.864 22.265 12.836  1.00 21.50  ? 41   SER A C     1 
ATOM   353  O  O     . SER A 1 44  ? -32.556 21.658 13.838  1.00 19.74  ? 41   SER A O     1 
ATOM   354  C  CB    . SER A 1 44  ? -34.047 20.556 11.419  1.00 24.12  ? 41   SER A CB    1 
ATOM   355  O  OG    . SER A 1 44  ? -32.841 20.457 10.677  1.00 25.74  ? 41   SER A OG    1 
ATOM   356  N  N     . TRP A 1 45  ? -32.123 23.257 12.373  1.00 21.41  ? 42   TRP A N     1 
ATOM   357  C  CA    . TRP A 1 45  ? -30.884 23.650 13.062  1.00 24.22  ? 42   TRP A CA    1 
ATOM   358  C  C     . TRP A 1 45  ? -31.188 24.819 14.018  1.00 23.96  ? 42   TRP A C     1 
ATOM   359  O  O     . TRP A 1 45  ? -31.147 26.014 13.599  1.00 22.95  ? 42   TRP A O     1 
ATOM   360  C  CB    . TRP A 1 45  ? -29.815 24.066 12.054  1.00 25.72  ? 42   TRP A CB    1 
ATOM   361  C  CG    . TRP A 1 45  ? -29.356 22.967 11.135  1.00 29.16  ? 42   TRP A CG    1 
ATOM   362  C  CD1   . TRP A 1 45  ? -29.613 21.617 11.230  1.00 29.30  ? 42   TRP A CD1   1 
ATOM   363  C  CD2   . TRP A 1 45  ? -28.515 23.136 9.975   1.00 30.84  ? 42   TRP A CD2   1 
ATOM   364  N  NE1   . TRP A 1 45  ? -28.987 20.955 10.196  1.00 28.98  ? 42   TRP A NE1   1 
ATOM   365  C  CE2   . TRP A 1 45  ? -28.310 21.861 9.416   1.00 29.71  ? 42   TRP A CE2   1 
ATOM   366  C  CE3   . TRP A 1 45  ? -27.908 24.249 9.366   1.00 30.53  ? 42   TRP A CE3   1 
ATOM   367  C  CZ2   . TRP A 1 45  ? -27.513 21.667 8.272   1.00 31.38  ? 42   TRP A CZ2   1 
ATOM   368  C  CZ3   . TRP A 1 45  ? -27.111 24.039 8.233   1.00 29.81  ? 42   TRP A CZ3   1 
ATOM   369  C  CH2   . TRP A 1 45  ? -26.923 22.777 7.709   1.00 29.42  ? 42   TRP A CH2   1 
ATOM   370  N  N     . LYS A 1 46  ? -31.568 24.484 15.266  1.00 20.96  ? 43   LYS A N     1 
ATOM   371  C  CA    . LYS A 1 46  ? -31.842 25.496 16.290  1.00 20.20  ? 43   LYS A CA    1 
ATOM   372  C  C     . LYS A 1 46  ? -32.793 26.586 15.838  1.00 18.27  ? 43   LYS A C     1 
ATOM   373  O  O     . LYS A 1 46  ? -32.595 27.795 16.169  1.00 19.51  ? 43   LYS A O     1 
ATOM   374  C  CB    . LYS A 1 46  ? -30.541 26.118 16.788  1.00 22.08  ? 43   LYS A CB    1 
ATOM   375  C  CG    . LYS A 1 46  ? -29.741 25.208 17.680  1.00 25.72  ? 43   LYS A CG    1 
ATOM   376  C  CD    . LYS A 1 46  ? -28.525 25.893 18.342  1.00 28.15  ? 43   LYS A CD    1 
ATOM   377  C  CE    . LYS A 1 46  ? -28.976 26.762 19.505  1.00 29.20  ? 43   LYS A CE    1 
ATOM   378  N  NZ    . LYS A 1 46  ? -27.854 27.353 20.305  1.00 31.27  ? 43   LYS A NZ    1 
ATOM   379  N  N     . GLY A 1 47  ? -33.838 26.166 15.126  1.00 14.83  ? 44   GLY A N     1 
ATOM   380  C  CA    . GLY A 1 47  ? -34.887 27.029 14.636  1.00 15.70  ? 44   GLY A CA    1 
ATOM   381  C  C     . GLY A 1 47  ? -34.455 27.717 13.357  1.00 13.91  ? 44   GLY A C     1 
ATOM   382  O  O     . GLY A 1 47  ? -35.232 28.441 12.744  1.00 14.41  ? 44   GLY A O     1 
ATOM   383  N  N     . GLY A 1 48  ? -33.231 27.514 12.951  1.00 13.91  ? 45   GLY A N     1 
ATOM   384  C  CA    . GLY A 1 48  ? -32.769 28.014 11.633  1.00 14.85  ? 45   GLY A CA    1 
ATOM   385  C  C     . GLY A 1 48  ? -31.823 29.174 11.772  1.00 14.12  ? 45   GLY A C     1 
ATOM   386  O  O     . GLY A 1 48  ? -31.824 29.860 12.787  1.00 14.09  ? 45   GLY A O     1 
ATOM   387  N  N     . GLY A 1 49  ? -30.968 29.341 10.758  1.00 13.81  ? 46   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 49  ? -29.969 30.413 10.747  1.00 12.67  ? 46   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 49  ? -30.583 31.687 10.277  1.00 11.74  ? 46   GLY A C     1 
ATOM   390  O  O     . GLY A 1 49  ? -31.256 31.675 9.246   1.00 12.24  ? 46   GLY A O     1 
ATOM   391  N  N     . ILE A 1 50  ? -30.413 32.768 11.028  1.00 10.64  ? 47   ILE A N     1 
ATOM   392  C  CA    . ILE A 1 50  ? -31.056 34.030 10.703  1.00 10.52  ? 47   ILE A CA    1 
ATOM   393  C  C     . ILE A 1 50  ? -30.193 34.736 9.661   1.00 11.06  ? 47   ILE A C     1 
ATOM   394  O  O     . ILE A 1 50  ? -28.983 34.997 9.901   1.00 10.37  ? 47   ILE A O     1 
ATOM   395  C  CB    . ILE A 1 50  ? -31.239 34.964 11.929  1.00 10.12  ? 47   ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 50  ? -32.340 34.436 12.831  1.00 10.63  ? 47   ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 50  ? -31.659 36.365 11.499  1.00 9.70   ? 47   ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 50  ? -32.463 35.243 14.114  1.00 11.31  ? 47   ILE A CD1   1 
ATOM   399  N  N     . ILE A 1 51  ? -30.807 35.086 8.538   1.00 11.07  ? 48   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 51  ? -30.098 35.803 7.482   1.00 11.45  ? 48   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 51  ? -30.584 37.244 7.235   1.00 11.12  ? 48   ILE A C     1 
ATOM   402  O  O     . ILE A 1 51  ? -29.882 38.019 6.587   1.00 14.22  ? 48   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 51  ? -30.086 34.997 6.167   1.00 12.85  ? 48   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 51  ? -31.496 34.655 5.668   1.00 12.28  ? 48   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 51  ? -29.305 33.688 6.350   1.00 13.24  ? 48   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 51  ? -31.445 34.073 4.292   1.00 13.51  ? 48   ILE A CD1   1 
ATOM   407  N  N     . ALA A 1 52  ? -31.713 37.639 7.805   1.00 9.82   ? 49   ALA A N     1 
ATOM   408  C  CA    . ALA A 1 52  ? -32.176 39.014 7.737   1.00 8.48   ? 49   ALA A CA    1 
ATOM   409  C  C     . ALA A 1 52  ? -33.135 39.300 8.892   1.00 7.92   ? 49   ALA A C     1 
ATOM   410  O  O     . ALA A 1 52  ? -33.858 38.399 9.326   1.00 7.15   ? 49   ALA A O     1 
ATOM   411  C  CB    . ALA A 1 52  ? -32.881 39.269 6.380   1.00 8.74   ? 49   ALA A CB    1 
ATOM   412  N  N     . VAL A 1 53  ? -33.170 40.556 9.341   1.00 7.85   ? 50   VAL A N     1 
ATOM   413  C  CA    . VAL A 1 53  ? -33.801 40.956 10.624  1.00 8.06   ? 50   VAL A CA    1 
ATOM   414  C  C     . VAL A 1 53  ? -34.501 42.297 10.442  1.00 7.49   ? 50   VAL A C     1 
ATOM   415  O  O     . VAL A 1 53  ? -33.890 43.271 10.005  1.00 7.02   ? 50   VAL A O     1 
ATOM   416  C  CB    . VAL A 1 53  ? -32.725 41.075 11.739  1.00 8.49   ? 50   VAL A CB    1 
ATOM   417  C  CG1   . VAL A 1 53  ? -33.360 41.228 13.085  1.00 8.99   ? 50   VAL A CG1   1 
ATOM   418  C  CG2   . VAL A 1 53  ? -31.846 39.865 11.820  1.00 8.73   ? 50   VAL A CG2   1 
ATOM   419  N  N     . SER A 1 54  ? -35.779 42.380 10.780  1.00 8.06   ? 51   SER A N     1 
ATOM   420  C  CA    . SER A 1 54  ? -36.499 43.642 10.714  1.00 8.78   ? 51   SER A CA    1 
ATOM   421  C  C     . SER A 1 54  ? -35.944 44.598 11.736  1.00 9.75   ? 51   SER A C     1 
ATOM   422  O  O     . SER A 1 54  ? -35.401 44.140 12.751  1.00 9.76   ? 51   SER A O     1 
ATOM   423  C  CB    . SER A 1 54  ? -37.985 43.467 10.957  1.00 8.81   ? 51   SER A CB    1 
ATOM   424  O  OG    . SER A 1 54  ? -38.339 43.243 12.350  1.00 9.32   ? 51   SER A OG    1 
ATOM   425  N  N     . TYR A 1 55  ? -36.145 45.897 11.521  1.00 10.23  ? 52   TYR A N     1 
ATOM   426  C  CA    . TYR A 1 55  ? -35.667 46.914 12.467  1.00 11.24  ? 52   TYR A CA    1 
ATOM   427  C  C     . TYR A 1 55  ? -36.328 46.841 13.842  1.00 12.89  ? 52   TYR A C     1 
ATOM   428  O  O     . TYR A 1 55  ? -35.635 47.027 14.830  1.00 12.10  ? 52   TYR A O     1 
ATOM   429  C  CB    . TYR A 1 55  ? -35.764 48.335 11.881  1.00 12.35  ? 52   TYR A CB    1 
ATOM   430  C  CG    . TYR A 1 55  ? -34.626 48.585 10.936  1.00 12.30  ? 52   TYR A CG    1 
ATOM   431  C  CD1   . TYR A 1 55  ? -34.654 48.108 9.637   1.00 11.65  ? 52   TYR A CD1   1 
ATOM   432  C  CD2   . TYR A 1 55  ? -33.462 49.217 11.373  1.00 13.71  ? 52   TYR A CD2   1 
ATOM   433  C  CE1   . TYR A 1 55  ? -33.585 48.281 8.789   1.00 12.08  ? 52   TYR A CE1   1 
ATOM   434  C  CE2   . TYR A 1 55  ? -32.376 49.400 10.509  1.00 13.30  ? 52   TYR A CE2   1 
ATOM   435  C  CZ    . TYR A 1 55  ? -32.459 48.939 9.208   1.00 13.01  ? 52   TYR A CZ    1 
ATOM   436  O  OH    . TYR A 1 55  ? -31.390 49.099 8.322   1.00 15.60  ? 52   TYR A OH    1 
ATOM   437  N  N     . GLU A 1 56  ? -37.587 46.376 13.911  1.00 13.76  ? 53   GLU A N     1 
ATOM   438  C  CA    . GLU A 1 56  ? -38.260 46.156 15.194  1.00 14.68  ? 53   GLU A CA    1 
ATOM   439  C  C     . GLU A 1 56  ? -37.552 45.017 15.956  1.00 14.74  ? 53   GLU A C     1 
ATOM   440  O  O     . GLU A 1 56  ? -37.421 45.082 17.168  1.00 13.31  ? 53   GLU A O     1 
ATOM   441  C  CB    . GLU A 1 56  ? -39.753 45.812 15.049  1.00 16.27  ? 53   GLU A CB    1 
ATOM   442  C  CG    . GLU A 1 56  ? -40.706 46.783 14.351  1.00 17.48  ? 53   GLU A CG    1 
ATOM   443  C  CD    . GLU A 1 56  ? -40.587 46.880 12.840  1.00 21.16  ? 53   GLU A CD    1 
ATOM   444  O  OE1   . GLU A 1 56  ? -39.692 46.235 12.190  1.00 20.65  ? 53   GLU A OE1   1 
ATOM   445  O  OE2   . GLU A 1 56  ? -41.381 47.662 12.274  1.00 23.25  ? 53   GLU A OE2   1 
ATOM   446  N  N     . ALA A 1 57  ? -37.094 43.968 15.256  1.00 13.29  ? 54   ALA A N     1 
ATOM   447  C  CA    . ALA A 1 57  ? -36.368 42.873 15.913  1.00 12.85  ? 54   ALA A CA    1 
ATOM   448  C  C     . ALA A 1 57  ? -34.949 43.286 16.279  1.00 12.43  ? 54   ALA A C     1 
ATOM   449  O  O     . ALA A 1 57  ? -34.421 42.876 17.286  1.00 11.98  ? 54   ALA A O     1 
ATOM   450  C  CB    . ALA A 1 57  ? -36.365 41.611 15.026  1.00 13.15  ? 54   ALA A CB    1 
ATOM   451  N  N     . ARG A 1 58  ? -34.316 44.125 15.445  1.00 13.09  ? 55   ARG A N     1 
ATOM   452  C  CA    . ARG A 1 58  ? -32.955 44.634 15.798  1.00 13.34  ? 55   ARG A CA    1 
ATOM   453  C  C     . ARG A 1 58  ? -32.915 45.407 17.152  1.00 13.81  ? 55   ARG A C     1 
ATOM   454  O  O     . ARG A 1 58  ? -31.922 45.312 17.876  1.00 12.83  ? 55   ARG A O     1 
ATOM   455  C  CB    . ARG A 1 58  ? -32.385 45.489 14.726  1.00 12.51  ? 55   ARG A CB    1 
ATOM   456  C  CG    . ARG A 1 58  ? -32.255 44.782 13.418  1.00 13.27  ? 55   ARG A CG    1 
ATOM   457  C  CD    . ARG A 1 58  ? -31.681 45.696 12.365  1.00 14.79  ? 55   ARG A CD    1 
ATOM   458  N  NE    . ARG A 1 58  ? -31.902 45.120 11.059  1.00 14.48  ? 55   ARG A NE    1 
ATOM   459  C  CZ    . ARG A 1 58  ? -31.212 45.403 9.961   1.00 16.60  ? 55   ARG A CZ    1 
ATOM   460  N  NH1   . ARG A 1 58  ? -30.242 46.334 9.959   1.00 17.27  ? 55   ARG A NH1   1 
ATOM   461  N  NH2   . ARG A 1 58  ? -31.507 44.759 8.831   1.00 14.75  ? 55   ARG A NH2   1 
ATOM   462  N  N     . ALA A 1 59  ? -34.012 46.055 17.518  1.00 14.37  ? 56   ALA A N     1 
ATOM   463  C  CA    . ALA A 1 59  ? -34.104 46.794 18.773  1.00 15.29  ? 56   ALA A CA    1 
ATOM   464  C  C     . ALA A 1 59  ? -34.020 45.864 19.972  1.00 17.17  ? 56   ALA A C     1 
ATOM   465  O  O     . ALA A 1 59  ? -33.695 46.361 21.064  1.00 18.58  ? 56   ALA A O     1 
ATOM   466  C  CB    . ALA A 1 59  ? -35.398 47.615 18.846  1.00 16.06  ? 56   ALA A CB    1 
ATOM   467  N  N     . PHE A 1 60  ? -34.311 44.566 19.799  1.00 14.80  ? 57   PHE A N     1 
ATOM   468  C  CA    . PHE A 1 60  ? -34.132 43.584 20.842  1.00 15.07  ? 57   PHE A CA    1 
ATOM   469  C  C     . PHE A 1 60  ? -32.738 42.951 20.844  1.00 14.80  ? 57   PHE A C     1 
ATOM   470  O  O     . PHE A 1 60  ? -32.430 42.182 21.756  1.00 15.46  ? 57   PHE A O     1 
ATOM   471  C  CB    . PHE A 1 60  ? -35.163 42.456 20.747  1.00 14.45  ? 57   PHE A CB    1 
ATOM   472  C  CG    . PHE A 1 60  ? -36.566 42.862 21.060  1.00 16.21  ? 57   PHE A CG    1 
ATOM   473  C  CD1   . PHE A 1 60  ? -37.106 42.625 22.336  1.00 16.86  ? 57   PHE A CD1   1 
ATOM   474  C  CD2   . PHE A 1 60  ? -37.369 43.415 20.084  1.00 15.72  ? 57   PHE A CD2   1 
ATOM   475  C  CE1   . PHE A 1 60  ? -38.435 42.955 22.647  1.00 19.29  ? 57   PHE A CE1   1 
ATOM   476  C  CE2   . PHE A 1 60  ? -38.675 43.789 20.363  1.00 18.88  ? 57   PHE A CE2   1 
ATOM   477  C  CZ    . PHE A 1 60  ? -39.240 43.549 21.632  1.00 19.98  ? 57   PHE A CZ    1 
ATOM   478  N  N     . GLY A 1 61  ? -31.892 43.263 19.857  1.00 13.32  ? 58   GLY A N     1 
ATOM   479  C  CA    . GLY A 1 61  ? -30.560 42.683 19.769  1.00 13.08  ? 58   GLY A CA    1 
ATOM   480  C  C     . GLY A 1 61  ? -30.458 41.493 18.854  1.00 13.39  ? 58   GLY A C     1 
ATOM   481  O  O     . GLY A 1 61  ? -29.444 40.750 18.832  1.00 12.08  ? 58   GLY A O     1 
ATOM   482  N  N     . VAL A 1 62  ? -31.520 41.267 18.071  1.00 13.56  ? 59   VAL A N     1 
ATOM   483  C  CA    . VAL A 1 62  ? -31.504 40.161 17.094  1.00 12.84  ? 59   VAL A CA    1 
ATOM   484  C  C     . VAL A 1 62  ? -30.596 40.562 15.971  1.00 12.39  ? 59   VAL A C     1 
ATOM   485  O  O     . VAL A 1 62  ? -30.688 41.682 15.495  1.00 11.49  ? 59   VAL A O     1 
ATOM   486  C  CB    . VAL A 1 62  ? -32.907 39.836 16.579  1.00 12.16  ? 59   VAL A CB    1 
ATOM   487  C  CG1   . VAL A 1 62  ? -32.851 38.701 15.584  1.00 12.81  ? 59   VAL A CG1   1 
ATOM   488  C  CG2   . VAL A 1 62  ? -33.776 39.379 17.693  1.00 11.96  ? 59   VAL A CG2   1 
ATOM   489  N  N     . THR A 1 63  ? -29.709 39.647 15.569  1.00 13.68  ? 60   THR A N     1 
ATOM   490  C  CA    . THR A 1 63  ? -28.812 39.854 14.475  1.00 13.95  ? 60   THR A CA    1 
ATOM   491  C  C     . THR A 1 63  ? -28.776 38.716 13.497  1.00 14.51  ? 60   THR A C     1 
ATOM   492  O  O     . THR A 1 63  ? -29.248 37.594 13.766  1.00 15.26  ? 60   THR A O     1 
ATOM   493  C  CB    . THR A 1 63  ? -27.344 40.101 14.952  1.00 14.40  ? 60   THR A CB    1 
ATOM   494  O  OG1   . THR A 1 63  ? -26.784 38.873 15.407  1.00 13.98  ? 60   THR A OG1   1 
ATOM   495  C  CG2   . THR A 1 63  ? -27.279 41.160 15.983  1.00 14.51  ? 60   THR A CG2   1 
ATOM   496  N  N     . ARG A 1 64  ? -28.210 39.032 12.337  1.00 14.70  ? 61   ARG A N     1 
ATOM   497  C  CA    . ARG A 1 64  ? -27.746 38.042 11.364  1.00 17.75  ? 61   ARG A CA    1 
ATOM   498  C  C     . ARG A 1 64  ? -26.738 37.092 11.971  1.00 17.13  ? 61   ARG A C     1 
ATOM   499  O  O     . ARG A 1 64  ? -26.040 37.463 12.899  1.00 19.43  ? 61   ARG A O     1 
ATOM   500  C  CB    . ARG A 1 64  ? -27.131 38.752 10.129  1.00 18.85  ? 61   ARG A CB    1 
ATOM   501  C  CG    . ARG A 1 64  ? -26.420 37.847 9.140   1.00 21.27  ? 61   ARG A CG    1 
ATOM   502  C  CD    . ARG A 1 64  ? -25.982 38.599 7.874   1.00 22.44  ? 61   ARG A CD    1 
ATOM   503  N  NE    . ARG A 1 64  ? -27.195 39.155 7.321   1.00 22.45  ? 61   ARG A NE    1 
ATOM   504  C  CZ    . ARG A 1 64  ? -27.407 40.406 6.904   1.00 22.98  ? 61   ARG A CZ    1 
ATOM   505  N  NH1   . ARG A 1 64  ? -26.438 41.328 6.838   1.00 23.65  ? 61   ARG A NH1   1 
ATOM   506  N  NH2   . ARG A 1 64  ? -28.643 40.732 6.513   1.00 20.51  ? 61   ARG A NH2   1 
ATOM   507  N  N     . SER A 1 65  ? -26.684 35.864 11.477  1.00 17.43  ? 62   SER A N     1 
ATOM   508  C  CA    . SER A 1 65  ? -25.785 34.856 11.980  1.00 19.18  ? 62   SER A CA    1 
ATOM   509  C  C     . SER A 1 65  ? -25.965 34.553 13.481  1.00 19.77  ? 62   SER A C     1 
ATOM   510  O  O     . SER A 1 65  ? -25.039 34.233 14.204  1.00 20.84  ? 62   SER A O     1 
ATOM   511  C  CB    . SER A 1 65  ? -24.360 35.225 11.637  1.00 23.01  ? 62   SER A CB    1 
ATOM   512  O  OG    . SER A 1 65  ? -23.746 35.799 12.753  1.00 28.19  ? 62   SER A OG    1 
ATOM   513  N  N     . MET A 1 66  ? -27.195 34.646 13.907  1.00 17.33  ? 63   MET A N     1 
ATOM   514  C  CA    . MET A 1 66  ? -27.684 34.126 15.179  1.00 16.89  ? 63   MET A CA    1 
ATOM   515  C  C     . MET A 1 66  ? -28.640 32.976 14.803  1.00 15.60  ? 63   MET A C     1 
ATOM   516  O  O     . MET A 1 66  ? -29.343 33.071 13.766  1.00 13.67  ? 63   MET A O     1 
ATOM   517  C  CB    . MET A 1 66  ? -28.380 35.295 15.831  1.00 17.18  ? 63   MET A CB    1 
ATOM   518  C  CG    . MET A 1 66  ? -28.828 35.156 17.231  1.00 20.27  ? 63   MET A CG    1 
ATOM   519  S  SD    . MET A 1 66  ? -29.436 36.754 17.784  1.00 19.57  ? 63   MET A SD    1 
ATOM   520  C  CE    . MET A 1 66  ? -27.968 37.573 18.409  1.00 19.84  ? 63   MET A CE    1 
ATOM   521  N  N     . TRP A 1 67  ? -28.671 31.912 15.617  1.00 15.23  ? 64   TRP A N     1 
ATOM   522  C  CA    . TRP A 1 67  ? -29.685 30.848 15.489  1.00 13.62  ? 64   TRP A CA    1 
ATOM   523  C  C     . TRP A 1 67  ? -31.022 31.343 15.996  1.00 12.32  ? 64   TRP A C     1 
ATOM   524  O  O     . TRP A 1 67  ? -31.048 32.064 16.974  1.00 12.59  ? 64   TRP A O     1 
ATOM   525  C  CB    . TRP A 1 67  ? -29.277 29.555 16.216  1.00 14.44  ? 64   TRP A CB    1 
ATOM   526  C  CG    . TRP A 1 67  ? -28.020 28.998 15.661  1.00 16.12  ? 64   TRP A CG    1 
ATOM   527  C  CD1   . TRP A 1 67  ? -26.792 28.977 16.255  1.00 17.23  ? 64   TRP A CD1   1 
ATOM   528  C  CD2   . TRP A 1 67  ? -27.855 28.392 14.375  1.00 16.69  ? 64   TRP A CD2   1 
ATOM   529  N  NE1   . TRP A 1 67  ? -25.873 28.388 15.413  1.00 17.83  ? 64   TRP A NE1   1 
ATOM   530  C  CE2   . TRP A 1 67  ? -26.492 28.047 14.244  1.00 18.35  ? 64   TRP A CE2   1 
ATOM   531  C  CE3   . TRP A 1 67  ? -28.717 28.147 13.311  1.00 17.11  ? 64   TRP A CE3   1 
ATOM   532  C  CZ2   . TRP A 1 67  ? -25.972 27.437 13.071  1.00 18.16  ? 64   TRP A CZ2   1 
ATOM   533  C  CZ3   . TRP A 1 67  ? -28.237 27.544 12.196  1.00 18.66  ? 64   TRP A CZ3   1 
ATOM   534  C  CH2   . TRP A 1 67  ? -26.862 27.190 12.077  1.00 18.37  ? 64   TRP A CH2   1 
ATOM   535  N  N     . ALA A 1 68  ? -32.130 30.976 15.319  1.00 11.01  ? 65   ALA A N     1 
ATOM   536  C  CA    . ALA A 1 68  ? -33.430 31.467 15.664  1.00 11.75  ? 65   ALA A CA    1 
ATOM   537  C  C     . ALA A 1 68  ? -33.797 31.161 17.121  1.00 12.06  ? 65   ALA A C     1 
ATOM   538  O  O     . ALA A 1 68  ? -34.403 31.994 17.784  1.00 12.96  ? 65   ALA A O     1 
ATOM   539  C  CB    . ALA A 1 68  ? -34.504 30.889 14.751  1.00 11.41  ? 65   ALA A CB    1 
ATOM   540  N  N     . ASP A 1 69  ? -33.402 29.996 17.625  1.00 13.57  ? 66   ASP A N     1 
ATOM   541  C  CA    . ASP A 1 69  ? -33.700 29.630 19.018  1.00 14.74  ? 66   ASP A CA    1 
ATOM   542  C  C     . ASP A 1 69  ? -33.033 30.605 19.986  1.00 14.90  ? 66   ASP A C     1 
ATOM   543  O  O     . ASP A 1 69  ? -33.573 30.879 21.030  1.00 15.18  ? 66   ASP A O     1 
ATOM   544  C  CB    . ASP A 1 69  ? -33.267 28.195 19.321  1.00 16.02  ? 66   ASP A CB    1 
ATOM   545  C  CG    . ASP A 1 69  ? -34.265 27.143 18.772  1.00 18.10  ? 66   ASP A CG    1 
ATOM   546  O  OD1   . ASP A 1 69  ? -35.387 27.531 18.332  1.00 20.26  ? 66   ASP A OD1   1 
ATOM   547  O  OD2   . ASP A 1 69  ? -33.909 25.946 18.798  1.00 22.06  ? 66   ASP A OD2   1 
ATOM   548  N  N     . ASP A 1 70  ? -31.814 31.033 19.657  1.00 13.29  ? 67   ASP A N     1 
ATOM   549  C  CA    . ASP A 1 70  ? -31.078 31.951 20.500  1.00 13.24  ? 67   ASP A CA    1 
ATOM   550  C  C     . ASP A 1 70  ? -31.714 33.345 20.396  1.00 11.64  ? 67   ASP A C     1 
ATOM   551  O  O     . ASP A 1 70  ? -31.883 34.023 21.380  1.00 11.52  ? 67   ASP A O     1 
ATOM   552  C  CB    . ASP A 1 70  ? -29.603 31.949 20.063  1.00 14.73  ? 67   ASP A CB    1 
ATOM   553  C  CG    . ASP A 1 70  ? -28.918 30.601 20.363  1.00 17.72  ? 67   ASP A CG    1 
ATOM   554  O  OD1   . ASP A 1 70  ? -29.409 29.918 21.310  1.00 16.91  ? 67   ASP A OD1   1 
ATOM   555  O  OD2   . ASP A 1 70  ? -27.943 30.229 19.642  1.00 15.18  ? 67   ASP A OD2   1 
ATOM   556  N  N     . ALA A 1 71  ? -32.111 33.756 19.182  1.00 10.37  ? 68   ALA A N     1 
ATOM   557  C  CA    . ALA A 1 71  ? -32.733 35.050 18.986  1.00 11.07  ? 68   ALA A CA    1 
ATOM   558  C  C     . ALA A 1 71  ? -34.000 35.179 19.839  1.00 11.24  ? 68   ALA A C     1 
ATOM   559  O  O     . ALA A 1 71  ? -34.354 36.281 20.299  1.00 11.22  ? 68   ALA A O     1 
ATOM   560  C  CB    . ALA A 1 71  ? -33.080 35.289 17.514  1.00 10.53  ? 68   ALA A CB    1 
ATOM   561  N  N     . LYS A 1 72  ? -34.711 34.064 19.947  1.00 11.94  ? 69   LYS A N     1 
ATOM   562  C  CA    . LYS A 1 72  ? -35.963 33.983 20.742  1.00 13.67  ? 69   LYS A CA    1 
ATOM   563  C  C     . LYS A 1 72  ? -35.800 34.267 22.227  1.00 14.06  ? 69   LYS A C     1 
ATOM   564  O  O     . LYS A 1 72  ? -36.751 34.650 22.899  1.00 13.40  ? 69   LYS A O     1 
ATOM   565  C  CB    . LYS A 1 72  ? -36.571 32.594 20.613  1.00 15.25  ? 69   LYS A CB    1 
ATOM   566  C  CG    . LYS A 1 72  ? -37.093 32.329 19.235  1.00 16.94  ? 69   LYS A CG    1 
ATOM   567  C  CD    . LYS A 1 72  ? -38.465 32.859 19.078  1.00 19.05  ? 69   LYS A CD    1 
ATOM   568  C  CE    . LYS A 1 72  ? -38.882 32.678 17.639  1.00 23.81  ? 69   LYS A CE    1 
ATOM   569  N  NZ    . LYS A 1 72  ? -39.268 31.252 17.276  1.00 26.62  ? 69   LYS A NZ    1 
ATOM   570  N  N     . LYS A 1 73  ? -34.569 34.099 22.716  1.00 14.62  ? 70   LYS A N     1 
ATOM   571  C  CA    . LYS A 1 73  ? -34.227 34.355 24.103  1.00 15.62  ? 70   LYS A CA    1 
ATOM   572  C  C     . LYS A 1 73  ? -34.162 35.857 24.301  1.00 15.51  ? 70   LYS A C     1 
ATOM   573  O  O     . LYS A 1 73  ? -34.538 36.331 25.339  1.00 16.46  ? 70   LYS A O     1 
ATOM   574  C  CB    . LYS A 1 73  ? -32.884 33.669 24.432  1.00 16.10  ? 70   LYS A CB    1 
ATOM   575  C  CG    . LYS A 1 73  ? -32.866 32.171 24.189  1.00 16.10  ? 70   LYS A CG    1 
ATOM   576  C  CD    . LYS A 1 73  ? -31.459 31.594 24.371  1.00 17.78  ? 70   LYS A CD    1 
ATOM   577  C  CE    . LYS A 1 73  ? -31.472 30.088 24.114  1.00 18.16  ? 70   LYS A CE    1 
ATOM   578  N  NZ    . LYS A 1 73  ? -30.065 29.656 24.011  1.00 20.15  ? 70   LYS A NZ    1 
ATOM   579  N  N     . LEU A 1 74  ? -33.698 36.606 23.294  1.00 14.10  ? 71   LEU A N     1 
ATOM   580  C  CA    . LEU A 1 74  ? -33.706 38.078 23.355  1.00 14.47  ? 71   LEU A CA    1 
ATOM   581  C  C     . LEU A 1 74  ? -35.082 38.663 23.054  1.00 14.52  ? 71   LEU A C     1 
ATOM   582  O  O     . LEU A 1 74  ? -35.385 39.754 23.492  1.00 13.13  ? 71   LEU A O     1 
ATOM   583  C  CB    . LEU A 1 74  ? -32.749 38.648 22.291  1.00 14.74  ? 71   LEU A CB    1 
ATOM   584  C  CG    . LEU A 1 74  ? -31.320 38.186 22.383  1.00 16.69  ? 71   LEU A CG    1 
ATOM   585  C  CD1   . LEU A 1 74  ? -30.434 38.916 21.379  1.00 17.97  ? 71   LEU A CD1   1 
ATOM   586  C  CD2   . LEU A 1 74  ? -30.747 38.450 23.760  1.00 16.88  ? 71   LEU A CD2   1 
ATOM   587  N  N     . CYS A 1 75  ? -35.840 37.971 22.187  1.00 15.52  ? 72   CYS A N     1 
ATOM   588  C  CA    . CYS A 1 75  ? -37.061 38.506 21.547  1.00 14.90  ? 72   CYS A CA    1 
ATOM   589  C  C     . CYS A 1 75  ? -38.035 37.343 21.441  1.00 15.81  ? 72   CYS A C     1 
ATOM   590  O  O     . CYS A 1 75  ? -38.131 36.698 20.396  1.00 16.78  ? 72   CYS A O     1 
ATOM   591  C  CB    . CYS A 1 75  ? -36.732 39.106 20.183  1.00 15.43  ? 72   CYS A CB    1 
ATOM   592  S  SG    . CYS A 1 75  ? -38.177 39.847 19.352  1.00 15.67  ? 72   CYS A SG    1 
ATOM   593  N  N     . PRO A 1 76  ? -38.772 37.053 22.539  1.00 15.28  ? 73   PRO A N     1 
ATOM   594  C  CA    . PRO A 1 76  ? -39.692 35.922 22.583  1.00 15.97  ? 73   PRO A CA    1 
ATOM   595  C  C     . PRO A 1 76  ? -40.839 35.987 21.569  1.00 15.61  ? 73   PRO A C     1 
ATOM   596  O  O     . PRO A 1 76  ? -41.383 34.961 21.192  1.00 16.00  ? 73   PRO A O     1 
ATOM   597  C  CB    . PRO A 1 76  ? -40.264 35.977 24.030  1.00 16.20  ? 73   PRO A CB    1 
ATOM   598  C  CG    . PRO A 1 76  ? -39.239 36.744 24.829  1.00 16.33  ? 73   PRO A CG    1 
ATOM   599  C  CD    . PRO A 1 76  ? -38.651 37.737 23.845  1.00 15.80  ? 73   PRO A CD    1 
ATOM   600  N  N     . ASP A 1 77  ? -41.250 37.165 21.190  1.00 15.87  ? 74   ASP A N     1 
ATOM   601  C  CA    . ASP A 1 77  ? -42.332 37.273 20.186  1.00 18.32  ? 74   ASP A CA    1 
ATOM   602  C  C     . ASP A 1 77  ? -41.841 37.443 18.723  1.00 17.41  ? 74   ASP A C     1 
ATOM   603  O  O     . ASP A 1 77  ? -42.678 37.759 17.823  1.00 16.53  ? 74   ASP A O     1 
ATOM   604  C  CB    . ASP A 1 77  ? -43.240 38.444 20.548  1.00 21.44  ? 74   ASP A CB    1 
ATOM   605  C  CG    . ASP A 1 77  ? -44.045 38.154 21.792  1.00 25.31  ? 74   ASP A CG    1 
ATOM   606  O  OD1   . ASP A 1 77  ? -44.052 39.036 22.672  1.00 28.13  ? 74   ASP A OD1   1 
ATOM   607  O  OD2   . ASP A 1 77  ? -44.585 37.003 21.904  1.00 28.72  ? 74   ASP A OD2   1 
ATOM   608  N  N     . LEU A 1 78  ? -40.532 37.201 18.483  1.00 13.81  ? 75   LEU A N     1 
ATOM   609  C  CA    . LEU A 1 78  ? -39.954 37.242 17.127  1.00 12.39  ? 75   LEU A CA    1 
ATOM   610  C  C     . LEU A 1 78  ? -40.772 36.305 16.164  1.00 11.63  ? 75   LEU A C     1 
ATOM   611  O  O     . LEU A 1 78  ? -41.040 35.147 16.445  1.00 10.32  ? 75   LEU A O     1 
ATOM   612  C  CB    . LEU A 1 78  ? -38.543 36.754 17.152  1.00 12.28  ? 75   LEU A CB    1 
ATOM   613  C  CG    . LEU A 1 78  ? -37.758 36.772 15.862  1.00 11.51  ? 75   LEU A CG    1 
ATOM   614  C  CD1   . LEU A 1 78  ? -37.492 38.190 15.414  1.00 11.28  ? 75   LEU A CD1   1 
ATOM   615  C  CD2   . LEU A 1 78  ? -36.451 36.116 16.159  1.00 11.95  ? 75   LEU A CD2   1 
ATOM   616  N  N     . LEU A 1 79  ? -41.193 36.856 15.048  1.00 10.16  ? 76   LEU A N     1 
ATOM   617  C  CA    . LEU A 1 79  ? -41.839 36.065 14.006  1.00 10.14  ? 76   LEU A CA    1 
ATOM   618  C  C     . LEU A 1 79  ? -40.813 35.650 12.996  1.00 10.48  ? 76   LEU A C     1 
ATOM   619  O  O     . LEU A 1 79  ? -39.830 36.325 12.810  1.00 11.05  ? 76   LEU A O     1 
ATOM   620  C  CB    . LEU A 1 79  ? -42.960 36.864 13.358  1.00 9.60   ? 76   LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 79  ? -44.065 37.271 14.320  1.00 9.54   ? 76   LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 79  ? -45.177 38.088 13.654  1.00 9.85   ? 76   LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 79  ? -44.621 36.066 15.074  1.00 9.71   ? 76   LEU A CD2   1 
ATOM   624  N  N     . LEU A 1 80  ? -41.051 34.535 12.316  1.00 10.45  ? 77   LEU A N     1 
ATOM   625  C  CA    . LEU A 1 80  ? -40.061 34.039 11.366  1.00 10.87  ? 77   LEU A CA    1 
ATOM   626  C  C     . LEU A 1 80  ? -40.670 33.729 10.007  1.00 11.39  ? 77   LEU A C     1 
ATOM   627  O  O     . LEU A 1 80  ? -41.806 33.317 9.924   1.00 11.45  ? 77   LEU A O     1 
ATOM   628  C  CB    . LEU A 1 80  ? -39.407 32.785 11.887  1.00 10.97  ? 77   LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 80  ? -38.742 32.874 13.224  1.00 10.36  ? 77   LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 80  ? -38.261 31.513 13.617  1.00 10.95  ? 77   LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 80  ? -37.569 33.821 13.092  1.00 11.41  ? 77   LEU A CD2   1 
ATOM   632  N  N     . ALA A 1 81  ? -39.897 33.937 8.949   1.00 11.74  ? 78   ALA A N     1 
ATOM   633  C  CA    . ALA A 1 81  ? -40.239 33.400 7.639   1.00 12.02  ? 78   ALA A CA    1 
ATOM   634  C  C     . ALA A 1 81  ? -39.045 32.588 7.186   1.00 11.92  ? 78   ALA A C     1 
ATOM   635  O  O     . ALA A 1 81  ? -37.897 32.957 7.460   1.00 12.69  ? 78   ALA A O     1 
ATOM   636  C  CB    . ALA A 1 81  ? -40.599 34.546 6.700   1.00 11.87  ? 78   ALA A CB    1 
ATOM   637  N  N     . GLN A 1 82  ? -39.298 31.466 6.540   1.00 12.69  ? 79   GLN A N     1 
ATOM   638  C  CA    . GLN A 1 82  ? -38.250 30.562 6.131   1.00 14.08  ? 79   GLN A CA    1 
ATOM   639  C  C     . GLN A 1 82  ? -38.004 30.589 4.617   1.00 14.48  ? 79   GLN A C     1 
ATOM   640  O  O     . GLN A 1 82  ? -38.916 30.730 3.809   1.00 13.38  ? 79   GLN A O     1 
ATOM   641  C  CB    . GLN A 1 82  ? -38.415 29.141 6.695   1.00 17.07  ? 79   GLN A CB    1 
ATOM   642  C  CG    . GLN A 1 82  ? -39.421 28.233 6.058   1.00 19.16  ? 79   GLN A CG    1 
ATOM   643  C  CD    . GLN A 1 82  ? -39.686 26.969 6.905   1.00 22.13  ? 79   GLN A CD    1 
ATOM   644  O  OE1   . GLN A 1 82  ? -39.483 25.853 6.450   1.00 21.56  ? 79   GLN A OE1   1 
ATOM   645  N  NE2   . GLN A 1 82  ? -40.136 27.162 8.134   1.00 22.88  ? 79   GLN A NE2   1 
ATOM   646  N  N     . VAL A 1 83  ? -36.735 30.508 4.283   1.00 13.10  ? 80   VAL A N     1 
ATOM   647  C  CA    . VAL A 1 83  ? -36.322 30.439 2.930   1.00 13.89  ? 80   VAL A CA    1 
ATOM   648  C  C     . VAL A 1 83  ? -36.791 29.097 2.363   1.00 13.75  ? 80   VAL A C     1 
ATOM   649  O  O     . VAL A 1 83  ? -36.682 28.020 2.997   1.00 12.30  ? 80   VAL A O     1 
ATOM   650  C  CB    . VAL A 1 83  ? -34.803 30.555 2.865   1.00 14.25  ? 80   VAL A CB    1 
ATOM   651  C  CG1   . VAL A 1 83  ? -34.268 30.326 1.516   1.00 15.38  ? 80   VAL A CG1   1 
ATOM   652  C  CG2   . VAL A 1 83  ? -34.390 31.970 3.274   1.00 16.22  ? 80   VAL A CG2   1 
ATOM   653  N  N     . ARG A 1 84  ? -37.252 29.175 1.157   1.00 15.24  ? 81   ARG A N     1 
ATOM   654  C  CA    . ARG A 1 84  ? -37.591 27.975 0.407   1.00 17.87  ? 81   ARG A CA    1 
ATOM   655  C  C     . ARG A 1 84  ? -36.376 27.033 0.333   1.00 15.99  ? 81   ARG A C     1 
ATOM   656  O  O     . ARG A 1 84  ? -35.251 27.467 0.179   1.00 15.47  ? 81   ARG A O     1 
ATOM   657  C  CB    . ARG A 1 84  ? -38.010 28.341 -0.992  1.00 20.29  ? 81   ARG A CB    1 
ATOM   658  C  CG    . ARG A 1 84  ? -38.168 27.119 -1.869  1.00 25.96  ? 81   ARG A CG    1 
ATOM   659  C  CD    . ARG A 1 84  ? -39.117 27.294 -3.005  1.00 31.26  ? 81   ARG A CD    1 
ATOM   660  N  NE    . ARG A 1 84  ? -38.414 27.823 -4.143  1.00 41.08  ? 81   ARG A NE    1 
ATOM   661  C  CZ    . ARG A 1 84  ? -38.915 27.864 -5.390  1.00 50.92  ? 81   ARG A CZ    1 
ATOM   662  N  NH1   . ARG A 1 84  ? -40.147 27.402 -5.647  1.00 52.94  ? 81   ARG A NH1   1 
ATOM   663  N  NH2   . ARG A 1 84  ? -38.186 28.390 -6.392  1.00 47.19  ? 81   ARG A NH2   1 
ATOM   664  N  N     . GLU A 1 85  ? -36.642 25.747 0.430   1.00 16.29  ? 82   GLU A N     1 
ATOM   665  C  CA    . GLU A 1 85  ? -35.632 24.725 0.279   1.00 19.36  ? 82   GLU A CA    1 
ATOM   666  C  C     . GLU A 1 85  ? -36.004 23.877 -0.930  1.00 20.26  ? 82   GLU A C     1 
ATOM   667  O  O     . GLU A 1 85  ? -37.087 23.343 -0.978  1.00 17.54  ? 82   GLU A O     1 
ATOM   668  C  CB    . GLU A 1 85  ? -35.608 23.819 1.522   1.00 22.06  ? 82   GLU A CB    1 
ATOM   669  C  CG    . GLU A 1 85  ? -34.430 24.039 2.399   1.00 25.19  ? 82   GLU A CG    1 
ATOM   670  C  CD    . GLU A 1 85  ? -34.219 22.901 3.384   1.00 28.53  ? 82   GLU A CD    1 
ATOM   671  O  OE1   . GLU A 1 85  ? -33.836 21.760 3.001   1.00 28.21  ? 82   GLU A OE1   1 
ATOM   672  O  OE2   . GLU A 1 85  ? -34.470 23.168 4.554   1.00 28.50  ? 82   GLU A OE2   1 
ATOM   673  N  N     . SER A 1 86  ? -35.063 23.683 -1.856  1.00 22.57  ? 83   SER A N     1 
ATOM   674  C  CA    . SER A 1 86  ? -35.257 22.832 -3.021  1.00 23.49  ? 83   SER A CA    1 
ATOM   675  C  C     . SER A 1 86  ? -34.059 21.941 -3.185  1.00 22.95  ? 83   SER A C     1 
ATOM   676  O  O     . SER A 1 86  ? -32.928 22.402 -3.045  1.00 21.73  ? 83   SER A O     1 
ATOM   677  C  CB    . SER A 1 86  ? -35.463 23.660 -4.270  1.00 23.65  ? 83   SER A CB    1 
ATOM   678  O  OG    . SER A 1 86  ? -36.659 24.404 -4.071  1.00 27.89  ? 83   SER A OG    1 
ATOM   679  N  N     . ARG A 1 87  ? -34.328 20.660 -3.394  1.00 23.30  ? 84   ARG A N     1 
ATOM   680  C  CA    A ARG A 1 87  ? -33.296 19.627 -3.513  0.36 23.96  ? 84   ARG A CA    1 
ATOM   681  C  CA    B ARG A 1 87  ? -33.268 19.642 -3.517  0.64 24.38  ? 84   ARG A CA    1 
ATOM   682  C  C     . ARG A 1 87  ? -32.307 19.617 -2.357  1.00 23.26  ? 84   ARG A C     1 
ATOM   683  O  O     . ARG A 1 87  ? -31.113 19.485 -2.554  1.00 26.39  ? 84   ARG A O     1 
ATOM   684  C  CB    A ARG A 1 87  ? -32.595 19.770 -4.865  0.36 23.90  ? 84   ARG A CB    1 
ATOM   685  C  CB    B ARG A 1 87  ? -32.468 19.879 -4.796  0.64 24.34  ? 84   ARG A CB    1 
ATOM   686  C  CG    A ARG A 1 87  ? -33.483 19.312 -6.004  0.36 24.82  ? 84   ARG A CG    1 
ATOM   687  C  CG    B ARG A 1 87  ? -33.314 20.071 -6.031  0.64 26.05  ? 84   ARG A CG    1 
ATOM   688  C  CD    A ARG A 1 87  ? -32.835 19.515 -7.362  0.36 25.66  ? 84   ARG A CD    1 
ATOM   689  C  CD    B ARG A 1 87  ? -32.421 20.186 -7.249  0.64 27.87  ? 84   ARG A CD    1 
ATOM   690  N  NE    A ARG A 1 87  ? -33.062 20.851 -7.899  0.36 25.66  ? 84   ARG A NE    1 
ATOM   691  N  NE    B ARG A 1 87  ? -33.179 20.626 -8.413  0.64 27.73  ? 84   ARG A NE    1 
ATOM   692  C  CZ    A ARG A 1 87  ? -33.719 21.099 -9.026  0.36 25.58  ? 84   ARG A CZ    1 
ATOM   693  C  CZ    B ARG A 1 87  ? -33.569 21.880 -8.634  0.64 29.28  ? 84   ARG A CZ    1 
ATOM   694  N  NH1   A ARG A 1 87  ? -34.220 20.108 -9.754  0.36 24.88  ? 84   ARG A NH1   1 
ATOM   695  N  NH1   B ARG A 1 87  ? -33.285 22.885 -7.775  0.64 29.07  ? 84   ARG A NH1   1 
ATOM   696  N  NH2   A ARG A 1 87  ? -33.875 22.351 -9.428  0.36 27.10  ? 84   ARG A NH2   1 
ATOM   697  N  NH2   B ARG A 1 87  ? -34.272 22.134 -9.732  0.64 31.28  ? 84   ARG A NH2   1 
ATOM   698  N  N     . GLY A 1 88  ? -32.822 19.751 -1.152  1.00 22.27  ? 85   GLY A N     1 
ATOM   699  C  CA    . GLY A 1 88  ? -32.011 19.770 0.066   1.00 22.11  ? 85   GLY A CA    1 
ATOM   700  C  C     . GLY A 1 88  ? -31.174 20.994 0.337   1.00 21.22  ? 85   GLY A C     1 
ATOM   701  O  O     . GLY A 1 88  ? -30.242 20.976 1.156   1.00 23.01  ? 85   GLY A O     1 
ATOM   702  N  N     . LYS A 1 89  ? -31.452 22.089 -0.352  1.00 17.71  ? 86   LYS A N     1 
ATOM   703  C  CA    . LYS A 1 89  ? -30.708 23.265 -0.094  1.00 16.76  ? 86   LYS A CA    1 
ATOM   704  C  C     . LYS A 1 89  ? -31.525 24.550 -0.164  1.00 16.95  ? 86   LYS A C     1 
ATOM   705  O  O     . LYS A 1 89  ? -32.596 24.608 -0.782  1.00 17.27  ? 86   LYS A O     1 
ATOM   706  C  CB    . LYS A 1 89  ? -29.537 23.332 -1.065  1.00 17.21  ? 86   LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 89  ? -29.887 23.645 -2.493  1.00 17.67  ? 86   LYS A CG    1 
ATOM   708  C  CD    . LYS A 1 89  ? -28.617 23.829 -3.331  1.00 18.96  ? 86   LYS A CD    1 
ATOM   709  C  CE    . LYS A 1 89  ? -27.899 25.114 -3.062  1.00 17.80  ? 86   LYS A CE    1 
ATOM   710  N  NZ    . LYS A 1 89  ? -28.797 26.295 -3.373  1.00 18.83  ? 86   LYS A NZ    1 
ATOM   711  N  N     . ALA A 1 90  ? -30.987 25.598 0.434   1.00 17.41  ? 87   ALA A N     1 
ATOM   712  C  CA    . ALA A 1 90  ? -31.673 26.896 0.425   1.00 16.97  ? 87   ALA A CA    1 
ATOM   713  C  C     . ALA A 1 90  ? -31.754 27.373 -1.015  1.00 16.95  ? 87   ALA A C     1 
ATOM   714  O  O     . ALA A 1 90  ? -30.831 27.141 -1.798  1.00 18.62  ? 87   ALA A O     1 
ATOM   715  C  CB    . ALA A 1 90  ? -30.948 27.885 1.295   1.00 17.11  ? 87   ALA A CB    1 
ATOM   716  N  N     . ASN A 1 91  ? -32.890 27.961 -1.380  1.00 16.17  ? 88   ASN A N     1 
ATOM   717  C  CA    . ASN A 1 91  ? -33.139 28.404 -2.770  1.00 16.43  ? 88   ASN A CA    1 
ATOM   718  C  C     . ASN A 1 91  ? -33.574 29.853 -2.676  1.00 16.05  ? 88   ASN A C     1 
ATOM   719  O  O     . ASN A 1 91  ? -34.597 30.163 -2.116  1.00 16.65  ? 88   ASN A O     1 
ATOM   720  C  CB    . ASN A 1 91  ? -34.210 27.492 -3.372  1.00 16.93  ? 88   ASN A CB    1 
ATOM   721  C  CG    . ASN A 1 91  ? -34.719 27.925 -4.734  1.00 19.11  ? 88   ASN A CG    1 
ATOM   722  O  OD1   . ASN A 1 91  ? -34.381 28.946 -5.288  1.00 16.27  ? 88   ASN A OD1   1 
ATOM   723  N  ND2   . ASN A 1 91  ? -35.650 27.130 -5.241  1.00 22.69  ? 88   ASN A ND2   1 
ATOM   724  N  N     . LEU A 1 92  ? -32.789 30.744 -3.243  1.00 16.21  ? 89   LEU A N     1 
ATOM   725  C  CA    . LEU A 1 92  ? -32.987 32.175 -3.061  1.00 15.80  ? 89   LEU A CA    1 
ATOM   726  C  C     . LEU A 1 92  ? -33.725 32.829 -4.209  1.00 14.40  ? 89   LEU A C     1 
ATOM   727  O  O     . LEU A 1 92  ? -33.749 34.050 -4.276  1.00 12.92  ? 89   LEU A O     1 
ATOM   728  C  CB    . LEU A 1 92  ? -31.639 32.879 -2.808  1.00 16.57  ? 89   LEU A CB    1 
ATOM   729  C  CG    . LEU A 1 92  ? -30.783 32.611 -1.558  1.00 17.29  ? 89   LEU A CG    1 
ATOM   730  C  CD1   . LEU A 1 92  ? -31.599 32.387 -0.312  1.00 17.21  ? 89   LEU A CD1   1 
ATOM   731  C  CD2   . LEU A 1 92  ? -29.949 31.420 -1.825  1.00 21.90  ? 89   LEU A CD2   1 
ATOM   732  N  N     . THR A 1 93  ? -34.438 32.048 -5.019  1.00 12.61  ? 90   THR A N     1 
ATOM   733  C  CA    . THR A 1 93  ? -35.131 32.583 -6.219  1.00 13.31  ? 90   THR A CA    1 
ATOM   734  C  C     . THR A 1 93  ? -36.083 33.767 -5.986  1.00 12.22  ? 90   THR A C     1 
ATOM   735  O  O     . THR A 1 93  ? -36.017 34.811 -6.668  1.00 12.01  ? 90   THR A O     1 
ATOM   736  C  CB    . THR A 1 93  ? -35.853 31.411 -6.944  1.00 14.22  ? 90   THR A CB    1 
ATOM   737  O  OG1   . THR A 1 93  ? -34.837 30.470 -7.319  1.00 18.12  ? 90   THR A OG1   1 
ATOM   738  C  CG2   . THR A 1 93  ? -36.501 31.861 -8.209  1.00 14.44  ? 90   THR A CG2   1 
ATOM   739  N  N     . LYS A 1 94  ? -36.937 33.634 -4.985  1.00 11.79  ? 91   LYS A N     1 
ATOM   740  C  CA    . LYS A 1 94  ? -37.838 34.682 -4.623  1.00 11.54  ? 91   LYS A CA    1 
ATOM   741  C  C     . LYS A 1 94  ? -37.141 36.052 -4.448  1.00 11.62  ? 91   LYS A C     1 
ATOM   742  O  O     . LYS A 1 94  ? -37.647 37.080 -4.889  1.00 12.49  ? 91   LYS A O     1 
ATOM   743  C  CB    . LYS A 1 94  ? -38.582 34.313 -3.332  1.00 12.26  ? 91   LYS A CB    1 
ATOM   744  C  CG    . LYS A 1 94  ? -39.866 35.114 -3.097  1.00 11.60  ? 91   LYS A CG    1 
ATOM   745  C  CD    . LYS A 1 94  ? -40.328 34.995 -1.642  1.00 11.70  ? 91   LYS A CD    1 
ATOM   746  C  CE    . LYS A 1 94  ? -40.752 33.597 -1.308  1.00 11.80  ? 91   LYS A CE    1 
ATOM   747  N  NZ    . LYS A 1 94  ? -41.239 33.494 0.080   1.00 11.12  ? 91   LYS A NZ    1 
ATOM   748  N  N     . TYR A 1 95  ? -35.983 36.045 -3.834  1.00 10.23  ? 92   TYR A N     1 
ATOM   749  C  CA    . TYR A 1 95  ? -35.265 37.271 -3.494  1.00 10.95  ? 92   TYR A CA    1 
ATOM   750  C  C     . TYR A 1 95  ? -34.555 37.806 -4.704  1.00 11.07  ? 92   TYR A C     1 
ATOM   751  O  O     . TYR A 1 95  ? -34.474 39.029 -4.864  1.00 10.52  ? 92   TYR A O     1 
ATOM   752  C  CB    . TYR A 1 95  ? -34.309 37.061 -2.279  1.00 10.50  ? 92   TYR A CB    1 
ATOM   753  C  CG    . TYR A 1 95  ? -35.008 36.265 -1.166  1.00 10.42  ? 92   TYR A CG    1 
ATOM   754  C  CD1   . TYR A 1 95  ? -34.716 34.919 -0.942  1.00 11.24  ? 92   TYR A CD1   1 
ATOM   755  C  CD2   . TYR A 1 95  ? -36.014 36.806 -0.441  1.00 10.83  ? 92   TYR A CD2   1 
ATOM   756  C  CE1   . TYR A 1 95  ? -35.397 34.154 -0.016  1.00 11.08  ? 92   TYR A CE1   1 
ATOM   757  C  CE2   . TYR A 1 95  ? -36.688 36.081 0.524   1.00 11.27  ? 92   TYR A CE2   1 
ATOM   758  C  CZ    . TYR A 1 95  ? -36.409 34.741 0.717   1.00 11.84  ? 92   TYR A CZ    1 
ATOM   759  O  OH    . TYR A 1 95  ? -37.118 33.970 1.647   1.00 11.82  ? 92   TYR A OH    1 
ATOM   760  N  N     . ARG A 1 96  ? -34.018 36.910 -5.558  1.00 11.90  ? 93   ARG A N     1 
ATOM   761  C  CA    . ARG A 1 96  ? -33.377 37.343 -6.822  1.00 12.39  ? 93   ARG A CA    1 
ATOM   762  C  C     . ARG A 1 96  ? -34.397 38.011 -7.746  1.00 12.89  ? 93   ARG A C     1 
ATOM   763  O  O     . ARG A 1 96  ? -34.118 39.046 -8.402  1.00 12.06  ? 93   ARG A O     1 
ATOM   764  C  CB    . ARG A 1 96  ? -32.712 36.189 -7.575  1.00 13.71  ? 93   ARG A CB    1 
ATOM   765  C  CG    . ARG A 1 96  ? -31.600 35.517 -6.817  1.00 14.73  ? 93   ARG A CG    1 
ATOM   766  C  CD    . ARG A 1 96  ? -30.705 34.686 -7.714  1.00 16.62  ? 93   ARG A CD    1 
ATOM   767  N  NE    . ARG A 1 96  ? -29.618 34.103 -6.924  1.00 17.65  ? 93   ARG A NE    1 
ATOM   768  C  CZ    . ARG A 1 96  ? -29.648 32.903 -6.309  1.00 18.57  ? 93   ARG A CZ    1 
ATOM   769  N  NH1   . ARG A 1 96  ? -28.584 32.550 -5.566  1.00 18.57  ? 93   ARG A NH1   1 
ATOM   770  N  NH2   . ARG A 1 96  ? -30.691 32.038 -6.460  1.00 17.89  ? 93   ARG A NH2   1 
ATOM   771  N  N     . GLU A 1 97  ? -35.591 37.441 -7.785  1.00 13.99  ? 94   GLU A N     1 
ATOM   772  C  CA    . GLU A 1 97  ? -36.682 37.987 -8.584  1.00 14.29  ? 94   GLU A CA    1 
ATOM   773  C  C     . GLU A 1 97  ? -37.148 39.341 -8.031  1.00 13.57  ? 94   GLU A C     1 
ATOM   774  O  O     . GLU A 1 97  ? -37.348 40.283 -8.795  1.00 12.77  ? 94   GLU A O     1 
ATOM   775  C  CB    . GLU A 1 97  ? -37.832 36.983 -8.690  1.00 16.65  ? 94   GLU A CB    1 
ATOM   776  C  CG    . GLU A 1 97  ? -37.450 35.823 -9.597  1.00 20.87  ? 94   GLU A CG    1 
ATOM   777  C  CD    . GLU A 1 97  ? -38.459 34.679 -9.629  1.00 25.29  ? 94   GLU A CD    1 
ATOM   778  O  OE1   . GLU A 1 97  ? -39.407 34.642 -8.801  1.00 32.33  ? 94   GLU A OE1   1 
ATOM   779  O  OE2   . GLU A 1 97  ? -38.295 33.788 -10.491 1.00 26.54  ? 94   GLU A OE2   1 
ATOM   780  N  N     . ALA A 1 98  ? -37.348 39.442 -6.717  1.00 12.78  ? 95   ALA A N     1 
ATOM   781  C  CA    . ALA A 1 98  ? -37.646 40.739 -6.122  1.00 12.43  ? 95   ALA A CA    1 
ATOM   782  C  C     . ALA A 1 98  ? -36.576 41.810 -6.391  1.00 11.94  ? 95   ALA A C     1 
ATOM   783  O  O     . ALA A 1 98  ? -36.903 42.976 -6.594  1.00 11.30  ? 95   ALA A O     1 
ATOM   784  C  CB    . ALA A 1 98  ? -37.881 40.591 -4.621  1.00 12.82  ? 95   ALA A CB    1 
ATOM   785  N  N     . SER A 1 99  ? -35.307 41.393 -6.399  1.00 11.53  ? 96   SER A N     1 
ATOM   786  C  CA    . SER A 1 99  ? -34.188 42.292 -6.725  1.00 12.58  ? 96   SER A CA    1 
ATOM   787  C  C     . SER A 1 99  ? -34.315 42.851 -8.144  1.00 11.73  ? 96   SER A C     1 
ATOM   788  O  O     . SER A 1 99  ? -34.120 44.058 -8.372  1.00 9.34   ? 96   SER A O     1 
ATOM   789  C  CB    . SER A 1 99  ? -32.893 41.494 -6.605  1.00 13.87  ? 96   SER A CB    1 
ATOM   790  O  OG    . SER A 1 99  ? -31.818 42.184 -7.154  1.00 14.62  ? 96   SER A OG    1 
ATOM   791  N  N     . VAL A 1 100 ? -34.649 41.976 -9.092  1.00 11.49  ? 97   VAL A N     1 
ATOM   792  C  CA    . VAL A 1 100 ? -34.885 42.392 -10.487 1.00 12.03  ? 97   VAL A CA    1 
ATOM   793  C  C     . VAL A 1 100 ? -35.979 43.436 -10.535 1.00 12.17  ? 97   VAL A C     1 
ATOM   794  O  O     . VAL A 1 100 ? -35.826 44.447 -11.243 1.00 11.56  ? 97   VAL A O     1 
ATOM   795  C  CB    . VAL A 1 100 ? -35.271 41.205 -11.387 1.00 12.68  ? 97   VAL A CB    1 
ATOM   796  C  CG1   . VAL A 1 100 ? -35.747 41.647 -12.787 1.00 13.56  ? 97   VAL A CG1   1 
ATOM   797  C  CG2   . VAL A 1 100 ? -34.109 40.290 -11.546 1.00 13.05  ? 97   VAL A CG2   1 
ATOM   798  N  N     . GLU A 1 101 ? -37.051 43.262 -9.750  1.00 11.69  ? 98   GLU A N     1 
ATOM   799  C  CA    . GLU A 1 101 ? -38.087 44.288 -9.723  1.00 11.93  ? 98   GLU A CA    1 
ATOM   800  C  C     . GLU A 1 101 ? -37.511 45.698 -9.403  1.00 11.86  ? 98   GLU A C     1 
ATOM   801  O  O     . GLU A 1 101 ? -37.903 46.710 -10.003 1.00 10.85  ? 98   GLU A O     1 
ATOM   802  C  CB    . GLU A 1 101 ? -39.190 44.025 -8.674  1.00 13.13  ? 98   GLU A CB    1 
ATOM   803  C  CG    . GLU A 1 101 ? -40.223 42.931 -8.953  1.00 13.48  ? 98   GLU A CG    1 
ATOM   804  C  CD    . GLU A 1 101 ? -41.226 42.821 -7.792  1.00 13.04  ? 98   GLU A CD    1 
ATOM   805  O  OE1   . GLU A 1 101 ? -42.019 43.765 -7.571  1.00 12.61  ? 98   GLU A OE1   1 
ATOM   806  O  OE2   . GLU A 1 101 ? -41.106 41.811 -7.037  1.00 13.76  ? 98   GLU A OE2   1 
ATOM   807  N  N     . VAL A 1 102 ? -36.619 45.749 -8.417  1.00 10.88  ? 99   VAL A N     1 
ATOM   808  C  CA    . VAL A 1 102 ? -36.100 46.994 -7.946  1.00 12.79  ? 99   VAL A CA    1 
ATOM   809  C  C     . VAL A 1 102 ? -35.094 47.567 -8.932  1.00 13.10  ? 99   VAL A C     1 
ATOM   810  O  O     . VAL A 1 102 ? -35.177 48.754 -9.275  1.00 12.79  ? 99   VAL A O     1 
ATOM   811  C  CB    . VAL A 1 102 ? -35.441 46.805 -6.545  1.00 12.80  ? 99   VAL A CB    1 
ATOM   812  C  CG1   . VAL A 1 102 ? -34.637 48.005 -6.156  1.00 15.28  ? 99   VAL A CG1   1 
ATOM   813  C  CG2   . VAL A 1 102 ? -36.559 46.593 -5.539  1.00 12.69  ? 99   VAL A CG2   1 
ATOM   814  N  N     . MET A 1 103 ? -34.183 46.717 -9.403  1.00 13.50  ? 100  MET A N     1 
ATOM   815  C  CA    . MET A 1 103 ? -33.149 47.144 -10.353 1.00 14.86  ? 100  MET A CA    1 
ATOM   816  C  C     . MET A 1 103 ? -33.759 47.665 -11.669 1.00 14.21  ? 100  MET A C     1 
ATOM   817  O  O     . MET A 1 103 ? -33.274 48.618 -12.223 1.00 12.91  ? 100  MET A O     1 
ATOM   818  C  CB    . MET A 1 103 ? -32.273 45.971 -10.680 1.00 16.63  ? 100  MET A CB    1 
ATOM   819  C  CG    . MET A 1 103 ? -31.502 45.364 -9.524  1.00 19.94  ? 100  MET A CG    1 
ATOM   820  S  SD    . MET A 1 103 ? -30.395 46.497 -8.714  1.00 22.40  ? 100  MET A SD    1 
ATOM   821  C  CE    . MET A 1 103 ? -29.767 45.428 -7.418  1.00 22.84  ? 100  MET A CE    1 
ATOM   822  N  N     . GLU A 1 104 ? -34.830 47.038 -12.154 1.00 14.30  ? 101  GLU A N     1 
ATOM   823  C  CA    . GLU A 1 104 ? -35.545 47.563 -13.357 1.00 15.90  ? 101  GLU A CA    1 
ATOM   824  C  C     . GLU A 1 104 ? -36.096 48.997 -13.163 1.00 13.96  ? 101  GLU A C     1 
ATOM   825  O  O     . GLU A 1 104 ? -36.009 49.840 -14.042 1.00 14.66  ? 101  GLU A O     1 
ATOM   826  C  CB    . GLU A 1 104 ? -36.648 46.576 -13.821 1.00 18.33  ? 101  GLU A CB    1 
ATOM   827  C  CG    . GLU A 1 104 ? -36.022 45.319 -14.378 1.00 23.78  ? 101  GLU A CG    1 
ATOM   828  C  CD    . GLU A 1 104 ? -37.022 44.376 -15.077 1.00 26.96  ? 101  GLU A CD    1 
ATOM   829  O  OE1   . GLU A 1 104 ? -38.253 44.534 -14.945 1.00 27.88  ? 101  GLU A OE1   1 
ATOM   830  O  OE2   . GLU A 1 104 ? -36.529 43.477 -15.756 1.00 31.40  ? 101  GLU A OE2   1 
ATOM   831  N  N     . ILE A 1 105 ? -36.624 49.291 -11.987 1.00 12.66  ? 102  ILE A N     1 
ATOM   832  C  CA    . ILE A 1 105 ? -37.124 50.633 -11.660 1.00 11.81  ? 102  ILE A CA    1 
ATOM   833  C  C     . ILE A 1 105 ? -35.988 51.646 -11.608 1.00 11.87  ? 102  ILE A C     1 
ATOM   834  O  O     . ILE A 1 105 ? -36.023 52.709 -12.309 1.00 11.38  ? 102  ILE A O     1 
ATOM   835  C  CB    . ILE A 1 105 ? -37.943 50.622 -10.353 1.00 11.63  ? 102  ILE A CB    1 
ATOM   836  C  CG1   . ILE A 1 105 ? -39.180 49.728 -10.514 1.00 12.64  ? 102  ILE A CG1   1 
ATOM   837  C  CG2   . ILE A 1 105 ? -38.409 51.988 -9.979  1.00 11.92  ? 102  ILE A CG2   1 
ATOM   838  C  CD1   . ILE A 1 105 ? -39.755 49.221 -9.195  1.00 12.86  ? 102  ILE A CD1   1 
ATOM   839  N  N     . MET A 1 106 ? -34.927 51.315 -10.900 1.00 11.65  ? 103  MET A N     1 
ATOM   840  C  CA    . MET A 1 106 ? -33.793 52.240 -10.828 1.00 12.83  ? 103  MET A CA    1 
ATOM   841  C  C     . MET A 1 106 ? -33.177 52.548 -12.208 1.00 12.40  ? 103  MET A C     1 
ATOM   842  O  O     . MET A 1 106 ? -32.749 53.694 -12.464 1.00 11.44  ? 103  MET A O     1 
ATOM   843  C  CB    . MET A 1 106 ? -32.696 51.677 -9.938  1.00 14.28  ? 103  MET A CB    1 
ATOM   844  C  CG    . MET A 1 106 ? -33.102 51.630 -8.492  1.00 16.16  ? 103  MET A CG    1 
ATOM   845  S  SD    . MET A 1 106 ? -31.796 51.034 -7.380  1.00 17.49  ? 103  MET A SD    1 
ATOM   846  C  CE    . MET A 1 106 ? -30.547 52.263 -7.637  1.00 21.01  ? 103  MET A CE    1 
ATOM   847  N  N     . SER A 1 107 ? -33.126 51.540 -13.071 1.00 13.19  ? 104  SER A N     1 
ATOM   848  C  CA    . SER A 1 107 ? -32.625 51.677 -14.434 1.00 14.92  ? 104  SER A CA    1 
ATOM   849  C  C     . SER A 1 107 ? -33.344 52.713 -15.270 1.00 16.20  ? 104  SER A C     1 
ATOM   850  O  O     . SER A 1 107 ? -32.755 53.179 -16.223 1.00 14.86  ? 104  SER A O     1 
ATOM   851  C  CB    . SER A 1 107 ? -32.674 50.348 -15.165 1.00 16.53  ? 104  SER A CB    1 
ATOM   852  O  OG    . SER A 1 107 ? -31.683 49.480 -14.628 1.00 20.92  ? 104  SER A OG    1 
ATOM   853  N  N     . ARG A 1 108 ? -34.603 53.065 -14.930 1.00 15.70  ? 105  ARG A N     1 
ATOM   854  C  CA    . ARG A 1 108 ? -35.325 54.138 -15.638 1.00 17.61  ? 105  ARG A CA    1 
ATOM   855  C  C     . ARG A 1 108 ? -34.718 55.500 -15.372 1.00 19.47  ? 105  ARG A C     1 
ATOM   856  O  O     . ARG A 1 108 ? -34.875 56.402 -16.192 1.00 19.11  ? 105  ARG A O     1 
ATOM   857  C  CB    . ARG A 1 108 ? -36.811 54.231 -15.251 1.00 18.72  ? 105  ARG A CB    1 
ATOM   858  C  CG    . ARG A 1 108 ? -37.553 52.919 -15.386 1.00 19.83  ? 105  ARG A CG    1 
ATOM   859  C  CD    . ARG A 1 108 ? -38.992 53.161 -15.649 1.00 21.27  ? 105  ARG A CD    1 
ATOM   860  N  NE    . ARG A 1 108 ? -39.628 53.847 -14.529 1.00 22.39  ? 105  ARG A NE    1 
ATOM   861  C  CZ    . ARG A 1 108 ? -40.416 53.279 -13.600 1.00 21.26  ? 105  ARG A CZ    1 
ATOM   862  N  NH1   . ARG A 1 108 ? -40.947 54.042 -12.659 1.00 20.67  ? 105  ARG A NH1   1 
ATOM   863  N  NH2   . ARG A 1 108 ? -40.663 51.981 -13.572 1.00 21.15  ? 105  ARG A NH2   1 
ATOM   864  N  N     . PHE A 1 109 ? -34.068 55.674 -14.221 1.00 18.05  ? 106  PHE A N     1 
ATOM   865  C  CA    . PHE A 1 109 ? -33.515 56.967 -13.828 1.00 19.49  ? 106  PHE A CA    1 
ATOM   866  C  C     . PHE A 1 109 ? -32.068 57.168 -14.337 1.00 20.68  ? 106  PHE A C     1 
ATOM   867  O  O     . PHE A 1 109 ? -31.684 58.261 -14.707 1.00 22.33  ? 106  PHE A O     1 
ATOM   868  C  CB    . PHE A 1 109 ? -33.646 57.176 -12.306 1.00 18.11  ? 106  PHE A CB    1 
ATOM   869  C  CG    . PHE A 1 109 ? -35.076 57.216 -11.810 1.00 17.29  ? 106  PHE A CG    1 
ATOM   870  C  CD1   . PHE A 1 109 ? -35.802 56.045 -11.630 1.00 16.92  ? 106  PHE A CD1   1 
ATOM   871  C  CD2   . PHE A 1 109 ? -35.681 58.405 -11.505 1.00 17.01  ? 106  PHE A CD2   1 
ATOM   872  C  CE1   . PHE A 1 109 ? -37.127 56.061 -11.180 1.00 17.50  ? 106  PHE A CE1   1 
ATOM   873  C  CE2   . PHE A 1 109 ? -36.989 58.442 -11.040 1.00 17.55  ? 106  PHE A CE2   1 
ATOM   874  C  CZ    . PHE A 1 109 ? -37.724 57.268 -10.883 1.00 17.41  ? 106  PHE A CZ    1 
ATOM   875  N  N     . ALA A 1 110 ? -31.292 56.108 -14.403 1.00 20.63  ? 107  ALA A N     1 
ATOM   876  C  CA    . ALA A 1 110 ? -29.879 56.202 -14.737 1.00 21.55  ? 107  ALA A CA    1 
ATOM   877  C  C     . ALA A 1 110 ? -29.293 54.845 -14.891 1.00 22.93  ? 107  ALA A C     1 
ATOM   878  O  O     . ALA A 1 110 ? -29.902 53.840 -14.517 1.00 22.01  ? 107  ALA A O     1 
ATOM   879  C  CB    . ALA A 1 110 ? -29.146 56.878 -13.621 1.00 21.43  ? 107  ALA A CB    1 
ATOM   880  N  N     . VAL A 1 111 ? -28.059 54.809 -15.374 1.00 24.73  ? 108  VAL A N     1 
ATOM   881  C  CA    . VAL A 1 111 ? -27.392 53.563 -15.544 1.00 26.58  ? 108  VAL A CA    1 
ATOM   882  C  C     . VAL A 1 111 ? -26.925 53.147 -14.149 1.00 23.14  ? 108  VAL A C     1 
ATOM   883  O  O     . VAL A 1 111 ? -26.468 53.970 -13.343 1.00 21.02  ? 108  VAL A O     1 
ATOM   884  C  CB    . VAL A 1 111 ? -26.262 53.613 -16.573 1.00 31.97  ? 108  VAL A CB    1 
ATOM   885  C  CG1   . VAL A 1 111 ? -25.705 52.195 -16.806 1.00 30.18  ? 108  VAL A CG1   1 
ATOM   886  C  CG2   . VAL A 1 111 ? -26.824 54.083 -17.893 1.00 33.60  ? 108  VAL A CG2   1 
ATOM   887  N  N     . ILE A 1 112 ? -27.171 51.876 -13.842 1.00 19.90  ? 109  ILE A N     1 
ATOM   888  C  CA    . ILE A 1 112 ? -26.850 51.330 -12.521 1.00 18.07  ? 109  ILE A CA    1 
ATOM   889  C  C     . ILE A 1 112 ? -25.771 50.301 -12.588 1.00 14.64  ? 109  ILE A C     1 
ATOM   890  O  O     . ILE A 1 112 ? -25.572 49.638 -13.624 1.00 13.25  ? 109  ILE A O     1 
ATOM   891  C  CB    . ILE A 1 112 ? -28.136 50.762 -11.810 1.00 19.61  ? 109  ILE A CB    1 
ATOM   892  C  CG1   . ILE A 1 112 ? -28.574 49.454 -12.407 1.00 20.55  ? 109  ILE A CG1   1 
ATOM   893  C  CG2   . ILE A 1 112 ? -29.250 51.817 -11.856 1.00 20.65  ? 109  ILE A CG2   1 
ATOM   894  C  CD1   . ILE A 1 112 ? -29.605 48.700 -11.549 1.00 21.46  ? 109  ILE A CD1   1 
ATOM   895  N  N     . GLU A 1 113 ? -25.044 50.185 -11.489 1.00 13.00  ? 110  GLU A N     1 
ATOM   896  C  CA    . GLU A 1 113 ? -24.175 49.071 -11.248 1.00 12.86  ? 110  GLU A CA    1 
ATOM   897  C  C     . GLU A 1 113 ? -24.781 48.222 -10.173 1.00 12.69  ? 110  GLU A C     1 
ATOM   898  O  O     . GLU A 1 113 ? -24.806 48.618 -9.020  1.00 11.70  ? 110  GLU A O     1 
ATOM   899  C  CB    . GLU A 1 113 ? -22.780 49.536 -10.764 1.00 13.56  ? 110  GLU A CB    1 
ATOM   900  C  CG    . GLU A 1 113 ? -21.804 48.409 -10.520 1.00 12.96  ? 110  GLU A CG    1 
ATOM   901  C  CD    . GLU A 1 113 ? -20.426 48.865 -10.105 1.00 13.74  ? 110  GLU A CD    1 
ATOM   902  O  OE1   . GLU A 1 113 ? -19.690 48.002 -9.593  1.00 16.29  ? 110  GLU A OE1   1 
ATOM   903  O  OE2   . GLU A 1 113 ? -20.029 50.039 -10.296 1.00 13.24  ? 110  GLU A OE2   1 
ATOM   904  N  N     . ARG A 1 114 ? -25.175 47.013 -10.515 1.00 12.76  ? 111  ARG A N     1 
ATOM   905  C  CA    . ARG A 1 114 ? -25.620 46.040 -9.494  1.00 13.73  ? 111  ARG A CA    1 
ATOM   906  C  C     . ARG A 1 114 ? -24.461 45.659 -8.584  1.00 13.08  ? 111  ARG A C     1 
ATOM   907  O  O     . ARG A 1 114 ? -23.522 44.953 -9.034  1.00 14.05  ? 111  ARG A O     1 
ATOM   908  C  CB    . ARG A 1 114 ? -26.193 44.777 -10.148 1.00 14.50  ? 111  ARG A CB    1 
ATOM   909  C  CG    . ARG A 1 114 ? -26.870 43.835 -9.188  1.00 16.62  ? 111  ARG A CG    1 
ATOM   910  C  CD    . ARG A 1 114 ? -26.863 42.395 -9.682  1.00 19.34  ? 111  ARG A CD    1 
ATOM   911  N  NE    . ARG A 1 114 ? -27.771 41.492 -8.960  1.00 21.84  ? 111  ARG A NE    1 
ATOM   912  C  CZ    . ARG A 1 114 ? -27.439 40.500 -8.114  1.00 22.53  ? 111  ARG A CZ    1 
ATOM   913  N  NH1   . ARG A 1 114 ? -26.188 40.267 -7.749  1.00 24.00  ? 111  ARG A NH1   1 
ATOM   914  N  NH2   . ARG A 1 114 ? -28.417 39.736 -7.598  1.00 25.09  ? 111  ARG A NH2   1 
ATOM   915  N  N     . ALA A 1 115 ? -24.518 46.069 -7.321  1.00 11.73  ? 112  ALA A N     1 
ATOM   916  C  CA    . ALA A 1 115 ? -23.448 45.758 -6.381  1.00 11.78  ? 112  ALA A CA    1 
ATOM   917  C  C     . ALA A 1 115 ? -23.647 44.450 -5.606  1.00 12.58  ? 112  ALA A C     1 
ATOM   918  O  O     . ALA A 1 115 ? -22.676 43.795 -5.201  1.00 11.58  ? 112  ALA A O     1 
ATOM   919  C  CB    . ALA A 1 115 ? -23.258 46.901 -5.390  1.00 11.79  ? 112  ALA A CB    1 
ATOM   920  N  N     . SER A 1 116 ? -24.901 44.118 -5.329  1.00 12.86  ? 113  SER A N     1 
ATOM   921  C  CA    . SER A 1 116 ? -25.246 42.903 -4.627  1.00 13.61  ? 113  SER A CA    1 
ATOM   922  C  C     . SER A 1 116 ? -26.702 42.598 -4.963  1.00 12.59  ? 113  SER A C     1 
ATOM   923  O  O     . SER A 1 116 ? -27.290 43.354 -5.736  1.00 13.86  ? 113  SER A O     1 
ATOM   924  C  CB    . SER A 1 116 ? -25.098 43.162 -3.131  1.00 14.79  ? 113  SER A CB    1 
ATOM   925  O  OG    . SER A 1 116 ? -26.051 44.124 -2.643  1.00 14.03  ? 113  SER A OG    1 
ATOM   926  N  N     . ILE A 1 117 ? -27.299 41.598 -4.340  1.00 10.81  ? 114  ILE A N     1 
ATOM   927  C  CA    . ILE A 1 117 ? -28.719 41.329 -4.518  1.00 12.48  ? 114  ILE A CA    1 
ATOM   928  C  C     . ILE A 1 117 ? -29.637 42.537 -4.234  1.00 12.40  ? 114  ILE A C     1 
ATOM   929  O  O     . ILE A 1 117 ? -30.690 42.676 -4.872  1.00 11.61  ? 114  ILE A O     1 
ATOM   930  C  CB    . ILE A 1 117 ? -29.235 40.112 -3.652  1.00 12.91  ? 114  ILE A CB    1 
ATOM   931  C  CG1   . ILE A 1 117 ? -30.541 39.548 -4.213  1.00 13.97  ? 114  ILE A CG1   1 
ATOM   932  C  CG2   . ILE A 1 117 ? -29.381 40.456 -2.192  1.00 12.39  ? 114  ILE A CG2   1 
ATOM   933  C  CD1   . ILE A 1 117 ? -30.704 38.058 -3.898  1.00 14.94  ? 114  ILE A CD1   1 
ATOM   934  N  N     . ASP A 1 118 ? -29.230 43.392 -3.281  1.00 12.44  ? 115  ASP A N     1 
ATOM   935  C  CA    . ASP A 1 118 ? -30.072 44.550 -2.925  1.00 12.92  ? 115  ASP A CA    1 
ATOM   936  C  C     . ASP A 1 118 ? -29.446 45.954 -2.881  1.00 12.84  ? 115  ASP A C     1 
ATOM   937  O  O     . ASP A 1 118 ? -30.087 46.888 -2.287  1.00 11.95  ? 115  ASP A O     1 
ATOM   938  C  CB    . ASP A 1 118 ? -30.761 44.268 -1.599  1.00 12.44  ? 115  ASP A CB    1 
ATOM   939  C  CG    . ASP A 1 118 ? -29.874 44.542 -0.439  1.00 13.76  ? 115  ASP A CG    1 
ATOM   940  O  OD1   . ASP A 1 118 ? -30.442 44.971 0.614   1.00 11.21  ? 115  ASP A OD1   1 
ATOM   941  O  OD2   . ASP A 1 118 ? -28.582 44.362 -0.596  1.00 14.32  ? 115  ASP A OD2   1 
ATOM   942  N  N     . GLU A 1 119 ? -28.272 46.118 -3.496  1.00 11.33  ? 116  GLU A N     1 
ATOM   943  C  CA    . GLU A 1 119 ? -27.594 47.427 -3.621  1.00 11.52  ? 116  GLU A CA    1 
ATOM   944  C  C     . GLU A 1 119 ? -27.269 47.752 -5.068  1.00 11.17  ? 116  GLU A C     1 
ATOM   945  O  O     . GLU A 1 119 ? -26.870 46.853 -5.872  1.00 10.60  ? 116  GLU A O     1 
ATOM   946  C  CB    . GLU A 1 119 ? -26.319 47.380 -2.844  1.00 12.85  ? 116  GLU A CB    1 
ATOM   947  C  CG    . GLU A 1 119 ? -26.505 47.242 -1.352  1.00 15.32  ? 116  GLU A CG    1 
ATOM   948  C  CD    . GLU A 1 119 ? -25.153 47.327 -0.616  1.00 18.40  ? 116  GLU A CD    1 
ATOM   949  O  OE1   . GLU A 1 119 ? -24.184 46.760 -1.080  1.00 22.53  ? 116  GLU A OE1   1 
ATOM   950  O  OE2   . GLU A 1 119 ? -25.053 47.935 0.429   1.00 23.63  ? 116  GLU A OE2   1 
ATOM   951  N  N     . ALA A 1 120 ? -27.451 49.012 -5.432  1.00 9.96   ? 117  ALA A N     1 
ATOM   952  C  CA    . ALA A 1 120 ? -27.022 49.482 -6.685  1.00 10.70  ? 117  ALA A CA    1 
ATOM   953  C  C     . ALA A 1 120 ? -26.401 50.866 -6.572  1.00 10.67  ? 117  ALA A C     1 
ATOM   954  O  O     . ALA A 1 120 ? -26.907 51.751 -5.866  1.00 9.28   ? 117  ALA A O     1 
ATOM   955  C  CB    . ALA A 1 120 ? -28.183 49.502 -7.673  1.00 10.91  ? 117  ALA A CB    1 
ATOM   956  N  N     . TYR A 1 121 ? -25.289 51.038 -7.274  1.00 11.24  ? 118  TYR A N     1 
ATOM   957  C  CA    . TYR A 1 121 ? -24.788 52.390 -7.486  1.00 11.62  ? 118  TYR A CA    1 
ATOM   958  C  C     . TYR A 1 121 ? -25.374 53.001 -8.708  1.00 12.40  ? 118  TYR A C     1 
ATOM   959  O  O     . TYR A 1 121 ? -25.646 52.318 -9.726  1.00 11.69  ? 118  TYR A O     1 
ATOM   960  C  CB    . TYR A 1 121 ? -23.285 52.411 -7.591  1.00 11.98  ? 118  TYR A CB    1 
ATOM   961  C  CG    . TYR A 1 121 ? -22.582 51.977 -6.361  1.00 11.47  ? 118  TYR A CG    1 
ATOM   962  C  CD1   . TYR A 1 121 ? -22.226 50.663 -6.175  1.00 13.23  ? 118  TYR A CD1   1 
ATOM   963  C  CD2   . TYR A 1 121 ? -22.252 52.888 -5.379  1.00 12.37  ? 118  TYR A CD2   1 
ATOM   964  C  CE1   . TYR A 1 121 ? -21.509 50.245 -5.007  1.00 13.45  ? 118  TYR A CE1   1 
ATOM   965  C  CE2   . TYR A 1 121 ? -21.544 52.497 -4.215  1.00 13.04  ? 118  TYR A CE2   1 
ATOM   966  C  CZ    . TYR A 1 121 ? -21.176 51.186 -4.045  1.00 12.82  ? 118  TYR A CZ    1 
ATOM   967  O  OH    . TYR A 1 121 ? -20.484 50.830 -2.911  1.00 14.81  ? 118  TYR A OH    1 
ATOM   968  N  N     . VAL A 1 122 ? -25.529 54.322 -8.627  1.00 12.70  ? 119  VAL A N     1 
ATOM   969  C  CA    . VAL A 1 122 ? -26.081 55.124 -9.656  1.00 13.86  ? 119  VAL A CA    1 
ATOM   970  C  C     . VAL A 1 122 ? -25.166 56.257 -9.973  1.00 13.94  ? 119  VAL A C     1 
ATOM   971  O  O     . VAL A 1 122 ? -24.753 56.962 -9.019  1.00 11.33  ? 119  VAL A O     1 
ATOM   972  C  CB    . VAL A 1 122 ? -27.414 55.774 -9.130  1.00 16.78  ? 119  VAL A CB    1 
ATOM   973  C  CG1   . VAL A 1 122 ? -28.252 56.169 -10.310 1.00 18.14  ? 119  VAL A CG1   1 
ATOM   974  C  CG2   . VAL A 1 122 ? -28.174 54.822 -8.219  1.00 19.53  ? 119  VAL A CG2   1 
ATOM   975  N  N     . ASP A 1 123 ? -24.822 56.469 -11.252 1.00 13.36  ? 120  ASP A N     1 
ATOM   976  C  CA    . ASP A 1 123 ? -24.127 57.713 -11.670 1.00 16.20  ? 120  ASP A CA    1 
ATOM   977  C  C     . ASP A 1 123 ? -25.192 58.706 -12.140 1.00 15.39  ? 120  ASP A C     1 
ATOM   978  O  O     . ASP A 1 123 ? -25.839 58.508 -13.174 1.00 15.75  ? 120  ASP A O     1 
ATOM   979  C  CB    . ASP A 1 123 ? -23.063 57.464 -12.755 1.00 17.97  ? 120  ASP A CB    1 
ATOM   980  C  CG    . ASP A 1 123 ? -22.136 58.639 -12.938 1.00 21.88  ? 120  ASP A CG    1 
ATOM   981  O  OD1   . ASP A 1 123 ? -22.575 59.791 -13.033 1.00 20.89  ? 120  ASP A OD1   1 
ATOM   982  O  OD2   . ASP A 1 123 ? -20.907 58.430 -13.015 1.00 30.71  ? 120  ASP A OD2   1 
ATOM   983  N  N     . LEU A 1 124 ? -25.421 59.739 -11.349 1.00 13.22  ? 121  LEU A N     1 
ATOM   984  C  CA    . LEU A 1 124 ? -26.456 60.727 -11.623 1.00 12.88  ? 121  LEU A CA    1 
ATOM   985  C  C     . LEU A 1 124 ? -25.942 62.000 -12.292 1.00 11.96  ? 121  LEU A C     1 
ATOM   986  O  O     . LEU A 1 124 ? -26.678 62.937 -12.401 1.00 9.84   ? 121  LEU A O     1 
ATOM   987  C  CB    . LEU A 1 124 ? -27.165 61.101 -10.329 1.00 14.42  ? 121  LEU A CB    1 
ATOM   988  C  CG    . LEU A 1 124 ? -27.959 59.993 -9.622  1.00 16.60  ? 121  LEU A CG    1 
ATOM   989  C  CD1   . LEU A 1 124 ? -28.245 60.340 -8.174  1.00 17.51  ? 121  LEU A CD1   1 
ATOM   990  C  CD2   . LEU A 1 124 ? -29.267 59.769 -10.297 1.00 17.66  ? 121  LEU A CD2   1 
ATOM   991  N  N     . THR A 1 125 ? -24.672 62.020 -12.710 1.00 13.05  ? 122  THR A N     1 
ATOM   992  C  CA    . THR A 1 125 ? -24.041 63.271 -13.162 1.00 15.04  ? 122  THR A CA    1 
ATOM   993  C  C     . THR A 1 125 ? -24.814 63.910 -14.305 1.00 14.67  ? 122  THR A C     1 
ATOM   994  O  O     . THR A 1 125 ? -25.191 65.105 -14.284 1.00 14.45  ? 122  THR A O     1 
ATOM   995  C  CB    . THR A 1 125 ? -22.576 63.023 -13.554 1.00 15.51  ? 122  THR A CB    1 
ATOM   996  O  OG1   . THR A 1 125 ? -21.892 62.397 -12.463 1.00 15.54  ? 122  THR A OG1   1 
ATOM   997  C  CG2   . THR A 1 125 ? -21.892 64.311 -13.900 1.00 17.86  ? 122  THR A CG2   1 
ATOM   998  N  N     . SER A 1 126 ? -25.135 63.079 -15.268 1.00 15.93  ? 123  SER A N     1 
ATOM   999  C  CA    . SER A 1 126 ? -25.850 63.552 -16.464 1.00 17.27  ? 123  SER A CA    1 
ATOM   1000 C  C     . SER A 1 126 ? -27.308 63.964 -16.157 1.00 17.12  ? 123  SER A C     1 
ATOM   1001 O  O     . SER A 1 126 ? -27.803 64.981 -16.645 1.00 17.86  ? 123  SER A O     1 
ATOM   1002 C  CB    . SER A 1 126 ? -25.793 62.438 -17.545 1.00 17.69  ? 123  SER A CB    1 
ATOM   1003 O  OG    A SER A 1 126 ? -24.515 62.613 -18.091 0.59 18.32  ? 123  SER A OG    1 
ATOM   1004 O  OG    B SER A 1 126 ? -26.928 61.657 -17.303 0.41 18.13  ? 123  SER A OG    1 
ATOM   1005 N  N     . ALA A 1 127 ? -28.024 63.156 -15.382 1.00 16.13  ? 124  ALA A N     1 
ATOM   1006 C  CA    . ALA A 1 127 ? -29.408 63.506 -15.004 1.00 15.46  ? 124  ALA A CA    1 
ATOM   1007 C  C     . ALA A 1 127 ? -29.474 64.786 -14.172 1.00 14.65  ? 124  ALA A C     1 
ATOM   1008 O  O     . ALA A 1 127 ? -30.424 65.543 -14.275 1.00 15.94  ? 124  ALA A O     1 
ATOM   1009 C  CB    . ALA A 1 127 ? -30.083 62.351 -14.262 1.00 14.77  ? 124  ALA A CB    1 
ATOM   1010 N  N     . VAL A 1 128 ? -28.494 65.013 -13.319 1.00 14.35  ? 125  VAL A N     1 
ATOM   1011 C  CA    . VAL A 1 128 ? -28.390 66.273 -12.609 1.00 14.99  ? 125  VAL A CA    1 
ATOM   1012 C  C     . VAL A 1 128 ? -28.222 67.476 -13.553 1.00 15.68  ? 125  VAL A C     1 
ATOM   1013 O  O     . VAL A 1 128 ? -28.883 68.512 -13.368 1.00 16.36  ? 125  VAL A O     1 
ATOM   1014 C  CB    . VAL A 1 128 ? -27.221 66.222 -11.583 1.00 15.14  ? 125  VAL A CB    1 
ATOM   1015 C  CG1   . VAL A 1 128 ? -26.760 67.619 -11.138 1.00 14.60  ? 125  VAL A CG1   1 
ATOM   1016 C  CG2   . VAL A 1 128 ? -27.687 65.414 -10.391 1.00 15.14  ? 125  VAL A CG2   1 
ATOM   1017 N  N     . GLN A 1 129 ? -27.346 67.360 -14.526 1.00 19.17  ? 126  GLN A N     1 
ATOM   1018 C  CA    . GLN A 1 129 ? -27.130 68.462 -15.478 1.00 25.24  ? 126  GLN A CA    1 
ATOM   1019 C  C     . GLN A 1 129 ? -28.444 68.813 -16.177 1.00 26.89  ? 126  GLN A C     1 
ATOM   1020 O  O     . GLN A 1 129 ? -28.869 69.952 -16.226 1.00 29.45  ? 126  GLN A O     1 
ATOM   1021 C  CB    . GLN A 1 129 ? -26.076 68.091 -16.520 1.00 30.83  ? 126  GLN A CB    1 
ATOM   1022 C  CG    . GLN A 1 129 ? -24.695 67.812 -15.961 1.00 37.38  ? 126  GLN A CG    1 
ATOM   1023 C  CD    . GLN A 1 129 ? -24.095 69.051 -15.313 1.00 46.04  ? 126  GLN A CD    1 
ATOM   1024 O  OE1   . GLN A 1 129 ? -24.208 69.280 -14.098 1.00 49.93  ? 126  GLN A OE1   1 
ATOM   1025 N  NE2   . GLN A 1 129 ? -23.492 69.881 -16.133 1.00 55.62  ? 126  GLN A NE2   1 
ATOM   1026 N  N     . GLU A 1 130 ? -29.093 67.790 -16.683 1.00 27.95  ? 127  GLU A N     1 
ATOM   1027 C  CA    . GLU A 1 130 ? -30.361 67.938 -17.355 1.00 31.52  ? 127  GLU A CA    1 
ATOM   1028 C  C     . GLU A 1 130 ? -31.458 68.546 -16.440 1.00 29.69  ? 127  GLU A C     1 
ATOM   1029 O  O     . GLU A 1 130 ? -32.225 69.406 -16.892 1.00 32.88  ? 127  GLU A O     1 
ATOM   1030 C  CB    . GLU A 1 130 ? -30.733 66.562 -17.909 1.00 33.33  ? 127  GLU A CB    1 
ATOM   1031 C  CG    . GLU A 1 130 ? -32.064 66.443 -18.603 1.00 42.00  ? 127  GLU A CG    1 
ATOM   1032 C  CD    . GLU A 1 130 ? -32.367 64.984 -18.909 1.00 54.30  ? 127  GLU A CD    1 
ATOM   1033 O  OE1   . GLU A 1 130 ? -32.518 64.200 -17.931 1.00 60.96  ? 127  GLU A OE1   1 
ATOM   1034 O  OE2   . GLU A 1 130 ? -32.433 64.612 -20.115 1.00 61.80  ? 127  GLU A OE2   1 
ATOM   1035 N  N     . ARG A 1 131 ? -31.545 68.094 -15.189 1.00 24.08  ? 128  ARG A N     1 
ATOM   1036 C  CA    . ARG A 1 131 ? -32.533 68.600 -14.239 1.00 24.47  ? 128  ARG A CA    1 
ATOM   1037 C  C     . ARG A 1 131 ? -32.223 70.051 -13.852 1.00 26.17  ? 128  ARG A C     1 
ATOM   1038 O  O     . ARG A 1 131 ? -33.143 70.866 -13.713 1.00 27.69  ? 128  ARG A O     1 
ATOM   1039 C  CB    . ARG A 1 131 ? -32.619 67.681 -13.028 1.00 22.66  ? 128  ARG A CB    1 
ATOM   1040 C  CG    A ARG A 1 131 ? -33.654 68.040 -11.973 0.57 23.57  ? 128  ARG A CG    1 
ATOM   1041 C  CG    B ARG A 1 131 ? -33.541 68.144 -11.893 0.43 24.08  ? 128  ARG A CG    1 
ATOM   1042 C  CD    A ARG A 1 131 ? -35.081 68.002 -12.539 0.57 23.53  ? 128  ARG A CD    1 
ATOM   1043 C  CD    B ARG A 1 131 ? -35.009 68.265 -12.287 0.43 24.61  ? 128  ARG A CD    1 
ATOM   1044 N  NE    A ARG A 1 131 ? -36.088 68.138 -11.499 0.57 21.88  ? 128  ARG A NE    1 
ATOM   1045 N  NE    B ARG A 1 131 ? -35.531 66.934 -12.526 0.43 23.66  ? 128  ARG A NE    1 
ATOM   1046 C  CZ    A ARG A 1 131 ? -36.440 67.169 -10.653 0.57 20.35  ? 128  ARG A CZ    1 
ATOM   1047 C  CZ    B ARG A 1 131 ? -36.115 66.201 -11.587 0.43 24.10  ? 128  ARG A CZ    1 
ATOM   1048 N  NH1   A ARG A 1 131 ? -37.371 67.402 -9.735  0.57 18.79  ? 128  ARG A NH1   1 
ATOM   1049 N  NH1   B ARG A 1 131 ? -36.546 64.982 -11.879 0.43 23.45  ? 128  ARG A NH1   1 
ATOM   1050 N  NH2   A ARG A 1 131 ? -35.850 65.968 -10.711 0.57 19.48  ? 128  ARG A NH2   1 
ATOM   1051 N  NH2   B ARG A 1 131 ? -36.294 66.700 -10.372 0.43 23.88  ? 128  ARG A NH2   1 
ATOM   1052 N  N     . LEU A 1 132 ? -30.936 70.378 -13.729 1.00 25.05  ? 129  LEU A N     1 
ATOM   1053 C  CA    . LEU A 1 132 ? -30.486 71.745 -13.478 1.00 26.46  ? 129  LEU A CA    1 
ATOM   1054 C  C     . LEU A 1 132 ? -30.866 72.704 -14.608 1.00 34.98  ? 129  LEU A C     1 
ATOM   1055 O  O     . LEU A 1 132 ? -31.179 73.840 -14.327 1.00 33.52  ? 129  LEU A O     1 
ATOM   1056 C  CB    . LEU A 1 132 ? -28.966 71.824 -13.304 1.00 26.81  ? 129  LEU A CB    1 
ATOM   1057 C  CG    . LEU A 1 132 ? -28.444 71.590 -11.883 1.00 25.31  ? 129  LEU A CG    1 
ATOM   1058 C  CD1   . LEU A 1 132 ? -26.937 71.456 -11.847 1.00 24.73  ? 129  LEU A CD1   1 
ATOM   1059 C  CD2   . LEU A 1 132 ? -28.912 72.719 -10.958 1.00 28.61  ? 129  LEU A CD2   1 
ATOM   1060 N  N     . GLN A 1 133 ? -30.785 72.268 -15.867 1.00 37.54  ? 130  GLN A N     1 
ATOM   1061 C  CA    . GLN A 1 133 ? -31.215 73.124 -16.982 1.00 46.71  ? 130  GLN A CA    1 
ATOM   1062 C  C     . GLN A 1 133 ? -32.712 73.416 -16.867 1.00 49.33  ? 130  GLN A C     1 
ATOM   1063 O  O     . GLN A 1 133 ? -33.122 74.565 -16.917 1.00 49.67  ? 130  GLN A O     1 
ATOM   1064 C  CB    . GLN A 1 133 ? -30.893 72.519 -18.343 1.00 50.19  ? 130  GLN A CB    1 
ATOM   1065 C  CG    . GLN A 1 133 ? -31.024 73.512 -19.501 1.00 60.43  ? 130  GLN A CG    1 
ATOM   1066 C  CD    . GLN A 1 133 ? -32.467 73.730 -20.010 1.00 66.53  ? 130  GLN A CD    1 
ATOM   1067 O  OE1   . GLN A 1 133 ? -33.411 73.023 -19.615 1.00 75.91  ? 130  GLN A OE1   1 
ATOM   1068 N  NE2   . GLN A 1 133 ? -32.635 74.719 -20.895 1.00 64.51  ? 130  GLN A NE2   1 
ATOM   1069 N  N     . LYS A 1 134 ? -33.518 72.376 -16.702 1.00 49.45  ? 131  LYS A N     1 
ATOM   1070 C  CA    . LYS A 1 134 ? -34.972 72.540 -16.559 1.00 52.94  ? 131  LYS A CA    1 
ATOM   1071 C  C     . LYS A 1 134 ? -35.313 73.483 -15.423 1.00 52.80  ? 131  LYS A C     1 
ATOM   1072 O  O     . LYS A 1 134 ? -36.241 74.284 -15.537 1.00 53.48  ? 131  LYS A O     1 
ATOM   1073 C  CB    . LYS A 1 134 ? -35.643 71.179 -16.309 1.00 57.95  ? 131  LYS A CB    1 
ATOM   1074 C  CG    . LYS A 1 134 ? -37.136 71.200 -15.964 1.00 59.75  ? 131  LYS A CG    1 
ATOM   1075 C  CD    . LYS A 1 134 ? -37.539 69.978 -15.152 1.00 60.06  ? 131  LYS A CD    1 
ATOM   1076 C  CE    . LYS A 1 134 ? -37.404 68.697 -15.967 1.00 60.05  ? 131  LYS A CE    1 
ATOM   1077 N  NZ    . LYS A 1 134 ? -37.780 67.486 -15.181 1.00 58.53  ? 131  LYS A NZ    1 
ATOM   1078 N  N     . LEU A 1 135 ? -34.571 73.384 -14.325 1.00 56.20  ? 132  LEU A N     1 
ATOM   1079 C  CA    . LEU A 1 135 ? -34.863 74.183 -13.139 1.00 59.77  ? 132  LEU A CA    1 
ATOM   1080 C  C     . LEU A 1 135 ? -34.802 75.693 -13.354 1.00 61.97  ? 132  LEU A C     1 
ATOM   1081 O  O     . LEU A 1 135 ? -35.445 76.446 -12.630 1.00 66.89  ? 132  LEU A O     1 
ATOM   1082 C  CB    . LEU A 1 135 ? -33.953 73.784 -11.976 1.00 60.98  ? 132  LEU A CB    1 
ATOM   1083 C  CG    . LEU A 1 135 ? -34.444 72.542 -11.215 1.00 59.71  ? 132  LEU A CG    1 
ATOM   1084 C  CD1   . LEU A 1 135 ? -33.389 72.115 -10.203 1.00 56.03  ? 132  LEU A CD1   1 
ATOM   1085 C  CD2   . LEU A 1 135 ? -35.804 72.756 -10.546 1.00 59.78  ? 132  LEU A CD2   1 
ATOM   1086 N  N     . GLN A 1 136 ? -34.043 76.130 -14.361 1.00 65.20  ? 133  GLN A N     1 
ATOM   1087 C  CA    . GLN A 1 136 ? -33.953 77.545 -14.725 1.00 67.45  ? 133  GLN A CA    1 
ATOM   1088 C  C     . GLN A 1 136 ? -33.542 78.438 -13.542 1.00 62.85  ? 133  GLN A C     1 
ATOM   1089 O  O     . GLN A 1 136 ? -34.062 79.538 -13.348 1.00 60.26  ? 133  GLN A O     1 
ATOM   1090 C  CB    . GLN A 1 136 ? -35.265 78.005 -15.385 1.00 70.17  ? 133  GLN A CB    1 
ATOM   1091 C  CG    . GLN A 1 136 ? -35.189 78.022 -16.908 1.00 76.74  ? 133  GLN A CG    1 
ATOM   1092 C  CD    . GLN A 1 136 ? -36.543 77.893 -17.594 1.00 83.82  ? 133  GLN A CD    1 
ATOM   1093 O  OE1   . GLN A 1 136 ? -37.580 78.317 -17.069 1.00 86.56  ? 133  GLN A OE1   1 
ATOM   1094 N  NE2   . GLN A 1 136 ? -36.538 77.298 -18.777 1.00 86.90  ? 133  GLN A NE2   1 
ATOM   1095 N  N     . GLY A 1 137 ? -32.594 77.947 -12.752 1.00 57.22  ? 134  GLY A N     1 
ATOM   1096 C  CA    . GLY A 1 137 ? -32.076 78.702 -11.623 1.00 52.32  ? 134  GLY A CA    1 
ATOM   1097 C  C     . GLY A 1 137 ? -33.058 79.006 -10.489 1.00 50.16  ? 134  GLY A C     1 
ATOM   1098 O  O     . GLY A 1 137 ? -32.742 79.815 -9.641  1.00 46.38  ? 134  GLY A O     1 
ATOM   1099 N  N     . GLN A 1 138 ? -34.230 78.364 -10.457 1.00 49.74  ? 135  GLN A N     1 
ATOM   1100 C  CA    . GLN A 1 138 ? -35.157 78.533 -9.347  1.00 52.69  ? 135  GLN A CA    1 
ATOM   1101 C  C     . GLN A 1 138 ? -34.642 77.729 -8.147  1.00 49.02  ? 135  GLN A C     1 
ATOM   1102 O  O     . GLN A 1 138 ? -33.941 76.719 -8.325  1.00 52.95  ? 135  GLN A O     1 
ATOM   1103 C  CB    . GLN A 1 138 ? -36.563 78.078 -9.727  1.00 57.84  ? 135  GLN A CB    1 
ATOM   1104 C  CG    . GLN A 1 138 ? -36.740 76.571 -9.860  1.00 66.47  ? 135  GLN A CG    1 
ATOM   1105 C  CD    . GLN A 1 138 ? -38.107 76.177 -10.399 1.00 75.70  ? 135  GLN A CD    1 
ATOM   1106 O  OE1   . GLN A 1 138 ? -39.102 76.176 -9.656  1.00 76.31  ? 135  GLN A OE1   1 
ATOM   1107 N  NE2   . GLN A 1 138 ? -38.166 75.813 -11.685 1.00 78.66  ? 135  GLN A NE2   1 
ATOM   1108 N  N     . PRO A 1 139 ? -34.976 78.167 -6.923  1.00 42.07  ? 136  PRO A N     1 
ATOM   1109 C  CA    . PRO A 1 139 ? -34.483 77.462 -5.745  1.00 40.19  ? 136  PRO A CA    1 
ATOM   1110 C  C     . PRO A 1 139 ? -35.107 76.083 -5.556  1.00 38.12  ? 136  PRO A C     1 
ATOM   1111 O  O     . PRO A 1 139 ? -36.044 75.688 -6.257  1.00 41.31  ? 136  PRO A O     1 
ATOM   1112 C  CB    . PRO A 1 139 ? -34.873 78.390 -4.589  1.00 40.15  ? 136  PRO A CB    1 
ATOM   1113 C  CG    . PRO A 1 139 ? -36.008 79.175 -5.121  1.00 40.77  ? 136  PRO A CG    1 
ATOM   1114 C  CD    . PRO A 1 139 ? -35.687 79.396 -6.555  1.00 39.71  ? 136  PRO A CD    1 
ATOM   1115 N  N     . ILE A 1 140 ? -34.546 75.349 -4.608  1.00 33.90  ? 137  ILE A N     1 
ATOM   1116 C  CA    . ILE A 1 140 ? -34.981 74.020 -4.292  1.00 27.31  ? 137  ILE A CA    1 
ATOM   1117 C  C     . ILE A 1 140 ? -35.634 74.059 -2.947  1.00 24.22  ? 137  ILE A C     1 
ATOM   1118 O  O     . ILE A 1 140 ? -35.006 74.293 -1.910  1.00 23.32  ? 137  ILE A O     1 
ATOM   1119 C  CB    . ILE A 1 140 ? -33.805 73.041 -4.273  1.00 28.54  ? 137  ILE A CB    1 
ATOM   1120 C  CG1   . ILE A 1 140 ? -33.132 73.070 -5.633  1.00 29.11  ? 137  ILE A CG1   1 
ATOM   1121 C  CG2   . ILE A 1 140 ? -34.297 71.624 -3.975  1.00 27.61  ? 137  ILE A CG2   1 
ATOM   1122 C  CD1   . ILE A 1 140 ? -31.870 72.262 -5.714  1.00 32.42  ? 137  ILE A CD1   1 
ATOM   1123 N  N     . SER A 1 141 ? -36.904 73.744 -2.949  1.00 24.19  ? 138  SER A N     1 
ATOM   1124 C  CA    . SER A 1 141 ? -37.709 73.756 -1.731  1.00 20.62  ? 138  SER A CA    1 
ATOM   1125 C  C     . SER A 1 141 ? -37.335 72.524 -0.864  1.00 19.35  ? 138  SER A C     1 
ATOM   1126 O  O     . SER A 1 141 ? -37.030 71.452 -1.387  1.00 17.49  ? 138  SER A O     1 
ATOM   1127 C  CB    . SER A 1 141 ? -39.195 73.713 -2.148  1.00 22.73  ? 138  SER A CB    1 
ATOM   1128 O  OG    . SER A 1 141 ? -40.017 73.223 -1.132  1.00 24.42  ? 138  SER A OG    1 
ATOM   1129 N  N     . ALA A 1 142 ? -37.389 72.681 0.443   1.00 18.05  ? 139  ALA A N     1 
ATOM   1130 C  CA    . ALA A 1 142 ? -37.210 71.560 1.324   1.00 21.14  ? 139  ALA A CA    1 
ATOM   1131 C  C     . ALA A 1 142 ? -38.228 70.439 1.083   1.00 22.08  ? 139  ALA A C     1 
ATOM   1132 O  O     . ALA A 1 142 ? -37.984 69.287 1.512   1.00 20.81  ? 139  ALA A O     1 
ATOM   1133 C  CB    . ALA A 1 142 ? -37.299 71.982 2.766   1.00 22.33  ? 139  ALA A CB    1 
ATOM   1134 N  N     . ASP A 1 143 ? -39.371 70.791 0.480   1.00 23.60  ? 140  ASP A N     1 
ATOM   1135 C  CA    . ASP A 1 143 ? -40.428 69.817 0.251   1.00 25.46  ? 140  ASP A CA    1 
ATOM   1136 C  C     . ASP A 1 143 ? -40.014 68.764 -0.769  1.00 20.57  ? 140  ASP A C     1 
ATOM   1137 O  O     . ASP A 1 143 ? -40.543 67.682 -0.735  1.00 18.82  ? 140  ASP A O     1 
ATOM   1138 C  CB    . ASP A 1 143 ? -41.742 70.480 -0.141  1.00 26.96  ? 140  ASP A CB    1 
ATOM   1139 C  CG    . ASP A 1 143 ? -42.399 71.249 1.034   1.00 32.72  ? 140  ASP A CG    1 
ATOM   1140 O  OD1   . ASP A 1 143 ? -42.137 70.970 2.229   1.00 34.17  ? 140  ASP A OD1   1 
ATOM   1141 O  OD2   . ASP A 1 143 ? -43.187 72.170 0.735   1.00 42.74  ? 140  ASP A OD2   1 
ATOM   1142 N  N     . LEU A 1 144 ? -39.032 69.080 -1.595  1.00 17.68  ? 141  LEU A N     1 
ATOM   1143 C  CA    . LEU A 1 144 ? -38.458 68.135 -2.540  1.00 17.59  ? 141  LEU A CA    1 
ATOM   1144 C  C     . LEU A 1 144 ? -37.514 67.142 -1.893  1.00 15.50  ? 141  LEU A C     1 
ATOM   1145 O  O     . LEU A 1 144 ? -37.056 66.217 -2.577  1.00 13.26  ? 141  LEU A O     1 
ATOM   1146 C  CB    . LEU A 1 144 ? -37.756 68.882 -3.683  1.00 16.83  ? 141  LEU A CB    1 
ATOM   1147 C  CG    . LEU A 1 144 ? -38.689 69.832 -4.497  1.00 19.99  ? 141  LEU A CG    1 
ATOM   1148 C  CD1   . LEU A 1 144 ? -37.949 70.534 -5.606  1.00 19.14  ? 141  LEU A CD1   1 
ATOM   1149 C  CD2   . LEU A 1 144 ? -39.885 69.075 -5.052  1.00 21.24  ? 141  LEU A CD2   1 
ATOM   1150 N  N     . LEU A 1 145 ? -37.248 67.314 -0.590  1.00 15.27  ? 142  LEU A N     1 
ATOM   1151 C  CA    . LEU A 1 145 ? -36.243 66.512 0.158   1.00 14.89  ? 142  LEU A CA    1 
ATOM   1152 C  C     . LEU A 1 145 ? -36.776 65.998 1.489   1.00 13.78  ? 142  LEU A C     1 
ATOM   1153 O  O     . LEU A 1 145 ? -36.176 66.178 2.534   1.00 13.73  ? 142  LEU A O     1 
ATOM   1154 C  CB    . LEU A 1 145 ? -34.951 67.357 0.317   1.00 14.78  ? 142  LEU A CB    1 
ATOM   1155 C  CG    . LEU A 1 145 ? -34.256 67.691 -0.983  1.00 14.73  ? 142  LEU A CG    1 
ATOM   1156 C  CD1   . LEU A 1 145 ? -33.198 68.820 -0.860  1.00 15.07  ? 142  LEU A CD1   1 
ATOM   1157 C  CD2   . LEU A 1 145 ? -33.590 66.478 -1.614  1.00 15.33  ? 142  LEU A CD2   1 
ATOM   1158 N  N     . PRO A 1 146 ? -37.923 65.293 1.463   1.00 13.98  ? 143  PRO A N     1 
ATOM   1159 C  CA    . PRO A 1 146 ? -38.633 65.014 2.691   1.00 13.10  ? 143  PRO A CA    1 
ATOM   1160 C  C     . PRO A 1 146 ? -37.986 63.950 3.560   1.00 12.74  ? 143  PRO A C     1 
ATOM   1161 O  O     . PRO A 1 146 ? -38.423 63.776 4.700   1.00 11.27  ? 143  PRO A O     1 
ATOM   1162 C  CB    . PRO A 1 146 ? -40.012 64.520 2.201   1.00 14.03  ? 143  PRO A CB    1 
ATOM   1163 C  CG    . PRO A 1 146 ? -39.740 63.919 0.841   1.00 13.83  ? 143  PRO A CG    1 
ATOM   1164 C  CD    . PRO A 1 146 ? -38.684 64.844 0.281   1.00 14.28  ? 143  PRO A CD    1 
ATOM   1165 N  N     . SER A 1 147 ? -37.001 63.195 3.022   1.00 12.08  ? 144  SER A N     1 
ATOM   1166 C  CA    . SER A 1 147 ? -36.379 62.145 3.809   1.00 11.64  ? 144  SER A CA    1 
ATOM   1167 C  C     . SER A 1 147 ? -34.872 62.214 3.785   1.00 11.12  ? 144  SER A C     1 
ATOM   1168 O  O     . SER A 1 147 ? -34.223 61.233 4.106   1.00 9.45   ? 144  SER A O     1 
ATOM   1169 C  CB    . SER A 1 147 ? -36.858 60.765 3.340   1.00 11.77  ? 144  SER A CB    1 
ATOM   1170 O  OG    . SER A 1 147 ? -36.407 60.469 2.002   1.00 12.83  ? 144  SER A OG    1 
ATOM   1171 N  N     . THR A 1 148 ? -34.349 63.389 3.463   1.00 11.72  ? 145  THR A N     1 
ATOM   1172 C  CA    . THR A 1 148 ? -32.947 63.625 3.287   1.00 11.61  ? 145  THR A CA    1 
ATOM   1173 C  C     . THR A 1 148 ? -32.262 64.251 4.546   1.00 11.79  ? 145  THR A C     1 
ATOM   1174 O  O     . THR A 1 148 ? -32.743 65.223 5.140   1.00 11.65  ? 145  THR A O     1 
ATOM   1175 C  CB    . THR A 1 148 ? -32.758 64.585 2.091   1.00 12.42  ? 145  THR A CB    1 
ATOM   1176 O  OG1   . THR A 1 148 ? -33.090 63.908 0.855   1.00 12.35  ? 145  THR A OG1   1 
ATOM   1177 C  CG2   . THR A 1 148 ? -31.240 65.069 2.004   1.00 12.27  ? 145  THR A CG2   1 
ATOM   1178 N  N     . TYR A 1 149 ? -31.126 63.683 4.948   1.00 12.88  ? 146  TYR A N     1 
ATOM   1179 C  CA    . TYR A 1 149 ? -30.216 64.254 5.942   1.00 12.20  ? 146  TYR A CA    1 
ATOM   1180 C  C     . TYR A 1 149 ? -28.995 64.877 5.268   1.00 11.93  ? 146  TYR A C     1 
ATOM   1181 O  O     . TYR A 1 149 ? -28.470 64.295 4.296   1.00 11.92  ? 146  TYR A O     1 
ATOM   1182 C  CB    . TYR A 1 149 ? -29.728 63.172 6.891   1.00 12.83  ? 146  TYR A CB    1 
ATOM   1183 C  CG    . TYR A 1 149 ? -30.777 62.784 7.918   1.00 13.80  ? 146  TYR A CG    1 
ATOM   1184 C  CD1   . TYR A 1 149 ? -30.675 63.263 9.211   1.00 15.43  ? 146  TYR A CD1   1 
ATOM   1185 C  CD2   . TYR A 1 149 ? -31.875 61.959 7.583   1.00 14.54  ? 146  TYR A CD2   1 
ATOM   1186 C  CE1   . TYR A 1 149 ? -31.607 62.926 10.179  1.00 16.89  ? 146  TYR A CE1   1 
ATOM   1187 C  CE2   . TYR A 1 149 ? -32.839 61.627 8.550   1.00 17.22  ? 146  TYR A CE2   1 
ATOM   1188 C  CZ    . TYR A 1 149 ? -32.693 62.124 9.843   1.00 17.47  ? 146  TYR A CZ    1 
ATOM   1189 O  OH    . TYR A 1 149 ? -33.569 61.805 10.898  1.00 21.61  ? 146  TYR A OH    1 
ATOM   1190 N  N     . ILE A 1 150 ? -28.565 66.020 5.794   1.00 10.77  ? 147  ILE A N     1 
ATOM   1191 C  CA    . ILE A 1 150 ? -27.294 66.669 5.386   1.00 10.79  ? 147  ILE A CA    1 
ATOM   1192 C  C     . ILE A 1 150 ? -26.297 66.401 6.451   1.00 10.63  ? 147  ILE A C     1 
ATOM   1193 O  O     . ILE A 1 150 ? -26.427 66.925 7.586   1.00 11.15  ? 147  ILE A O     1 
ATOM   1194 C  CB    . ILE A 1 150 ? -27.392 68.184 5.172   1.00 10.74  ? 147  ILE A CB    1 
ATOM   1195 C  CG1   . ILE A 1 150 ? -28.626 68.531 4.323   1.00 10.93  ? 147  ILE A CG1   1 
ATOM   1196 C  CG2   . ILE A 1 150 ? -26.104 68.738 4.502   1.00 11.11  ? 147  ILE A CG2   1 
ATOM   1197 C  CD1   . ILE A 1 150 ? -28.612 68.001 2.894   1.00 11.55  ? 147  ILE A CD1   1 
ATOM   1198 N  N     . GLU A 1 151 ? -25.345 65.535 6.150   1.00 10.71  ? 148  GLU A N     1 
ATOM   1199 C  CA    . GLU A 1 151 ? -24.418 65.082 7.182   1.00 11.29  ? 148  GLU A CA    1 
ATOM   1200 C  C     . GLU A 1 151 ? -23.571 66.309 7.638   1.00 11.81  ? 148  GLU A C     1 
ATOM   1201 O  O     . GLU A 1 151 ? -23.114 67.112 6.803   1.00 10.87  ? 148  GLU A O     1 
ATOM   1202 C  CB    . GLU A 1 151 ? -23.503 63.986 6.683   1.00 11.75  ? 148  GLU A CB    1 
ATOM   1203 C  CG    . GLU A 1 151 ? -22.331 63.644 7.624   1.00 12.31  ? 148  GLU A CG    1 
ATOM   1204 C  CD    . GLU A 1 151 ? -22.778 63.110 8.945   1.00 13.80  ? 148  GLU A CD    1 
ATOM   1205 O  OE1   . GLU A 1 151 ? -22.033 63.248 9.910   1.00 13.60  ? 148  GLU A OE1   1 
ATOM   1206 O  OE2   . GLU A 1 151 ? -23.891 62.516 8.960   1.00 15.08  ? 148  GLU A OE2   1 
ATOM   1207 N  N     . GLY A 1 152 ? -23.431 66.427 8.956   1.00 12.75  ? 149  GLY A N     1 
ATOM   1208 C  CA    . GLY A 1 152 ? -22.714 67.527 9.582   1.00 14.05  ? 149  GLY A CA    1 
ATOM   1209 C  C     . GLY A 1 152 ? -23.560 68.731 9.925   1.00 14.26  ? 149  GLY A C     1 
ATOM   1210 O  O     . GLY A 1 152 ? -23.084 69.660 10.577  1.00 16.91  ? 149  GLY A O     1 
ATOM   1211 N  N     . LEU A 1 153 ? -24.809 68.752 9.525   1.00 13.78  ? 150  LEU A N     1 
ATOM   1212 C  CA    . LEU A 1 153 ? -25.717 69.864 9.882   1.00 13.90  ? 150  LEU A CA    1 
ATOM   1213 C  C     . LEU A 1 153 ? -26.872 69.273 10.662  1.00 15.84  ? 150  LEU A C     1 
ATOM   1214 O  O     . LEU A 1 153 ? -27.196 68.103 10.452  1.00 15.94  ? 150  LEU A O     1 
ATOM   1215 C  CB    . LEU A 1 153 ? -26.230 70.590 8.670   1.00 13.98  ? 150  LEU A CB    1 
ATOM   1216 C  CG    . LEU A 1 153 ? -25.202 71.281 7.807   1.00 14.64  ? 150  LEU A CG    1 
ATOM   1217 C  CD1   . LEU A 1 153 ? -25.873 71.915 6.634   1.00 14.03  ? 150  LEU A CD1   1 
ATOM   1218 C  CD2   . LEU A 1 153 ? -24.463 72.383 8.569   1.00 16.14  ? 150  LEU A CD2   1 
ATOM   1219 N  N     . PRO A 1 154 ? -27.518 70.032 11.556  1.00 18.30  ? 151  PRO A N     1 
ATOM   1220 C  CA    . PRO A 1 154 ? -27.246 71.462 11.841  1.00 20.62  ? 151  PRO A CA    1 
ATOM   1221 C  C     . PRO A 1 154 ? -26.017 71.663 12.667  1.00 20.95  ? 151  PRO A C     1 
ATOM   1222 O  O     . PRO A 1 154 ? -25.529 70.737 13.303  1.00 18.30  ? 151  PRO A O     1 
ATOM   1223 C  CB    . PRO A 1 154 ? -28.518 71.911 12.627  1.00 20.96  ? 151  PRO A CB    1 
ATOM   1224 C  CG    . PRO A 1 154 ? -28.969 70.664 13.337  1.00 20.44  ? 151  PRO A CG    1 
ATOM   1225 C  CD    . PRO A 1 154 ? -28.626 69.511 12.385  1.00 19.95  ? 151  PRO A CD    1 
ATOM   1226 N  N     . GLN A 1 155 ? -25.491 72.871 12.596  1.00 25.74  ? 152  GLN A N     1 
ATOM   1227 C  CA    . GLN A 1 155 ? -24.244 73.238 13.254  1.00 32.38  ? 152  GLN A CA    1 
ATOM   1228 C  C     . GLN A 1 155 ? -24.369 74.693 13.657  1.00 37.37  ? 152  GLN A C     1 
ATOM   1229 O  O     . GLN A 1 155 ? -25.127 75.417 13.017  1.00 33.76  ? 152  GLN A O     1 
ATOM   1230 C  CB    . GLN A 1 155 ? -23.105 73.058 12.261  1.00 37.99  ? 152  GLN A CB    1 
ATOM   1231 C  CG    . GLN A 1 155 ? -21.883 73.977 12.350  1.00 46.74  ? 152  GLN A CG    1 
ATOM   1232 C  CD    . GLN A 1 155 ? -20.636 73.214 12.796  1.00 57.90  ? 152  GLN A CD    1 
ATOM   1233 O  OE1   . GLN A 1 155 ? -19.955 72.575 11.992  1.00 56.87  ? 152  GLN A OE1   1 
ATOM   1234 N  NE2   . GLN A 1 155 ? -20.343 73.267 14.092  1.00 70.08  ? 152  GLN A NE2   1 
ATOM   1235 N  N     . GLY A 1 156 ? -23.630 75.113 14.689  1.00 41.88  ? 153  GLY A N     1 
ATOM   1236 C  CA    . GLY A 1 156 ? -23.474 76.542 15.026  1.00 51.00  ? 153  GLY A CA    1 
ATOM   1237 C  C     . GLY A 1 156 ? -24.418 77.095 16.098  1.00 60.79  ? 153  GLY A C     1 
ATOM   1238 O  O     . GLY A 1 156 ? -25.219 76.349 16.682  1.00 63.23  ? 153  GLY A O     1 
ATOM   1239 N  N     . PRO A 1 157 ? -24.339 78.424 16.350  1.00 71.54  ? 154  PRO A N     1 
ATOM   1240 C  CA    . PRO A 1 157 ? -25.021 79.039 17.513  1.00 69.73  ? 154  PRO A CA    1 
ATOM   1241 C  C     . PRO A 1 157 ? -26.563 79.062 17.447  1.00 65.29  ? 154  PRO A C     1 
ATOM   1242 O  O     . PRO A 1 157 ? -27.126 79.414 16.419  1.00 64.41  ? 154  PRO A O     1 
ATOM   1243 C  CB    . PRO A 1 157 ? -24.429 80.463 17.549  1.00 66.96  ? 154  PRO A CB    1 
ATOM   1244 C  CG    . PRO A 1 157 ? -23.960 80.726 16.154  1.00 63.58  ? 154  PRO A CG    1 
ATOM   1245 C  CD    . PRO A 1 157 ? -23.524 79.411 15.599  1.00 65.26  ? 154  PRO A CD    1 
ATOM   1246 N  N     . THR A 1 163 ? -34.617 72.495 18.892  1.00 77.70  ? 160  THR A N     1 
ATOM   1247 C  CA    . THR A 1 163 ? -35.539 71.375 19.077  1.00 74.36  ? 160  THR A CA    1 
ATOM   1248 C  C     . THR A 1 163 ? -34.766 70.099 19.448  1.00 69.39  ? 160  THR A C     1 
ATOM   1249 O  O     . THR A 1 163 ? -33.566 69.988 19.193  1.00 71.49  ? 160  THR A O     1 
ATOM   1250 C  CB    . THR A 1 163 ? -36.402 71.121 17.812  1.00 73.79  ? 160  THR A CB    1 
ATOM   1251 O  OG1   . THR A 1 163 ? -35.604 70.496 16.792  1.00 67.07  ? 160  THR A OG1   1 
ATOM   1252 C  CG2   . THR A 1 163 ? -37.039 72.419 17.269  1.00 72.81  ? 160  THR A CG2   1 
ATOM   1253 N  N     . VAL A 1 164 ? -35.467 69.142 20.046  1.00 62.53  ? 161  VAL A N     1 
ATOM   1254 C  CA    . VAL A 1 164 ? -34.828 67.958 20.647  1.00 57.88  ? 161  VAL A CA    1 
ATOM   1255 C  C     . VAL A 1 164 ? -35.290 66.605 20.080  1.00 52.65  ? 161  VAL A C     1 
ATOM   1256 O  O     . VAL A 1 164 ? -34.947 65.561 20.648  1.00 53.86  ? 161  VAL A O     1 
ATOM   1257 C  CB    . VAL A 1 164 ? -35.038 67.961 22.186  1.00 56.23  ? 161  VAL A CB    1 
ATOM   1258 C  CG1   . VAL A 1 164 ? -34.607 69.297 22.793  1.00 56.54  ? 161  VAL A CG1   1 
ATOM   1259 C  CG2   . VAL A 1 164 ? -36.482 67.624 22.560  1.00 53.23  ? 161  VAL A CG2   1 
ATOM   1260 N  N     . GLN A 1 165 ? -36.061 66.628 18.991  1.00 47.49  ? 162  GLN A N     1 
ATOM   1261 C  CA    . GLN A 1 165 ? -36.569 65.410 18.336  1.00 48.73  ? 162  GLN A CA    1 
ATOM   1262 C  C     . GLN A 1 165 ? -36.030 65.202 16.908  1.00 43.91  ? 162  GLN A C     1 
ATOM   1263 O  O     . GLN A 1 165 ? -35.596 66.150 16.238  1.00 35.37  ? 162  GLN A O     1 
ATOM   1264 C  CB    . GLN A 1 165 ? -38.101 65.383 18.329  1.00 54.22  ? 162  GLN A CB    1 
ATOM   1265 C  CG    . GLN A 1 165 ? -38.728 65.268 19.728  1.00 57.66  ? 162  GLN A CG    1 
ATOM   1266 C  CD    . GLN A 1 165 ? -38.249 64.048 20.547  1.00 62.36  ? 162  GLN A CD    1 
ATOM   1267 O  OE1   . GLN A 1 165 ? -38.005 62.959 20.015  1.00 70.40  ? 162  GLN A OE1   1 
ATOM   1268 N  NE2   . GLN A 1 165 ? -38.129 64.235 21.845  1.00 58.86  ? 162  GLN A NE2   1 
ATOM   1269 N  N     . LYS A 1 166 ? -36.083 63.950 16.457  1.00 35.94  ? 163  LYS A N     1 
ATOM   1270 C  CA    . LYS A 1 166 ? -35.296 63.501 15.311  1.00 35.80  ? 163  LYS A CA    1 
ATOM   1271 C  C     . LYS A 1 166 ? -35.610 64.292 14.026  1.00 30.86  ? 163  LYS A C     1 
ATOM   1272 O  O     . LYS A 1 166 ? -34.724 64.784 13.341  1.00 26.55  ? 163  LYS A O     1 
ATOM   1273 C  CB    . LYS A 1 166 ? -35.529 62.006 15.091  1.00 40.00  ? 163  LYS A CB    1 
ATOM   1274 C  CG    . LYS A 1 166 ? -34.500 61.349 14.208  1.00 43.40  ? 163  LYS A CG    1 
ATOM   1275 C  CD    . LYS A 1 166 ? -34.665 59.827 14.216  1.00 50.09  ? 163  LYS A CD    1 
ATOM   1276 C  CE    . LYS A 1 166 ? -33.595 59.113 13.363  1.00 53.03  ? 163  LYS A CE    1 
ATOM   1277 N  NZ    . LYS A 1 166 ? -32.198 59.679 13.443  1.00 51.67  ? 163  LYS A NZ    1 
ATOM   1278 N  N     . GLU A 1 167 ? -36.889 64.383 13.711  1.00 28.73  ? 164  GLU A N     1 
ATOM   1279 C  CA    . GLU A 1 167 ? -37.354 65.070 12.511  1.00 27.21  ? 164  GLU A CA    1 
ATOM   1280 C  C     . GLU A 1 167 ? -37.022 66.528 12.554  1.00 25.71  ? 164  GLU A C     1 
ATOM   1281 O  O     . GLU A 1 167 ? -36.708 67.131 11.531  1.00 23.59  ? 164  GLU A O     1 
ATOM   1282 C  CB    . GLU A 1 167 ? -38.891 64.842 12.321  1.00 28.67  ? 164  GLU A CB    1 
ATOM   1283 C  CG    . GLU A 1 167 ? -39.510 65.428 11.046  1.00 27.69  ? 164  GLU A CG    1 
ATOM   1284 C  CD    . GLU A 1 167 ? -38.762 65.092 9.718   1.00 28.35  ? 164  GLU A CD    1 
ATOM   1285 O  OE1   . GLU A 1 167 ? -39.008 65.803 8.721   1.00 29.93  ? 164  GLU A OE1   1 
ATOM   1286 O  OE2   . GLU A 1 167 ? -37.955 64.128 9.612   1.00 27.60  ? 164  GLU A OE2   1 
ATOM   1287 N  N     . GLY A 1 168 ? -37.114 67.104 13.747  1.00 26.09  ? 165  GLY A N     1 
ATOM   1288 C  CA    . GLY A 1 168 ? -36.795 68.534 13.945  1.00 27.16  ? 165  GLY A CA    1 
ATOM   1289 C  C     . GLY A 1 168 ? -35.373 68.877 13.596  1.00 23.09  ? 165  GLY A C     1 
ATOM   1290 O  O     . GLY A 1 168 ? -35.130 69.774 12.829  1.00 22.99  ? 165  GLY A O     1 
ATOM   1291 N  N     . MET A 1 169 ? -34.451 68.083 14.116  1.00 24.33  ? 166  MET A N     1 
ATOM   1292 C  CA    . MET A 1 169 ? -33.026 68.176 13.804  1.00 25.23  ? 166  MET A CA    1 
ATOM   1293 C  C     . MET A 1 169 ? -32.759 67.949 12.320  1.00 21.85  ? 166  MET A C     1 
ATOM   1294 O  O     . MET A 1 169 ? -32.008 68.707 11.728  1.00 20.64  ? 166  MET A O     1 
ATOM   1295 C  CB    . MET A 1 169 ? -32.238 67.159 14.622  1.00 29.93  ? 166  MET A CB    1 
ATOM   1296 C  CG    . MET A 1 169 ? -32.270 67.422 16.137  1.00 36.47  ? 166  MET A CG    1 
ATOM   1297 S  SD    . MET A 1 169 ? -31.271 68.883 16.536  1.00 46.09  ? 166  MET A SD    1 
ATOM   1298 C  CE    . MET A 1 169 ? -29.610 68.294 16.067  1.00 39.81  ? 166  MET A CE    1 
ATOM   1299 N  N     . ARG A 1 170 ? -33.400 66.938 11.693  1.00 20.43  ? 167  ARG A N     1 
ATOM   1300 C  CA    . ARG A 1 170 ? -33.238 66.729 10.223  1.00 19.13  ? 167  ARG A CA    1 
ATOM   1301 C  C     . ARG A 1 170 ? -33.569 67.981 9.443   1.00 17.95  ? 167  ARG A C     1 
ATOM   1302 O  O     . ARG A 1 170 ? -32.811 68.404 8.577   1.00 16.60  ? 167  ARG A O     1 
ATOM   1303 C  CB    . ARG A 1 170 ? -34.114 65.556 9.731   1.00 18.66  ? 167  ARG A CB    1 
ATOM   1304 C  CG    . ARG A 1 170 ? -33.905 65.170 8.268   1.00 17.76  ? 167  ARG A CG    1 
ATOM   1305 C  CD    . ARG A 1 170 ? -35.039 64.308 7.765   1.00 17.47  ? 167  ARG A CD    1 
ATOM   1306 N  NE    . ARG A 1 170 ? -36.258 65.090 7.539   1.00 16.36  ? 167  ARG A NE    1 
ATOM   1307 C  CZ    . ARG A 1 170 ? -36.461 65.852 6.467   1.00 16.26  ? 167  ARG A CZ    1 
ATOM   1308 N  NH1   . ARG A 1 170 ? -35.556 65.970 5.507   1.00 15.07  ? 167  ARG A NH1   1 
ATOM   1309 N  NH2   . ARG A 1 170 ? -37.596 66.525 6.356   1.00 17.42  ? 167  ARG A NH2   1 
ATOM   1310 N  N     . LYS A 1 171 ? -34.739 68.563 9.722   1.00 18.58  ? 168  LYS A N     1 
ATOM   1311 C  CA    . LYS A 1 171 ? -35.185 69.751 8.998   1.00 21.46  ? 168  LYS A CA    1 
ATOM   1312 C  C     . LYS A 1 171 ? -34.324 70.974 9.238   1.00 19.58  ? 168  LYS A C     1 
ATOM   1313 O  O     . LYS A 1 171 ? -34.024 71.713 8.294   1.00 19.20  ? 168  LYS A O     1 
ATOM   1314 C  CB    . LYS A 1 171 ? -36.667 70.086 9.293   1.00 25.93  ? 168  LYS A CB    1 
ATOM   1315 C  CG    . LYS A 1 171 ? -37.585 69.136 8.534   1.00 31.94  ? 168  LYS A CG    1 
ATOM   1316 C  CD    . LYS A 1 171 ? -38.737 69.839 7.812   1.00 39.88  ? 168  LYS A CD    1 
ATOM   1317 C  CE    . LYS A 1 171 ? -39.744 70.384 8.811   1.00 43.36  ? 168  LYS A CE    1 
ATOM   1318 N  NZ    . LYS A 1 171 ? -40.277 69.269 9.647   1.00 49.05  ? 168  LYS A NZ    1 
ATOM   1319 N  N     . GLN A 1 172 ? -33.952 71.194 10.498  1.00 19.76  ? 169  GLN A N     1 
ATOM   1320 C  CA    . GLN A 1 172 ? -32.967 72.248 10.825  1.00 22.01  ? 169  GLN A CA    1 
ATOM   1321 C  C     . GLN A 1 172 ? -31.682 72.158 9.939   1.00 18.76  ? 169  GLN A C     1 
ATOM   1322 O  O     . GLN A 1 172 ? -31.239 73.139 9.377   1.00 17.01  ? 169  GLN A O     1 
ATOM   1323 C  CB    . GLN A 1 172 ? -32.509 72.113 12.266  1.00 28.25  ? 169  GLN A CB    1 
ATOM   1324 C  CG    . GLN A 1 172 ? -33.289 72.850 13.320  1.00 34.30  ? 169  GLN A CG    1 
ATOM   1325 C  CD    . GLN A 1 172 ? -32.743 72.535 14.728  1.00 41.92  ? 169  GLN A CD    1 
ATOM   1326 O  OE1   . GLN A 1 172 ? -31.608 72.100 14.896  1.00 44.43  ? 169  GLN A OE1   1 
ATOM   1327 N  NE2   . GLN A 1 172 ? -33.571 72.756 15.742  1.00 52.25  ? 169  GLN A NE2   1 
ATOM   1328 N  N     . GLY A 1 173 ? -31.054 70.988 9.880   1.00 15.74  ? 170  GLY A N     1 
ATOM   1329 C  CA    . GLY A 1 173 ? -29.885 70.791 9.044   1.00 15.01  ? 170  GLY A CA    1 
ATOM   1330 C  C     . GLY A 1 173 ? -30.145 71.099 7.595   1.00 14.34  ? 170  GLY A C     1 
ATOM   1331 O  O     . GLY A 1 173 ? -29.347 71.762 6.936   1.00 14.76  ? 170  GLY A O     1 
ATOM   1332 N  N     . LEU A 1 174 ? -31.289 70.606 7.106   1.00 16.13  ? 171  LEU A N     1 
ATOM   1333 C  CA    . LEU A 1 174 ? -31.685 70.785 5.712   1.00 17.48  ? 171  LEU A CA    1 
ATOM   1334 C  C     . LEU A 1 174 ? -31.916 72.303 5.406   1.00 18.01  ? 171  LEU A C     1 
ATOM   1335 O  O     . LEU A 1 174 ? -31.507 72.796 4.366   1.00 15.48  ? 171  LEU A O     1 
ATOM   1336 C  CB    . LEU A 1 174 ? -32.957 69.956 5.423   1.00 17.78  ? 171  LEU A CB    1 
ATOM   1337 C  CG    . LEU A 1 174 ? -33.483 70.103 4.016   1.00 16.82  ? 171  LEU A CG    1 
ATOM   1338 C  CD1   . LEU A 1 174 ? -32.433 69.606 3.022   1.00 16.88  ? 171  LEU A CD1   1 
ATOM   1339 C  CD2   . LEU A 1 174 ? -34.749 69.279 3.875   1.00 17.61  ? 171  LEU A CD2   1 
ATOM   1340 N  N     . PHE A 1 175 ? -32.568 73.018 6.320   1.00 18.87  ? 172  PHE A N     1 
ATOM   1341 C  CA    . PHE A 1 175 ? -32.736 74.473 6.131   1.00 21.03  ? 172  PHE A CA    1 
ATOM   1342 C  C     . PHE A 1 175 ? -31.399 75.214 6.053   1.00 19.60  ? 172  PHE A C     1 
ATOM   1343 O  O     . PHE A 1 175 ? -31.208 76.032 5.162   1.00 19.92  ? 172  PHE A O     1 
ATOM   1344 C  CB    . PHE A 1 175 ? -33.610 75.099 7.225   1.00 23.23  ? 172  PHE A CB    1 
ATOM   1345 C  CG    . PHE A 1 175 ? -35.029 74.630 7.223   1.00 29.33  ? 172  PHE A CG    1 
ATOM   1346 C  CD1   . PHE A 1 175 ? -35.720 74.348 6.021   1.00 31.93  ? 172  PHE A CD1   1 
ATOM   1347 C  CD2   . PHE A 1 175 ? -35.732 74.505 8.444   1.00 35.47  ? 172  PHE A CD2   1 
ATOM   1348 C  CE1   . PHE A 1 175 ? -37.063 73.939 6.042   1.00 35.36  ? 172  PHE A CE1   1 
ATOM   1349 C  CE2   . PHE A 1 175 ? -37.096 74.119 8.461   1.00 38.98  ? 172  PHE A CE2   1 
ATOM   1350 C  CZ    . PHE A 1 175 ? -37.748 73.812 7.252   1.00 38.15  ? 172  PHE A CZ    1 
ATOM   1351 N  N     . GLN A 1 176 ? -30.470 74.907 6.964   1.00 18.89  ? 173  GLN A N     1 
ATOM   1352 C  CA    . GLN A 1 176 ? -29.133 75.532 6.928   1.00 19.27  ? 173  GLN A CA    1 
ATOM   1353 C  C     . GLN A 1 176 ? -28.469 75.232 5.625   1.00 18.95  ? 173  GLN A C     1 
ATOM   1354 O  O     . GLN A 1 176 ? -27.944 76.132 4.990   1.00 17.74  ? 173  GLN A O     1 
ATOM   1355 C  CB    . GLN A 1 176 ? -28.235 75.047 8.051   1.00 20.95  ? 173  GLN A CB    1 
ATOM   1356 C  CG    . GLN A 1 176 ? -28.733 75.415 9.423   1.00 21.98  ? 173  GLN A CG    1 
ATOM   1357 C  CD    . GLN A 1 176 ? -27.713 75.148 10.535  1.00 24.11  ? 173  GLN A CD    1 
ATOM   1358 O  OE1   . GLN A 1 176 ? -26.679 74.508 10.347  1.00 24.91  ? 173  GLN A OE1   1 
ATOM   1359 N  NE2   . GLN A 1 176 ? -28.033 75.633 11.725  1.00 24.91  ? 173  GLN A NE2   1 
ATOM   1360 N  N     . TRP A 1 177 ? -28.560 73.980 5.169   1.00 17.49  ? 174  TRP A N     1 
ATOM   1361 C  CA    . TRP A 1 177 ? -27.965 73.623 3.870   1.00 16.89  ? 174  TRP A CA    1 
ATOM   1362 C  C     . TRP A 1 177 ? -28.565 74.437 2.720   1.00 18.68  ? 174  TRP A C     1 
ATOM   1363 O  O     . TRP A 1 177 ? -27.866 75.064 1.930   1.00 18.38  ? 174  TRP A O     1 
ATOM   1364 C  CB    . TRP A 1 177 ? -28.212 72.146 3.589   1.00 15.53  ? 174  TRP A CB    1 
ATOM   1365 C  CG    . TRP A 1 177 ? -27.720 71.637 2.259   1.00 14.55  ? 174  TRP A CG    1 
ATOM   1366 C  CD1   . TRP A 1 177 ? -28.482 71.292 1.197   1.00 14.36  ? 174  TRP A CD1   1 
ATOM   1367 C  CD2   . TRP A 1 177 ? -26.359 71.377 1.886   1.00 13.85  ? 174  TRP A CD2   1 
ATOM   1368 N  NE1   . TRP A 1 177 ? -27.695 70.808 0.182   1.00 14.80  ? 174  TRP A NE1   1 
ATOM   1369 C  CE2   . TRP A 1 177 ? -26.382 70.846 0.573   1.00 14.32  ? 174  TRP A CE2   1 
ATOM   1370 C  CE3   . TRP A 1 177 ? -25.122 71.547 2.524   1.00 14.02  ? 174  TRP A CE3   1 
ATOM   1371 C  CZ2   . TRP A 1 177 ? -25.217 70.488 -0.124  1.00 13.50  ? 174  TRP A CZ2   1 
ATOM   1372 C  CZ3   . TRP A 1 177 ? -23.924 71.182 1.823   1.00 14.01  ? 174  TRP A CZ3   1 
ATOM   1373 C  CH2   . TRP A 1 177 ? -23.999 70.658 0.497   1.00 13.05  ? 174  TRP A CH2   1 
ATOM   1374 N  N     . LEU A 1 178 ? -29.876 74.416 2.616   1.00 18.70  ? 175  LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 178 ? -30.523 75.086 1.476   1.00 21.31  ? 175  LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 178 ? -30.369 76.606 1.521   1.00 23.84  ? 175  LEU A C     1 
ATOM   1377 O  O     . LEU A 1 178 ? -30.150 77.206 0.486   1.00 25.06  ? 175  LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 178 ? -32.001 74.755 1.417   1.00 19.63  ? 175  LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 178 ? -32.318 73.272 1.194   1.00 20.15  ? 175  LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 178 ? -33.795 73.042 1.471   1.00 21.82  ? 175  LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 178 ? -31.975 72.863 -0.230  1.00 20.29  ? 175  LEU A CD2   1 
ATOM   1382 N  N     . ASP A 1 179 ? -30.466 77.191 2.705   1.00 25.75  ? 176  ASP A N     1 
ATOM   1383 C  CA    . ASP A 1 179 ? -30.317 78.652 2.853   1.00 31.39  ? 176  ASP A CA    1 
ATOM   1384 C  C     . ASP A 1 179 ? -28.968 79.109 2.397   1.00 31.85  ? 176  ASP A C     1 
ATOM   1385 O  O     . ASP A 1 179 ? -28.862 80.205 1.870   1.00 34.04  ? 176  ASP A O     1 
ATOM   1386 C  CB    . ASP A 1 179 ? -30.584 79.148 4.265   1.00 33.29  ? 176  ASP A CB    1 
ATOM   1387 C  CG    . ASP A 1 179 ? -32.048 79.068 4.632   1.00 38.41  ? 176  ASP A CG    1 
ATOM   1388 O  OD1   . ASP A 1 179 ? -32.900 79.033 3.721   1.00 44.74  ? 176  ASP A OD1   1 
ATOM   1389 O  OD2   . ASP A 1 179 ? -32.374 79.026 5.846   1.00 45.00  ? 176  ASP A OD2   1 
ATOM   1390 N  N     . SER A 1 180 ? -27.969 78.254 2.557   1.00 26.64  ? 177  SER A N     1 
ATOM   1391 C  CA    . SER A 1 180 ? -26.636 78.521 2.044   1.00 26.86  ? 177  SER A CA    1 
ATOM   1392 C  C     . SER A 1 180 ? -26.383 78.205 0.578   1.00 26.74  ? 177  SER A C     1 
ATOM   1393 O  O     . SER A 1 180 ? -25.310 78.537 0.074   1.00 28.30  ? 177  SER A O     1 
ATOM   1394 C  CB    . SER A 1 180 ? -25.619 77.764 2.902   1.00 25.81  ? 177  SER A CB    1 
ATOM   1395 O  OG    . SER A 1 180 ? -25.741 78.213 4.234   1.00 29.87  ? 177  SER A OG    1 
ATOM   1396 N  N     . LEU A 1 181 ? -27.301 77.541 -0.100  1.00 25.01  ? 178  LEU A N     1 
ATOM   1397 C  CA    . LEU A 1 181 ? -27.006 77.123 -1.460  1.00 31.07  ? 178  LEU A CA    1 
ATOM   1398 C  C     . LEU A 1 181 ? -26.845 78.228 -2.510  1.00 36.73  ? 178  LEU A C     1 
ATOM   1399 O  O     . LEU A 1 181 ? -27.602 79.186 -2.527  1.00 37.75  ? 178  LEU A O     1 
ATOM   1400 C  CB    . LEU A 1 181 ? -28.056 76.145 -2.000  1.00 31.27  ? 178  LEU A CB    1 
ATOM   1401 C  CG    . LEU A 1 181 ? -27.794 74.668 -1.836  1.00 28.58  ? 178  LEU A CG    1 
ATOM   1402 C  CD1   . LEU A 1 181 ? -28.868 73.877 -2.584  1.00 26.03  ? 178  LEU A CD1   1 
ATOM   1403 C  CD2   . LEU A 1 181 ? -26.396 74.290 -2.321  1.00 28.63  ? 178  LEU A CD2   1 
ATOM   1404 N  N     . GLN A 1 182 ? -25.954 77.958 -3.462  1.00 44.51  ? 179  GLN A N     1 
ATOM   1405 C  CA    . GLN A 1 182 ? -25.537 78.851 -4.544  1.00 51.77  ? 179  GLN A CA    1 
ATOM   1406 C  C     . GLN A 1 182 ? -26.231 78.398 -5.837  1.00 52.93  ? 179  GLN A C     1 
ATOM   1407 O  O     . GLN A 1 182 ? -25.571 77.921 -6.776  1.00 58.64  ? 179  GLN A O     1 
ATOM   1408 C  CB    . GLN A 1 182 ? -24.000 78.822 -4.708  1.00 60.79  ? 179  GLN A CB    1 
ATOM   1409 C  CG    . GLN A 1 182 ? -23.224 78.458 -3.425  1.00 71.61  ? 179  GLN A CG    1 
ATOM   1410 C  CD    . GLN A 1 182 ? -23.203 76.960 -3.088  1.00 73.83  ? 179  GLN A CD    1 
ATOM   1411 O  OE1   . GLN A 1 182 ? -23.930 76.162 -3.696  1.00 75.91  ? 179  GLN A OE1   1 
ATOM   1412 N  NE2   . GLN A 1 182 ? -22.368 76.575 -2.113  1.00 72.32  ? 179  GLN A NE2   1 
ATOM   1413 N  N     . ILE A 1 183 ? -27.564 78.558 -5.872  1.00 50.15  ? 180  ILE A N     1 
ATOM   1414 C  CA    . ILE A 1 183 ? -28.405 78.206 -7.051  1.00 53.21  ? 180  ILE A CA    1 
ATOM   1415 C  C     . ILE A 1 183 ? -28.099 78.978 -8.344  1.00 53.21  ? 180  ILE A C     1 
ATOM   1416 O  O     . ILE A 1 183 ? -28.523 78.571 -9.421  1.00 54.95  ? 180  ILE A O     1 
ATOM   1417 C  CB    . ILE A 1 183 ? -29.941 78.233 -6.761  1.00 51.09  ? 180  ILE A CB    1 
ATOM   1418 C  CG1   . ILE A 1 183 ? -30.422 79.580 -6.192  1.00 54.48  ? 180  ILE A CG1   1 
ATOM   1419 C  CG2   . ILE A 1 183 ? -30.311 77.107 -5.808  1.00 52.80  ? 180  ILE A CG2   1 
ATOM   1420 C  CD1   . ILE A 1 183 ? -30.810 80.603 -7.226  1.00 55.90  ? 180  ILE A CD1   1 
ATOM   1421 N  N     . ASP A 1 184 ? -27.381 80.082 -8.192  1.00 57.70  ? 181  ASP A N     1 
ATOM   1422 C  CA    . ASP A 1 184 ? -26.826 80.891 -9.276  1.00 62.09  ? 181  ASP A CA    1 
ATOM   1423 C  C     . ASP A 1 184 ? -25.819 80.168 -10.200 1.00 58.36  ? 181  ASP A C     1 
ATOM   1424 O  O     . ASP A 1 184 ? -25.793 80.456 -11.402 1.00 49.15  ? 181  ASP A O     1 
ATOM   1425 C  CB    . ASP A 1 184 ? -26.136 82.131 -8.651  1.00 70.12  ? 181  ASP A CB    1 
ATOM   1426 C  CG    . ASP A 1 184 ? -26.147 83.351 -9.568  1.00 82.43  ? 181  ASP A CG    1 
ATOM   1427 O  OD1   . ASP A 1 184 ? -25.941 83.196 -10.791 1.00 100.99 ? 181  ASP A OD1   1 
ATOM   1428 O  OD2   . ASP A 1 184 ? -26.351 84.486 -9.060  1.00 89.50  ? 181  ASP A OD2   1 
ATOM   1429 N  N     . ASN A 1 185 ? -24.967 79.296 -9.644  1.00 52.43  ? 182  ASN A N     1 
ATOM   1430 C  CA    . ASN A 1 185 ? -23.951 78.571 -10.440 1.00 49.14  ? 182  ASN A CA    1 
ATOM   1431 C  C     . ASN A 1 185 ? -24.367 77.105 -10.729 1.00 47.33  ? 182  ASN A C     1 
ATOM   1432 O  O     . ASN A 1 185 ? -24.549 76.295 -9.816  1.00 44.01  ? 182  ASN A O     1 
ATOM   1433 C  CB    . ASN A 1 185 ? -22.590 78.622 -9.740  1.00 44.85  ? 182  ASN A CB    1 
ATOM   1434 C  CG    . ASN A 1 185 ? -21.498 77.913 -10.523 1.00 46.45  ? 182  ASN A CG    1 
ATOM   1435 O  OD1   . ASN A 1 185 ? -21.594 77.704 -11.732 1.00 48.40  ? 182  ASN A OD1   1 
ATOM   1436 N  ND2   . ASN A 1 185 ? -20.450 77.516 -9.823  1.00 50.95  ? 182  ASN A ND2   1 
ATOM   1437 N  N     . LEU A 1 186 ? -24.476 76.766 -12.012 1.00 48.82  ? 183  LEU A N     1 
ATOM   1438 C  CA    . LEU A 1 186 ? -24.821 75.393 -12.438 1.00 44.30  ? 183  LEU A CA    1 
ATOM   1439 C  C     . LEU A 1 186 ? -23.684 74.381 -12.234 1.00 38.78  ? 183  LEU A C     1 
ATOM   1440 O  O     . LEU A 1 186 ? -23.952 73.185 -12.212 1.00 33.15  ? 183  LEU A O     1 
ATOM   1441 C  CB    . LEU A 1 186 ? -25.309 75.363 -13.907 1.00 46.94  ? 183  LEU A CB    1 
ATOM   1442 C  CG    . LEU A 1 186 ? -26.648 76.069 -14.255 1.00 52.00  ? 183  LEU A CG    1 
ATOM   1443 C  CD1   . LEU A 1 186 ? -27.425 75.298 -15.323 1.00 49.59  ? 183  LEU A CD1   1 
ATOM   1444 C  CD2   . LEU A 1 186 ? -27.570 76.331 -13.050 1.00 54.20  ? 183  LEU A CD2   1 
ATOM   1445 N  N     . THR A 1 187 ? -22.445 74.865 -12.088 1.00 37.29  ? 184  THR A N     1 
ATOM   1446 C  CA    . THR A 1 187 ? -21.273 74.023 -11.821 1.00 37.19  ? 184  THR A CA    1 
ATOM   1447 C  C     . THR A 1 187 ? -20.899 73.876 -10.334 1.00 30.13  ? 184  THR A C     1 
ATOM   1448 O  O     . THR A 1 187 ? -19.877 73.263 -10.054 1.00 32.16  ? 184  THR A O     1 
ATOM   1449 C  CB    . THR A 1 187 ? -20.028 74.566 -12.591 1.00 41.62  ? 184  THR A CB    1 
ATOM   1450 O  OG1   . THR A 1 187 ? -19.706 75.900 -12.136 1.00 40.87  ? 184  THR A OG1   1 
ATOM   1451 C  CG2   . THR A 1 187 ? -20.304 74.606 -14.083 1.00 42.55  ? 184  THR A CG2   1 
ATOM   1452 N  N     . SER A 1 188 ? -21.672 74.454 -9.408  1.00 24.76  ? 185  SER A N     1 
ATOM   1453 C  CA    . SER A 1 188 ? -21.463 74.246 -7.942  1.00 20.78  ? 185  SER A CA    1 
ATOM   1454 C  C     . SER A 1 188 ? -21.687 72.778 -7.533  1.00 16.18  ? 185  SER A C     1 
ATOM   1455 O  O     . SER A 1 188 ? -22.773 72.259 -7.737  1.00 13.49  ? 185  SER A O     1 
ATOM   1456 C  CB    . SER A 1 188 ? -22.418 75.061 -7.122  1.00 20.87  ? 185  SER A CB    1 
ATOM   1457 O  OG    . SER A 1 188 ? -22.237 74.793 -5.703  1.00 21.97  ? 185  SER A OG    1 
ATOM   1458 N  N     . PRO A 1 189 ? -20.648 72.127 -7.009  1.00 13.90  ? 186  PRO A N     1 
ATOM   1459 C  CA    . PRO A 1 189 ? -20.747 70.715 -6.583  1.00 13.11  ? 186  PRO A CA    1 
ATOM   1460 C  C     . PRO A 1 189 ? -21.852 70.444 -5.608  1.00 12.15  ? 186  PRO A C     1 
ATOM   1461 O  O     . PRO A 1 189 ? -22.486 69.393 -5.714  1.00 12.46  ? 186  PRO A O     1 
ATOM   1462 C  CB    . PRO A 1 189 ? -19.393 70.434 -5.985  1.00 12.83  ? 186  PRO A CB    1 
ATOM   1463 C  CG    . PRO A 1 189 ? -18.493 71.302 -6.851  1.00 13.79  ? 186  PRO A CG    1 
ATOM   1464 C  CD    . PRO A 1 189 ? -19.241 72.578 -7.061  1.00 13.71  ? 186  PRO A CD    1 
ATOM   1465 N  N     . ASP A 1 190 ? -21.994 71.341 -4.638  1.00 12.37  ? 187  ASP A N     1 
ATOM   1466 C  CA    . ASP A 1 190 ? -22.981 71.213 -3.604  1.00 12.54  ? 187  ASP A CA    1 
ATOM   1467 C  C     . ASP A 1 190 ? -24.387 71.243 -4.174  1.00 12.76  ? 187  ASP A C     1 
ATOM   1468 O  O     . ASP A 1 190 ? -25.227 70.530 -3.700  1.00 12.68  ? 187  ASP A O     1 
ATOM   1469 C  CB    . ASP A 1 190 ? -22.861 72.304 -2.560  1.00 13.09  ? 187  ASP A CB    1 
ATOM   1470 C  CG    . ASP A 1 190 ? -21.685 72.087 -1.617  1.00 14.53  ? 187  ASP A CG    1 
ATOM   1471 O  OD1   . ASP A 1 190 ? -21.040 71.019 -1.653  1.00 12.42  ? 187  ASP A OD1   1 
ATOM   1472 O  OD2   . ASP A 1 190 ? -21.398 73.050 -0.885  1.00 14.84  ? 187  ASP A OD2   1 
ATOM   1473 N  N     . LEU A 1 191 ? -24.609 72.112 -5.151  1.00 12.45  ? 188  LEU A N     1 
ATOM   1474 C  CA    . LEU A 1 191 ? -25.872 72.209 -5.805  1.00 13.56  ? 188  LEU A CA    1 
ATOM   1475 C  C     . LEU A 1 191 ? -26.161 70.946 -6.590  1.00 12.16  ? 188  LEU A C     1 
ATOM   1476 O  O     . LEU A 1 191 ? -27.266 70.482 -6.567  1.00 12.00  ? 188  LEU A O     1 
ATOM   1477 C  CB    . LEU A 1 191 ? -25.917 73.450 -6.732  1.00 15.47  ? 188  LEU A CB    1 
ATOM   1478 C  CG    . LEU A 1 191 ? -27.168 73.554 -7.663  1.00 16.64  ? 188  LEU A CG    1 
ATOM   1479 C  CD1   . LEU A 1 191 ? -28.399 73.665 -6.805  1.00 17.02  ? 188  LEU A CD1   1 
ATOM   1480 C  CD2   . LEU A 1 191 ? -27.014 74.785 -8.567  1.00 18.01  ? 188  LEU A CD2   1 
ATOM   1481 N  N     . GLN A 1 192 ? -25.157 70.417 -7.267  1.00 12.06  ? 189  GLN A N     1 
ATOM   1482 C  CA    . GLN A 1 192 ? -25.274 69.163 -8.027  1.00 12.59  ? 189  GLN A CA    1 
ATOM   1483 C  C     . GLN A 1 192 ? -25.692 67.990 -7.120  1.00 10.96  ? 189  GLN A C     1 
ATOM   1484 O  O     . GLN A 1 192 ? -26.575 67.261 -7.500  1.00 9.91   ? 189  GLN A O     1 
ATOM   1485 C  CB    . GLN A 1 192 ? -23.973 68.882 -8.784  1.00 14.45  ? 189  GLN A CB    1 
ATOM   1486 C  CG    . GLN A 1 192 ? -23.715 69.873 -9.894  1.00 18.90  ? 189  GLN A CG    1 
ATOM   1487 C  CD    . GLN A 1 192 ? -22.319 69.851 -10.466 1.00 23.04  ? 189  GLN A CD    1 
ATOM   1488 O  OE1   . GLN A 1 192 ? -21.399 69.246 -9.960  1.00 25.34  ? 189  GLN A OE1   1 
ATOM   1489 N  NE2   . GLN A 1 192 ? -22.169 70.555 -11.571 1.00 28.86  ? 189  GLN A NE2   1 
ATOM   1490 N  N     . LEU A 1 193 ? -25.069 67.849 -5.921  1.00 10.30  ? 190  LEU A N     1 
ATOM   1491 C  CA    . LEU A 1 193 ? -25.407 66.837 -4.930  1.00 9.04   ? 190  LEU A CA    1 
ATOM   1492 C  C     . LEU A 1 193 ? -26.846 67.009 -4.492  1.00 10.00  ? 190  LEU A C     1 
ATOM   1493 O  O     . LEU A 1 193 ? -27.569 66.043 -4.355  1.00 9.24   ? 190  LEU A O     1 
ATOM   1494 C  CB    . LEU A 1 193 ? -24.474 66.871 -3.723  1.00 8.92   ? 190  LEU A CB    1 
ATOM   1495 C  CG    . LEU A 1 193 ? -23.004 66.507 -3.927  1.00 8.72   ? 190  LEU A CG    1 
ATOM   1496 C  CD1   . LEU A 1 193 ? -22.264 66.575 -2.607  1.00 9.11   ? 190  LEU A CD1   1 
ATOM   1497 C  CD2   . LEU A 1 193 ? -22.895 65.112 -4.525  1.00 8.47   ? 190  LEU A CD2   1 
ATOM   1498 N  N     . THR A 1 194 ? -27.280 68.263 -4.332  1.00 10.55  ? 191  THR A N     1 
ATOM   1499 C  CA    . THR A 1 194 ? -28.621 68.569 -3.863  1.00 10.43  ? 191  THR A CA    1 
ATOM   1500 C  C     . THR A 1 194 ? -29.669 68.079 -4.849  1.00 11.64  ? 191  THR A C     1 
ATOM   1501 O  O     . THR A 1 194 ? -30.682 67.471 -4.453  1.00 11.57  ? 191  THR A O     1 
ATOM   1502 C  CB    . THR A 1 194 ? -28.773 70.075 -3.614  1.00 10.44  ? 191  THR A CB    1 
ATOM   1503 O  OG1   . THR A 1 194 ? -27.770 70.489 -2.677  1.00 9.88   ? 191  THR A OG1   1 
ATOM   1504 C  CG2   . THR A 1 194 ? -30.194 70.350 -3.004  1.00 10.69  ? 191  THR A CG2   1 
ATOM   1505 N  N     . VAL A 1 195 ? -29.410 68.343 -6.128  1.00 12.06  ? 192  VAL A N     1 
ATOM   1506 C  CA    . VAL A 1 195 ? -30.335 67.955 -7.181  1.00 12.34  ? 192  VAL A CA    1 
ATOM   1507 C  C     . VAL A 1 195 ? -30.269 66.456 -7.285  1.00 12.31  ? 192  VAL A C     1 
ATOM   1508 O  O     . VAL A 1 195 ? -31.303 65.836 -7.537  1.00 12.37  ? 192  VAL A O     1 
ATOM   1509 C  CB    . VAL A 1 195 ? -29.926 68.624 -8.529  1.00 12.60  ? 192  VAL A CB    1 
ATOM   1510 C  CG1   . VAL A 1 195 ? -30.646 67.976 -9.740  1.00 12.95  ? 192  VAL A CG1   1 
ATOM   1511 C  CG2   . VAL A 1 195 ? -30.203 70.126 -8.457  1.00 12.32  ? 192  VAL A CG2   1 
ATOM   1512 N  N     . GLY A 1 196 ? -29.067 65.883 -7.190  1.00 11.08  ? 193  GLY A N     1 
ATOM   1513 C  CA    . GLY A 1 196 ? -28.918 64.409 -7.092  1.00 11.03  ? 193  GLY A CA    1 
ATOM   1514 C  C     . GLY A 1 196 ? -29.848 63.801 -6.045  1.00 10.63  ? 193  GLY A C     1 
ATOM   1515 O  O     . GLY A 1 196 ? -30.508 62.791 -6.283  1.00 11.73  ? 193  GLY A O     1 
ATOM   1516 N  N     . ALA A 1 197 ? -29.922 64.441 -4.889  1.00 10.89  ? 194  ALA A N     1 
ATOM   1517 C  CA    . ALA A 1 197 ? -30.747 63.996 -3.783  1.00 10.11  ? 194  ALA A CA    1 
ATOM   1518 C  C     . ALA A 1 197 ? -32.241 64.128 -4.104  1.00 10.19  ? 194  ALA A C     1 
ATOM   1519 O  O     . ALA A 1 197 ? -33.054 63.295 -3.612  1.00 9.31   ? 194  ALA A O     1 
ATOM   1520 C  CB    . ALA A 1 197 ? -30.383 64.708 -2.473  1.00 10.44  ? 194  ALA A CB    1 
ATOM   1521 N  N     . VAL A 1 198 ? -32.594 65.146 -4.879  1.00 9.79   ? 195  VAL A N     1 
ATOM   1522 C  CA    . VAL A 1 198 ? -33.979 65.321 -5.333  1.00 11.04  ? 195  VAL A CA    1 
ATOM   1523 C  C     . VAL A 1 198 ? -34.344 64.152 -6.270  1.00 10.65  ? 195  VAL A C     1 
ATOM   1524 O  O     . VAL A 1 198 ? -35.382 63.510 -6.098  1.00 11.29  ? 195  VAL A O     1 
ATOM   1525 C  CB    . VAL A 1 198 ? -34.201 66.659 -6.020  1.00 11.67  ? 195  VAL A CB    1 
ATOM   1526 C  CG1   . VAL A 1 198 ? -35.583 66.697 -6.770  1.00 12.57  ? 195  VAL A CG1   1 
ATOM   1527 C  CG2   . VAL A 1 198 ? -34.114 67.751 -4.991  1.00 12.08  ? 195  VAL A CG2   1 
ATOM   1528 N  N     . ILE A 1 199 ? -33.448 63.825 -7.173  1.00 9.24   ? 196  ILE A N     1 
ATOM   1529 C  CA    . ILE A 1 199 ? -33.684 62.658 -8.025  1.00 9.86   ? 196  ILE A CA    1 
ATOM   1530 C  C     . ILE A 1 199 ? -33.809 61.333 -7.228  1.00 9.71   ? 196  ILE A C     1 
ATOM   1531 O  O     . ILE A 1 199 ? -34.647 60.492 -7.548  1.00 10.80  ? 196  ILE A O     1 
ATOM   1532 C  CB    . ILE A 1 199 ? -32.613 62.557 -9.097  1.00 9.45   ? 196  ILE A CB    1 
ATOM   1533 C  CG1   . ILE A 1 199 ? -32.746 63.775 -10.019 1.00 9.79   ? 196  ILE A CG1   1 
ATOM   1534 C  CG2   . ILE A 1 199 ? -32.753 61.316 -9.891  1.00 9.59   ? 196  ILE A CG2   1 
ATOM   1535 C  CD1   . ILE A 1 199 ? -31.551 63.947 -10.903 1.00 10.02  ? 196  ILE A CD1   1 
ATOM   1536 N  N     . VAL A 1 200 ? -32.982 61.150 -6.223  1.00 9.12   ? 197  VAL A N     1 
ATOM   1537 C  CA    . VAL A 1 200 ? -32.981 59.923 -5.439  1.00 8.87   ? 197  VAL A CA    1 
ATOM   1538 C  C     . VAL A 1 200 ? -34.244 59.838 -4.602  1.00 9.81   ? 197  VAL A C     1 
ATOM   1539 O  O     . VAL A 1 200 ? -34.805 58.740 -4.515  1.00 10.17  ? 197  VAL A O     1 
ATOM   1540 C  CB    . VAL A 1 200 ? -31.703 59.757 -4.605  1.00 8.07   ? 197  VAL A CB    1 
ATOM   1541 C  CG1   . VAL A 1 200 ? -31.843 58.514 -3.744  1.00 8.05   ? 197  VAL A CG1   1 
ATOM   1542 C  CG2   . VAL A 1 200 ? -30.493 59.577 -5.531  1.00 8.22   ? 197  VAL A CG2   1 
ATOM   1543 N  N     . GLU A 1 201 ? -34.757 60.957 -4.095  1.00 10.08  ? 198  GLU A N     1 
ATOM   1544 C  CA    . GLU A 1 201 ? -36.095 60.970 -3.503  1.00 11.22  ? 198  GLU A CA    1 
ATOM   1545 C  C     . GLU A 1 201 ? -37.149 60.420 -4.448  1.00 11.76  ? 198  GLU A C     1 
ATOM   1546 O  O     . GLU A 1 201 ? -37.979 59.615 -4.047  1.00 11.37  ? 198  GLU A O     1 
ATOM   1547 C  CB    . GLU A 1 201 ? -36.554 62.379 -2.983  1.00 11.78  ? 198  GLU A CB    1 
ATOM   1548 C  CG    . GLU A 1 201 ? -35.729 62.970 -1.823  1.00 11.67  ? 198  GLU A CG    1 
ATOM   1549 C  CD    . GLU A 1 201 ? -36.189 62.597 -0.455  1.00 11.86  ? 198  GLU A CD    1 
ATOM   1550 O  OE1   . GLU A 1 201 ? -37.061 61.684 -0.280  1.00 12.47  ? 198  GLU A OE1   1 
ATOM   1551 O  OE2   . GLU A 1 201 ? -35.612 63.149 0.516   1.00 11.66  ? 198  GLU A OE2   1 
ATOM   1552 N  N     . GLU A 1 202 ? -37.120 60.876 -5.679  1.00 12.51  ? 199  GLU A N     1 
ATOM   1553 C  CA    . GLU A 1 202 ? -38.065 60.421 -6.697  1.00 13.56  ? 199  GLU A CA    1 
ATOM   1554 C  C     . GLU A 1 202 ? -37.845 58.930 -7.009  1.00 13.39  ? 199  GLU A C     1 
ATOM   1555 O  O     . GLU A 1 202 ? -38.806 58.179 -7.181  1.00 13.26  ? 199  GLU A O     1 
ATOM   1556 C  CB    . GLU A 1 202 ? -37.897 61.263 -7.972  1.00 15.71  ? 199  GLU A CB    1 
ATOM   1557 C  CG    . GLU A 1 202 ? -38.301 62.720 -7.785  1.00 17.99  ? 199  GLU A CG    1 
ATOM   1558 C  CD    . GLU A 1 202 ? -37.770 63.666 -8.866  1.00 20.05  ? 199  GLU A CD    1 
ATOM   1559 O  OE1   . GLU A 1 202 ? -38.152 64.852 -8.887  1.00 21.61  ? 199  GLU A OE1   1 
ATOM   1560 O  OE2   . GLU A 1 202 ? -36.987 63.257 -9.711  1.00 22.67  ? 199  GLU A OE2   1 
ATOM   1561 N  N     . MET A 1 203 ? -36.585 58.507 -7.122  1.00 12.97  ? 200  MET A N     1 
ATOM   1562 C  CA    . MET A 1 203 ? -36.296 57.126 -7.383  1.00 13.82  ? 200  MET A CA    1 
ATOM   1563 C  C     . MET A 1 203 ? -36.824 56.230 -6.266  1.00 12.20  ? 200  MET A C     1 
ATOM   1564 O  O     . MET A 1 203 ? -37.455 55.164 -6.519  1.00 11.32  ? 200  MET A O     1 
ATOM   1565 C  CB    . MET A 1 203 ? -34.791 56.965 -7.518  1.00 16.23  ? 200  MET A CB    1 
ATOM   1566 C  CG    . MET A 1 203 ? -34.348 55.604 -7.967  1.00 19.15  ? 200  MET A CG    1 
ATOM   1567 S  SD    . MET A 1 203 ? -32.571 55.422 -8.339  1.00 25.99  ? 200  MET A SD    1 
ATOM   1568 C  CE    . MET A 1 203 ? -32.139 57.071 -8.858  1.00 18.96  ? 200  MET A CE    1 
ATOM   1569 N  N     . ARG A 1 204 ? -36.592 56.653 -5.007  1.00 10.49  ? 201  ARG A N     1 
ATOM   1570 C  CA    . ARG A 1 204 ? -37.003 55.856 -3.865  1.00 10.06  ? 201  ARG A CA    1 
ATOM   1571 C  C     . ARG A 1 204 ? -38.532 55.808 -3.733  1.00 10.10  ? 201  ARG A C     1 
ATOM   1572 O  O     . ARG A 1 204 ? -39.078 54.811 -3.253  1.00 9.71   ? 201  ARG A O     1 
ATOM   1573 C  CB    . ARG A 1 204 ? -36.355 56.401 -2.590  1.00 10.37  ? 201  ARG A CB    1 
ATOM   1574 C  CG    . ARG A 1 204 ? -34.837 56.162 -2.640  1.00 9.94   ? 201  ARG A CG    1 
ATOM   1575 C  CD    . ARG A 1 204 ? -34.131 56.634 -1.386  1.00 10.52  ? 201  ARG A CD    1 
ATOM   1576 N  NE    . ARG A 1 204 ? -34.870 56.275 -0.207  1.00 9.97   ? 201  ARG A NE    1 
ATOM   1577 C  CZ    . ARG A 1 204 ? -35.445 57.099 0.659   1.00 11.21  ? 201  ARG A CZ    1 
ATOM   1578 N  NH1   . ARG A 1 204 ? -36.135 56.572 1.670   1.00 11.60  ? 201  ARG A NH1   1 
ATOM   1579 N  NH2   . ARG A 1 204 ? -35.276 58.409 0.600   1.00 11.33  ? 201  ARG A NH2   1 
ATOM   1580 N  N     . ALA A 1 205 ? -39.219 56.880 -4.166  1.00 9.99   ? 202  ALA A N     1 
ATOM   1581 C  CA    . ALA A 1 205 ? -40.678 56.942 -4.076  1.00 9.72   ? 202  ALA A CA    1 
ATOM   1582 C  C     . ALA A 1 205 ? -41.246 55.970 -5.130  1.00 10.34  ? 202  ALA A C     1 
ATOM   1583 O  O     . ALA A 1 205 ? -42.198 55.268 -4.847  1.00 10.36  ? 202  ALA A O     1 
ATOM   1584 C  CB    . ALA A 1 205 ? -41.199 58.359 -4.295  1.00 10.04  ? 202  ALA A CB    1 
ATOM   1585 N  N     . ALA A 1 206 ? -40.623 55.930 -6.305  1.00 9.46   ? 203  ALA A N     1 
ATOM   1586 C  CA    . ALA A 1 206 ? -41.056 55.042 -7.404  1.00 9.70   ? 203  ALA A CA    1 
ATOM   1587 C  C     . ALA A 1 206 ? -40.885 53.547 -6.978  1.00 9.95   ? 203  ALA A C     1 
ATOM   1588 O  O     . ALA A 1 206 ? -41.782 52.715 -7.179  1.00 10.00  ? 203  ALA A O     1 
ATOM   1589 C  CB    . ALA A 1 206 ? -40.252 55.323 -8.637  1.00 9.24   ? 203  ALA A CB    1 
ATOM   1590 N  N     . ILE A 1 207 ? -39.759 53.224 -6.354  1.00 9.20   ? 204  ILE A N     1 
ATOM   1591 C  CA    . ILE A 1 207 ? -39.532 51.869 -5.878  1.00 9.51   ? 204  ILE A CA    1 
ATOM   1592 C  C     . ILE A 1 207 ? -40.637 51.444 -4.916  1.00 9.49   ? 204  ILE A C     1 
ATOM   1593 O  O     . ILE A 1 207 ? -41.170 50.353 -5.030  1.00 9.06   ? 204  ILE A O     1 
ATOM   1594 C  CB    . ILE A 1 207 ? -38.162 51.741 -5.164  1.00 8.95   ? 204  ILE A CB    1 
ATOM   1595 C  CG1   . ILE A 1 207 ? -37.074 51.896 -6.198  1.00 9.56   ? 204  ILE A CG1   1 
ATOM   1596 C  CG2   . ILE A 1 207 ? -37.976 50.352 -4.557  1.00 9.17   ? 204  ILE A CG2   1 
ATOM   1597 C  CD1   . ILE A 1 207 ? -35.637 51.989 -5.630  1.00 9.34   ? 204  ILE A CD1   1 
ATOM   1598 N  N     . GLU A 1 208 ? -40.896 52.280 -3.908  1.00 10.06  ? 205  GLU A N     1 
ATOM   1599 C  CA    . GLU A 1 208 ? -41.861 51.970 -2.878  1.00 10.44  ? 205  GLU A CA    1 
ATOM   1600 C  C     . GLU A 1 208 ? -43.269 51.881 -3.466  1.00 11.18  ? 205  GLU A C     1 
ATOM   1601 O  O     . GLU A 1 208 ? -43.989 50.969 -3.158  1.00 10.47  ? 205  GLU A O     1 
ATOM   1602 C  CB    . GLU A 1 208 ? -41.912 52.996 -1.777  1.00 11.25  ? 205  GLU A CB    1 
ATOM   1603 C  CG    . GLU A 1 208 ? -42.704 52.469 -0.555  1.00 11.92  ? 205  GLU A CG    1 
ATOM   1604 C  CD    . GLU A 1 208 ? -42.656 53.389 0.647   1.00 12.94  ? 205  GLU A CD    1 
ATOM   1605 O  OE1   . GLU A 1 208 ? -43.141 52.986 1.715   1.00 15.06  ? 205  GLU A OE1   1 
ATOM   1606 O  OE2   . GLU A 1 208 ? -42.109 54.500 0.564   1.00 12.42  ? 205  GLU A OE2   1 
ATOM   1607 N  N     . ARG A 1 209 ? -43.604 52.803 -4.355  1.00 11.76  ? 206  ARG A N     1 
ATOM   1608 C  CA    . ARG A 1 209 ? -44.947 52.810 -5.002  1.00 13.02  ? 206  ARG A CA    1 
ATOM   1609 C  C     . ARG A 1 209 ? -45.128 51.560 -5.805  1.00 11.08  ? 206  ARG A C     1 
ATOM   1610 O  O     . ARG A 1 209 ? -46.185 50.982 -5.742  1.00 10.42  ? 206  ARG A O     1 
ATOM   1611 C  CB    . ARG A 1 209 ? -45.168 54.042 -5.919  1.00 16.21  ? 206  ARG A CB    1 
ATOM   1612 C  CG    . ARG A 1 209 ? -46.598 54.148 -6.523  1.00 21.21  ? 206  ARG A CG    1 
ATOM   1613 C  CD    . ARG A 1 209 ? -46.868 55.216 -7.627  1.00 24.59  ? 206  ARG A CD    1 
ATOM   1614 N  NE    . ARG A 1 209 ? -46.346 54.964 -8.995  1.00 26.93  ? 206  ARG A NE    1 
ATOM   1615 C  CZ    . ARG A 1 209 ? -46.825 54.082 -9.900  1.00 28.12  ? 206  ARG A CZ    1 
ATOM   1616 N  NH1   . ARG A 1 209 ? -46.236 53.958 -11.120 1.00 24.15  ? 206  ARG A NH1   1 
ATOM   1617 N  NH2   . ARG A 1 209 ? -47.834 53.297 -9.586  1.00 26.64  ? 206  ARG A NH2   1 
ATOM   1618 N  N     . GLU A 1 210 ? -44.122 51.189 -6.595  1.00 10.10  ? 207  GLU A N     1 
ATOM   1619 C  CA    . GLU A 1 210 ? -44.252 50.103 -7.529  1.00 9.55   ? 207  GLU A CA    1 
ATOM   1620 C  C     . GLU A 1 210 ? -43.911 48.727 -6.955  1.00 9.29   ? 207  GLU A C     1 
ATOM   1621 O  O     . GLU A 1 210 ? -44.176 47.702 -7.625  1.00 8.63   ? 207  GLU A O     1 
ATOM   1622 C  CB    . GLU A 1 210 ? -43.425 50.413 -8.759  1.00 10.35  ? 207  GLU A CB    1 
ATOM   1623 C  CG    . GLU A 1 210 ? -43.799 51.740 -9.384  1.00 11.32  ? 207  GLU A CG    1 
ATOM   1624 C  CD    . GLU A 1 210 ? -43.064 52.081 -10.673 1.00 12.50  ? 207  GLU A CD    1 
ATOM   1625 O  OE1   . GLU A 1 210 ? -42.580 51.180 -11.385 1.00 13.82  ? 207  GLU A OE1   1 
ATOM   1626 O  OE2   . GLU A 1 210 ? -42.982 53.277 -10.982 1.00 15.05  ? 207  GLU A OE2   1 
ATOM   1627 N  N     . THR A 1 211 ? -43.261 48.650 -5.766  1.00 8.70   ? 208  THR A N     1 
ATOM   1628 C  CA    . THR A 1 211 ? -42.933 47.356 -5.217  1.00 8.85   ? 208  THR A CA    1 
ATOM   1629 C  C     . THR A 1 211 ? -43.439 47.133 -3.824  1.00 8.97   ? 208  THR A C     1 
ATOM   1630 O  O     . THR A 1 211 ? -43.449 45.998 -3.380  1.00 9.02   ? 208  THR A O     1 
ATOM   1631 C  CB    . THR A 1 211 ? -41.433 47.073 -5.225  1.00 8.85   ? 208  THR A CB    1 
ATOM   1632 O  OG1   . THR A 1 211 ? -40.745 47.896 -4.281  1.00 8.89   ? 208  THR A OG1   1 
ATOM   1633 C  CG2   . THR A 1 211 ? -40.860 47.311 -6.596  1.00 9.16   ? 208  THR A CG2   1 
ATOM   1634 N  N     . GLY A 1 212 ? -43.777 48.201 -3.121  1.00 9.51   ? 209  GLY A N     1 
ATOM   1635 C  CA    . GLY A 1 212 ? -43.926 48.157 -1.655  1.00 10.10  ? 209  GLY A CA    1 
ATOM   1636 C  C     . GLY A 1 212 ? -42.626 48.193 -0.848  1.00 10.38  ? 209  GLY A C     1 
ATOM   1637 O  O     . GLY A 1 212 ? -42.698 48.348 0.311   1.00 12.38  ? 209  GLY A O     1 
ATOM   1638 N  N     . PHE A 1 213 ? -41.445 48.166 -1.457  1.00 10.20  ? 210  PHE A N     1 
ATOM   1639 C  CA    . PHE A 1 213 ? -40.190 48.063 -0.718  1.00 9.34   ? 210  PHE A CA    1 
ATOM   1640 C  C     . PHE A 1 213 ? -39.614 49.422 -0.386  1.00 9.75   ? 210  PHE A C     1 
ATOM   1641 O  O     . PHE A 1 213 ? -39.635 50.305 -1.216  1.00 10.42  ? 210  PHE A O     1 
ATOM   1642 C  CB    . PHE A 1 213 ? -39.170 47.208 -1.464  1.00 8.47   ? 210  PHE A CB    1 
ATOM   1643 C  CG    . PHE A 1 213 ? -39.634 45.812 -1.780  1.00 8.21   ? 210  PHE A CG    1 
ATOM   1644 C  CD1   . PHE A 1 213 ? -39.323 45.209 -2.985  1.00 8.11   ? 210  PHE A CD1   1 
ATOM   1645 C  CD2   . PHE A 1 213 ? -40.367 45.039 -0.857  1.00 8.05   ? 210  PHE A CD2   1 
ATOM   1646 C  CE1   . PHE A 1 213 ? -39.753 43.919 -3.288  1.00 7.92   ? 210  PHE A CE1   1 
ATOM   1647 C  CE2   . PHE A 1 213 ? -40.795 43.759 -1.180  1.00 7.80   ? 210  PHE A CE2   1 
ATOM   1648 C  CZ    . PHE A 1 213 ? -40.474 43.196 -2.402  1.00 7.96   ? 210  PHE A CZ    1 
ATOM   1649 N  N     . GLN A 1 214 ? -39.151 49.592 0.859   1.00 8.67   ? 211  GLN A N     1 
ATOM   1650 C  CA    . GLN A 1 214 ? -38.414 50.788 1.258   1.00 8.89   ? 211  GLN A CA    1 
ATOM   1651 C  C     . GLN A 1 214 ? -36.897 50.583 1.199   1.00 8.20   ? 211  GLN A C     1 
ATOM   1652 O  O     . GLN A 1 214 ? -36.371 49.418 1.310   1.00 7.18   ? 211  GLN A O     1 
ATOM   1653 C  CB    . GLN A 1 214 ? -38.816 51.153 2.695   1.00 9.97   ? 211  GLN A CB    1 
ATOM   1654 C  CG    . GLN A 1 214 ? -40.190 51.868 2.739   1.00 11.42  ? 211  GLN A CG    1 
ATOM   1655 C  CD    . GLN A 1 214 ? -40.663 52.144 4.185   1.00 12.40  ? 211  GLN A CD    1 
ATOM   1656 O  OE1   . GLN A 1 214 ? -39.960 51.877 5.167   1.00 11.44  ? 211  GLN A OE1   1 
ATOM   1657 N  NE2   . GLN A 1 214 ? -41.877 52.706 4.302   1.00 13.36  ? 211  GLN A NE2   1 
ATOM   1658 N  N     . CYS A 1 215 ? -36.188 51.677 1.073   1.00 7.98   ? 212  CYS A N     1 
ATOM   1659 C  CA    . CYS A 1 215 ? -34.710 51.649 1.042   1.00 8.52   ? 212  CYS A CA    1 
ATOM   1660 C  C     . CYS A 1 215 ? -34.104 52.911 1.648   1.00 8.56   ? 212  CYS A C     1 
ATOM   1661 O  O     . CYS A 1 215 ? -34.777 53.954 1.841   1.00 8.35   ? 212  CYS A O     1 
ATOM   1662 C  CB    . CYS A 1 215 ? -34.207 51.507 -0.391  1.00 9.16   ? 212  CYS A CB    1 
ATOM   1663 S  SG    . CYS A 1 215 ? -34.749 52.818 -1.472  1.00 11.22  ? 212  CYS A SG    1 
ATOM   1664 N  N     . SER A 1 216 ? -32.811 52.820 1.876   1.00 8.49   ? 213  SER A N     1 
ATOM   1665 C  CA    . SER A 1 216 ? -31.980 53.971 2.250   1.00 8.57   ? 213  SER A CA    1 
ATOM   1666 C  C     . SER A 1 216 ? -31.048 54.274 1.087   1.00 8.36   ? 213  SER A C     1 
ATOM   1667 O  O     . SER A 1 216 ? -30.882 53.481 0.166   1.00 8.93   ? 213  SER A O     1 
ATOM   1668 C  CB    . SER A 1 216 ? -31.265 53.666 3.531   1.00 8.58   ? 213  SER A CB    1 
ATOM   1669 O  OG    . SER A 1 216 ? -32.259 53.392 4.537   1.00 8.56   ? 213  SER A OG    1 
ATOM   1670 N  N     . ALA A 1 217 ? -30.477 55.465 1.110   1.00 7.55   ? 214  ALA A N     1 
ATOM   1671 C  CA    . ALA A 1 217 ? -29.576 55.898 0.055   1.00 7.17   ? 214  ALA A CA    1 
ATOM   1672 C  C     . ALA A 1 217 ? -28.546 56.893 0.562   1.00 7.60   ? 214  ALA A C     1 
ATOM   1673 O  O     . ALA A 1 217 ? -28.784 57.585 1.539   1.00 7.16   ? 214  ALA A O     1 
ATOM   1674 C  CB    . ALA A 1 217 ? -30.314 56.468 -1.122  1.00 7.32   ? 214  ALA A CB    1 
ATOM   1675 N  N     . GLY A 1 218 ? -27.377 56.843 -0.063  1.00 7.76   ? 215  GLY A N     1 
ATOM   1676 C  CA    . GLY A 1 218 ? -26.351 57.845 0.127   1.00 7.64   ? 215  GLY A CA    1 
ATOM   1677 C  C     . GLY A 1 218 ? -26.064 58.560 -1.159  1.00 7.33   ? 215  GLY A C     1 
ATOM   1678 O  O     . GLY A 1 218 ? -26.144 57.947 -2.228  1.00 7.82   ? 215  GLY A O     1 
ATOM   1679 N  N     . ILE A 1 219 ? -25.817 59.866 -1.076  1.00 7.05   ? 216  ILE A N     1 
ATOM   1680 C  CA    . ILE A 1 219 ? -25.507 60.688 -2.237  1.00 7.15   ? 216  ILE A CA    1 
ATOM   1681 C  C     . ILE A 1 219 ? -24.264 61.478 -1.963  1.00 7.50   ? 216  ILE A C     1 
ATOM   1682 O  O     . ILE A 1 219 ? -24.216 62.229 -0.989  1.00 7.33   ? 216  ILE A O     1 
ATOM   1683 C  CB    . ILE A 1 219 ? -26.689 61.692 -2.558  1.00 7.31   ? 216  ILE A CB    1 
ATOM   1684 C  CG1   . ILE A 1 219 ? -28.077 60.969 -2.686  1.00 7.41   ? 216  ILE A CG1   1 
ATOM   1685 C  CG2   . ILE A 1 219 ? -26.345 62.504 -3.796  1.00 7.26   ? 216  ILE A CG2   1 
ATOM   1686 C  CD1   . ILE A 1 219 ? -28.982 60.941 -1.457  1.00 7.41   ? 216  ILE A CD1   1 
ATOM   1687 N  N     . SER A 1 220 ? -23.241 61.282 -2.789  1.00 7.92   ? 217  SER A N     1 
ATOM   1688 C  CA    . SER A 1 220 ? -21.995 62.009 -2.683  1.00 7.80   ? 217  SER A CA    1 
ATOM   1689 C  C     . SER A 1 220 ? -21.320 62.077 -4.033  1.00 7.98   ? 217  SER A C     1 
ATOM   1690 O  O     . SER A 1 220 ? -22.006 61.947 -5.102  1.00 7.53   ? 217  SER A O     1 
ATOM   1691 C  CB    . SER A 1 220 ? -21.145 61.385 -1.610  1.00 8.18   ? 217  SER A CB    1 
ATOM   1692 O  OG    . SER A 1 220 ? -20.083 62.231 -1.215  1.00 8.15   ? 217  SER A OG    1 
ATOM   1693 N  N     . HIS A 1 221 ? -19.990 62.283 -4.025  1.00 7.63   ? 218  HIS A N     1 
ATOM   1694 C  CA    . HIS A 1 221 ? -19.259 62.465 -5.235  1.00 8.22   ? 218  HIS A CA    1 
ATOM   1695 C  C     . HIS A 1 221 ? -18.585 61.212 -5.746  1.00 8.43   ? 218  HIS A C     1 
ATOM   1696 O  O     . HIS A 1 221 ? -18.016 61.199 -6.819  1.00 7.97   ? 218  HIS A O     1 
ATOM   1697 C  CB    . HIS A 1 221 ? -18.197 63.548 -5.036  1.00 8.32   ? 218  HIS A CB    1 
ATOM   1698 C  CG    . HIS A 1 221 ? -18.763 64.906 -4.930  1.00 8.86   ? 218  HIS A CG    1 
ATOM   1699 N  ND1   . HIS A 1 221 ? -19.423 65.497 -5.979  1.00 8.86   ? 218  HIS A ND1   1 
ATOM   1700 C  CD2   . HIS A 1 221 ? -18.762 65.799 -3.914  1.00 9.05   ? 218  HIS A CD2   1 
ATOM   1701 C  CE1   . HIS A 1 221 ? -19.843 66.682 -5.603  1.00 9.15   ? 218  HIS A CE1   1 
ATOM   1702 N  NE2   . HIS A 1 221 ? -19.420 66.900 -4.374  1.00 9.44   ? 218  HIS A NE2   1 
ATOM   1703 N  N     . ASN A 1 222 ? -18.599 60.149 -4.967  1.00 8.71   ? 219  ASN A N     1 
ATOM   1704 C  CA    . ASN A 1 222 ? -18.005 58.887 -5.467  1.00 8.92   ? 219  ASN A CA    1 
ATOM   1705 C  C     . ASN A 1 222 ? -18.643 57.703 -4.712  1.00 9.41   ? 219  ASN A C     1 
ATOM   1706 O  O     . ASN A 1 222 ? -19.413 57.945 -3.762  1.00 9.44   ? 219  ASN A O     1 
ATOM   1707 C  CB    . ASN A 1 222 ? -16.478 58.915 -5.209  1.00 9.08   ? 219  ASN A CB    1 
ATOM   1708 C  CG    . ASN A 1 222 ? -16.136 59.269 -3.744  1.00 9.39   ? 219  ASN A CG    1 
ATOM   1709 O  OD1   . ASN A 1 222 ? -16.462 58.521 -2.807  1.00 8.95   ? 219  ASN A OD1   1 
ATOM   1710 N  ND2   . ASN A 1 222 ? -15.486 60.434 -3.547  1.00 8.94   ? 219  ASN A ND2   1 
ATOM   1711 N  N     . LYS A 1 223 ? -18.306 56.468 -5.095  1.00 9.66   ? 220  LYS A N     1 
ATOM   1712 C  CA    . LYS A 1 223 ? -18.978 55.291 -4.556  1.00 10.75  ? 220  LYS A CA    1 
ATOM   1713 C  C     . LYS A 1 223 ? -18.735 55.116 -3.058  1.00 10.80  ? 220  LYS A C     1 
ATOM   1714 O  O     . LYS A 1 223 ? -19.669 54.760 -2.296  1.00 10.61  ? 220  LYS A O     1 
ATOM   1715 C  CB    . LYS A 1 223 ? -18.515 54.030 -5.326  1.00 11.97  ? 220  LYS A CB    1 
ATOM   1716 C  CG    . LYS A 1 223 ? -18.964 54.013 -6.772  1.00 12.85  ? 220  LYS A CG    1 
ATOM   1717 C  CD    . LYS A 1 223 ? -18.151 53.053 -7.633  1.00 14.33  ? 220  LYS A CD    1 
ATOM   1718 C  CE    . LYS A 1 223 ? -18.765 51.740 -7.645  1.00 14.88  ? 220  LYS A CE    1 
ATOM   1719 N  NZ    . LYS A 1 223 ? -17.993 50.712 -8.378  1.00 16.27  ? 220  LYS A NZ    1 
ATOM   1720 N  N     . VAL A 1 224 ? -17.467 55.248 -2.660  1.00 10.64  ? 221  VAL A N     1 
ATOM   1721 C  CA    . VAL A 1 224 ? -17.117 55.104 -1.246  1.00 10.98  ? 221  VAL A CA    1 
ATOM   1722 C  C     . VAL A 1 224 ? -17.870 56.037 -0.306  1.00 10.51  ? 221  VAL A C     1 
ATOM   1723 O  O     . VAL A 1 224 ? -18.449 55.589 0.710   1.00 10.95  ? 221  VAL A O     1 
ATOM   1724 C  CB    . VAL A 1 224 ? -15.631 55.168 -0.988  1.00 11.38  ? 221  VAL A CB    1 
ATOM   1725 C  CG1   . VAL A 1 224 ? -15.335 55.233 0.513   1.00 12.50  ? 221  VAL A CG1   1 
ATOM   1726 C  CG2   . VAL A 1 224 ? -14.971 53.935 -1.619  1.00 12.37  ? 221  VAL A CG2   1 
ATOM   1727 N  N     . LEU A 1 225 ? -17.903 57.304 -0.633  1.00 9.28   ? 222  LEU A N     1 
ATOM   1728 C  CA    . LEU A 1 225 ? -18.674 58.242 0.175   1.00 8.78   ? 222  LEU A CA    1 
ATOM   1729 C  C     . LEU A 1 225 ? -20.198 57.964 0.058   1.00 8.75   ? 222  LEU A C     1 
ATOM   1730 O  O     . LEU A 1 225 ? -20.941 58.074 1.067   1.00 8.29   ? 222  LEU A O     1 
ATOM   1731 C  CB    . LEU A 1 225 ? -18.387 59.701 -0.168  1.00 8.81   ? 222  LEU A CB    1 
ATOM   1732 C  CG    . LEU A 1 225 ? -16.941 60.222 0.132   1.00 9.05   ? 222  LEU A CG    1 
ATOM   1733 C  CD1   . LEU A 1 225 ? -16.832 61.681 -0.246  1.00 9.49   ? 222  LEU A CD1   1 
ATOM   1734 C  CD2   . LEU A 1 225 ? -16.537 60.024 1.582   1.00 9.33   ? 222  LEU A CD2   1 
ATOM   1735 N  N     . ALA A 1 226 ? -20.638 57.563 -1.119  1.00 8.14   ? 223  ALA A N     1 
ATOM   1736 C  CA    . ALA A 1 226 ? -22.054 57.246 -1.271  1.00 9.11   ? 223  ALA A CA    1 
ATOM   1737 C  C     . ALA A 1 226 ? -22.470 56.093 -0.373  1.00 9.08   ? 223  ALA A C     1 
ATOM   1738 O  O     . ALA A 1 226 ? -23.485 56.158 0.293   1.00 8.78   ? 223  ALA A O     1 
ATOM   1739 C  CB    . ALA A 1 226 ? -22.353 56.966 -2.726  1.00 9.44   ? 223  ALA A CB    1 
ATOM   1740 N  N     . LYS A 1 227 ? -21.646 55.046 -0.347  1.00 9.21   ? 224  LYS A N     1 
ATOM   1741 C  CA    . LYS A 1 227 ? -21.903 53.888 0.499   1.00 9.53   ? 224  LYS A CA    1 
ATOM   1742 C  C     . LYS A 1 227 ? -21.834 54.267 1.972   1.00 9.39   ? 224  LYS A C     1 
ATOM   1743 O  O     . LYS A 1 227 ? -22.735 53.888 2.744   1.00 9.31   ? 224  LYS A O     1 
ATOM   1744 C  CB    . LYS A 1 227 ? -20.900 52.787 0.149   1.00 9.98   ? 224  LYS A CB    1 
ATOM   1745 C  CG    A LYS A 1 227 ? -20.774 51.647 1.159   0.53 10.54  ? 224  LYS A CG    1 
ATOM   1746 C  CG    B LYS A 1 227 ? -20.911 51.565 1.059   0.47 10.46  ? 224  LYS A CG    1 
ATOM   1747 C  CD    A LYS A 1 227 ? -22.059 50.910 1.430   0.53 11.02  ? 224  LYS A CD    1 
ATOM   1748 C  CD    B LYS A 1 227 ? -22.226 50.839 0.936   0.47 10.93  ? 224  LYS A CD    1 
ATOM   1749 C  CE    A LYS A 1 227 ? -21.921 49.813 2.497   0.53 11.03  ? 224  LYS A CE    1 
ATOM   1750 C  CE    B LYS A 1 227 ? -22.171 49.410 1.475   0.47 10.90  ? 224  LYS A CE    1 
ATOM   1751 N  NZ    A LYS A 1 227 ? -20.910 48.792 2.140   0.53 10.76  ? 224  LYS A NZ    1 
ATOM   1752 N  NZ    B LYS A 1 227 ? -23.456 49.018 2.127   0.47 10.82  ? 224  LYS A NZ    1 
ATOM   1753 N  N     . LEU A 1 228 ? -20.808 55.029 2.361   1.00 8.99   ? 225  LEU A N     1 
ATOM   1754 C  CA    . LEU A 1 228 ? -20.682 55.508 3.739   1.00 9.74   ? 225  LEU A CA    1 
ATOM   1755 C  C     . LEU A 1 228 ? -21.921 56.283 4.144   1.00 9.38   ? 225  LEU A C     1 
ATOM   1756 O  O     . LEU A 1 228 ? -22.493 56.048 5.209   1.00 10.04  ? 225  LEU A O     1 
ATOM   1757 C  CB    . LEU A 1 228 ? -19.416 56.353 3.954   1.00 10.42  ? 225  LEU A CB    1 
ATOM   1758 C  CG    . LEU A 1 228 ? -18.991 56.776 5.364   1.00 11.61  ? 225  LEU A CG    1 
ATOM   1759 C  CD1   . LEU A 1 228 ? -18.745 55.551 6.232   1.00 11.91  ? 225  LEU A CD1   1 
ATOM   1760 C  CD2   . LEU A 1 228 ? -17.754 57.665 5.342   1.00 12.04  ? 225  LEU A CD2   1 
ATOM   1761 N  N     . ALA A 1 229 ? -22.278 57.247 3.341   1.00 8.70   ? 226  ALA A N     1 
ATOM   1762 C  CA    . ALA A 1 229 ? -23.443 58.084 3.565   1.00 8.85   ? 226  ALA A CA    1 
ATOM   1763 C  C     . ALA A 1 229 ? -24.728 57.279 3.752   1.00 9.59   ? 226  ALA A C     1 
ATOM   1764 O  O     . ALA A 1 229 ? -25.526 57.588 4.666   1.00 10.31  ? 226  ALA A O     1 
ATOM   1765 C  CB    . ALA A 1 229 ? -23.635 59.056 2.411   1.00 8.38   ? 226  ALA A CB    1 
ATOM   1766 N  N     . CYS A 1 230 ? -24.945 56.293 2.879   1.00 9.70   ? 227  CYS A N     1 
ATOM   1767 C  CA    . CYS A 1 230 ? -26.133 55.435 2.972   1.00 9.74   ? 227  CYS A CA    1 
ATOM   1768 C  C     . CYS A 1 230 ? -26.397 54.855 4.357   1.00 10.11  ? 227  CYS A C     1 
ATOM   1769 O  O     . CYS A 1 230 ? -27.537 54.849 4.816   1.00 10.11  ? 227  CYS A O     1 
ATOM   1770 C  CB    . CYS A 1 230 ? -26.022 54.270 2.001   1.00 10.10  ? 227  CYS A CB    1 
ATOM   1771 S  SG    . CYS A 1 230 ? -27.579 53.379 1.803   1.00 10.35  ? 227  CYS A SG    1 
ATOM   1772 N  N     . GLY A 1 231 ? -25.332 54.387 5.018   1.00 10.05  ? 228  GLY A N     1 
ATOM   1773 C  CA    . GLY A 1 231 ? -25.422 53.737 6.334   1.00 10.12  ? 228  GLY A CA    1 
ATOM   1774 C  C     . GLY A 1 231 ? -25.664 54.718 7.498   1.00 11.12  ? 228  GLY A C     1 
ATOM   1775 O  O     . GLY A 1 231 ? -25.856 54.284 8.599   1.00 10.12  ? 228  GLY A O     1 
ATOM   1776 N  N     . LEU A 1 232 ? -25.624 56.024 7.277   1.00 11.16  ? 229  LEU A N     1 
ATOM   1777 C  CA    . LEU A 1 232 ? -25.631 56.965 8.373   1.00 11.38  ? 229  LEU A CA    1 
ATOM   1778 C  C     . LEU A 1 232 ? -27.024 57.191 8.955   1.00 12.33  ? 229  LEU A C     1 
ATOM   1779 O  O     . LEU A 1 232 ? -27.112 57.601 10.085  1.00 10.88  ? 229  LEU A O     1 
ATOM   1780 C  CB    . LEU A 1 232 ? -25.041 58.331 7.986   1.00 12.00  ? 229  LEU A CB    1 
ATOM   1781 C  CG    . LEU A 1 232 ? -23.561 58.356 7.633   1.00 12.44  ? 229  LEU A CG    1 
ATOM   1782 C  CD1   . LEU A 1 232 ? -23.099 59.700 7.149   1.00 13.38  ? 229  LEU A CD1   1 
ATOM   1783 C  CD2   . LEU A 1 232 ? -22.636 57.888 8.737   1.00 13.71  ? 229  LEU A CD2   1 
ATOM   1784 N  N     . ASN A 1 233 ? -28.094 57.011 8.173   1.00 12.19  ? 230  ASN A N     1 
ATOM   1785 C  CA    . ASN A 1 233 ? -29.455 57.262 8.648   1.00 13.69  ? 230  ASN A CA    1 
ATOM   1786 C  C     . ASN A 1 233 ? -30.354 56.212 7.981   1.00 14.49  ? 230  ASN A C     1 
ATOM   1787 O  O     . ASN A 1 233 ? -30.795 56.376 6.854   1.00 17.38  ? 230  ASN A O     1 
ATOM   1788 C  CB    . ASN A 1 233 ? -29.919 58.671 8.255   1.00 12.82  ? 230  ASN A CB    1 
ATOM   1789 C  CG    . ASN A 1 233 ? -29.126 59.759 8.937   1.00 12.44  ? 230  ASN A CG    1 
ATOM   1790 O  OD1   . ASN A 1 233 ? -29.372 60.032 10.099  1.00 13.00  ? 230  ASN A OD1   1 
ATOM   1791 N  ND2   . ASN A 1 233 ? -28.232 60.399 8.228   1.00 10.51  ? 230  ASN A ND2   1 
ATOM   1792 N  N     . LYS A 1 234 ? -30.572 55.126 8.681   1.00 15.81  ? 231  LYS A N     1 
ATOM   1793 C  CA    . LYS A 1 234 ? -31.385 54.017 8.211   1.00 16.87  ? 231  LYS A CA    1 
ATOM   1794 C  C     . LYS A 1 234 ? -32.402 53.734 9.286   1.00 16.07  ? 231  LYS A C     1 
ATOM   1795 O  O     . LYS A 1 234 ? -32.129 54.069 10.403  1.00 17.32  ? 231  LYS A O     1 
ATOM   1796 C  CB    . LYS A 1 234 ? -30.521 52.791 8.041   1.00 19.07  ? 231  LYS A CB    1 
ATOM   1797 C  CG    . LYS A 1 234 ? -29.574 52.863 6.865   1.00 22.11  ? 231  LYS A CG    1 
ATOM   1798 C  CD    . LYS A 1 234 ? -28.893 51.499 6.707   1.00 25.27  ? 231  LYS A CD    1 
ATOM   1799 C  CE    . LYS A 1 234 ? -28.405 51.295 5.305   1.00 28.94  ? 231  LYS A CE    1 
ATOM   1800 N  NZ    . LYS A 1 234 ? -28.107 49.858 5.136   1.00 30.56  ? 231  LYS A NZ    1 
ATOM   1801 N  N     . PRO A 1 235 ? -33.537 53.110 8.993   1.00 13.23  ? 232  PRO A N     1 
ATOM   1802 C  CA    . PRO A 1 235 ? -34.028 52.784 7.632   1.00 13.01  ? 232  PRO A CA    1 
ATOM   1803 C  C     . PRO A 1 235 ? -34.842 53.922 6.984   1.00 11.99  ? 232  PRO A C     1 
ATOM   1804 O  O     . PRO A 1 235 ? -35.226 54.938 7.638   1.00 12.07  ? 232  PRO A O     1 
ATOM   1805 C  CB    . PRO A 1 235 ? -35.009 51.627 7.921   1.00 13.16  ? 232  PRO A CB    1 
ATOM   1806 C  CG    . PRO A 1 235 ? -35.647 52.068 9.236   1.00 13.14  ? 232  PRO A CG    1 
ATOM   1807 C  CD    . PRO A 1 235 ? -34.480 52.651 10.028  1.00 14.35  ? 232  PRO A CD    1 
ATOM   1808 N  N     . ASN A 1 236 ? -35.209 53.706 5.729   1.00 10.65  ? 233  ASN A N     1 
ATOM   1809 C  CA    . ASN A 1 236 ? -36.130 54.564 5.047   1.00 10.82  ? 233  ASN A CA    1 
ATOM   1810 C  C     . ASN A 1 236 ? -35.709 56.052 4.951   1.00 10.30  ? 233  ASN A C     1 
ATOM   1811 O  O     . ASN A 1 236 ? -36.550 56.904 4.955   1.00 11.81  ? 233  ASN A O     1 
ATOM   1812 C  CB    . ASN A 1 236 ? -37.549 54.447 5.635   1.00 10.52  ? 233  ASN A CB    1 
ATOM   1813 C  CG    . ASN A 1 236 ? -38.635 54.986 4.666   1.00 11.13  ? 233  ASN A CG    1 
ATOM   1814 O  OD1   . ASN A 1 236 ? -38.519 54.849 3.473   1.00 10.75  ? 233  ASN A OD1   1 
ATOM   1815 N  ND2   . ASN A 1 236 ? -39.636 55.654 5.201   1.00 11.05  ? 233  ASN A ND2   1 
ATOM   1816 N  N     . ARG A 1 237 ? -34.425 56.345 4.886   1.00 9.89   ? 234  ARG A N     1 
ATOM   1817 C  CA    . ARG A 1 237 ? -33.944 57.724 4.851   1.00 11.30  ? 234  ARG A CA    1 
ATOM   1818 C  C     . ARG A 1 237 ? -32.803 57.830 3.878   1.00 10.41  ? 234  ARG A C     1 
ATOM   1819 O  O     . ARG A 1 237 ? -32.195 56.822 3.518   1.00 10.39  ? 234  ARG A O     1 
ATOM   1820 C  CB    . ARG A 1 237 ? -33.448 58.201 6.228   1.00 12.84  ? 234  ARG A CB    1 
ATOM   1821 C  CG    . ARG A 1 237 ? -34.531 58.325 7.316   1.00 14.45  ? 234  ARG A CG    1 
ATOM   1822 C  CD    . ARG A 1 237 ? -35.481 59.424 6.943   1.00 18.73  ? 234  ARG A CD    1 
ATOM   1823 N  NE    . ARG A 1 237 ? -36.567 59.661 7.928   1.00 21.79  ? 234  ARG A NE    1 
ATOM   1824 C  CZ    . ARG A 1 237 ? -37.765 59.060 7.922   1.00 25.06  ? 234  ARG A CZ    1 
ATOM   1825 N  NH1   . ARG A 1 237 ? -38.089 58.146 7.022   1.00 22.49  ? 234  ARG A NH1   1 
ATOM   1826 N  NH2   . ARG A 1 237 ? -38.656 59.373 8.860   1.00 29.15  ? 234  ARG A NH2   1 
ATOM   1827 N  N     . GLN A 1 238 ? -32.441 59.041 3.484   1.00 9.74   ? 235  GLN A N     1 
ATOM   1828 C  CA    . GLN A 1 238 ? -31.258 59.191 2.632   1.00 9.68   ? 235  GLN A CA    1 
ATOM   1829 C  C     . GLN A 1 238 ? -30.346 60.315 3.149   1.00 9.77   ? 235  GLN A C     1 
ATOM   1830 O  O     . GLN A 1 238 ? -30.844 61.251 3.800   1.00 11.33  ? 235  GLN A O     1 
ATOM   1831 C  CB    . GLN A 1 238 ? -31.649 59.430 1.187   1.00 8.86   ? 235  GLN A CB    1 
ATOM   1832 C  CG    . GLN A 1 238 ? -32.404 60.697 0.935   1.00 9.18   ? 235  GLN A CG    1 
ATOM   1833 C  CD    . GLN A 1 238 ? -32.852 60.867 -0.503  1.00 9.41   ? 235  GLN A CD    1 
ATOM   1834 O  OE1   . GLN A 1 238 ? -33.556 60.024 -1.025  1.00 10.97  ? 235  GLN A OE1   1 
ATOM   1835 N  NE2   . GLN A 1 238 ? -32.472 61.926 -1.121  1.00 9.29   ? 235  GLN A NE2   1 
ATOM   1836 N  N     . THR A 1 239 ? -29.049 60.174 2.900   1.00 9.08   ? 236  THR A N     1 
ATOM   1837 C  CA    . THR A 1 239 ? -28.053 61.055 3.456   1.00 9.22   ? 236  THR A CA    1 
ATOM   1838 C  C     . THR A 1 239 ? -27.166 61.636 2.311   1.00 9.38   ? 236  THR A C     1 
ATOM   1839 O  O     . THR A 1 239 ? -26.655 60.899 1.475   1.00 9.37   ? 236  THR A O     1 
ATOM   1840 C  CB    . THR A 1 239 ? -27.203 60.357 4.503   1.00 9.58   ? 236  THR A CB    1 
ATOM   1841 O  OG1   . THR A 1 239 ? -28.042 59.692 5.469   1.00 9.38   ? 236  THR A OG1   1 
ATOM   1842 C  CG2   . THR A 1 239 ? -26.343 61.346 5.273   1.00 10.22  ? 236  THR A CG2   1 
ATOM   1843 N  N     . LEU A 1 240 ? -26.959 62.945 2.339   1.00 9.29   ? 237  LEU A N     1 
ATOM   1844 C  CA    . LEU A 1 240 ? -26.065 63.656 1.446   1.00 9.40   ? 237  LEU A CA    1 
ATOM   1845 C  C     . LEU A 1 240 ? -24.764 63.987 2.205   1.00 9.25   ? 237  LEU A C     1 
ATOM   1846 O  O     . LEU A 1 240 ? -24.805 64.659 3.264   1.00 8.45   ? 237  LEU A O     1 
ATOM   1847 C  CB    . LEU A 1 240 ? -26.758 64.904 0.927   1.00 9.82   ? 237  LEU A CB    1 
ATOM   1848 C  CG    . LEU A 1 240 ? -26.083 65.789 -0.094  1.00 10.76  ? 237  LEU A CG    1 
ATOM   1849 C  CD1   . LEU A 1 240 ? -27.135 66.709 -0.716  1.00 11.06  ? 237  LEU A CD1   1 
ATOM   1850 C  CD2   . LEU A 1 240 ? -24.876 66.611 0.473   1.00 11.62  ? 237  LEU A CD2   1 
ATOM   1851 N  N     . VAL A 1 241 ? -23.653 63.452 1.687   1.00 9.17   ? 238  VAL A N     1 
ATOM   1852 C  CA    . VAL A 1 241 ? -22.333 63.757 2.202   1.00 9.45   ? 238  VAL A CA    1 
ATOM   1853 C  C     . VAL A 1 241 ? -21.593 64.638 1.203   1.00 9.70   ? 238  VAL A C     1 
ATOM   1854 O  O     . VAL A 1 241 ? -21.213 64.193 0.103   1.00 9.14   ? 238  VAL A O     1 
ATOM   1855 C  CB    . VAL A 1 241 ? -21.591 62.469 2.490   1.00 9.16   ? 238  VAL A CB    1 
ATOM   1856 C  CG1   . VAL A 1 241 ? -20.126 62.705 2.711   1.00 8.97   ? 238  VAL A CG1   1 
ATOM   1857 C  CG2   . VAL A 1 241 ? -22.234 61.833 3.699   1.00 9.25   ? 238  VAL A CG2   1 
ATOM   1858 N  N     . SER A 1 242 ? -21.411 65.899 1.583   1.00 9.43   ? 239  SER A N     1 
ATOM   1859 C  CA    . SER A 1 242 ? -20.756 66.852 0.710   1.00 9.64   ? 239  SER A CA    1 
ATOM   1860 C  C     . SER A 1 242 ? -19.267 66.697 0.843   1.00 9.32   ? 239  SER A C     1 
ATOM   1861 O  O     . SER A 1 242 ? -18.763 66.122 1.794   1.00 8.34   ? 239  SER A O     1 
ATOM   1862 C  CB    . SER A 1 242 ? -21.136 68.317 1.052   1.00 10.41  ? 239  SER A CB    1 
ATOM   1863 O  OG    . SER A 1 242 ? -20.689 68.566 2.373   1.00 9.83   ? 239  SER A OG    1 
ATOM   1864 N  N     . HIS A 1 243 ? -18.555 67.285 -0.090  1.00 9.87   ? 240  HIS A N     1 
ATOM   1865 C  CA    . HIS A 1 243 ? -17.099 67.322 -0.009  1.00 9.96   ? 240  HIS A CA    1 
ATOM   1866 C  C     . HIS A 1 243 ? -16.597 68.017 1.268   1.00 9.93   ? 240  HIS A C     1 
ATOM   1867 O  O     . HIS A 1 243 ? -15.687 67.544 1.924   1.00 9.13   ? 240  HIS A O     1 
ATOM   1868 C  CB    . HIS A 1 243 ? -16.486 68.016 -1.230  1.00 10.82  ? 240  HIS A CB    1 
ATOM   1869 C  CG    . HIS A 1 243 ? -14.976 68.078 -1.201  1.00 10.96  ? 240  HIS A CG    1 
ATOM   1870 N  ND1   . HIS A 1 243 ? -14.181 66.983 -1.478  1.00 11.29  ? 240  HIS A ND1   1 
ATOM   1871 C  CD2   . HIS A 1 243 ? -14.126 69.098 -0.948  1.00 11.48  ? 240  HIS A CD2   1 
ATOM   1872 C  CE1   . HIS A 1 243 ? -12.908 67.309 -1.334  1.00 11.01  ? 240  HIS A CE1   1 
ATOM   1873 N  NE2   . HIS A 1 243 ? -12.841 68.604 -1.072  1.00 11.53  ? 240  HIS A NE2   1 
ATOM   1874 N  N     . GLY A 1 244 ? -17.206 69.151 1.571   1.00 9.81   ? 241  GLY A N     1 
ATOM   1875 C  CA    . GLY A 1 244 ? -16.832 69.942 2.702   1.00 9.86   ? 241  GLY A CA    1 
ATOM   1876 C  C     . GLY A 1 244 ? -17.094 69.265 4.006   1.00 9.30   ? 241  GLY A C     1 
ATOM   1877 O  O     . GLY A 1 244 ? -16.430 69.591 4.988   1.00 8.90   ? 241  GLY A O     1 
ATOM   1878 N  N     . SER A 1 245 ? -18.022 68.285 4.016   1.00 9.42   ? 242  SER A N     1 
ATOM   1879 C  CA    . SER A 1 245 ? -18.306 67.474 5.201   1.00 9.42   ? 242  SER A CA    1 
ATOM   1880 C  C     . SER A 1 245 ? -17.241 66.479 5.595   1.00 9.26   ? 242  SER A C     1 
ATOM   1881 O  O     . SER A 1 245 ? -17.222 66.015 6.737   1.00 9.17   ? 242  SER A O     1 
ATOM   1882 C  CB    . SER A 1 245 ? -19.627 66.725 5.087   1.00 9.65   ? 242  SER A CB    1 
ATOM   1883 O  OG    . SER A 1 245 ? -19.554 65.560 4.288   1.00 9.12   ? 242  SER A OG    1 
ATOM   1884 N  N     . VAL A 1 246 ? -16.317 66.199 4.678   1.00 9.27   ? 243  VAL A N     1 
ATOM   1885 C  CA    . VAL A 1 246 ? -15.401 65.077 4.868   1.00 9.73   ? 243  VAL A CA    1 
ATOM   1886 C  C     . VAL A 1 246 ? -14.433 65.221 6.058   1.00 9.70   ? 243  VAL A C     1 
ATOM   1887 O  O     . VAL A 1 246 ? -14.271 64.281 6.852   1.00 8.73   ? 243  VAL A O     1 
ATOM   1888 C  CB    . VAL A 1 246 ? -14.715 64.746 3.536   1.00 10.10  ? 243  VAL A CB    1 
ATOM   1889 C  CG1   . VAL A 1 246 ? -13.506 63.816 3.772   1.00 10.82  ? 243  VAL A CG1   1 
ATOM   1890 C  CG2   . VAL A 1 246 ? -15.779 64.198 2.577   1.00 9.94   ? 243  VAL A CG2   1 
ATOM   1891 N  N     . PRO A 1 247 ? -13.798 66.407 6.214   1.00 10.07  ? 244  PRO A N     1 
ATOM   1892 C  CA    . PRO A 1 247 ? -12.856 66.498 7.324   1.00 9.62   ? 244  PRO A CA    1 
ATOM   1893 C  C     . PRO A 1 247 ? -13.454 66.191 8.689   1.00 9.55   ? 244  PRO A C     1 
ATOM   1894 O  O     . PRO A 1 247 ? -12.838 65.450 9.463   1.00 8.62   ? 244  PRO A O     1 
ATOM   1895 C  CB    . PRO A 1 247 ? -12.320 67.943 7.205   1.00 9.79   ? 244  PRO A CB    1 
ATOM   1896 C  CG    . PRO A 1 247 ? -12.391 68.202 5.712   1.00 10.17  ? 244  PRO A CG    1 
ATOM   1897 C  CD    . PRO A 1 247 ? -13.705 67.581 5.304   1.00 10.11  ? 244  PRO A CD    1 
ATOM   1898 N  N     . GLN A 1 248 ? -14.621 66.755 8.996   1.00 10.01  ? 245  GLN A N     1 
ATOM   1899 C  CA    . GLN A 1 248 ? -15.218 66.447 10.253  1.00 10.78  ? 245  GLN A CA    1 
ATOM   1900 C  C     . GLN A 1 248 ? -15.698 65.002 10.357  1.00 10.07  ? 245  GLN A C     1 
ATOM   1901 O  O     . GLN A 1 248 ? -15.519 64.377 11.417  1.00 8.88   ? 245  GLN A O     1 
ATOM   1902 C  CB    . GLN A 1 248 ? -16.348 67.393 10.575  1.00 13.26  ? 245  GLN A CB    1 
ATOM   1903 C  CG    . GLN A 1 248 ? -15.847 68.814 10.867  1.00 17.42  ? 245  GLN A CG    1 
ATOM   1904 C  CD    . GLN A 1 248 ? -16.556 69.489 12.046  1.00 24.12  ? 245  GLN A CD    1 
ATOM   1905 O  OE1   . GLN A 1 248 ? -17.470 70.379 11.883  1.00 26.51  ? 245  GLN A OE1   1 
ATOM   1906 N  NE2   . GLN A 1 248 ? -16.097 69.120 13.254  1.00 26.57  ? 245  GLN A NE2   1 
ATOM   1907 N  N     . LEU A 1 249 ? -16.363 64.502 9.308   1.00 9.02   ? 246  LEU A N     1 
ATOM   1908 C  CA    . LEU A 1 249 ? -16.889 63.134 9.304   1.00 9.20   ? 246  LEU A CA    1 
ATOM   1909 C  C     . LEU A 1 249 ? -15.750 62.131 9.498   1.00 8.40   ? 246  LEU A C     1 
ATOM   1910 O  O     . LEU A 1 249 ? -15.852 61.194 10.280  1.00 8.08   ? 246  LEU A O     1 
ATOM   1911 C  CB    . LEU A 1 249 ? -17.616 62.864 7.968   1.00 9.88   ? 246  LEU A CB    1 
ATOM   1912 C  CG    . LEU A 1 249 ? -18.169 61.487 7.663   1.00 10.71  ? 246  LEU A CG    1 
ATOM   1913 C  CD1   . LEU A 1 249 ? -19.248 61.128 8.668   1.00 11.33  ? 246  LEU A CD1   1 
ATOM   1914 C  CD2   . LEU A 1 249 ? -18.639 61.274 6.196   1.00 11.44  ? 246  LEU A CD2   1 
ATOM   1915 N  N     . PHE A 1 250 ? -14.655 62.319 8.790   1.00 8.19   ? 247  PHE A N     1 
ATOM   1916 C  CA    . PHE A 1 250 ? -13.509 61.408 8.877   1.00 8.39   ? 247  PHE A CA    1 
ATOM   1917 C  C     . PHE A 1 250 ? -12.671 61.519 10.144  1.00 8.44   ? 247  PHE A C     1 
ATOM   1918 O  O     . PHE A 1 250 ? -11.929 60.586 10.450  1.00 8.21   ? 247  PHE A O     1 
ATOM   1919 C  CB    . PHE A 1 250 ? -12.579 61.559 7.647   1.00 8.26   ? 247  PHE A CB    1 
ATOM   1920 C  CG    . PHE A 1 250 ? -13.084 60.868 6.396   1.00 7.75   ? 247  PHE A CG    1 
ATOM   1921 C  CD1   . PHE A 1 250 ? -12.255 60.774 5.300   1.00 7.96   ? 247  PHE A CD1   1 
ATOM   1922 C  CD2   . PHE A 1 250 ? -14.343 60.255 6.330   1.00 8.21   ? 247  PHE A CD2   1 
ATOM   1923 C  CE1   . PHE A 1 250 ? -12.648 60.099 4.163   1.00 8.16   ? 247  PHE A CE1   1 
ATOM   1924 C  CE2   . PHE A 1 250 ? -14.771 59.590 5.176   1.00 7.87   ? 247  PHE A CE2   1 
ATOM   1925 C  CZ    . PHE A 1 250 ? -13.934 59.541 4.082   1.00 8.36   ? 247  PHE A CZ    1 
ATOM   1926 N  N     . SER A 1 251 ? -12.782 62.640 10.865  1.00 8.37   ? 248  SER A N     1 
ATOM   1927 C  CA    . SER A 1 251 ? -11.938 62.899 11.997  1.00 8.54   ? 248  SER A CA    1 
ATOM   1928 C  C     . SER A 1 251 ? -12.174 61.887 13.122  1.00 8.76   ? 248  SER A C     1 
ATOM   1929 O  O     . SER A 1 251 ? -11.284 61.691 13.933  1.00 7.20   ? 248  SER A O     1 
ATOM   1930 C  CB    . SER A 1 251 ? -12.146 64.330 12.588  1.00 8.48   ? 248  SER A CB    1 
ATOM   1931 O  OG    . SER A 1 251 ? -13.428 64.446 13.214  1.00 8.36   ? 248  SER A OG    1 
ATOM   1932 N  N     . GLN A 1 252 ? -13.405 61.331 13.194  1.00 9.71   ? 249  GLN A N     1 
ATOM   1933 C  CA    . GLN A 1 252 ? -13.713 60.295 14.123  1.00 11.04  ? 249  GLN A CA    1 
ATOM   1934 C  C     . GLN A 1 252 ? -14.282 59.005 13.482  1.00 11.04  ? 249  GLN A C     1 
ATOM   1935 O  O     . GLN A 1 252 ? -14.946 58.243 14.157  1.00 9.85   ? 249  GLN A O     1 
ATOM   1936 C  CB    . GLN A 1 252 ? -14.739 60.767 15.132  1.00 12.90  ? 249  GLN A CB    1 
ATOM   1937 C  CG    . GLN A 1 252 ? -14.415 62.064 15.799  1.00 13.85  ? 249  GLN A CG    1 
ATOM   1938 C  CD    . GLN A 1 252 ? -15.416 62.344 16.869  1.00 15.37  ? 249  GLN A CD    1 
ATOM   1939 O  OE1   . GLN A 1 252 ? -15.322 61.907 18.027  1.00 15.20  ? 249  GLN A OE1   1 
ATOM   1940 N  NE2   . GLN A 1 252 ? -16.389 63.103 16.482  1.00 16.68  ? 249  GLN A NE2   1 
ATOM   1941 N  N     . MET A 1 253 ? -13.996 58.767 12.225  1.00 11.19  ? 250  MET A N     1 
ATOM   1942 C  CA    . MET A 1 253 ? -14.584 57.621 11.525  1.00 11.42  ? 250  MET A CA    1 
ATOM   1943 C  C     . MET A 1 253 ? -13.590 56.500 11.594  1.00 10.59  ? 250  MET A C     1 
ATOM   1944 O  O     . MET A 1 253 ? -12.513 56.619 10.990  1.00 11.16  ? 250  MET A O     1 
ATOM   1945 C  CB    . MET A 1 253 ? -14.867 57.955 10.042  1.00 11.77  ? 250  MET A CB    1 
ATOM   1946 C  CG    . MET A 1 253 ? -15.428 56.781 9.238   1.00 12.18  ? 250  MET A CG    1 
ATOM   1947 S  SD    . MET A 1 253 ? -17.099 56.369 9.802   1.00 14.80  ? 250  MET A SD    1 
ATOM   1948 C  CE    . MET A 1 253 ? -18.039 57.872 9.616   1.00 12.29  ? 250  MET A CE    1 
ATOM   1949 N  N     . PRO A 1 254 ? -13.909 55.414 12.331  1.00 9.80   ? 251  PRO A N     1 
ATOM   1950 C  CA    . PRO A 1 254 ? -12.988 54.243 12.289  1.00 9.62   ? 251  PRO A CA    1 
ATOM   1951 C  C     . PRO A 1 254 ? -12.671 53.792 10.855  1.00 9.57   ? 251  PRO A C     1 
ATOM   1952 O  O     . PRO A 1 254 ? -13.542 53.723 9.970   1.00 9.00   ? 251  PRO A O     1 
ATOM   1953 C  CB    . PRO A 1 254 ? -13.728 53.158 13.063  1.00 9.10   ? 251  PRO A CB    1 
ATOM   1954 C  CG    . PRO A 1 254 ? -14.689 53.900 13.897  1.00 9.39   ? 251  PRO A CG    1 
ATOM   1955 C  CD    . PRO A 1 254 ? -15.140 55.072 13.051  1.00 9.54   ? 251  PRO A CD    1 
ATOM   1956 N  N     . ILE A 1 255 ? -11.398 53.577 10.627  1.00 10.66  ? 252  ILE A N     1 
ATOM   1957 C  CA    . ILE A 1 255 ? -10.916 53.157 9.305   1.00 11.17  ? 252  ILE A CA    1 
ATOM   1958 C  C     . ILE A 1 255 ? -11.719 51.974 8.699   1.00 11.38  ? 252  ILE A C     1 
ATOM   1959 O  O     . ILE A 1 255 ? -11.958 51.931 7.436   1.00 11.70  ? 252  ILE A O     1 
ATOM   1960 C  CB    . ILE A 1 255 ? -9.399  52.852 9.362   1.00 11.22  ? 252  ILE A CB    1 
ATOM   1961 C  CG1   . ILE A 1 255 ? -8.630  54.170 9.465   1.00 11.59  ? 252  ILE A CG1   1 
ATOM   1962 C  CG2   . ILE A 1 255 ? -8.969  52.054 8.135   1.00 11.09  ? 252  ILE A CG2   1 
ATOM   1963 C  CD1   . ILE A 1 255 ? -7.194  54.015 9.783   1.00 12.45  ? 252  ILE A CD1   1 
ATOM   1964 N  N     . ARG A 1 256 ? -12.118 51.038 9.559   1.00 11.17  ? 253  ARG A N     1 
ATOM   1965 C  CA    . ARG A 1 256 ? -12.809 49.851 9.127   1.00 11.79  ? 253  ARG A CA    1 
ATOM   1966 C  C     . ARG A 1 256 ? -14.164 50.109 8.546   1.00 11.66  ? 253  ARG A C     1 
ATOM   1967 O  O     . ARG A 1 256 ? -14.711 49.202 7.948   1.00 10.58  ? 253  ARG A O     1 
ATOM   1968 C  CB    . ARG A 1 256 ? -12.977 48.798 10.229  1.00 13.00  ? 253  ARG A CB    1 
ATOM   1969 C  CG    . ARG A 1 256 ? -13.954 49.202 11.319  1.00 14.89  ? 253  ARG A CG    1 
ATOM   1970 C  CD    . ARG A 1 256 ? -14.019 48.142 12.432  1.00 17.40  ? 253  ARG A CD    1 
ATOM   1971 N  NE    . ARG A 1 256 ? -14.840 48.694 13.537  1.00 17.89  ? 253  ARG A NE    1 
ATOM   1972 C  CZ    . ARG A 1 256 ? -14.397 49.494 14.512  1.00 19.13  ? 253  ARG A CZ    1 
ATOM   1973 N  NH1   . ARG A 1 256 ? -13.106 49.791 14.618  1.00 20.42  ? 253  ARG A NH1   1 
ATOM   1974 N  NH2   . ARG A 1 256 ? -15.255 49.975 15.398  1.00 19.17  ? 253  ARG A NH2   1 
ATOM   1975 N  N     . LYS A 1 257 ? -14.719 51.300 8.739   1.00 12.04  ? 254  LYS A N     1 
ATOM   1976 C  CA    . LYS A 1 257 ? -16.020 51.627 8.199   1.00 12.64  ? 254  LYS A CA    1 
ATOM   1977 C  C     . LYS A 1 257 ? -16.026 51.957 6.717   1.00 12.41  ? 254  LYS A C     1 
ATOM   1978 O  O     . LYS A 1 257 ? -17.132 52.013 6.094   1.00 10.83  ? 254  LYS A O     1 
ATOM   1979 C  CB    . LYS A 1 257 ? -16.640 52.791 8.983   1.00 14.09  ? 254  LYS A CB    1 
ATOM   1980 C  CG    . LYS A 1 257 ? -16.813 52.518 10.438  1.00 15.88  ? 254  LYS A CG    1 
ATOM   1981 C  CD    . LYS A 1 257 ? -17.828 51.473 10.720  1.00 18.93  ? 254  LYS A CD    1 
ATOM   1982 C  CE    . LYS A 1 257 ? -18.102 51.384 12.227  1.00 23.09  ? 254  LYS A CE    1 
ATOM   1983 N  NZ    . LYS A 1 257 ? -18.744 50.098 12.673  1.00 24.72  ? 254  LYS A NZ    1 
ATOM   1984 N  N     . ILE A 1 258 ? -14.835 52.267 6.169   1.00 11.73  ? 255  ILE A N     1 
ATOM   1985 C  CA    . ILE A 1 258 ? -14.696 52.650 4.748   1.00 12.15  ? 255  ILE A CA    1 
ATOM   1986 C  C     . ILE A 1 258 ? -14.603 51.358 3.918   1.00 12.41  ? 255  ILE A C     1 
ATOM   1987 O  O     . ILE A 1 258 ? -13.810 50.458 4.221   1.00 11.58  ? 255  ILE A O     1 
ATOM   1988 C  CB    . ILE A 1 258 ? -13.457 53.535 4.520   1.00 13.14  ? 255  ILE A CB    1 
ATOM   1989 C  CG1   . ILE A 1 258 ? -13.745 55.011 4.867   1.00 15.47  ? 255  ILE A CG1   1 
ATOM   1990 C  CG2   . ILE A 1 258 ? -12.967 53.534 3.096   1.00 12.20  ? 255  ILE A CG2   1 
ATOM   1991 C  CD1   . ILE A 1 258 ? -14.232 55.224 6.274   1.00 17.46  ? 255  ILE A CD1   1 
ATOM   1992 N  N     . ARG A 1 259 ? -15.347 51.310 2.842   1.00 12.72  ? 256  ARG A N     1 
ATOM   1993 C  CA    . ARG A 1 259 ? -15.413 50.109 2.006   1.00 14.68  ? 256  ARG A CA    1 
ATOM   1994 C  C     . ARG A 1 259 ? -14.022 49.709 1.480   1.00 13.08  ? 256  ARG A C     1 
ATOM   1995 O  O     . ARG A 1 259 ? -13.320 50.548 0.904   1.00 12.20  ? 256  ARG A O     1 
ATOM   1996 C  CB    . ARG A 1 259 ? -16.361 50.324 0.817   1.00 17.27  ? 256  ARG A CB    1 
ATOM   1997 C  CG    . ARG A 1 259 ? -16.815 49.019 0.156   1.00 20.95  ? 256  ARG A CG    1 
ATOM   1998 C  CD    . ARG A 1 259 ? -17.461 49.232 -1.224  1.00 25.41  ? 256  ARG A CD    1 
ATOM   1999 N  NE    . ARG A 1 259 ? -16.435 49.605 -2.185  1.00 32.19  ? 256  ARG A NE    1 
ATOM   2000 C  CZ    . ARG A 1 259 ? -16.609 50.166 -3.387  1.00 41.12  ? 256  ARG A CZ    1 
ATOM   2001 N  NH1   . ARG A 1 259 ? -15.516 50.404 -4.110  1.00 47.59  ? 256  ARG A NH1   1 
ATOM   2002 N  NH2   . ARG A 1 259 ? -17.814 50.484 -3.901  1.00 42.50  ? 256  ARG A NH2   1 
ATOM   2003 N  N     . SER A 1 260 ? -13.649 48.456 1.755   1.00 13.14  ? 257  SER A N     1 
ATOM   2004 C  CA    . SER A 1 260 ? -12.411 47.773 1.339   1.00 12.71  ? 257  SER A CA    1 
ATOM   2005 C  C     . SER A 1 260 ? -11.418 47.781 2.462   1.00 12.69  ? 257  SER A C     1 
ATOM   2006 O  O     . SER A 1 260 ? -10.418 47.054 2.416   1.00 11.78  ? 257  SER A O     1 
ATOM   2007 C  CB    . SER A 1 260 ? -11.810 48.303 0.047   1.00 12.85  ? 257  SER A CB    1 
ATOM   2008 O  OG    . SER A 1 260 ? -11.103 49.509 0.236   1.00 13.11  ? 257  SER A OG    1 
ATOM   2009 N  N     . LEU A 1 261 ? -11.725 48.529 3.523   1.00 12.11  ? 258  LEU A N     1 
ATOM   2010 C  CA    . LEU A 1 261 ? -10.865 48.561 4.685   1.00 12.60  ? 258  LEU A CA    1 
ATOM   2011 C  C     . LEU A 1 261 ? -11.423 47.776 5.899   1.00 12.38  ? 258  LEU A C     1 
ATOM   2012 O  O     . LEU A 1 261 ? -10.883 47.851 6.965   1.00 12.24  ? 258  LEU A O     1 
ATOM   2013 C  CB    . LEU A 1 261 ? -10.584 50.030 5.059   1.00 12.35  ? 258  LEU A CB    1 
ATOM   2014 C  CG    . LEU A 1 261 ? -9.884  50.843 3.954   1.00 12.97  ? 258  LEU A CG    1 
ATOM   2015 C  CD1   . LEU A 1 261 ? -9.519  52.248 4.452   1.00 12.34  ? 258  LEU A CD1   1 
ATOM   2016 C  CD2   . LEU A 1 261 ? -8.606  50.172 3.436   1.00 13.69  ? 258  LEU A CD2   1 
ATOM   2017 N  N     . GLY A 1 262 ? -12.480 46.995 5.710   1.00 13.10  ? 259  GLY A N     1 
ATOM   2018 C  CA    . GLY A 1 262 ? -13.127 46.284 6.798   1.00 14.23  ? 259  GLY A CA    1 
ATOM   2019 C  C     . GLY A 1 262 ? -12.387 45.038 7.209   1.00 14.04  ? 259  GLY A C     1 
ATOM   2020 O  O     . GLY A 1 262 ? -12.800 44.381 8.134   1.00 12.39  ? 259  GLY A O     1 
ATOM   2021 N  N     . GLY A 1 263 ? -11.334 44.674 6.480   1.00 13.51  ? 260  GLY A N     1 
ATOM   2022 C  CA    . GLY A 1 263 ? -10.649 43.412 6.705   1.00 14.33  ? 260  GLY A CA    1 
ATOM   2023 C  C     . GLY A 1 263 ? -9.169  43.593 7.067   1.00 15.32  ? 260  GLY A C     1 
ATOM   2024 O  O     . GLY A 1 263 ? -8.778  44.476 7.878   1.00 15.40  ? 260  GLY A O     1 
ATOM   2025 N  N     . LYS A 1 264 ? -8.345  42.730 6.506   1.00 15.32  ? 261  LYS A N     1 
ATOM   2026 C  CA    . LYS A 1 264 ? -6.907  42.710 6.817   1.00 17.30  ? 261  LYS A CA    1 
ATOM   2027 C  C     . LYS A 1 264 ? -6.106  43.967 6.474   1.00 15.41  ? 261  LYS A C     1 
ATOM   2028 O  O     . LYS A 1 264 ? -5.280  44.353 7.277   1.00 15.71  ? 261  LYS A O     1 
ATOM   2029 C  CB    . LYS A 1 264 ? -6.242  41.497 6.156   1.00 19.81  ? 261  LYS A CB    1 
ATOM   2030 C  CG    . LYS A 1 264 ? -6.706  40.195 6.795   1.00 21.51  ? 261  LYS A CG    1 
ATOM   2031 C  CD    . LYS A 1 264 ? -5.991  39.012 6.116   1.00 26.62  ? 261  LYS A CD    1 
ATOM   2032 C  CE    . LYS A 1 264 ? -6.677  37.713 6.443   1.00 29.78  ? 261  LYS A CE    1 
ATOM   2033 N  NZ    . LYS A 1 264 ? -5.801  36.593 6.040   1.00 36.86  ? 261  LYS A NZ    1 
ATOM   2034 N  N     . LEU A 1 265 ? -6.298  44.548 5.283   1.00 14.18  ? 262  LEU A N     1 
ATOM   2035 C  CA    . LEU A 1 265 ? -5.616  45.788 4.883   1.00 13.84  ? 262  LEU A CA    1 
ATOM   2036 C  C     . LEU A 1 265 ? -5.919  46.891 5.873   1.00 13.69  ? 262  LEU A C     1 
ATOM   2037 O  O     . LEU A 1 265 ? -5.011  47.580 6.323   1.00 15.43  ? 262  LEU A O     1 
ATOM   2038 C  CB    . LEU A 1 265 ? -6.085  46.255 3.529   1.00 14.33  ? 262  LEU A CB    1 
ATOM   2039 C  CG    . LEU A 1 265 ? -5.527  47.591 3.029   1.00 15.05  ? 262  LEU A CG    1 
ATOM   2040 C  CD1   . LEU A 1 265 ? -3.990  47.603 2.904   1.00 16.16  ? 262  LEU A CD1   1 
ATOM   2041 C  CD2   . LEU A 1 265 ? -6.124  47.865 1.674   1.00 14.95  ? 262  LEU A CD2   1 
ATOM   2042 N  N     . GLY A 1 266 ? -7.188  47.082 6.204   1.00 13.43  ? 263  GLY A N     1 
ATOM   2043 C  CA    . GLY A 1 266 ? -7.575  48.077 7.193   1.00 14.31  ? 263  GLY A CA    1 
ATOM   2044 C  C     . GLY A 1 266 ? -6.910  47.876 8.541   1.00 14.10  ? 263  GLY A C     1 
ATOM   2045 O  O     . GLY A 1 266 ? -6.435  48.815 9.173   1.00 11.93  ? 263  GLY A O     1 
ATOM   2046 N  N     . ALA A 1 267 ? -6.836  46.625 8.950   1.00 15.20  ? 264  ALA A N     1 
ATOM   2047 C  CA    . ALA A 1 267 ? -6.262  46.283 10.238  1.00 15.68  ? 264  ALA A CA    1 
ATOM   2048 C  C     . ALA A 1 267 ? -4.762  46.575 10.185  1.00 15.39  ? 264  ALA A C     1 
ATOM   2049 O  O     . ALA A 1 267 ? -4.171  47.016 11.164  1.00 16.99  ? 264  ALA A O     1 
ATOM   2050 C  CB    . ALA A 1 267 ? -6.547  44.797 10.558  1.00 16.72  ? 264  ALA A CB    1 
ATOM   2051 N  N     . SER A 1 268 ? -4.132  46.350 9.036   1.00 16.09  ? 265  SER A N     1 
ATOM   2052 C  CA    . SER A 1 268 ? -2.695  46.669 8.900   1.00 16.67  ? 265  SER A CA    1 
ATOM   2053 C  C     . SER A 1 268 ? -2.428  48.184 8.809   1.00 15.81  ? 265  SER A C     1 
ATOM   2054 O  O     . SER A 1 268 ? -1.397  48.660 9.255   1.00 14.67  ? 265  SER A O     1 
ATOM   2055 C  CB    . SER A 1 268 ? -2.055  45.912 7.710   1.00 18.52  ? 265  SER A CB    1 
ATOM   2056 O  OG    . SER A 1 268 ? -2.285  46.588 6.508   1.00 21.48  ? 265  SER A OG    1 
ATOM   2057 N  N     . VAL A 1 269 ? -3.351  48.947 8.232   1.00 13.53  ? 266  VAL A N     1 
ATOM   2058 C  CA    . VAL A 1 269 ? -3.231  50.422 8.254   1.00 13.36  ? 266  VAL A CA    1 
ATOM   2059 C  C     . VAL A 1 269 ? -3.172  50.947 9.731   1.00 13.93  ? 266  VAL A C     1 
ATOM   2060 O  O     . VAL A 1 269 ? -2.334  51.772 10.081  1.00 15.03  ? 266  VAL A O     1 
ATOM   2061 C  CB    . VAL A 1 269 ? -4.389  51.093 7.485   1.00 13.06  ? 266  VAL A CB    1 
ATOM   2062 C  CG1   . VAL A 1 269 ? -4.420  52.600 7.766   1.00 13.32  ? 266  VAL A CG1   1 
ATOM   2063 C  CG2   . VAL A 1 269 ? -4.316  50.812 5.982   1.00 12.70  ? 266  VAL A CG2   1 
ATOM   2064 N  N     . ILE A 1 270 ? -4.051  50.418 10.557  1.00 12.74  ? 267  ILE A N     1 
ATOM   2065 C  CA    . ILE A 1 270 ? -4.196  50.795 11.954  1.00 13.14  ? 267  ILE A CA    1 
ATOM   2066 C  C     . ILE A 1 270 ? -2.944  50.452 12.703  1.00 13.82  ? 267  ILE A C     1 
ATOM   2067 O  O     . ILE A 1 270 ? -2.419  51.275 13.480  1.00 14.68  ? 267  ILE A O     1 
ATOM   2068 C  CB    . ILE A 1 270 ? -5.427  50.095 12.519  1.00 13.01  ? 267  ILE A CB    1 
ATOM   2069 C  CG1   . ILE A 1 270 ? -6.710  50.778 11.999  1.00 12.96  ? 267  ILE A CG1   1 
ATOM   2070 C  CG2   . ILE A 1 270 ? -5.465  50.088 14.039  1.00 14.68  ? 267  ILE A CG2   1 
ATOM   2071 C  CD1   . ILE A 1 270 ? -7.972  49.960 12.124  1.00 14.18  ? 267  ILE A CD1   1 
ATOM   2072 N  N     . GLU A 1 271 ? -2.443  49.246 12.478  1.00 15.73  ? 268  GLU A N     1 
ATOM   2073 C  CA    . GLU A 1 271 ? -1.330  48.719 13.251  1.00 19.23  ? 268  GLU A CA    1 
ATOM   2074 C  C     . GLU A 1 271 ? -0.022  49.312 12.859  1.00 18.23  ? 268  GLU A C     1 
ATOM   2075 O  O     . GLU A 1 271 ? 0.700   49.805 13.716  1.00 18.56  ? 268  GLU A O     1 
ATOM   2076 C  CB    . GLU A 1 271 ? -1.236  47.202 13.149  1.00 24.70  ? 268  GLU A CB    1 
ATOM   2077 C  CG    . GLU A 1 271 ? -2.257  46.476 14.026  1.00 35.15  ? 268  GLU A CG    1 
ATOM   2078 C  CD    . GLU A 1 271 ? -2.414  46.981 15.501  1.00 43.22  ? 268  GLU A CD    1 
ATOM   2079 O  OE1   . GLU A 1 271 ? -1.378  47.172 16.204  1.00 51.17  ? 268  GLU A OE1   1 
ATOM   2080 O  OE2   . GLU A 1 271 ? -3.588  47.192 15.966  1.00 44.13  ? 268  GLU A OE2   1 
ATOM   2081 N  N     . ILE A 1 272 ? 0.250   49.341 11.557  1.00 16.58  ? 269  ILE A N     1 
ATOM   2082 C  CA    . ILE A 1 272 ? 1.490   49.865 11.053  1.00 16.28  ? 269  ILE A CA    1 
ATOM   2083 C  C     . ILE A 1 272 ? 1.640   51.331 11.334  1.00 16.74  ? 269  ILE A C     1 
ATOM   2084 O  O     . ILE A 1 272 ? 2.721   51.814 11.680  1.00 15.78  ? 269  ILE A O     1 
ATOM   2085 C  CB    . ILE A 1 272 ? 1.579   49.598 9.547   1.00 17.56  ? 269  ILE A CB    1 
ATOM   2086 C  CG1   . ILE A 1 272 ? 1.786   48.089 9.307   1.00 19.94  ? 269  ILE A CG1   1 
ATOM   2087 C  CG2   . ILE A 1 272 ? 2.717   50.366 8.886   1.00 18.55  ? 269  ILE A CG2   1 
ATOM   2088 C  CD1   . ILE A 1 272 ? 1.851   47.704 7.814   1.00 21.94  ? 269  ILE A CD1   1 
ATOM   2089 N  N     . LEU A 1 273 ? 0.576   52.093 11.086  1.00 15.97  ? 270  LEU A N     1 
ATOM   2090 C  CA    . LEU A 1 273 ? 0.646   53.531 11.240  1.00 15.05  ? 270  LEU A CA    1 
ATOM   2091 C  C     . LEU A 1 273 ? 0.319   54.016 12.653  1.00 14.41  ? 270  LEU A C     1 
ATOM   2092 O  O     . LEU A 1 273 ? 0.569   55.153 12.974  1.00 14.08  ? 270  LEU A O     1 
ATOM   2093 C  CB    . LEU A 1 273 ? -0.275  54.204 10.217  1.00 15.72  ? 270  LEU A CB    1 
ATOM   2094 C  CG    . LEU A 1 273 ? 0.075   53.961 8.746   1.00 15.81  ? 270  LEU A CG    1 
ATOM   2095 C  CD1   . LEU A 1 273 ? -0.896  54.673 7.829   1.00 17.74  ? 270  LEU A CD1   1 
ATOM   2096 C  CD2   . LEU A 1 273 ? 1.470   54.435 8.405   1.00 15.72  ? 270  LEU A CD2   1 
ATOM   2097 N  N     . GLY A 1 274 ? -0.312  53.201 13.468  1.00 13.76  ? 271  GLY A N     1 
ATOM   2098 C  CA    . GLY A 1 274 ? -0.630  53.578 14.803  1.00 13.52  ? 271  GLY A CA    1 
ATOM   2099 C  C     . GLY A 1 274 ? -1.755  54.599 14.843  1.00 15.04  ? 271  GLY A C     1 
ATOM   2100 O  O     . GLY A 1 274 ? -1.734  55.506 15.684  1.00 16.07  ? 271  GLY A O     1 
ATOM   2101 N  N     . ILE A 1 275 ? -2.743  54.470 13.954  1.00 13.94  ? 272  ILE A N     1 
ATOM   2102 C  CA    . ILE A 1 275 ? -3.869  55.435 13.884  1.00 12.48  ? 272  ILE A CA    1 
ATOM   2103 C  C     . ILE A 1 275 ? -5.164  54.669 14.077  1.00 12.47  ? 272  ILE A C     1 
ATOM   2104 O  O     . ILE A 1 275 ? -5.159  53.430 13.995  1.00 11.56  ? 272  ILE A O     1 
ATOM   2105 C  CB    . ILE A 1 275 ? -3.877  56.179 12.557  1.00 12.57  ? 272  ILE A CB    1 
ATOM   2106 C  CG1   . ILE A 1 275 ? -4.000  55.239 11.340  1.00 12.66  ? 272  ILE A CG1   1 
ATOM   2107 C  CG2   . ILE A 1 275 ? -2.601  57.000 12.449  1.00 13.02  ? 272  ILE A CG2   1 
ATOM   2108 C  CD1   . ILE A 1 275 ? -4.225  55.988 10.037  1.00 12.37  ? 272  ILE A CD1   1 
ATOM   2109 N  N     . GLU A 1 276 ? -6.268  55.387 14.296  1.00 13.50  ? 273  GLU A N     1 
ATOM   2110 C  CA    . GLU A 1 276 ? -7.609  54.787 14.364  1.00 13.94  ? 273  GLU A CA    1 
ATOM   2111 C  C     . GLU A 1 276 ? -8.609  55.291 13.330  1.00 13.13  ? 273  GLU A C     1 
ATOM   2112 O  O     . GLU A 1 276 ? -9.541  54.551 12.970  1.00 11.20  ? 273  GLU A O     1 
ATOM   2113 C  CB    . GLU A 1 276 ? -8.253  55.031 15.729  1.00 17.40  ? 273  GLU A CB    1 
ATOM   2114 C  CG    . GLU A 1 276 ? -7.505  54.490 16.910  1.00 21.32  ? 273  GLU A CG    1 
ATOM   2115 C  CD    . GLU A 1 276 ? -8.030  55.040 18.257  1.00 27.36  ? 273  GLU A CD    1 
ATOM   2116 O  OE1   . GLU A 1 276 ? -7.222  55.329 19.113  1.00 36.04  ? 273  GLU A OE1   1 
ATOM   2117 O  OE2   . GLU A 1 276 ? -9.240  55.178 18.490  1.00 34.03  ? 273  GLU A OE2   1 
ATOM   2118 N  N     . TYR A 1 277 ? -8.476  56.559 12.912  1.00 12.03  ? 274  TYR A N     1 
ATOM   2119 C  CA    . TYR A 1 277 ? -9.550  57.221 12.166  1.00 11.41  ? 274  TYR A CA    1 
ATOM   2120 C  C     . TYR A 1 277 ? -9.092  57.571 10.789  1.00 11.12  ? 274  TYR A C     1 
ATOM   2121 O  O     . TYR A 1 277 ? -7.934  57.935 10.587  1.00 12.40  ? 274  TYR A O     1 
ATOM   2122 C  CB    . TYR A 1 277 ? -9.985  58.491 12.876  1.00 11.91  ? 274  TYR A CB    1 
ATOM   2123 C  CG    . TYR A 1 277 ? -10.412 58.265 14.273  1.00 12.30  ? 274  TYR A CG    1 
ATOM   2124 C  CD1   . TYR A 1 277 ? -9.806  58.925 15.354  1.00 12.39  ? 274  TYR A CD1   1 
ATOM   2125 C  CD2   . TYR A 1 277 ? -11.431 57.420 14.529  1.00 11.78  ? 274  TYR A CD2   1 
ATOM   2126 C  CE1   . TYR A 1 277 ? -10.228 58.692 16.662  1.00 12.19  ? 274  TYR A CE1   1 
ATOM   2127 C  CE2   . TYR A 1 277 ? -11.825 57.140 15.805  1.00 11.94  ? 274  TYR A CE2   1 
ATOM   2128 C  CZ    . TYR A 1 277 ? -11.230 57.759 16.888  1.00 12.64  ? 274  TYR A CZ    1 
ATOM   2129 O  OH    . TYR A 1 277 ? -11.745 57.459 18.198  1.00 11.86  ? 274  TYR A OH    1 
ATOM   2130 N  N     . MET A 1 278 ? -10.011 57.531 9.841   1.00 10.69  ? 275  MET A N     1 
ATOM   2131 C  CA    . MET A 1 278 ? -9.713  57.786 8.463   1.00 10.86  ? 275  MET A CA    1 
ATOM   2132 C  C     . MET A 1 278 ? -8.985  59.139 8.218   1.00 11.13  ? 275  MET A C     1 
ATOM   2133 O  O     . MET A 1 278 ? -8.016  59.220 7.416   1.00 9.18   ? 275  MET A O     1 
ATOM   2134 C  CB    . MET A 1 278 ? -11.017 57.676 7.681   1.00 11.42  ? 275  MET A CB    1 
ATOM   2135 C  CG    . MET A 1 278 ? -10.878 57.513 6.202   1.00 13.01  ? 275  MET A CG    1 
ATOM   2136 S  SD    . MET A 1 278 ? -10.100 55.986 5.749   1.00 14.64  ? 275  MET A SD    1 
ATOM   2137 C  CE    . MET A 1 278 ? -9.824  56.347 4.055   1.00 14.63  ? 275  MET A CE    1 
ATOM   2138 N  N     . GLY A 1 279 ? -9.375  60.170 8.972   1.00 10.84  ? 276  GLY A N     1 
ATOM   2139 C  CA    . GLY A 1 279 ? -8.819  61.491 8.801   1.00 11.28  ? 276  GLY A CA    1 
ATOM   2140 C  C     . GLY A 1 279 ? -7.327  61.585 9.109   1.00 11.90  ? 276  GLY A C     1 
ATOM   2141 O  O     . GLY A 1 279 ? -6.570  62.385 8.513   1.00 11.00  ? 276  GLY A O     1 
ATOM   2142 N  N     . GLU A 1 280 ? -6.886  60.730 10.022  1.00 11.48  ? 277  GLU A N     1 
ATOM   2143 C  CA    . GLU A 1 280 ? -5.505  60.690 10.419  1.00 10.85  ? 277  GLU A CA    1 
ATOM   2144 C  C     . GLU A 1 280 ? -4.576  60.322 9.282   1.00 10.41  ? 277  GLU A C     1 
ATOM   2145 O  O     . GLU A 1 280 ? -3.359  60.624 9.363   1.00 9.52   ? 277  GLU A O     1 
ATOM   2146 C  CB    . GLU A 1 280 ? -5.285  59.718 11.611  1.00 11.54  ? 277  GLU A CB    1 
ATOM   2147 C  CG    . GLU A 1 280 ? -6.009  60.099 12.870  1.00 11.98  ? 277  GLU A CG    1 
ATOM   2148 C  CD    . GLU A 1 280 ? -5.720  59.151 14.001  1.00 12.90  ? 277  GLU A CD    1 
ATOM   2149 O  OE1   . GLU A 1 280 ? -6.558  58.298 14.271  1.00 13.07  ? 277  GLU A OE1   1 
ATOM   2150 O  OE2   . GLU A 1 280 ? -4.640  59.244 14.617  1.00 13.15  ? 277  GLU A OE2   1 
ATOM   2151 N  N     . LEU A 1 281 ? -5.090  59.664 8.239   1.00 9.98   ? 278  LEU A N     1 
ATOM   2152 C  CA    . LEU A 1 281 ? -4.282  59.386 7.032   1.00 10.16  ? 278  LEU A CA    1 
ATOM   2153 C  C     . LEU A 1 281 ? -3.727  60.580 6.307   1.00 10.84  ? 278  LEU A C     1 
ATOM   2154 O  O     . LEU A 1 281 ? -2.741  60.419 5.573   1.00 10.27  ? 278  LEU A O     1 
ATOM   2155 C  CB    . LEU A 1 281 ? -5.056  58.526 6.021   1.00 9.95   ? 278  LEU A CB    1 
ATOM   2156 C  CG    . LEU A 1 281 ? -5.153  57.055 6.435   1.00 10.24  ? 278  LEU A CG    1 
ATOM   2157 C  CD1   . LEU A 1 281 ? -6.234  56.321 5.645   1.00 11.03  ? 278  LEU A CD1   1 
ATOM   2158 C  CD2   . LEU A 1 281 ? -3.817  56.344 6.300   1.00 9.96   ? 278  LEU A CD2   1 
ATOM   2159 N  N     . THR A 1 282 ? -4.363  61.756 6.451   1.00 11.54  ? 279  THR A N     1 
ATOM   2160 C  CA    . THR A 1 282 ? -3.971  62.944 5.688   1.00 13.02  ? 279  THR A CA    1 
ATOM   2161 C  C     . THR A 1 282 ? -2.558  63.385 6.038   1.00 13.41  ? 279  THR A C     1 
ATOM   2162 O  O     . THR A 1 282 ? -1.995  64.085 5.285   1.00 13.00  ? 279  THR A O     1 
ATOM   2163 C  CB    . THR A 1 282 ? -4.847  64.178 5.967   1.00 12.48  ? 279  THR A CB    1 
ATOM   2164 O  OG1   . THR A 1 282 ? -4.822  64.439 7.390   1.00 12.50  ? 279  THR A OG1   1 
ATOM   2165 C  CG2   . THR A 1 282 ? -6.247  63.921 5.540   1.00 12.17  ? 279  THR A CG2   1 
ATOM   2166 N  N     . GLN A 1 283 ? -2.012  62.970 7.172   1.00 14.93  ? 280  GLN A N     1 
ATOM   2167 C  CA    . GLN A 1 283 ? -0.691  63.443 7.577   1.00 18.69  ? 280  GLN A CA    1 
ATOM   2168 C  C     . GLN A 1 283 ? 0.496   62.716 6.895   1.00 19.86  ? 280  GLN A C     1 
ATOM   2169 O  O     . GLN A 1 283 ? 1.647   63.166 7.016   1.00 24.00  ? 280  GLN A O     1 
ATOM   2170 C  CB    . GLN A 1 283 ? -0.582  63.379 9.117   1.00 19.97  ? 280  GLN A CB    1 
ATOM   2171 C  CG    . GLN A 1 283 ? -0.458  62.045 9.716   1.00 24.28  ? 280  GLN A CG    1 
ATOM   2172 C  CD    . GLN A 1 283 ? -0.925  62.050 11.202  1.00 31.39  ? 280  GLN A CD    1 
ATOM   2173 O  OE1   . GLN A 1 283 ? -1.814  61.253 11.628  1.00 24.29  ? 280  GLN A OE1   1 
ATOM   2174 N  NE2   . GLN A 1 283 ? -0.296  62.943 12.010  1.00 33.45  ? 280  GLN A NE2   1 
ATOM   2175 N  N     . PHE A 1 284 ? 0.219   61.641 6.160   1.00 15.68  ? 281  PHE A N     1 
ATOM   2176 C  CA    . PHE A 1 284 ? 1.242   60.900 5.474   1.00 15.57  ? 281  PHE A CA    1 
ATOM   2177 C  C     . PHE A 1 284 ? 1.330   61.301 3.998   1.00 14.59  ? 281  PHE A C     1 
ATOM   2178 O  O     . PHE A 1 284 ? 0.341   61.653 3.352   1.00 14.45  ? 281  PHE A O     1 
ATOM   2179 C  CB    . PHE A 1 284 ? 0.976   59.419 5.615   1.00 15.19  ? 281  PHE A CB    1 
ATOM   2180 C  CG    . PHE A 1 284 ? 0.869   58.964 7.051   1.00 15.19  ? 281  PHE A CG    1 
ATOM   2181 C  CD1   . PHE A 1 284 ? 1.994   58.538 7.748   1.00 15.80  ? 281  PHE A CD1   1 
ATOM   2182 C  CD2   . PHE A 1 284 ? -0.355  58.975 7.708   1.00 14.95  ? 281  PHE A CD2   1 
ATOM   2183 C  CE1   . PHE A 1 284 ? 1.889   58.132 9.067   1.00 16.39  ? 281  PHE A CE1   1 
ATOM   2184 C  CE2   . PHE A 1 284 ? -0.442  58.615 9.014   1.00 14.65  ? 281  PHE A CE2   1 
ATOM   2185 C  CZ    . PHE A 1 284 ? 0.658   58.155 9.687   1.00 15.20  ? 281  PHE A CZ    1 
ATOM   2186 N  N     . THR A 1 285 ? 2.530   61.213 3.446   1.00 13.69  ? 282  THR A N     1 
ATOM   2187 C  CA    . THR A 1 285 ? 2.724   61.587 2.087   1.00 12.10  ? 282  THR A CA    1 
ATOM   2188 C  C     . THR A 1 285 ? 2.195   60.402 1.259   1.00 11.86  ? 282  THR A C     1 
ATOM   2189 O  O     . THR A 1 285 ? 2.076   59.300 1.738   1.00 12.93  ? 282  THR A O     1 
ATOM   2190 C  CB    . THR A 1 285 ? 4.202   61.868 1.749   1.00 11.68  ? 282  THR A CB    1 
ATOM   2191 O  OG1   . THR A 1 285 ? 4.906   60.664 1.763   1.00 9.63   ? 282  THR A OG1   1 
ATOM   2192 C  CG2   . THR A 1 285 ? 4.850   62.872 2.709   1.00 12.40  ? 282  THR A CG2   1 
ATOM   2193 N  N     . GLU A 1 286 ? 1.908   60.627 0.003   1.00 12.18  ? 283  GLU A N     1 
ATOM   2194 C  CA    . GLU A 1 286 ? 1.527   59.578 -0.886  1.00 13.30  ? 283  GLU A CA    1 
ATOM   2195 C  C     . GLU A 1 286 ? 2.652   58.490 -0.969  1.00 12.34  ? 283  GLU A C     1 
ATOM   2196 O  O     . GLU A 1 286 ? 2.378   57.281 -0.974  1.00 10.92  ? 283  GLU A O     1 
ATOM   2197 C  CB    . GLU A 1 286 ? 1.126   60.156 -2.268  1.00 14.40  ? 283  GLU A CB    1 
ATOM   2198 C  CG    . GLU A 1 286 ? 0.684   59.107 -3.234  1.00 15.39  ? 283  GLU A CG    1 
ATOM   2199 C  CD    . GLU A 1 286 ? 0.116   59.661 -4.519  1.00 16.93  ? 283  GLU A CD    1 
ATOM   2200 O  OE1   . GLU A 1 286 ? 0.227   60.867 -4.739  1.00 20.37  ? 283  GLU A OE1   1 
ATOM   2201 O  OE2   . GLU A 1 286 ? -0.542  58.887 -5.243  1.00 17.37  ? 283  GLU A OE2   1 
ATOM   2202 N  N     . SER A 1 287 ? 3.894   58.918 -1.049  1.00 12.62  ? 284  SER A N     1 
ATOM   2203 C  CA    . SER A 1 287 ? 5.016   57.936 -1.066  1.00 14.48  ? 284  SER A CA    1 
ATOM   2204 C  C     . SER A 1 287 ? 5.107   57.085 0.206   1.00 14.48  ? 284  SER A C     1 
ATOM   2205 O  O     . SER A 1 287 ? 5.368   55.900 0.106   1.00 14.46  ? 284  SER A O     1 
ATOM   2206 C  CB    . SER A 1 287 ? 6.369   58.666 -1.317  1.00 16.45  ? 284  SER A CB    1 
ATOM   2207 O  OG    . SER A 1 287 ? 6.331   59.203 -2.626  1.00 17.13  ? 284  SER A OG    1 
ATOM   2208 N  N     . GLN A 1 288 ? 4.784   57.650 1.387   1.00 14.24  ? 285  GLN A N     1 
ATOM   2209 C  CA    . GLN A 1 288 ? 4.808   56.869 2.586   1.00 14.11  ? 285  GLN A CA    1 
ATOM   2210 C  C     . GLN A 1 288 ? 3.705   55.815 2.535   1.00 14.34  ? 285  GLN A C     1 
ATOM   2211 O  O     . GLN A 1 288 ? 3.919   54.673 2.881   1.00 14.63  ? 285  GLN A O     1 
ATOM   2212 C  CB    . GLN A 1 288 ? 4.599   57.744 3.802   1.00 16.45  ? 285  GLN A CB    1 
ATOM   2213 C  CG    . GLN A 1 288 ? 5.782   58.595 4.134   1.00 18.94  ? 285  GLN A CG    1 
ATOM   2214 C  CD    . GLN A 1 288 ? 5.497   59.565 5.275   1.00 20.69  ? 285  GLN A CD    1 
ATOM   2215 O  OE1   . GLN A 1 288 ? 4.451   60.197 5.354   1.00 18.78  ? 285  GLN A OE1   1 
ATOM   2216 N  NE2   . GLN A 1 288 ? 6.451   59.671 6.177   1.00 23.24  ? 285  GLN A NE2   1 
ATOM   2217 N  N     . LEU A 1 289 ? 2.517   56.186 2.084   1.00 13.73  ? 286  LEU A N     1 
ATOM   2218 C  CA    . LEU A 1 289 ? 1.424   55.214 2.037   1.00 14.15  ? 286  LEU A CA    1 
ATOM   2219 C  C     . LEU A 1 289 ? 1.679   54.115 0.985   1.00 14.03  ? 286  LEU A C     1 
ATOM   2220 O  O     . LEU A 1 289 ? 1.433   52.905 1.210   1.00 13.90  ? 286  LEU A O     1 
ATOM   2221 C  CB    . LEU A 1 289 ? 0.094   55.916 1.774   1.00 14.02  ? 286  LEU A CB    1 
ATOM   2222 C  CG    . LEU A 1 289 ? -0.311  56.951 2.843   1.00 13.53  ? 286  LEU A CG    1 
ATOM   2223 C  CD1   . LEU A 1 289 ? -1.609  57.633 2.421   1.00 13.69  ? 286  LEU A CD1   1 
ATOM   2224 C  CD2   . LEU A 1 289 ? -0.427  56.302 4.234   1.00 13.95  ? 286  LEU A CD2   1 
ATOM   2225 N  N     . GLN A 1 290 ? 2.255   54.524 -0.129  1.00 14.95  ? 287  GLN A N     1 
ATOM   2226 C  CA    . GLN A 1 290 ? 2.648   53.523 -1.132  1.00 15.83  ? 287  GLN A CA    1 
ATOM   2227 C  C     . GLN A 1 290 ? 3.699   52.575 -0.627  1.00 15.07  ? 287  GLN A C     1 
ATOM   2228 O  O     . GLN A 1 290 ? 3.643   51.430 -0.972  1.00 14.97  ? 287  GLN A O     1 
ATOM   2229 C  CB    . GLN A 1 290 ? 3.096   54.150 -2.387  1.00 16.72  ? 287  GLN A CB    1 
ATOM   2230 C  CG    . GLN A 1 290 ? 1.949   54.854 -3.114  1.00 18.06  ? 287  GLN A CG    1 
ATOM   2231 C  CD    . GLN A 1 290 ? 2.477   55.532 -4.374  1.00 18.84  ? 287  GLN A CD    1 
ATOM   2232 O  OE1   . GLN A 1 290 ? 3.530   56.171 -4.328  1.00 19.25  ? 287  GLN A OE1   1 
ATOM   2233 N  NE2   . GLN A 1 290 ? 1.742   55.411 -5.492  1.00 20.41  ? 287  GLN A NE2   1 
ATOM   2234 N  N     . SER A 1 291 ? 4.626   53.075 0.171   1.00 15.28  ? 288  SER A N     1 
ATOM   2235 C  CA    . SER A 1 291 ? 5.656   52.240 0.771   1.00 17.37  ? 288  SER A CA    1 
ATOM   2236 C  C     . SER A 1 291 ? 5.082   51.172 1.674   1.00 18.54  ? 288  SER A C     1 
ATOM   2237 O  O     . SER A 1 291 ? 5.496   50.009 1.628   1.00 20.83  ? 288  SER A O     1 
ATOM   2238 C  CB    . SER A 1 291 ? 6.625   53.058 1.617   1.00 17.33  ? 288  SER A CB    1 
ATOM   2239 O  OG    A SER A 1 291 ? 7.734   52.264 1.963   0.26 18.13  ? 288  SER A OG    1 
ATOM   2240 O  OG    B SER A 1 291 ? 7.686   52.214 1.934   0.74 19.06  ? 288  SER A OG    1 
ATOM   2241 N  N     . HIS A 1 292 ? 4.158   51.578 2.532   1.00 17.48  ? 289  HIS A N     1 
ATOM   2242 C  CA    . HIS A 1 292 ? 3.528   50.624 3.423   1.00 16.70  ? 289  HIS A CA    1 
ATOM   2243 C  C     . HIS A 1 292 ? 2.553   49.657 2.722   1.00 17.07  ? 289  HIS A C     1 
ATOM   2244 O  O     . HIS A 1 292 ? 2.585   48.478 2.965   1.00 18.46  ? 289  HIS A O     1 
ATOM   2245 C  CB    . HIS A 1 292 ? 2.823   51.401 4.499   1.00 18.70  ? 289  HIS A CB    1 
ATOM   2246 C  CG    . HIS A 1 292 ? 3.748   52.125 5.430   1.00 18.48  ? 289  HIS A CG    1 
ATOM   2247 N  ND1   . HIS A 1 292 ? 4.651   51.455 6.230   1.00 20.34  ? 289  HIS A ND1   1 
ATOM   2248 C  CD2   . HIS A 1 292 ? 3.864   53.452 5.740   1.00 19.16  ? 289  HIS A CD2   1 
ATOM   2249 C  CE1   . HIS A 1 292 ? 5.308   52.339 6.981   1.00 20.39  ? 289  HIS A CE1   1 
ATOM   2250 N  NE2   . HIS A 1 292 ? 4.852   53.557 6.700   1.00 19.92  ? 289  HIS A NE2   1 
ATOM   2251 N  N     . PHE A 1 293 ? 1.704   50.153 1.836   1.00 14.78  ? 290  PHE A N     1 
ATOM   2252 C  CA    . PHE A 1 293 ? 0.565   49.375 1.377   1.00 14.98  ? 290  PHE A CA    1 
ATOM   2253 C  C     . PHE A 1 293 ? 0.600   49.009 -0.110  1.00 15.74  ? 290  PHE A C     1 
ATOM   2254 O  O     . PHE A 1 293 ? -0.396  48.464 -0.624  1.00 17.89  ? 290  PHE A O     1 
ATOM   2255 C  CB    . PHE A 1 293 ? -0.702  50.132 1.758   1.00 13.17  ? 290  PHE A CB    1 
ATOM   2256 C  CG    . PHE A 1 293 ? -0.714  50.521 3.209   1.00 13.00  ? 290  PHE A CG    1 
ATOM   2257 C  CD1   . PHE A 1 293 ? -0.702  49.522 4.207   1.00 11.99  ? 290  PHE A CD1   1 
ATOM   2258 C  CD2   . PHE A 1 293 ? -0.588  51.885 3.603   1.00 13.34  ? 290  PHE A CD2   1 
ATOM   2259 C  CE1   . PHE A 1 293 ? -0.607  49.844 5.558   1.00 11.90  ? 290  PHE A CE1   1 
ATOM   2260 C  CE2   . PHE A 1 293 ? -0.524  52.205 4.978   1.00 12.71  ? 290  PHE A CE2   1 
ATOM   2261 C  CZ    . PHE A 1 293 ? -0.544  51.183 5.938   1.00 12.45  ? 290  PHE A CZ    1 
ATOM   2262 N  N     . GLY A 1 294 ? 1.706   49.337 -0.809  1.00 16.39  ? 291  GLY A N     1 
ATOM   2263 C  CA    . GLY A 1 294 ? 1.772   49.150 -2.283  1.00 15.88  ? 291  GLY A CA    1 
ATOM   2264 C  C     . GLY A 1 294 ? 1.338   50.362 -3.082  1.00 16.24  ? 291  GLY A C     1 
ATOM   2265 O  O     . GLY A 1 294 ? 0.701   51.285 -2.565  1.00 14.59  ? 291  GLY A O     1 
ATOM   2266 N  N     . GLU A 1 295 ? 1.671   50.338 -4.369  1.00 17.27  ? 292  GLU A N     1 
ATOM   2267 C  CA    . GLU A 1 295 ? 1.460   51.475 -5.270  1.00 17.77  ? 292  GLU A CA    1 
ATOM   2268 C  C     . GLU A 1 295 ? -0.014  51.825 -5.364  1.00 17.00  ? 292  GLU A C     1 
ATOM   2269 O  O     . GLU A 1 295 ? -0.384  52.941 -5.184  1.00 13.46  ? 292  GLU A O     1 
ATOM   2270 C  CB    . GLU A 1 295 ? 2.037   51.188 -6.648  1.00 19.23  ? 292  GLU A CB    1 
ATOM   2271 C  CG    . GLU A 1 295 ? 1.842   52.290 -7.690  1.00 22.67  ? 292  GLU A CG    1 
ATOM   2272 C  CD    . GLU A 1 295 ? 2.380   51.886 -9.065  1.00 25.81  ? 292  GLU A CD    1 
ATOM   2273 O  OE1   . GLU A 1 295 ? 1.637   52.041 -10.057 1.00 35.18  ? 292  GLU A OE1   1 
ATOM   2274 O  OE2   . GLU A 1 295 ? 3.503   51.342 -9.174  1.00 26.18  ? 292  GLU A OE2   1 
ATOM   2275 N  N     . LYS A 1 296 ? -0.832  50.827 -5.616  1.00 18.40  ? 293  LYS A N     1 
ATOM   2276 C  CA    . LYS A 1 296 ? -2.273  51.021 -5.828  1.00 20.32  ? 293  LYS A CA    1 
ATOM   2277 C  C     . LYS A 1 296 ? -2.992  51.376 -4.524  1.00 17.28  ? 293  LYS A C     1 
ATOM   2278 O  O     . LYS A 1 296 ? -3.674  52.380 -4.463  1.00 15.40  ? 293  LYS A O     1 
ATOM   2279 C  CB    . LYS A 1 296 ? -2.873  49.743 -6.481  1.00 25.33  ? 293  LYS A CB    1 
ATOM   2280 C  CG    . LYS A 1 296 ? -4.375  49.552 -6.354  1.00 33.55  ? 293  LYS A CG    1 
ATOM   2281 C  CD    . LYS A 1 296 ? -4.818  48.337 -7.152  1.00 39.94  ? 293  LYS A CD    1 
ATOM   2282 C  CE    . LYS A 1 296 ? -6.309  48.060 -6.965  1.00 46.36  ? 293  LYS A CE    1 
ATOM   2283 N  NZ    . LYS A 1 296 ? -6.915  47.812 -8.313  1.00 50.51  ? 293  LYS A NZ    1 
ATOM   2284 N  N     . ASN A 1 297 ? -2.836  50.561 -3.496  1.00 15.55  ? 294  ASN A N     1 
ATOM   2285 C  CA    . ASN A 1 297 ? -3.462  50.854 -2.248  1.00 15.91  ? 294  ASN A CA    1 
ATOM   2286 C  C     . ASN A 1 297 ? -2.996  52.213 -1.686  1.00 14.67  ? 294  ASN A C     1 
ATOM   2287 O  O     . ASN A 1 297 ? -3.803  52.883 -1.092  1.00 14.39  ? 294  ASN A O     1 
ATOM   2288 C  CB    . ASN A 1 297 ? -3.201  49.821 -1.183  1.00 15.91  ? 294  ASN A CB    1 
ATOM   2289 C  CG    . ASN A 1 297 ? -3.935  48.536 -1.430  1.00 16.45  ? 294  ASN A CG    1 
ATOM   2290 O  OD1   . ASN A 1 297 ? -4.955  48.517 -2.112  1.00 17.99  ? 294  ASN A OD1   1 
ATOM   2291 N  ND2   . ASN A 1 297 ? -3.387  47.435 -0.905  1.00 16.52  ? 294  ASN A ND2   1 
ATOM   2292 N  N     . GLY A 1 298 ? -1.733  52.567 -1.827  1.00 13.05  ? 295  GLY A N     1 
ATOM   2293 C  CA    . GLY A 1 298 ? -1.236  53.804 -1.249  1.00 13.01  ? 295  GLY A CA    1 
ATOM   2294 C  C     . GLY A 1 298 ? -1.794  55.051 -1.912  1.00 13.35  ? 295  GLY A C     1 
ATOM   2295 O  O     . GLY A 1 298 ? -2.134  56.026 -1.196  1.00 13.27  ? 295  GLY A O     1 
ATOM   2296 N  N     . SER A 1 299 ? -1.828  55.050 -3.256  1.00 13.19  ? 296  SER A N     1 
ATOM   2297 C  CA    . SER A 1 299 ? -2.476  56.093 -4.042  1.00 14.33  ? 296  SER A CA    1 
ATOM   2298 C  C     . SER A 1 299 ? -3.958  56.217 -3.668  1.00 14.21  ? 296  SER A C     1 
ATOM   2299 O  O     . SER A 1 299 ? -4.458  57.331 -3.518  1.00 11.18  ? 296  SER A O     1 
ATOM   2300 C  CB    . SER A 1 299 ? -2.361  55.791 -5.539  1.00 17.54  ? 296  SER A CB    1 
ATOM   2301 O  OG    . SER A 1 299 ? -0.984  55.918 -5.899  1.00 22.29  ? 296  SER A OG    1 
ATOM   2302 N  N     . TRP A 1 300 ? -4.627  55.053 -3.505  1.00 12.33  ? 297  TRP A N     1 
ATOM   2303 C  CA    . TRP A 1 300 ? -6.035  55.022 -3.228  1.00 13.13  ? 297  TRP A CA    1 
ATOM   2304 C  C     . TRP A 1 300 ? -6.279  55.659 -1.854  1.00 12.27  ? 297  TRP A C     1 
ATOM   2305 O  O     . TRP A 1 300 ? -7.205  56.519 -1.727  1.00 11.64  ? 297  TRP A O     1 
ATOM   2306 C  CB    . TRP A 1 300 ? -6.557  53.572 -3.268  1.00 13.56  ? 297  TRP A CB    1 
ATOM   2307 C  CG    . TRP A 1 300 ? -8.034  53.494 -3.086  1.00 14.18  ? 297  TRP A CG    1 
ATOM   2308 C  CD1   . TRP A 1 300 ? -8.979  53.633 -4.040  1.00 14.65  ? 297  TRP A CD1   1 
ATOM   2309 C  CD2   . TRP A 1 300 ? -8.730  53.287 -1.845  1.00 13.70  ? 297  TRP A CD2   1 
ATOM   2310 N  NE1   . TRP A 1 300 ? -10.229 53.511 -3.476  1.00 15.75  ? 297  TRP A NE1   1 
ATOM   2311 C  CE2   . TRP A 1 300 ? -10.096 53.273 -2.131  1.00 14.58  ? 297  TRP A CE2   1 
ATOM   2312 C  CE3   . TRP A 1 300 ? -8.323  53.081 -0.549  1.00 14.90  ? 297  TRP A CE3   1 
ATOM   2313 C  CZ2   . TRP A 1 300 ? -11.053 53.111 -1.165  1.00 14.61  ? 297  TRP A CZ2   1 
ATOM   2314 C  CZ3   . TRP A 1 300 ? -9.312  52.917 0.449   1.00 15.53  ? 297  TRP A CZ3   1 
ATOM   2315 C  CH2   . TRP A 1 300 ? -10.650 52.902 0.115   1.00 14.00  ? 297  TRP A CH2   1 
ATOM   2316 N  N     . LEU A 1 301 ? -5.439  55.255 -0.874  1.00 10.86  ? 298  LEU A N     1 
ATOM   2317 C  CA    . LEU A 1 301 ? -5.603  55.763 0.494   1.00 11.30  ? 298  LEU A CA    1 
ATOM   2318 C  C     . LEU A 1 301 ? -5.347  57.241 0.617   1.00 11.22  ? 298  LEU A C     1 
ATOM   2319 O  O     . LEU A 1 301 ? -6.072  57.991 1.343   1.00 9.33   ? 298  LEU A O     1 
ATOM   2320 C  CB    . LEU A 1 301 ? -4.706  55.037 1.504   1.00 10.98  ? 298  LEU A CB    1 
ATOM   2321 C  CG    . LEU A 1 301 ? -5.150  53.594 1.740   1.00 11.41  ? 298  LEU A CG    1 
ATOM   2322 C  CD1   . LEU A 1 301 ? -4.020  52.724 2.315   1.00 11.59  ? 298  LEU A CD1   1 
ATOM   2323 C  CD2   . LEU A 1 301 ? -6.380  53.575 2.660   1.00 11.52  ? 298  LEU A CD2   1 
ATOM   2324 N  N     . TYR A 1 302 ? -4.318  57.685 -0.103  1.00 11.62  ? 299  TYR A N     1 
ATOM   2325 C  CA    . TYR A 1 302 ? -3.954  59.126 -0.097  1.00 11.69  ? 299  TYR A CA    1 
ATOM   2326 C  C     . TYR A 1 302 ? -5.086  59.990 -0.596  1.00 10.80  ? 299  TYR A C     1 
ATOM   2327 O  O     . TYR A 1 302 ? -5.392  61.006 -0.009  1.00 10.17  ? 299  TYR A O     1 
ATOM   2328 C  CB    . TYR A 1 302 ? -2.691  59.380 -0.964  1.00 12.48  ? 299  TYR A CB    1 
ATOM   2329 C  CG    . TYR A 1 302 ? -2.233  60.803 -0.930  1.00 13.58  ? 299  TYR A CG    1 
ATOM   2330 C  CD1   . TYR A 1 302 ? -1.350  61.257 0.055   1.00 14.28  ? 299  TYR A CD1   1 
ATOM   2331 C  CD2   . TYR A 1 302 ? -2.700  61.727 -1.889  1.00 15.97  ? 299  TYR A CD2   1 
ATOM   2332 C  CE1   . TYR A 1 302 ? -0.938  62.596 0.107   1.00 15.12  ? 299  TYR A CE1   1 
ATOM   2333 C  CE2   . TYR A 1 302 ? -2.300  63.079 -1.847  1.00 17.11  ? 299  TYR A CE2   1 
ATOM   2334 C  CZ    . TYR A 1 302 ? -1.366  63.475 -0.862  1.00 16.78  ? 299  TYR A CZ    1 
ATOM   2335 O  OH    . TYR A 1 302 ? -0.989  64.773 -0.815  1.00 17.87  ? 299  TYR A OH    1 
ATOM   2336 N  N     . ALA A 1 303 ? -5.715  59.593 -1.694  1.00 10.87  ? 300  ALA A N     1 
ATOM   2337 C  CA    . ALA A 1 303 ? -6.892  60.302 -2.176  1.00 10.63  ? 300  ALA A CA    1 
ATOM   2338 C  C     . ALA A 1 303 ? -8.154  60.095 -1.299  1.00 10.77  ? 300  ALA A C     1 
ATOM   2339 O  O     . ALA A 1 303 ? -8.920  61.009 -1.070  1.00 11.48  ? 300  ALA A O     1 
ATOM   2340 C  CB    . ALA A 1 303 ? -7.186  59.841 -3.616  1.00 11.42  ? 300  ALA A CB    1 
ATOM   2341 N  N     . MET A 1 304 ? -8.408  58.875 -0.897  1.00 10.48  ? 301  MET A N     1 
ATOM   2342 C  CA    . MET A 1 304 ? -9.652  58.570 -0.188  1.00 10.23  ? 301  MET A CA    1 
ATOM   2343 C  C     . MET A 1 304 ? -9.795  59.290 1.133   1.00 10.34  ? 301  MET A C     1 
ATOM   2344 O  O     . MET A 1 304 ? -10.934 59.689 1.493   1.00 10.15  ? 301  MET A O     1 
ATOM   2345 C  CB    . MET A 1 304 ? -9.769  57.077 0.122   1.00 10.38  ? 301  MET A CB    1 
ATOM   2346 C  CG    . MET A 1 304 ? -11.175 56.619 0.530   1.00 10.54  ? 301  MET A CG    1 
ATOM   2347 S  SD    . MET A 1 304 ? -12.330 56.847 -0.822  1.00 10.99  ? 301  MET A SD    1 
ATOM   2348 C  CE    . MET A 1 304 ? -13.287 58.275 -0.309  1.00 11.65  ? 301  MET A CE    1 
ATOM   2349 N  N     . CYS A 1 305 ? -8.718  59.379 1.897   1.00 10.10  ? 302  CYS A N     1 
ATOM   2350 C  CA    . CYS A 1 305 ? -8.763  60.127 3.176   1.00 11.07  ? 302  CYS A CA    1 
ATOM   2351 C  C     . CYS A 1 305 ? -9.071  61.626 3.028   1.00 10.70  ? 302  CYS A C     1 
ATOM   2352 O  O     . CYS A 1 305 ? -9.414  62.295 4.015   1.00 10.28  ? 302  CYS A O     1 
ATOM   2353 C  CB    . CYS A 1 305 ? -7.505  59.884 4.004   1.00 11.23  ? 302  CYS A CB    1 
ATOM   2354 S  SG    . CYS A 1 305 ? -6.065  60.806 3.412   1.00 11.66  ? 302  CYS A SG    1 
ATOM   2355 N  N     . ARG A 1 306 ? -8.893  62.141 1.798   1.00 11.32  ? 303  ARG A N     1 
ATOM   2356 C  CA    . ARG A 1 306 ? -9.315  63.465 1.389   1.00 11.66  ? 303  ARG A CA    1 
ATOM   2357 C  C     . ARG A 1 306 ? -10.720 63.473 0.721   1.00 11.32  ? 303  ARG A C     1 
ATOM   2358 O  O     . ARG A 1 306 ? -11.232 64.525 0.341   1.00 11.30  ? 303  ARG A O     1 
ATOM   2359 C  CB    . ARG A 1 306 ? -8.232  64.072 0.419   1.00 12.34  ? 303  ARG A CB    1 
ATOM   2360 C  CG    . ARG A 1 306 ? -6.887  64.282 1.118   1.00 12.29  ? 303  ARG A CG    1 
ATOM   2361 C  CD    . ARG A 1 306 ? -5.761  64.675 0.181   1.00 12.89  ? 303  ARG A CD    1 
ATOM   2362 N  NE    . ARG A 1 306 ? -4.606  65.073 1.000   1.00 13.28  ? 303  ARG A NE    1 
ATOM   2363 C  CZ    . ARG A 1 306 ? -3.864  64.261 1.735   1.00 13.10  ? 303  ARG A CZ    1 
ATOM   2364 N  NH1   . ARG A 1 306 ? -2.868  64.766 2.473   1.00 13.81  ? 303  ARG A NH1   1 
ATOM   2365 N  NH2   . ARG A 1 306 ? -4.005  62.937 1.625   1.00 13.97  ? 303  ARG A NH2   1 
ATOM   2366 N  N     . GLY A 1 307 ? -11.392 62.340 0.650   1.00 11.38  ? 304  GLY A N     1 
ATOM   2367 C  CA    . GLY A 1 307 ? -12.734 62.304 0.091   1.00 11.12  ? 304  GLY A CA    1 
ATOM   2368 C  C     . GLY A 1 307 ? -12.757 62.113 -1.425  1.00 11.27  ? 304  GLY A C     1 
ATOM   2369 O  O     . GLY A 1 307 ? -13.813 62.299 -2.055  1.00 10.20  ? 304  GLY A O     1 
ATOM   2370 N  N     . ILE A 1 308 ? -11.642 61.653 -1.982  1.00 11.56  ? 305  ILE A N     1 
ATOM   2371 C  CA    . ILE A 1 308 ? -11.452 61.604 -3.430  1.00 12.59  ? 305  ILE A CA    1 
ATOM   2372 C  C     . ILE A 1 308 ? -11.267 60.145 -3.833  1.00 13.12  ? 305  ILE A C     1 
ATOM   2373 O  O     . ILE A 1 308 ? -10.463 59.384 -3.234  1.00 11.50  ? 305  ILE A O     1 
ATOM   2374 C  CB    . ILE A 1 308 ? -10.245 62.440 -3.845  1.00 14.89  ? 305  ILE A CB    1 
ATOM   2375 C  CG1   . ILE A 1 308 ? -10.486 63.915 -3.460  1.00 15.33  ? 305  ILE A CG1   1 
ATOM   2376 C  CG2   . ILE A 1 308 ? -9.971  62.302 -5.351  1.00 15.89  ? 305  ILE A CG2   1 
ATOM   2377 C  CD1   . ILE A 1 308 ? -9.309  64.826 -3.819  1.00 17.47  ? 305  ILE A CD1   1 
ATOM   2378 N  N     . GLU A 1 309 ? -12.027 59.728 -4.835  1.00 14.16  ? 306  GLU A N     1 
ATOM   2379 C  CA    . GLU A 1 309 ? -11.993 58.327 -5.306  1.00 16.42  ? 306  GLU A CA    1 
ATOM   2380 C  C     . GLU A 1 309 ? -12.619 58.254 -6.684  1.00 17.63  ? 306  GLU A C     1 
ATOM   2381 O  O     . GLU A 1 309 ? -13.578 58.976 -6.992  1.00 16.34  ? 306  GLU A O     1 
ATOM   2382 C  CB    . GLU A 1 309 ? -12.763 57.416 -4.349  1.00 18.64  ? 306  GLU A CB    1 
ATOM   2383 C  CG    . GLU A 1 309 ? -12.505 55.966 -4.568  1.00 20.64  ? 306  GLU A CG    1 
ATOM   2384 C  CD    . GLU A 1 309 ? -13.736 55.115 -4.768  1.00 25.42  ? 306  GLU A CD    1 
ATOM   2385 O  OE1   . GLU A 1 309 ? -14.938 55.569 -4.745  1.00 25.06  ? 306  GLU A OE1   1 
ATOM   2386 O  OE2   . GLU A 1 309 ? -13.414 53.917 -4.913  1.00 25.91  ? 306  GLU A OE2   1 
ATOM   2387 N  N     . HIS A 1 310 ? -12.027 57.446 -7.556  1.00 19.33  ? 307  HIS A N     1 
ATOM   2388 C  CA    . HIS A 1 310 ? -12.350 57.556 -9.000  1.00 21.82  ? 307  HIS A CA    1 
ATOM   2389 C  C     . HIS A 1 310 ? -12.945 56.309 -9.598  1.00 19.84  ? 307  HIS A C     1 
ATOM   2390 O  O     . HIS A 1 310 ? -13.197 56.299 -10.792 1.00 20.51  ? 307  HIS A O     1 
ATOM   2391 C  CB    . HIS A 1 310 ? -11.119 58.004 -9.786  1.00 26.61  ? 307  HIS A CB    1 
ATOM   2392 C  CG    . HIS A 1 310 ? -10.669 59.384 -9.408  1.00 32.38  ? 307  HIS A CG    1 
ATOM   2393 N  ND1   . HIS A 1 310 ? -11.463 60.500 -9.598  1.00 32.14  ? 307  HIS A ND1   1 
ATOM   2394 C  CD2   . HIS A 1 310 ? -9.557  59.808 -8.766  1.00 33.13  ? 307  HIS A CD2   1 
ATOM   2395 C  CE1   . HIS A 1 310 ? -10.833 61.562 -9.132  1.00 35.33  ? 307  HIS A CE1   1 
ATOM   2396 N  NE2   . HIS A 1 310 ? -9.672  61.166 -8.629  1.00 35.34  ? 307  HIS A NE2   1 
ATOM   2397 N  N     . ASP A 1 311 ? -13.189 55.303 -8.782  1.00 17.67  ? 308  ASP A N     1 
ATOM   2398 C  CA    . ASP A 1 311 ? -13.805 54.053 -9.254  1.00 20.70  ? 308  ASP A CA    1 
ATOM   2399 C  C     . ASP A 1 311 ? -15.157 54.364 -9.946  1.00 19.88  ? 308  ASP A C     1 
ATOM   2400 O  O     . ASP A 1 311 ? -16.050 54.943 -9.335  1.00 16.80  ? 308  ASP A O     1 
ATOM   2401 C  CB    . ASP A 1 311 ? -13.924 53.026 -8.139  1.00 22.17  ? 308  ASP A CB    1 
ATOM   2402 C  CG    . ASP A 1 311 ? -14.505 51.695 -8.615  1.00 28.85  ? 308  ASP A CG    1 
ATOM   2403 O  OD1   . ASP A 1 311 ? -15.408 51.171 -7.965  1.00 36.49  ? 308  ASP A OD1   1 
ATOM   2404 O  OD2   . ASP A 1 311 ? -14.066 51.128 -9.636  1.00 36.15  ? 308  ASP A OD2   1 
ATOM   2405 N  N     . PRO A 1 312 ? -15.290 53.972 -11.241 1.00 19.31  ? 309  PRO A N     1 
ATOM   2406 C  CA    . PRO A 1 312 ? -16.519 54.292 -11.970 1.00 16.87  ? 309  PRO A CA    1 
ATOM   2407 C  C     . PRO A 1 312 ? -17.686 53.435 -11.615 1.00 14.81  ? 309  PRO A C     1 
ATOM   2408 O  O     . PRO A 1 312 ? -17.534 52.273 -11.221 1.00 13.43  ? 309  PRO A O     1 
ATOM   2409 C  CB    . PRO A 1 312 ? -16.126 54.077 -13.451 1.00 17.94  ? 309  PRO A CB    1 
ATOM   2410 C  CG    . PRO A 1 312 ? -14.980 53.065 -13.395 1.00 18.92  ? 309  PRO A CG    1 
ATOM   2411 C  CD    . PRO A 1 312 ? -14.261 53.351 -12.115 1.00 19.04  ? 309  PRO A CD    1 
ATOM   2412 N  N     . VAL A 1 313 ? -18.870 54.024 -11.721 1.00 14.81  ? 310  VAL A N     1 
ATOM   2413 C  CA    . VAL A 1 313 ? -20.118 53.244 -11.673 1.00 14.36  ? 310  VAL A CA    1 
ATOM   2414 C  C     . VAL A 1 313 ? -20.148 52.458 -12.990 1.00 14.38  ? 310  VAL A C     1 
ATOM   2415 O  O     . VAL A 1 313 ? -20.161 53.057 -14.107 1.00 14.33  ? 310  VAL A O     1 
ATOM   2416 C  CB    . VAL A 1 313 ? -21.338 54.147 -11.595 1.00 14.89  ? 310  VAL A CB    1 
ATOM   2417 C  CG1   . VAL A 1 313 ? -22.633 53.333 -11.658 1.00 15.03  ? 310  VAL A CG1   1 
ATOM   2418 C  CG2   . VAL A 1 313 ? -21.295 54.999 -10.322 1.00 14.21  ? 310  VAL A CG2   1 
ATOM   2419 N  N     . LYS A 1 314 ? -20.011 51.147 -12.888 1.00 15.80  ? 311  LYS A N     1 
ATOM   2420 C  CA    . LYS A 1 314 ? -19.911 50.302 -14.071 1.00 17.53  ? 311  LYS A CA    1 
ATOM   2421 C  C     . LYS A 1 314 ? -21.278 50.030 -14.609 1.00 17.08  ? 311  LYS A C     1 
ATOM   2422 O  O     . LYS A 1 314 ? -22.195 49.669 -13.835 1.00 15.50  ? 311  LYS A O     1 
ATOM   2423 C  CB    . LYS A 1 314 ? -19.226 48.978 -13.745 1.00 19.36  ? 311  LYS A CB    1 
ATOM   2424 C  CG    . LYS A 1 314 ? -17.754 49.193 -13.449 1.00 22.67  ? 311  LYS A CG    1 
ATOM   2425 C  CD    . LYS A 1 314 ? -17.153 47.983 -12.758 1.00 27.80  ? 311  LYS A CD    1 
ATOM   2426 C  CE    . LYS A 1 314 ? -15.729 48.280 -12.314 1.00 33.68  ? 311  LYS A CE    1 
ATOM   2427 N  NZ    . LYS A 1 314 ? -15.577 49.574 -11.520 1.00 37.77  ? 311  LYS A NZ    1 
ATOM   2428 N  N     . PRO A 1 315 ? -21.454 50.198 -15.925 1.00 18.37  ? 312  PRO A N     1 
ATOM   2429 C  CA    . PRO A 1 315 ? -22.723 49.854 -16.538 1.00 18.30  ? 312  PRO A CA    1 
ATOM   2430 C  C     . PRO A 1 315 ? -22.884 48.333 -16.560 1.00 20.76  ? 312  PRO A C     1 
ATOM   2431 O  O     . PRO A 1 315 ? -22.537 47.669 -17.572 1.00 19.70  ? 312  PRO A O     1 
ATOM   2432 C  CB    . PRO A 1 315 ? -22.586 50.445 -17.947 1.00 18.53  ? 312  PRO A CB    1 
ATOM   2433 C  CG    . PRO A 1 315 ? -21.138 50.337 -18.239 1.00 18.88  ? 312  PRO A CG    1 
ATOM   2434 C  CD    . PRO A 1 315 ? -20.487 50.688 -16.934 1.00 19.29  ? 312  PRO A CD    1 
ATOM   2435 N  N     . ARG A 1 316 ? -23.435 47.788 -15.471 1.00 20.41  ? 313  ARG A N     1 
ATOM   2436 C  CA    . ARG A 1 316 ? -23.674 46.334 -15.340 1.00 21.57  ? 313  ARG A CA    1 
ATOM   2437 C  C     . ARG A 1 316 ? -24.832 46.059 -14.374 1.00 21.24  ? 313  ARG A C     1 
ATOM   2438 O  O     . ARG A 1 316 ? -24.704 46.271 -13.189 1.00 19.07  ? 313  ARG A O     1 
ATOM   2439 C  CB    . ARG A 1 316 ? -22.414 45.655 -14.846 1.00 26.39  ? 313  ARG A CB    1 
ATOM   2440 C  CG    . ARG A 1 316 ? -22.392 44.126 -14.975 1.00 31.01  ? 313  ARG A CG    1 
ATOM   2441 C  CD    . ARG A 1 316 ? -21.210 43.506 -14.226 1.00 32.83  ? 313  ARG A CD    1 
ATOM   2442 N  NE    . ARG A 1 316 ? -21.392 43.671 -12.794 1.00 38.15  ? 313  ARG A NE    1 
ATOM   2443 C  CZ    . ARG A 1 316 ? -20.642 44.421 -11.976 1.00 45.76  ? 313  ARG A CZ    1 
ATOM   2444 N  NH1   . ARG A 1 316 ? -20.970 44.485 -10.667 1.00 43.49  ? 313  ARG A NH1   1 
ATOM   2445 N  NH2   . ARG A 1 316 ? -19.558 45.080 -12.414 1.00 45.98  ? 313  ARG A NH2   1 
ATOM   2446 N  N     . GLN A 1 317 ? -25.954 45.608 -14.904 1.00 21.75  ? 314  GLN A N     1 
ATOM   2447 C  CA    . GLN A 1 317 ? -27.193 45.356 -14.154 1.00 27.24  ? 314  GLN A CA    1 
ATOM   2448 C  C     . GLN A 1 317 ? -27.377 43.865 -13.816 1.00 27.84  ? 314  GLN A C     1 
ATOM   2449 O  O     . GLN A 1 317 ? -28.242 43.523 -12.991 1.00 27.27  ? 314  GLN A O     1 
ATOM   2450 C  CB    . GLN A 1 317 ? -28.410 45.752 -15.009 1.00 30.92  ? 314  GLN A CB    1 
ATOM   2451 C  CG    . GLN A 1 317 ? -29.685 45.919 -14.186 1.00 37.72  ? 314  GLN A CG    1 
ATOM   2452 C  CD    . GLN A 1 317 ? -30.892 46.448 -14.955 1.00 39.42  ? 314  GLN A CD    1 
ATOM   2453 O  OE1   . GLN A 1 317 ? -32.053 46.331 -14.506 1.00 36.60  ? 314  GLN A OE1   1 
ATOM   2454 N  NE2   . GLN A 1 317 ? -30.627 47.032 -16.112 1.00 42.99  ? 314  GLN A NE2   1 
ATOM   2455 N  N     . LEU A 1 318 ? -26.603 43.015 -14.485 1.00 24.08  ? 315  LEU A N     1 
ATOM   2456 C  CA    . LEU A 1 318 ? -26.678 41.580 -14.351 1.00 25.65  ? 315  LEU A CA    1 
ATOM   2457 C  C     . LEU A 1 318 ? -25.419 41.020 -13.673 1.00 24.52  ? 315  LEU A C     1 
ATOM   2458 O  O     . LEU A 1 318 ? -24.306 41.485 -13.933 1.00 24.34  ? 315  LEU A O     1 
ATOM   2459 C  CB    . LEU A 1 318 ? -26.786 40.910 -15.739 1.00 25.68  ? 315  LEU A CB    1 
ATOM   2460 C  CG    . LEU A 1 318 ? -27.969 41.290 -16.620 1.00 26.67  ? 315  LEU A CG    1 
ATOM   2461 C  CD1   . LEU A 1 318 ? -27.911 40.580 -17.997 1.00 25.82  ? 315  LEU A CD1   1 
ATOM   2462 C  CD2   . LEU A 1 318 ? -29.296 40.993 -15.931 1.00 27.29  ? 315  LEU A CD2   1 
ATOM   2463 N  N     . PRO A 1 319 ? -25.585 39.963 -12.848 1.00 24.82  ? 316  PRO A N     1 
ATOM   2464 C  CA    . PRO A 1 319 ? -24.399 39.214 -12.365 1.00 26.96  ? 316  PRO A CA    1 
ATOM   2465 C  C     . PRO A 1 319 ? -23.518 38.634 -13.514 1.00 25.58  ? 316  PRO A C     1 
ATOM   2466 O  O     . PRO A 1 319 ? -24.086 38.223 -14.499 1.00 23.68  ? 316  PRO A O     1 
ATOM   2467 C  CB    . PRO A 1 319 ? -25.032 38.067 -11.535 1.00 28.95  ? 316  PRO A CB    1 
ATOM   2468 C  CG    . PRO A 1 319 ? -26.445 38.508 -11.246 1.00 29.02  ? 316  PRO A CG    1 
ATOM   2469 C  CD    . PRO A 1 319 ? -26.861 39.342 -12.414 1.00 25.29  ? 316  PRO A CD    1 
ATOM   2470 N  N     . LYS A 1 320 ? -22.182 38.560 -13.360 1.00 25.83  ? 317  LYS A N     1 
ATOM   2471 C  CA    . LYS A 1 320 ? -21.278 37.917 -14.344 1.00 24.95  ? 317  LYS A CA    1 
ATOM   2472 C  C     . LYS A 1 320 ? -21.013 36.427 -14.053 1.00 24.93  ? 317  LYS A C     1 
ATOM   2473 O  O     . LYS A 1 320 ? -20.256 35.752 -14.782 1.00 21.50  ? 317  LYS A O     1 
ATOM   2474 C  CB    . LYS A 1 320 ? -19.868 38.507 -14.293 1.00 32.21  ? 317  LYS A CB    1 
ATOM   2475 C  CG    . LYS A 1 320 ? -19.674 39.995 -14.040 1.00 39.80  ? 317  LYS A CG    1 
ATOM   2476 C  CD    . LYS A 1 320 ? -18.155 40.295 -14.096 1.00 42.09  ? 317  LYS A CD    1 
ATOM   2477 C  CE    . LYS A 1 320 ? -17.870 41.714 -14.544 1.00 45.83  ? 317  LYS A CE    1 
ATOM   2478 N  NZ    . LYS A 1 320 ? -16.439 41.878 -14.895 1.00 48.32  ? 317  LYS A NZ    1 
ATOM   2479 N  N     . THR A 1 321 ? -21.509 35.966 -12.907 1.00 21.88  ? 318  THR A N     1 
ATOM   2480 C  CA    . THR A 1 321 ? -21.386 34.566 -12.481 1.00 22.17  ? 318  THR A CA    1 
ATOM   2481 C  C     . THR A 1 321 ? -22.733 34.144 -11.936 1.00 19.13  ? 318  THR A C     1 
ATOM   2482 O  O     . THR A 1 321 ? -23.542 34.971 -11.521 1.00 19.51  ? 318  THR A O     1 
ATOM   2483 C  CB    . THR A 1 321 ? -20.265 34.320 -11.411 1.00 23.89  ? 318  THR A CB    1 
ATOM   2484 O  OG1   . THR A 1 321 ? -20.477 35.170 -10.278 1.00 20.86  ? 318  THR A OG1   1 
ATOM   2485 C  CG2   . THR A 1 321 ? -18.891 34.606 -11.972 1.00 24.46  ? 318  THR A CG2   1 
ATOM   2486 N  N     . ILE A 1 322 ? -23.022 32.862 -12.038 1.00 18.23  ? 319  ILE A N     1 
ATOM   2487 C  CA    . ILE A 1 322 ? -24.260 32.245 -11.498 1.00 19.22  ? 319  ILE A CA    1 
ATOM   2488 C  C     . ILE A 1 322 ? -23.779 30.959 -10.794 1.00 18.48  ? 319  ILE A C     1 
ATOM   2489 O  O     . ILE A 1 322 ? -23.260 30.055 -11.457 1.00 17.41  ? 319  ILE A O     1 
ATOM   2490 C  CB    . ILE A 1 322 ? -25.249 31.897 -12.610 1.00 18.78  ? 319  ILE A CB    1 
ATOM   2491 C  CG1   . ILE A 1 322 ? -25.701 33.201 -13.304 1.00 20.90  ? 319  ILE A CG1   1 
ATOM   2492 C  CG2   . ILE A 1 322 ? -26.421 31.104 -12.070 1.00 19.47  ? 319  ILE A CG2   1 
ATOM   2493 C  CD1   . ILE A 1 322 ? -26.921 33.057 -14.210 1.00 20.55  ? 319  ILE A CD1   1 
ATOM   2494 N  N     . GLY A 1 323 ? -23.916 30.917 -9.479  1.00 17.16  ? 320  GLY A N     1 
ATOM   2495 C  CA    . GLY A 1 323 ? -23.319 29.881 -8.672  1.00 17.70  ? 320  GLY A CA    1 
ATOM   2496 C  C     . GLY A 1 323 ? -24.317 29.238 -7.735  1.00 18.61  ? 320  GLY A C     1 
ATOM   2497 O  O     . GLY A 1 323 ? -25.347 29.820 -7.430  1.00 20.38  ? 320  GLY A O     1 
ATOM   2498 N  N     . CYS A 1 324 ? -23.973 28.022 -7.311  1.00 18.41  ? 321  CYS A N     1 
ATOM   2499 C  CA    A CYS A 1 324 ? -24.780 27.202 -6.441  0.44 19.77  ? 321  CYS A CA    1 
ATOM   2500 C  CA    B CYS A 1 324 ? -24.784 27.213 -6.395  0.56 18.79  ? 321  CYS A CA    1 
ATOM   2501 C  C     . CYS A 1 324 ? -23.835 26.497 -5.481  1.00 18.88  ? 321  CYS A C     1 
ATOM   2502 O  O     . CYS A 1 324 ? -22.922 25.822 -5.928  1.00 18.16  ? 321  CYS A O     1 
ATOM   2503 C  CB    A CYS A 1 324 ? -25.497 26.159 -7.313  0.44 21.34  ? 321  CYS A CB    1 
ATOM   2504 C  CB    B CYS A 1 324 ? -25.590 26.111 -7.121  0.56 19.11  ? 321  CYS A CB    1 
ATOM   2505 S  SG    A CYS A 1 324 ? -26.929 25.405 -6.576  0.44 23.48  ? 321  CYS A SG    1 
ATOM   2506 S  SG    B CYS A 1 324 ? -26.878 26.685 -8.230  0.56 18.97  ? 321  CYS A SG    1 
ATOM   2507 N  N     . SER A 1 325 ? -24.070 26.620 -4.181  1.00 19.73  ? 322  SER A N     1 
ATOM   2508 C  CA    . SER A 1 325 ? -23.191 25.980 -3.241  1.00 20.15  ? 322  SER A CA    1 
ATOM   2509 C  C     . SER A 1 325 ? -23.889 25.490 -2.004  1.00 17.53  ? 322  SER A C     1 
ATOM   2510 O  O     . SER A 1 325 ? -24.919 26.038 -1.619  1.00 17.75  ? 322  SER A O     1 
ATOM   2511 C  CB    . SER A 1 325 ? -22.045 26.961 -2.902  1.00 20.99  ? 322  SER A CB    1 
ATOM   2512 O  OG    . SER A 1 325 ? -22.312 27.788 -1.819  1.00 22.01  ? 322  SER A OG    1 
ATOM   2513 N  N     . LYS A 1 326 ? -23.295 24.482 -1.362  1.00 18.50  ? 323  LYS A N     1 
ATOM   2514 C  CA    . LYS A 1 326 ? -23.752 24.025 -0.053  1.00 19.07  ? 323  LYS A CA    1 
ATOM   2515 C  C     . LYS A 1 326 ? -22.614 23.510 0.816   1.00 20.30  ? 323  LYS A C     1 
ATOM   2516 O  O     . LYS A 1 326 ? -21.752 22.828 0.323   1.00 16.78  ? 323  LYS A O     1 
ATOM   2517 C  CB    . LYS A 1 326 ? -24.825 22.941 -0.232  1.00 19.62  ? 323  LYS A CB    1 
ATOM   2518 C  CG    . LYS A 1 326 ? -25.328 22.351 1.075   1.00 19.93  ? 323  LYS A CG    1 
ATOM   2519 C  CD    . LYS A 1 326 ? -26.506 21.408 0.839   1.00 20.28  ? 323  LYS A CD    1 
ATOM   2520 C  CE    . LYS A 1 326 ? -27.013 20.726 2.113   1.00 20.28  ? 323  LYS A CE    1 
ATOM   2521 N  NZ    . LYS A 1 326 ? -27.468 21.744 3.053   1.00 20.84  ? 323  LYS A NZ    1 
ATOM   2522 N  N     . ASN A 1 327 ? -22.650 23.866 2.101   1.00 20.23  ? 324  ASN A N     1 
ATOM   2523 C  CA    . ASN A 1 327 ? -21.785 23.299 3.114   1.00 22.78  ? 324  ASN A CA    1 
ATOM   2524 C  C     . ASN A 1 327 ? -22.397 22.073 3.809   1.00 21.20  ? 324  ASN A C     1 
ATOM   2525 O  O     . ASN A 1 327 ? -23.610 21.959 3.951   1.00 18.14  ? 324  ASN A O     1 
ATOM   2526 C  CB    . ASN A 1 327 ? -21.415 24.351 4.117   1.00 24.56  ? 324  ASN A CB    1 
ATOM   2527 C  CG    . ASN A 1 327 ? -20.627 25.477 3.462   1.00 29.51  ? 324  ASN A CG    1 
ATOM   2528 O  OD1   . ASN A 1 327 ? -19.504 25.301 3.017   1.00 29.86  ? 324  ASN A OD1   1 
ATOM   2529 N  ND2   . ASN A 1 327 ? -21.254 26.594 3.318   1.00 33.66  ? 324  ASN A ND2   1 
ATOM   2530 N  N     . PHE A 1 328 ? -21.505 21.159 4.198   1.00 21.53  ? 325  PHE A N     1 
ATOM   2531 C  CA    . PHE A 1 328 ? -21.865 19.845 4.726   1.00 21.97  ? 325  PHE A CA    1 
ATOM   2532 C  C     . PHE A 1 328 ? -21.035 19.693 6.001   1.00 25.51  ? 325  PHE A C     1 
ATOM   2533 O  O     . PHE A 1 328 ? -19.952 19.056 6.008   1.00 25.99  ? 325  PHE A O     1 
ATOM   2534 C  CB    . PHE A 1 328 ? -21.496 18.780 3.747   1.00 18.83  ? 325  PHE A CB    1 
ATOM   2535 C  CG    . PHE A 1 328 ? -22.270 18.845 2.513   1.00 18.12  ? 325  PHE A CG    1 
ATOM   2536 C  CD1   . PHE A 1 328 ? -21.723 19.444 1.404   1.00 15.74  ? 325  PHE A CD1   1 
ATOM   2537 C  CD2   . PHE A 1 328 ? -23.584 18.374 2.476   1.00 15.40  ? 325  PHE A CD2   1 
ATOM   2538 C  CE1   . PHE A 1 328 ? -22.446 19.557 0.258   1.00 16.82  ? 325  PHE A CE1   1 
ATOM   2539 C  CE2   . PHE A 1 328 ? -24.296 18.446 1.326   1.00 16.10  ? 325  PHE A CE2   1 
ATOM   2540 C  CZ    . PHE A 1 328 ? -23.741 19.064 0.189   1.00 15.98  ? 325  PHE A CZ    1 
ATOM   2541 N  N     . PRO A 1 329 ? -21.504 20.320 7.075   1.00 30.58  ? 326  PRO A N     1 
ATOM   2542 C  CA    . PRO A 1 329 ? -20.663 20.480 8.258   1.00 31.84  ? 326  PRO A CA    1 
ATOM   2543 C  C     . PRO A 1 329 ? -20.632 19.252 9.168   1.00 33.19  ? 326  PRO A C     1 
ATOM   2544 O  O     . PRO A 1 329 ? -21.574 18.448 9.173   1.00 26.17  ? 326  PRO A O     1 
ATOM   2545 C  CB    . PRO A 1 329 ? -21.323 21.657 8.971   1.00 34.24  ? 326  PRO A CB    1 
ATOM   2546 C  CG    . PRO A 1 329 ? -22.782 21.476 8.636   1.00 33.34  ? 326  PRO A CG    1 
ATOM   2547 C  CD    . PRO A 1 329 ? -22.766 21.081 7.188   1.00 31.52  ? 326  PRO A CD    1 
ATOM   2548 N  N     . GLY A 1 330 ? -19.524 19.131 9.907   1.00 39.82  ? 327  GLY A N     1 
ATOM   2549 C  CA    . GLY A 1 330 ? -19.356 18.154 10.984  1.00 40.94  ? 327  GLY A CA    1 
ATOM   2550 C  C     . GLY A 1 330 ? -19.612 16.728 10.524  1.00 44.07  ? 327  GLY A C     1 
ATOM   2551 O  O     . GLY A 1 330 ? -18.855 16.188 9.693   1.00 41.72  ? 327  GLY A O     1 
ATOM   2552 N  N     . LYS A 1 331 ? -20.701 16.149 11.038  1.00 44.19  ? 328  LYS A N     1 
ATOM   2553 C  CA    . LYS A 1 331 ? -21.043 14.759 10.775  1.00 49.90  ? 328  LYS A CA    1 
ATOM   2554 C  C     . LYS A 1 331 ? -21.614 14.595 9.419   1.00 45.01  ? 328  LYS A C     1 
ATOM   2555 O  O     . LYS A 1 331 ? -21.488 13.521 8.860   1.00 55.31  ? 328  LYS A O     1 
ATOM   2556 C  CB    . LYS A 1 331 ? -22.055 14.202 11.791  1.00 52.97  ? 328  LYS A CB    1 
ATOM   2557 C  CG    . LYS A 1 331 ? -21.570 14.148 13.231  1.00 56.96  ? 328  LYS A CG    1 
ATOM   2558 C  CD    . LYS A 1 331 ? -20.107 13.768 13.360  1.00 61.48  ? 328  LYS A CD    1 
ATOM   2559 C  CE    . LYS A 1 331 ? -19.768 13.335 14.786  1.00 66.20  ? 328  LYS A CE    1 
ATOM   2560 N  NZ    . LYS A 1 331 ? -20.143 14.330 15.835  1.00 66.50  ? 328  LYS A NZ    1 
ATOM   2561 N  N     . THR A 1 332 ? -22.239 15.638 8.874   1.00 41.93  ? 329  THR A N     1 
ATOM   2562 C  CA    . THR A 1 332 ? -22.888 15.532 7.574   1.00 36.99  ? 329  THR A CA    1 
ATOM   2563 C  C     . THR A 1 332 ? -21.904 15.580 6.405   1.00 31.96  ? 329  THR A C     1 
ATOM   2564 O  O     . THR A 1 332 ? -22.319 15.516 5.269   1.00 33.69  ? 329  THR A O     1 
ATOM   2565 C  CB    . THR A 1 332 ? -23.924 16.640 7.377   1.00 36.85  ? 329  THR A CB    1 
ATOM   2566 O  OG1   . THR A 1 332 ? -23.248 17.898 7.430   1.00 33.39  ? 329  THR A OG1   1 
ATOM   2567 C  CG2   . THR A 1 332 ? -25.023 16.545 8.471   1.00 36.27  ? 329  THR A CG2   1 
ATOM   2568 N  N     . ALA A 1 333 ? -20.623 15.696 6.678   1.00 29.78  ? 330  ALA A N     1 
ATOM   2569 C  CA    . ALA A 1 333 ? -19.611 15.758 5.628   1.00 30.39  ? 330  ALA A CA    1 
ATOM   2570 C  C     . ALA A 1 333 ? -19.657 14.538 4.731   1.00 31.23  ? 330  ALA A C     1 
ATOM   2571 O  O     . ALA A 1 333 ? -19.984 13.420 5.160   1.00 31.87  ? 330  ALA A O     1 
ATOM   2572 C  CB    . ALA A 1 333 ? -18.238 15.967 6.246   1.00 29.71  ? 330  ALA A CB    1 
ATOM   2573 N  N     . LEU A 1 334 ? -19.410 14.775 3.451   1.00 32.12  ? 331  LEU A N     1 
ATOM   2574 C  CA    . LEU A 1 334 ? -19.717 13.805 2.438   1.00 31.58  ? 331  LEU A CA    1 
ATOM   2575 C  C     . LEU A 1 334 ? -18.614 12.730 2.372   1.00 30.37  ? 331  LEU A C     1 
ATOM   2576 O  O     . LEU A 1 334 ? -17.467 13.017 2.077   1.00 35.45  ? 331  LEU A O     1 
ATOM   2577 C  CB    . LEU A 1 334 ? -19.888 14.508 1.090   1.00 32.73  ? 331  LEU A CB    1 
ATOM   2578 C  CG    . LEU A 1 334 ? -20.944 15.610 1.000   1.00 32.73  ? 331  LEU A CG    1 
ATOM   2579 C  CD1   . LEU A 1 334 ? -21.148 15.977 -0.473  1.00 33.43  ? 331  LEU A CD1   1 
ATOM   2580 C  CD2   . LEU A 1 334 ? -22.243 15.180 1.671   1.00 29.64  ? 331  LEU A CD2   1 
ATOM   2581 N  N     . ALA A 1 335 ? -18.969 11.500 2.692   1.00 33.15  ? 332  ALA A N     1 
ATOM   2582 C  CA    . ALA A 1 335 ? -17.951 10.473 2.983   1.00 35.80  ? 332  ALA A CA    1 
ATOM   2583 C  C     . ALA A 1 335 ? -17.870 9.372  1.953   1.00 36.10  ? 332  ALA A C     1 
ATOM   2584 O  O     . ALA A 1 335 ? -16.877 8.632  1.946   1.00 43.04  ? 332  ALA A O     1 
ATOM   2585 C  CB    . ALA A 1 335 ? -18.228 9.868  4.348   1.00 35.66  ? 332  ALA A CB    1 
ATOM   2586 N  N     . THR A 1 336 ? -18.930 9.191  1.164   1.00 33.44  ? 333  THR A N     1 
ATOM   2587 C  CA    . THR A 1 336 ? -18.961 8.216  0.117   1.00 34.78  ? 333  THR A CA    1 
ATOM   2588 C  C     . THR A 1 336 ? -19.017 8.884  -1.245  1.00 41.92  ? 333  THR A C     1 
ATOM   2589 O  O     . THR A 1 336 ? -19.595 9.985  -1.392  1.00 37.47  ? 333  THR A O     1 
ATOM   2590 C  CB    . THR A 1 336 ? -20.169 7.280  0.274   1.00 35.90  ? 333  THR A CB    1 
ATOM   2591 O  OG1   . THR A 1 336 ? -21.369 7.910  -0.164  1.00 31.29  ? 333  THR A OG1   1 
ATOM   2592 C  CG2   . THR A 1 336 ? -20.342 6.856  1.733   1.00 38.84  ? 333  THR A CG2   1 
ATOM   2593 N  N     . ARG A 1 337 ? -18.443 8.191  -2.238  1.00 43.74  ? 334  ARG A N     1 
ATOM   2594 C  CA    . ARG A 1 337 ? -18.558 8.569  -3.652  1.00 44.72  ? 334  ARG A CA    1 
ATOM   2595 C  C     . ARG A 1 337 ? -19.995 8.787  -4.143  1.00 42.16  ? 334  ARG A C     1 
ATOM   2596 O  O     . ARG A 1 337 ? -20.239 9.671  -4.987  1.00 35.62  ? 334  ARG A O     1 
ATOM   2597 C  CB    . ARG A 1 337 ? -17.855 7.559  -4.583  1.00 53.28  ? 334  ARG A CB    1 
ATOM   2598 C  CG    . ARG A 1 337 ? -16.695 8.155  -5.387  1.00 60.04  ? 334  ARG A CG    1 
ATOM   2599 C  CD    . ARG A 1 337 ? -16.180 7.208  -6.482  1.00 67.30  ? 334  ARG A CD    1 
ATOM   2600 N  NE    . ARG A 1 337 ? -14.947 6.516  -6.085  1.00 71.62  ? 334  ARG A NE    1 
ATOM   2601 C  CZ    . ARG A 1 337 ? -13.702 7.004  -6.162  1.00 75.80  ? 334  ARG A CZ    1 
ATOM   2602 N  NH1   . ARG A 1 337 ? -13.440 8.227  -6.634  1.00 73.94  ? 334  ARG A NH1   1 
ATOM   2603 N  NH2   . ARG A 1 337 ? -12.688 6.235  -5.761  1.00 83.30  ? 334  ARG A NH2   1 
ATOM   2604 N  N     . GLU A 1 338 ? -20.930 7.994  -3.630  1.00 38.89  ? 335  GLU A N     1 
ATOM   2605 C  CA    . GLU A 1 338 ? -22.323 8.085  -4.065  1.00 40.36  ? 335  GLU A CA    1 
ATOM   2606 C  C     . GLU A 1 338 ? -23.047 9.326  -3.503  1.00 36.77  ? 335  GLU A C     1 
ATOM   2607 O  O     . GLU A 1 338 ? -23.964 9.865  -4.122  1.00 32.15  ? 335  GLU A O     1 
ATOM   2608 C  CB    . GLU A 1 338 ? -23.077 6.793  -3.703  1.00 46.72  ? 335  GLU A CB    1 
ATOM   2609 C  CG    . GLU A 1 338 ? -24.064 6.308  -4.769  1.00 57.37  ? 335  GLU A CG    1 
ATOM   2610 C  CD    . GLU A 1 338 ? -23.460 6.236  -6.170  1.00 67.42  ? 335  GLU A CD    1 
ATOM   2611 O  OE1   . GLU A 1 338 ? -22.214 6.165  -6.279  1.00 76.10  ? 335  GLU A OE1   1 
ATOM   2612 O  OE2   . GLU A 1 338 ? -24.224 6.272  -7.166  1.00 77.14  ? 335  GLU A OE2   1 
ATOM   2613 N  N     . GLN A 1 339 ? -22.652 9.740  -2.310  1.00 32.61  ? 336  GLN A N     1 
ATOM   2614 C  CA    . GLN A 1 339 ? -23.168 10.955 -1.742  1.00 31.72  ? 336  GLN A CA    1 
ATOM   2615 C  C     . GLN A 1 339 ? -22.668 12.157 -2.586  1.00 29.52  ? 336  GLN A C     1 
ATOM   2616 O  O     . GLN A 1 339 ? -23.441 13.055 -2.928  1.00 28.28  ? 336  GLN A O     1 
ATOM   2617 C  CB    . GLN A 1 339 ? -22.635 11.151 -0.337  1.00 31.73  ? 336  GLN A CB    1 
ATOM   2618 C  CG    . GLN A 1 339 ? -23.429 10.563 0.788   1.00 30.39  ? 336  GLN A CG    1 
ATOM   2619 C  CD    . GLN A 1 339 ? -22.848 11.033 2.090   1.00 30.24  ? 336  GLN A CD    1 
ATOM   2620 O  OE1   . GLN A 1 339 ? -21.717 10.697 2.419   1.00 31.46  ? 336  GLN A OE1   1 
ATOM   2621 N  NE2   . GLN A 1 339 ? -23.575 11.860 2.802   1.00 28.41  ? 336  GLN A NE2   1 
ATOM   2622 N  N     . VAL A 1 340 ? -21.368 12.166 -2.863  1.00 25.85  ? 337  VAL A N     1 
ATOM   2623 C  CA    . VAL A 1 340 ? -20.715 13.262 -3.562  1.00 27.58  ? 337  VAL A CA    1 
ATOM   2624 C  C     . VAL A 1 340 ? -21.334 13.512 -4.925  1.00 27.28  ? 337  VAL A C     1 
ATOM   2625 O  O     . VAL A 1 340 ? -21.490 14.649 -5.336  1.00 29.25  ? 337  VAL A O     1 
ATOM   2626 C  CB    . VAL A 1 340 ? -19.198 13.025 -3.695  1.00 26.69  ? 337  VAL A CB    1 
ATOM   2627 C  CG1   . VAL A 1 340 ? -18.543 14.036 -4.634  1.00 24.98  ? 337  VAL A CG1   1 
ATOM   2628 C  CG2   . VAL A 1 340 ? -18.535 13.114 -2.329  1.00 26.74  ? 337  VAL A CG2   1 
ATOM   2629 N  N     . GLN A 1 341 ? -21.704 12.439 -5.590  1.00 28.51  ? 338  GLN A N     1 
ATOM   2630 C  CA    . GLN A 1 341 ? -22.298 12.475 -6.893  1.00 30.60  ? 338  GLN A CA    1 
ATOM   2631 C  C     . GLN A 1 341 ? -23.755 12.895 -6.787  1.00 30.43  ? 338  GLN A C     1 
ATOM   2632 O  O     . GLN A 1 341 ? -24.225 13.616 -7.643  1.00 32.29  ? 338  GLN A O     1 
ATOM   2633 C  CB    . GLN A 1 341 ? -22.194 11.097 -7.579  1.00 33.94  ? 338  GLN A CB    1 
ATOM   2634 C  CG    . GLN A 1 341 ? -20.759 10.767 -7.998  1.00 37.16  ? 338  GLN A CG    1 
ATOM   2635 C  CD    . GLN A 1 341 ? -20.613 9.389  -8.608  1.00 40.92  ? 338  GLN A CD    1 
ATOM   2636 O  OE1   . GLN A 1 341 ? -21.453 8.498  -8.409  1.00 42.79  ? 338  GLN A OE1   1 
ATOM   2637 N  NE2   . GLN A 1 341 ? -19.548 9.209  -9.394  1.00 42.27  ? 338  GLN A NE2   1 
ATOM   2638 N  N     . TRP A 1 342 ? -24.474 12.422 -5.771  1.00 24.53  ? 339  TRP A N     1 
ATOM   2639 C  CA    . TRP A 1 342 ? -25.862 12.821 -5.589  1.00 24.20  ? 339  TRP A CA    1 
ATOM   2640 C  C     . TRP A 1 342 ? -25.986 14.356 -5.328  1.00 22.40  ? 339  TRP A C     1 
ATOM   2641 O  O     . TRP A 1 342 ? -26.843 14.990 -5.871  1.00 20.89  ? 339  TRP A O     1 
ATOM   2642 C  CB    . TRP A 1 342 ? -26.505 12.044 -4.437  1.00 22.90  ? 339  TRP A CB    1 
ATOM   2643 C  CG    . TRP A 1 342 ? -27.994 12.237 -4.379  1.00 22.39  ? 339  TRP A CG    1 
ATOM   2644 C  CD1   . TRP A 1 342 ? -28.918 11.655 -5.185  1.00 21.89  ? 339  TRP A CD1   1 
ATOM   2645 C  CD2   . TRP A 1 342 ? -28.712 13.128 -3.533  1.00 21.04  ? 339  TRP A CD2   1 
ATOM   2646 N  NE1   . TRP A 1 342 ? -30.180 12.097 -4.880  1.00 21.18  ? 339  TRP A NE1   1 
ATOM   2647 C  CE2   . TRP A 1 342 ? -30.084 13.008 -3.868  1.00 20.56  ? 339  TRP A CE2   1 
ATOM   2648 C  CE3   . TRP A 1 342 ? -28.329 14.043 -2.550  1.00 21.58  ? 339  TRP A CE3   1 
ATOM   2649 C  CZ2   . TRP A 1 342 ? -31.091 13.732 -3.229  1.00 21.07  ? 339  TRP A CZ2   1 
ATOM   2650 C  CZ3   . TRP A 1 342 ? -29.341 14.770 -1.882  1.00 21.75  ? 339  TRP A CZ3   1 
ATOM   2651 C  CH2   . TRP A 1 342 ? -30.695 14.618 -2.234  1.00 21.32  ? 339  TRP A CH2   1 
ATOM   2652 N  N     . TRP A 1 343 ? -25.094 14.910 -4.504  1.00 21.87  ? 340  TRP A N     1 
ATOM   2653 C  CA    . TRP A 1 343 ? -25.142 16.334 -4.184  1.00 22.39  ? 340  TRP A CA    1 
ATOM   2654 C  C     . TRP A 1 343 ? -24.657 17.178 -5.342  1.00 24.34  ? 340  TRP A C     1 
ATOM   2655 O  O     . TRP A 1 343 ? -25.170 18.280 -5.533  1.00 24.33  ? 340  TRP A O     1 
ATOM   2656 C  CB    . TRP A 1 343 ? -24.362 16.664 -2.921  1.00 20.84  ? 340  TRP A CB    1 
ATOM   2657 C  CG    . TRP A 1 343 ? -25.178 16.323 -1.670  1.00 23.60  ? 340  TRP A CG    1 
ATOM   2658 C  CD1   . TRP A 1 343 ? -24.991 15.279 -0.836  1.00 24.34  ? 340  TRP A CD1   1 
ATOM   2659 C  CD2   . TRP A 1 343 ? -26.335 17.046 -1.158  1.00 23.45  ? 340  TRP A CD2   1 
ATOM   2660 N  NE1   . TRP A 1 343 ? -25.966 15.287 0.159   1.00 23.54  ? 340  TRP A NE1   1 
ATOM   2661 C  CE2   . TRP A 1 343 ? -26.775 16.379 -0.012  1.00 23.57  ? 340  TRP A CE2   1 
ATOM   2662 C  CE3   . TRP A 1 343 ? -27.005 18.201 -1.553  1.00 23.70  ? 340  TRP A CE3   1 
ATOM   2663 C  CZ2   . TRP A 1 343 ? -27.848 16.824 0.740   1.00 22.56  ? 340  TRP A CZ2   1 
ATOM   2664 C  CZ3   . TRP A 1 343 ? -28.061 18.653 -0.796  1.00 23.14  ? 340  TRP A CZ3   1 
ATOM   2665 C  CH2   . TRP A 1 343 ? -28.482 17.955 0.337   1.00 24.10  ? 340  TRP A CH2   1 
ATOM   2666 N  N     . LEU A 1 344 ? -23.658 16.696 -6.086  1.00 22.50  ? 341  LEU A N     1 
ATOM   2667 C  CA    . LEU A 1 344 ? -23.228 17.427 -7.283  1.00 24.04  ? 341  LEU A CA    1 
ATOM   2668 C  C     . LEU A 1 344 ? -24.402 17.501 -8.241  1.00 21.27  ? 341  LEU A C     1 
ATOM   2669 O  O     . LEU A 1 344 ? -24.657 18.567 -8.843  1.00 19.51  ? 341  LEU A O     1 
ATOM   2670 C  CB    . LEU A 1 344 ? -22.007 16.803 -7.974  1.00 24.90  ? 341  LEU A CB    1 
ATOM   2671 C  CG    . LEU A 1 344 ? -20.645 17.049 -7.339  1.00 24.79  ? 341  LEU A CG    1 
ATOM   2672 C  CD1   . LEU A 1 344 ? -19.617 16.156 -7.986  1.00 26.87  ? 341  LEU A CD1   1 
ATOM   2673 C  CD2   . LEU A 1 344 ? -20.231 18.508 -7.423  1.00 25.63  ? 341  LEU A CD2   1 
ATOM   2674 N  N     . LEU A 1 345 ? -25.139 16.400 -8.348  1.00 20.22  ? 342  LEU A N     1 
ATOM   2675 C  CA    . LEU A 1 345 ? -26.314 16.379 -9.180  1.00 21.44  ? 342  LEU A CA    1 
ATOM   2676 C  C     . LEU A 1 345 ? -27.383 17.376 -8.714  1.00 19.30  ? 342  LEU A C     1 
ATOM   2677 O  O     . LEU A 1 345 ? -27.934 18.098 -9.527  1.00 19.45  ? 342  LEU A O     1 
ATOM   2678 C  CB    . LEU A 1 345 ? -26.879 14.956 -9.289  1.00 23.20  ? 342  LEU A CB    1 
ATOM   2679 C  CG    . LEU A 1 345 ? -28.212 14.885 -10.064 1.00 23.11  ? 342  LEU A CG    1 
ATOM   2680 C  CD1   . LEU A 1 345 ? -28.061 15.382 -11.499 1.00 22.69  ? 342  LEU A CD1   1 
ATOM   2681 C  CD2   . LEU A 1 345 ? -28.798 13.472 -10.039 1.00 24.32  ? 342  LEU A CD2   1 
ATOM   2682 N  N     . GLN A 1 346 ? -27.646 17.418 -7.414  1.00 18.67  ? 343  GLN A N     1 
ATOM   2683 C  CA    . GLN A 1 346 ? -28.559 18.402 -6.841  1.00 18.39  ? 343  GLN A CA    1 
ATOM   2684 C  C     . GLN A 1 346 ? -28.167 19.863 -7.173  1.00 18.58  ? 343  GLN A C     1 
ATOM   2685 O  O     . GLN A 1 346 ? -29.010 20.665 -7.662  1.00 14.81  ? 343  GLN A O     1 
ATOM   2686 C  CB    . GLN A 1 346 ? -28.637 18.254 -5.313  1.00 18.25  ? 343  GLN A CB    1 
ATOM   2687 C  CG    . GLN A 1 346 ? -29.145 16.892 -4.816  1.00 19.23  ? 343  GLN A CG    1 
ATOM   2688 C  CD    . GLN A 1 346 ? -30.284 16.358 -5.647  1.00 19.85  ? 343  GLN A CD    1 
ATOM   2689 O  OE1   . GLN A 1 346 ? -31.394 16.898 -5.647  1.00 21.08  ? 343  GLN A OE1   1 
ATOM   2690 N  NE2   . GLN A 1 346 ? -29.999 15.304 -6.426  1.00 23.17  ? 343  GLN A NE2   1 
ATOM   2691 N  N     . LEU A 1 347 ? -26.899 20.172 -6.935  1.00 19.30  ? 344  LEU A N     1 
ATOM   2692 C  CA    . LEU A 1 347 ? -26.392 21.499 -7.268  1.00 20.15  ? 344  LEU A CA    1 
ATOM   2693 C  C     . LEU A 1 347 ? -26.502 21.766 -8.764  1.00 18.97  ? 344  LEU A C     1 
ATOM   2694 O  O     . LEU A 1 347 ? -26.893 22.850 -9.171  1.00 17.83  ? 344  LEU A O     1 
ATOM   2695 C  CB    . LEU A 1 347 ? -24.952 21.671 -6.856  1.00 20.14  ? 344  LEU A CB    1 
ATOM   2696 C  CG    . LEU A 1 347 ? -24.732 21.727 -5.337  1.00 23.06  ? 344  LEU A CG    1 
ATOM   2697 C  CD1   . LEU A 1 347 ? -23.260 21.932 -5.013  1.00 26.53  ? 344  LEU A CD1   1 
ATOM   2698 C  CD2   . LEU A 1 347 ? -25.456 22.844 -4.715  1.00 22.30  ? 344  LEU A CD2   1 
ATOM   2699 N  N     . ALA A 1 348 ? -26.120 20.788 -9.556  1.00 18.06  ? 345  ALA A N     1 
ATOM   2700 C  CA    . ALA A 1 348 ? -26.142 20.942 -10.997 1.00 17.21  ? 345  ALA A CA    1 
ATOM   2701 C  C     . ALA A 1 348 ? -27.533 21.156 -11.530 1.00 15.90  ? 345  ALA A C     1 
ATOM   2702 O  O     . ALA A 1 348 ? -27.687 21.856 -12.534 1.00 13.77  ? 345  ALA A O     1 
ATOM   2703 C  CB    . ALA A 1 348 ? -25.474 19.752 -11.695 1.00 18.13  ? 345  ALA A CB    1 
ATOM   2704 N  N     . GLN A 1 349 ? -28.552 20.535 -10.907 1.00 16.28  ? 346  GLN A N     1 
ATOM   2705 C  CA    . GLN A 1 349 ? -29.959 20.725 -11.340 1.00 16.66  ? 346  GLN A CA    1 
ATOM   2706 C  C     . GLN A 1 349 ? -30.475 22.160 -11.109 1.00 17.05  ? 346  GLN A C     1 
ATOM   2707 O  O     . GLN A 1 349 ? -31.177 22.755 -11.949 1.00 15.80  ? 346  GLN A O     1 
ATOM   2708 C  CB    . GLN A 1 349 ? -30.879 19.718 -10.618 1.00 19.12  ? 346  GLN A CB    1 
ATOM   2709 C  CG    . GLN A 1 349 ? -30.621 18.280 -11.071 1.00 22.56  ? 346  GLN A CG    1 
ATOM   2710 C  CD    . GLN A 1 349 ? -31.611 17.236 -10.594 1.00 26.11  ? 346  GLN A CD    1 
ATOM   2711 O  OE1   . GLN A 1 349 ? -32.318 17.395 -9.597  1.00 30.45  ? 346  GLN A OE1   1 
ATOM   2712 N  NE2   . GLN A 1 349 ? -31.631 16.128 -11.313 1.00 25.77  ? 346  GLN A NE2   1 
ATOM   2713 N  N     . GLU A 1 350 ? -30.118 22.723 -9.963  1.00 17.02  ? 347  GLU A N     1 
ATOM   2714 C  CA    . GLU A 1 350 ? -30.511 24.105 -9.665  1.00 18.01  ? 347  GLU A CA    1 
ATOM   2715 C  C     . GLU A 1 350 ? -29.802 25.068 -10.630 1.00 15.09  ? 347  GLU A C     1 
ATOM   2716 O  O     . GLU A 1 350 ? -30.394 26.019 -11.089 1.00 13.42  ? 347  GLU A O     1 
ATOM   2717 C  CB    . GLU A 1 350 ? -30.187 24.488 -8.227  1.00 18.43  ? 347  GLU A CB    1 
ATOM   2718 C  CG    . GLU A 1 350 ? -30.883 25.795 -7.857  1.00 22.65  ? 347  GLU A CG    1 
ATOM   2719 C  CD    . GLU A 1 350 ? -30.410 26.394 -6.536  1.00 23.69  ? 347  GLU A CD    1 
ATOM   2720 O  OE1   . GLU A 1 350 ? -29.974 25.656 -5.621  1.00 27.99  ? 347  GLU A OE1   1 
ATOM   2721 O  OE2   . GLU A 1 350 ? -30.408 27.624 -6.425  1.00 24.11  ? 347  GLU A OE2   1 
ATOM   2722 N  N     . LEU A 1 351 ? -28.539 24.774 -10.878 1.00 15.31  ? 348  LEU A N     1 
ATOM   2723 C  CA    . LEU A 1 351 ? -27.708 25.558 -11.740 1.00 15.94  ? 348  LEU A CA    1 
ATOM   2724 C  C     . LEU A 1 351 ? -28.274 25.553 -13.153 1.00 17.29  ? 348  LEU A C     1 
ATOM   2725 O  O     . LEU A 1 351 ? -28.469 26.628 -13.759 1.00 15.59  ? 348  LEU A O     1 
ATOM   2726 C  CB    . LEU A 1 351 ? -26.283 25.027 -11.757 1.00 16.16  ? 348  LEU A CB    1 
ATOM   2727 C  CG    . LEU A 1 351 ? -25.302 26.046 -12.413 1.00 16.05  ? 348  LEU A CG    1 
ATOM   2728 C  CD1   . LEU A 1 351 ? -25.331 27.468 -11.815 1.00 17.15  ? 348  LEU A CD1   1 
ATOM   2729 C  CD2   . LEU A 1 351 ? -23.920 25.505 -12.480 1.00 15.86  ? 348  LEU A CD2   1 
ATOM   2730 N  N     . GLU A 1 352 ? -28.626 24.369 -13.639 1.00 16.93  ? 349  GLU A N     1 
ATOM   2731 C  CA    . GLU A 1 352 ? -29.201 24.274 -14.962 1.00 19.86  ? 349  GLU A CA    1 
ATOM   2732 C  C     . GLU A 1 352 ? -30.449 25.113 -15.083 1.00 18.65  ? 349  GLU A C     1 
ATOM   2733 O  O     . GLU A 1 352 ? -30.699 25.801 -16.116 1.00 17.56  ? 349  GLU A O     1 
ATOM   2734 C  CB    . GLU A 1 352 ? -29.547 22.826 -15.296 1.00 24.32  ? 349  GLU A CB    1 
ATOM   2735 C  CG    . GLU A 1 352 ? -30.136 22.636 -16.681 1.00 30.08  ? 349  GLU A CG    1 
ATOM   2736 C  CD    . GLU A 1 352 ? -30.969 21.379 -16.723 1.00 41.02  ? 349  GLU A CD    1 
ATOM   2737 O  OE1   . GLU A 1 352 ? -32.200 21.546 -16.911 1.00 49.80  ? 349  GLU A OE1   1 
ATOM   2738 O  OE2   . GLU A 1 352 ? -30.411 20.245 -16.494 1.00 41.72  ? 349  GLU A OE2   1 
ATOM   2739 N  N     . GLU A 1 353 ? -31.273 25.019 -14.060 1.00 18.96  ? 350  GLU A N     1 
ATOM   2740 C  CA    . GLU A 1 353 ? -32.516 25.784 -14.005 1.00 20.87  ? 350  GLU A CA    1 
ATOM   2741 C  C     . GLU A 1 353 ? -32.270 27.325 -14.064 1.00 18.58  ? 350  GLU A C     1 
ATOM   2742 O  O     . GLU A 1 353 ? -32.900 28.049 -14.856 1.00 18.36  ? 350  GLU A O     1 
ATOM   2743 C  CB    . GLU A 1 353 ? -33.231 25.346 -12.747 1.00 25.57  ? 350  GLU A CB    1 
ATOM   2744 C  CG    . GLU A 1 353 ? -34.596 25.891 -12.506 1.00 31.66  ? 350  GLU A CG    1 
ATOM   2745 C  CD    . GLU A 1 353 ? -35.327 25.145 -11.373 1.00 35.97  ? 350  GLU A CD    1 
ATOM   2746 O  OE1   . GLU A 1 353 ? -36.284 25.733 -10.836 1.00 39.77  ? 350  GLU A OE1   1 
ATOM   2747 O  OE2   . GLU A 1 353 ? -34.971 23.976 -11.049 1.00 33.97  ? 350  GLU A OE2   1 
ATOM   2748 N  N     . ARG A 1 354 ? -31.317 27.804 -13.275 1.00 16.16  ? 351  ARG A N     1 
ATOM   2749 C  CA    . ARG A 1 354 ? -30.961 29.217 -13.275 1.00 15.39  ? 351  ARG A CA    1 
ATOM   2750 C  C     . ARG A 1 354 ? -30.305 29.610 -14.594 1.00 15.92  ? 351  ARG A C     1 
ATOM   2751 O  O     . ARG A 1 354 ? -30.642 30.685 -15.159 1.00 14.37  ? 351  ARG A O     1 
ATOM   2752 C  CB    . ARG A 1 354 ? -30.067 29.552 -12.086 1.00 15.27  ? 351  ARG A CB    1 
ATOM   2753 C  CG    A ARG A 1 354 ? -30.877 29.429 -10.788 0.46 14.84  ? 351  ARG A CG    1 
ATOM   2754 C  CG    B ARG A 1 354 ? -30.697 29.474 -10.705 0.54 14.84  ? 351  ARG A CG    1 
ATOM   2755 C  CD    A ARG A 1 354 ? -29.997 29.281 -9.573  0.46 14.42  ? 351  ARG A CD    1 
ATOM   2756 C  CD    B ARG A 1 354 ? -29.694 29.996 -9.678  0.54 14.12  ? 351  ARG A CD    1 
ATOM   2757 N  NE    A ARG A 1 354 ? -29.199 30.465 -9.404  0.46 13.86  ? 351  ARG A NE    1 
ATOM   2758 N  NE    B ARG A 1 354 ? -29.407 31.416 -9.891  0.54 14.09  ? 351  ARG A NE    1 
ATOM   2759 C  CZ    A ARG A 1 354 ? -28.255 30.604 -8.483  0.46 14.20  ? 351  ARG A CZ    1 
ATOM   2760 C  CZ    B ARG A 1 354 ? -28.383 32.099 -9.368  0.54 14.25  ? 351  ARG A CZ    1 
ATOM   2761 N  NH1   A ARG A 1 354 ? -27.988 29.611 -7.600  0.46 13.26  ? 351  ARG A NH1   1 
ATOM   2762 N  NH1   B ARG A 1 354 ? -27.479 31.522 -8.604  0.54 15.10  ? 351  ARG A NH1   1 
ATOM   2763 N  NH2   A ARG A 1 354 ? -27.594 31.771 -8.456  0.46 14.41  ? 351  ARG A NH2   1 
ATOM   2764 N  NH2   B ARG A 1 354 ? -28.240 33.385 -9.636  0.54 14.46  ? 351  ARG A NH2   1 
ATOM   2765 N  N     . LEU A 1 355 ? -29.437 28.744 -15.122 1.00 13.98  ? 352  LEU A N     1 
ATOM   2766 C  CA    . LEU A 1 355 ? -28.821 29.026 -16.411 1.00 15.12  ? 352  LEU A CA    1 
ATOM   2767 C  C     . LEU A 1 355 ? -29.788 29.146 -17.616 1.00 16.89  ? 352  LEU A C     1 
ATOM   2768 O  O     . LEU A 1 355 ? -29.705 30.083 -18.445 1.00 16.53  ? 352  LEU A O     1 
ATOM   2769 C  CB    . LEU A 1 355 ? -27.758 28.007 -16.719 1.00 14.55  ? 352  LEU A CB    1 
ATOM   2770 C  CG    . LEU A 1 355 ? -26.513 28.113 -15.891 1.00 14.93  ? 352  LEU A CG    1 
ATOM   2771 C  CD1   . LEU A 1 355 ? -25.600 26.948 -16.197 1.00 15.39  ? 352  LEU A CD1   1 
ATOM   2772 C  CD2   . LEU A 1 355 ? -25.777 29.400 -16.196 1.00 15.78  ? 352  LEU A CD2   1 
ATOM   2773 N  N     . THR A 1 356 ? -30.700 28.187 -17.732 1.00 19.04  ? 353  THR A N     1 
ATOM   2774 C  CA    . THR A 1 356 ? -31.686 28.195 -18.803 1.00 20.06  ? 353  THR A CA    1 
ATOM   2775 C  C     . THR A 1 356 ? -32.525 29.445 -18.722 1.00 19.58  ? 353  THR A C     1 
ATOM   2776 O  O     . THR A 1 356 ? -32.818 30.027 -19.738 1.00 20.40  ? 353  THR A O     1 
ATOM   2777 C  CB    . THR A 1 356 ? -32.607 26.967 -18.689 1.00 20.78  ? 353  THR A CB    1 
ATOM   2778 O  OG1   . THR A 1 356 ? -31.793 25.804 -18.736 1.00 21.30  ? 353  THR A OG1   1 
ATOM   2779 C  CG2   . THR A 1 356 ? -33.591 26.936 -19.808 1.00 21.75  ? 353  THR A CG2   1 
ATOM   2780 N  N     . LYS A 1 357 ? -32.945 29.839 -17.510 1.00 19.73  ? 354  LYS A N     1 
ATOM   2781 C  CA    . LYS A 1 357 ? -33.714 31.081 -17.342 1.00 21.27  ? 354  LYS A CA    1 
ATOM   2782 C  C     . LYS A 1 357 ? -32.864 32.291 -17.780 1.00 19.86  ? 354  LYS A C     1 
ATOM   2783 O  O     . LYS A 1 357 ? -33.324 33.215 -18.455 1.00 20.53  ? 354  LYS A O     1 
ATOM   2784 C  CB    . LYS A 1 357 ? -34.157 31.248 -15.890 1.00 25.55  ? 354  LYS A CB    1 
ATOM   2785 C  CG    . LYS A 1 357 ? -34.965 32.496 -15.595 1.00 28.97  ? 354  LYS A CG    1 
ATOM   2786 C  CD    . LYS A 1 357 ? -36.309 32.427 -16.316 1.00 32.83  ? 354  LYS A CD    1 
ATOM   2787 C  CE    . LYS A 1 357 ? -37.258 33.511 -15.826 1.00 38.12  ? 354  LYS A CE    1 
ATOM   2788 N  NZ    . LYS A 1 357 ? -38.640 33.181 -16.300 1.00 41.38  ? 354  LYS A NZ    1 
ATOM   2789 N  N     . ASP A 1 358 ? -31.607 32.267 -17.385 1.00 18.80  ? 355  ASP A N     1 
ATOM   2790 C  CA    . ASP A 1 358 ? -30.717 33.363 -17.696 1.00 20.54  ? 355  ASP A CA    1 
ATOM   2791 C  C     . ASP A 1 358 ? -30.540 33.515 -19.218 1.00 20.67  ? 355  ASP A C     1 
ATOM   2792 O  O     . ASP A 1 358 ? -30.455 34.643 -19.726 1.00 26.59  ? 355  ASP A O     1 
ATOM   2793 C  CB    . ASP A 1 358 ? -29.372 33.148 -17.014 1.00 18.33  ? 355  ASP A CB    1 
ATOM   2794 C  CG    . ASP A 1 358 ? -28.399 34.318 -17.247 1.00 18.00  ? 355  ASP A CG    1 
ATOM   2795 O  OD1   . ASP A 1 358 ? -28.610 35.391 -16.620 1.00 18.12  ? 355  ASP A OD1   1 
ATOM   2796 O  OD2   . ASP A 1 358 ? -27.449 34.161 -18.049 1.00 15.87  ? 355  ASP A OD2   1 
ATOM   2797 N  N     . ARG A 1 359 ? -30.406 32.405 -19.927 1.00 20.79  ? 356  ARG A N     1 
ATOM   2798 C  CA    . ARG A 1 359 ? -30.252 32.398 -21.361 1.00 21.08  ? 356  ARG A CA    1 
ATOM   2799 C  C     . ARG A 1 359 ? -31.468 32.953 -22.108 1.00 20.12  ? 356  ARG A C     1 
ATOM   2800 O  O     . ARG A 1 359 ? -31.303 33.741 -22.985 1.00 17.97  ? 356  ARG A O     1 
ATOM   2801 C  CB    . ARG A 1 359 ? -29.910 31.010 -21.877 1.00 23.57  ? 356  ARG A CB    1 
ATOM   2802 C  CG    . ARG A 1 359 ? -29.487 30.969 -23.359 1.00 25.29  ? 356  ARG A CG    1 
ATOM   2803 C  CD    . ARG A 1 359 ? -29.107 29.537 -23.756 1.00 26.21  ? 356  ARG A CD    1 
ATOM   2804 N  NE    . ARG A 1 359 ? -30.322 28.711 -23.709 1.00 29.78  ? 356  ARG A NE    1 
ATOM   2805 C  CZ    . ARG A 1 359 ? -30.401 27.391 -23.510 1.00 30.23  ? 356  ARG A CZ    1 
ATOM   2806 N  NH1   . ARG A 1 359 ? -29.293 26.665 -23.329 1.00 28.46  ? 356  ARG A NH1   1 
ATOM   2807 N  NH2   . ARG A 1 359 ? -31.626 26.806 -23.499 1.00 29.68  ? 356  ARG A NH2   1 
ATOM   2808 N  N     . ASN A 1 360 ? -32.663 32.574 -21.708 1.00 21.25  ? 357  ASN A N     1 
ATOM   2809 C  CA    . ASN A 1 360 ? -33.908 33.148 -22.286 1.00 22.10  ? 357  ASN A CA    1 
ATOM   2810 C  C     . ASN A 1 360 ? -34.124 34.654 -21.990 1.00 23.99  ? 357  ASN A C     1 
ATOM   2811 O  O     . ASN A 1 360 ? -34.605 35.437 -22.860 1.00 22.46  ? 357  ASN A O     1 
ATOM   2812 C  CB    . ASN A 1 360 ? -35.097 32.364 -21.728 1.00 23.37  ? 357  ASN A CB    1 
ATOM   2813 C  CG    . ASN A 1 360 ? -35.200 30.982 -22.336 1.00 24.06  ? 357  ASN A CG    1 
ATOM   2814 O  OD1   . ASN A 1 360 ? -34.832 30.770 -23.470 1.00 23.88  ? 357  ASN A OD1   1 
ATOM   2815 N  ND2   . ASN A 1 360 ? -35.741 30.054 -21.595 1.00 25.15  ? 357  ASN A ND2   1 
ATOM   2816 N  N     . ASP A 1 361 ? -33.810 35.049 -20.754 1.00 22.23  ? 358  ASP A N     1 
ATOM   2817 C  CA    . ASP A 1 361 ? -34.022 36.443 -20.317 1.00 24.65  ? 358  ASP A CA    1 
ATOM   2818 C  C     . ASP A 1 361 ? -32.997 37.400 -20.848 1.00 21.61  ? 358  ASP A C     1 
ATOM   2819 O  O     . ASP A 1 361 ? -33.325 38.553 -21.127 1.00 20.35  ? 358  ASP A O     1 
ATOM   2820 C  CB    . ASP A 1 361 ? -34.006 36.567 -18.771 1.00 26.05  ? 358  ASP A CB    1 
ATOM   2821 C  CG    . ASP A 1 361 ? -35.229 35.975 -18.124 1.00 29.30  ? 358  ASP A CG    1 
ATOM   2822 O  OD1   . ASP A 1 361 ? -36.256 35.742 -18.826 1.00 29.32  ? 358  ASP A OD1   1 
ATOM   2823 O  OD2   . ASP A 1 361 ? -35.129 35.741 -16.899 1.00 28.03  ? 358  ASP A OD2   1 
ATOM   2824 N  N     . ASN A 1 362 ? -31.755 36.964 -20.889 1.00 21.98  ? 359  ASN A N     1 
ATOM   2825 C  CA    . ASN A 1 362 ? -30.639 37.907 -21.053 1.00 23.87  ? 359  ASN A CA    1 
ATOM   2826 C  C     . ASN A 1 362 ? -29.813 37.662 -22.268 1.00 22.05  ? 359  ASN A C     1 
ATOM   2827 O  O     . ASN A 1 362 ? -28.896 38.380 -22.492 1.00 21.76  ? 359  ASN A O     1 
ATOM   2828 C  CB    . ASN A 1 362 ? -29.794 37.973 -19.764 1.00 23.20  ? 359  ASN A CB    1 
ATOM   2829 C  CG    . ASN A 1 362 ? -30.662 38.328 -18.544 1.00 25.01  ? 359  ASN A CG    1 
ATOM   2830 O  OD1   . ASN A 1 362 ? -31.513 39.176 -18.649 1.00 23.81  ? 359  ASN A OD1   1 
ATOM   2831 N  ND2   . ASN A 1 362 ? -30.469 37.643 -17.397 1.00 26.32  ? 359  ASN A ND2   1 
ATOM   2832 N  N     . ASP A 1 363 ? -30.147 36.681 -23.086 1.00 24.17  ? 360  ASP A N     1 
ATOM   2833 C  CA    . ASP A 1 363 ? -29.468 36.490 -24.356 1.00 25.36  ? 360  ASP A CA    1 
ATOM   2834 C  C     . ASP A 1 363 ? -27.996 36.315 -24.217 1.00 27.87  ? 360  ASP A C     1 
ATOM   2835 O  O     . ASP A 1 363 ? -27.246 37.014 -24.876 1.00 29.43  ? 360  ASP A O     1 
ATOM   2836 C  CB    . ASP A 1 363 ? -29.766 37.674 -25.332 1.00 28.01  ? 360  ASP A CB    1 
ATOM   2837 C  CG    . ASP A 1 363 ? -31.265 37.855 -25.584 1.00 27.40  ? 360  ASP A CG    1 
ATOM   2838 O  OD1   . ASP A 1 363 ? -31.956 36.868 -25.951 1.00 26.03  ? 360  ASP A OD1   1 
ATOM   2839 O  OD2   . ASP A 1 363 ? -31.741 38.981 -25.397 1.00 25.11  ? 360  ASP A OD2   1 
ATOM   2840 N  N     . ARG A 1 364 ? -27.579 35.337 -23.407 1.00 26.71  ? 361  ARG A N     1 
ATOM   2841 C  CA    . ARG A 1 364 ? -26.156 34.977 -23.194 1.00 26.85  ? 361  ARG A CA    1 
ATOM   2842 C  C     . ARG A 1 364 ? -26.068 33.504 -22.759 1.00 25.33  ? 361  ARG A C     1 
ATOM   2843 O  O     . ARG A 1 364 ? -27.039 32.955 -22.297 1.00 24.31  ? 361  ARG A O     1 
ATOM   2844 C  CB    . ARG A 1 364 ? -25.500 35.870 -22.117 1.00 26.95  ? 361  ARG A CB    1 
ATOM   2845 C  CG    . ARG A 1 364 ? -26.270 35.919 -20.792 1.00 27.02  ? 361  ARG A CG    1 
ATOM   2846 C  CD    . ARG A 1 364 ? -25.599 36.770 -19.712 1.00 26.97  ? 361  ARG A CD    1 
ATOM   2847 N  NE    . ARG A 1 364 ? -26.213 36.576 -18.374 1.00 26.09  ? 361  ARG A NE    1 
ATOM   2848 C  CZ    . ARG A 1 364 ? -25.689 37.037 -17.223 1.00 27.50  ? 361  ARG A CZ    1 
ATOM   2849 N  NH1   . ARG A 1 364 ? -26.300 36.850 -16.035 1.00 27.18  ? 361  ARG A NH1   1 
ATOM   2850 N  NH2   . ARG A 1 364 ? -24.592 37.757 -17.240 1.00 29.41  ? 361  ARG A NH2   1 
ATOM   2851 N  N     . VAL A 1 365 ? -24.895 32.915 -22.918 1.00 25.90  ? 362  VAL A N     1 
ATOM   2852 C  CA    . VAL A 1 365 ? -24.550 31.595 -22.449 1.00 25.06  ? 362  VAL A CA    1 
ATOM   2853 C  C     . VAL A 1 365 ? -23.242 31.603 -21.676 1.00 24.83  ? 362  VAL A C     1 
ATOM   2854 O  O     . VAL A 1 365 ? -22.247 32.226 -22.121 1.00 21.69  ? 362  VAL A O     1 
ATOM   2855 C  CB    . VAL A 1 365 ? -24.377 30.606 -23.626 1.00 31.51  ? 362  VAL A CB    1 
ATOM   2856 C  CG1   . VAL A 1 365 ? -25.749 30.161 -24.108 1.00 34.38  ? 362  VAL A CG1   1 
ATOM   2857 C  CG2   . VAL A 1 365 ? -23.583 31.210 -24.794 1.00 34.08  ? 362  VAL A CG2   1 
ATOM   2858 N  N     . ALA A 1 366 ? -23.234 30.942 -20.517 1.00 20.54  ? 363  ALA A N     1 
ATOM   2859 C  CA    . ALA A 1 366 ? -21.986 30.685 -19.792 1.00 21.19  ? 363  ALA A CA    1 
ATOM   2860 C  C     . ALA A 1 366 ? -21.145 29.690 -20.596 1.00 21.69  ? 363  ALA A C     1 
ATOM   2861 O  O     . ALA A 1 366 ? -21.666 28.820 -21.306 1.00 22.42  ? 363  ALA A O     1 
ATOM   2862 C  CB    . ALA A 1 366 ? -22.270 30.093 -18.435 1.00 20.02  ? 363  ALA A CB    1 
ATOM   2863 N  N     . THR A 1 367 ? -19.841 29.784 -20.464 1.00 21.39  ? 364  THR A N     1 
ATOM   2864 C  CA    . THR A 1 367 ? -18.967 28.835 -21.178 1.00 23.08  ? 364  THR A CA    1 
ATOM   2865 C  C     . THR A 1 367 ? -17.929 28.120 -20.363 1.00 21.50  ? 364  THR A C     1 
ATOM   2866 O  O     . THR A 1 367 ? -17.254 27.279 -20.895 1.00 22.74  ? 364  THR A O     1 
ATOM   2867 C  CB    . THR A 1 367 ? -18.216 29.625 -22.300 1.00 22.64  ? 364  THR A CB    1 
ATOM   2868 O  OG1   . THR A 1 367 ? -17.379 30.620 -21.674 1.00 20.67  ? 364  THR A OG1   1 
ATOM   2869 C  CG2   . THR A 1 367 ? -19.254 30.310 -23.159 1.00 22.61  ? 364  THR A CG2   1 
ATOM   2870 N  N     . GLN A 1 368 ? -17.753 28.503 -19.102 1.00 23.00  ? 365  GLN A N     1 
ATOM   2871 C  CA    . GLN A 1 368 ? -16.854 27.837 -18.190 1.00 24.70  ? 365  GLN A CA    1 
ATOM   2872 C  C     . GLN A 1 368 ? -17.617 27.421 -16.877 1.00 22.05  ? 365  GLN A C     1 
ATOM   2873 O  O     . GLN A 1 368 ? -18.444 28.150 -16.351 1.00 18.76  ? 365  GLN A O     1 
ATOM   2874 C  CB    . GLN A 1 368 ? -15.708 28.756 -17.877 1.00 30.47  ? 365  GLN A CB    1 
ATOM   2875 C  CG    . GLN A 1 368 ? -14.721 28.211 -16.862 1.00 36.52  ? 365  GLN A CG    1 
ATOM   2876 C  CD    . GLN A 1 368 ? -13.407 28.987 -16.893 1.00 44.91  ? 365  GLN A CD    1 
ATOM   2877 O  OE1   . GLN A 1 368 ? -13.375 30.194 -16.634 1.00 53.10  ? 365  GLN A OE1   1 
ATOM   2878 N  NE2   . GLN A 1 368 ? -12.319 28.294 -17.215 1.00 50.33  ? 365  GLN A NE2   1 
ATOM   2879 N  N     . LEU A 1 369 ? -17.379 26.194 -16.452 1.00 21.42  ? 366  LEU A N     1 
ATOM   2880 C  CA    . LEU A 1 369 ? -17.900 25.669 -15.182 1.00 22.21  ? 366  LEU A CA    1 
ATOM   2881 C  C     . LEU A 1 369 ? -16.740 25.595 -14.180 1.00 21.14  ? 366  LEU A C     1 
ATOM   2882 O  O     . LEU A 1 369 ? -15.735 24.943 -14.426 1.00 21.00  ? 366  LEU A O     1 
ATOM   2883 C  CB    . LEU A 1 369 ? -18.473 24.289 -15.386 1.00 22.33  ? 366  LEU A CB    1 
ATOM   2884 C  CG    . LEU A 1 369 ? -19.002 23.610 -14.096 1.00 22.16  ? 366  LEU A CG    1 
ATOM   2885 C  CD1   . LEU A 1 369 ? -20.284 24.316 -13.650 1.00 20.97  ? 366  LEU A CD1   1 
ATOM   2886 C  CD2   . LEU A 1 369 ? -19.241 22.109 -14.314 1.00 22.07  ? 366  LEU A CD2   1 
ATOM   2887 N  N     . VAL A 1 370 ? -16.886 26.269 -13.048 1.00 21.67  ? 367  VAL A N     1 
ATOM   2888 C  CA    . VAL A 1 370 ? -15.852 26.223 -12.021 1.00 22.00  ? 367  VAL A CA    1 
ATOM   2889 C  C     . VAL A 1 370 ? -16.398 25.335 -10.881 1.00 23.57  ? 367  VAL A C     1 
ATOM   2890 O  O     . VAL A 1 370 ? -17.538 25.548 -10.389 1.00 21.41  ? 367  VAL A O     1 
ATOM   2891 C  CB    . VAL A 1 370 ? -15.543 27.637 -11.484 1.00 23.42  ? 367  VAL A CB    1 
ATOM   2892 C  CG1   . VAL A 1 370 ? -14.655 27.565 -10.243 1.00 24.49  ? 367  VAL A CG1   1 
ATOM   2893 C  CG2   . VAL A 1 370 ? -14.936 28.531 -12.584 1.00 23.68  ? 367  VAL A CG2   1 
ATOM   2894 N  N     . VAL A 1 371 ? -15.575 24.396 -10.431 1.00 21.11  ? 368  VAL A N     1 
ATOM   2895 C  CA    . VAL A 1 371 ? -15.941 23.422 -9.420  1.00 22.86  ? 368  VAL A CA    1 
ATOM   2896 C  C     . VAL A 1 371 ? -15.000 23.673 -8.257  1.00 24.59  ? 368  VAL A C     1 
ATOM   2897 O  O     . VAL A 1 371 ? -13.765 23.721 -8.412  1.00 24.53  ? 368  VAL A O     1 
ATOM   2898 C  CB    . VAL A 1 371 ? -15.758 21.989 -9.927  1.00 25.74  ? 368  VAL A CB    1 
ATOM   2899 C  CG1   . VAL A 1 371 ? -16.320 20.967 -8.941  1.00 27.99  ? 368  VAL A CG1   1 
ATOM   2900 C  CG2   . VAL A 1 371 ? -16.428 21.843 -11.272 1.00 29.15  ? 368  VAL A CG2   1 
ATOM   2901 N  N     . SER A 1 372 ? -15.571 23.846 -7.084  1.00 24.36  ? 369  SER A N     1 
ATOM   2902 C  CA    . SER A 1 372 ? -14.796 24.081 -5.900  1.00 25.86  ? 369  SER A CA    1 
ATOM   2903 C  C     . SER A 1 372 ? -15.308 23.195 -4.755  1.00 25.10  ? 369  SER A C     1 
ATOM   2904 O  O     . SER A 1 372 ? -16.507 22.983 -4.611  1.00 23.82  ? 369  SER A O     1 
ATOM   2905 C  CB    . SER A 1 372 ? -14.872 25.562 -5.556  1.00 26.63  ? 369  SER A CB    1 
ATOM   2906 O  OG    . SER A 1 372 ? -14.018 25.876 -4.487  1.00 29.81  ? 369  SER A OG    1 
ATOM   2907 N  N     . ILE A 1 373 ? -14.380 22.662 -3.975  1.00 25.23  ? 370  ILE A N     1 
ATOM   2908 C  CA    . ILE A 1 373 ? -14.691 21.819 -2.842  1.00 28.16  ? 370  ILE A CA    1 
ATOM   2909 C  C     . ILE A 1 373 ? -13.856 22.178 -1.626  1.00 31.31  ? 370  ILE A C     1 
ATOM   2910 O  O     . ILE A 1 373 ? -12.845 22.886 -1.734  1.00 29.12  ? 370  ILE A O     1 
ATOM   2911 C  CB    . ILE A 1 373 ? -14.460 20.335 -3.143  1.00 29.38  ? 370  ILE A CB    1 
ATOM   2912 C  CG1   . ILE A 1 373 ? -12.947 20.020 -3.106  1.00 33.44  ? 370  ILE A CG1   1 
ATOM   2913 C  CG2   . ILE A 1 373 ? -15.214 19.912 -4.408  1.00 27.82  ? 370  ILE A CG2   1 
ATOM   2914 C  CD1   . ILE A 1 373 ? -12.619 18.628 -3.596  1.00 37.42  ? 370  ILE A CD1   1 
ATOM   2915 N  N     . ARG A 1 374 ? -14.285 21.674 -0.466  1.00 33.88  ? 371  ARG A N     1 
ATOM   2916 C  CA    . ARG A 1 374 ? -13.517 21.844 0.767   1.00 36.04  ? 371  ARG A CA    1 
ATOM   2917 C  C     . ARG A 1 374 ? -13.512 20.548 1.539   1.00 39.76  ? 371  ARG A C     1 
ATOM   2918 O  O     . ARG A 1 374 ? -14.578 20.022 1.849   1.00 39.09  ? 371  ARG A O     1 
ATOM   2919 C  CB    . ARG A 1 374 ? -14.074 22.995 1.580   1.00 37.62  ? 371  ARG A CB    1 
ATOM   2920 C  CG    . ARG A 1 374 ? -13.268 23.414 2.811   1.00 40.18  ? 371  ARG A CG    1 
ATOM   2921 C  CD    . ARG A 1 374 ? -14.105 24.314 3.721   1.00 42.31  ? 371  ARG A CD    1 
ATOM   2922 N  NE    . ARG A 1 374 ? -13.351 24.791 4.873   1.00 53.60  ? 371  ARG A NE    1 
ATOM   2923 C  CZ    . ARG A 1 374 ? -13.840 25.527 5.880   1.00 58.16  ? 371  ARG A CZ    1 
ATOM   2924 N  NH1   . ARG A 1 374 ? -15.117 25.892 5.919   1.00 61.19  ? 371  ARG A NH1   1 
ATOM   2925 N  NH2   . ARG A 1 374 ? -13.022 25.898 6.867   1.00 64.26  ? 371  ARG A NH2   1 
ATOM   2926 N  N     . VAL A 1 375 ? -12.315 20.019 1.821   1.00 43.84  ? 372  VAL A N     1 
ATOM   2927 C  CA    . VAL A 1 375 ? -12.204 18.801 2.628   1.00 46.85  ? 372  VAL A CA    1 
ATOM   2928 C  C     . VAL A 1 375 ? -12.180 19.152 4.104   1.00 44.00  ? 372  VAL A C     1 
ATOM   2929 O  O     . VAL A 1 375 ? -11.837 20.290 4.503   1.00 39.63  ? 372  VAL A O     1 
ATOM   2930 C  CB    . VAL A 1 375 ? -10.998 17.913 2.242   1.00 55.48  ? 372  VAL A CB    1 
ATOM   2931 C  CG1   . VAL A 1 375 ? -11.011 17.625 0.745   1.00 54.81  ? 372  VAL A CG1   1 
ATOM   2932 C  CG2   . VAL A 1 375 ? -9.676  18.547 2.639   1.00 58.08  ? 372  VAL A CG2   1 
ATOM   2933 N  N     . GLN A 1 376 ? -12.552 18.177 4.916   1.00 43.56  ? 373  GLN A N     1 
ATOM   2934 C  CA    . GLN A 1 376 ? -12.608 18.403 6.360   1.00 46.32  ? 373  GLN A CA    1 
ATOM   2935 C  C     . GLN A 1 376 ? -11.222 18.654 6.932   1.00 45.21  ? 373  GLN A C     1 
ATOM   2936 O  O     . GLN A 1 376 ? -10.316 17.870 6.697   1.00 46.49  ? 373  GLN A O     1 
ATOM   2937 C  CB    . GLN A 1 376 ? -13.243 17.215 7.056   1.00 49.09  ? 373  GLN A CB    1 
ATOM   2938 C  CG    . GLN A 1 376 ? -13.905 17.570 8.391   1.00 51.79  ? 373  GLN A CG    1 
ATOM   2939 C  CD    . GLN A 1 376 ? -15.037 16.608 8.721   1.00 52.40  ? 373  GLN A CD    1 
ATOM   2940 O  OE1   . GLN A 1 376 ? -14.919 15.398 8.467   1.00 50.60  ? 373  GLN A OE1   1 
ATOM   2941 N  NE2   . GLN A 1 376 ? -16.156 17.136 9.255   1.00 54.46  ? 373  GLN A NE2   1 
ATOM   2942 N  N     . GLY A 1 377 ? -11.059 19.740 7.679   1.00 46.55  ? 374  GLY A N     1 
ATOM   2943 C  CA    . GLY A 1 377 ? -9.722  20.156 8.145   1.00 52.54  ? 374  GLY A CA    1 
ATOM   2944 C  C     . GLY A 1 377 ? -9.460  21.623 7.847   1.00 56.85  ? 374  GLY A C     1 
ATOM   2945 O  O     . GLY A 1 377 ? -9.440  22.420 8.780   1.00 56.67  ? 374  GLY A O     1 
ATOM   2946 N  N     . ASP A 1 378 ? -9.320  21.958 6.549   1.00 56.77  ? 375  ASP A N     1 
ATOM   2947 C  CA    . ASP A 1 378 ? -8.930  23.305 6.064   1.00 58.91  ? 375  ASP A CA    1 
ATOM   2948 C  C     . ASP A 1 378 ? -9.731  24.420 6.750   1.00 62.15  ? 375  ASP A C     1 
ATOM   2949 O  O     . ASP A 1 378 ? -10.959 24.455 6.647   1.00 63.06  ? 375  ASP A O     1 
ATOM   2950 C  CB    . ASP A 1 378 ? -9.118  23.476 4.527   1.00 60.31  ? 375  ASP A CB    1 
ATOM   2951 C  CG    . ASP A 1 378 ? -8.607  22.322 3.695   1.00 58.73  ? 375  ASP A CG    1 
ATOM   2952 O  OD1   . ASP A 1 378 ? -7.421  22.334 3.316   1.00 51.91  ? 375  ASP A OD1   1 
ATOM   2953 O  OD2   . ASP A 1 378 ? -9.427  21.455 3.359   1.00 57.23  ? 375  ASP A OD2   1 
ATOM   2954 N  N     . LYS A 1 379 ? -9.031  25.317 7.451   1.00 70.50  ? 376  LYS A N     1 
ATOM   2955 C  CA    . LYS A 1 379 ? -9.654  26.485 8.128   1.00 79.86  ? 376  LYS A CA    1 
ATOM   2956 C  C     . LYS A 1 379 ? -10.070 27.449 7.030   1.00 82.45  ? 376  LYS A C     1 
ATOM   2957 O  O     . LYS A 1 379 ? -11.138 28.065 7.063   1.00 79.96  ? 376  LYS A O     1 
ATOM   2958 C  CB    . LYS A 1 379 ? -8.653  27.161 9.094   1.00 81.16  ? 376  LYS A CB    1 
ATOM   2959 C  CG    . LYS A 1 379 ? -9.196  27.472 10.494  1.00 80.45  ? 376  LYS A CG    1 
ATOM   2960 C  CD    . LYS A 1 379 ? -8.223  28.286 11.366  1.00 79.60  ? 376  LYS A CD    1 
ATOM   2961 C  CE    . LYS A 1 379 ? -7.477  27.465 12.428  1.00 80.02  ? 376  LYS A CE    1 
ATOM   2962 N  NZ    . LYS A 1 379 ? -8.337  27.090 13.588  1.00 79.64  ? 376  LYS A NZ    1 
ATOM   2963 N  N     . ARG A 1 380 ? -9.127  27.621 6.112   1.00 86.71  ? 377  ARG A N     1 
ATOM   2964 C  CA    . ARG A 1 380 ? -9.363  27.699 4.677   1.00 86.59  ? 377  ARG A CA    1 
ATOM   2965 C  C     . ARG A 1 380 ? -10.793 27.332 4.227   1.00 85.09  ? 377  ARG A C     1 
ATOM   2966 O  O     . ARG A 1 380 ? -11.271 26.243 4.514   1.00 84.60  ? 377  ARG A O     1 
ATOM   2967 C  CB    . ARG A 1 380 ? -8.396  26.693 4.080   1.00 86.42  ? 377  ARG A CB    1 
ATOM   2968 C  CG    . ARG A 1 380 ? -8.497  26.468 2.586   1.00 84.38  ? 377  ARG A CG    1 
ATOM   2969 C  CD    . ARG A 1 380 ? -7.726  27.564 1.888   1.00 84.30  ? 377  ARG A CD    1 
ATOM   2970 N  NE    . ARG A 1 380 ? -6.306  27.437 2.168   1.00 76.15  ? 377  ARG A NE    1 
ATOM   2971 C  CZ    . ARG A 1 380 ? -5.508  26.488 1.683   1.00 72.43  ? 377  ARG A CZ    1 
ATOM   2972 N  NH1   . ARG A 1 380 ? -5.967  25.528 0.883   1.00 65.33  ? 377  ARG A NH1   1 
ATOM   2973 N  NH2   . ARG A 1 380 ? -4.219  26.494 2.023   1.00 78.79  ? 377  ARG A NH2   1 
ATOM   2974 N  N     . LEU A 1 381 ? -11.448 28.241 3.504   1.00 81.41  ? 378  LEU A N     1 
ATOM   2975 C  CA    . LEU A 1 381 ? -12.786 27.989 2.940   1.00 77.80  ? 378  LEU A CA    1 
ATOM   2976 C  C     . LEU A 1 381 ? -12.686 27.365 1.541   1.00 76.54  ? 378  LEU A C     1 
ATOM   2977 O  O     . LEU A 1 381 ? -13.327 26.360 1.235   1.00 74.22  ? 378  LEU A O     1 
ATOM   2978 C  CB    . LEU A 1 381 ? -13.609 29.278 2.909   1.00 77.32  ? 378  LEU A CB    1 
ATOM   2979 C  CG    . LEU A 1 381 ? -14.392 29.586 4.198   1.00 81.74  ? 378  LEU A CG    1 
ATOM   2980 C  CD1   . LEU A 1 381 ? -13.481 29.778 5.399   1.00 82.16  ? 378  LEU A CD1   1 
ATOM   2981 C  CD2   . LEU A 1 381 ? -15.276 30.811 4.019   1.00 81.67  ? 378  LEU A CD2   1 
ATOM   2982 N  N     . SER A 1 382 ? -11.866 27.976 0.702   1.00 78.77  ? 379  SER A N     1 
ATOM   2983 C  CA    . SER A 1 382 ? -11.544 27.463 -0.634  1.00 73.92  ? 379  SER A CA    1 
ATOM   2984 C  C     . SER A 1 382 ? -10.419 26.458 -0.549  1.00 65.64  ? 379  SER A C     1 
ATOM   2985 O  O     . SER A 1 382 ? -9.256  26.845 -0.583  1.00 79.25  ? 379  SER A O     1 
ATOM   2986 C  CB    . SER A 1 382 ? -11.067 28.630 -1.535  1.00 80.26  ? 379  SER A CB    1 
ATOM   2987 O  OG    . SER A 1 382 ? -9.803  29.163 -1.089  1.00 80.23  ? 379  SER A OG    1 
ATOM   2988 N  N     . SER A 1 383 ? -10.709 25.172 -0.503  1.00 55.86  ? 380  SER A N     1 
ATOM   2989 C  CA    . SER A 1 383 ? -9.614  24.205 -0.479  1.00 54.89  ? 380  SER A CA    1 
ATOM   2990 C  C     . SER A 1 383 ? -9.068  23.899 -1.870  1.00 53.35  ? 380  SER A C     1 
ATOM   2991 O  O     . SER A 1 383 ? -7.859  23.831 -2.039  1.00 54.80  ? 380  SER A O     1 
ATOM   2992 C  CB    . SER A 1 383 ? -10.006 22.918 0.249   1.00 61.65  ? 380  SER A CB    1 
ATOM   2993 O  OG    . SER A 1 383 ? -10.719 22.033 -0.582  1.00 73.78  ? 380  SER A OG    1 
ATOM   2994 N  N     . LEU A 1 384 ? -9.948  23.704 -2.857  1.00 48.43  ? 381  LEU A N     1 
ATOM   2995 C  CA    . LEU A 1 384 ? -9.541  23.351 -4.231  1.00 42.75  ? 381  LEU A CA    1 
ATOM   2996 C  C     . LEU A 1 384 ? -10.538 23.843 -5.272  1.00 41.74  ? 381  LEU A C     1 
ATOM   2997 O  O     . LEU A 1 384 ? -11.735 23.649 -5.114  1.00 41.78  ? 381  LEU A O     1 
ATOM   2998 C  CB    . LEU A 1 384 ? -9.482  21.845 -4.385  1.00 40.14  ? 381  LEU A CB    1 
ATOM   2999 C  CG    . LEU A 1 384 ? -9.091  21.325 -5.777  1.00 40.43  ? 381  LEU A CG    1 
ATOM   3000 C  CD1   . LEU A 1 384 ? -7.654  20.829 -5.718  1.00 43.26  ? 381  LEU A CD1   1 
ATOM   3001 C  CD2   . LEU A 1 384 ? -10.012 20.255 -6.374  1.00 40.43  ? 381  LEU A CD2   1 
ATOM   3002 N  N     . ARG A 1 385 ? -10.020 24.389 -6.368  1.00 37.19  ? 382  ARG A N     1 
ATOM   3003 C  CA    . ARG A 1 385 ? -10.807 24.976 -7.425  1.00 36.65  ? 382  ARG A CA    1 
ATOM   3004 C  C     . ARG A 1 385 ? -10.268 24.495 -8.792  1.00 33.84  ? 382  ARG A C     1 
ATOM   3005 O  O     . ARG A 1 385 ? -9.059  24.463 -9.026  1.00 31.31  ? 382  ARG A O     1 
ATOM   3006 C  CB    . ARG A 1 385 ? -10.747 26.476 -7.322  1.00 39.01  ? 382  ARG A CB    1 
ATOM   3007 C  CG    . ARG A 1 385 ? -11.933 27.147 -7.983  1.00 47.14  ? 382  ARG A CG    1 
ATOM   3008 C  CD    . ARG A 1 385 ? -11.647 28.504 -8.650  1.00 52.62  ? 382  ARG A CD    1 
ATOM   3009 N  NE    . ARG A 1 385 ? -10.982 28.340 -9.964  1.00 61.51  ? 382  ARG A NE    1 
ATOM   3010 C  CZ    . ARG A 1 385 ? -10.961 29.226 -10.959 1.00 60.12  ? 382  ARG A CZ    1 
ATOM   3011 N  NH1   . ARG A 1 385 ? -10.300 28.919 -12.077 1.00 62.87  ? 382  ARG A NH1   1 
ATOM   3012 N  NH2   . ARG A 1 385 ? -11.601 30.392 -10.856 1.00 62.25  ? 382  ARG A NH2   1 
ATOM   3013 N  N     . ARG A 1 386 ? -11.174 24.046 -9.652  1.00 28.42  ? 383  ARG A N     1 
ATOM   3014 C  CA    . ARG A 1 386 ? -10.829 23.579 -10.999 1.00 28.44  ? 383  ARG A CA    1 
ATOM   3015 C  C     . ARG A 1 386 ? -11.943 23.966 -11.971 1.00 27.84  ? 383  ARG A C     1 
ATOM   3016 O  O     . ARG A 1 386 ? -13.083 23.994 -11.607 1.00 24.53  ? 383  ARG A O     1 
ATOM   3017 C  CB    . ARG A 1 386 ? -10.686 22.059 -11.016 1.00 28.69  ? 383  ARG A CB    1 
ATOM   3018 C  CG    . ARG A 1 386 ? -9.608  21.461 -10.127 1.00 31.47  ? 383  ARG A CG    1 
ATOM   3019 C  CD    . ARG A 1 386 ? -8.264  21.740 -10.748 1.00 30.02  ? 383  ARG A CD    1 
ATOM   3020 N  NE    . ARG A 1 386 ? -7.172  20.988 -10.175 1.00 30.89  ? 383  ARG A NE    1 
ATOM   3021 C  CZ    . ARG A 1 386 ? -6.438  21.349 -9.128  1.00 33.27  ? 383  ARG A CZ    1 
ATOM   3022 N  NH1   . ARG A 1 386 ? -6.699  22.464 -8.450  1.00 36.86  ? 383  ARG A NH1   1 
ATOM   3023 N  NH2   . ARG A 1 386 ? -5.398  20.579 -8.769  1.00 36.11  ? 383  ARG A NH2   1 
ATOM   3024 N  N     . CYS A 1 387 ? -11.607 24.233 -13.226 1.00 29.36  ? 384  CYS A N     1 
ATOM   3025 C  CA    . CYS A 1 387 ? -12.612 24.449 -14.263 1.00 30.78  ? 384  CYS A CA    1 
ATOM   3026 C  C     . CYS A 1 387 ? -12.589 23.425 -15.339 1.00 31.54  ? 384  CYS A C     1 
ATOM   3027 O  O     . CYS A 1 387 ? -11.596 22.772 -15.568 1.00 34.02  ? 384  CYS A O     1 
ATOM   3028 C  CB    . CYS A 1 387 ? -12.412 25.784 -14.938 1.00 31.26  ? 384  CYS A CB    1 
ATOM   3029 S  SG    A CYS A 1 387 ? -10.669 26.276 -15.158 0.61 34.04  ? 384  CYS A SG    1 
ATOM   3030 S  SG    B CYS A 1 387 ? -11.746 26.994 -13.829 0.39 27.76  ? 384  CYS A SG    1 
ATOM   3031 N  N     . CYS A 1 388 ? -13.727 23.325 -16.006 1.00 33.60  ? 385  CYS A N     1 
ATOM   3032 C  CA    . CYS A 1 388 ? -13.834 22.639 -17.259 1.00 32.75  ? 385  CYS A CA    1 
ATOM   3033 C  C     . CYS A 1 388 ? -14.690 23.479 -18.171 1.00 31.04  ? 385  CYS A C     1 
ATOM   3034 O  O     . CYS A 1 388 ? -15.217 24.529 -17.764 1.00 32.61  ? 385  CYS A O     1 
ATOM   3035 C  CB    . CYS A 1 388 ? -14.407 21.223 -17.045 1.00 34.32  ? 385  CYS A CB    1 
ATOM   3036 S  SG    . CYS A 1 388 ? -15.934 21.136 -16.088 1.00 33.50  ? 385  CYS A SG    1 
ATOM   3037 N  N     . ALA A 1 389 ? -14.823 23.031 -19.415 1.00 28.25  ? 386  ALA A N     1 
ATOM   3038 C  CA    . ALA A 1 389 ? -15.755 23.658 -20.316 1.00 27.14  ? 386  ALA A CA    1 
ATOM   3039 C  C     . ALA A 1 389 ? -17.197 23.375 -19.911 1.00 26.84  ? 386  ALA A C     1 
ATOM   3040 O  O     . ALA A 1 389 ? -17.539 22.281 -19.485 1.00 27.07  ? 386  ALA A O     1 
ATOM   3041 C  CB    . ALA A 1 389 ? -15.523 23.211 -21.738 1.00 29.97  ? 386  ALA A CB    1 
ATOM   3042 N  N     . LEU A 1 390 ? -18.040 24.380 -20.081 1.00 25.96  ? 387  LEU A N     1 
ATOM   3043 C  CA    . LEU A 1 390 ? -19.469 24.241 -19.965 1.00 25.75  ? 387  LEU A CA    1 
ATOM   3044 C  C     . LEU A 1 390 ? -20.002 24.389 -21.376 1.00 29.28  ? 387  LEU A C     1 
ATOM   3045 O  O     . LEU A 1 390 ? -20.087 25.494 -21.917 1.00 34.61  ? 387  LEU A O     1 
ATOM   3046 C  CB    . LEU A 1 390 ? -20.029 25.336 -19.070 1.00 23.74  ? 387  LEU A CB    1 
ATOM   3047 C  CG    . LEU A 1 390 ? -21.364 25.106 -18.352 1.00 22.96  ? 387  LEU A CG    1 
ATOM   3048 C  CD1   . LEU A 1 390 ? -21.609 26.288 -17.377 1.00 20.29  ? 387  LEU A CD1   1 
ATOM   3049 C  CD2   . LEU A 1 390 ? -22.510 24.961 -19.348 1.00 22.60  ? 387  LEU A CD2   1 
ATOM   3050 N  N     . THR A 1 391 ? -20.327 23.267 -21.983 1.00 31.07  ? 388  THR A N     1 
ATOM   3051 C  CA    . THR A 1 391 ? -20.758 23.231 -23.385 1.00 35.41  ? 388  THR A CA    1 
ATOM   3052 C  C     . THR A 1 391 ? -22.248 22.988 -23.576 1.00 36.54  ? 388  THR A C     1 
ATOM   3053 O  O     . THR A 1 391 ? -22.756 23.228 -24.659 1.00 34.87  ? 388  THR A O     1 
ATOM   3054 C  CB    . THR A 1 391 ? -19.976 22.157 -24.164 1.00 35.60  ? 388  THR A CB    1 
ATOM   3055 O  OG1   . THR A 1 391 ? -20.115 20.879 -23.519 1.00 35.95  ? 388  THR A OG1   1 
ATOM   3056 C  CG2   . THR A 1 391 ? -18.504 22.532 -24.258 1.00 35.98  ? 388  THR A CG2   1 
ATOM   3057 N  N     . ARG A 1 392 ? -22.941 22.496 -22.545 1.00 37.06  ? 389  ARG A N     1 
ATOM   3058 C  CA    . ARG A 1 392 ? -24.379 22.189 -22.609 1.00 35.37  ? 389  ARG A CA    1 
ATOM   3059 C  C     . ARG A 1 392 ? -25.014 22.456 -21.218 1.00 30.92  ? 389  ARG A C     1 
ATOM   3060 O  O     . ARG A 1 392 ? -24.460 22.087 -20.173 1.00 30.19  ? 389  ARG A O     1 
ATOM   3061 C  CB    . ARG A 1 392 ? -24.606 20.699 -22.932 1.00 40.91  ? 389  ARG A CB    1 
ATOM   3062 C  CG    . ARG A 1 392 ? -24.124 20.216 -24.297 1.00 49.83  ? 389  ARG A CG    1 
ATOM   3063 C  CD    . ARG A 1 392 ? -25.256 19.693 -25.161 1.00 56.31  ? 389  ARG A CD    1 
ATOM   3064 N  NE    . ARG A 1 392 ? -25.851 18.504 -24.535 1.00 62.57  ? 389  ARG A NE    1 
ATOM   3065 C  CZ    . ARG A 1 392 ? -25.329 17.271 -24.543 1.00 68.12  ? 389  ARG A CZ    1 
ATOM   3066 N  NH1   . ARG A 1 392 ? -25.992 16.294 -23.915 1.00 73.15  ? 389  ARG A NH1   1 
ATOM   3067 N  NH2   . ARG A 1 392 ? -24.164 16.989 -25.156 1.00 62.80  ? 389  ARG A NH2   1 
ATOM   3068 N  N     . TYR A 1 393 ? -26.193 23.040 -21.217 1.00 26.18  ? 390  TYR A N     1 
ATOM   3069 C  CA    . TYR A 1 393 ? -26.970 23.221 -19.989 1.00 26.10  ? 390  TYR A CA    1 
ATOM   3070 C  C     . TYR A 1 393 ? -27.684 21.924 -19.678 1.00 27.60  ? 390  TYR A C     1 
ATOM   3071 O  O     . TYR A 1 393 ? -28.892 21.779 -19.901 1.00 29.16  ? 390  TYR A O     1 
ATOM   3072 C  CB    . TYR A 1 393 ? -27.961 24.388 -20.174 1.00 26.27  ? 390  TYR A CB    1 
ATOM   3073 C  CG    . TYR A 1 393 ? -27.344 25.792 -20.200 1.00 23.12  ? 390  TYR A CG    1 
ATOM   3074 C  CD1   . TYR A 1 393 ? -28.162 26.907 -20.253 1.00 20.94  ? 390  TYR A CD1   1 
ATOM   3075 C  CD2   . TYR A 1 393 ? -25.956 26.007 -20.131 1.00 24.15  ? 390  TYR A CD2   1 
ATOM   3076 C  CE1   . TYR A 1 393 ? -27.634 28.180 -20.232 1.00 22.03  ? 390  TYR A CE1   1 
ATOM   3077 C  CE2   . TYR A 1 393 ? -25.436 27.299 -20.080 1.00 22.53  ? 390  TYR A CE2   1 
ATOM   3078 C  CZ    . TYR A 1 393 ? -26.283 28.373 -20.145 1.00 20.26  ? 390  TYR A CZ    1 
ATOM   3079 O  OH    . TYR A 1 393 ? -25.770 29.665 -20.097 1.00 21.02  ? 390  TYR A OH    1 
ATOM   3080 N  N     . ASP A 1 394 ? -26.930 20.958 -19.189 1.00 26.33  ? 391  ASP A N     1 
ATOM   3081 C  CA    . ASP A 1 394 ? -27.511 19.704 -18.790 1.00 25.74  ? 391  ASP A CA    1 
ATOM   3082 C  C     . ASP A 1 394 ? -26.935 19.312 -17.448 1.00 22.10  ? 391  ASP A C     1 
ATOM   3083 O  O     . ASP A 1 394 ? -25.723 19.223 -17.309 1.00 21.81  ? 391  ASP A O     1 
ATOM   3084 C  CB    . ASP A 1 394 ? -27.233 18.590 -19.809 1.00 29.17  ? 391  ASP A CB    1 
ATOM   3085 C  CG    . ASP A 1 394 ? -27.821 17.258 -19.347 1.00 30.42  ? 391  ASP A CG    1 
ATOM   3086 O  OD1   . ASP A 1 394 ? -27.051 16.442 -18.779 1.00 31.02  ? 391  ASP A OD1   1 
ATOM   3087 O  OD2   . ASP A 1 394 ? -29.064 17.116 -19.424 1.00 34.11  ? 391  ASP A OD2   1 
ATOM   3088 N  N     . ALA A 1 395 ? -27.811 19.033 -16.488 1.00 22.14  ? 392  ALA A N     1 
ATOM   3089 C  CA    . ALA A 1 395 ? -27.384 18.824 -15.104 1.00 22.88  ? 392  ALA A CA    1 
ATOM   3090 C  C     . ALA A 1 395 ? -26.544 17.572 -14.927 1.00 21.55  ? 392  ALA A C     1 
ATOM   3091 O  O     . ALA A 1 395 ? -25.603 17.575 -14.173 1.00 21.67  ? 392  ALA A O     1 
ATOM   3092 C  CB    . ALA A 1 395 ? -28.586 18.825 -14.178 1.00 22.66  ? 392  ALA A CB    1 
ATOM   3093 N  N     . HIS A 1 396 ? -26.883 16.493 -15.633 1.00 24.03  ? 393  HIS A N     1 
ATOM   3094 C  CA    . HIS A 1 396 ? -26.109 15.245 -15.551 1.00 25.86  ? 393  HIS A CA    1 
ATOM   3095 C  C     . HIS A 1 396 ? -24.709 15.377 -16.143 1.00 25.20  ? 393  HIS A C     1 
ATOM   3096 O  O     . HIS A 1 396 ? -23.737 14.889 -15.546 1.00 26.91  ? 393  HIS A O     1 
ATOM   3097 C  CB    . HIS A 1 396 ? -26.871 14.065 -16.184 1.00 27.99  ? 393  HIS A CB    1 
ATOM   3098 C  CG    . HIS A 1 396 ? -27.922 13.493 -15.286 1.00 30.87  ? 393  HIS A CG    1 
ATOM   3099 N  ND1   . HIS A 1 396 ? -29.238 13.915 -15.309 1.00 31.31  ? 393  HIS A ND1   1 
ATOM   3100 C  CD2   . HIS A 1 396 ? -27.847 12.549 -14.313 1.00 32.23  ? 393  HIS A CD2   1 
ATOM   3101 C  CE1   . HIS A 1 396 ? -29.937 13.243 -14.408 1.00 32.78  ? 393  HIS A CE1   1 
ATOM   3102 N  NE2   . HIS A 1 396 ? -29.113 12.410 -13.788 1.00 35.35  ? 393  HIS A NE2   1 
ATOM   3103 N  N     . LYS A 1 397 ? -24.568 16.090 -17.259 1.00 26.94  ? 394  LYS A N     1 
ATOM   3104 C  CA    . LYS A 1 397 ? -23.197 16.363 -17.773 1.00 27.32  ? 394  LYS A CA    1 
ATOM   3105 C  C     . LYS A 1 397 ? -22.371 17.258 -16.879 1.00 23.89  ? 394  LYS A C     1 
ATOM   3106 O  O     . LYS A 1 397 ? -21.175 16.990 -16.638 1.00 23.95  ? 394  LYS A O     1 
ATOM   3107 C  CB    . LYS A 1 397 ? -23.198 16.929 -19.189 1.00 29.58  ? 394  LYS A CB    1 
ATOM   3108 C  CG    . LYS A 1 397 ? -21.772 17.200 -19.670 1.00 33.04  ? 394  LYS A CG    1 
ATOM   3109 C  CD    . LYS A 1 397 ? -21.698 17.651 -21.126 1.00 39.10  ? 394  LYS A CD    1 
ATOM   3110 C  CE    . LYS A 1 397 ? -20.323 18.258 -21.436 1.00 41.88  ? 394  LYS A CE    1 
ATOM   3111 N  NZ    . LYS A 1 397 ? -19.195 17.296 -21.222 1.00 42.60  ? 394  LYS A NZ    1 
ATOM   3112 N  N     . MET A 1 398 ? -22.986 18.333 -16.402 1.00 21.93  ? 395  MET A N     1 
ATOM   3113 C  CA    . MET A 1 398 ? -22.281 19.248 -15.500 1.00 21.41  ? 395  MET A CA    1 
ATOM   3114 C  C     . MET A 1 398 ? -21.792 18.546 -14.241 1.00 20.85  ? 395  MET A C     1 
ATOM   3115 O  O     . MET A 1 398 ? -20.642 18.741 -13.818 1.00 22.28  ? 395  MET A O     1 
ATOM   3116 C  CB    . MET A 1 398 ? -23.147 20.489 -15.144 1.00 20.90  ? 395  MET A CB    1 
ATOM   3117 C  CG    . MET A 1 398 ? -23.267 21.455 -16.312 1.00 21.49  ? 395  MET A CG    1 
ATOM   3118 S  SD    . MET A 1 398 ? -23.970 23.058 -15.865 1.00 23.95  ? 395  MET A SD    1 
ATOM   3119 C  CE    . MET A 1 398 ? -25.679 22.631 -15.568 1.00 23.85  ? 395  MET A CE    1 
ATOM   3120 N  N     . SER A 1 399 ? -22.662 17.721 -13.665 1.00 24.30  ? 396  SER A N     1 
ATOM   3121 C  CA    . SER A 1 399 ? -22.360 16.991 -12.453 1.00 25.60  ? 396  SER A CA    1 
ATOM   3122 C  C     . SER A 1 399 ? -21.324 15.908 -12.693 1.00 26.53  ? 396  SER A C     1 
ATOM   3123 O  O     . SER A 1 399 ? -20.452 15.692 -11.847 1.00 25.35  ? 396  SER A O     1 
ATOM   3124 C  CB    . SER A 1 399 ? -23.636 16.396 -11.800 1.00 26.76  ? 396  SER A CB    1 
ATOM   3125 O  OG    . SER A 1 399 ? -24.381 15.547 -12.665 1.00 27.39  ? 396  SER A OG    1 
ATOM   3126 N  N     . HIS A 1 400 ? -21.411 15.233 -13.829 1.00 29.00  ? 397  HIS A N     1 
ATOM   3127 C  CA    . HIS A 1 400 ? -20.354 14.272 -14.197 1.00 31.20  ? 397  HIS A CA    1 
ATOM   3128 C  C     . HIS A 1 400 ? -19.002 14.957 -14.426 1.00 27.69  ? 397  HIS A C     1 
ATOM   3129 O  O     . HIS A 1 400 ? -17.972 14.530 -13.916 1.00 25.61  ? 397  HIS A O     1 
ATOM   3130 C  CB    . HIS A 1 400 ? -20.770 13.499 -15.448 1.00 38.51  ? 397  HIS A CB    1 
ATOM   3131 C  CG    . HIS A 1 400 ? -19.877 12.330 -15.766 1.00 47.42  ? 397  HIS A CG    1 
ATOM   3132 N  ND1   . HIS A 1 400 ? -18.669 12.468 -16.423 1.00 47.11  ? 397  HIS A ND1   1 
ATOM   3133 C  CD2   . HIS A 1 400 ? -20.032 11.002 -15.539 1.00 49.47  ? 397  HIS A CD2   1 
ATOM   3134 C  CE1   . HIS A 1 400 ? -18.110 11.283 -16.566 1.00 48.48  ? 397  HIS A CE1   1 
ATOM   3135 N  NE2   . HIS A 1 400 ? -18.920 10.375 -16.049 1.00 52.30  ? 397  HIS A NE2   1 
ATOM   3136 N  N     . ASP A 1 401 ? -19.007 16.038 -15.203 1.00 27.45  ? 398  ASP A N     1 
ATOM   3137 C  CA    . ASP A 1 401 ? -17.791 16.826 -15.412 1.00 26.59  ? 398  ASP A CA    1 
ATOM   3138 C  C     . ASP A 1 401 ? -17.180 17.310 -14.119 1.00 25.12  ? 398  ASP A C     1 
ATOM   3139 O  O     . ASP A 1 401 ? -15.935 17.292 -13.921 1.00 25.21  ? 398  ASP A O     1 
ATOM   3140 C  CB    . ASP A 1 401 ? -18.067 18.026 -16.333 1.00 27.69  ? 398  ASP A CB    1 
ATOM   3141 C  CG    . ASP A 1 401 ? -18.380 17.599 -17.766 1.00 30.47  ? 398  ASP A CG    1 
ATOM   3142 O  OD1   . ASP A 1 401 ? -18.222 16.403 -18.057 1.00 31.44  ? 398  ASP A OD1   1 
ATOM   3143 O  OD2   . ASP A 1 401 ? -18.820 18.423 -18.600 1.00 28.45  ? 398  ASP A OD2   1 
ATOM   3144 N  N     . ALA A 1 402 ? -18.038 17.773 -13.226 1.00 25.13  ? 399  ALA A N     1 
ATOM   3145 C  CA    . ALA A 1 402 ? -17.550 18.299 -11.950 1.00 25.60  ? 399  ALA A CA    1 
ATOM   3146 C  C     . ALA A 1 402 ? -16.875 17.200 -11.191 1.00 26.26  ? 399  ALA A C     1 
ATOM   3147 O  O     . ALA A 1 402 ? -15.865 17.412 -10.555 1.00 24.54  ? 399  ALA A O     1 
ATOM   3148 C  CB    . ALA A 1 402 ? -18.700 18.887 -11.134 1.00 25.94  ? 399  ALA A CB    1 
ATOM   3149 N  N     . PHE A 1 403 ? -17.469 16.014 -11.238 1.00 31.17  ? 400  PHE A N     1 
ATOM   3150 C  CA    . PHE A 1 403 ? -16.914 14.868 -10.547 1.00 32.06  ? 400  PHE A CA    1 
ATOM   3151 C  C     . PHE A 1 403 ? -15.540 14.524 -11.109 1.00 32.99  ? 400  PHE A C     1 
ATOM   3152 O  O     . PHE A 1 403 ? -14.587 14.352 -10.343 1.00 36.79  ? 400  PHE A O     1 
ATOM   3153 C  CB    . PHE A 1 403 ? -17.858 13.658 -10.647 1.00 34.49  ? 400  PHE A CB    1 
ATOM   3154 C  CG    . PHE A 1 403 ? -17.390 12.490 -9.840  1.00 45.46  ? 400  PHE A CG    1 
ATOM   3155 C  CD1   . PHE A 1 403 ? -17.666 12.424 -8.479  1.00 45.13  ? 400  PHE A CD1   1 
ATOM   3156 C  CD2   . PHE A 1 403 ? -16.606 11.482 -10.413 1.00 51.35  ? 400  PHE A CD2   1 
ATOM   3157 C  CE1   . PHE A 1 403 ? -17.218 11.373 -7.710  1.00 49.03  ? 400  PHE A CE1   1 
ATOM   3158 C  CE2   . PHE A 1 403 ? -16.139 10.424 -9.632  1.00 52.24  ? 400  PHE A CE2   1 
ATOM   3159 C  CZ    . PHE A 1 403 ? -16.447 10.377 -8.282  1.00 51.89  ? 400  PHE A CZ    1 
ATOM   3160 N  N     . THR A 1 404 ? -15.442 14.461 -12.440 1.00 34.94  ? 401  THR A N     1 
ATOM   3161 C  CA    . THR A 1 404 ? -14.190 14.087 -13.101 1.00 36.26  ? 401  THR A CA    1 
ATOM   3162 C  C     . THR A 1 404 ? -13.029 15.001 -12.704 1.00 34.07  ? 401  THR A C     1 
ATOM   3163 O  O     . THR A 1 404 ? -11.960 14.512 -12.375 1.00 37.91  ? 401  THR A O     1 
ATOM   3164 C  CB    . THR A 1 404 ? -14.297 13.985 -14.651 1.00 35.55  ? 401  THR A CB    1 
ATOM   3165 O  OG1   . THR A 1 404 ? -14.438 15.286 -15.225 1.00 48.82  ? 401  THR A OG1   1 
ATOM   3166 C  CG2   . THR A 1 404 ? -15.467 13.118 -15.069 1.00 33.47  ? 401  THR A CG2   1 
ATOM   3167 N  N     . VAL A 1 405 ? -13.250 16.311 -12.682 1.00 31.67  ? 402  VAL A N     1 
ATOM   3168 C  CA    . VAL A 1 405 ? -12.170 17.252 -12.373 1.00 33.63  ? 402  VAL A CA    1 
ATOM   3169 C  C     . VAL A 1 405 ? -11.796 17.271 -10.911 1.00 33.76  ? 402  VAL A C     1 
ATOM   3170 O  O     . VAL A 1 405 ? -10.765 17.792 -10.592 1.00 34.13  ? 402  VAL A O     1 
ATOM   3171 C  CB    . VAL A 1 405 ? -12.443 18.712 -12.853 1.00 34.21  ? 402  VAL A CB    1 
ATOM   3172 C  CG1   . VAL A 1 405 ? -12.723 18.739 -14.343 1.00 34.27  ? 402  VAL A CG1   1 
ATOM   3173 C  CG2   . VAL A 1 405 ? -13.571 19.368 -12.108 1.00 31.43  ? 402  VAL A CG2   1 
ATOM   3174 N  N     . ILE A 1 406 ? -12.627 16.709 -10.036 1.00 36.44  ? 403  ILE A N     1 
ATOM   3175 C  CA    . ILE A 1 406 ? -12.289 16.587 -8.621  1.00 37.54  ? 403  ILE A CA    1 
ATOM   3176 C  C     . ILE A 1 406 ? -12.047 15.162 -8.103  1.00 36.37  ? 403  ILE A C     1 
ATOM   3177 O  O     . ILE A 1 406 ? -11.592 15.007 -6.975  1.00 36.43  ? 403  ILE A O     1 
ATOM   3178 C  CB    . ILE A 1 406 ? -13.418 17.200 -7.735  1.00 37.83  ? 403  ILE A CB    1 
ATOM   3179 C  CG1   . ILE A 1 406 ? -14.670 16.323 -7.763  1.00 40.68  ? 403  ILE A CG1   1 
ATOM   3180 C  CG2   . ILE A 1 406 ? -13.698 18.638 -8.144  1.00 38.63  ? 403  ILE A CG2   1 
ATOM   3181 C  CD1   . ILE A 1 406 ? -15.579 16.600 -6.594  1.00 44.91  ? 403  ILE A CD1   1 
ATOM   3182 N  N     . LYS A 1 407 ? -12.415 14.138 -8.867  1.00 38.65  ? 404  LYS A N     1 
ATOM   3183 C  CA    . LYS A 1 407 ? -12.379 12.759 -8.359  1.00 45.64  ? 404  LYS A CA    1 
ATOM   3184 C  C     . LYS A 1 407 ? -11.043 12.243 -7.791  1.00 49.82  ? 404  LYS A C     1 
ATOM   3185 O  O     . LYS A 1 407 ? -11.022 11.272 -7.044  1.00 57.22  ? 404  LYS A O     1 
ATOM   3186 C  CB    . LYS A 1 407 ? -12.866 11.788 -9.424  1.00 47.24  ? 404  LYS A CB    1 
ATOM   3187 C  CG    . LYS A 1 407 ? -11.985 11.703 -10.648 1.00 48.41  ? 404  LYS A CG    1 
ATOM   3188 C  CD    . LYS A 1 407 ? -12.622 10.781 -11.674 1.00 52.33  ? 404  LYS A CD    1 
ATOM   3189 C  CE    . LYS A 1 407 ? -11.684 10.493 -12.834 1.00 56.62  ? 404  LYS A CE    1 
ATOM   3190 N  NZ    . LYS A 1 407 ? -11.331 11.745 -13.567 1.00 60.55  ? 404  LYS A NZ    1 
ATOM   3191 N  N     . ASN A 1 408 ? -9.942  12.876 -8.170  1.00 51.73  ? 405  ASN A N     1 
ATOM   3192 C  CA    . ASN A 1 408 ? -8.605  12.479 -7.713  1.00 57.98  ? 405  ASN A CA    1 
ATOM   3193 C  C     . ASN A 1 408 ? -8.214  13.202 -6.439  1.00 55.57  ? 405  ASN A C     1 
ATOM   3194 O  O     . ASN A 1 408 ? -7.130  12.980 -5.910  1.00 54.11  ? 405  ASN A O     1 
ATOM   3195 C  CB    . ASN A 1 408 ? -7.568  12.736 -8.802  1.00 55.68  ? 405  ASN A CB    1 
ATOM   3196 C  CG    . ASN A 1 408 ? -7.526  14.191 -9.214  1.00 65.05  ? 405  ASN A CG    1 
ATOM   3197 O  OD1   . ASN A 1 408 ? -8.580  14.810 -9.464  1.00 62.14  ? 405  ASN A OD1   1 
ATOM   3198 N  ND2   . ASN A 1 408 ? -6.321  14.765 -9.255  1.00 70.35  ? 405  ASN A ND2   1 
ATOM   3199 N  N     . CYS A 1 409 ? -9.092  14.061 -5.933  1.00 54.24  ? 406  CYS A N     1 
ATOM   3200 C  CA    . CYS A 1 409 ? -8.904  14.629 -4.593  1.00 55.03  ? 406  CYS A CA    1 
ATOM   3201 C  C     . CYS A 1 409 ? -9.163  13.598 -3.516  1.00 53.55  ? 406  CYS A C     1 
ATOM   3202 O  O     . CYS A 1 409 ? -8.773  13.797 -2.365  1.00 57.00  ? 406  CYS A O     1 
ATOM   3203 C  CB    . CYS A 1 409 ? -9.815  15.831 -4.340  1.00 54.11  ? 406  CYS A CB    1 
ATOM   3204 S  SG    . CYS A 1 409 ? -9.027  17.324 -4.900  1.00 59.32  ? 406  CYS A SG    1 
ATOM   3205 N  N     . ASN A 1 410 ? -9.872  12.538 -3.886  1.00 50.90  ? 407  ASN A N     1 
ATOM   3206 C  CA    . ASN A 1 410 ? -10.081 11.408 -3.025  1.00 48.38  ? 407  ASN A CA    1 
ATOM   3207 C  C     . ASN A 1 410 ? -8.733  10.697 -2.720  1.00 51.79  ? 407  ASN A C     1 
ATOM   3208 O  O     . ASN A 1 410 ? -8.068  10.192 -3.624  1.00 45.69  ? 407  ASN A O     1 
ATOM   3209 C  CB    . ASN A 1 410 ? -11.052 10.455 -3.697  1.00 45.13  ? 407  ASN A CB    1 
ATOM   3210 C  CG    . ASN A 1 410 ? -11.625 9.459  -2.744  1.00 46.33  ? 407  ASN A CG    1 
ATOM   3211 O  OD1   . ASN A 1 410 ? -11.154 9.319  -1.601  1.00 47.21  ? 407  ASN A OD1   1 
ATOM   3212 N  ND2   . ASN A 1 410 ? -12.650 8.739  -3.202  1.00 46.98  ? 407  ASN A ND2   1 
ATOM   3213 N  N     . THR A 1 411 ? -8.353  10.694 -1.441  1.00 54.20  ? 408  THR A N     1 
ATOM   3214 C  CA    . THR A 1 411 ? -7.121  10.045 -0.963  1.00 54.51  ? 408  THR A CA    1 
ATOM   3215 C  C     . THR A 1 411 ? -7.366  8.601  -0.539  1.00 56.64  ? 408  THR A C     1 
ATOM   3216 O  O     . THR A 1 411 ? -6.402  7.892  -0.257  1.00 54.77  ? 408  THR A O     1 
ATOM   3217 C  CB    . THR A 1 411 ? -6.522  10.776 0.254   1.00 51.23  ? 408  THR A CB    1 
ATOM   3218 O  OG1   . THR A 1 411 ? -7.359  10.563 1.398   1.00 46.63  ? 408  THR A OG1   1 
ATOM   3219 C  CG2   . THR A 1 411 ? -6.360  12.281 -0.018  1.00 52.67  ? 408  THR A CG2   1 
ATOM   3220 N  N     . SER A 1 412 ? -8.636  8.180  -0.471  1.00 55.65  ? 409  SER A N     1 
ATOM   3221 C  CA    . SER A 1 412 ? -8.982  6.841  -0.015  1.00 57.13  ? 409  SER A CA    1 
ATOM   3222 C  C     . SER A 1 412 ? -8.663  5.790  -1.076  1.00 62.56  ? 409  SER A C     1 
ATOM   3223 O  O     . SER A 1 412 ? -9.161  5.849  -2.192  1.00 59.46  ? 409  SER A O     1 
ATOM   3224 C  CB    . SER A 1 412 ? -10.468 6.753  0.353   1.00 59.49  ? 409  SER A CB    1 
ATOM   3225 O  OG    . SER A 1 412 ? -10.887 5.415  0.613   1.00 55.44  ? 409  SER A OG    1 
ATOM   3226 N  N     . GLY A 1 413 ? -7.830  4.822  -0.707  1.00 69.67  ? 410  GLY A N     1 
ATOM   3227 C  CA    . GLY A 1 413 ? -7.609  3.626  -1.515  1.00 73.96  ? 410  GLY A CA    1 
ATOM   3228 C  C     . GLY A 1 413 ? -8.890  2.824  -1.706  1.00 75.15  ? 410  GLY A C     1 
ATOM   3229 O  O     . GLY A 1 413 ? -9.070  2.218  -2.756  1.00 77.13  ? 410  GLY A O     1 
ATOM   3230 N  N     . ILE A 1 414 ? -9.781  2.840  -0.706  1.00 74.88  ? 411  ILE A N     1 
ATOM   3231 C  CA    . ILE A 1 414 ? -11.088 2.200  -0.829  1.00 71.21  ? 411  ILE A CA    1 
ATOM   3232 C  C     . ILE A 1 414 ? -11.851 2.966  -1.898  1.00 81.28  ? 411  ILE A C     1 
ATOM   3233 O  O     . ILE A 1 414 ? -12.019 4.190  -1.786  1.00 82.86  ? 411  ILE A O     1 
ATOM   3234 C  CB    . ILE A 1 414 ? -11.944 2.218  0.462   1.00 65.68  ? 411  ILE A CB    1 
ATOM   3235 C  CG1   . ILE A 1 414 ? -11.186 1.675  1.681   1.00 65.44  ? 411  ILE A CG1   1 
ATOM   3236 C  CG2   . ILE A 1 414 ? -13.218 1.402  0.252   1.00 65.04  ? 411  ILE A CG2   1 
ATOM   3237 C  CD1   . ILE A 1 414 ? -10.921 0.185  1.658   1.00 64.96  ? 411  ILE A CD1   1 
ATOM   3238 N  N     . GLN A 1 415 ? -12.302 2.225  -2.912  1.00 86.73  ? 412  GLN A N     1 
ATOM   3239 C  CA    . GLN A 1 415 ? -12.934 2.767  -4.120  1.00 87.99  ? 412  GLN A CA    1 
ATOM   3240 C  C     . GLN A 1 415 ? -14.217 3.557  -3.859  1.00 81.50  ? 412  GLN A C     1 
ATOM   3241 O  O     . GLN A 1 415 ? -14.416 4.620  -4.436  1.00 77.10  ? 412  GLN A O     1 
ATOM   3242 C  CB    . GLN A 1 415 ? -13.242 1.609  -5.083  1.00 93.16  ? 412  GLN A CB    1 
ATOM   3243 C  CG    . GLN A 1 415 ? -14.128 1.954  -6.274  1.00 94.13  ? 412  GLN A CG    1 
ATOM   3244 C  CD    . GLN A 1 415 ? -14.491 0.728  -7.099  1.00 97.29  ? 412  GLN A CD    1 
ATOM   3245 O  OE1   . GLN A 1 415 ? -13.697 -0.204 -7.232  1.00 99.92  ? 412  GLN A OE1   1 
ATOM   3246 N  NE2   . GLN A 1 415 ? -15.700 0.724  -7.662  1.00 95.55  ? 412  GLN A NE2   1 
ATOM   3247 N  N     . THR A 1 416 ? -15.088 3.014  -3.018  1.00 73.93  ? 413  THR A N     1 
ATOM   3248 C  CA    . THR A 1 416 ? -16.419 3.591  -2.799  1.00 67.90  ? 413  THR A CA    1 
ATOM   3249 C  C     . THR A 1 416 ? -16.447 4.724  -1.754  1.00 61.84  ? 413  THR A C     1 
ATOM   3250 O  O     . THR A 1 416 ? -17.454 5.401  -1.616  1.00 60.88  ? 413  THR A O     1 
ATOM   3251 C  CB    . THR A 1 416 ? -17.407 2.507  -2.341  1.00 67.64  ? 413  THR A CB    1 
ATOM   3252 O  OG1   . THR A 1 416 ? -17.100 2.121  -0.986  1.00 67.00  ? 413  THR A OG1   1 
ATOM   3253 C  CG2   . THR A 1 416 ? -17.357 1.291  -3.281  1.00 67.75  ? 413  THR A CG2   1 
ATOM   3254 N  N     . GLU A 1 417 ? -15.369 4.896  -0.994  1.00 52.61  ? 414  GLU A N     1 
ATOM   3255 C  CA    . GLU A 1 417 ? -15.311 5.917  0.037   1.00 50.84  ? 414  GLU A CA    1 
ATOM   3256 C  C     . GLU A 1 417 ? -14.664 7.194  -0.478  1.00 53.06  ? 414  GLU A C     1 
ATOM   3257 O  O     . GLU A 1 417 ? -13.922 7.190  -1.488  1.00 52.43  ? 414  GLU A O     1 
ATOM   3258 C  CB    . GLU A 1 417 ? -14.517 5.426  1.259   1.00 47.93  ? 414  GLU A CB    1 
ATOM   3259 C  CG    . GLU A 1 417 ? -15.013 4.127  1.849   1.00 50.11  ? 414  GLU A CG    1 
ATOM   3260 C  CD    . GLU A 1 417 ? -16.484 4.166  2.223   1.00 49.83  ? 414  GLU A CD    1 
ATOM   3261 O  OE1   . GLU A 1 417 ? -16.842 4.917  3.152   1.00 52.64  ? 414  GLU A OE1   1 
ATOM   3262 O  OE2   . GLU A 1 417 ? -17.285 3.453  1.579   1.00 47.01  ? 414  GLU A OE2   1 
ATOM   3263 N  N     . TRP A 1 418 ? -14.916 8.271  0.263   1.00 44.89  ? 415  TRP A N     1 
ATOM   3264 C  CA    . TRP A 1 418 ? -14.315 9.544  -0.000  1.00 43.07  ? 415  TRP A CA    1 
ATOM   3265 C  C     . TRP A 1 418 ? -13.569 10.055 1.212   1.00 42.78  ? 415  TRP A C     1 
ATOM   3266 O  O     . TRP A 1 418 ? -14.160 10.347 2.246   1.00 46.33  ? 415  TRP A O     1 
ATOM   3267 C  CB    . TRP A 1 418 ? -15.373 10.561 -0.475  1.00 42.26  ? 415  TRP A CB    1 
ATOM   3268 C  CG    . TRP A 1 418 ? -14.732 11.680 -1.162  1.00 38.75  ? 415  TRP A CG    1 
ATOM   3269 C  CD1   . TRP A 1 418 ? -14.022 12.678 -0.589  1.00 39.09  ? 415  TRP A CD1   1 
ATOM   3270 C  CD2   . TRP A 1 418 ? -14.642 11.876 -2.578  1.00 39.06  ? 415  TRP A CD2   1 
ATOM   3271 N  NE1   . TRP A 1 418 ? -13.499 13.512 -1.560  1.00 38.69  ? 415  TRP A NE1   1 
ATOM   3272 C  CE2   . TRP A 1 418 ? -13.877 13.043 -2.788  1.00 37.46  ? 415  TRP A CE2   1 
ATOM   3273 C  CE3   . TRP A 1 418 ? -15.153 11.191 -3.688  1.00 40.70  ? 415  TRP A CE3   1 
ATOM   3274 C  CZ2   . TRP A 1 418 ? -13.617 13.548 -4.058  1.00 38.38  ? 415  TRP A CZ2   1 
ATOM   3275 C  CZ3   . TRP A 1 418 ? -14.898 11.696 -4.946  1.00 39.23  ? 415  TRP A CZ3   1 
ATOM   3276 C  CH2   . TRP A 1 418 ? -14.134 12.858 -5.119  1.00 38.19  ? 415  TRP A CH2   1 
ATOM   3277 N  N     . SER A 1 419 ? -12.255 10.183 1.077   1.00 46.81  ? 416  SER A N     1 
ATOM   3278 C  CA    . SER A 1 419 ? -11.438 10.734 2.143   1.00 49.60  ? 416  SER A CA    1 
ATOM   3279 C  C     . SER A 1 419 ? -10.506 11.799 1.583   1.00 49.20  ? 416  SER A C     1 
ATOM   3280 O  O     . SER A 1 419 ? -9.985  11.627 0.469   1.00 47.74  ? 416  SER A O     1 
ATOM   3281 C  CB    . SER A 1 419 ? -10.599 9.649  2.823   1.00 52.74  ? 416  SER A CB    1 
ATOM   3282 O  OG    . SER A 1 419 ? -11.419 8.558  3.156   1.00 60.02  ? 416  SER A OG    1 
ATOM   3283 N  N     . PRO A 1 420 ? -10.282 12.884 2.336   1.00 50.12  ? 417  PRO A N     1 
ATOM   3284 C  CA    . PRO A 1 420 ? -11.040 13.193 3.565   1.00 53.49  ? 417  PRO A CA    1 
ATOM   3285 C  C     . PRO A 1 420 ? -12.445 13.670 3.177   1.00 51.68  ? 417  PRO A C     1 
ATOM   3286 O  O     . PRO A 1 420 ? -12.615 14.147 2.053   1.00 52.98  ? 417  PRO A O     1 
ATOM   3287 C  CB    . PRO A 1 420 ? -10.230 14.325 4.214   1.00 55.18  ? 417  PRO A CB    1 
ATOM   3288 C  CG    . PRO A 1 420 ? -8.903  14.302 3.511   1.00 53.00  ? 417  PRO A CG    1 
ATOM   3289 C  CD    . PRO A 1 420 ? -9.224  13.875 2.111   1.00 49.95  ? 417  PRO A CD    1 
ATOM   3290 N  N     . PRO A 1 421 ? -13.439 13.531 4.081   1.00 50.34  ? 418  PRO A N     1 
ATOM   3291 C  CA    . PRO A 1 421 ? -14.823 13.923 3.737   1.00 46.13  ? 418  PRO A CA    1 
ATOM   3292 C  C     . PRO A 1 421 ? -14.913 15.371 3.249   1.00 38.02  ? 418  PRO A C     1 
ATOM   3293 O  O     . PRO A 1 421 ? -14.153 16.240 3.711   1.00 34.66  ? 418  PRO A O     1 
ATOM   3294 C  CB    . PRO A 1 421 ? -15.601 13.737 5.060   1.00 46.69  ? 418  PRO A CB    1 
ATOM   3295 C  CG    . PRO A 1 421 ? -14.756 12.828 5.887   1.00 49.03  ? 418  PRO A CG    1 
ATOM   3296 C  CD    . PRO A 1 421 ? -13.321 13.120 5.497   1.00 51.47  ? 418  PRO A CD    1 
ATOM   3297 N  N     . LEU A 1 422 ? -15.822 15.600 2.306   1.00 33.43  ? 419  LEU A N     1 
ATOM   3298 C  CA    . LEU A 1 422 ? -16.058 16.933 1.771   1.00 30.88  ? 419  LEU A CA    1 
ATOM   3299 C  C     . LEU A 1 422 ? -17.050 17.743 2.632   1.00 27.12  ? 419  LEU A C     1 
ATOM   3300 O  O     . LEU A 1 422 ? -18.159 17.308 2.875   1.00 27.76  ? 419  LEU A O     1 
ATOM   3301 C  CB    . LEU A 1 422 ? -16.567 16.827 0.336   1.00 30.89  ? 419  LEU A CB    1 
ATOM   3302 C  CG    . LEU A 1 422 ? -15.695 16.080 -0.703  1.00 33.02  ? 419  LEU A CG    1 
ATOM   3303 C  CD1   . LEU A 1 422 ? -16.323 16.194 -2.099  1.00 34.80  ? 419  LEU A CD1   1 
ATOM   3304 C  CD2   . LEU A 1 422 ? -14.255 16.590 -0.730  1.00 33.62  ? 419  LEU A CD2   1 
ATOM   3305 N  N     . THR A 1 423 ? -16.654 18.932 3.051   1.00 25.20  ? 420  THR A N     1 
ATOM   3306 C  CA    . THR A 1 423 ? -17.530 19.831 3.817   1.00 25.27  ? 420  THR A CA    1 
ATOM   3307 C  C     . THR A 1 423 ? -18.130 20.984 2.985   1.00 22.32  ? 420  THR A C     1 
ATOM   3308 O  O     . THR A 1 423 ? -18.812 21.818 3.562   1.00 22.40  ? 420  THR A O     1 
ATOM   3309 C  CB    . THR A 1 423 ? -16.727 20.454 4.955   1.00 26.02  ? 420  THR A CB    1 
ATOM   3310 O  OG1   . THR A 1 423 ? -15.508 20.993 4.395   1.00 27.95  ? 420  THR A OG1   1 
ATOM   3311 C  CG2   . THR A 1 423 ? -16.380 19.367 5.990   1.00 28.34  ? 420  THR A CG2   1 
ATOM   3312 N  N     . MET A 1 424 ? -17.908 21.017 1.666   1.00 20.11  ? 421  MET A N     1 
ATOM   3313 C  CA    . MET A 1 424 ? -18.499 22.041 0.789   1.00 20.16  ? 421  MET A CA    1 
ATOM   3314 C  C     . MET A 1 424 ? -18.365 21.643 -0.670  1.00 20.69  ? 421  MET A C     1 
ATOM   3315 O  O     . MET A 1 424 ? -17.308 21.129 -1.072  1.00 24.03  ? 421  MET A O     1 
ATOM   3316 C  CB    . MET A 1 424 ? -17.809 23.389 1.001   1.00 22.13  ? 421  MET A CB    1 
ATOM   3317 C  CG    . MET A 1 424 ? -18.330 24.609 0.197   1.00 23.72  ? 421  MET A CG    1 
ATOM   3318 S  SD    . MET A 1 424 ? -17.615 24.751 -1.450  1.00 27.79  ? 421  MET A SD    1 
ATOM   3319 C  CE    . MET A 1 424 ? -15.871 25.000 -1.127  1.00 27.93  ? 421  MET A CE    1 
ATOM   3320 N  N     . LEU A 1 425 ? -19.418 21.887 -1.450  1.00 18.05  ? 422  LEU A N     1 
ATOM   3321 C  CA    . LEU A 1 425 ? -19.429 21.742 -2.873  1.00 18.05  ? 422  LEU A CA    1 
ATOM   3322 C  C     . LEU A 1 425 ? -19.942 23.082 -3.449  1.00 20.31  ? 422  LEU A C     1 
ATOM   3323 O  O     . LEU A 1 425 ? -20.810 23.794 -2.828  1.00 17.24  ? 422  LEU A O     1 
ATOM   3324 C  CB    . LEU A 1 425 ? -20.361 20.636 -3.298  1.00 18.49  ? 422  LEU A CB    1 
ATOM   3325 C  CG    . LEU A 1 425 ? -20.080 19.168 -2.920  1.00 17.86  ? 422  LEU A CG    1 
ATOM   3326 C  CD1   . LEU A 1 425 ? -21.176 18.285 -3.499  1.00 19.44  ? 422  LEU A CD1   1 
ATOM   3327 C  CD2   . LEU A 1 425 ? -18.732 18.729 -3.450  1.00 19.16  ? 422  LEU A CD2   1 
ATOM   3328 N  N     . PHE A 1 426 ? -19.442 23.415 -4.646  1.00 20.43  ? 423  PHE A N     1 
ATOM   3329 C  CA    . PHE A 1 426 ? -19.659 24.723 -5.233  1.00 21.58  ? 423  PHE A CA    1 
ATOM   3330 C  C     . PHE A 1 426 ? -19.542 24.552 -6.735  1.00 22.17  ? 423  PHE A C     1 
ATOM   3331 O  O     . PHE A 1 426 ? -18.497 24.051 -7.248  1.00 23.64  ? 423  PHE A O     1 
ATOM   3332 C  CB    . PHE A 1 426 ? -18.578 25.666 -4.722  1.00 26.34  ? 423  PHE A CB    1 
ATOM   3333 C  CG    . PHE A 1 426 ? -18.588 27.027 -5.365  1.00 31.29  ? 423  PHE A CG    1 
ATOM   3334 C  CD1   . PHE A 1 426 ? -19.529 27.964 -4.996  1.00 38.30  ? 423  PHE A CD1   1 
ATOM   3335 C  CD2   . PHE A 1 426 ? -17.678 27.369 -6.364  1.00 39.23  ? 423  PHE A CD2   1 
ATOM   3336 C  CE1   . PHE A 1 426 ? -19.565 29.246 -5.551  1.00 39.73  ? 423  PHE A CE1   1 
ATOM   3337 C  CE2   . PHE A 1 426 ? -17.682 28.646 -6.923  1.00 39.95  ? 423  PHE A CE2   1 
ATOM   3338 C  CZ    . PHE A 1 426 ? -18.626 29.590 -6.496  1.00 40.07  ? 423  PHE A CZ    1 
ATOM   3339 N  N     . LEU A 1 427 ? -20.609 24.907 -7.428  1.00 19.12  ? 424  LEU A N     1 
ATOM   3340 C  CA    . LEU A 1 427 ? -20.628 24.893 -8.868  1.00 19.19  ? 424  LEU A CA    1 
ATOM   3341 C  C     . LEU A 1 427 ? -20.933 26.278 -9.324  1.00 19.26  ? 424  LEU A C     1 
ATOM   3342 O  O     . LEU A 1 427 ? -21.880 26.872 -8.866  1.00 18.13  ? 424  LEU A O     1 
ATOM   3343 C  CB    . LEU A 1 427 ? -21.673 23.939 -9.402  1.00 19.54  ? 424  LEU A CB    1 
ATOM   3344 C  CG    . LEU A 1 427 ? -21.488 22.451 -9.201  1.00 19.08  ? 424  LEU A CG    1 
ATOM   3345 C  CD1   . LEU A 1 427 ? -22.585 21.721 -9.976  1.00 19.88  ? 424  LEU A CD1   1 
ATOM   3346 C  CD2   . LEU A 1 427 ? -20.118 21.985 -9.685  1.00 18.62  ? 424  LEU A CD2   1 
ATOM   3347 N  N     . CYS A 1 428 ? -20.093 26.805 -10.222 1.00 20.80  ? 425  CYS A N     1 
ATOM   3348 C  CA    . CYS A 1 428 ? -20.239 28.202 -10.680 1.00 21.45  ? 425  CYS A CA    1 
ATOM   3349 C  C     . CYS A 1 428 ? -20.092 28.354 -12.197 1.00 19.88  ? 425  CYS A C     1 
ATOM   3350 O  O     . CYS A 1 428 ? -19.019 28.051 -12.766 1.00 21.84  ? 425  CYS A O     1 
ATOM   3351 C  CB    . CYS A 1 428 ? -19.228 29.137 -9.987  1.00 22.59  ? 425  CYS A CB    1 
ATOM   3352 S  SG    . CYS A 1 428 ? -19.575 30.924 -10.264 1.00 27.79  ? 425  CYS A SG    1 
ATOM   3353 N  N     . ALA A 1 429 ? -21.135 28.881 -12.821 1.00 17.68  ? 426  ALA A N     1 
ATOM   3354 C  CA    . ALA A 1 429 ? -21.089 29.166 -14.264 1.00 16.78  ? 426  ALA A CA    1 
ATOM   3355 C  C     . ALA A 1 429 ? -20.503 30.560 -14.487 1.00 17.27  ? 426  ALA A C     1 
ATOM   3356 O  O     . ALA A 1 429 ? -20.979 31.554 -13.870 1.00 14.79  ? 426  ALA A O     1 
ATOM   3357 C  CB    . ALA A 1 429 ? -22.483 29.102 -14.844 1.00 16.31  ? 426  ALA A CB    1 
ATOM   3358 N  N     . THR A 1 430 ? -19.524 30.662 -15.396 1.00 19.19  ? 427  THR A N     1 
ATOM   3359 C  CA    . THR A 1 430 ? -18.785 31.905 -15.612 1.00 23.08  ? 427  THR A CA    1 
ATOM   3360 C  C     . THR A 1 430 ? -18.475 32.039 -17.098 1.00 21.62  ? 427  THR A C     1 
ATOM   3361 O  O     . THR A 1 430 ? -18.802 31.154 -17.889 1.00 20.14  ? 427  THR A O     1 
ATOM   3362 C  CB    . THR A 1 430 ? -17.434 31.943 -14.838 1.00 24.76  ? 427  THR A CB    1 
ATOM   3363 O  OG1   . THR A 1 430 ? -16.569 30.949 -15.342 1.00 29.46  ? 427  THR A OG1   1 
ATOM   3364 C  CG2   . THR A 1 430 ? -17.588 31.590 -13.395 1.00 29.47  ? 427  THR A CG2   1 
ATOM   3365 N  N     . LYS A 1 431 ? -17.821 33.143 -17.456 1.00 22.65  ? 428  LYS A N     1 
ATOM   3366 C  CA    . LYS A 1 431 ? -17.344 33.400 -18.853 1.00 23.81  ? 428  LYS A CA    1 
ATOM   3367 C  C     . LYS A 1 431 ? -18.523 33.431 -19.845 1.00 20.27  ? 428  LYS A C     1 
ATOM   3368 O  O     . LYS A 1 431 ? -18.601 32.621 -20.747 1.00 19.44  ? 428  LYS A O     1 
ATOM   3369 C  CB    . LYS A 1 431 ? -16.292 32.391 -19.290 1.00 25.17  ? 428  LYS A CB    1 
ATOM   3370 C  CG    . LYS A 1 431 ? -15.064 32.389 -18.423 1.00 34.24  ? 428  LYS A CG    1 
ATOM   3371 C  CD    . LYS A 1 431 ? -14.221 33.640 -18.616 1.00 39.35  ? 428  LYS A CD    1 
ATOM   3372 C  CE    . LYS A 1 431 ? -12.927 33.581 -17.799 1.00 44.48  ? 428  LYS A CE    1 
ATOM   3373 N  NZ    . LYS A 1 431 ? -12.114 32.367 -18.108 1.00 45.46  ? 428  LYS A NZ    1 
ATOM   3374 N  N     . PHE A 1 432 ? -19.445 34.353 -19.626 1.00 20.39  ? 429  PHE A N     1 
ATOM   3375 C  CA    . PHE A 1 432 ? -20.646 34.509 -20.463 1.00 22.55  ? 429  PHE A CA    1 
ATOM   3376 C  C     . PHE A 1 432 ? -20.265 35.081 -21.814 1.00 25.62  ? 429  PHE A C     1 
ATOM   3377 O  O     . PHE A 1 432 ? -19.386 35.957 -21.881 1.00 23.80  ? 429  PHE A O     1 
ATOM   3378 C  CB    . PHE A 1 432 ? -21.730 35.398 -19.768 1.00 24.23  ? 429  PHE A CB    1 
ATOM   3379 C  CG    . PHE A 1 432 ? -22.470 34.666 -18.658 1.00 25.02  ? 429  PHE A CG    1 
ATOM   3380 C  CD1   . PHE A 1 432 ? -23.560 33.858 -18.947 1.00 23.97  ? 429  PHE A CD1   1 
ATOM   3381 C  CD2   . PHE A 1 432 ? -21.991 34.663 -17.360 1.00 28.94  ? 429  PHE A CD2   1 
ATOM   3382 C  CE1   . PHE A 1 432 ? -24.198 33.117 -17.971 1.00 22.28  ? 429  PHE A CE1   1 
ATOM   3383 C  CE2   . PHE A 1 432 ? -22.640 33.929 -16.364 1.00 26.34  ? 429  PHE A CE2   1 
ATOM   3384 C  CZ    . PHE A 1 432 ? -23.733 33.148 -16.691 1.00 25.13  ? 429  PHE A CZ    1 
ATOM   3385 N  N     . SER A 1 433 ? -20.912 34.576 -22.868 1.00 27.42  ? 430  SER A N     1 
ATOM   3386 C  CA    . SER A 1 433 ? -20.871 35.165 -24.228 1.00 30.42  ? 430  SER A CA    1 
ATOM   3387 C  C     . SER A 1 433 ? -22.281 35.452 -24.727 1.00 29.38  ? 430  SER A C     1 
ATOM   3388 O  O     . SER A 1 433 ? -23.253 34.780 -24.327 1.00 25.67  ? 430  SER A O     1 
ATOM   3389 C  CB    . SER A 1 433 ? -20.256 34.184 -25.224 1.00 32.58  ? 430  SER A CB    1 
ATOM   3390 O  OG    . SER A 1 433 ? -19.227 33.441 -24.630 1.00 39.44  ? 430  SER A OG    1 
ATOM   3391 N  N     . ALA A 1 434 ? -22.396 36.431 -25.616 1.00 31.90  ? 431  ALA A N     1 
ATOM   3392 C  CA    . ALA A 1 434 ? -23.709 36.870 -26.118 1.00 36.12  ? 431  ALA A CA    1 
ATOM   3393 C  C     . ALA A 1 434 ? -24.366 35.741 -26.911 1.00 38.09  ? 431  ALA A C     1 
ATOM   3394 O  O     . ALA A 1 434 ? -23.670 34.959 -27.570 1.00 36.94  ? 431  ALA A O     1 
ATOM   3395 C  CB    . ALA A 1 434 ? -23.578 38.120 -26.967 1.00 40.22  ? 431  ALA A CB    1 
ATOM   3396 N  N     . SER A 1 435 ? -25.690 35.623 -26.784 1.00 40.33  ? 432  SER A N     1 
ATOM   3397 C  CA    . SER A 1 435 ? -26.449 34.508 -27.393 1.00 46.95  ? 432  SER A CA    1 
ATOM   3398 C  C     . SER A 1 435 ? -27.727 35.028 -28.023 1.00 46.38  ? 432  SER A C     1 
ATOM   3399 O  O     . SER A 1 435 ? -27.939 34.890 -29.209 1.00 51.32  ? 432  SER A O     1 
ATOM   3400 C  CB    . SER A 1 435 ? -26.760 33.430 -26.346 1.00 48.04  ? 432  SER A CB    1 
ATOM   3401 O  OG    . SER A 1 435 ? -27.859 32.614 -26.709 1.00 57.83  ? 432  SER A OG    1 
ATOM   3402 O  OXT   . SER A 1 435 ? -28.579 35.593 -27.360 1.00 46.73  ? 432  SER A OXT   1 
ATOM   3403 O  "O5'" . DA  B 2 2   ? -22.111 24.951 19.410  1.00 72.96  ? 2    DA  T "O5'" 1 
ATOM   3404 C  "C5'" . DA  B 2 2   ? -20.933 25.058 18.578  1.00 68.08  ? 2    DA  T "C5'" 1 
ATOM   3405 C  "C4'" . DA  B 2 2   ? -21.273 24.792 17.128  1.00 63.60  ? 2    DA  T "C4'" 1 
ATOM   3406 O  "O4'" . DA  B 2 2   ? -22.008 23.558 17.008  1.00 66.70  ? 2    DA  T "O4'" 1 
ATOM   3407 C  "C3'" . DA  B 2 2   ? -22.127 25.863 16.430  1.00 58.69  ? 2    DA  T "C3'" 1 
ATOM   3408 O  "O3'" . DA  B 2 2   ? -21.286 26.414 15.424  1.00 50.31  ? 2    DA  T "O3'" 1 
ATOM   3409 C  "C2'" . DA  B 2 2   ? -23.338 25.111 15.898  1.00 59.30  ? 2    DA  T "C2'" 1 
ATOM   3410 C  "C1'" . DA  B 2 2   ? -22.873 23.669 15.898  1.00 63.22  ? 2    DA  T "C1'" 1 
ATOM   3411 N  N9    . DA  B 2 2   ? -23.925 22.677 16.062  1.00 59.50  ? 2    DA  T N9    1 
ATOM   3412 C  C8    . DA  B 2 2   ? -24.981 22.715 16.937  1.00 63.44  ? 2    DA  T C8    1 
ATOM   3413 N  N7    . DA  B 2 2   ? -25.747 21.654 16.884  1.00 63.71  ? 2    DA  T N7    1 
ATOM   3414 C  C5    . DA  B 2 2   ? -25.145 20.855 15.924  1.00 65.31  ? 2    DA  T C5    1 
ATOM   3415 C  C6    . DA  B 2 2   ? -25.475 19.592 15.402  1.00 71.64  ? 2    DA  T C6    1 
ATOM   3416 N  N6    . DA  B 2 2   ? -26.536 18.887 15.796  1.00 76.13  ? 2    DA  T N6    1 
ATOM   3417 N  N1    . DA  B 2 2   ? -24.664 19.070 14.452  1.00 77.37  ? 2    DA  T N1    1 
ATOM   3418 C  C2    . DA  B 2 2   ? -23.601 19.784 14.053  1.00 74.11  ? 2    DA  T C2    1 
ATOM   3419 N  N3    . DA  B 2 2   ? -23.185 20.978 14.474  1.00 74.21  ? 2    DA  T N3    1 
ATOM   3420 C  C4    . DA  B 2 2   ? -24.013 21.466 15.418  1.00 67.13  ? 2    DA  T C4    1 
ATOM   3421 P  P     . DT  B 2 3   ? -21.785 27.428 14.376  1.00 44.26  ? 3    DT  T P     1 
ATOM   3422 O  OP1   . DT  B 2 3   ? -20.636 28.182 13.894  1.00 39.27  ? 3    DT  T OP1   1 
ATOM   3423 O  OP2   . DT  B 2 3   ? -22.929 28.140 14.916  1.00 48.21  ? 3    DT  T OP2   1 
ATOM   3424 O  "O5'" . DT  B 2 3   ? -22.287 26.471 13.219  1.00 41.60  ? 3    DT  T "O5'" 1 
ATOM   3425 C  "C5'" . DT  B 2 3   ? -21.399 25.524 12.621  1.00 36.49  ? 3    DT  T "C5'" 1 
ATOM   3426 C  "C4'" . DT  B 2 3   ? -22.128 24.566 11.713  1.00 33.96  ? 3    DT  T "C4'" 1 
ATOM   3427 O  "O4'" . DT  B 2 3   ? -23.058 23.770 12.469  1.00 30.48  ? 3    DT  T "O4'" 1 
ATOM   3428 C  "C3'" . DT  B 2 3   ? -22.921 25.206 10.568  1.00 33.31  ? 3    DT  T "C3'" 1 
ATOM   3429 O  "O3'" . DT  B 2 3   ? -22.332 24.769 9.333   1.00 31.68  ? 3    DT  T "O3'" 1 
ATOM   3430 C  "C2'" . DT  B 2 3   ? -24.347 24.703 10.788  1.00 31.06  ? 3    DT  T "C2'" 1 
ATOM   3431 C  "C1'" . DT  B 2 3   ? -24.154 23.460 11.638  1.00 30.88  ? 3    DT  T "C1'" 1 
ATOM   3432 N  N1    . DT  B 2 3   ? -25.291 23.054 12.497  1.00 32.44  ? 3    DT  T N1    1 
ATOM   3433 C  C2    . DT  B 2 3   ? -25.814 21.799 12.301  1.00 32.48  ? 3    DT  T C2    1 
ATOM   3434 O  O2    . DT  B 2 3   ? -25.394 21.038 11.455  1.00 33.00  ? 3    DT  T O2    1 
ATOM   3435 N  N3    . DT  B 2 3   ? -26.853 21.472 13.136  1.00 33.00  ? 3    DT  T N3    1 
ATOM   3436 C  C4    . DT  B 2 3   ? -27.402 22.259 14.129  1.00 31.13  ? 3    DT  T C4    1 
ATOM   3437 O  O4    . DT  B 2 3   ? -28.311 21.826 14.817  1.00 31.23  ? 3    DT  T O4    1 
ATOM   3438 C  C5    . DT  B 2 3   ? -26.795 23.558 14.290  1.00 31.69  ? 3    DT  T C5    1 
ATOM   3439 C  C7    . DT  B 2 3   ? -27.296 24.463 15.368  1.00 34.81  ? 3    DT  T C7    1 
ATOM   3440 C  C6    . DT  B 2 3   ? -25.777 23.883 13.484  1.00 32.19  ? 3    DT  T C6    1 
HETATM 3441 P  P     . 5DB B 2 4   ? -21.756 25.782 8.212   1.00 29.34  ? 4    5DB T P     1 
HETATM 3442 O  OP1   . 5DB B 2 4   ? -20.888 24.881 7.323   1.00 29.10  ? 4    5DB T OP1   1 
HETATM 3443 O  "O5'" . 5DB B 2 4   ? -23.126 26.397 7.681   1.00 27.42  ? 4    5DB T "O5'" 1 
HETATM 3444 C  "C5'" . 5DB B 2 4   ? -24.013 25.537 6.994   1.00 26.91  ? 4    5DB T "C5'" 1 
HETATM 3445 C  "C4'" . 5DB B 2 4   ? -25.132 26.332 6.353   1.00 24.46  ? 4    5DB T "C4'" 1 
HETATM 3446 C  "C3'" . 5DB B 2 4   ? -24.634 27.485 5.511   1.00 23.69  ? 4    5DB T "C3'" 1 
HETATM 3447 O  "O3'" . 5DB B 2 4   ? -25.344 27.429 4.278   1.00 20.66  ? 4    5DB T "O3'" 1 
HETATM 3448 C  "C2'" . 5DB B 2 4   ? -24.952 28.801 6.114   1.00 20.90  ? 4    5DB T "C2'" 1 
HETATM 3449 C  "C1'" . 5DB B 2 4   ? -25.956 28.335 7.145   1.00 22.32  ? 4    5DB T "C1'" 1 
HETATM 3450 O  "O4'" . 5DB B 2 4   ? -25.838 26.943 7.406   1.00 22.02  ? 4    5DB T "O4'" 1 
HETATM 3451 N  N1    . 5DB B 2 4   ? -25.760 28.950 8.425   1.00 23.64  ? 4    5DB T N1    1 
HETATM 3452 C  C6    . 5DB B 2 4   ? -24.619 28.697 9.049   1.00 24.78  ? 4    5DB T C6    1 
HETATM 3453 C  C5    . 5DB B 2 4   ? -24.374 29.304 10.265  1.00 26.73  ? 4    5DB T C5    1 
HETATM 3454 C  C7    . 5DB B 2 4   ? -23.077 28.991 10.944  1.00 29.26  ? 4    5DB T C7    1 
HETATM 3455 C  C4    . 5DB B 2 4   ? -25.442 30.182 10.857  1.00 24.02  ? 4    5DB T C4    1 
HETATM 3456 N  N3    . 5DB B 2 4   ? -26.576 30.392 10.165  1.00 22.50  ? 4    5DB T N3    1 
HETATM 3457 C  C2    . 5DB B 2 4   ? -26.773 29.805 8.971   1.00 23.41  ? 4    5DB T C2    1 
HETATM 3458 O  O2    . 5DB B 2 4   ? -27.803 30.036 8.275   1.00 22.08  ? 4    5DB T O2    1 
HETATM 3459 O  O4    . 5DB B 2 4   ? -25.299 30.799 12.078  1.00 24.47  ? 4    5DB T O4    1 
HETATM 3460 O  OP2   . 5DB B 2 4   ? -21.084 26.932 8.918   1.00 31.50  ? 4    5DB T OP2   1 
HETATM 3461 C  C1    . 5DB B 2 4   ? -26.428 31.051 12.890  1.00 22.38  ? 4    5DB T C1    1 
ATOM   3462 P  P     . DA  B 2 5   ? -25.438 26.787 2.786   1.00 16.98  ? 5    DA  T P     1 
ATOM   3463 O  OP1   . DA  B 2 5   ? -26.457 25.743 2.644   1.00 18.00  ? 5    DA  T OP1   1 
ATOM   3464 O  OP2   . DA  B 2 5   ? -24.032 26.361 2.664   1.00 16.86  ? 5    DA  T OP2   1 
ATOM   3465 O  "O5'" . DA  B 2 5   ? -25.747 27.917 1.699   1.00 18.99  ? 5    DA  T "O5'" 1 
ATOM   3466 C  "C5'" . DA  B 2 5   ? -27.093 28.384 1.437   1.00 17.95  ? 5    DA  T "C5'" 1 
ATOM   3467 C  "C4'" . DA  B 2 5   ? -27.052 29.508 0.436   1.00 19.05  ? 5    DA  T "C4'" 1 
ATOM   3468 O  "O4'" . DA  B 2 5   ? -26.369 30.638 1.040   1.00 19.75  ? 5    DA  T "O4'" 1 
ATOM   3469 C  "C3'" . DA  B 2 5   ? -26.278 29.180 -0.846  1.00 19.71  ? 5    DA  T "C3'" 1 
ATOM   3470 O  "O3'" . DA  B 2 5   ? -26.989 29.805 -1.905  1.00 19.57  ? 5    DA  T "O3'" 1 
ATOM   3471 C  "C2'" . DA  B 2 5   ? -24.909 29.776 -0.573  1.00 19.87  ? 5    DA  T "C2'" 1 
ATOM   3472 C  "C1'" . DA  B 2 5   ? -25.304 31.028 0.200   1.00 20.68  ? 5    DA  T "C1'" 1 
ATOM   3473 N  N9    . DA  B 2 5   ? -24.266 31.659 1.015   1.00 20.57  ? 5    DA  T N9    1 
ATOM   3474 C  C8    . DA  B 2 5   ? -23.250 31.077 1.731   1.00 20.35  ? 5    DA  T C8    1 
ATOM   3475 N  N7    . DA  B 2 5   ? -22.457 31.940 2.321   1.00 19.41  ? 5    DA  T N7    1 
ATOM   3476 C  C5    . DA  B 2 5   ? -22.951 33.174 1.922   1.00 20.76  ? 5    DA  T C5    1 
ATOM   3477 C  C6    . DA  B 2 5   ? -22.548 34.492 2.204   1.00 19.56  ? 5    DA  T C6    1 
ATOM   3478 N  N6    . DA  B 2 5   ? -21.484 34.797 2.943   1.00 19.82  ? 5    DA  T N6    1 
ATOM   3479 N  N1    . DA  B 2 5   ? -23.282 35.498 1.680   1.00 20.80  ? 5    DA  T N1    1 
ATOM   3480 C  C2    . DA  B 2 5   ? -24.344 35.189 0.924   1.00 18.73  ? 5    DA  T C2    1 
ATOM   3481 N  N3    . DA  B 2 5   ? -24.800 33.994 0.562   1.00 17.16  ? 5    DA  T N3    1 
ATOM   3482 C  C4    . DA  B 2 5   ? -24.069 33.017 1.123   1.00 19.78  ? 5    DA  T C4    1 
ATOM   3483 P  P     . DT  B 2 6   ? -26.707 29.458 -3.419  1.00 21.53  ? 6    DT  T P     1 
ATOM   3484 O  OP1   . DT  B 2 6   ? -27.712 30.221 -4.196  1.00 25.47  ? 6    DT  T OP1   1 
ATOM   3485 O  OP2   . DT  B 2 6   ? -26.662 27.996 -3.540  1.00 25.54  ? 6    DT  T OP2   1 
ATOM   3486 O  "O5'" . DT  B 2 6   ? -25.228 29.994 -3.629  1.00 23.69  ? 6    DT  T "O5'" 1 
ATOM   3487 C  "C5'" . DT  B 2 6   ? -24.905 31.058 -4.525  1.00 23.95  ? 6    DT  T "C5'" 1 
ATOM   3488 C  "C4'" . DT  B 2 6   ? -25.105 32.451 -3.969  1.00 23.01  ? 6    DT  T "C4'" 1 
ATOM   3489 O  "O4'" . DT  B 2 6   ? -24.401 32.600 -2.717  1.00 25.39  ? 6    DT  T "O4'" 1 
ATOM   3490 C  "C3'" . DT  B 2 6   ? -24.508 33.496 -4.917  1.00 22.09  ? 6    DT  T "C3'" 1 
ATOM   3491 O  "O3'" . DT  B 2 6   ? -25.494 34.023 -5.802  1.00 20.33  ? 6    DT  T "O3'" 1 
ATOM   3492 C  "C2'" . DT  B 2 6   ? -23.833 34.516 -4.019  1.00 23.70  ? 6    DT  T "C2'" 1 
ATOM   3493 C  "C1'" . DT  B 2 6   ? -23.909 33.940 -2.613  1.00 24.46  ? 6    DT  T "C1'" 1 
ATOM   3494 N  N1    . DT  B 2 6   ? -22.610 33.915 -1.901  1.00 22.39  ? 6    DT  T N1    1 
ATOM   3495 C  C2    . DT  B 2 6   ? -22.054 35.126 -1.528  1.00 23.72  ? 6    DT  T C2    1 
ATOM   3496 O  O2    . DT  B 2 6   ? -22.549 36.206 -1.811  1.00 21.94  ? 6    DT  T O2    1 
ATOM   3497 N  N3    . DT  B 2 6   ? -20.870 35.025 -0.833  1.00 21.22  ? 6    DT  T N3    1 
ATOM   3498 C  C4    . DT  B 2 6   ? -20.235 33.870 -0.435  1.00 21.84  ? 6    DT  T C4    1 
ATOM   3499 O  O4    . DT  B 2 6   ? -19.182 33.936 0.186   1.00 24.07  ? 6    DT  T O4    1 
ATOM   3500 C  C5    . DT  B 2 6   ? -20.877 32.639 -0.843  1.00 23.09  ? 6    DT  T C5    1 
ATOM   3501 C  C7    . DT  B 2 6   ? -20.243 31.337 -0.469  1.00 22.48  ? 6    DT  T C7    1 
ATOM   3502 C  C6    . DT  B 2 6   ? -22.023 32.720 -1.535  1.00 22.54  ? 6    DT  T C6    1 
ATOM   3503 P  P     . DG  B 2 7   ? -25.145 34.334 -7.328  1.00 22.65  ? 7    DG  T P     1 
ATOM   3504 O  OP1   . DG  B 2 7   ? -26.343 34.920 -7.987  1.00 28.75  ? 7    DG  T OP1   1 
ATOM   3505 O  OP2   . DG  B 2 7   ? -24.435 33.175 -7.943  1.00 19.53  ? 7    DG  T OP2   1 
ATOM   3506 O  "O5'" . DG  B 2 7   ? -23.914 35.350 -7.246  1.00 24.56  ? 7    DG  T "O5'" 1 
ATOM   3507 C  "C5'" . DG  B 2 7   ? -24.153 36.743 -7.241  1.00 26.02  ? 7    DG  T "C5'" 1 
ATOM   3508 C  "C4'" . DG  B 2 7   ? -22.895 37.527 -6.964  1.00 24.04  ? 7    DG  T "C4'" 1 
ATOM   3509 O  "O4'" . DG  B 2 7   ? -22.265 37.078 -5.746  1.00 22.51  ? 7    DG  T "O4'" 1 
ATOM   3510 C  "C3'" . DG  B 2 7   ? -21.811 37.494 -8.049  1.00 25.28  ? 7    DG  T "C3'" 1 
ATOM   3511 O  "O3'" . DG  B 2 7   ? -21.811 38.733 -8.769  1.00 26.56  ? 7    DG  T "O3'" 1 
ATOM   3512 C  "C2'" . DG  B 2 7   ? -20.516 37.410 -7.256  1.00 26.08  ? 7    DG  T "C2'" 1 
ATOM   3513 C  "C1'" . DG  B 2 7   ? -20.959 37.562 -5.805  1.00 23.44  ? 7    DG  T "C1'" 1 
ATOM   3514 N  N9    . DG  B 2 7   ? -20.139 36.808 -4.862  1.00 23.10  ? 7    DG  T N9    1 
ATOM   3515 C  C8    . DG  B 2 7   ? -20.079 35.450 -4.664  1.00 21.54  ? 7    DG  T C8    1 
ATOM   3516 N  N7    . DG  B 2 7   ? -19.212 35.104 -3.752  1.00 21.72  ? 7    DG  T N7    1 
ATOM   3517 C  C5    . DG  B 2 7   ? -18.622 36.299 -3.372  1.00 20.83  ? 7    DG  T C5    1 
ATOM   3518 C  C6    . DG  B 2 7   ? -17.579 36.552 -2.455  1.00 20.71  ? 7    DG  T C6    1 
ATOM   3519 O  O6    . DG  B 2 7   ? -16.981 35.751 -1.731  1.00 19.24  ? 7    DG  T O6    1 
ATOM   3520 N  N1    . DG  B 2 7   ? -17.303 37.914 -2.357  1.00 20.52  ? 7    DG  T N1    1 
ATOM   3521 C  C2    . DG  B 2 7   ? -17.941 38.900 -3.066  1.00 22.03  ? 7    DG  T C2    1 
ATOM   3522 N  N2    . DG  B 2 7   ? -17.509 40.154 -2.866  1.00 20.85  ? 7    DG  T N2    1 
ATOM   3523 N  N3    . DG  B 2 7   ? -18.901 38.670 -3.946  1.00 20.95  ? 7    DG  T N3    1 
ATOM   3524 C  C4    . DG  B 2 7   ? -19.192 37.360 -4.041  1.00 22.22  ? 7    DG  T C4    1 
ATOM   3525 P  P     . DA  B 2 8   ? -20.815 38.982 -10.018 1.00 29.41  ? 8    DA  T P     1 
ATOM   3526 O  OP1   . DA  B 2 8   ? -21.516 39.789 -10.990 1.00 26.56  ? 8    DA  T OP1   1 
ATOM   3527 O  OP2   . DA  B 2 8   ? -20.143 37.702 -10.422 1.00 28.88  ? 8    DA  T OP2   1 
ATOM   3528 O  "O5'" . DA  B 2 8   ? -19.688 39.927 -9.389  1.00 28.31  ? 8    DA  T "O5'" 1 
ATOM   3529 C  "C5'" . DA  B 2 8   ? -20.051 41.138 -8.708  1.00 24.20  ? 8    DA  T "C5'" 1 
ATOM   3530 C  "C4'" . DA  B 2 8   ? -18.799 41.926 -8.406  1.00 25.14  ? 8    DA  T "C4'" 1 
ATOM   3531 O  "O4'" . DA  B 2 8   ? -18.152 41.298 -7.282  1.00 24.01  ? 8    DA  T "O4'" 1 
ATOM   3532 C  "C3'" . DA  B 2 8   ? -17.766 41.959 -9.540  1.00 24.42  ? 8    DA  T "C3'" 1 
ATOM   3533 O  "O3'" . DA  B 2 8   ? -17.183 43.255 -9.586  1.00 24.36  ? 8    DA  T "O3'" 1 
ATOM   3534 C  "C2'" . DA  B 2 8   ? -16.741 40.923 -9.125  1.00 25.25  ? 8    DA  T "C2'" 1 
ATOM   3535 C  "C1'" . DA  B 2 8   ? -16.834 40.940 -7.608  1.00 23.70  ? 8    DA  T "C1'" 1 
ATOM   3536 N  N9    . DA  B 2 8   ? -16.548 39.643 -7.003  1.00 21.44  ? 8    DA  T N9    1 
ATOM   3537 C  C8    . DA  B 2 8   ? -17.024 38.408 -7.369  1.00 20.75  ? 8    DA  T C8    1 
ATOM   3538 N  N7    . DA  B 2 8   ? -16.523 37.421 -6.670  1.00 18.42  ? 8    DA  T N7    1 
ATOM   3539 C  C5    . DA  B 2 8   ? -15.658 38.048 -5.785  1.00 18.26  ? 8    DA  T C5    1 
ATOM   3540 C  C6    . DA  B 2 8   ? -14.800 37.552 -4.798  1.00 18.16  ? 8    DA  T C6    1 
ATOM   3541 N  N6    . DA  B 2 8   ? -14.705 36.260 -4.486  1.00 18.79  ? 8    DA  T N6    1 
ATOM   3542 N  N1    . DA  B 2 8   ? -14.083 38.445 -4.083  1.00 18.52  ? 8    DA  T N1    1 
ATOM   3543 C  C2    . DA  B 2 8   ? -14.223 39.745 -4.361  1.00 18.47  ? 8    DA  T C2    1 
ATOM   3544 N  N3    . DA  B 2 8   ? -14.974 40.330 -5.287  1.00 18.16  ? 8    DA  T N3    1 
ATOM   3545 C  C4    . DA  B 2 8   ? -15.672 39.416 -5.973  1.00 18.80  ? 8    DA  T C4    1 
ATOM   3546 P  P     . DC  B 2 9   ? -16.199 43.697 -10.796 1.00 26.74  ? 9    DC  T P     1 
ATOM   3547 O  OP1   . DC  B 2 9   ? -16.501 45.113 -11.077 1.00 28.99  ? 9    DC  T OP1   1 
ATOM   3548 O  OP2   . DC  B 2 9   ? -16.211 42.690 -11.920 1.00 24.76  ? 9    DC  T OP2   1 
ATOM   3549 O  "O5'" . DC  B 2 9   ? -14.749 43.504 -10.152 1.00 25.74  ? 9    DC  T "O5'" 1 
ATOM   3550 C  "C5'" . DC  B 2 9   ? -14.425 44.247 -8.959  1.00 24.27  ? 9    DC  T "C5'" 1 
ATOM   3551 C  "C4'" . DC  B 2 9   ? -13.139 43.717 -8.387  1.00 23.87  ? 9    DC  T "C4'" 1 
ATOM   3552 O  "O4'" . DC  B 2 9   ? -13.342 42.379 -7.882  1.00 24.88  ? 9    DC  T "O4'" 1 
ATOM   3553 C  "C3'" . DC  B 2 9   ? -12.009 43.617 -9.410  1.00 25.25  ? 9    DC  T "C3'" 1 
ATOM   3554 O  "O3'" . DC  B 2 9   ? -10.910 44.324 -8.855  1.00 29.16  ? 9    DC  T "O3'" 1 
ATOM   3555 C  "C2'" . DC  B 2 9   ? -11.763 42.131 -9.532  1.00 22.92  ? 9    DC  T "C2'" 1 
ATOM   3556 C  "C1'" . DC  B 2 9   ? -12.172 41.659 -8.166  1.00 22.74  ? 9    DC  T "C1'" 1 
ATOM   3557 N  N1    . DC  B 2 9   ? -12.483 40.233 -8.074  1.00 22.78  ? 9    DC  T N1    1 
ATOM   3558 C  C2    . DC  B 2 9   ? -11.898 39.497 -7.056  1.00 21.06  ? 9    DC  T C2    1 
ATOM   3559 O  O2    . DC  B 2 9   ? -11.166 40.083 -6.246  1.00 21.11  ? 9    DC  T O2    1 
ATOM   3560 N  N3    . DC  B 2 9   ? -12.176 38.182 -6.945  1.00 19.73  ? 9    DC  T N3    1 
ATOM   3561 C  C4    . DC  B 2 9   ? -12.977 37.592 -7.840  1.00 22.86  ? 9    DC  T C4    1 
ATOM   3562 N  N4    . DC  B 2 9   ? -13.188 36.283 -7.726  1.00 21.44  ? 9    DC  T N4    1 
ATOM   3563 C  C5    . DC  B 2 9   ? -13.595 38.322 -8.889  1.00 23.48  ? 9    DC  T C5    1 
ATOM   3564 C  C6    . DC  B 2 9   ? -13.328 39.631 -8.964  1.00 24.21  ? 9    DC  T C6    1 
ATOM   3565 P  P     . DG  B 2 10  ? -9.602  44.627 -9.706  1.00 28.34  ? 10   DG  T P     1 
ATOM   3566 O  OP1   . DG  B 2 10  ? -9.501  46.071 -9.889  1.00 37.36  ? 10   DG  T OP1   1 
ATOM   3567 O  OP2   . DG  B 2 10  ? -9.499  43.704 -10.857 1.00 27.26  ? 10   DG  T OP2   1 
ATOM   3568 O  "O5'" . DG  B 2 10  ? -8.443  44.203 -8.713  1.00 27.03  ? 10   DG  T "O5'" 1 
ATOM   3569 C  "C5'" . DG  B 2 10  ? -8.566  44.307 -7.271  1.00 26.73  ? 10   DG  T "C5'" 1 
ATOM   3570 C  "C4'" . DG  B 2 10  ? -7.351  43.678 -6.626  1.00 26.31  ? 10   DG  T "C4'" 1 
ATOM   3571 O  "O4'" . DG  B 2 10  ? -7.605  42.282 -6.335  1.00 26.94  ? 10   DG  T "O4'" 1 
ATOM   3572 C  "C3'" . DG  B 2 10  ? -6.094  43.683 -7.505  1.00 26.57  ? 10   DG  T "C3'" 1 
ATOM   3573 O  "O3'" . DG  B 2 10  ? -4.948  43.705 -6.647  1.00 26.67  ? 10   DG  T "O3'" 1 
ATOM   3574 C  "C2'" . DG  B 2 10  ? -6.173  42.352 -8.233  1.00 23.83  ? 10   DG  T "C2'" 1 
ATOM   3575 C  "C1'" . DG  B 2 10  ? -6.795  41.456 -7.169  1.00 22.34  ? 10   DG  T "C1'" 1 
ATOM   3576 N  N9    . DG  B 2 10  ? -7.633  40.390 -7.713  1.00 20.91  ? 10   DG  T N9    1 
ATOM   3577 C  C8    . DG  B 2 10  ? -8.594  40.493 -8.686  1.00 19.02  ? 10   DG  T C8    1 
ATOM   3578 N  N7    . DG  B 2 10  ? -9.129  39.347 -8.999  1.00 20.95  ? 10   DG  T N7    1 
ATOM   3579 C  C5    . DG  B 2 10  ? -8.475  38.433 -8.189  1.00 19.30  ? 10   DG  T C5    1 
ATOM   3580 C  C6    . DG  B 2 10  ? -8.602  37.024 -8.102  1.00 19.65  ? 10   DG  T C6    1 
ATOM   3581 O  O6    . DG  B 2 10  ? -9.363  36.279 -8.720  1.00 20.50  ? 10   DG  T O6    1 
ATOM   3582 N  N1    . DG  B 2 10  ? -7.712  36.488 -7.175  1.00 20.87  ? 10   DG  T N1    1 
ATOM   3583 C  C2    . DG  B 2 10  ? -6.818  37.215 -6.431  1.00 19.96  ? 10   DG  T C2    1 
ATOM   3584 N  N2    . DG  B 2 10  ? -6.039  36.523 -5.597  1.00 21.09  ? 10   DG  T N2    1 
ATOM   3585 N  N3    . DG  B 2 10  ? -6.687  38.525 -6.510  1.00 19.17  ? 10   DG  T N3    1 
ATOM   3586 C  C4    . DG  B 2 10  ? -7.531  39.063 -7.408  1.00 18.00  ? 10   DG  T C4    1 
ATOM   3587 P  P     . DC  B 2 11  ? -3.453  43.849 -7.254  1.00 27.36  ? 11   DC  T P     1 
ATOM   3588 O  OP1   . DC  B 2 11  ? -2.740  44.810 -6.375  1.00 29.52  ? 11   DC  T OP1   1 
ATOM   3589 O  OP2   . DC  B 2 11  ? -3.477  44.148 -8.675  1.00 23.11  ? 11   DC  T OP2   1 
ATOM   3590 O  "O5'" . DC  B 2 11  ? -2.892  42.381 -7.026  1.00 24.61  ? 11   DC  T "O5'" 1 
ATOM   3591 C  "C5'" . DC  B 2 11  ? -2.781  41.889 -5.694  1.00 22.62  ? 11   DC  T "C5'" 1 
ATOM   3592 C  "C4'" . DC  B 2 11  ? -2.070  40.557 -5.735  1.00 21.29  ? 11   DC  T "C4'" 1 
ATOM   3593 O  "O4'" . DC  B 2 11  ? -2.955  39.570 -6.306  1.00 22.89  ? 11   DC  T "O4'" 1 
ATOM   3594 C  "C3'" . DC  B 2 11  ? -0.792  40.516 -6.585  1.00 19.73  ? 11   DC  T "C3'" 1 
ATOM   3595 O  "O3'" . DC  B 2 11  ? 0.202   39.848 -5.763  1.00 17.11  ? 11   DC  T "O3'" 1 
ATOM   3596 C  "C2'" . DC  B 2 11  ? -1.232  39.793 -7.851  1.00 18.58  ? 11   DC  T "C2'" 1 
ATOM   3597 C  "C1'" . DC  B 2 11  ? -2.306  38.840 -7.333  1.00 19.51  ? 11   DC  T "C1'" 1 
ATOM   3598 N  N1    . DC  B 2 11  ? -3.348  38.402 -8.308  1.00 18.41  ? 11   DC  T N1    1 
ATOM   3599 C  C2    . DC  B 2 11  ? -3.657  37.042 -8.426  1.00 18.44  ? 11   DC  T C2    1 
ATOM   3600 O  O2    . DC  B 2 11  ? -3.040  36.225 -7.739  1.00 17.70  ? 11   DC  T O2    1 
ATOM   3601 N  N3    . DC  B 2 11  ? -4.626  36.651 -9.291  1.00 18.96  ? 11   DC  T N3    1 
ATOM   3602 C  C4    . DC  B 2 11  ? -5.262  37.559 -10.033 1.00 18.58  ? 11   DC  T C4    1 
ATOM   3603 N  N4    . DC  B 2 11  ? -6.194  37.123 -10.895 1.00 17.89  ? 11   DC  T N4    1 
ATOM   3604 C  C5    . DC  B 2 11  ? -4.991  38.956 -9.911  1.00 18.96  ? 11   DC  T C5    1 
ATOM   3605 C  C6    . DC  B 2 11  ? -4.040  39.328 -9.038  1.00 18.69  ? 11   DC  T C6    1 
ATOM   3606 P  P     . DT  B 2 12  ? 1.762   39.842 -6.195  1.00 17.57  ? 12   DT  T P     1 
ATOM   3607 O  OP1   . DT  B 2 12  ? 2.577   39.832 -4.955  1.00 16.30  ? 12   DT  T OP1   1 
ATOM   3608 O  OP2   . DT  B 2 12  ? 1.938   40.867 -7.203  1.00 12.68  ? 12   DT  T OP2   1 
ATOM   3609 O  "O5'" . DT  B 2 12  ? 1.894   38.472 -6.997  1.00 17.93  ? 12   DT  T "O5'" 1 
ATOM   3610 C  "C5'" . DT  B 2 12  ? 1.894   37.228 -6.298  1.00 21.38  ? 12   DT  T "C5'" 1 
ATOM   3611 C  "C4'" . DT  B 2 12  ? 1.923   36.064 -7.261  1.00 22.77  ? 12   DT  T "C4'" 1 
ATOM   3612 O  "O4'" . DT  B 2 12  ? 0.659   36.033 -7.959  1.00 25.27  ? 12   DT  T "O4'" 1 
ATOM   3613 C  "C3'" . DT  B 2 12  ? 3.007   36.148 -8.341  1.00 23.65  ? 12   DT  T "C3'" 1 
ATOM   3614 O  "O3'" . DT  B 2 12  ? 3.735   34.934 -8.488  1.00 21.66  ? 12   DT  T "O3'" 1 
ATOM   3615 C  "C2'" . DT  B 2 12  ? 2.225   36.452 -9.601  1.00 25.11  ? 12   DT  T "C2'" 1 
ATOM   3616 C  "C1'" . DT  B 2 12  ? 0.924   35.741 -9.305  1.00 26.23  ? 12   DT  T "C1'" 1 
ATOM   3617 N  N1    . DT  B 2 12  ? -0.232  36.174 -10.104 1.00 28.16  ? 12   DT  T N1    1 
ATOM   3618 C  C2    . DT  B 2 12  ? -1.124  35.209 -10.502 1.00 26.81  ? 12   DT  T C2    1 
ATOM   3619 O  O2    . DT  B 2 12  ? -1.019  34.039 -10.200 1.00 32.26  ? 12   DT  T O2    1 
ATOM   3620 N  N3    . DT  B 2 12  ? -2.155  35.667 -11.271 1.00 28.18  ? 12   DT  T N3    1 
ATOM   3621 C  C4    . DT  B 2 12  ? -2.366  36.958 -11.700 1.00 26.59  ? 12   DT  T C4    1 
ATOM   3622 O  O4    . DT  B 2 12  ? -3.332  37.206 -12.409 1.00 27.64  ? 12   DT  T O4    1 
ATOM   3623 C  C5    . DT  B 2 12  ? -1.396  37.927 -11.244 1.00 27.57  ? 12   DT  T C5    1 
ATOM   3624 C  C7    . DT  B 2 12  ? -1.541  39.357 -11.657 1.00 30.39  ? 12   DT  T C7    1 
ATOM   3625 C  C6    . DT  B 2 12  ? -0.383  37.490 -10.488 1.00 28.93  ? 12   DT  T C6    1 
ATOM   3626 O  "O5'" . DA  C 3 1   ? -7.308  28.870 -16.691 1.00 45.64  ? 1    DA  P "O5'" 1 
ATOM   3627 C  "C5'" . DA  C 3 1   ? -6.331  27.862 -16.980 1.00 43.83  ? 1    DA  P "C5'" 1 
ATOM   3628 C  "C4'" . DA  C 3 1   ? -5.565  27.522 -15.724 1.00 43.36  ? 1    DA  P "C4'" 1 
ATOM   3629 O  "O4'" . DA  C 3 1   ? -4.722  28.631 -15.319 1.00 40.33  ? 1    DA  P "O4'" 1 
ATOM   3630 C  "C3'" . DA  C 3 1   ? -6.440  27.181 -14.516 1.00 40.27  ? 1    DA  P "C3'" 1 
ATOM   3631 O  "O3'" . DA  C 3 1   ? -5.825  26.132 -13.776 1.00 38.20  ? 1    DA  P "O3'" 1 
ATOM   3632 C  "C2'" . DA  C 3 1   ? -6.441  28.454 -13.690 1.00 41.39  ? 1    DA  P "C2'" 1 
ATOM   3633 C  "C1'" . DA  C 3 1   ? -5.140  29.167 -14.075 1.00 39.10  ? 1    DA  P "C1'" 1 
ATOM   3634 N  N9    . DA  C 3 1   ? -5.295  30.617 -14.232 1.00 32.32  ? 1    DA  P N9    1 
ATOM   3635 C  C8    . DA  C 3 1   ? -6.132  31.308 -15.073 1.00 32.95  ? 1    DA  P C8    1 
ATOM   3636 N  N7    . DA  C 3 1   ? -6.053  32.612 -14.947 1.00 32.84  ? 1    DA  P N7    1 
ATOM   3637 C  C5    . DA  C 3 1   ? -5.132  32.788 -13.925 1.00 28.83  ? 1    DA  P C5    1 
ATOM   3638 C  C6    . DA  C 3 1   ? -4.618  33.934 -13.313 1.00 30.02  ? 1    DA  P C6    1 
ATOM   3639 N  N6    . DA  C 3 1   ? -4.984  35.172 -13.646 1.00 29.40  ? 1    DA  P N6    1 
ATOM   3640 N  N1    . DA  C 3 1   ? -3.690  33.768 -12.344 1.00 30.01  ? 1    DA  P N1    1 
ATOM   3641 C  C2    . DA  C 3 1   ? -3.326  32.523 -12.010 1.00 28.45  ? 1    DA  P C2    1 
ATOM   3642 N  N3    . DA  C 3 1   ? -3.756  31.364 -12.499 1.00 29.83  ? 1    DA  P N3    1 
ATOM   3643 C  C4    . DA  C 3 1   ? -4.665  31.569 -13.468 1.00 31.13  ? 1    DA  P C4    1 
ATOM   3644 P  P     . DG  C 3 2   ? -6.691  25.219 -12.781 1.00 36.31  ? 2    DG  P P     1 
ATOM   3645 O  OP1   . DG  C 3 2   ? -6.103  23.877 -12.819 1.00 32.76  ? 2    DG  P OP1   1 
ATOM   3646 O  OP2   . DG  C 3 2   ? -8.153  25.508 -12.979 1.00 31.96  ? 2    DG  P OP2   1 
ATOM   3647 O  "O5'" . DG  C 3 2   ? -6.431  25.854 -11.349 1.00 30.04  ? 2    DG  P "O5'" 1 
ATOM   3648 C  "C5'" . DG  C 3 2   ? -5.185  25.653 -10.690 1.00 27.09  ? 2    DG  P "C5'" 1 
ATOM   3649 C  "C4'" . DG  C 3 2   ? -5.075  26.655 -9.568  1.00 25.09  ? 2    DG  P "C4'" 1 
ATOM   3650 O  "O4'" . DG  C 3 2   ? -5.142  28.003 -10.077 1.00 22.68  ? 2    DG  P "O4'" 1 
ATOM   3651 C  "C3'" . DG  C 3 2   ? -6.175  26.539 -8.510  1.00 23.06  ? 2    DG  P "C3'" 1 
ATOM   3652 O  "O3'" . DG  C 3 2   ? -5.420  26.221 -7.359  1.00 28.69  ? 2    DG  P "O3'" 1 
ATOM   3653 C  "C2'" . DG  C 3 2   ? -6.835  27.906 -8.475  1.00 21.98  ? 2    DG  P "C2'" 1 
ATOM   3654 C  "C1'" . DG  C 3 2   ? -5.781  28.799 -9.094  1.00 21.10  ? 2    DG  P "C1'" 1 
ATOM   3655 N  N9    . DG  C 3 2   ? -6.299  29.999 -9.726  1.00 19.84  ? 2    DG  P N9    1 
ATOM   3656 C  C8    . DG  C 3 2   ? -7.351  30.110 -10.603 1.00 19.51  ? 2    DG  P C8    1 
ATOM   3657 N  N7    . DG  C 3 2   ? -7.601  31.344 -10.943 1.00 18.61  ? 2    DG  P N7    1 
ATOM   3658 C  C5    . DG  C 3 2   ? -6.629  32.088 -10.286 1.00 19.01  ? 2    DG  P C5    1 
ATOM   3659 C  C6    . DG  C 3 2   ? -6.394  33.490 -10.265 1.00 19.80  ? 2    DG  P C6    1 
ATOM   3660 O  O6    . DG  C 3 2   ? -6.979  34.380 -10.885 1.00 17.82  ? 2    DG  P O6    1 
ATOM   3661 N  N1    . DG  C 3 2   ? -5.328  33.817 -9.436  1.00 21.66  ? 2    DG  P N1    1 
ATOM   3662 C  C2    . DG  C 3 2   ? -4.569  32.912 -8.741  1.00 20.56  ? 2    DG  P C2    1 
ATOM   3663 N  N2    . DG  C 3 2   ? -3.567  33.410 -8.012  1.00 21.73  ? 2    DG  P N2    1 
ATOM   3664 N  N3    . DG  C 3 2   ? -4.790  31.614 -8.737  1.00 21.94  ? 2    DG  P N3    1 
ATOM   3665 C  C4    . DG  C 3 2   ? -5.826  31.274 -9.524  1.00 20.51  ? 2    DG  P C4    1 
ATOM   3666 P  P     . DC  C 3 3   ? -6.101  25.983 -5.953  1.00 31.34  ? 3    DC  P P     1 
ATOM   3667 O  OP1   . DC  C 3 3   ? -5.193  25.111 -5.182  1.00 31.81  ? 3    DC  P OP1   1 
ATOM   3668 O  OP2   . DC  C 3 3   ? -7.507  25.642 -6.155  1.00 30.57  ? 3    DC  P OP2   1 
ATOM   3669 O  "O5'" . DC  C 3 3   ? -5.944  27.423 -5.296  1.00 39.57  ? 3    DC  P "O5'" 1 
ATOM   3670 C  "C5'" . DC  C 3 3   ? -4.609  27.938 -5.124  1.00 41.34  ? 3    DC  P "C5'" 1 
ATOM   3671 C  "C4'" . DC  C 3 3   ? -4.643  29.314 -4.504  1.00 41.03  ? 3    DC  P "C4'" 1 
ATOM   3672 O  "O4'" . DC  C 3 3   ? -5.120  30.237 -5.505  1.00 40.39  ? 3    DC  P "O4'" 1 
ATOM   3673 C  "C3'" . DC  C 3 3   ? -5.558  29.467 -3.274  1.00 39.12  ? 3    DC  P "C3'" 1 
ATOM   3674 O  "O3'" . DC  C 3 3   ? -4.794  29.963 -2.170  1.00 37.19  ? 3    DC  P "O3'" 1 
ATOM   3675 C  "C2'" . DC  C 3 3   ? -6.616  30.467 -3.713  1.00 37.05  ? 3    DC  P "C2'" 1 
ATOM   3676 C  "C1'" . DC  C 3 3   ? -5.935  31.198 -4.868  1.00 37.82  ? 3    DC  P "C1'" 1 
ATOM   3677 N  N1    . DC  C 3 3   ? -6.875  31.726 -5.864  1.00 33.69  ? 3    DC  P N1    1 
ATOM   3678 C  C2    . DC  C 3 3   ? -6.859  33.087 -6.140  1.00 29.29  ? 3    DC  P C2    1 
ATOM   3679 O  O2    . DC  C 3 3   ? -6.008  33.796 -5.592  1.00 32.13  ? 3    DC  P O2    1 
ATOM   3680 N  N3    . DC  C 3 3   ? -7.763  33.597 -7.004  1.00 28.31  ? 3    DC  P N3    1 
ATOM   3681 C  C4    . DC  C 3 3   ? -8.679  32.803 -7.557  1.00 28.09  ? 3    DC  P C4    1 
ATOM   3682 N  N4    . DC  C 3 3   ? -9.548  33.348 -8.411  1.00 24.61  ? 3    DC  P N4    1 
ATOM   3683 C  C5    . DC  C 3 3   ? -8.728  31.407 -7.281  1.00 29.52  ? 3    DC  P C5    1 
ATOM   3684 C  C6    . DC  C 3 3   ? -7.830  30.920 -6.419  1.00 30.46  ? 3    DC  P C6    1 
ATOM   3685 P  P     . DG  C 3 4   ? -5.484  30.246 -0.770  1.00 35.99  ? 4    DG  P P     1 
ATOM   3686 O  OP1   . DG  C 3 4   ? -4.514  29.801 0.264   1.00 38.58  ? 4    DG  P OP1   1 
ATOM   3687 O  OP2   . DG  C 3 4   ? -6.886  29.718 -0.787  1.00 29.90  ? 4    DG  P OP2   1 
ATOM   3688 O  "O5'" . DG  C 3 4   ? -5.668  31.833 -0.781  1.00 32.39  ? 4    DG  P "O5'" 1 
ATOM   3689 C  "C5'" . DG  C 3 4   ? -4.555  32.727 -0.913  1.00 31.01  ? 4    DG  P "C5'" 1 
ATOM   3690 C  "C4'" . DG  C 3 4   ? -5.029  34.164 -0.860  1.00 32.49  ? 4    DG  P "C4'" 1 
ATOM   3691 O  "O4'" . DG  C 3 4   ? -5.853  34.453 -2.015  1.00 32.94  ? 4    DG  P "O4'" 1 
ATOM   3692 C  "C3'" . DG  C 3 4   ? -5.884  34.497 0.370   1.00 30.60  ? 4    DG  P "C3'" 1 
ATOM   3693 O  "O3'" . DG  C 3 4   ? -5.392  35.655 1.080   1.00 34.59  ? 4    DG  P "O3'" 1 
ATOM   3694 C  "C2'" . DG  C 3 4   ? -7.288  34.629 -0.200  1.00 28.90  ? 4    DG  P "C2'" 1 
ATOM   3695 C  "C1'" . DG  C 3 4   ? -7.029  35.128 -1.601  1.00 27.56  ? 4    DG  P "C1'" 1 
ATOM   3696 N  N9    . DG  C 3 4   ? -8.083  34.779 -2.537  1.00 25.53  ? 4    DG  P N9    1 
ATOM   3697 C  C8    . DG  C 3 4   ? -8.578  33.517 -2.755  1.00 24.10  ? 4    DG  P C8    1 
ATOM   3698 N  N7    . DG  C 3 4   ? -9.539  33.489 -3.637  1.00 23.88  ? 4    DG  P N7    1 
ATOM   3699 C  C5    . DG  C 3 4   ? -9.676  34.811 -4.039  1.00 23.71  ? 4    DG  P C5    1 
ATOM   3700 C  C6    . DG  C 3 4   ? -10.566 35.396 -4.973  1.00 24.80  ? 4    DG  P C6    1 
ATOM   3701 O  O6    . DG  C 3 4   ? -11.433 34.846 -5.659  1.00 26.22  ? 4    DG  P O6    1 
ATOM   3702 N  N1    . DG  C 3 4   ? -10.396 36.777 -5.047  1.00 24.39  ? 4    DG  P N1    1 
ATOM   3703 C  C2    . DG  C 3 4   ? -9.479  37.499 -4.324  1.00 22.43  ? 4    DG  P C2    1 
ATOM   3704 N  N2    . DG  C 3 4   ? -9.460  38.821 -4.548  1.00 20.46  ? 4    DG  P N2    1 
ATOM   3705 N  N3    . DG  C 3 4   ? -8.636  36.963 -3.455  1.00 21.88  ? 4    DG  P N3    1 
ATOM   3706 C  C4    . DG  C 3 4   ? -8.785  35.622 -3.369  1.00 23.25  ? 4    DG  P C4    1 
ATOM   3707 P  P     . DT  C 3 5   ? -6.212  36.181 2.395   1.00 38.74  ? 5    DT  P P     1 
ATOM   3708 O  OP1   . DT  C 3 5   ? -5.232  36.671 3.382   1.00 33.73  ? 5    DT  P OP1   1 
ATOM   3709 O  OP2   . DT  C 3 5   ? -7.267  35.188 2.740   1.00 30.78  ? 5    DT  P OP2   1 
ATOM   3710 O  "O5'" . DT  C 3 5   ? -7.113  37.354 1.799   1.00 27.88  ? 5    DT  P "O5'" 1 
ATOM   3711 C  "C5'" . DT  C 3 5   ? -6.506  38.335 0.981   1.00 24.12  ? 5    DT  P "C5'" 1 
ATOM   3712 C  "C4'" . DT  C 3 5   ? -7.516  39.410 0.669   1.00 21.84  ? 5    DT  P "C4'" 1 
ATOM   3713 O  "O4'" . DT  C 3 5   ? -8.405  38.919 -0.349  1.00 19.72  ? 5    DT  P "O4'" 1 
ATOM   3714 C  "C3'" . DT  C 3 5   ? -8.390  39.836 1.848   1.00 19.77  ? 5    DT  P "C3'" 1 
ATOM   3715 O  "O3'" . DT  C 3 5   ? -8.314  41.255 1.898   1.00 18.70  ? 5    DT  P "O3'" 1 
ATOM   3716 C  "C2'" . DT  C 3 5   ? -9.773  39.306 1.499   1.00 19.50  ? 5    DT  P "C2'" 1 
ATOM   3717 C  "C1'" . DT  C 3 5   ? -9.730  39.243 -0.015  1.00 19.68  ? 5    DT  P "C1'" 1 
ATOM   3718 N  N1    . DT  C 3 5   ? -10.600 38.236 -0.648  1.00 18.30  ? 5    DT  P N1    1 
ATOM   3719 C  C2    . DT  C 3 5   ? -11.496 38.645 -1.603  1.00 17.67  ? 5    DT  P C2    1 
ATOM   3720 O  O2    . DT  C 3 5   ? -11.657 39.810 -1.912  1.00 18.41  ? 5    DT  P O2    1 
ATOM   3721 N  N3    . DT  C 3 5   ? -12.261 37.644 -2.133  1.00 19.71  ? 5    DT  P N3    1 
ATOM   3722 C  C4    . DT  C 3 5   ? -12.196 36.296 -1.839  1.00 20.09  ? 5    DT  P C4    1 
ATOM   3723 O  O4    . DT  C 3 5   ? -12.939 35.508 -2.421  1.00 19.48  ? 5    DT  P O4    1 
ATOM   3724 C  C5    . DT  C 3 5   ? -11.227 35.931 -0.833  1.00 20.41  ? 5    DT  P C5    1 
ATOM   3725 C  C7    . DT  C 3 5   ? -11.111 34.494 -0.422  1.00 19.91  ? 5    DT  P C7    1 
ATOM   3726 C  C6    . DT  C 3 5   ? -10.495 36.909 -0.284  1.00 18.41  ? 5    DT  P C6    1 
ATOM   3727 P  P     . DC  C 3 6   ? -8.946  42.043 3.110   1.00 16.17  ? 6    DC  P P     1 
ATOM   3728 O  OP1   . DC  C 3 6   ? -8.242  43.368 3.190   1.00 15.22  ? 6    DC  P OP1   1 
ATOM   3729 O  OP2   . DC  C 3 6   ? -9.037  41.168 4.253   1.00 13.99  ? 6    DC  P OP2   1 
ATOM   3730 O  "O5'" . DC  C 3 6   ? -10.433 42.345 2.602   1.00 16.01  ? 6    DC  P "O5'" 1 
ATOM   3731 C  "C5'" . DC  C 3 6   ? -10.639 43.273 1.563   1.00 16.72  ? 6    DC  P "C5'" 1 
ATOM   3732 C  "C4'" . DC  C 3 6   ? -12.104 43.305 1.233   1.00 17.93  ? 6    DC  P "C4'" 1 
ATOM   3733 O  "O4'" . DC  C 3 6   ? -12.442 42.049 0.596   1.00 18.05  ? 6    DC  P "O4'" 1 
ATOM   3734 C  "C3'" . DC  C 3 6   ? -13.038 43.449 2.447   1.00 16.97  ? 6    DC  P "C3'" 1 
ATOM   3735 O  "O3'" . DC  C 3 6   ? -13.683 44.722 2.376   1.00 15.52  ? 6    DC  P "O3'" 1 
ATOM   3736 C  "C2'" . DC  C 3 6   ? -14.025 42.301 2.296   1.00 17.26  ? 6    DC  P "C2'" 1 
ATOM   3737 C  "C1'" . DC  C 3 6   ? -13.801 41.804 0.871   1.00 18.04  ? 6    DC  P "C1'" 1 
ATOM   3738 N  N1    . DC  C 3 6   ? -14.065 40.357 0.677   1.00 17.10  ? 6    DC  P N1    1 
ATOM   3739 C  C2    . DC  C 3 6   ? -14.914 39.943 -0.359  1.00 17.18  ? 6    DC  P C2    1 
ATOM   3740 O  O2    . DC  C 3 6   ? -15.379 40.796 -1.142  1.00 14.49  ? 6    DC  P O2    1 
ATOM   3741 N  N3    . DC  C 3 6   ? -15.148 38.621 -0.530  1.00 16.89  ? 6    DC  P N3    1 
ATOM   3742 C  C4    . DC  C 3 6   ? -14.636 37.737 0.327   1.00 17.22  ? 6    DC  P C4    1 
ATOM   3743 N  N4    . DC  C 3 6   ? -14.908 36.448 0.132   1.00 16.74  ? 6    DC  P N4    1 
ATOM   3744 C  C5    . DC  C 3 6   ? -13.760 38.127 1.378   1.00 17.48  ? 6    DC  P C5    1 
ATOM   3745 C  C6    . DC  C 3 6   ? -13.503 39.436 1.515   1.00 18.65  ? 6    DC  P C6    1 
ATOM   3746 P  P     . DA  C 3 7   ? -14.740 45.181 3.471   1.00 15.94  ? 7    DA  P P     1 
ATOM   3747 O  OP1   . DA  C 3 7   ? -14.592 46.639 3.646   1.00 16.82  ? 7    DA  P OP1   1 
ATOM   3748 O  OP2   . DA  C 3 7   ? -14.602 44.364 4.668   1.00 15.35  ? 7    DA  P OP2   1 
ATOM   3749 O  "O5'" . DA  C 3 7   ? -16.131 44.725 2.852   1.00 16.89  ? 7    DA  P "O5'" 1 
ATOM   3750 C  "C5'" . DA  C 3 7   ? -16.655 45.327 1.688   1.00 19.75  ? 7    DA  P "C5'" 1 
ATOM   3751 C  "C4'" . DA  C 3 7   ? -17.804 44.495 1.173   1.00 21.56  ? 7    DA  P "C4'" 1 
ATOM   3752 O  "O4'" . DA  C 3 7   ? -17.346 43.181 0.806   1.00 19.99  ? 7    DA  P "O4'" 1 
ATOM   3753 C  "C3'" . DA  C 3 7   ? -18.940 44.207 2.146   1.00 21.43  ? 7    DA  P "C3'" 1 
ATOM   3754 O  "O3'" . DA  C 3 7   ? -19.924 45.231 2.166   1.00 25.21  ? 7    DA  P "O3'" 1 
ATOM   3755 C  "C2'" . DA  C 3 7   ? -19.603 43.022 1.480   1.00 21.57  ? 7    DA  P "C2'" 1 
ATOM   3756 C  "C1'" . DA  C 3 7   ? -18.493 42.386 0.676   1.00 20.44  ? 7    DA  P "C1'" 1 
ATOM   3757 N  N9    . DA  C 3 7   ? -18.175 41.057 1.156   1.00 19.88  ? 7    DA  P N9    1 
ATOM   3758 C  C8    . DA  C 3 7   ? -17.247 40.624 2.068   1.00 19.52  ? 7    DA  P C8    1 
ATOM   3759 N  N7    . DA  C 3 7   ? -17.221 39.323 2.214   1.00 21.07  ? 7    DA  P N7    1 
ATOM   3760 C  C5    . DA  C 3 7   ? -18.184 38.870 1.321   1.00 20.53  ? 7    DA  P C5    1 
ATOM   3761 C  C6    . DA  C 3 7   ? -18.640 37.586 0.998   1.00 20.42  ? 7    DA  P C6    1 
ATOM   3762 N  N6    . DA  C 3 7   ? -18.173 36.477 1.569   1.00 19.75  ? 7    DA  P N6    1 
ATOM   3763 N  N1    . DA  C 3 7   ? -19.644 37.482 0.096   1.00 21.21  ? 7    DA  P N1    1 
ATOM   3764 C  C2    . DA  C 3 7   ? -20.129 38.605 -0.457  1.00 19.22  ? 7    DA  P C2    1 
ATOM   3765 N  N3    . DA  C 3 7   ? -19.796 39.872 -0.212  1.00 19.02  ? 7    DA  P N3    1 
ATOM   3766 C  C4    . DA  C 3 7   ? -18.798 39.932 0.686   1.00 19.04  ? 7    DA  P C4    1 
ATOM   3767 P  P     . DT  C 3 8   ? -21.292 45.075 3.037   1.00 30.08  ? 8    DT  P P     1 
ATOM   3768 O  OP1   . DT  C 3 8   ? -21.836 46.451 3.156   1.00 24.00  ? 8    DT  P OP1   1 
ATOM   3769 O  OP2   . DT  C 3 8   ? -21.020 44.247 4.260   1.00 28.74  ? 8    DT  P OP2   1 
ATOM   3770 O  "O5'" . DT  C 3 8   ? -22.263 44.141 2.153   1.00 28.68  ? 8    DT  P "O5'" 1 
ATOM   3771 C  "C5'" . DT  C 3 8   ? -22.833 44.609 0.908   1.00 23.62  ? 8    DT  P "C5'" 1 
ATOM   3772 C  "C4'" . DT  C 3 8   ? -23.797 43.619 0.287   1.00 21.45  ? 8    DT  P "C4'" 1 
ATOM   3773 O  "O4'" . DT  C 3 8   ? -23.224 42.300 0.233   1.00 19.88  ? 8    DT  P "O4'" 1 
ATOM   3774 C  "C3'" . DT  C 3 8   ? -25.191 43.473 0.910   1.00 20.04  ? 8    DT  P "C3'" 1 
ATOM   3775 O  "O3'" . DT  C 3 8   ? -26.223 43.433 -0.110  1.00 19.22  ? 8    DT  P "O3'" 1 
ATOM   3776 C  "C2'" . DT  C 3 8   ? -25.124 42.145 1.642   1.00 21.01  ? 8    DT  P "C2'" 1 
ATOM   3777 C  "C1'" . DT  C 3 8   ? -24.098 41.351 0.834   1.00 19.94  ? 8    DT  P "C1'" 1 
ATOM   3778 N  N1    . DT  C 3 8   ? -23.267 40.399 1.603   1.00 20.39  ? 8    DT  P N1    1 
ATOM   3779 C  C2    . DT  C 3 8   ? -23.447 39.065 1.333   1.00 20.54  ? 8    DT  P C2    1 
ATOM   3780 O  O2    . DT  C 3 8   ? -24.298 38.657 0.572   1.00 19.99  ? 8    DT  P O2    1 
ATOM   3781 N  N3    . DT  C 3 8   ? -22.626 38.219 2.034   1.00 18.68  ? 8    DT  P N3    1 
ATOM   3782 C  C4    . DT  C 3 8   ? -21.635 38.571 2.919   1.00 19.75  ? 8    DT  P C4    1 
ATOM   3783 O  O4    . DT  C 3 8   ? -21.004 37.700 3.491   1.00 19.45  ? 8    DT  P O4    1 
ATOM   3784 C  C5    . DT  C 3 8   ? -21.493 39.994 3.156   1.00 19.29  ? 8    DT  P C5    1 
ATOM   3785 C  C7    . DT  C 3 8   ? -20.474 40.469 4.142   1.00 18.61  ? 8    DT  P C7    1 
ATOM   3786 C  C6    . DT  C 3 8   ? -22.296 40.825 2.482   1.00 19.73  ? 8    DT  P C6    1 
HETATM 3787 P  PG    . DTP D 4 .   ? -29.909 46.407 6.112   1.00 49.78  ? 501  DTP A PG    1 
HETATM 3788 O  O1G   . DTP D 4 .   ? -29.526 46.784 4.614   1.00 33.14  ? 501  DTP A O1G   1 
HETATM 3789 O  O2G   . DTP D 4 .   ? -28.682 46.400 7.220   1.00 31.78  ? 501  DTP A O2G   1 
HETATM 3790 O  O3G   . DTP D 4 .   ? -31.220 47.272 6.375   1.00 22.69  ? 501  DTP A O3G   1 
HETATM 3791 P  PB    . DTP D 4 .   ? -30.308 43.749 5.071   1.00 17.50  ? 501  DTP A PB    1 
HETATM 3792 O  O1B   . DTP D 4 .   ? -30.684 44.395 3.787   1.00 14.34  ? 501  DTP A O1B   1 
HETATM 3793 O  O2B   . DTP D 4 .   ? -31.050 42.486 5.427   1.00 13.72  ? 501  DTP A O2B   1 
HETATM 3794 O  O3B   . DTP D 4 .   ? -30.264 44.775 6.282   1.00 21.52  ? 501  DTP A O3B   1 
HETATM 3795 P  PA    . DTP D 4 .   ? -27.683 43.536 3.853   1.00 17.24  ? 501  DTP A PA    1 
HETATM 3796 O  O1A   . DTP D 4 .   ? -27.954 44.779 3.004   1.00 16.97  ? 501  DTP A O1A   1 
HETATM 3797 O  O2A   . DTP D 4 .   ? -26.302 43.280 4.403   1.00 17.33  ? 501  DTP A O2A   1 
HETATM 3798 O  O3A   . DTP D 4 .   ? -28.753 43.356 5.036   1.00 17.88  ? 501  DTP A O3A   1 
HETATM 3799 O  "O5'" . DTP D 4 .   ? -27.957 42.314 2.932   1.00 15.90  ? 501  DTP A "O5'" 1 
HETATM 3800 C  "C5'" . DTP D 4 .   ? -29.020 42.264 2.013   1.00 17.00  ? 501  DTP A "C5'" 1 
HETATM 3801 C  "C4'" . DTP D 4 .   ? -29.723 40.933 1.993   1.00 16.48  ? 501  DTP A "C4'" 1 
HETATM 3802 O  "O4'" . DTP D 4 .   ? -28.779 39.875 1.552   1.00 18.52  ? 501  DTP A "O4'" 1 
HETATM 3803 C  "C3'" . DTP D 4 .   ? -30.250 40.523 3.351   1.00 15.26  ? 501  DTP A "C3'" 1 
HETATM 3804 O  "O3'" . DTP D 4 .   ? -31.585 40.843 3.524   1.00 14.21  ? 501  DTP A "O3'" 1 
HETATM 3805 C  "C2'" . DTP D 4 .   ? -30.033 39.007 3.335   1.00 16.21  ? 501  DTP A "C2'" 1 
HETATM 3806 C  "C1'" . DTP D 4 .   ? -28.856 38.693 2.382   1.00 17.32  ? 501  DTP A "C1'" 1 
HETATM 3807 N  N9    . DTP D 4 .   ? -27.555 38.422 3.115   1.00 19.77  ? 501  DTP A N9    1 
HETATM 3808 C  C8    . DTP D 4 .   ? -26.600 39.278 3.626   1.00 18.41  ? 501  DTP A C8    1 
HETATM 3809 N  N7    . DTP D 4 .   ? -25.590 38.673 4.200   1.00 18.55  ? 501  DTP A N7    1 
HETATM 3810 C  C5    . DTP D 4 .   ? -25.850 37.388 4.068   1.00 18.91  ? 501  DTP A C5    1 
HETATM 3811 C  C6    . DTP D 4 .   ? -25.154 36.188 4.501   1.00 20.89  ? 501  DTP A C6    1 
HETATM 3812 N  N6    . DTP D 4 .   ? -23.990 36.365 5.123   1.00 19.95  ? 501  DTP A N6    1 
HETATM 3813 N  N1    . DTP D 4 .   ? -25.713 34.988 4.263   1.00 19.05  ? 501  DTP A N1    1 
HETATM 3814 C  C2    . DTP D 4 .   ? -26.890 34.903 3.621   1.00 19.83  ? 501  DTP A C2    1 
HETATM 3815 N  N3    . DTP D 4 .   ? -27.596 35.968 3.182   1.00 18.05  ? 501  DTP A N3    1 
HETATM 3816 C  C4    . DTP D 4 .   ? -27.131 37.196 3.403   1.00 20.05  ? 501  DTP A C4    1 
HETATM 3817 CA CA    . CA  E 5 .   ? -29.833 46.009 2.472   1.00 12.95  ? 502  CA  A CA    1 
HETATM 3818 C  C1    . GOL F 6 .   ? -8.560  65.354 8.468   1.00 13.84  ? 503  GOL A C1    1 
HETATM 3819 O  O1    . GOL F 6 .   ? -9.251  65.962 7.339   1.00 13.97  ? 503  GOL A O1    1 
HETATM 3820 C  C2    . GOL F 6 .   ? -9.496  65.246 9.694   1.00 13.33  ? 503  GOL A C2    1 
HETATM 3821 O  O2    . GOL F 6 .   ? -10.499 64.259 9.411   1.00 12.50  ? 503  GOL A O2    1 
HETATM 3822 C  C3    . GOL F 6 .   ? -8.746  64.974 11.063  1.00 14.07  ? 503  GOL A C3    1 
HETATM 3823 O  O3    . GOL F 6 .   ? -8.061  63.728 11.137  1.00 14.66  ? 503  GOL A O3    1 
HETATM 3824 O  O     . HOH G 7 .   ? -15.492 52.295 -5.270  1.00 22.63  ? 601  HOH A O     1 
HETATM 3825 O  O     . HOH G 7 .   ? -20.807 75.635 -4.128  1.00 36.13  ? 602  HOH A O     1 
HETATM 3826 O  O     . HOH G 7 .   ? -34.717 64.528 -13.219 1.00 32.25  ? 603  HOH A O     1 
HETATM 3827 O  O     . HOH G 7 .   ? -31.249 58.618 11.605  1.00 29.29  ? 604  HOH A O     1 
HETATM 3828 O  O     . HOH G 7 .   ? -30.448 33.079 -11.153 1.00 20.11  ? 605  HOH A O     1 
HETATM 3829 O  O     . HOH G 7 .   ? -29.382 47.052 -18.110 1.00 47.60  ? 606  HOH A O     1 
HETATM 3830 O  O     . HOH G 7 .   ? -16.829 61.051 12.454  1.00 25.46  ? 607  HOH A O     1 
HETATM 3831 O  O     . HOH G 7 .   ? -24.897 55.675 -13.962 1.00 25.76  ? 608  HOH A O     1 
HETATM 3832 O  O     . HOH G 7 .   ? -2.215  56.698 17.713  1.00 22.36  ? 609  HOH A O     1 
HETATM 3833 O  O     . HOH G 7 .   ? -40.805 35.189 -6.903  1.00 31.50  ? 610  HOH A O     1 
HETATM 3834 O  O     . HOH G 7 .   ? -23.104 75.227 -0.222  1.00 27.77  ? 611  HOH A O     1 
HETATM 3835 O  O     . HOH G 7 .   ? -0.685  55.403 -8.284  1.00 25.25  ? 612  HOH A O     1 
HETATM 3836 O  O     . HOH G 7 .   ? -39.365 65.934 -7.004  1.00 28.17  ? 613  HOH A O     1 
HETATM 3837 O  O     . HOH G 7 .   ? -2.485  74.138 -6.875  1.00 30.40  ? 614  HOH A O     1 
HETATM 3838 O  O     . HOH G 7 .   ? -24.247 17.776 -27.521 1.00 35.79  ? 615  HOH A O     1 
HETATM 3839 O  O     . HOH G 7 .   ? -34.140 76.519 -1.164  1.00 35.90  ? 616  HOH A O     1 
HETATM 3840 O  O     . HOH G 7 .   ? -8.596  62.186 13.044  1.00 11.24  ? 617  HOH A O     1 
HETATM 3841 O  O     . HOH G 7 .   ? 5.505   51.850 -7.746  1.00 15.84  ? 618  HOH A O     1 
HETATM 3842 O  O     . HOH G 7 .   ? -16.937 26.062 -23.076 1.00 34.82  ? 619  HOH A O     1 
HETATM 3843 O  O     . HOH G 7 .   ? -32.477 31.696 -8.203  1.00 16.92  ? 620  HOH A O     1 
HETATM 3844 O  O     . HOH G 7 .   ? -35.879 61.165 10.088  1.00 34.86  ? 621  HOH A O     1 
HETATM 3845 O  O     . HOH G 7 .   ? -19.042 69.842 -10.673 1.00 42.38  ? 622  HOH A O     1 
HETATM 3846 O  O     . HOH G 7 .   ? -19.933 33.901 -8.140  1.00 34.65  ? 623  HOH A O     1 
HETATM 3847 O  O     . HOH G 7 .   ? -43.651 36.471 -2.536  1.00 23.75  ? 624  HOH A O     1 
HETATM 3848 O  O     . HOH G 7 .   ? 0.676   65.313 1.038   1.00 28.84  ? 625  HOH A O     1 
HETATM 3849 O  O     . HOH G 7 .   ? -41.625 33.830 18.910  1.00 18.48  ? 626  HOH A O     1 
HETATM 3850 O  O     . HOH G 7 .   ? -11.024 68.504 -8.961  1.00 38.97  ? 627  HOH A O     1 
HETATM 3851 O  O     . HOH G 7 .   ? -27.209 78.292 6.334   1.00 23.44  ? 628  HOH A O     1 
HETATM 3852 O  O     . HOH G 7 .   ? -28.985 57.355 4.989   1.00 7.47   ? 629  HOH A O     1 
HETATM 3853 O  O     . HOH G 7 .   ? -25.235 58.401 11.641  1.00 26.36  ? 630  HOH A O     1 
HETATM 3854 O  O     . HOH G 7 .   ? -13.684 60.389 -10.883 1.00 36.24  ? 631  HOH A O     1 
HETATM 3855 O  O     . HOH G 7 .   ? -22.453 27.882 0.745   1.00 23.52  ? 632  HOH A O     1 
HETATM 3856 O  O     . HOH G 7 .   ? -12.668 51.524 -4.346  1.00 38.49  ? 633  HOH A O     1 
HETATM 3857 O  O     . HOH G 7 .   ? -2.435  60.687 14.059  1.00 20.29  ? 634  HOH A O     1 
HETATM 3858 O  O     . HOH G 7 .   ? -26.164 46.765 3.192   1.00 31.97  ? 635  HOH A O     1 
HETATM 3859 O  O     . HOH G 7 .   ? -31.052 42.106 7.975   1.00 14.38  ? 636  HOH A O     1 
HETATM 3860 O  O     . HOH G 7 .   ? -42.485 44.936 -9.821  1.00 13.08  ? 637  HOH A O     1 
HETATM 3861 O  O     . HOH G 7 .   ? -6.165  56.306 21.255  1.00 36.70  ? 638  HOH A O     1 
HETATM 3862 O  O     . HOH G 7 .   ? -25.555 50.538 3.224   1.00 35.44  ? 639  HOH A O     1 
HETATM 3863 O  O     . HOH G 7 .   ? -23.737 39.869 5.545   1.00 34.77  ? 640  HOH A O     1 
HETATM 3864 O  O     . HOH G 7 .   ? -28.390 30.301 25.874  1.00 21.12  ? 641  HOH A O     1 
HETATM 3865 O  O     . HOH G 7 .   ? -16.149 56.066 -6.980  1.00 10.00  ? 642  HOH A O     1 
HETATM 3866 O  O     . HOH G 7 .   ? -24.849 32.746 5.233   1.00 24.13  ? 643  HOH A O     1 
HETATM 3867 O  O     . HOH G 7 .   ? -38.734 39.946 -10.963 1.00 14.21  ? 644  HOH A O     1 
HETATM 3868 O  O     . HOH G 7 .   ? -13.937 59.826 18.740  1.00 27.20  ? 645  HOH A O     1 
HETATM 3869 O  O     . HOH G 7 .   ? -43.827 55.345 -9.540  1.00 22.28  ? 646  HOH A O     1 
HETATM 3870 O  O     . HOH G 7 .   ? -38.901 46.738 18.541  1.00 22.69  ? 647  HOH A O     1 
HETATM 3871 O  O     . HOH G 7 .   ? -28.403 61.658 11.900  1.00 23.37  ? 648  HOH A O     1 
HETATM 3872 O  O     . HOH G 7 .   ? -40.063 37.640 -5.715  1.00 16.87  ? 649  HOH A O     1 
HETATM 3873 O  O     . HOH G 7 .   ? -28.516 32.048 2.322   1.00 25.37  ? 650  HOH A O     1 
HETATM 3874 O  O     . HOH G 7 .   ? -18.889 56.852 -12.483 1.00 10.74  ? 651  HOH A O     1 
HETATM 3875 O  O     . HOH G 7 .   ? -43.055 39.536 -1.737  1.00 13.20  ? 652  HOH A O     1 
HETATM 3876 O  O     . HOH G 7 .   ? -19.616 67.568 -12.883 1.00 37.29  ? 653  HOH A O     1 
HETATM 3877 O  O     . HOH G 7 .   ? -2.238  61.300 3.017   1.00 12.73  ? 654  HOH A O     1 
HETATM 3878 O  O     . HOH G 7 .   ? -37.921 32.881 24.447  1.00 33.36  ? 655  HOH A O     1 
HETATM 3879 O  O     . HOH G 7 .   ? -51.978 40.476 11.437  1.00 44.95  ? 656  HOH A O     1 
HETATM 3880 O  O     . HOH G 7 .   ? -38.700 59.982 -1.430  1.00 12.16  ? 657  HOH A O     1 
HETATM 3881 O  O     . HOH G 7 .   ? -10.063 64.670 5.196   1.00 14.71  ? 658  HOH A O     1 
HETATM 3882 O  O     . HOH G 7 .   ? -14.649 45.262 9.786   1.00 28.64  ? 659  HOH A O     1 
HETATM 3883 O  O     . HOH G 7 .   ? 5.502   56.023 7.354   1.00 33.18  ? 660  HOH A O     1 
HETATM 3884 O  O     . HOH G 7 .   ? -16.945 64.174 14.141  1.00 23.87  ? 661  HOH A O     1 
HETATM 3885 O  O     . HOH G 7 .   ? -13.963 50.517 -1.982  1.00 24.38  ? 662  HOH A O     1 
HETATM 3886 O  O     . HOH G 7 .   ? -40.084 46.361 -11.450 1.00 13.54  ? 663  HOH A O     1 
HETATM 3887 O  O     . HOH G 7 .   ? -20.565 67.074 -8.710  1.00 16.58  ? 664  HOH A O     1 
HETATM 3888 O  O     . HOH G 7 .   ? -4.443  57.632 16.708  1.00 25.61  ? 665  HOH A O     1 
HETATM 3889 O  O     . HOH G 7 .   ? -31.439 32.600 -13.511 1.00 19.69  ? 666  HOH A O     1 
HETATM 3890 O  O     . HOH G 7 .   ? -23.178 40.781 -16.226 1.00 24.79  ? 667  HOH A O     1 
HETATM 3891 O  O     . HOH G 7 .   ? -14.582 28.415 -3.967  1.00 35.43  ? 668  HOH A O     1 
HETATM 3892 O  O     . HOH G 7 .   ? -30.927 75.484 -12.259 1.00 38.42  ? 669  HOH A O     1 
HETATM 3893 O  O     . HOH G 7 .   ? -18.440 76.478 -8.435  1.00 42.19  ? 670  HOH A O     1 
HETATM 3894 O  O     . HOH G 7 .   ? -17.452 47.923 11.865  1.00 29.08  ? 671  HOH A O     1 
HETATM 3895 O  O     . HOH G 7 .   ? -22.218 54.153 7.053   1.00 14.98  ? 672  HOH A O     1 
HETATM 3896 O  O     . HOH G 7 .   ? -4.036  42.650 8.899   1.00 31.24  ? 673  HOH A O     1 
HETATM 3897 O  O     . HOH G 7 .   ? -10.154 52.328 14.302  1.00 14.15  ? 674  HOH A O     1 
HETATM 3898 O  O     . HOH G 7 .   ? -19.033 52.027 4.226   1.00 10.18  ? 675  HOH A O     1 
HETATM 3899 O  O     . HOH G 7 .   ? 0.763   63.349 -3.929  1.00 30.50  ? 676  HOH A O     1 
HETATM 3900 O  O     . HOH G 7 .   ? -20.178 44.391 -5.916  1.00 36.00  ? 677  HOH A O     1 
HETATM 3901 O  O     . HOH G 7 .   ? -37.135 35.146 -23.648 1.00 33.48  ? 678  HOH A O     1 
HETATM 3902 O  O     . HOH G 7 .   ? -14.498 57.745 -12.616 1.00 30.73  ? 679  HOH A O     1 
HETATM 3903 O  O     . HOH G 7 .   ? -31.617 75.976 -9.403  1.00 38.56  ? 680  HOH A O     1 
HETATM 3904 O  O     . HOH G 7 .   ? 7.207   54.708 -1.415  1.00 11.26  ? 681  HOH A O     1 
HETATM 3905 O  O     . HOH G 7 .   ? -36.458 35.682 27.077  1.00 26.68  ? 682  HOH A O     1 
HETATM 3906 O  O     . HOH G 7 .   ? -24.395 61.166 11.208  1.00 32.97  ? 683  HOH A O     1 
HETATM 3907 O  O     . HOH G 7 .   ? 5.039   50.523 11.985  1.00 29.81  ? 684  HOH A O     1 
HETATM 3908 O  O     . HOH G 7 .   ? -43.838 35.584 3.919   1.00 15.32  ? 685  HOH A O     1 
HETATM 3909 O  O     . HOH G 7 .   ? -36.732 55.905 9.622   1.00 34.78  ? 686  HOH A O     1 
HETATM 3910 O  O     . HOH G 7 .   ? -25.845 23.519 4.220   1.00 17.99  ? 687  HOH A O     1 
HETATM 3911 O  O     . HOH G 7 .   ? -30.824 49.968 3.831   1.00 10.20  ? 688  HOH A O     1 
HETATM 3912 O  O     . HOH G 7 .   ? -28.836 34.623 1.223   1.00 26.37  ? 689  HOH A O     1 
HETATM 3913 O  O     . HOH G 7 .   ? -5.881  66.887 7.096   1.00 29.40  ? 690  HOH A O     1 
HETATM 3914 O  O     . HOH G 7 .   ? -3.454  59.385 -4.924  1.00 23.49  ? 691  HOH A O     1 
HETATM 3915 O  O     . HOH G 7 .   ? -39.429 45.918 7.307   1.00 12.08  ? 692  HOH A O     1 
HETATM 3916 O  O     . HOH G 7 .   ? -9.012  63.761 -8.403  1.00 28.43  ? 693  HOH A O     1 
HETATM 3917 O  O     . HOH G 7 .   ? -27.021 41.079 19.948  1.00 23.29  ? 694  HOH A O     1 
HETATM 3918 O  O     . HOH G 7 .   ? -38.469 65.092 -4.568  1.00 28.93  ? 695  HOH A O     1 
HETATM 3919 O  O     . HOH G 7 .   ? -48.698 51.759 -5.187  1.00 11.94  ? 696  HOH A O     1 
HETATM 3920 O  O     . HOH G 7 .   ? -41.598 48.335 3.992   1.00 35.47  ? 697  HOH A O     1 
HETATM 3921 O  O     . HOH G 7 .   ? -8.529  68.158 5.963   1.00 17.29  ? 698  HOH A O     1 
HETATM 3922 O  O     . HOH G 7 .   ? -36.791 31.552 -2.827  1.00 13.26  ? 699  HOH A O     1 
HETATM 3923 O  O     . HOH G 7 .   ? -10.178 46.594 9.241   1.00 19.01  ? 700  HOH A O     1 
HETATM 3924 O  O     . HOH G 7 .   ? -35.309 27.541 -15.952 1.00 20.24  ? 701  HOH A O     1 
HETATM 3925 O  O     . HOH G 7 .   ? -37.413 68.399 17.473  1.00 38.80  ? 702  HOH A O     1 
HETATM 3926 O  O     . HOH G 7 .   ? -18.907 70.942 -0.005  1.00 12.59  ? 703  HOH A O     1 
HETATM 3927 O  O     . HOH G 7 .   ? -4.155  52.463 16.305  1.00 16.47  ? 704  HOH A O     1 
HETATM 3928 O  O     . HOH G 7 .   ? -38.156 52.756 -1.763  1.00 22.12  ? 705  HOH A O     1 
HETATM 3929 O  O     . HOH G 7 .   ? -19.154 66.650 8.522   1.00 9.71   ? 706  HOH A O     1 
HETATM 3930 O  O     . HOH G 7 .   ? -15.318 57.629 16.768  1.00 24.36  ? 707  HOH A O     1 
HETATM 3931 O  O     . HOH G 7 .   ? -41.023 59.221 -8.336  1.00 14.53  ? 708  HOH A O     1 
HETATM 3932 O  O     . HOH G 7 .   ? -40.715 65.011 5.471   1.00 33.13  ? 709  HOH A O     1 
HETATM 3933 O  O     . HOH G 7 .   ? -32.697 30.218 -25.058 1.00 29.98  ? 710  HOH A O     1 
HETATM 3934 O  O     . HOH G 7 .   ? -33.918 49.057 15.393  1.00 23.80  ? 711  HOH A O     1 
HETATM 3935 O  O     . HOH G 7 .   ? -15.207 64.551 -2.668  1.00 14.45  ? 712  HOH A O     1 
HETATM 3936 O  O     . HOH G 7 .   ? -44.263 46.994 -10.249 1.00 9.62   ? 713  HOH A O     1 
HETATM 3937 O  O     . HOH G 7 .   ? -34.016 48.968 21.769  1.00 30.80  ? 714  HOH A O     1 
HETATM 3938 O  O     . HOH G 7 .   ? -24.786 38.531 17.224  1.00 24.71  ? 715  HOH A O     1 
HETATM 3939 O  O     . HOH G 7 .   ? -5.355  64.195 10.145  1.00 20.06  ? 716  HOH A O     1 
HETATM 3940 O  O     . HOH G 7 .   ? -35.182 26.925 4.994   1.00 19.31  ? 717  HOH A O     1 
HETATM 3941 O  O     . HOH G 7 .   ? -9.133  57.013 -3.595  1.00 15.32  ? 718  HOH A O     1 
HETATM 3942 O  O     . HOH G 7 .   ? -27.034 32.066 17.836  1.00 16.23  ? 719  HOH A O     1 
HETATM 3943 O  O     . HOH G 7 .   ? -49.229 46.030 10.165  1.00 28.04  ? 720  HOH A O     1 
HETATM 3944 O  O     . HOH G 7 .   ? -29.535 66.680 10.545  1.00 17.40  ? 721  HOH A O     1 
HETATM 3945 O  O     . HOH G 7 .   ? -16.982 47.643 -9.345  1.00 28.01  ? 722  HOH A O     1 
HETATM 3946 O  O     . HOH G 7 .   ? -35.326 29.391 22.527  1.00 22.24  ? 723  HOH A O     1 
HETATM 3947 O  O     . HOH G 7 .   ? -26.707 62.616 8.766   1.00 22.02  ? 724  HOH A O     1 
HETATM 3948 O  O     . HOH G 7 .   ? -30.697 41.728 -9.617  1.00 21.20  ? 725  HOH A O     1 
HETATM 3949 O  O     . HOH G 7 .   ? -29.740 16.389 -16.386 1.00 36.99  ? 726  HOH A O     1 
HETATM 3950 O  O     . HOH G 7 .   ? -30.477 42.123 -12.228 1.00 27.08  ? 727  HOH A O     1 
HETATM 3951 O  O     . HOH G 7 .   ? -21.732 69.458 6.444   1.00 14.72  ? 728  HOH A O     1 
HETATM 3952 O  O     . HOH G 7 .   ? -5.100  46.352 13.662  1.00 34.17  ? 729  HOH A O     1 
HETATM 3953 O  O     . HOH G 7 .   ? -27.232 31.958 -19.709 1.00 22.64  ? 730  HOH A O     1 
HETATM 3954 O  O     . HOH G 7 .   ? 4.577   62.651 6.591   1.00 23.41  ? 731  HOH A O     1 
HETATM 3955 O  O     . HOH G 7 .   ? -36.327 25.250 17.114  1.00 30.05  ? 732  HOH A O     1 
HETATM 3956 O  O     . HOH G 7 .   ? -51.207 36.540 5.428   1.00 28.50  ? 733  HOH A O     1 
HETATM 3957 O  O     . HOH G 7 .   ? -38.814 31.137 -11.030 1.00 37.64  ? 734  HOH A O     1 
HETATM 3958 O  O     . HOH G 7 .   ? -14.461 47.750 -2.692  1.00 43.11  ? 735  HOH A O     1 
HETATM 3959 O  O     . HOH G 7 .   ? -15.914 68.958 7.622   1.00 11.53  ? 736  HOH A O     1 
HETATM 3960 O  O     . HOH G 7 .   ? -38.333 27.435 15.522  1.00 32.13  ? 737  HOH A O     1 
HETATM 3961 O  O     . HOH G 7 .   ? -44.302 39.840 17.020  1.00 27.04  ? 738  HOH A O     1 
HETATM 3962 O  O     . HOH G 7 .   ? -24.208 12.876 -13.342 1.00 49.38  ? 739  HOH A O     1 
HETATM 3963 O  O     . HOH G 7 .   ? -37.689 50.509 5.940   1.00 9.44   ? 740  HOH A O     1 
HETATM 3964 O  O     . HOH G 7 .   ? -43.067 49.140 13.887  1.00 35.30  ? 741  HOH A O     1 
HETATM 3965 O  O     . HOH G 7 .   ? -37.632 75.271 1.373   1.00 25.80  ? 742  HOH A O     1 
HETATM 3966 O  O     . HOH G 7 .   ? -19.450 68.872 -2.439  1.00 10.18  ? 743  HOH A O     1 
HETATM 3967 O  O     . HOH G 7 .   ? -41.343 45.584 10.003  1.00 22.10  ? 744  HOH A O     1 
HETATM 3968 O  O     . HOH G 7 .   ? -39.264 23.786 -3.374  1.00 33.76  ? 745  HOH A O     1 
HETATM 3969 O  O     . HOH G 7 .   ? -49.239 39.009 13.089  1.00 35.75  ? 746  HOH A O     1 
HETATM 3970 O  O     . HOH G 7 .   ? -39.479 49.839 -14.866 1.00 30.51  ? 747  HOH A O     1 
HETATM 3971 O  O     . HOH G 7 .   ? -32.279 23.879 -5.295  1.00 28.30  ? 748  HOH A O     1 
HETATM 3972 O  O     . HOH G 7 .   ? -42.973 48.487 -11.896 1.00 15.37  ? 749  HOH A O     1 
HETATM 3973 O  O     . HOH G 7 .   ? -20.041 28.050 1.292   1.00 24.81  ? 750  HOH A O     1 
HETATM 3974 O  O     . HOH G 7 .   ? -22.387 45.008 -18.346 1.00 21.88  ? 751  HOH A O     1 
HETATM 3975 O  O     . HOH G 7 .   ? -37.044 29.155 16.809  1.00 31.06  ? 752  HOH A O     1 
HETATM 3976 O  O     . HOH G 7 .   ? -9.316  56.046 21.126  1.00 27.72  ? 753  HOH A O     1 
HETATM 3977 O  O     . HOH G 7 .   ? -10.540 70.101 -0.647  1.00 23.37  ? 754  HOH A O     1 
HETATM 3978 O  O     . HOH G 7 .   ? -40.022 29.443 11.352  1.00 22.95  ? 755  HOH A O     1 
HETATM 3979 O  O     . HOH G 7 .   ? -40.168 52.834 7.768   1.00 22.11  ? 756  HOH A O     1 
HETATM 3980 O  O     . HOH G 7 .   ? -38.360 25.894 3.628   1.00 21.40  ? 757  HOH A O     1 
HETATM 3981 O  O     . HOH G 7 .   ? -18.503 49.457 3.370   1.00 26.47  ? 758  HOH A O     1 
HETATM 3982 O  O     . HOH G 7 .   ? -27.295 60.451 -14.821 1.00 16.50  ? 759  HOH A O     1 
HETATM 3983 O  O     . HOH G 7 .   ? -44.002 33.017 8.239   1.00 27.57  ? 760  HOH A O     1 
HETATM 3984 O  O     . HOH G 7 .   ? -20.397 69.922 11.272  1.00 38.08  ? 761  HOH A O     1 
HETATM 3985 O  O     . HOH G 7 .   ? -38.750 30.542 -4.646  1.00 25.93  ? 762  HOH A O     1 
HETATM 3986 O  O     . HOH G 7 .   ? -16.130 47.135 9.168   1.00 24.09  ? 763  HOH A O     1 
HETATM 3987 O  O     . HOH G 7 .   ? -17.763 72.834 -3.184  1.00 32.46  ? 764  HOH A O     1 
HETATM 3988 O  O     . HOH G 7 .   ? -37.752 54.199 0.869   1.00 18.08  ? 765  HOH A O     1 
HETATM 3989 O  O     . HOH G 7 .   ? -8.844  46.159 0.291   1.00 20.97  ? 766  HOH A O     1 
HETATM 3990 O  O     . HOH G 7 .   ? -43.920 50.326 2.055   1.00 21.86  ? 767  HOH A O     1 
HETATM 3991 O  O     . HOH G 7 .   ? -7.767  72.752 -9.098  1.00 51.94  ? 768  HOH A O     1 
HETATM 3992 O  O     . HOH G 7 .   ? -40.659 32.738 22.729  1.00 49.86  ? 769  HOH A O     1 
HETATM 3993 O  O     . HOH G 7 .   ? -40.645 28.870 2.633   1.00 21.99  ? 770  HOH A O     1 
HETATM 3994 O  O     . HOH G 7 .   ? -25.461 43.993 -17.136 1.00 35.72  ? 771  HOH A O     1 
HETATM 3995 O  O     . HOH G 7 .   ? -41.344 32.143 3.572   1.00 17.98  ? 772  HOH A O     1 
HETATM 3996 O  O     . HOH G 7 .   ? -48.852 42.665 10.709  1.00 23.26  ? 773  HOH A O     1 
HETATM 3997 O  O     . HOH G 7 .   ? -35.722 49.296 -16.776 1.00 35.28  ? 774  HOH A O     1 
HETATM 3998 O  O     . HOH G 7 .   ? -25.906 39.760 -2.748  1.00 14.69  ? 775  HOH A O     1 
HETATM 3999 O  O     . HOH G 7 .   ? -23.841 13.264 -10.398 1.00 27.09  ? 776  HOH A O     1 
HETATM 4000 O  O     . HOH G 7 .   ? -32.895 64.454 -15.031 1.00 22.20  ? 777  HOH A O     1 
HETATM 4001 O  O     . HOH G 7 .   ? -38.223 68.208 4.199   1.00 19.29  ? 778  HOH A O     1 
HETATM 4002 O  O     . HOH G 7 .   ? -40.389 30.819 0.195   1.00 17.64  ? 779  HOH A O     1 
HETATM 4003 O  O     . HOH G 7 .   ? -25.000 65.405 11.053  1.00 25.35  ? 780  HOH A O     1 
HETATM 4004 O  O     . HOH G 7 .   ? -40.372 39.273 -8.007  1.00 16.96  ? 781  HOH A O     1 
HETATM 4005 O  O     . HOH G 7 .   ? -14.241 61.825 -5.763  1.00 9.39   ? 782  HOH A O     1 
HETATM 4006 O  O     . HOH G 7 .   ? -19.819 64.881 10.507  1.00 23.04  ? 783  HOH A O     1 
HETATM 4007 O  O     . HOH G 7 .   ? -33.215 60.624 -14.678 1.00 26.66  ? 784  HOH A O     1 
HETATM 4008 O  O     . HOH G 7 .   ? -15.900 44.041 -16.616 1.00 43.98  ? 785  HOH A O     1 
HETATM 4009 O  O     . HOH G 7 .   ? -3.290  69.583 -11.816 1.00 29.73  ? 786  HOH A O     1 
HETATM 4010 O  O     . HOH G 7 .   ? -23.723 66.970 -12.561 1.00 28.91  ? 787  HOH A O     1 
HETATM 4011 O  O     . HOH G 7 .   ? -19.782 21.032 -18.143 1.00 32.50  ? 788  HOH A O     1 
HETATM 4012 O  O     . HOH G 7 .   ? -13.024 68.455 2.087   1.00 10.50  ? 789  HOH A O     1 
HETATM 4013 O  O     . HOH G 7 .   ? -18.110 48.777 -6.318  1.00 23.81  ? 790  HOH A O     1 
HETATM 4014 O  O     . HOH G 7 .   ? 0.112   57.225 16.967  1.00 45.58  ? 791  HOH A O     1 
HETATM 4015 O  O     . HOH G 7 .   ? -37.883 31.839 -0.055  1.00 10.85  ? 792  HOH A O     1 
HETATM 4016 O  O     . HOH G 7 .   ? -40.560 39.686 22.288  1.00 24.41  ? 793  HOH A O     1 
HETATM 4017 O  O     . HOH G 7 .   ? -29.271 48.095 11.961  1.00 26.51  ? 794  HOH A O     1 
HETATM 4018 O  O     . HOH G 7 .   ? -11.261 51.426 -9.947  1.00 41.20  ? 795  HOH A O     1 
HETATM 4019 O  O     . HOH G 7 .   ? 7.736   60.753 1.545   1.00 16.86  ? 796  HOH A O     1 
HETATM 4020 O  O     . HOH G 7 .   ? -23.954 60.373 -15.447 1.00 16.58  ? 797  HOH A O     1 
HETATM 4021 O  O     . HOH G 7 .   ? -37.892 61.708 11.099  1.00 31.34  ? 798  HOH A O     1 
HETATM 4022 O  O     . HOH G 7 .   ? -4.551  44.948 -0.172  1.00 35.62  ? 799  HOH A O     1 
HETATM 4023 O  O     . HOH G 7 .   ? -29.538 59.219 -16.307 1.00 28.16  ? 800  HOH A O     1 
HETATM 4024 O  O     . HOH G 7 .   ? -26.868 48.653 -15.958 1.00 34.20  ? 801  HOH A O     1 
HETATM 4025 O  O     . HOH G 7 .   ? -30.287 67.263 7.925   1.00 12.27  ? 802  HOH A O     1 
HETATM 4026 O  O     . HOH G 7 .   ? -10.044 58.487 20.235  1.00 31.20  ? 803  HOH A O     1 
HETATM 4027 O  O     . HOH G 7 .   ? -37.237 71.673 12.582  1.00 37.72  ? 804  HOH A O     1 
HETATM 4028 O  O     . HOH G 7 .   ? -11.002 66.772 2.078   1.00 25.60  ? 805  HOH A O     1 
HETATM 4029 O  O     . HOH G 7 .   ? -25.047 75.158 1.506   1.00 32.25  ? 806  HOH A O     1 
HETATM 4030 O  O     . HOH G 7 .   ? 4.887   61.527 -1.647  1.00 21.00  ? 807  HOH A O     1 
HETATM 4031 O  O     . HOH G 7 .   ? -37.131 30.569 -19.153 1.00 24.80  ? 808  HOH A O     1 
HETATM 4032 O  O     . HOH G 7 .   ? -27.329 25.713 -0.115  1.00 28.00  ? 809  HOH A O     1 
HETATM 4033 O  O     . HOH G 7 .   ? -3.562  7.699  -0.529  1.00 47.21  ? 810  HOH A O     1 
HETATM 4034 O  O     . HOH G 7 .   ? -39.570 55.446 -0.352  1.00 25.23  ? 811  HOH A O     1 
HETATM 4035 O  O     . HOH G 7 .   ? -4.958  53.455 -6.785  1.00 24.89  ? 812  HOH A O     1 
HETATM 4036 O  O     . HOH G 7 .   ? -15.370 61.446 -8.462  1.00 19.60  ? 813  HOH A O     1 
HETATM 4037 O  O     . HOH G 7 .   ? -40.307 34.478 -12.419 1.00 40.19  ? 814  HOH A O     1 
HETATM 4038 O  O     . HOH G 7 .   ? -38.045 46.881 9.606   1.00 8.36   ? 815  HOH A O     1 
HETATM 4039 O  O     . HOH G 7 .   ? -1.388  48.079 -3.501  1.00 15.62  ? 816  HOH A O     1 
HETATM 4040 O  O     . HOH G 7 .   ? -39.407 65.067 -12.186 1.00 37.53  ? 817  HOH A O     1 
HETATM 4041 O  O     . HOH G 7 .   ? -20.009 37.872 -26.333 1.00 26.09  ? 818  HOH A O     1 
HETATM 4042 O  O     . HOH G 7 .   ? -30.623 81.801 0.242   1.00 41.27  ? 819  HOH A O     1 
HETATM 4043 O  O     . HOH G 7 .   ? -29.319 36.365 -14.002 1.00 35.10  ? 820  HOH A O     1 
HETATM 4044 O  O     . HOH G 7 .   ? -28.930 35.560 -11.400 1.00 18.39  ? 821  HOH A O     1 
HETATM 4045 O  O     . HOH G 7 .   ? 2.372   63.158 -1.305  1.00 25.02  ? 822  HOH A O     1 
HETATM 4046 O  O     . HOH G 7 .   ? -23.103 66.904 3.894   1.00 9.12   ? 823  HOH A O     1 
HETATM 4047 O  O     . HOH G 7 .   ? -8.386  49.450 -0.740  1.00 37.72  ? 824  HOH A O     1 
HETATM 4048 O  O     . HOH G 7 .   ? -18.492 23.441 5.930   1.00 48.08  ? 825  HOH A O     1 
HETATM 4049 O  O     . HOH G 7 .   ? -19.109 36.517 -17.324 1.00 27.84  ? 826  HOH A O     1 
HETATM 4050 O  O     . HOH G 7 .   ? -31.784 21.959 16.672  1.00 33.72  ? 827  HOH A O     1 
HETATM 4051 O  O     . HOH G 7 .   ? -1.361  62.171 -6.785  1.00 37.37  ? 828  HOH A O     1 
HETATM 4052 O  O     . HOH G 7 .   ? -38.491 73.541 -5.368  1.00 27.72  ? 829  HOH A O     1 
HETATM 4053 O  O     . HOH G 7 .   ? -17.546 53.360 2.343   1.00 8.18   ? 830  HOH A O     1 
HETATM 4054 O  O     . HOH G 7 .   ? -41.515 24.100 7.575   1.00 22.11  ? 831  HOH A O     1 
HETATM 4055 O  O     . HOH G 7 .   ? -32.298 43.587 -13.564 1.00 26.41  ? 832  HOH A O     1 
HETATM 4056 O  O     . HOH G 7 .   ? -22.747 41.143 -6.405  1.00 38.97  ? 833  HOH A O     1 
HETATM 4057 O  O     . HOH G 7 .   ? -28.462 81.606 -1.144  1.00 41.15  ? 834  HOH A O     1 
HETATM 4058 O  O     . HOH G 7 .   ? -43.293 46.010 7.661   1.00 31.70  ? 835  HOH A O     1 
HETATM 4059 O  O     . HOH G 7 .   ? -27.390 64.994 9.551   1.00 30.01  ? 836  HOH A O     1 
HETATM 4060 O  O     . HOH G 7 .   ? -0.891  46.165 1.106   1.00 39.21  ? 837  HOH A O     1 
HETATM 4061 O  O     . HOH G 7 .   ? -2.513  66.111 8.026   1.00 28.94  ? 838  HOH A O     1 
HETATM 4062 O  O     . HOH G 7 .   ? -49.734 46.646 0.728   1.00 23.13  ? 839  HOH A O     1 
HETATM 4063 O  O     . HOH G 7 .   ? -32.022 77.764 8.462   1.00 34.28  ? 840  HOH A O     1 
HETATM 4064 O  O     . HOH G 7 .   ? 3.099   56.408 12.204  1.00 28.09  ? 841  HOH A O     1 
HETATM 4065 O  O     . HOH G 7 .   ? -39.342 24.955 1.241   1.00 23.06  ? 842  HOH A O     1 
HETATM 4066 O  O     . HOH G 7 .   ? -32.329 21.027 -14.031 1.00 35.02  ? 843  HOH A O     1 
HETATM 4067 O  O     . HOH G 7 .   ? -22.707 12.321 5.566   1.00 37.09  ? 844  HOH A O     1 
HETATM 4068 O  O     . HOH G 7 .   ? 2.053   55.556 -8.413  1.00 42.70  ? 845  HOH A O     1 
HETATM 4069 O  O     . HOH G 7 .   ? -33.400 40.138 -16.608 1.00 32.47  ? 846  HOH A O     1 
HETATM 4070 O  O     . HOH G 7 .   ? -22.094 9.107  -11.220 1.00 40.50  ? 847  HOH A O     1 
HETATM 4071 O  O     . HOH G 7 .   ? -2.847  67.722 2.375   1.00 30.02  ? 848  HOH A O     1 
HETATM 4072 O  O     . HOH G 7 .   ? -31.814 25.483 20.851  1.00 41.29  ? 849  HOH A O     1 
HETATM 4073 O  O     . HOH G 7 .   ? -21.667 21.079 -20.093 1.00 26.90  ? 850  HOH A O     1 
HETATM 4074 O  O     . HOH G 7 .   ? -10.901 48.114 13.546  1.00 26.22  ? 851  HOH A O     1 
HETATM 4075 O  O     . HOH G 7 .   ? -29.308 44.158 16.385  1.00 29.91  ? 852  HOH A O     1 
HETATM 4076 O  O     . HOH G 7 .   ? -36.170 24.694 6.474   1.00 43.17  ? 853  HOH A O     1 
HETATM 4077 O  O     . HOH G 7 .   ? -21.945 9.492  5.143   1.00 47.06  ? 854  HOH A O     1 
HETATM 4078 O  O     . HOH G 7 .   ? -27.675 41.903 11.666  1.00 26.77  ? 855  HOH A O     1 
HETATM 4079 O  O     . HOH G 7 .   ? -22.994 38.727 -19.589 1.00 28.54  ? 856  HOH A O     1 
HETATM 4080 O  O     . HOH G 7 .   ? -34.977 66.474 -15.548 1.00 32.09  ? 857  HOH A O     1 
HETATM 4081 O  O     . HOH G 7 .   ? -21.535 66.521 -11.219 1.00 35.35  ? 858  HOH A O     1 
HETATM 4082 O  O     . HOH G 7 .   ? 0.352   65.050 3.669   1.00 30.55  ? 859  HOH A O     1 
HETATM 4083 O  O     . HOH G 7 .   ? -43.111 54.100 6.670   1.00 39.52  ? 860  HOH A O     1 
HETATM 4084 O  O     . HOH G 7 .   ? -42.093 56.276 2.998   1.00 27.95  ? 861  HOH A O     1 
HETATM 4085 O  O     . HOH G 7 .   ? -21.177 13.076 -10.525 1.00 40.98  ? 862  HOH A O     1 
HETATM 4086 O  O     . HOH G 7 .   ? -20.711 48.042 -1.765  1.00 22.56  ? 863  HOH A O     1 
HETATM 4087 O  O     . HOH G 7 .   ? -19.942 60.624 -14.860 1.00 26.91  ? 864  HOH A O     1 
HETATM 4088 O  O     . HOH G 7 .   ? -31.158 39.198 -9.013  1.00 31.32  ? 865  HOH A O     1 
HETATM 4089 O  O     . HOH G 7 .   ? -31.698 13.624 -8.285  1.00 33.78  ? 866  HOH A O     1 
HETATM 4090 O  O     . HOH G 7 .   ? -44.587 45.392 16.751  1.00 33.23  ? 867  HOH A O     1 
HETATM 4091 O  O     . HOH G 7 .   ? -11.140 50.573 12.395  1.00 16.48  ? 868  HOH A O     1 
HETATM 4092 O  O     . HOH G 7 .   ? -7.107  50.005 -3.661  1.00 33.54  ? 869  HOH A O     1 
HETATM 4093 O  O     . HOH G 7 .   ? -6.400  57.964 17.836  1.00 37.70  ? 870  HOH A O     1 
HETATM 4094 O  O     . HOH G 7 .   ? -38.487 58.074 2.892   1.00 27.94  ? 871  HOH A O     1 
HETATM 4095 O  O     . HOH G 7 .   ? -10.904 60.507 -12.595 1.00 48.47  ? 872  HOH A O     1 
HETATM 4096 O  O     . HOH G 7 .   ? -36.253 55.538 -18.772 1.00 33.40  ? 873  HOH A O     1 
HETATM 4097 O  O     . HOH G 7 .   ? -30.995 74.904 13.851  1.00 53.66  ? 874  HOH A O     1 
HETATM 4098 O  O     . HOH G 7 .   ? -42.226 38.243 -4.411  1.00 21.79  ? 875  HOH A O     1 
HETATM 4099 O  O     . HOH G 7 .   ? -28.896 49.729 10.013  1.00 29.48  ? 876  HOH A O     1 
HETATM 4100 O  O     . HOH G 7 .   ? -30.858 41.567 -20.486 1.00 31.05  ? 877  HOH A O     1 
HETATM 4101 O  O     . HOH G 7 .   ? -24.561 41.786 9.249   1.00 42.63  ? 878  HOH A O     1 
HETATM 4102 O  O     . HOH G 7 .   ? -33.797 47.260 -16.892 1.00 34.63  ? 879  HOH A O     1 
HETATM 4103 O  O     . HOH G 7 .   ? -28.281 17.940 10.304  1.00 42.45  ? 880  HOH A O     1 
HETATM 4104 O  O     . HOH G 7 .   ? -37.758 36.870 -21.308 1.00 35.70  ? 881  HOH A O     1 
HETATM 4105 O  O     . HOH G 7 .   ? -43.523 31.098 1.303   1.00 37.79  ? 882  HOH A O     1 
HETATM 4106 O  O     . HOH G 7 .   ? -34.411 75.585 18.506  1.00 46.83  ? 883  HOH A O     1 
HETATM 4107 O  O     . HOH G 7 .   ? -25.265 15.210 4.245   1.00 33.67  ? 884  HOH A O     1 
HETATM 4108 O  O     . HOH G 7 .   ? -13.753 68.224 -9.197  1.00 19.24  ? 885  HOH A O     1 
HETATM 4109 O  O     . HOH G 7 .   ? -19.925 73.568 -3.847  1.00 22.44  ? 886  HOH A O     1 
HETATM 4110 O  O     . HOH G 7 .   ? 3.992   62.176 8.862   1.00 39.81  ? 887  HOH A O     1 
HETATM 4111 O  O     . HOH G 7 .   ? -14.199 48.196 -8.502  1.00 33.18  ? 888  HOH A O     1 
HETATM 4112 O  O     . HOH G 7 .   ? -19.739 38.983 -21.089 1.00 43.69  ? 889  HOH A O     1 
HETATM 4113 O  O     . HOH G 7 .   ? -17.834 37.364 -24.241 1.00 26.72  ? 890  HOH A O     1 
HETATM 4114 O  O     . HOH G 7 .   ? -42.708 45.234 2.145   1.00 33.27  ? 891  HOH A O     1 
HETATM 4115 O  O     . HOH G 7 .   ? -13.031 41.239 8.358   1.00 35.03  ? 892  HOH A O     1 
HETATM 4116 O  O     . HOH G 7 .   ? 0.346   45.020 14.629  1.00 40.09  ? 893  HOH A O     1 
HETATM 4117 O  O     . HOH G 7 .   ? -35.947 20.417 -0.451  1.00 31.15  ? 894  HOH A O     1 
HETATM 4118 O  O     . HOH G 7 .   ? -20.334 47.217 -6.557  1.00 36.77  ? 895  HOH A O     1 
HETATM 4119 O  O     . HOH G 7 .   ? 5.121   48.288 6.123   1.00 43.50  ? 896  HOH A O     1 
HETATM 4120 O  O     . HOH G 7 .   ? -30.001 42.304 23.851  1.00 31.39  ? 897  HOH A O     1 
HETATM 4121 O  O     . HOH G 7 .   ? -33.406 42.683 -15.798 1.00 34.41  ? 898  HOH A O     1 
HETATM 4122 O  O     . HOH G 7 .   ? -19.787 51.018 7.630   1.00 28.75  ? 899  HOH A O     1 
HETATM 4123 O  O     . HOH G 7 .   ? -30.302 10.645 -11.363 1.00 44.62  ? 900  HOH A O     1 
HETATM 4124 O  O     . HOH G 7 .   ? -2.774  50.202 16.845  1.00 33.83  ? 901  HOH A O     1 
HETATM 4125 O  O     . HOH G 7 .   ? -44.620 33.577 5.872   1.00 13.03  ? 902  HOH A O     1 
HETATM 4126 O  O     . HOH G 7 .   ? -40.925 30.072 9.372   1.00 24.01  ? 903  HOH A O     1 
HETATM 4127 O  O     . HOH G 7 .   ? -32.800 18.781 -14.823 1.00 42.95  ? 904  HOH A O     1 
HETATM 4128 O  O     . HOH G 7 .   ? -31.316 26.963 22.630  1.00 37.88  ? 905  HOH A O     1 
HETATM 4129 O  O     . HOH G 7 .   ? 3.023   52.809 14.788  1.00 40.06  ? 906  HOH A O     1 
HETATM 4130 O  O     . HOH G 7 .   ? -9.488  49.548 -2.618  1.00 28.65  ? 907  HOH A O     1 
HETATM 4131 O  O     . HOH G 7 .   ? -23.443 41.673 -9.019  1.00 28.56  ? 908  HOH A O     1 
HETATM 4132 O  O     . HOH G 7 .   ? 6.989   55.156 4.787   1.00 44.29  ? 909  HOH A O     1 
HETATM 4133 O  O     . HOH G 7 .   ? -39.166 57.044 -15.201 1.00 34.22  ? 910  HOH A O     1 
HETATM 4134 O  O     . HOH G 7 .   ? -39.188 48.047 5.767   1.00 23.46  ? 911  HOH A O     1 
HETATM 4135 O  O     . HOH G 7 .   ? -12.105 45.383 11.224  1.00 44.57  ? 912  HOH A O     1 
HETATM 4136 O  O     . HOH G 7 .   ? -50.055 46.414 6.148   1.00 37.00  ? 913  HOH A O     1 
HETATM 4137 O  O     . HOH G 7 .   ? -35.529 46.263 23.858  1.00 45.86  ? 914  HOH A O     1 
HETATM 4138 O  O     . HOH G 7 .   ? -52.058 41.785 8.888   1.00 36.39  ? 915  HOH A O     1 
HETATM 4139 O  O     . HOH G 7 .   ? -5.973  68.123 0.762   1.00 37.29  ? 916  HOH A O     1 
HETATM 4140 O  O     . HOH G 7 .   ? -2.758  43.980 11.289  1.00 40.16  ? 917  HOH A O     1 
HETATM 4141 O  O     . HOH G 7 .   ? -31.692 76.413 -2.385  1.00 39.31  ? 918  HOH A O     1 
HETATM 4142 O  O     . HOH G 7 .   ? -32.092 38.646 -14.629 1.00 27.38  ? 919  HOH A O     1 
HETATM 4143 O  O     . HOH G 7 .   ? -31.237 28.734 -26.944 1.00 39.10  ? 920  HOH A O     1 
HETATM 4144 O  O     . HOH G 7 .   ? -3.852  54.331 18.024  1.00 33.26  ? 921  HOH A O     1 
HETATM 4145 O  O     . HOH G 7 .   ? -39.367 67.863 16.138  1.00 34.51  ? 922  HOH A O     1 
HETATM 4146 O  O     . HOH G 7 .   ? -22.859 33.335 6.101   1.00 36.13  ? 923  HOH A O     1 
HETATM 4147 O  O     . HOH G 7 .   ? -40.419 31.411 -8.888  1.00 36.26  ? 924  HOH A O     1 
HETATM 4148 O  O     . HOH G 7 .   ? -34.460 28.691 -10.206 1.00 33.18  ? 925  HOH A O     1 
HETATM 4149 O  O     . HOH G 7 .   ? -27.301 31.830 23.196  1.00 37.35  ? 926  HOH A O     1 
HETATM 4150 O  O     . HOH G 7 .   ? -40.353 32.345 -6.458  1.00 33.29  ? 927  HOH A O     1 
HETATM 4151 O  O     . HOH G 7 .   ? -10.798 54.315 -12.202 1.00 26.91  ? 928  HOH A O     1 
HETATM 4152 O  O     . HOH G 7 .   ? -49.829 34.345 4.602   1.00 46.83  ? 929  HOH A O     1 
HETATM 4153 O  O     . HOH G 7 .   ? -39.259 61.537 -11.659 1.00 36.69  ? 930  HOH A O     1 
HETATM 4154 O  O     . HOH G 7 .   ? -16.703 71.914 -0.436  1.00 30.19  ? 931  HOH A O     1 
HETATM 4155 O  O     . HOH G 7 .   ? -12.498 59.381 20.972  1.00 24.10  ? 932  HOH A O     1 
HETATM 4156 O  O     . HOH G 7 .   ? -38.093 49.686 14.816  1.00 33.91  ? 933  HOH A O     1 
HETATM 4157 O  O     . HOH G 7 .   ? -31.234 55.783 -17.939 1.00 45.22  ? 934  HOH A O     1 
HETATM 4158 O  O     . HOH G 7 .   ? -37.304 19.806 -4.980  1.00 41.83  ? 935  HOH A O     1 
HETATM 4159 O  O     . HOH G 7 .   ? -5.751  55.815 -6.720  1.00 27.77  ? 936  HOH A O     1 
HETATM 4160 O  O     . HOH G 7 .   ? -18.741 63.791 12.682  1.00 34.49  ? 937  HOH A O     1 
HETATM 4161 O  O     . HOH G 7 .   ? -43.218 30.510 8.352   1.00 27.06  ? 938  HOH A O     1 
HETATM 4162 O  O     . HOH G 7 .   ? -38.108 23.035 13.956  1.00 34.46  ? 939  HOH A O     1 
HETATM 4163 O  O     . HOH G 7 .   ? -8.600  41.616 9.917   1.00 31.61  ? 940  HOH A O     1 
HETATM 4164 O  O     . HOH G 7 .   ? -40.318 47.056 -13.612 1.00 29.17  ? 941  HOH A O     1 
HETATM 4165 O  O     . HOH G 7 .   ? 4.599   54.766 11.242  1.00 40.56  ? 942  HOH A O     1 
HETATM 4166 O  O     . HOH G 7 .   ? -32.823 36.710 -10.709 1.00 35.65  ? 943  HOH A O     1 
HETATM 4167 O  O     . HOH G 7 .   ? -10.096 34.054 -15.746 1.00 43.66  ? 944  HOH A O     1 
HETATM 4168 O  O     . HOH G 7 .   ? -39.251 55.004 8.667   1.00 31.83  ? 945  HOH A O     1 
HETATM 4169 O  O     . HOH G 7 .   ? -28.841 42.518 9.594   1.00 19.83  ? 946  HOH A O     1 
HETATM 4170 O  O     . HOH G 7 .   ? -16.518 9.005  -18.327 1.00 49.36  ? 947  HOH A O     1 
HETATM 4171 O  O     . HOH G 7 .   ? 0.689   54.553 18.158  1.00 47.44  ? 948  HOH A O     1 
HETATM 4172 O  O     . HOH G 7 .   ? -37.469 32.838 -24.779 1.00 28.90  ? 949  HOH A O     1 
HETATM 4173 O  O     . HOH G 7 .   ? -31.464 11.141 -16.200 1.00 37.09  ? 950  HOH A O     1 
HETATM 4174 O  O     . HOH G 7 .   ? -25.782 25.963 -23.748 1.00 41.15  ? 951  HOH A O     1 
HETATM 4175 O  O     . HOH G 7 .   ? -18.288 59.557 13.623  1.00 33.45  ? 952  HOH A O     1 
HETATM 4176 O  O     . HOH G 7 .   ? -44.836 45.861 4.098   1.00 35.21  ? 953  HOH A O     1 
HETATM 4177 O  O     . HOH G 7 .   ? -26.035 47.347 -18.565 1.00 50.58  ? 954  HOH A O     1 
HETATM 4178 O  O     . HOH G 7 .   ? -4.703  58.106 -7.082  1.00 35.75  ? 955  HOH A O     1 
HETATM 4179 O  O     . HOH G 7 .   ? -25.666 82.241 -1.938  1.00 43.36  ? 956  HOH A O     1 
HETATM 4180 O  O     . HOH G 7 .   ? -6.158  67.502 3.291   1.00 29.74  ? 957  HOH A O     1 
HETATM 4181 O  O     . HOH G 7 .   ? -39.460 61.748 13.860  1.00 43.70  ? 958  HOH A O     1 
HETATM 4182 O  O     . HOH G 7 .   ? -9.247  66.577 3.695   1.00 22.35  ? 959  HOH A O     1 
HETATM 4183 O  O     . HOH G 7 .   ? -27.826 68.626 -20.057 1.00 47.08  ? 960  HOH A O     1 
HETATM 4184 O  O     . HOH G 7 .   ? -36.469 28.654 -18.238 1.00 30.23  ? 961  HOH A O     1 
HETATM 4185 O  O     . HOH G 7 .   ? -41.724 47.923 8.536   1.00 33.47  ? 962  HOH A O     1 
HETATM 4186 O  O     . HOH G 7 .   ? -43.815 57.348 -7.616  1.00 39.59  ? 963  HOH A O     1 
HETATM 4187 O  O     . HOH G 7 .   ? -39.760 42.043 -12.601 1.00 30.59  ? 964  HOH A O     1 
HETATM 4188 O  O     . HOH G 7 .   ? -45.174 45.731 1.331   1.00 22.06  ? 965  HOH A O     1 
HETATM 4189 O  O     . HOH G 7 .   ? 2.517   57.810 -8.272  1.00 34.79  ? 966  HOH A O     1 
HETATM 4190 O  O     . HOH G 7 .   ? -40.728 30.700 -3.469  1.00 39.13  ? 967  HOH A O     1 
HETATM 4191 O  O     . HOH G 7 .   ? -30.237 65.204 12.835  1.00 37.74  ? 968  HOH A O     1 
HETATM 4192 O  O     . HOH G 7 .   ? -39.319 57.915 0.101   1.00 29.60  ? 969  HOH A O     1 
HETATM 4193 O  O     . HOH G 7 .   ? -4.203  44.230 -2.773  1.00 29.83  ? 970  HOH A O     1 
HETATM 4194 O  O     . HOH G 7 .   ? -22.683 80.650 1.834   1.00 31.07  ? 971  HOH A O     1 
HETATM 4195 O  O     . HOH G 7 .   ? -21.352 51.793 5.612   1.00 21.84  ? 972  HOH A O     1 
HETATM 4196 O  O     . HOH G 7 .   ? -19.682 43.424 -2.829  1.00 49.88  ? 973  HOH A O     1 
HETATM 4197 O  O     . HOH G 7 .   ? -2.742  43.273 4.574   1.00 37.09  ? 974  HOH A O     1 
HETATM 4198 O  O     . HOH G 7 .   ? -24.455 31.589 17.053  1.00 32.69  ? 975  HOH A O     1 
HETATM 4199 O  O     . HOH G 7 .   ? -20.552 33.819 11.821  1.00 42.09  ? 976  HOH A O     1 
HETATM 4200 O  O     . HOH G 7 .   ? -31.891 57.775 -18.573 1.00 45.27  ? 977  HOH A O     1 
HETATM 4201 O  O     . HOH G 7 .   ? -35.628 57.980 11.324  1.00 40.57  ? 978  HOH A O     1 
HETATM 4202 O  O     . HOH G 7 .   ? -36.593 75.540 20.331  1.00 41.06  ? 979  HOH A O     1 
HETATM 4203 O  O     . HOH G 7 .   ? -19.831 13.426 -21.445 1.00 44.01  ? 980  HOH A O     1 
HETATM 4204 O  O     . HOH G 7 .   ? -22.250 38.899 7.579   1.00 33.35  ? 981  HOH A O     1 
HETATM 4205 O  O     A HOH G 7 .   ? -15.926 70.833 -9.553  0.59 25.40  ? 982  HOH A O     1 
HETATM 4206 O  O     B HOH G 7 .   ? -17.353 71.869 -10.416 0.41 16.35  ? 982  HOH A O     1 
HETATM 4207 O  O     . HOH G 7 .   ? -38.926 77.124 -3.230  1.00 40.47  ? 983  HOH A O     1 
HETATM 4208 O  O     . HOH G 7 .   ? -25.809 65.681 -20.226 1.00 44.86  ? 984  HOH A O     1 
HETATM 4209 O  O     . HOH G 7 .   ? -7.883  33.443 7.233   1.00 48.40  ? 985  HOH A O     1 
HETATM 4210 O  O     . HOH G 7 .   ? -2.617  71.512 -2.546  1.00 48.83  ? 986  HOH A O     1 
HETATM 4211 O  O     . HOH G 7 .   ? -23.739 76.153 8.217   1.00 40.10  ? 987  HOH A O     1 
HETATM 4212 O  O     . HOH G 7 .   ? -7.192  51.451 -6.704  1.00 39.92  ? 988  HOH A O     1 
HETATM 4213 O  O     . HOH G 7 .   ? 0.289   59.113 14.259  1.00 46.67  ? 989  HOH A O     1 
HETATM 4214 O  O     . HOH G 7 .   ? -24.097 55.664 11.905  1.00 36.45  ? 990  HOH A O     1 
HETATM 4215 O  O     . HOH G 7 .   ? -0.069  66.135 9.065   1.00 36.99  ? 991  HOH A O     1 
HETATM 4216 O  O     . HOH G 7 .   ? -19.971 67.266 12.436  1.00 46.47  ? 992  HOH A O     1 
HETATM 4217 O  O     . HOH G 7 .   ? -27.890 45.203 17.997  1.00 34.27  ? 993  HOH A O     1 
HETATM 4218 O  O     . HOH G 7 .   ? 1.972   45.131 5.135   1.00 39.35  ? 994  HOH A O     1 
HETATM 4219 O  O     . HOH G 7 .   ? -41.230 72.462 -4.924  1.00 38.92  ? 995  HOH A O     1 
HETATM 4220 O  O     . HOH G 7 .   ? -35.581 51.400 -18.537 1.00 43.73  ? 996  HOH A O     1 
HETATM 4221 O  O     . HOH G 7 .   ? -33.511 31.981 -10.850 1.00 42.19  ? 997  HOH A O     1 
HETATM 4222 O  O     . HOH G 7 .   ? -11.425 72.257 -2.159  1.00 39.96  ? 998  HOH A O     1 
HETATM 4223 O  O     . HOH G 7 .   ? -39.133 48.781 17.546  1.00 37.03  ? 999  HOH A O     1 
HETATM 4224 O  O     . HOH G 7 .   ? -14.152 26.773 -23.520 1.00 40.51  ? 1000 HOH A O     1 
HETATM 4225 O  O     . HOH G 7 .   ? 3.012   64.933 0.050   1.00 39.13  ? 1001 HOH A O     1 
HETATM 4226 O  O     . HOH G 7 .   ? -5.414  66.033 -3.237  1.00 30.55  ? 1002 HOH A O     1 
HETATM 4227 O  O     . HOH G 7 .   ? -53.584 37.770 13.725  1.00 33.34  ? 1003 HOH A O     1 
HETATM 4228 O  O     . HOH G 7 .   ? -6.386  51.225 17.242  1.00 30.98  ? 1004 HOH A O     1 
HETATM 4229 O  O     . HOH G 7 .   ? -42.635 56.731 7.822   1.00 44.63  ? 1005 HOH A O     1 
HETATM 4230 O  O     . HOH G 7 .   ? -33.874 27.206 22.895  1.00 42.10  ? 1006 HOH A O     1 
HETATM 4231 O  O     . HOH G 7 .   ? -26.677 34.186 19.835  1.00 25.66  ? 1007 HOH A O     1 
HETATM 4232 O  O     . HOH G 7 .   ? -22.497 33.275 9.690   1.00 38.61  ? 1008 HOH A O     1 
HETATM 4233 O  O     . HOH G 7 .   ? -12.383 36.257 -19.633 1.00 37.30  ? 1009 HOH A O     1 
HETATM 4234 O  O     . HOH G 7 .   ? -16.764 57.706 -14.154 1.00 21.44  ? 1010 HOH A O     1 
HETATM 4235 O  O     . HOH G 7 .   ? -6.225  62.381 -6.527  1.00 39.88  ? 1011 HOH A O     1 
HETATM 4236 O  O     . HOH G 7 .   ? 9.670   60.139 3.466   1.00 29.42  ? 1012 HOH A O     1 
HETATM 4237 O  O     . HOH G 7 .   ? -35.949 30.753 25.003  1.00 28.81  ? 1013 HOH A O     1 
HETATM 4238 O  O     . HOH G 7 .   ? -17.155 -1.863 -4.559  1.00 39.02  ? 1014 HOH A O     1 
HETATM 4239 O  O     . HOH G 7 .   ? -5.525  69.169 -13.307 1.00 36.30  ? 1015 HOH A O     1 
HETATM 4240 O  O     . HOH G 7 .   ? -29.683 46.622 22.719  1.00 44.91  ? 1016 HOH A O     1 
HETATM 4241 O  O     . HOH G 7 .   ? -36.908 20.477 13.712  1.00 48.58  ? 1017 HOH A O     1 
HETATM 4242 O  O     . HOH G 7 .   ? -41.234 38.917 -10.332 1.00 25.52  ? 1018 HOH A O     1 
HETATM 4243 O  O     . HOH G 7 .   ? -22.526 81.125 -2.139  1.00 40.03  ? 1019 HOH A O     1 
HETATM 4244 O  O     . HOH G 7 .   ? -42.554 43.476 -11.929 1.00 25.50  ? 1020 HOH A O     1 
HETATM 4245 O  O     . HOH G 7 .   ? -28.456 44.546 -19.031 1.00 42.55  ? 1021 HOH A O     1 
HETATM 4246 O  O     . HOH G 7 .   ? -26.127 46.121 11.525  1.00 36.68  ? 1022 HOH A O     1 
HETATM 4247 O  O     . HOH G 7 .   ? -4.054  62.146 -5.110  1.00 32.95  ? 1023 HOH A O     1 
HETATM 4248 O  O     . HOH G 7 .   ? -44.831 41.576 18.835  1.00 33.55  ? 1024 HOH A O     1 
HETATM 4249 O  O     . HOH G 7 .   ? -41.757 45.517 18.298  1.00 39.03  ? 1025 HOH A O     1 
HETATM 4250 O  O     . HOH G 7 .   ? -15.200 34.945 -23.199 1.00 35.70  ? 1026 HOH A O     1 
HETATM 4251 O  O     . HOH G 7 .   ? -30.598 37.648 -10.973 1.00 26.56  ? 1027 HOH A O     1 
HETATM 4252 O  O     . HOH G 7 .   ? 7.112   49.566 9.562   1.00 60.55  ? 1028 HOH A O     1 
HETATM 4253 O  O     . HOH G 7 .   ? -1.091  67.870 -11.383 1.00 20.12  ? 1029 HOH A O     1 
HETATM 4254 O  O     . HOH G 7 .   ? -37.842 49.361 8.483   1.00 23.97  ? 1030 HOH A O     1 
HETATM 4255 O  O     . HOH G 7 .   ? -42.412 75.314 -4.579  1.00 33.30  ? 1031 HOH A O     1 
HETATM 4256 O  O     . HOH G 7 .   ? -41.275 27.335 -0.421  1.00 42.24  ? 1032 HOH A O     1 
HETATM 4257 O  O     . HOH G 7 .   ? -38.308 47.161 21.490  1.00 38.97  ? 1033 HOH A O     1 
HETATM 4258 O  O     . HOH G 7 .   ? -30.465 39.378 -12.937 1.00 25.42  ? 1034 HOH A O     1 
HETATM 4259 O  O     . HOH G 7 .   ? -37.799 29.399 22.526  1.00 37.19  ? 1035 HOH A O     1 
HETATM 4260 O  O     . HOH G 7 .   ? -39.009 51.269 9.838   1.00 43.40  ? 1036 HOH A O     1 
HETATM 4261 O  O     . HOH G 7 .   ? -37.835 53.935 11.643  1.00 31.27  ? 1037 HOH A O     1 
HETATM 4262 O  O     . HOH G 7 .   ? -37.102 60.583 -14.392 1.00 38.60  ? 1038 HOH A O     1 
HETATM 4263 O  O     . HOH G 7 .   ? -42.483 43.252 20.256  1.00 43.68  ? 1039 HOH A O     1 
HETATM 4264 O  O     . HOH G 7 .   ? -7.945  71.517 -14.279 1.00 37.99  ? 1040 HOH A O     1 
HETATM 4265 O  O     . HOH G 7 .   ? -19.431 38.537 10.106  1.00 41.09  ? 1041 HOH A O     1 
HETATM 4266 O  O     . HOH H 7 .   ? -10.380 38.953 -11.054 1.00 36.30  ? 101  HOH T O     1 
HETATM 4267 O  O     . HOH H 7 .   ? -3.416  46.144 -4.410  1.00 29.77  ? 102  HOH T O     1 
HETATM 4268 O  O     . HOH H 7 .   ? -3.056  42.356 -10.325 1.00 31.31  ? 103  HOH T O     1 
HETATM 4269 O  O     . HOH H 7 .   ? -22.035 32.559 -7.335  1.00 31.88  ? 104  HOH T O     1 
HETATM 4270 O  O     . HOH H 7 .   ? -27.120 32.866 9.771   1.00 22.70  ? 105  HOH T O     1 
HETATM 4271 O  O     . HOH H 7 .   ? -14.741 42.864 -4.835  1.00 24.26  ? 106  HOH T O     1 
HETATM 4272 O  O     . HOH H 7 .   ? -17.540 37.369 -10.530 1.00 28.31  ? 107  HOH T O     1 
HETATM 4273 O  O     . HOH H 7 .   ? -14.955 40.372 -11.684 1.00 29.62  ? 108  HOH T O     1 
HETATM 4274 O  O     . HOH H 7 .   ? -1.705  35.595 -5.503  1.00 22.49  ? 109  HOH T O     1 
HETATM 4275 O  O     . HOH H 7 .   ? -21.325 29.281 7.638   1.00 34.38  ? 110  HOH T O     1 
HETATM 4276 O  O     . HOH H 7 .   ? -17.357 34.986 -7.599  1.00 28.12  ? 111  HOH T O     1 
HETATM 4277 O  O     . HOH H 7 .   ? -30.390 29.865 -4.664  1.00 14.30  ? 112  HOH T O     1 
HETATM 4278 O  O     . HOH H 7 .   ? -18.656 42.005 -4.565  1.00 34.84  ? 113  HOH T O     1 
HETATM 4279 O  O     . HOH H 7 .   ? -22.781 31.967 11.998  1.00 57.13  ? 114  HOH T O     1 
HETATM 4280 O  O     . HOH H 7 .   ? -27.304 18.780 12.582  1.00 49.85  ? 115  HOH T O     1 
HETATM 4281 O  O     . HOH H 7 .   ? -5.605  39.814 -4.275  1.00 51.94  ? 116  HOH T O     1 
HETATM 4282 O  O     . HOH H 7 .   ? -27.998 36.701 -6.479  1.00 25.62  ? 117  HOH T O     1 
HETATM 4283 O  O     . HOH H 7 .   ? -11.151 43.048 -13.210 1.00 37.40  ? 118  HOH T O     1 
HETATM 4284 O  O     . HOH H 7 .   ? -19.159 27.660 11.043  1.00 42.68  ? 119  HOH T O     1 
HETATM 4285 O  O     . HOH H 7 .   ? -7.590  39.292 -12.389 1.00 34.71  ? 120  HOH T O     1 
HETATM 4286 O  O     . HOH H 7 .   ? -23.386 38.657 -3.474  1.00 42.46  ? 121  HOH T O     1 
HETATM 4287 O  O     . HOH H 7 .   ? -23.194 31.113 14.836  1.00 30.27  ? 122  HOH T O     1 
HETATM 4288 O  O     . HOH H 7 .   ? -11.058 36.318 -11.286 1.00 34.64  ? 123  HOH T O     1 
HETATM 4289 O  O     . HOH H 7 .   ? -15.571 35.491 -9.730  1.00 42.03  ? 124  HOH T O     1 
HETATM 4290 O  O     . HOH H 7 .   ? -16.116 33.517 -5.500  1.00 26.13  ? 125  HOH T O     1 
HETATM 4291 O  O     . HOH H 7 .   ? -19.163 32.193 3.231   1.00 38.74  ? 126  HOH T O     1 
HETATM 4292 O  O     . HOH H 7 .   ? -24.619 32.817 8.168   1.00 37.45  ? 127  HOH T O     1 
HETATM 4293 O  O     . HOH H 7 .   ? -0.618  43.271 -10.922 1.00 39.10  ? 128  HOH T O     1 
HETATM 4294 O  O     . HOH H 7 .   ? -15.906 45.382 -5.639  1.00 44.80  ? 129  HOH T O     1 
HETATM 4295 O  O     . HOH H 7 .   ? -17.798 33.250 11.657  1.00 39.01  ? 130  HOH T O     1 
HETATM 4296 O  O     . HOH I 7 .   ? -21.186 46.649 0.812   1.00 28.23  ? 101  HOH P O     1 
HETATM 4297 O  O     . HOH I 7 .   ? -3.815  33.709 -4.401  1.00 40.94  ? 102  HOH P O     1 
HETATM 4298 O  O     . HOH I 7 .   ? -15.588 43.183 -2.087  1.00 26.07  ? 103  HOH P O     1 
HETATM 4299 O  O     . HOH I 7 .   ? -7.332  43.998 0.831   1.00 18.38  ? 104  HOH P O     1 
HETATM 4300 O  O     . HOH I 7 .   ? -9.530  38.774 5.324   1.00 32.32  ? 105  HOH P O     1 
HETATM 4301 O  O     . HOH I 7 .   ? -11.134 42.416 -2.318  1.00 22.14  ? 106  HOH P O     1 
HETATM 4302 O  O     . HOH I 7 .   ? -13.833 41.973 5.668   1.00 21.17  ? 107  HOH P O     1 
HETATM 4303 O  O     . HOH I 7 .   ? -26.849 38.864 -0.312  1.00 31.40  ? 108  HOH P O     1 
HETATM 4304 O  O     . HOH I 7 .   ? -9.477  45.423 4.476   1.00 12.39  ? 109  HOH P O     1 
HETATM 4305 O  O     . HOH I 7 .   ? -9.211  34.866 -12.432 1.00 32.41  ? 110  HOH P O     1 
HETATM 4306 O  O     . HOH I 7 .   ? -15.981 48.280 5.392   1.00 13.01  ? 111  HOH P O     1 
HETATM 4307 O  O     . HOH I 7 .   ? -14.304 34.487 1.993   1.00 29.16  ? 112  HOH P O     1 
HETATM 4308 O  O     . HOH I 7 .   ? -23.991 47.417 4.633   1.00 27.24  ? 113  HOH P O     1 
HETATM 4309 O  O     . HOH I 7 .   ? -1.989  29.239 -11.739 1.00 27.89  ? 114  HOH P O     1 
HETATM 4310 O  O     . HOH I 7 .   ? -21.443 41.609 -1.938  1.00 29.67  ? 115  HOH P O     1 
HETATM 4311 O  O     . HOH I 7 .   ? -15.949 36.266 3.477   1.00 40.09  ? 116  HOH P O     1 
HETATM 4312 O  O     . HOH I 7 .   ? -15.753 38.319 4.648   1.00 33.93  ? 117  HOH P O     1 
HETATM 4313 O  O     . HOH I 7 .   ? -11.712 31.814 -6.280  1.00 38.32  ? 118  HOH P O     1 
HETATM 4314 O  O     . HOH I 7 .   ? -11.944 40.080 4.546   1.00 37.72  ? 119  HOH P O     1 
HETATM 4315 O  O     . HOH I 7 .   ? -7.910  42.159 -1.225  1.00 32.66  ? 120  HOH P O     1 
HETATM 4316 O  O     . HOH I 7 .   ? -14.227 45.616 -1.091  1.00 26.43  ? 121  HOH P O     1 
HETATM 4317 O  O     . HOH I 7 .   ? -10.688 45.074 -1.452  1.00 25.08  ? 122  HOH P O     1 
HETATM 4318 O  O     . HOH I 7 .   ? -21.012 44.519 9.937   1.00 47.55  ? 123  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   ?   ?   ?   T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   5DB 4   4   4   5DB OMT T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DTP 1   501  1   DTP DTP A . 
E 5 CA  1   502  1   CA  CA  A . 
F 6 GOL 1   503  1   GOL GOL A . 
G 7 HOH 1   601  269 HOH HOH A . 
G 7 HOH 2   602  40  HOH HOH A . 
G 7 HOH 3   603  238 HOH HOH A . 
G 7 HOH 4   604  156 HOH HOH A . 
G 7 HOH 5   605  78  HOH HOH A . 
G 7 HOH 6   606  472 HOH HOH A . 
G 7 HOH 7   607  209 HOH HOH A . 
G 7 HOH 8   608  244 HOH HOH A . 
G 7 HOH 9   609  324 HOH HOH A . 
G 7 HOH 10  610  448 HOH HOH A . 
G 7 HOH 11  611  41  HOH HOH A . 
G 7 HOH 12  612  236 HOH HOH A . 
G 7 HOH 13  613  428 HOH HOH A . 
G 7 HOH 14  614  278 HOH HOH A . 
G 7 HOH 15  615  158 HOH HOH A . 
G 7 HOH 16  616  388 HOH HOH A . 
G 7 HOH 17  617  9   HOH HOH A . 
G 7 HOH 18  618  59  HOH HOH A . 
G 7 HOH 19  619  375 HOH HOH A . 
G 7 HOH 20  620  31  HOH HOH A . 
G 7 HOH 21  621  462 HOH HOH A . 
G 7 HOH 22  622  152 HOH HOH A . 
G 7 HOH 23  623  468 HOH HOH A . 
G 7 HOH 24  624  316 HOH HOH A . 
G 7 HOH 25  625  171 HOH HOH A . 
G 7 HOH 26  626  143 HOH HOH A . 
G 7 HOH 27  627  307 HOH HOH A . 
G 7 HOH 28  628  210 HOH HOH A . 
G 7 HOH 29  629  2   HOH HOH A . 
G 7 HOH 30  630  318 HOH HOH A . 
G 7 HOH 31  631  399 HOH HOH A . 
G 7 HOH 32  632  234 HOH HOH A . 
G 7 HOH 33  633  270 HOH HOH A . 
G 7 HOH 34  634  124 HOH HOH A . 
G 7 HOH 35  635  138 HOH HOH A . 
G 7 HOH 36  636  33  HOH HOH A . 
G 7 HOH 37  637  49  HOH HOH A . 
G 7 HOH 38  638  474 HOH HOH A . 
G 7 HOH 39  639  136 HOH HOH A . 
G 7 HOH 40  640  421 HOH HOH A . 
G 7 HOH 41  641  12  HOH HOH A . 
G 7 HOH 42  642  1   HOH HOH A . 
G 7 HOH 43  643  397 HOH HOH A . 
G 7 HOH 44  644  46  HOH HOH A . 
G 7 HOH 45  645  351 HOH HOH A . 
G 7 HOH 46  646  233 HOH HOH A . 
G 7 HOH 47  647  139 HOH HOH A . 
G 7 HOH 48  648  155 HOH HOH A . 
G 7 HOH 49  649  44  HOH HOH A . 
G 7 HOH 50  650  106 HOH HOH A . 
G 7 HOH 51  651  11  HOH HOH A . 
G 7 HOH 52  652  42  HOH HOH A . 
G 7 HOH 53  653  373 HOH HOH A . 
G 7 HOH 54  654  10  HOH HOH A . 
G 7 HOH 55  655  312 HOH HOH A . 
G 7 HOH 56  656  245 HOH HOH A . 
G 7 HOH 57  657  144 HOH HOH A . 
G 7 HOH 58  658  62  HOH HOH A . 
G 7 HOH 59  659  48  HOH HOH A . 
G 7 HOH 60  660  356 HOH HOH A . 
G 7 HOH 61  661  333 HOH HOH A . 
G 7 HOH 62  662  224 HOH HOH A . 
G 7 HOH 63  663  52  HOH HOH A . 
G 7 HOH 64  664  108 HOH HOH A . 
G 7 HOH 65  665  188 HOH HOH A . 
G 7 HOH 66  666  79  HOH HOH A . 
G 7 HOH 67  667  202 HOH HOH A . 
G 7 HOH 68  668  194 HOH HOH A . 
G 7 HOH 69  669  341 HOH HOH A . 
G 7 HOH 70  670  383 HOH HOH A . 
G 7 HOH 71  671  255 HOH HOH A . 
G 7 HOH 72  672  19  HOH HOH A . 
G 7 HOH 73  673  285 HOH HOH A . 
G 7 HOH 74  674  70  HOH HOH A . 
G 7 HOH 75  675  13  HOH HOH A . 
G 7 HOH 76  676  130 HOH HOH A . 
G 7 HOH 77  677  114 HOH HOH A . 
G 7 HOH 78  678  72  HOH HOH A . 
G 7 HOH 79  679  259 HOH HOH A . 
G 7 HOH 80  680  447 HOH HOH A . 
G 7 HOH 81  681  135 HOH HOH A . 
G 7 HOH 82  682  377 HOH HOH A . 
G 7 HOH 83  683  174 HOH HOH A . 
G 7 HOH 84  684  329 HOH HOH A . 
G 7 HOH 85  685  57  HOH HOH A . 
G 7 HOH 86  686  220 HOH HOH A . 
G 7 HOH 87  687  30  HOH HOH A . 
G 7 HOH 88  688  28  HOH HOH A . 
G 7 HOH 89  689  105 HOH HOH A . 
G 7 HOH 90  690  352 HOH HOH A . 
G 7 HOH 91  691  248 HOH HOH A . 
G 7 HOH 92  692  21  HOH HOH A . 
G 7 HOH 93  693  347 HOH HOH A . 
G 7 HOH 94  694  185 HOH HOH A . 
G 7 HOH 95  695  243 HOH HOH A . 
G 7 HOH 96  696  34  HOH HOH A . 
G 7 HOH 97  697  24  HOH HOH A . 
G 7 HOH 98  698  61  HOH HOH A . 
G 7 HOH 99  699  53  HOH HOH A . 
G 7 HOH 100 700  126 HOH HOH A . 
G 7 HOH 101 701  250 HOH HOH A . 
G 7 HOH 102 702  479 HOH HOH A . 
G 7 HOH 103 703  37  HOH HOH A . 
G 7 HOH 104 704  190 HOH HOH A . 
G 7 HOH 105 705  99  HOH HOH A . 
G 7 HOH 106 706  7   HOH HOH A . 
G 7 HOH 107 707  302 HOH HOH A . 
G 7 HOH 108 708  153 HOH HOH A . 
G 7 HOH 109 709  148 HOH HOH A . 
G 7 HOH 110 710  303 HOH HOH A . 
G 7 HOH 111 711  225 HOH HOH A . 
G 7 HOH 112 712  111 HOH HOH A . 
G 7 HOH 113 713  50  HOH HOH A . 
G 7 HOH 114 714  228 HOH HOH A . 
G 7 HOH 115 715  183 HOH HOH A . 
G 7 HOH 116 716  222 HOH HOH A . 
G 7 HOH 117 717  160 HOH HOH A . 
G 7 HOH 118 718  32  HOH HOH A . 
G 7 HOH 119 719  68  HOH HOH A . 
G 7 HOH 120 720  315 HOH HOH A . 
G 7 HOH 121 721  110 HOH HOH A . 
G 7 HOH 122 722  113 HOH HOH A . 
G 7 HOH 123 723  310 HOH HOH A . 
G 7 HOH 124 724  159 HOH HOH A . 
G 7 HOH 125 725  88  HOH HOH A . 
G 7 HOH 126 726  441 HOH HOH A . 
G 7 HOH 127 727  87  HOH HOH A . 
G 7 HOH 128 728  35  HOH HOH A . 
G 7 HOH 129 729  261 HOH HOH A . 
G 7 HOH 130 730  230 HOH HOH A . 
G 7 HOH 131 731  336 HOH HOH A . 
G 7 HOH 132 732  389 HOH HOH A . 
G 7 HOH 133 733  361 HOH HOH A . 
G 7 HOH 134 734  170 HOH HOH A . 
G 7 HOH 135 735  386 HOH HOH A . 
G 7 HOH 136 736  6   HOH HOH A . 
G 7 HOH 137 737  309 HOH HOH A . 
G 7 HOH 138 738  296 HOH HOH A . 
G 7 HOH 139 739  418 HOH HOH A . 
G 7 HOH 140 740  3   HOH HOH A . 
G 7 HOH 141 741  482 HOH HOH A . 
G 7 HOH 142 742  191 HOH HOH A . 
G 7 HOH 143 743  5   HOH HOH A . 
G 7 HOH 144 744  22  HOH HOH A . 
G 7 HOH 145 745  359 HOH HOH A . 
G 7 HOH 146 746  396 HOH HOH A . 
G 7 HOH 147 747  91  HOH HOH A . 
G 7 HOH 148 748  297 HOH HOH A . 
G 7 HOH 149 749  51  HOH HOH A . 
G 7 HOH 150 750  353 HOH HOH A . 
G 7 HOH 151 751  186 HOH HOH A . 
G 7 HOH 152 752  264 HOH HOH A . 
G 7 HOH 153 753  291 HOH HOH A . 
G 7 HOH 154 754  175 HOH HOH A . 
G 7 HOH 155 755  321 HOH HOH A . 
G 7 HOH 156 756  214 HOH HOH A . 
G 7 HOH 157 757  162 HOH HOH A . 
G 7 HOH 158 758  14  HOH HOH A . 
G 7 HOH 159 759  63  HOH HOH A . 
G 7 HOH 160 760  134 HOH HOH A . 
G 7 HOH 161 761  229 HOH HOH A . 
G 7 HOH 162 762  167 HOH HOH A . 
G 7 HOH 163 763  47  HOH HOH A . 
G 7 HOH 164 764  38  HOH HOH A . 
G 7 HOH 165 765  100 HOH HOH A . 
G 7 HOH 166 766  120 HOH HOH A . 
G 7 HOH 167 767  25  HOH HOH A . 
G 7 HOH 168 768  475 HOH HOH A . 
G 7 HOH 169 769  311 HOH HOH A . 
G 7 HOH 170 770  56  HOH HOH A . 
G 7 HOH 171 771  283 HOH HOH A . 
G 7 HOH 172 772  58  HOH HOH A . 
G 7 HOH 173 773  395 HOH HOH A . 
G 7 HOH 174 774  465 HOH HOH A . 
G 7 HOH 175 775  103 HOH HOH A . 
G 7 HOH 176 776  266 HOH HOH A . 
G 7 HOH 177 777  176 HOH HOH A . 
G 7 HOH 178 778  147 HOH HOH A . 
G 7 HOH 179 779  55  HOH HOH A . 
G 7 HOH 180 780  157 HOH HOH A . 
G 7 HOH 181 781  45  HOH HOH A . 
G 7 HOH 182 782  29  HOH HOH A . 
G 7 HOH 183 783  8   HOH HOH A . 
G 7 HOH 184 784  337 HOH HOH A . 
G 7 HOH 185 785  348 HOH HOH A . 
G 7 HOH 186 786  189 HOH HOH A . 
G 7 HOH 187 787  257 HOH HOH A . 
G 7 HOH 188 788  247 HOH HOH A . 
G 7 HOH 189 789  107 HOH HOH A . 
G 7 HOH 190 790  112 HOH HOH A . 
G 7 HOH 191 791  430 HOH HOH A . 
G 7 HOH 192 792  54  HOH HOH A . 
G 7 HOH 193 793  293 HOH HOH A . 
G 7 HOH 194 794  231 HOH HOH A . 
G 7 HOH 195 795  208 HOH HOH A . 
G 7 HOH 196 796  123 HOH HOH A . 
G 7 HOH 197 797  64  HOH HOH A . 
G 7 HOH 198 798  424 HOH HOH A . 
G 7 HOH 199 799  366 HOH HOH A . 
G 7 HOH 200 800  65  HOH HOH A . 
G 7 HOH 201 801  284 HOH HOH A . 
G 7 HOH 202 802  109 HOH HOH A . 
G 7 HOH 203 803  325 HOH HOH A . 
G 7 HOH 204 804  268 HOH HOH A . 
G 7 HOH 205 805  142 HOH HOH A . 
G 7 HOH 206 806  277 HOH HOH A . 
G 7 HOH 207 807  128 HOH HOH A . 
G 7 HOH 208 808  256 HOH HOH A . 
G 7 HOH 209 809  414 HOH HOH A . 
G 7 HOH 210 810  477 HOH HOH A . 
G 7 HOH 211 811  146 HOH HOH A . 
G 7 HOH 212 812  211 HOH HOH A . 
G 7 HOH 213 813  102 HOH HOH A . 
G 7 HOH 214 814  335 HOH HOH A . 
G 7 HOH 215 815  20  HOH HOH A . 
G 7 HOH 216 816  96  HOH HOH A . 
G 7 HOH 217 817  363 HOH HOH A . 
G 7 HOH 218 818  181 HOH HOH A . 
G 7 HOH 219 819  484 HOH HOH A . 
G 7 HOH 220 820  338 HOH HOH A . 
G 7 HOH 221 821  77  HOH HOH A . 
G 7 HOH 222 822  129 HOH HOH A . 
G 7 HOH 223 823  36  HOH HOH A . 
G 7 HOH 224 824  273 HOH HOH A . 
G 7 HOH 225 825  455 HOH HOH A . 
G 7 HOH 226 826  206 HOH HOH A . 
G 7 HOH 227 827  349 HOH HOH A . 
G 7 HOH 228 828  132 HOH HOH A . 
G 7 HOH 229 829  241 HOH HOH A . 
G 7 HOH 230 830  16  HOH HOH A . 
G 7 HOH 231 831  95  HOH HOH A . 
G 7 HOH 232 832  89  HOH HOH A . 
G 7 HOH 233 833  364 HOH HOH A . 
G 7 HOH 234 834  370 HOH HOH A . 
G 7 HOH 235 835  23  HOH HOH A . 
G 7 HOH 236 836  491 HOH HOH A . 
G 7 HOH 237 837  367 HOH HOH A . 
G 7 HOH 238 838  328 HOH HOH A . 
G 7 HOH 239 839  223 HOH HOH A . 
G 7 HOH 240 840  439 HOH HOH A . 
G 7 HOH 241 841  374 HOH HOH A . 
G 7 HOH 242 842  163 HOH HOH A . 
G 7 HOH 243 843  442 HOH HOH A . 
G 7 HOH 244 844  282 HOH HOH A . 
G 7 HOH 245 845  323 HOH HOH A . 
G 7 HOH 246 846  438 HOH HOH A . 
G 7 HOH 247 847  420 HOH HOH A . 
G 7 HOH 248 848  317 HOH HOH A . 
G 7 HOH 249 849  467 HOH HOH A . 
G 7 HOH 250 850  246 HOH HOH A . 
G 7 HOH 251 851  75  HOH HOH A . 
G 7 HOH 252 852  180 HOH HOH A . 
G 7 HOH 253 853  161 HOH HOH A . 
G 7 HOH 254 854  281 HOH HOH A . 
G 7 HOH 255 855  178 HOH HOH A . 
G 7 HOH 256 856  203 HOH HOH A . 
G 7 HOH 257 857  239 HOH HOH A . 
G 7 HOH 258 858  258 HOH HOH A . 
G 7 HOH 259 859  169 HOH HOH A . 
G 7 HOH 260 860  216 HOH HOH A . 
G 7 HOH 261 861  221 HOH HOH A . 
G 7 HOH 262 862  265 HOH HOH A . 
G 7 HOH 263 863  149 HOH HOH A . 
G 7 HOH 264 864  66  HOH HOH A . 
G 7 HOH 265 865  86  HOH HOH A . 
G 7 HOH 266 866  416 HOH HOH A . 
G 7 HOH 267 867  301 HOH HOH A . 
G 7 HOH 268 868  69  HOH HOH A . 
G 7 HOH 269 869  97  HOH HOH A . 
G 7 HOH 270 870  360 HOH HOH A . 
G 7 HOH 271 871  101 HOH HOH A . 
G 7 HOH 272 872  473 HOH HOH A . 
G 7 HOH 273 873  382 HOH HOH A . 
G 7 HOH 274 874  464 HOH HOH A . 
G 7 HOH 275 875  43  HOH HOH A . 
G 7 HOH 276 876  376 HOH HOH A . 
G 7 HOH 277 877  437 HOH HOH A . 
G 7 HOH 278 878  378 HOH HOH A . 
G 7 HOH 279 879  444 HOH HOH A . 
G 7 HOH 280 880  405 HOH HOH A . 
G 7 HOH 281 881  345 HOH HOH A . 
G 7 HOH 282 882  166 HOH HOH A . 
G 7 HOH 283 883  394 HOH HOH A . 
G 7 HOH 284 884  279 HOH HOH A . 
G 7 HOH 285 885  150 HOH HOH A . 
G 7 HOH 286 886  39  HOH HOH A . 
G 7 HOH 287 887  450 HOH HOH A . 
G 7 HOH 288 888  271 HOH HOH A . 
G 7 HOH 289 889  204 HOH HOH A . 
G 7 HOH 290 890  227 HOH HOH A . 
G 7 HOH 291 891  274 HOH HOH A . 
G 7 HOH 292 892  275 HOH HOH A . 
G 7 HOH 293 893  434 HOH HOH A . 
G 7 HOH 294 894  357 HOH HOH A . 
G 7 HOH 295 895  254 HOH HOH A . 
G 7 HOH 296 896  486 HOH HOH A . 
G 7 HOH 297 897  260 HOH HOH A . 
G 7 HOH 298 898  90  HOH HOH A . 
G 7 HOH 299 899  18  HOH HOH A . 
G 7 HOH 300 900  489 HOH HOH A . 
G 7 HOH 301 901  429 HOH HOH A . 
G 7 HOH 302 902  60  HOH HOH A . 
G 7 HOH 303 903  322 HOH HOH A . 
G 7 HOH 304 904  483 HOH HOH A . 
G 7 HOH 305 905  413 HOH HOH A . 
G 7 HOH 306 906  433 HOH HOH A . 
G 7 HOH 307 907  98  HOH HOH A . 
G 7 HOH 308 908  237 HOH HOH A . 
G 7 HOH 309 909  485 HOH HOH A . 
G 7 HOH 310 910  381 HOH HOH A . 
G 7 HOH 311 911  212 HOH HOH A . 
G 7 HOH 312 912  125 HOH HOH A . 
G 7 HOH 313 913  346 HOH HOH A . 
G 7 HOH 314 914  443 HOH HOH A . 
G 7 HOH 315 915  400 HOH HOH A . 
G 7 HOH 316 916  331 HOH HOH A . 
G 7 HOH 317 917  262 HOH HOH A . 
G 7 HOH 318 918  371 HOH HOH A . 
G 7 HOH 319 919  83  HOH HOH A . 
G 7 HOH 320 920  304 HOH HOH A . 
G 7 HOH 321 921  131 HOH HOH A . 
G 7 HOH 322 922  267 HOH HOH A . 
G 7 HOH 323 923  398 HOH HOH A . 
G 7 HOH 324 924  384 HOH HOH A . 
G 7 HOH 325 925  446 HOH HOH A . 
G 7 HOH 326 926  494 HOH HOH A . 
G 7 HOH 327 927  168 HOH HOH A . 
G 7 HOH 328 928  313 HOH HOH A . 
G 7 HOH 329 929  466 HOH HOH A . 
G 7 HOH 330 930  362 HOH HOH A . 
G 7 HOH 331 931  440 HOH HOH A . 
G 7 HOH 332 932  263 HOH HOH A . 
G 7 HOH 333 933  140 HOH HOH A . 
G 7 HOH 334 934  339 HOH HOH A . 
G 7 HOH 335 935  358 HOH HOH A . 
G 7 HOH 336 936  326 HOH HOH A . 
G 7 HOH 337 937  355 HOH HOH A . 
G 7 HOH 338 938  334 HOH HOH A . 
G 7 HOH 339 939  368 HOH HOH A . 
G 7 HOH 340 940  127 HOH HOH A . 
G 7 HOH 341 941  330 HOH HOH A . 
G 7 HOH 342 942  432 HOH HOH A . 
G 7 HOH 343 943  82  HOH HOH A . 
G 7 HOH 344 944  200 HOH HOH A . 
G 7 HOH 345 945  215 HOH HOH A . 
G 7 HOH 346 946  177 HOH HOH A . 
G 7 HOH 347 947  419 HOH HOH A . 
G 7 HOH 348 948  390 HOH HOH A . 
G 7 HOH 349 949  71  HOH HOH A . 
G 7 HOH 350 950  417 HOH HOH A . 
G 7 HOH 351 951  476 HOH HOH A . 
G 7 HOH 352 952  305 HOH HOH A . 
G 7 HOH 353 953  26  HOH HOH A . 
G 7 HOH 354 954  184 HOH HOH A . 
G 7 HOH 355 955  249 HOH HOH A . 
G 7 HOH 356 956  380 HOH HOH A . 
G 7 HOH 357 957  235 HOH HOH A . 
G 7 HOH 358 958  493 HOH HOH A . 
G 7 HOH 359 959  141 HOH HOH A . 
G 7 HOH 360 960  488 HOH HOH A . 
G 7 HOH 361 961  480 HOH HOH A . 
G 7 HOH 362 962  401 HOH HOH A . 
G 7 HOH 363 963  342 HOH HOH A . 
G 7 HOH 364 964  402 HOH HOH A . 
G 7 HOH 365 965  27  HOH HOH A . 
G 7 HOH 366 966  387 HOH HOH A . 
G 7 HOH 367 967  165 HOH HOH A . 
G 7 HOH 368 968  490 HOH HOH A . 
G 7 HOH 369 969  145 HOH HOH A . 
G 7 HOH 370 970  94  HOH HOH A . 
G 7 HOH 371 971  154 HOH HOH A . 
G 7 HOH 372 972  17  HOH HOH A . 
G 7 HOH 373 973  272 HOH HOH A . 
G 7 HOH 374 974  492 HOH HOH A . 
G 7 HOH 375 975  452 HOH HOH A . 
G 7 HOH 376 976  289 HOH HOH A . 
G 7 HOH 377 977  340 HOH HOH A . 
G 7 HOH 378 978  425 HOH HOH A . 
G 7 HOH 379 979  392 HOH HOH A . 
G 7 HOH 380 980  406 HOH HOH A . 
G 7 HOH 381 981  422 HOH HOH A . 
G 7 HOH 382 982  151 HOH HOH A . 
G 7 HOH 383 983  470 HOH HOH A . 
G 7 HOH 384 984  372 HOH HOH A . 
G 7 HOH 385 985  461 HOH HOH A . 
G 7 HOH 386 986  478 HOH HOH A . 
G 7 HOH 387 987  410 HOH HOH A . 
G 7 HOH 388 988  481 HOH HOH A . 
G 7 HOH 389 989  431 HOH HOH A . 
G 7 HOH 390 990  319 HOH HOH A . 
G 7 HOH 391 991  327 HOH HOH A . 
G 7 HOH 392 992  354 HOH HOH A . 
G 7 HOH 393 993  179 HOH HOH A . 
G 7 HOH 394 994  487 HOH HOH A . 
G 7 HOH 395 995  242 HOH HOH A . 
G 7 HOH 396 996  445 HOH HOH A . 
G 7 HOH 397 997  80  HOH HOH A . 
G 7 HOH 398 998  92  HOH HOH A . 
G 7 HOH 399 999  299 HOH HOH A . 
G 7 HOH 400 1000 426 HOH HOH A . 
G 7 HOH 401 1001 172 HOH HOH A . 
G 7 HOH 402 1002 240 HOH HOH A . 
G 7 HOH 403 1003 173 HOH HOH A . 
G 7 HOH 404 1004 74  HOH HOH A . 
G 7 HOH 405 1005 219 HOH HOH A . 
G 7 HOH 406 1006 412 HOH HOH A . 
G 7 HOH 407 1007 187 HOH HOH A . 
G 7 HOH 408 1008 423 HOH HOH A . 
G 7 HOH 409 1009 298 HOH HOH A . 
G 7 HOH 410 1010 67  HOH HOH A . 
G 7 HOH 411 1011 391 HOH HOH A . 
G 7 HOH 412 1012 294 HOH HOH A . 
G 7 HOH 413 1013 292 HOH HOH A . 
G 7 HOH 414 1014 393 HOH HOH A . 
G 7 HOH 415 1015 76  HOH HOH A . 
G 7 HOH 416 1016 205 HOH HOH A . 
G 7 HOH 417 1017 369 HOH HOH A . 
G 7 HOH 418 1018 207 HOH HOH A . 
G 7 HOH 419 1019 379 HOH HOH A . 
G 7 HOH 420 1020 314 HOH HOH A . 
G 7 HOH 421 1021 182 HOH HOH A . 
G 7 HOH 422 1022 232 HOH HOH A . 
G 7 HOH 423 1023 133 HOH HOH A . 
G 7 HOH 424 1024 295 HOH HOH A . 
G 7 HOH 425 1025 436 HOH HOH A . 
G 7 HOH 426 1026 226 HOH HOH A . 
G 7 HOH 427 1027 85  HOH HOH A . 
G 7 HOH 428 1028 463 HOH HOH A . 
G 7 HOH 429 1029 73  HOH HOH A . 
G 7 HOH 430 1030 213 HOH HOH A . 
G 7 HOH 431 1031 427 HOH HOH A . 
G 7 HOH 432 1032 164 HOH HOH A . 
G 7 HOH 433 1033 300 HOH HOH A . 
G 7 HOH 434 1034 84  HOH HOH A . 
G 7 HOH 435 1035 411 HOH HOH A . 
G 7 HOH 436 1036 217 HOH HOH A . 
G 7 HOH 437 1037 218 HOH HOH A . 
G 7 HOH 438 1038 449 HOH HOH A . 
G 7 HOH 439 1039 435 HOH HOH A . 
G 7 HOH 440 1040 286 HOH HOH A . 
G 7 HOH 441 1041 458 HOH HOH A . 
H 7 HOH 1   101  197 HOH HOH T . 
H 7 HOH 2   102  93  HOH HOH T . 
H 7 HOH 3   103  201 HOH HOH T . 
H 7 HOH 4   104  332 HOH HOH T . 
H 7 HOH 5   105  306 HOH HOH T . 
H 7 HOH 6   106  117 HOH HOH T . 
H 7 HOH 7   107  251 HOH HOH T . 
H 7 HOH 8   108  252 HOH HOH T . 
H 7 HOH 9   109  404 HOH HOH T . 
H 7 HOH 10  110  407 HOH HOH T . 
H 7 HOH 11  111  192 HOH HOH T . 
H 7 HOH 12  112  81  HOH HOH T . 
H 7 HOH 13  113  115 HOH HOH T . 
H 7 HOH 14  114  453 HOH HOH T . 
H 7 HOH 15  115  350 HOH HOH T . 
H 7 HOH 16  116  469 HOH HOH T . 
H 7 HOH 17  117  409 HOH HOH T . 
H 7 HOH 18  118  253 HOH HOH T . 
H 7 HOH 19  119  454 HOH HOH T . 
H 7 HOH 20  120  198 HOH HOH T . 
H 7 HOH 21  121  365 HOH HOH T . 
H 7 HOH 22  122  308 HOH HOH T . 
H 7 HOH 23  123  196 HOH HOH T . 
H 7 HOH 24  124  471 HOH HOH T . 
H 7 HOH 25  125  193 HOH HOH T . 
H 7 HOH 26  126  408 HOH HOH T . 
H 7 HOH 27  127  287 HOH HOH T . 
H 7 HOH 28  128  451 HOH HOH T . 
H 7 HOH 29  129  456 HOH HOH T . 
H 7 HOH 30  130  290 HOH HOH T . 
I 7 HOH 1   101  415 HOH HOH P . 
I 7 HOH 2   102  403 HOH HOH P . 
I 7 HOH 3   103  116 HOH HOH P . 
I 7 HOH 4   104  122 HOH HOH P . 
I 7 HOH 5   105  343 HOH HOH P . 
I 7 HOH 6   106  119 HOH HOH P . 
I 7 HOH 7   107  276 HOH HOH P . 
I 7 HOH 8   108  104 HOH HOH P . 
I 7 HOH 9   109  4   HOH HOH P . 
I 7 HOH 10  110  199 HOH HOH P . 
I 7 HOH 11  111  15  HOH HOH P . 
I 7 HOH 12  112  460 HOH HOH P . 
I 7 HOH 13  113  137 HOH HOH P . 
I 7 HOH 14  114  280 HOH HOH P . 
I 7 HOH 15  115  320 HOH HOH P . 
I 7 HOH 16  116  459 HOH HOH P . 
I 7 HOH 17  117  288 HOH HOH P . 
I 7 HOH 18  118  195 HOH HOH P . 
I 7 HOH 19  119  344 HOH HOH P . 
I 7 HOH 20  120  121 HOH HOH P . 
I 7 HOH 21  121  385 HOH HOH P . 
I 7 HOH 22  122  118 HOH HOH P . 
I 7 HOH 23  123  457 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5040  ? 
1 MORE         -37   ? 
1 'SSA (A^2)'  22040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O   ? A MET 17  ? A MET 14  ? 1_555 84.9  ? 
2  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 93.3  ? 
3  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 84.1  ? 
4  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G ? D DTP .   ? A DTP 501 ? 1_555 98.4  ? 
5  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G ? D DTP .   ? A DTP 501 ? 1_555 93.1  ? 
6  OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G ? D DTP .   ? A DTP 501 ? 1_555 167.7 ? 
7  OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? D DTP .   ? A DTP 501 ? 1_555 173.7 ? 
8  O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? D DTP .   ? A DTP 501 ? 1_555 94.5  ? 
9  OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? D DTP .   ? A DTP 501 ? 1_555 92.9  ? 
10 O1G ? D DTP .   ? A DTP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B ? D DTP .   ? A DTP 501 ? 1_555 75.4  ? 
11 OD1 ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? D DTP .   ? A DTP 501 ? 1_555 102.2 ? 
12 O   ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? D DTP .   ? A DTP 501 ? 1_555 171.7 ? 
13 OD1 ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? D DTP .   ? A DTP 501 ? 1_555 99.6  ? 
14 O1G ? D DTP .   ? A DTP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? D DTP .   ? A DTP 501 ? 1_555 81.7  ? 
15 O1B ? D DTP .   ? A DTP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A ? D DTP .   ? A DTP 501 ? 1_555 77.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-10 
2 'Structure model' 1 1 2018-04-18 
3 'Structure model' 1 2 2019-01-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
4 3 'Structure model' 'Data collection'      
5 3 'Structure model' 'Source and taxonomy'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' pdbx_prerelease_seq   
4 2 'Structure model' pdbx_struct_oper_list 
5 3 'Structure model' pdbx_entity_src_syn   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_ISSN'                 
2 2 'Structure model' '_citation.pdbx_database_id_PubMed'         
3 2 'Structure model' '_citation.title'                           
4 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
5 3 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id'     
6 3 'Structure model' '_pdbx_entity_src_syn.organism_scientific'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.8.0151 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 824 ? ? O A HOH 907 ? ? 2.18 
2 1 O A HOH 934 ? ? O A HOH 977 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     930 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     971 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_454 
_pdbx_validate_symm_contact.dist              2.02 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE    A ARG 256 ? ? CZ    A ARG 256 ? ? NH1 A ARG 256 ? ? 117.12 120.30 -3.18 0.50 N 
2 1 NE    A ARG 256 ? ? CZ    A ARG 256 ? ? NH2 A ARG 256 ? ? 123.90 120.30 3.60  0.50 N 
3 1 NE    A ARG 351 ? A CZ    A ARG 351 ? A NH2 A ARG 351 ? A 117.12 120.30 -3.18 0.50 N 
4 1 "C3'" T 5DB 4   ? ? "O3'" T 5DB 4   ? ? P   T DA  5   ? ? 146.97 119.70 27.27 1.20 Y 
5 1 "O5'" T DG  7   ? ? P     T DG  7   ? ? OP2 T DG  7   ? ? 98.54  105.70 -7.16 0.90 N 
6 1 "O5'" P DT  5   ? ? P     P DT  5   ? ? OP2 P DT  5   ? ? 100.18 105.70 -5.52 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 26.10   60.82   
2 1 TYR A 39  ? ? 66.89   72.47   
3 1 GLN A 179 ? ? -103.07 67.48   
4 1 SER A 217 ? ? -153.58 -157.28 
5 1 SER A 257 ? ? 99.66   -8.92   
6 1 ARG A 377 ? ? -9.81   124.60  
7 1 LYS A 428 ? ? 60.53   60.25   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    376 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ARG 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    377 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            138.80 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      T 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       130 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.22 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 T DA 2 ? P   ? B DA 2 P   
2 1 Y 1 T DA 2 ? OP1 ? B DA 2 OP1 
3 1 Y 1 T DA 2 ? OP2 ? B DA 2 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
6 1 Y 1 T DC  1   ? B DC  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5DLF 'double helix'        
5DLF 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 -0.065 -0.127 -0.213 -3.995 -5.316  2.437  1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.174 -0.042 0.205  -3.819 -11.301 0.306  2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.193 -0.141 -0.378 -8.600 -3.606  -0.849 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.032  -0.194 0.021  3.541  -3.820  -1.241 4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.354  -0.072 -0.391 9.973  -3.324  2.982  5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.333 -0.157 -0.250 -2.266 -5.523  1.897  6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.110  -0.111 0.170  -2.730 -4.183  -1.676 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.085 -0.220 -0.233 17.890 -0.096  3.753  8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.890  -1.288 3.385 -3.088 -0.669 28.900 -2.416 -2.467 3.302 -1.336 6.163 
29.069 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.191 -1.170 3.419 5.881  9.611  29.693 -3.889 1.419  2.825 17.961 
-10.990 31.714 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.573 -0.493 3.203 -1.624 0.680  34.138 -0.944 0.723  3.216 1.158  2.765 
34.182 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.527  -0.731 3.277 2.972  2.651  30.800 -1.874 -0.415 3.240 4.965  -5.566 
31.050 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.511 -0.558 3.744 -4.361 4.729  35.295 -1.681 0.115  3.676 7.721  7.120 
35.858 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.581 -0.645 3.485 -3.228 0.552  34.965 -1.157 0.446  3.513 0.917  5.357 
35.113 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.319  -0.062 2.953 -0.547 1.172  27.842 -0.382 -0.781 2.941 2.434  1.137 
27.872 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 water                               HOH 
#