data_5DLG
# 
_entry.id   5DLG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DLG         
WWPDB D_1000213380 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'Crystal Structure of Human DNA Polymerase Eta Inserting dATP Opposite O4-Methylhymidine' 
_pdbx_database_related.db_id          5DLF 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DLG 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Patra, A.'       1 
'OFlaherty, D.K.' 2 
'Egli, M.'        3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem Sci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-6520 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                4896 
_citation.page_last                 4904 
_citation.title                     'Lesion Orientation ofO4-Alkylthymidine Influences Replication by Human DNA Polymeraseeta.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1039/C6SC00666C 
_citation.pdbx_database_id_PubMed   27574558 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 
;O'Flaherty, D.K.
;
1 ? 
primary 'Patra, A.'        2 ? 
primary 'Su, Y.'           3 ? 
primary 'Guengerich, F.P.' 4 ? 
primary 'Egli, M.'         5 ? 
primary 'Wilds, C.J.'      6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5DLG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     98.656 
_cell.length_a_esd                 ? 
_cell.length_b                     98.656 
_cell.length_b_esd                 ? 
_cell.length_c                     82.131 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5DLG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                                                         48617.707 1   
2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*CP*AP*TP*(5DB)P*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3651.418  1   ?       ? ? ? 
4 non-polymer syn GLYCEROL                                                                                     92.094    1   ? ? ? 
? 
5 non-polymer syn 'MAGNESIUM ION'                                                                              24.305    2   ? ? ? 
? 
6 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]guanosine" 506.196   1   ? ? ? 
? 
7 water       nat water                                                                                        18.015    222 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no  '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
3 polydeoxyribonucleotide no yes '(DC)(DA)(DT)(5DB)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATXATGACGCT T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DA  n 
2 2   DG  n 
2 3   DC  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
3 1   DC  n 
3 2   DA  n 
3 3   DT  n 
3 4   5DB n 
3 5   DA  n 
3 6   DT  n 
3 7   DG  n 
3 8   DA  n 
3 9   DC  n 
3 10  DG  n 
3 11  DC  n 
3 12  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 8  'synthetic construct' ? 32630 'Chemically Synthesized' 
3 1 sample 1 12 'synthetic construct' ? 32630 'Chemically Synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5DLG       5DLG   ? 2 ? 1 
3 PDB 5DLG       5DLG   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DLG A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5DLG P 1 ? 8   ? 5DLG   1 ? 8   ? 1 8   
3 3 5DLG T 1 ? 12  ? 5DLG   1 ? 12  ? 1 12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DLG GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5DLG PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5DLG HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5DB 'DNA linking'       . '1-(2-deoxy-5-O-phosphono-beta-D-erythro-pentofuranosyl)-4-methoxy-5-methylpyrimidin-2(1H)-one' ? 
'C11 H17 N2 O8 P'   336.235 
ALA 'L-peptide linking' y ALANINE                                                                                         ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                        ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                      ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                 ? 
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                        ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                            ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                             ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                            ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                    ? 
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                       ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                 ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                         ? 
'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                                                                        
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                       ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                           ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                      ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                         ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                          ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                      ? 
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                                 ? 'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                   ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                         ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                          ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                       ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                      ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                        ? 
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                                          ? 
'C5 H11 N O2'       117.146 
XG4 non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]guanosine"    ? 
'C10 H17 N6 O12 P3' 506.196 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DLG 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         41.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M MES pH 5.5, 5mM magnesium chloride, 20% PEG 2000 MME' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-08-15 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'C(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DLG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.35 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       18606 
_reflns.number_obs                       18606 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       0 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             97.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.2 
_reflns.pdbx_Rmerge_I_obs                0.127 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.127 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.457 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.35 
_reflns_shell.d_res_low                   2.39 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.941 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        96.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.941 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5DLG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.351 
_refine.ls_d_res_low                             37.899 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18587 
_refine.ls_number_reflns_R_free                  880 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.92 
_refine.ls_percent_reflns_R_free                 4.73 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1754 
_refine.ls_R_factor_R_free                       0.2475 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1718 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4O3N 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.46 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.33 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   387 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             222 
_refine_hist.number_atoms_total               4014 
_refine_hist.d_res_high                       2.351 
_refine_hist.d_res_low                        37.899 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 3895 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.147  ? 5344 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.254 ? 1500 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.041  ? 596  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 620  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3513 2.4986  . . 130 2892 97.00  . . . 0.3019 . 0.2388 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4986 2.6915  . . 143 2893 96.00  . . . 0.3325 . 0.2373 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6915 2.9623  . . 169 2866 96.00  . . . 0.3035 . 0.2087 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9623 3.3907  . . 150 2979 99.00  . . . 0.2645 . 0.1717 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3907 4.2710  . . 144 3020 100.00 . . . 0.2118 . 0.1365 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2710 37.9041 . . 144 3057 100.00 . . . 0.2057 . 0.1537 . . . . . . . . . . 
# 
_struct.entry_id                     5DLG 
_struct.title                        'Crystal Structure of Human DNA Polymerase Eta Inserting dGMPNPP Opposite O4-Methylhymidine' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DLG 
_struct_keywords.text            
;Catalytic Domain, DNA Damage, DNA-Directed DNA Polymerase, Guanosine Triphosphate, Y-family polymerase, trans-lesion synthesis (TLS), DNA Binding, O4-Alkylthymidine, O4-Methylthymidine, Transferase-DNA complex
;
_struct_keywords.pdbx_keywords   Transferase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  AA6 LEU A 124 ? LEU A 135 ? LEU A 121 LEU A 132 1 ? 12 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 AB2 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 AB3 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 AB4 PRO A 254 ? ILE A 258 ? PRO A 251 ILE A 255 5 ? 5  
HELX_P HELX_P14 AB5 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 AB6 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 AB7 THR A 285 ? CYS A 305 ? THR A 282 CYS A 302 1 ? 21 
HELX_P HELX_P17 AB8 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P18 AB9 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P19 AC1 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P20 AC2 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASP 16  OD1   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 13  A MG  502 1_555 ? ? ? ? ? ? ?            1.938 ? 
metalc2  metalc ?    ? A ASP 16  OD2   ? ? ? 1_555 F MG  .  MG  ? ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.215 ? 
metalc3  metalc ?    ? A MET 17  O     ? ? ? 1_555 E MG  .  MG  ? ? A MET 14  A MG  502 1_555 ? ? ? ? ? ? ?            2.173 ? 
metalc4  metalc ?    ? A ASP 118 OD1   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 115 A MG  502 1_555 ? ? ? ? ? ? ?            2.965 ? 
metalc5  metalc ?    ? A ASP 118 OD2   ? ? ? 1_555 E MG  .  MG  ? ? A ASP 115 A MG  502 1_555 ? ? ? ? ? ? ?            2.071 ? 
metalc6  metalc ?    ? A GLU 119 OE2   ? ? ? 1_555 F MG  .  MG  ? ? A GLU 116 A MG  503 1_555 ? ? ? ? ? ? ?            1.917 ? 
metalc7  metalc ?    ? B DT  8   "O3'" ? ? ? 1_555 F MG  .  MG  ? ? P DT  8   A MG  503 1_555 ? ? ? ? ? ? ?            2.490 ? 
covale1  covale both ? C DT  3   "O3'" ? ? ? 1_555 C 5DB 4  P   ? ? T DT  3   T 5DB 4   1_555 ? ? ? ? ? ? ?            1.605 ? 
covale2  covale one  ? C 5DB 4   "O3'" ? ? ? 1_555 C DA  5  P   ? ? T 5DB 4   T DA  5   1_555 ? ? ? ? ? ? ?            1.594 ? 
metalc8  metalc ?    ? E MG  .   MG    ? ? ? 1_555 G XG4 .  O1A ? ? A MG  502 A XG4 504 1_555 ? ? ? ? ? ? ?            2.285 ? 
metalc9  metalc ?    ? E MG  .   MG    ? ? ? 1_555 G XG4 .  O1B ? ? A MG  502 A XG4 504 1_555 ? ? ? ? ? ? ?            2.195 ? 
metalc10 metalc ?    ? E MG  .   MG    ? ? ? 1_555 G XG4 .  O1G ? ? A MG  502 A XG4 504 1_555 ? ? ? ? ? ? ?            2.150 ? 
metalc11 metalc ?    ? F MG  .   MG    ? ? ? 1_555 G XG4 .  O1A ? ? A MG  503 A XG4 504 1_555 ? ? ? ? ? ? ?            2.540 ? 
metalc12 metalc ?    ? F MG  .   MG    ? ? ? 1_555 H HOH .  O   ? ? A MG  503 A HOH 641 1_555 ? ? ? ? ? ? ?            2.091 ? 
hydrog1  hydrog ?    ? B DA  1   N1    ? ? ? 1_555 C DT  12 N3  ? ? P DA  1   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DA  1   N6    ? ? ? 1_555 C DT  12 O4  ? ? P DA  1   T DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DG  2   N1    ? ? ? 1_555 C DC  11 N3  ? ? P DG  2   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DG  2   N2    ? ? ? 1_555 C DC  11 O2  ? ? P DG  2   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DG  2   O6    ? ? ? 1_555 C DC  11 N4  ? ? P DG  2   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DC  3   N3    ? ? ? 1_555 C DG  10 N1  ? ? P DC  3   T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DC  3   N4    ? ? ? 1_555 C DG  10 O6  ? ? P DC  3   T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DC  3   O2    ? ? ? 1_555 C DG  10 N2  ? ? P DC  3   T DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DG  4   N1    ? ? ? 1_555 C DC  9  N3  ? ? P DG  4   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DG  4   N2    ? ? ? 1_555 C DC  9  O2  ? ? P DG  4   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DG  4   O6    ? ? ? 1_555 C DC  9  N4  ? ? P DG  4   T DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DT  5   N3    ? ? ? 1_555 C DA  8  N1  ? ? P DT  5   T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DT  5   O4    ? ? ? 1_555 C DA  8  N6  ? ? P DT  5   T DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DC  6   N3    ? ? ? 1_555 C DG  7  N1  ? ? P DC  6   T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DC  6   N4    ? ? ? 1_555 C DG  7  O6  ? ? P DC  6   T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DC  6   O2    ? ? ? 1_555 C DG  7  N2  ? ? P DC  6   T DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DA  7   N1    ? ? ? 1_555 C DT  6  N3  ? ? P DA  7   T DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DA  7   N6    ? ? ? 1_555 C DT  6  O4  ? ? P DA  7   T DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DT  8   N3    ? ? ? 1_555 C DA  5  N1  ? ? P DT  8   T DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DT  8   O4    ? ? ? 1_555 C DA  5  N6  ? ? P DT  8   T DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.61  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -1.46 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -6.57 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? ARG A 114 ? ILE A 109 ARG A 111 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
AA1 3 4 N ASP A 16  ? N ASP A 13  O SER A 216 ? O SER A 213 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N CYS A 324 ? N CYS A 321 O LEU A 427 ? O LEU A 424 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N CYS A 324 ? N CYS A 321 O LEU A 427 ? O LEU A 424 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 501 ? 9  'binding site for residue GOL A 501' 
AC2 Software A MG  502 ? 5  'binding site for residue MG A 502'  
AC3 Software A MG  503 ? 8  'binding site for residue MG A 503'  
AC4 Software A XG4 504 ? 24 'binding site for residue XG4 A 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  ARG A 27  ? ARG A 24  . ? 6_555 ? 
2  AC1 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
3  AC1 9  PHE A 250 ? PHE A 247 . ? 1_555 ? 
4  AC1 9  SER A 251 ? SER A 248 . ? 1_555 ? 
5  AC1 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
6  AC1 9  GLU A 280 ? GLU A 277 . ? 1_555 ? 
7  AC1 9  HOH H .   ? HOH A 610 . ? 1_555 ? 
8  AC1 9  HOH H .   ? HOH A 627 . ? 1_555 ? 
9  AC1 9  HOH H .   ? HOH A 655 . ? 1_555 ? 
10 AC2 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
11 AC2 5  MET A 17  ? MET A 14  . ? 1_555 ? 
12 AC2 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
13 AC2 5  MG  F .   ? MG  A 503 . ? 1_555 ? 
14 AC2 5  XG4 G .   ? XG4 A 504 . ? 1_555 ? 
15 AC3 8  ASP A 16  ? ASP A 13  . ? 1_555 ? 
16 AC3 8  SER A 116 ? SER A 113 . ? 1_555 ? 
17 AC3 8  ASP A 118 ? ASP A 115 . ? 1_555 ? 
18 AC3 8  GLU A 119 ? GLU A 116 . ? 1_555 ? 
19 AC3 8  MG  E .   ? MG  A 502 . ? 1_555 ? 
20 AC3 8  XG4 G .   ? XG4 A 504 . ? 1_555 ? 
21 AC3 8  HOH H .   ? HOH A 641 . ? 1_555 ? 
22 AC3 8  DT  B 8   ? DT  P 8   . ? 1_555 ? 
23 AC4 24 ASP A 16  ? ASP A 13  . ? 1_555 ? 
24 AC4 24 MET A 17  ? MET A 14  . ? 1_555 ? 
25 AC4 24 ASP A 18  ? ASP A 15  . ? 1_555 ? 
26 AC4 24 CYS A 19  ? CYS A 16  . ? 1_555 ? 
27 AC4 24 PHE A 20  ? PHE A 17  . ? 1_555 ? 
28 AC4 24 PHE A 21  ? PHE A 18  . ? 1_555 ? 
29 AC4 24 GLN A 41  ? GLN A 38  . ? 1_555 ? 
30 AC4 24 ILE A 51  ? ILE A 48  . ? 1_555 ? 
31 AC4 24 TYR A 55  ? TYR A 52  . ? 1_555 ? 
32 AC4 24 ARG A 58  ? ARG A 55  . ? 1_555 ? 
33 AC4 24 ARG A 64  ? ARG A 61  . ? 1_555 ? 
34 AC4 24 ASP A 118 ? ASP A 115 . ? 1_555 ? 
35 AC4 24 LYS A 234 ? LYS A 231 . ? 1_555 ? 
36 AC4 24 MG  E .   ? MG  A 502 . ? 1_555 ? 
37 AC4 24 MG  F .   ? MG  A 503 . ? 1_555 ? 
38 AC4 24 HOH H .   ? HOH A 638 . ? 1_555 ? 
39 AC4 24 HOH H .   ? HOH A 641 . ? 1_555 ? 
40 AC4 24 HOH H .   ? HOH A 645 . ? 1_555 ? 
41 AC4 24 HOH H .   ? HOH A 648 . ? 1_555 ? 
42 AC4 24 HOH H .   ? HOH A 680 . ? 1_555 ? 
43 AC4 24 HOH H .   ? HOH A 683 . ? 1_555 ? 
44 AC4 24 HOH H .   ? HOH A 693 . ? 1_555 ? 
45 AC4 24 DT  B 8   ? DT  P 8   . ? 1_555 ? 
46 AC4 24 DA  C 5   ? DA  T 5   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DLG 
_atom_sites.fract_transf_matrix[1][1]   0.010136 
_atom_sites.fract_transf_matrix[1][2]   0.005852 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011704 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012176 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 44.586 -11.367 7.841   1.00 61.83 ? -2  GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 44.967 -10.526 6.717   1.00 61.86 ? -2  GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 43.910 -10.462 5.629   1.00 61.36 ? -2  GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 42.795 -10.949 5.810   1.00 62.99 ? -2  GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 44.256 -9.850  4.486   1.00 65.35 ? -1  PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 43.356 -9.735  3.333   1.00 62.23 ? -1  PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 43.501 -10.889 2.336   1.00 65.31 ? -1  PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 42.638 -11.075 1.471   1.00 66.20 ? -1  PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 43.786 -8.414  2.700   1.00 63.14 ? -1  PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 45.255 -8.341  2.987   1.00 62.37 ? -1  PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 45.491 -9.065  4.298   1.00 64.39 ? -1  PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 44.583 -11.654 2.460   1.00 65.81 ? 0   HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 44.846 -12.778 1.560   1.00 65.15 ? 0   HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 44.602 -14.132 2.237   1.00 66.38 ? 0   HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 44.743 -15.176 1.599   1.00 63.92 ? 0   HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 46.286 -12.713 1.030   1.00 59.29 ? 0   HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 46.599 -11.451 0.288   1.00 53.54 ? 0   HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 46.020 -11.137 -0.925  1.00 56.50 ? 0   HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 47.419 -10.419 0.592   1.00 52.33 ? 0   HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 46.474 -9.965  -1.337  1.00 54.92 ? 0   HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 47.324 -9.508  -0.435  1.00 53.34 ? 0   HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 44.232 -14.105 3.520   1.00 70.57 ? 1   MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 44.007 -15.327 4.304   1.00 68.37 ? 1   MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 42.541 -15.802 4.241   1.00 65.30 ? 1   MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 41.611 -15.056 4.571   1.00 63.63 ? 1   MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 44.436 -15.103 5.762   1.00 64.68 ? 1   MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 45.364 -16.189 6.326   1.00 69.50 ? 1   MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 46.401 -15.633 7.707   1.00 81.10 ? 1   MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 45.152 -15.082 8.872   1.00 70.29 ? 1   MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 42.351 -17.050 3.812   1.00 60.25 ? 2   ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 41.022 -17.628 3.607   1.00 53.38 ? 2   ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 40.314 -17.936 4.923   1.00 51.65 ? 2   ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 40.926 -18.453 5.858   1.00 49.95 ? 2   ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 41.132 -18.877 2.778   1.00 60.67 ? 2   ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 39.021 -17.628 4.987   1.00 48.65 ? 3   THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 38.263 -17.785 6.227   1.00 39.24 ? 3   THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 37.321 -18.980 6.184   1.00 41.83 ? 3   THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 36.591 -19.251 7.158   1.00 37.76 ? 3   THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 37.436 -16.520 6.553   1.00 39.06 ? 3   THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 36.681 -16.098 5.402   1.00 38.08 ? 3   THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 38.357 -15.389 7.012   1.00 43.96 ? 3   THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 37.330 -19.682 5.051   1.00 39.42 ? 4   GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 36.435 -20.807 4.854   1.00 37.62 ? 4   GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 34.976 -20.423 5.010   1.00 32.04 ? 4   GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 34.236 -21.074 5.743   1.00 26.81 ? 4   GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 34.569 -19.359 4.320   1.00 32.87 ? 5   GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 33.174 -18.917 4.343   1.00 30.37 ? 5   GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 32.526 -18.957 2.956   1.00 29.11 ? 5   GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 31.512 -18.312 2.705   1.00 29.73 ? 5   GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 33.085 -17.512 4.921   1.00 28.93 ? 5   GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 33.436 -17.440 6.398   1.00 31.80 ? 5   GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 33.454 -16.014 6.915   1.00 30.09 ? 5   GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 34.338 -15.237 6.563   1.00 37.28 ? 5   GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 32.471 -15.657 7.738   1.00 29.84 ? 5   GLN A NE2   1 
ATOM   55   N  N     . ASP A 1 9   ? 33.114 -19.740 2.065   1.00 31.77 ? 6   ASP A N     1 
ATOM   56   C  CA    . ASP A 1 9   ? 32.691 -19.782 0.671   1.00 30.59 ? 6   ASP A CA    1 
ATOM   57   C  C     . ASP A 1 9   ? 31.429 -20.623 0.399   1.00 34.00 ? 6   ASP A C     1 
ATOM   58   O  O     . ASP A 1 9   ? 30.769 -20.427 -0.617  1.00 38.16 ? 6   ASP A O     1 
ATOM   59   C  CB    . ASP A 1 9   ? 33.854 -20.295 -0.190  1.00 28.83 ? 6   ASP A CB    1 
ATOM   60   C  CG    . ASP A 1 9   ? 34.587 -21.496 0.447   1.00 42.37 ? 6   ASP A CG    1 
ATOM   61   O  OD1   . ASP A 1 9   ? 34.470 -21.725 1.677   1.00 37.33 ? 6   ASP A OD1   1 
ATOM   62   O  OD2   . ASP A 1 9   ? 35.298 -22.216 -0.294  1.00 52.41 ? 6   ASP A OD2   1 
ATOM   63   N  N     . ARG A 1 10  ? 31.093 -21.548 1.295   1.00 30.31 ? 7   ARG A N     1 
ATOM   64   C  CA    . ARG A 1 10  ? 29.959 -22.440 1.082   1.00 30.44 ? 7   ARG A CA    1 
ATOM   65   C  C     . ARG A 1 10  ? 28.896 -22.330 2.156   1.00 28.11 ? 7   ARG A C     1 
ATOM   66   O  O     . ARG A 1 10  ? 29.180 -21.899 3.270   1.00 26.30 ? 7   ARG A O     1 
ATOM   67   C  CB    . ARG A 1 10  ? 30.422 -23.890 1.030   1.00 27.37 ? 7   ARG A CB    1 
ATOM   68   C  CG    . ARG A 1 10  ? 31.366 -24.210 -0.080  1.00 28.24 ? 7   ARG A CG    1 
ATOM   69   C  CD    . ARG A 1 10  ? 31.762 -25.668 0.039   1.00 33.88 ? 7   ARG A CD    1 
ATOM   70   N  NE    . ARG A 1 10  ? 32.670 -25.903 1.160   1.00 28.66 ? 7   ARG A NE    1 
ATOM   71   C  CZ    . ARG A 1 10  ? 32.737 -27.031 1.859   1.00 28.50 ? 7   ARG A CZ    1 
ATOM   72   N  NH1   . ARG A 1 10  ? 33.604 -27.133 2.861   1.00 22.23 ? 7   ARG A NH1   1 
ATOM   73   N  NH2   . ARG A 1 10  ? 31.930 -28.051 1.561   1.00 29.83 ? 7   ARG A NH2   1 
ATOM   74   N  N     . VAL A 1 11  ? 27.673 -22.744 1.827   1.00 27.54 ? 8   VAL A N     1 
ATOM   75   C  CA    . VAL A 1 11  ? 26.665 -22.951 2.856   1.00 23.17 ? 8   VAL A CA    1 
ATOM   76   C  C     . VAL A 1 11  ? 26.282 -24.418 2.847   1.00 26.56 ? 8   VAL A C     1 
ATOM   77   O  O     . VAL A 1 11  ? 25.773 -24.941 1.862   1.00 25.39 ? 8   VAL A O     1 
ATOM   78   C  CB    . VAL A 1 11  ? 25.423 -22.081 2.663   1.00 26.91 ? 8   VAL A CB    1 
ATOM   79   C  CG1   . VAL A 1 11  ? 24.406 -22.379 3.740   1.00 22.38 ? 8   VAL A CG1   1 
ATOM   80   C  CG2   . VAL A 1 11  ? 25.794 -20.589 2.661   1.00 27.59 ? 8   VAL A CG2   1 
ATOM   81   N  N     . VAL A 1 12  ? 26.548 -25.069 3.972   1.00 29.01 ? 9   VAL A N     1 
ATOM   82   C  CA    . VAL A 1 12  ? 26.438 -26.505 4.106   1.00 23.61 ? 9   VAL A CA    1 
ATOM   83   C  C     . VAL A 1 12  ? 25.581 -26.847 5.306   1.00 24.47 ? 9   VAL A C     1 
ATOM   84   O  O     . VAL A 1 12  ? 25.750 -26.276 6.394   1.00 23.82 ? 9   VAL A O     1 
ATOM   85   C  CB    . VAL A 1 12  ? 27.822 -27.144 4.263   1.00 23.79 ? 9   VAL A CB    1 
ATOM   86   C  CG1   . VAL A 1 12  ? 27.710 -28.657 4.518   1.00 25.06 ? 9   VAL A CG1   1 
ATOM   87   C  CG2   . VAL A 1 12  ? 28.669 -26.835 3.052   1.00 24.91 ? 9   VAL A CG2   1 
ATOM   88   N  N     . ALA A 1 13  ? 24.654 -27.776 5.109   1.00 24.37 ? 10  ALA A N     1 
ATOM   89   C  CA    . ALA A 1 13  ? 23.786 -28.204 6.187   1.00 23.39 ? 10  ALA A CA    1 
ATOM   90   C  C     . ALA A 1 13  ? 23.902 -29.699 6.379   1.00 21.23 ? 10  ALA A C     1 
ATOM   91   O  O     . ALA A 1 13  ? 24.195 -30.422 5.448   1.00 22.61 ? 10  ALA A O     1 
ATOM   92   C  CB    . ALA A 1 13  ? 22.345 -27.796 5.906   1.00 21.02 ? 10  ALA A CB    1 
ATOM   93   N  N     . LEU A 1 14  ? 23.700 -30.156 7.604   1.00 26.28 ? 11  LEU A N     1 
ATOM   94   C  CA    . LEU A 1 14  ? 23.563 -31.581 7.873   1.00 23.47 ? 11  LEU A CA    1 
ATOM   95   C  C     . LEU A 1 14  ? 22.204 -31.773 8.524   1.00 26.49 ? 11  LEU A C     1 
ATOM   96   O  O     . LEU A 1 14  ? 21.908 -31.149 9.547   1.00 25.70 ? 11  LEU A O     1 
ATOM   97   C  CB    . LEU A 1 14  ? 24.695 -32.098 8.764   1.00 23.03 ? 11  LEU A CB    1 
ATOM   98   C  CG    . LEU A 1 14  ? 24.722 -33.568 9.212   1.00 27.56 ? 11  LEU A CG    1 
ATOM   99   C  CD1   . LEU A 1 14  ? 23.826 -33.785 10.424  1.00 24.63 ? 11  LEU A CD1   1 
ATOM   100  C  CD2   . LEU A 1 14  ? 24.337 -34.550 8.066   1.00 25.63 ? 11  LEU A CD2   1 
ATOM   101  N  N     . VAL A 1 15  ? 21.374 -32.616 7.920   1.00 22.96 ? 12  VAL A N     1 
ATOM   102  C  CA    . VAL A 1 15  ? 20.087 -32.949 8.497   1.00 23.27 ? 12  VAL A CA    1 
ATOM   103  C  C     . VAL A 1 15  ? 20.097 -34.369 9.078   1.00 25.72 ? 12  VAL A C     1 
ATOM   104  O  O     . VAL A 1 15  ? 20.417 -35.329 8.393   1.00 22.02 ? 12  VAL A O     1 
ATOM   105  C  CB    . VAL A 1 15  ? 18.966 -32.841 7.470   1.00 21.52 ? 12  VAL A CB    1 
ATOM   106  C  CG1   . VAL A 1 15  ? 17.650 -33.235 8.099   1.00 23.90 ? 12  VAL A CG1   1 
ATOM   107  C  CG2   . VAL A 1 15  ? 18.882 -31.425 6.939   1.00 24.73 ? 12  VAL A CG2   1 
ATOM   108  N  N     . ASP A 1 16  ? 19.729 -34.495 10.345  1.00 22.05 ? 13  ASP A N     1 
ATOM   109  C  CA    . ASP A 1 16  ? 19.706 -35.788 10.985  1.00 24.68 ? 13  ASP A CA    1 
ATOM   110  C  C     . ASP A 1 16  ? 18.351 -36.059 11.641  1.00 23.13 ? 13  ASP A C     1 
ATOM   111  O  O     . ASP A 1 16  ? 17.862 -35.244 12.407  1.00 22.49 ? 13  ASP A O     1 
ATOM   112  C  CB    . ASP A 1 16  ? 20.826 -35.860 12.013  1.00 26.48 ? 13  ASP A CB    1 
ATOM   113  C  CG    . ASP A 1 16  ? 20.996 -37.238 12.581  1.00 28.14 ? 13  ASP A CG    1 
ATOM   114  O  OD1   . ASP A 1 16  ? 20.208 -37.595 13.477  1.00 29.20 ? 13  ASP A OD1   1 
ATOM   115  O  OD2   . ASP A 1 16  ? 21.907 -37.972 12.124  1.00 30.67 ? 13  ASP A OD2   1 
ATOM   116  N  N     . MET A 1 17  ? 17.750 -37.208 11.341  1.00 28.16 ? 14  MET A N     1 
ATOM   117  C  CA    . MET A 1 17  ? 16.433 -37.583 11.894  1.00 26.22 ? 14  MET A CA    1 
ATOM   118  C  C     . MET A 1 17  ? 16.478 -37.843 13.396  1.00 21.02 ? 14  MET A C     1 
ATOM   119  O  O     . MET A 1 17  ? 17.369 -38.507 13.880  1.00 22.55 ? 14  MET A O     1 
ATOM   120  C  CB    . MET A 1 17  ? 15.881 -38.829 11.191  1.00 25.03 ? 14  MET A CB    1 
ATOM   121  C  CG    . MET A 1 17  ? 15.963 -38.776 9.677   1.00 25.21 ? 14  MET A CG    1 
ATOM   122  S  SD    . MET A 1 17  ? 15.127 -37.342 8.975   1.00 25.03 ? 14  MET A SD    1 
ATOM   123  C  CE    . MET A 1 17  ? 13.455 -37.640 9.473   1.00 24.22 ? 14  MET A CE    1 
ATOM   124  N  N     . ASP A 1 18  ? 15.521 -37.294 14.125  1.00 21.72 ? 15  ASP A N     1 
ATOM   125  C  CA    . ASP A 1 18  ? 15.442 -37.534 15.560  1.00 21.63 ? 15  ASP A CA    1 
ATOM   126  C  C     . ASP A 1 18  ? 15.052 -38.983 15.838  1.00 22.32 ? 15  ASP A C     1 
ATOM   127  O  O     . ASP A 1 18  ? 14.078 -39.477 15.257  1.00 22.72 ? 15  ASP A O     1 
ATOM   128  C  CB    . ASP A 1 18  ? 14.439 -36.580 16.200  1.00 22.07 ? 15  ASP A CB    1 
ATOM   129  C  CG    . ASP A 1 18  ? 14.835 -35.123 16.044  1.00 22.85 ? 15  ASP A CG    1 
ATOM   130  O  OD1   . ASP A 1 18  ? 16.041 -34.853 15.898  1.00 20.45 ? 15  ASP A OD1   1 
ATOM   131  O  OD2   . ASP A 1 18  ? 13.940 -34.249 16.076  1.00 21.87 ? 15  ASP A OD2   1 
ATOM   132  N  N     . CYS A 1 19  ? 15.802 -39.644 16.726  1.00 21.36 ? 16  CYS A N     1 
ATOM   133  C  CA    . CYS A 1 19  ? 15.608 -41.067 17.083  1.00 23.16 ? 16  CYS A CA    1 
ATOM   134  C  C     . CYS A 1 19  ? 14.919 -41.886 15.972  1.00 22.59 ? 16  CYS A C     1 
ATOM   135  O  O     . CYS A 1 19  ? 13.831 -42.412 16.157  1.00 22.19 ? 16  CYS A O     1 
ATOM   136  C  CB    . CYS A 1 19  ? 14.824 -41.187 18.405  1.00 20.95 ? 16  CYS A CB    1 
ATOM   137  S  SG    . CYS A 1 19  ? 13.245 -40.287 18.511  1.00 24.07 ? 16  CYS A SG    1 
ATOM   138  N  N     . PHE A 1 20  ? 15.567 -41.958 14.814  1.00 24.02 ? 17  PHE A N     1 
ATOM   139  C  CA    . PHE A 1 20  ? 14.929 -42.379 13.567  1.00 22.92 ? 17  PHE A CA    1 
ATOM   140  C  C     . PHE A 1 20  ? 14.163 -43.728 13.611  1.00 23.74 ? 17  PHE A C     1 
ATOM   141  O  O     . PHE A 1 20  ? 12.970 -43.776 13.272  1.00 20.30 ? 17  PHE A O     1 
ATOM   142  C  CB    . PHE A 1 20  ? 15.977 -42.418 12.452  1.00 20.07 ? 17  PHE A CB    1 
ATOM   143  C  CG    . PHE A 1 20  ? 15.386 -42.641 11.086  1.00 23.07 ? 17  PHE A CG    1 
ATOM   144  C  CD1   . PHE A 1 20  ? 14.232 -41.968 10.705  1.00 19.95 ? 17  PHE A CD1   1 
ATOM   145  C  CD2   . PHE A 1 20  ? 15.975 -43.517 10.186  1.00 21.37 ? 17  PHE A CD2   1 
ATOM   146  C  CE1   . PHE A 1 20  ? 13.662 -42.171 9.472   1.00 20.38 ? 17  PHE A CE1   1 
ATOM   147  C  CE2   . PHE A 1 20  ? 15.405 -43.727 8.931   1.00 20.58 ? 17  PHE A CE2   1 
ATOM   148  C  CZ    . PHE A 1 20  ? 14.249 -43.053 8.576   1.00 21.42 ? 17  PHE A CZ    1 
ATOM   149  N  N     . PHE A 1 21  ? 14.811 -44.814 14.034  1.00 21.86 ? 18  PHE A N     1 
ATOM   150  C  CA    . PHE A 1 21  ? 14.113 -46.111 14.035  1.00 22.16 ? 18  PHE A CA    1 
ATOM   151  C  C     . PHE A 1 21  ? 12.850 -46.061 14.923  1.00 21.40 ? 18  PHE A C     1 
ATOM   152  O  O     . PHE A 1 21  ? 11.829 -46.645 14.575  1.00 21.83 ? 18  PHE A O     1 
ATOM   153  C  CB    . PHE A 1 21  ? 15.038 -47.254 14.477  1.00 21.32 ? 18  PHE A CB    1 
ATOM   154  C  CG    . PHE A 1 21  ? 16.067 -47.659 13.439  1.00 22.46 ? 18  PHE A CG    1 
ATOM   155  C  CD1   . PHE A 1 21  ? 16.473 -46.780 12.445  1.00 21.79 ? 18  PHE A CD1   1 
ATOM   156  C  CD2   . PHE A 1 21  ? 16.626 -48.929 13.462  1.00 23.34 ? 18  PHE A CD2   1 
ATOM   157  C  CE1   . PHE A 1 21  ? 17.435 -47.144 11.482  1.00 22.19 ? 18  PHE A CE1   1 
ATOM   158  C  CE2   . PHE A 1 21  ? 17.582 -49.304 12.503  1.00 26.42 ? 18  PHE A CE2   1 
ATOM   159  C  CZ    . PHE A 1 21  ? 17.987 -48.393 11.503  1.00 20.22 ? 18  PHE A CZ    1 
ATOM   160  N  N     . VAL A 1 22  ? 12.911 -45.335 16.040  1.00 21.73 ? 19  VAL A N     1 
ATOM   161  C  CA    . VAL A 1 22  ? 11.756 -45.179 16.939  1.00 21.16 ? 19  VAL A CA    1 
ATOM   162  C  C     . VAL A 1 22  ? 10.633 -44.397 16.253  1.00 23.75 ? 19  VAL A C     1 
ATOM   163  O  O     . VAL A 1 22  ? 9.472  -44.831 16.256  1.00 22.92 ? 19  VAL A O     1 
ATOM   164  C  CB    . VAL A 1 22  ? 12.165 -44.496 18.274  1.00 20.64 ? 19  VAL A CB    1 
ATOM   165  C  CG1   . VAL A 1 22  ? 10.971 -43.975 19.017  1.00 19.27 ? 19  VAL A CG1   1 
ATOM   166  C  CG2   . VAL A 1 22  ? 12.913 -45.487 19.160  1.00 21.99 ? 19  VAL A CG2   1 
ATOM   167  N  N     . GLN A 1 23  ? 10.970 -43.264 15.634  1.00 23.68 ? 20  GLN A N     1 
ATOM   168  C  CA    . GLN A 1 23  ? 9.983  -42.552 14.828  1.00 22.01 ? 20  GLN A CA    1 
ATOM   169  C  C     . GLN A 1 23  ? 9.329  -43.440 13.775  1.00 21.60 ? 20  GLN A C     1 
ATOM   170  O  O     . GLN A 1 23  ? 8.110  -43.380 13.602  1.00 25.45 ? 20  GLN A O     1 
ATOM   171  C  CB    . GLN A 1 23  ? 10.595 -41.340 14.144  1.00 20.93 ? 20  GLN A CB    1 
ATOM   172  C  CG    . GLN A 1 23  ? 10.806 -40.170 15.067  1.00 17.85 ? 20  GLN A CG    1 
ATOM   173  C  CD    . GLN A 1 23  ? 10.784 -38.865 14.332  1.00 25.05 ? 20  GLN A CD    1 
ATOM   174  O  OE1   . GLN A 1 23  ? 9.741  -38.222 14.239  1.00 26.95 ? 20  GLN A OE1   1 
ATOM   175  N  NE2   . GLN A 1 23  ? 11.934 -38.460 13.789  1.00 23.90 ? 20  GLN A NE2   1 
ATOM   176  N  N     . VAL A 1 24  ? 10.112 -44.264 13.083  1.00 19.77 ? 21  VAL A N     1 
ATOM   177  C  CA    . VAL A 1 24  ? 9.537  -45.135 12.043  1.00 23.44 ? 21  VAL A CA    1 
ATOM   178  C  C     . VAL A 1 24  ? 8.508  -46.103 12.656  1.00 24.49 ? 21  VAL A C     1 
ATOM   179  O  O     . VAL A 1 24  ? 7.412  -46.270 12.126  1.00 21.81 ? 21  VAL A O     1 
ATOM   180  C  CB    . VAL A 1 24  ? 10.629 -45.922 11.283  1.00 21.50 ? 21  VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 24  ? 10.020 -46.966 10.384  1.00 18.28 ? 21  VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 24  ? 11.498 -44.963 10.489  1.00 20.57 ? 21  VAL A CG2   1 
ATOM   183  N  N     . GLU A 1 25  ? 8.846  -46.682 13.805  1.00 20.80 ? 22  GLU A N     1 
ATOM   184  C  CA    . GLU A 1 25  ? 7.921  -47.550 14.498  1.00 20.92 ? 22  GLU A CA    1 
ATOM   185  C  C     . GLU A 1 25  ? 6.740  -46.779 15.107  1.00 23.66 ? 22  GLU A C     1 
ATOM   186  O  O     . GLU A 1 25  ? 5.626  -47.295 15.157  1.00 24.06 ? 22  GLU A O     1 
ATOM   187  C  CB    . GLU A 1 25  ? 8.662  -48.338 15.580  1.00 19.23 ? 22  GLU A CB    1 
ATOM   188  C  CG    . GLU A 1 25  ? 9.744  -49.234 15.040  1.00 21.05 ? 22  GLU A CG    1 
ATOM   189  C  CD    . GLU A 1 25  ? 9.182  -50.371 14.178  1.00 25.78 ? 22  GLU A CD    1 
ATOM   190  O  OE1   . GLU A 1 25  ? 8.030  -50.789 14.426  1.00 25.24 ? 22  GLU A OE1   1 
ATOM   191  O  OE2   . GLU A 1 25  ? 9.895  -50.843 13.261  1.00 21.47 ? 22  GLU A OE2   1 
ATOM   192  N  N     . GLN A 1 26  ? 6.978  -45.558 15.581  1.00 22.95 ? 23  GLN A N     1 
ATOM   193  C  CA    . GLN A 1 26  ? 5.904  -44.755 16.185  1.00 23.09 ? 23  GLN A CA    1 
ATOM   194  C  C     . GLN A 1 26  ? 4.884  -44.268 15.147  1.00 24.81 ? 23  GLN A C     1 
ATOM   195  O  O     . GLN A 1 26  ? 3.695  -44.134 15.451  1.00 22.02 ? 23  GLN A O     1 
ATOM   196  C  CB    . GLN A 1 26  ? 6.476  -43.551 16.936  1.00 21.28 ? 23  GLN A CB    1 
ATOM   197  C  CG    . GLN A 1 26  ? 7.236  -43.902 18.234  1.00 21.61 ? 23  GLN A CG    1 
ATOM   198  C  CD    . GLN A 1 26  ? 7.767  -42.669 18.973  1.00 24.16 ? 23  GLN A CD    1 
ATOM   199  O  OE1   . GLN A 1 26  ? 8.310  -41.735 18.363  1.00 21.90 ? 23  GLN A OE1   1 
ATOM   200  N  NE2   . GLN A 1 26  ? 7.601  -42.661 20.298  1.00 26.58 ? 23  GLN A NE2   1 
ATOM   201  N  N     . ARG A 1 27  ? 5.340  -43.994 13.926  1.00 22.74 ? 24  ARG A N     1 
ATOM   202  C  CA    . ARG A 1 27  ? 4.407  -43.624 12.863  1.00 24.60 ? 24  ARG A CA    1 
ATOM   203  C  C     . ARG A 1 27  ? 3.466  -44.797 12.583  1.00 26.33 ? 24  ARG A C     1 
ATOM   204  O  O     . ARG A 1 27  ? 2.261  -44.623 12.392  1.00 24.10 ? 24  ARG A O     1 
ATOM   205  C  CB    . ARG A 1 27  ? 5.142  -43.222 11.584  1.00 23.32 ? 24  ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 27  ? 4.203  -42.918 10.443  1.00 21.79 ? 24  ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 27  ? 4.935  -42.394 9.223   1.00 22.43 ? 24  ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 27  ? 5.576  -43.453 8.451   1.00 22.27 ? 24  ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 27  ? 6.238  -43.246 7.317   1.00 23.44 ? 24  ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 27  ? 6.349  -42.014 6.818   1.00 23.44 ? 24  ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 27  ? 6.784  -44.268 6.676   1.00 24.64 ? 24  ARG A NH2   1 
ATOM   212  N  N     . GLN A 1 28  ? 4.036  -45.995 12.585  1.00 23.99 ? 25  GLN A N     1 
ATOM   213  C  CA    . GLN A 1 28  ? 3.303  -47.205 12.266  1.00 27.26 ? 25  GLN A CA    1 
ATOM   214  C  C     . GLN A 1 28  ? 2.346  -47.642 13.392  1.00 25.59 ? 25  GLN A C     1 
ATOM   215  O  O     . GLN A 1 28  ? 1.250  -48.159 13.134  1.00 20.81 ? 25  GLN A O     1 
ATOM   216  C  CB    . GLN A 1 28  ? 4.294  -48.324 11.956  1.00 23.43 ? 25  GLN A CB    1 
ATOM   217  C  CG    . GLN A 1 28  ? 3.647  -49.614 11.456  1.00 27.39 ? 25  GLN A CG    1 
ATOM   218  C  CD    . GLN A 1 28  ? 4.619  -50.783 11.512  1.00 32.79 ? 25  GLN A CD    1 
ATOM   219  O  OE1   . GLN A 1 28  ? 5.745  -50.681 11.018  1.00 28.36 ? 25  GLN A OE1   1 
ATOM   220  N  NE2   . GLN A 1 28  ? 4.202  -51.887 12.147  1.00 31.92 ? 25  GLN A NE2   1 
ATOM   221  N  N     . ASN A 1 29  ? 2.788  -47.461 14.630  1.00 22.84 ? 26  ASN A N     1 
ATOM   222  C  CA    . ASN A 1 29  ? 1.999  -47.825 15.793  1.00 24.58 ? 26  ASN A CA    1 
ATOM   223  C  C     . ASN A 1 29  ? 1.696  -46.609 16.657  1.00 25.27 ? 26  ASN A C     1 
ATOM   224  O  O     . ASN A 1 29  ? 2.507  -46.228 17.493  1.00 25.55 ? 26  ASN A O     1 
ATOM   225  C  CB    . ASN A 1 29  ? 2.730  -48.872 16.622  1.00 25.30 ? 26  ASN A CB    1 
ATOM   226  C  CG    . ASN A 1 29  ? 1.869  -49.436 17.762  1.00 26.25 ? 26  ASN A CG    1 
ATOM   227  O  OD1   . ASN A 1 29  ? 0.843  -48.865 18.151  1.00 23.27 ? 26  ASN A OD1   1 
ATOM   228  N  ND2   . ASN A 1 29  ? 2.302  -50.567 18.304  1.00 25.72 ? 26  ASN A ND2   1 
ATOM   229  N  N     . PRO A 1 30  ? 0.528  -45.991 16.454  1.00 25.48 ? 27  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 30  ? 0.171  -44.775 17.205  1.00 25.02 ? 27  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 30  ? 0.248  -44.948 18.729  1.00 25.51 ? 27  PRO A C     1 
ATOM   232  O  O     . PRO A 1 30  ? 0.425  -43.965 19.428  1.00 27.00 ? 27  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 30  ? -1.268 -44.497 16.754  1.00 24.46 ? 27  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 30  ? -1.329 -45.058 15.373  1.00 29.51 ? 27  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 30  ? -0.410 -46.269 15.353  1.00 22.77 ? 27  PRO A CD    1 
ATOM   236  N  N     . HIS A 1 31  ? 0.132  -46.176 19.228  1.00 29.79 ? 28  HIS A N     1 
ATOM   237  C  CA    . HIS A 1 31  ? 0.233  -46.443 20.668  1.00 28.26 ? 28  HIS A CA    1 
ATOM   238  C  C     . HIS A 1 31  ? 1.591  -46.120 21.266  1.00 25.32 ? 28  HIS A C     1 
ATOM   239  O  O     . HIS A 1 31  ? 1.749  -46.179 22.472  1.00 27.29 ? 28  HIS A O     1 
ATOM   240  C  CB    . HIS A 1 31  ? -0.066 -47.915 20.976  1.00 26.41 ? 28  HIS A CB    1 
ATOM   241  C  CG    . HIS A 1 31  ? -1.487 -48.317 20.735  1.00 32.38 ? 28  HIS A CG    1 
ATOM   242  N  ND1   . HIS A 1 31  ? -2.558 -47.637 21.276  1.00 32.90 ? 28  HIS A ND1   1 
ATOM   243  C  CD2   . HIS A 1 31  ? -2.015 -49.338 20.017  1.00 36.66 ? 28  HIS A CD2   1 
ATOM   244  C  CE1   . HIS A 1 31  ? -3.683 -48.216 20.892  1.00 35.27 ? 28  HIS A CE1   1 
ATOM   245  N  NE2   . HIS A 1 31  ? -3.382 -49.250 20.131  1.00 37.95 ? 28  HIS A NE2   1 
ATOM   246  N  N     . LEU A 1 32  ? 2.582  -45.824 20.434  1.00 25.53 ? 29  LEU A N     1 
ATOM   247  C  CA    . LEU A 1 32  ? 3.944  -45.676 20.925  1.00 23.41 ? 29  LEU A CA    1 
ATOM   248  C  C     . LEU A 1 32  ? 4.368  -44.221 20.952  1.00 24.74 ? 29  LEU A C     1 
ATOM   249  O  O     . LEU A 1 32  ? 5.418  -43.884 21.523  1.00 25.20 ? 29  LEU A O     1 
ATOM   250  C  CB    . LEU A 1 32  ? 4.922  -46.494 20.061  1.00 21.74 ? 29  LEU A CB    1 
ATOM   251  C  CG    . LEU A 1 32  ? 4.760  -48.025 20.019  1.00 26.05 ? 29  LEU A CG    1 
ATOM   252  C  CD1   . LEU A 1 32  ? 5.731  -48.659 19.014  1.00 18.58 ? 29  LEU A CD1   1 
ATOM   253  C  CD2   . LEU A 1 32  ? 4.873  -48.694 21.422  1.00 19.83 ? 29  LEU A CD2   1 
ATOM   254  N  N     . ARG A 1 33  ? 3.561  -43.367 20.326  1.00 22.59 ? 30  ARG A N     1 
ATOM   255  C  CA    . ARG A 1 33  ? 3.931  -41.970 20.130  1.00 25.71 ? 30  ARG A CA    1 
ATOM   256  C  C     . ARG A 1 33  ? 3.947  -41.248 21.447  1.00 23.64 ? 30  ARG A C     1 
ATOM   257  O  O     . ARG A 1 33  ? 3.115  -41.539 22.291  1.00 22.58 ? 30  ARG A O     1 
ATOM   258  C  CB    . ARG A 1 33  ? 2.967  -41.279 19.175  1.00 24.48 ? 30  ARG A CB    1 
ATOM   259  C  CG    . ARG A 1 33  ? 2.696  -42.069 17.922  1.00 22.09 ? 30  ARG A CG    1 
ATOM   260  C  CD    . ARG A 1 33  ? 1.711  -41.372 17.015  1.00 20.34 ? 30  ARG A CD    1 
ATOM   261  N  NE    . ARG A 1 33  ? 1.715  -41.996 15.698  1.00 23.74 ? 30  ARG A NE    1 
ATOM   262  C  CZ    . ARG A 1 33  ? 1.013  -41.565 14.653  1.00 25.98 ? 30  ARG A CZ    1 
ATOM   263  N  NH1   . ARG A 1 33  ? 0.212  -40.514 14.771  1.00 27.79 ? 30  ARG A NH1   1 
ATOM   264  N  NH2   . ARG A 1 33  ? 1.107  -42.196 13.487  1.00 23.10 ? 30  ARG A NH2   1 
ATOM   265  N  N     . ASN A 1 34  ? 4.895  -40.320 21.608  1.00 25.46 ? 31  ASN A N     1 
ATOM   266  C  CA    . ASN A 1 34  ? 5.059  -39.526 22.841  1.00 27.63 ? 31  ASN A CA    1 
ATOM   267  C  C     . ASN A 1 34  ? 5.140  -40.377 24.095  1.00 24.67 ? 31  ASN A C     1 
ATOM   268  O  O     . ASN A 1 34  ? 4.491  -40.081 25.090  1.00 27.49 ? 31  ASN A O     1 
ATOM   269  C  CB    . ASN A 1 34  ? 3.912  -38.524 23.015  1.00 28.14 ? 31  ASN A CB    1 
ATOM   270  C  CG    . ASN A 1 34  ? 3.483  -37.910 21.715  1.00 33.65 ? 31  ASN A CG    1 
ATOM   271  O  OD1   . ASN A 1 34  ? 4.183  -37.063 21.147  1.00 34.14 ? 31  ASN A OD1   1 
ATOM   272  N  ND2   . ASN A 1 34  ? 2.328  -38.346 21.217  1.00 36.62 ? 31  ASN A ND2   1 
ATOM   273  N  N     . LYS A 1 35  ? 5.913  -41.449 24.030  1.00 25.22 ? 32  LYS A N     1 
ATOM   274  C  CA    . LYS A 1 35  ? 6.105  -42.339 25.166  1.00 25.04 ? 32  LYS A CA    1 
ATOM   275  C  C     . LYS A 1 35  ? 7.580  -42.649 25.256  1.00 26.02 ? 32  LYS A C     1 
ATOM   276  O  O     . LYS A 1 35  ? 8.287  -42.545 24.249  1.00 25.92 ? 32  LYS A O     1 
ATOM   277  C  CB    . LYS A 1 35  ? 5.320  -43.643 25.007  1.00 23.58 ? 32  LYS A CB    1 
ATOM   278  C  CG    . LYS A 1 35  ? 3.859  -43.478 24.676  1.00 25.11 ? 32  LYS A CG    1 
ATOM   279  C  CD    . LYS A 1 35  ? 3.038  -43.332 25.929  1.00 32.84 ? 32  LYS A CD    1 
ATOM   280  C  CE    . LYS A 1 35  ? 1.584  -43.729 25.683  1.00 37.87 ? 32  LYS A CE    1 
ATOM   281  N  NZ    . LYS A 1 35  ? 0.955  -44.179 26.955  1.00 43.90 ? 32  LYS A NZ    1 
ATOM   282  N  N     . PRO A 1 36  ? 8.052  -43.030 26.454  1.00 23.93 ? 33  PRO A N     1 
ATOM   283  C  CA    . PRO A 1 36  ? 9.380  -43.627 26.526  1.00 23.26 ? 33  PRO A CA    1 
ATOM   284  C  C     . PRO A 1 36  ? 9.378  -44.959 25.764  1.00 24.20 ? 33  PRO A C     1 
ATOM   285  O  O     . PRO A 1 36  ? 8.691  -45.938 26.125  1.00 20.32 ? 33  PRO A O     1 
ATOM   286  C  CB    . PRO A 1 36  ? 9.611  -43.808 28.026  1.00 23.67 ? 33  PRO A CB    1 
ATOM   287  C  CG    . PRO A 1 36  ? 8.257  -43.805 28.624  1.00 23.32 ? 33  PRO A CG    1 
ATOM   288  C  CD    . PRO A 1 36  ? 7.412  -42.937 27.775  1.00 23.35 ? 33  PRO A CD    1 
ATOM   289  N  N     . CYS A 1 37  ? 10.163 -44.972 24.694  1.00 21.36 ? 34  CYS A N     1 
ATOM   290  C  CA    . CYS A 1 37  ? 10.080 -46.019 23.685  1.00 23.19 ? 34  CYS A CA    1 
ATOM   291  C  C     . CYS A 1 37  ? 11.451 -46.313 23.083  1.00 22.47 ? 34  CYS A C     1 
ATOM   292  O  O     . CYS A 1 37  ? 12.267 -45.411 22.924  1.00 21.57 ? 34  CYS A O     1 
ATOM   293  C  CB    . CYS A 1 37  ? 9.103  -45.603 22.572  1.00 22.30 ? 34  CYS A CB    1 
ATOM   294  S  SG    . CYS A 1 37  ? 8.856  -46.858 21.331  1.00 28.85 ? 34  CYS A SG    1 
ATOM   295  N  N     . ALA A 1 38  ? 11.687 -47.566 22.719  1.00 22.60 ? 35  ALA A N     1 
ATOM   296  C  CA    . ALA A 1 38  ? 12.975 -47.968 22.185  1.00 21.69 ? 35  ALA A CA    1 
ATOM   297  C  C     . ALA A 1 38  ? 12.819 -49.072 21.151  1.00 22.58 ? 35  ALA A C     1 
ATOM   298  O  O     . ALA A 1 38  ? 11.849 -49.828 21.172  1.00 19.87 ? 35  ALA A O     1 
ATOM   299  C  CB    . ALA A 1 38  ? 13.898 -48.429 23.320  1.00 25.31 ? 35  ALA A CB    1 
ATOM   300  N  N     . VAL A 1 39  ? 13.789 -49.166 20.250  1.00 22.84 ? 36  VAL A N     1 
ATOM   301  C  CA    . VAL A 1 39  ? 13.790 -50.197 19.229  1.00 22.45 ? 36  VAL A CA    1 
ATOM   302  C  C     . VAL A 1 39  ? 14.939 -51.170 19.512  1.00 24.70 ? 36  VAL A C     1 
ATOM   303  O  O     . VAL A 1 39  ? 16.085 -50.755 19.648  1.00 24.86 ? 36  VAL A O     1 
ATOM   304  C  CB    . VAL A 1 39  ? 13.926 -49.588 17.817  1.00 24.55 ? 36  VAL A CB    1 
ATOM   305  C  CG1   . VAL A 1 39  ? 14.151 -50.684 16.757  1.00 21.91 ? 36  VAL A CG1   1 
ATOM   306  C  CG2   . VAL A 1 39  ? 12.694 -48.748 17.488  1.00 21.94 ? 36  VAL A CG2   1 
ATOM   307  N  N     . VAL A 1 40  ? 14.624 -52.457 19.616  1.00 24.19 ? 37  VAL A N     1 
ATOM   308  C  CA    . VAL A 1 40  ? 15.633 -53.464 19.935  1.00 29.78 ? 37  VAL A CA    1 
ATOM   309  C  C     . VAL A 1 40  ? 15.754 -54.510 18.816  1.00 27.94 ? 37  VAL A C     1 
ATOM   310  O  O     . VAL A 1 40  ? 14.921 -54.574 17.911  1.00 28.08 ? 37  VAL A O     1 
ATOM   311  C  CB    . VAL A 1 40  ? 15.331 -54.183 21.309  1.00 31.10 ? 37  VAL A CB    1 
ATOM   312  C  CG1   . VAL A 1 40  ? 15.177 -53.167 22.432  1.00 24.67 ? 37  VAL A CG1   1 
ATOM   313  C  CG2   . VAL A 1 40  ? 14.081 -55.065 21.226  1.00 25.42 ? 37  VAL A CG2   1 
ATOM   314  N  N     . GLN A 1 41  ? 16.824 -55.293 18.861  1.00 27.68 ? 38  GLN A N     1 
ATOM   315  C  CA    . GLN A 1 41  ? 16.954 -56.463 17.999  1.00 29.29 ? 38  GLN A CA    1 
ATOM   316  C  C     . GLN A 1 41  ? 17.284 -57.687 18.861  1.00 29.84 ? 38  GLN A C     1 
ATOM   317  O  O     . GLN A 1 41  ? 18.137 -57.614 19.757  1.00 27.27 ? 38  GLN A O     1 
ATOM   318  C  CB    . GLN A 1 41  ? 18.011 -56.238 16.894  1.00 27.15 ? 38  GLN A CB    1 
ATOM   319  C  CG    . GLN A 1 41  ? 19.234 -55.451 17.306  1.00 32.03 ? 38  GLN A CG    1 
ATOM   320  C  CD    . GLN A 1 41  ? 20.195 -55.155 16.148  1.00 34.65 ? 38  GLN A CD    1 
ATOM   321  O  OE1   . GLN A 1 41  ? 19.783 -54.967 14.997  1.00 37.39 ? 38  GLN A OE1   1 
ATOM   322  N  NE2   . GLN A 1 41  ? 21.488 -55.107 16.459  1.00 34.05 ? 38  GLN A NE2   1 
ATOM   323  N  N     . TYR A 1 42  ? 16.562 -58.782 18.599  1.00 27.79 ? 39  TYR A N     1 
ATOM   324  C  CA    . TYR A 1 42  ? 16.725 -60.084 19.261  1.00 28.63 ? 39  TYR A CA    1 
ATOM   325  C  C     . TYR A 1 42  ? 16.173 -60.101 20.691  1.00 31.73 ? 39  TYR A C     1 
ATOM   326  O  O     . TYR A 1 42  ? 16.922 -59.985 21.653  1.00 32.62 ? 39  TYR A O     1 
ATOM   327  C  CB    . TYR A 1 42  ? 18.192 -60.519 19.260  1.00 31.26 ? 39  TYR A CB    1 
ATOM   328  C  CG    . TYR A 1 42  ? 18.826 -60.573 17.886  1.00 33.46 ? 39  TYR A CG    1 
ATOM   329  C  CD1   . TYR A 1 42  ? 18.189 -61.200 16.818  1.00 33.30 ? 39  TYR A CD1   1 
ATOM   330  C  CD2   . TYR A 1 42  ? 20.057 -59.972 17.651  1.00 32.50 ? 39  TYR A CD2   1 
ATOM   331  C  CE1   . TYR A 1 42  ? 18.777 -61.244 15.562  1.00 33.43 ? 39  TYR A CE1   1 
ATOM   332  C  CE2   . TYR A 1 42  ? 20.645 -60.000 16.403  1.00 30.41 ? 39  TYR A CE2   1 
ATOM   333  C  CZ    . TYR A 1 42  ? 20.010 -60.640 15.364  1.00 28.91 ? 39  TYR A CZ    1 
ATOM   334  O  OH    . TYR A 1 42  ? 20.604 -60.673 14.130  1.00 27.05 ? 39  TYR A OH    1 
ATOM   335  N  N     . LYS A 1 43  ? 14.855 -60.281 20.791  1.00 35.45 ? 40  LYS A N     1 
ATOM   336  C  CA    . LYS A 1 43  ? 14.092 -60.399 22.044  1.00 33.93 ? 40  LYS A CA    1 
ATOM   337  C  C     . LYS A 1 43  ? 14.684 -61.337 23.102  1.00 37.04 ? 40  LYS A C     1 
ATOM   338  O  O     . LYS A 1 43  ? 14.606 -61.060 24.300  1.00 31.81 ? 40  LYS A O     1 
ATOM   339  C  CB    . LYS A 1 43  ? 12.657 -60.864 21.714  1.00 39.07 ? 40  LYS A CB    1 
ATOM   340  C  CG    . LYS A 1 43  ? 11.563 -60.058 22.399  1.00 43.60 ? 40  LYS A CG    1 
ATOM   341  C  CD    . LYS A 1 43  ? 11.978 -58.614 22.536  1.00 36.52 ? 40  LYS A CD    1 
ATOM   342  C  CE    . LYS A 1 43  ? 11.325 -57.941 23.727  1.00 35.71 ? 40  LYS A CE    1 
ATOM   343  N  NZ    . LYS A 1 43  ? 12.098 -56.724 24.044  1.00 39.79 ? 40  LYS A NZ    1 
ATOM   344  N  N     . SER A 1 44  ? 15.253 -62.458 22.670  1.00 38.34 ? 41  SER A N     1 
ATOM   345  C  CA    . SER A 1 44  ? 15.575 -63.513 23.615  1.00 34.95 ? 41  SER A CA    1 
ATOM   346  C  C     . SER A 1 44  ? 16.867 -63.225 24.350  1.00 34.59 ? 41  SER A C     1 
ATOM   347  O  O     . SER A 1 44  ? 17.211 -63.925 25.292  1.00 37.05 ? 41  SER A O     1 
ATOM   348  C  CB    . SER A 1 44  ? 15.653 -64.855 22.903  1.00 31.12 ? 41  SER A CB    1 
ATOM   349  O  OG    . SER A 1 44  ? 16.733 -64.870 21.990  1.00 38.76 ? 41  SER A OG    1 
ATOM   350  N  N     . TRP A 1 45  ? 17.577 -62.188 23.927  1.00 33.58 ? 42  TRP A N     1 
ATOM   351  C  CA    . TRP A 1 45  ? 18.834 -61.798 24.579  1.00 37.91 ? 42  TRP A CA    1 
ATOM   352  C  C     . TRP A 1 45  ? 18.596 -60.620 25.512  1.00 38.32 ? 42  TRP A C     1 
ATOM   353  O  O     . TRP A 1 45  ? 18.587 -59.469 25.054  1.00 33.10 ? 42  TRP A O     1 
ATOM   354  C  CB    . TRP A 1 45  ? 19.908 -61.401 23.556  1.00 40.72 ? 42  TRP A CB    1 
ATOM   355  C  CG    . TRP A 1 45  ? 20.332 -62.475 22.591  1.00 46.93 ? 42  TRP A CG    1 
ATOM   356  C  CD1   . TRP A 1 45  ? 19.928 -63.783 22.570  1.00 43.43 ? 42  TRP A CD1   1 
ATOM   357  C  CD2   . TRP A 1 45  ? 21.253 -62.323 21.502  1.00 47.39 ? 42  TRP A CD2   1 
ATOM   358  N  NE1   . TRP A 1 45  ? 20.546 -64.449 21.539  1.00 44.22 ? 42  TRP A NE1   1 
ATOM   359  C  CE2   . TRP A 1 45  ? 21.361 -63.577 20.868  1.00 44.27 ? 42  TRP A CE2   1 
ATOM   360  C  CE3   . TRP A 1 45  ? 21.993 -61.246 21.000  1.00 44.64 ? 42  TRP A CE3   1 
ATOM   361  C  CZ2   . TRP A 1 45  ? 22.182 -63.783 19.758  1.00 47.52 ? 42  TRP A CZ2   1 
ATOM   362  C  CZ3   . TRP A 1 45  ? 22.814 -61.458 19.899  1.00 45.71 ? 42  TRP A CZ3   1 
ATOM   363  C  CH2   . TRP A 1 45  ? 22.900 -62.712 19.291  1.00 40.85 ? 42  TRP A CH2   1 
ATOM   364  N  N     . LYS A 1 46  ? 18.387 -60.914 26.798  1.00 36.82 ? 43  LYS A N     1 
ATOM   365  C  CA    . LYS A 1 46  ? 18.161 -59.896 27.815  1.00 31.85 ? 43  LYS A CA    1 
ATOM   366  C  C     . LYS A 1 46  ? 17.177 -58.850 27.307  1.00 33.96 ? 43  LYS A C     1 
ATOM   367  O  O     . LYS A 1 46  ? 17.362 -57.643 27.511  1.00 34.91 ? 43  LYS A O     1 
ATOM   368  C  CB    . LYS A 1 46  ? 19.490 -59.254 28.231  1.00 34.31 ? 43  LYS A CB    1 
ATOM   369  C  CG    . LYS A 1 46  ? 20.320 -60.126 29.194  1.00 37.38 ? 43  LYS A CG    1 
ATOM   370  C  CD    . LYS A 1 46  ? 21.700 -59.527 29.549  1.00 42.49 ? 43  LYS A CD    1 
ATOM   371  C  CE    . LYS A 1 46  ? 21.606 -58.217 30.323  1.00 42.36 ? 43  LYS A CE    1 
ATOM   372  N  NZ    . LYS A 1 46  ? 21.643 -58.389 31.801  1.00 45.63 ? 43  LYS A NZ    1 
ATOM   373  N  N     . GLY A 1 47  ? 16.147 -59.327 26.608  1.00 33.14 ? 44  GLY A N     1 
ATOM   374  C  CA    . GLY A 1 47  ? 15.082 -58.480 26.115  1.00 27.64 ? 44  GLY A CA    1 
ATOM   375  C  C     . GLY A 1 47  ? 15.396 -57.816 24.785  1.00 31.54 ? 44  GLY A C     1 
ATOM   376  O  O     . GLY A 1 47  ? 14.525 -57.192 24.184  1.00 30.12 ? 44  GLY A O     1 
ATOM   377  N  N     . GLY A 1 48  ? 16.634 -57.951 24.315  1.00 31.96 ? 45  GLY A N     1 
ATOM   378  C  CA    . GLY A 1 48  ? 17.033 -57.321 23.066  1.00 29.23 ? 45  GLY A CA    1 
ATOM   379  C  C     . GLY A 1 48  ? 17.961 -56.140 23.247  1.00 27.68 ? 45  GLY A C     1 
ATOM   380  O  O     . GLY A 1 48  ? 17.914 -55.456 24.268  1.00 24.75 ? 45  GLY A O     1 
ATOM   381  N  N     . GLY A 1 49  ? 18.807 -55.900 22.248  1.00 27.45 ? 46  GLY A N     1 
ATOM   382  C  CA    . GLY A 1 49  ? 19.783 -54.834 22.337  1.00 26.52 ? 46  GLY A CA    1 
ATOM   383  C  C     . GLY A 1 49  ? 19.177 -53.574 21.779  1.00 28.05 ? 46  GLY A C     1 
ATOM   384  O  O     . GLY A 1 49  ? 18.607 -53.607 20.697  1.00 26.59 ? 46  GLY A O     1 
ATOM   385  N  N     . ILE A 1 50  ? 19.272 -52.473 22.521  1.00 23.23 ? 47  ILE A N     1 
ATOM   386  C  CA    . ILE A 1 50  ? 18.664 -51.223 22.094  1.00 21.84 ? 47  ILE A CA    1 
ATOM   387  C  C     . ILE A 1 50  ? 19.534 -50.489 21.074  1.00 26.70 ? 47  ILE A C     1 
ATOM   388  O  O     . ILE A 1 50  ? 20.734 -50.302 21.284  1.00 23.43 ? 47  ILE A O     1 
ATOM   389  C  CB    . ILE A 1 50  ? 18.397 -50.308 23.304  1.00 28.21 ? 47  ILE A CB    1 
ATOM   390  C  CG1   . ILE A 1 50  ? 17.318 -50.906 24.193  1.00 21.86 ? 47  ILE A CG1   1 
ATOM   391  C  CG2   . ILE A 1 50  ? 18.007 -48.897 22.873  1.00 26.18 ? 47  ILE A CG2   1 
ATOM   392  C  CD1   . ILE A 1 50  ? 17.323 -50.295 25.548  1.00 23.19 ? 47  ILE A CD1   1 
ATOM   393  N  N     . ILE A 1 51  ? 18.923 -50.089 19.960  1.00 27.20 ? 48  ILE A N     1 
ATOM   394  C  CA    . ILE A 1 51  ? 19.636 -49.350 18.921  1.00 24.61 ? 48  ILE A CA    1 
ATOM   395  C  C     . ILE A 1 51  ? 19.034 -47.967 18.666  1.00 25.83 ? 48  ILE A C     1 
ATOM   396  O  O     . ILE A 1 51  ? 19.673 -47.126 18.034  1.00 30.28 ? 48  ILE A O     1 
ATOM   397  C  CB    . ILE A 1 51  ? 19.675 -50.128 17.583  1.00 28.76 ? 48  ILE A CB    1 
ATOM   398  C  CG1   . ILE A 1 51  ? 18.269 -50.416 17.071  1.00 26.96 ? 48  ILE A CG1   1 
ATOM   399  C  CG2   . ILE A 1 51  ? 20.462 -51.436 17.738  1.00 33.47 ? 48  ILE A CG2   1 
ATOM   400  C  CD1   . ILE A 1 51  ? 18.272 -51.211 15.784  1.00 29.45 ? 48  ILE A CD1   1 
ATOM   401  N  N     . ALA A 1 52  ? 17.818 -47.724 19.153  1.00 21.88 ? 49  ALA A N     1 
ATOM   402  C  CA    . ALA A 1 52  ? 17.235 -46.388 19.083  1.00 23.80 ? 49  ALA A CA    1 
ATOM   403  C  C     . ALA A 1 52  ? 16.384 -46.079 20.323  1.00 24.88 ? 49  ALA A C     1 
ATOM   404  O  O     . ALA A 1 52  ? 15.661 -46.949 20.805  1.00 22.44 ? 49  ALA A O     1 
ATOM   405  C  CB    . ALA A 1 52  ? 16.398 -46.225 17.790  1.00 22.16 ? 49  ALA A CB    1 
ATOM   406  N  N     . VAL A 1 53  ? 16.473 -44.843 20.828  1.00 22.48 ? 50  VAL A N     1 
ATOM   407  C  CA    . VAL A 1 53  ? 15.779 -44.457 22.055  1.00 21.53 ? 50  VAL A CA    1 
ATOM   408  C  C     . VAL A 1 53  ? 15.016 -43.153 21.881  1.00 21.54 ? 50  VAL A C     1 
ATOM   409  O  O     . VAL A 1 53  ? 15.585 -42.159 21.445  1.00 29.50 ? 50  VAL A O     1 
ATOM   410  C  CB    . VAL A 1 53  ? 16.769 -44.267 23.235  1.00 21.11 ? 50  VAL A CB    1 
ATOM   411  C  CG1   . VAL A 1 53  ? 16.034 -44.199 24.531  1.00 20.64 ? 50  VAL A CG1   1 
ATOM   412  C  CG2   . VAL A 1 53  ? 17.784 -45.364 23.270  1.00 23.59 ? 50  VAL A CG2   1 
ATOM   413  N  N     . SER A 1 54  ? 13.746 -43.121 22.243  1.00 21.18 ? 51  SER A N     1 
ATOM   414  C  CA    . SER A 1 54  ? 13.023 -41.864 22.179  1.00 18.85 ? 51  SER A CA    1 
ATOM   415  C  C     . SER A 1 54  ? 13.549 -40.926 23.240  1.00 22.73 ? 51  SER A C     1 
ATOM   416  O  O     . SER A 1 54  ? 14.121 -41.371 24.243  1.00 25.38 ? 51  SER A O     1 
ATOM   417  C  CB    . SER A 1 54  ? 11.521 -42.078 22.358  1.00 23.74 ? 51  SER A CB    1 
ATOM   418  O  OG    . SER A 1 54  ? 11.188 -42.458 23.684  1.00 23.92 ? 51  SER A OG    1 
ATOM   419  N  N     . TYR A 1 55  ? 13.352 -39.629 23.048  1.00 20.35 ? 52  TYR A N     1 
ATOM   420  C  CA    . TYR A 1 55  ? 13.880 -38.669 24.013  1.00 21.25 ? 52  TYR A CA    1 
ATOM   421  C  C     . TYR A 1 55  ? 13.163 -38.742 25.375  1.00 25.12 ? 52  TYR A C     1 
ATOM   422  O  O     . TYR A 1 55  ? 13.769 -38.437 26.393  1.00 29.23 ? 52  TYR A O     1 
ATOM   423  C  CB    . TYR A 1 55  ? 13.829 -37.259 23.429  1.00 21.90 ? 52  TYR A CB    1 
ATOM   424  C  CG    . TYR A 1 55  ? 14.901 -37.037 22.375  1.00 23.06 ? 52  TYR A CG    1 
ATOM   425  C  CD1   . TYR A 1 55  ? 14.769 -37.560 21.101  1.00 20.01 ? 52  TYR A CD1   1 
ATOM   426  C  CD2   . TYR A 1 55  ? 16.044 -36.314 22.666  1.00 24.04 ? 52  TYR A CD2   1 
ATOM   427  C  CE1   . TYR A 1 55  ? 15.741 -37.359 20.145  1.00 22.98 ? 52  TYR A CE1   1 
ATOM   428  C  CE2   . TYR A 1 55  ? 17.020 -36.100 21.722  1.00 22.41 ? 52  TYR A CE2   1 
ATOM   429  C  CZ    . TYR A 1 55  ? 16.876 -36.630 20.457  1.00 26.73 ? 52  TYR A CZ    1 
ATOM   430  O  OH    . TYR A 1 55  ? 17.869 -36.422 19.504  1.00 22.85 ? 52  TYR A OH    1 
ATOM   431  N  N     . GLU A 1 56  ? 11.904 -39.185 25.402  1.00 24.83 ? 53  GLU A N     1 
ATOM   432  C  CA    . GLU A 1 56  ? 11.229 -39.442 26.670  1.00 23.28 ? 53  GLU A CA    1 
ATOM   433  C  C     . GLU A 1 56  ? 11.934 -40.559 27.436  1.00 26.84 ? 53  GLU A C     1 
ATOM   434  O  O     . GLU A 1 56  ? 12.039 -40.497 28.656  1.00 26.44 ? 53  GLU A O     1 
ATOM   435  C  CB    . GLU A 1 56  ? 9.753  -39.824 26.466  1.00 25.77 ? 53  GLU A CB    1 
ATOM   436  C  CG    . GLU A 1 56  ? 8.840  -38.738 25.884  1.00 24.29 ? 53  GLU A CG    1 
ATOM   437  C  CD    . GLU A 1 56  ? 8.937  -38.637 24.371  1.00 28.97 ? 53  GLU A CD    1 
ATOM   438  O  OE1   . GLU A 1 56  ? 9.926  -39.132 23.791  1.00 29.99 ? 53  GLU A OE1   1 
ATOM   439  O  OE2   . GLU A 1 56  ? 8.024  -38.065 23.753  1.00 33.54 ? 53  GLU A OE2   1 
ATOM   440  N  N     . ALA A 1 57  ? 12.402 -41.588 26.730  1.00 23.82 ? 54  ALA A N     1 
ATOM   441  C  CA    . ALA A 1 57  ? 13.071 -42.692 27.410  1.00 24.14 ? 54  ALA A CA    1 
ATOM   442  C  C     . ALA A 1 57  ? 14.514 -42.317 27.767  1.00 25.55 ? 54  ALA A C     1 
ATOM   443  O  O     . ALA A 1 57  ? 15.063 -42.812 28.759  1.00 25.03 ? 54  ALA A O     1 
ATOM   444  C  CB    . ALA A 1 57  ? 13.042 -43.962 26.558  1.00 21.47 ? 54  ALA A CB    1 
ATOM   445  N  N     . ARG A 1 58  ? 15.116 -41.446 26.955  1.00 22.61 ? 55  ARG A N     1 
ATOM   446  C  CA    . ARG A 1 58  ? 16.448 -40.917 27.236  1.00 23.19 ? 55  ARG A CA    1 
ATOM   447  C  C     . ARG A 1 58  ? 16.502 -40.172 28.582  1.00 26.53 ? 55  ARG A C     1 
ATOM   448  O  O     . ARG A 1 58  ? 17.544 -40.139 29.229  1.00 28.06 ? 55  ARG A O     1 
ATOM   449  C  CB    . ARG A 1 58  ? 16.908 -39.983 26.115  1.00 19.91 ? 55  ARG A CB    1 
ATOM   450  C  CG    . ARG A 1 58  ? 17.107 -40.640 24.767  1.00 22.52 ? 55  ARG A CG    1 
ATOM   451  C  CD    . ARG A 1 58  ? 17.682 -39.654 23.722  1.00 22.78 ? 55  ARG A CD    1 
ATOM   452  N  NE    . ARG A 1 58  ? 17.636 -40.208 22.370  1.00 23.04 ? 55  ARG A NE    1 
ATOM   453  C  CZ    . ARG A 1 58  ? 18.333 -39.761 21.326  1.00 25.16 ? 55  ARG A CZ    1 
ATOM   454  N  NH1   . ARG A 1 58  ? 19.155 -38.730 21.453  1.00 25.56 ? 55  ARG A NH1   1 
ATOM   455  N  NH2   . ARG A 1 58  ? 18.199 -40.354 20.145  1.00 24.60 ? 55  ARG A NH2   1 
ATOM   456  N  N     . ALA A 1 59  ? 15.377 -39.584 28.995  1.00 25.57 ? 56  ALA A N     1 
ATOM   457  C  CA    . ALA A 1 59  ? 15.329 -38.780 30.209  1.00 25.78 ? 56  ALA A CA    1 
ATOM   458  C  C     . ALA A 1 59  ? 15.339 -39.658 31.454  1.00 30.78 ? 56  ALA A C     1 
ATOM   459  O  O     . ALA A 1 59  ? 15.449 -39.147 32.568  1.00 33.66 ? 56  ALA A O     1 
ATOM   460  C  CB    . ALA A 1 59  ? 14.101 -37.875 30.216  1.00 19.00 ? 56  ALA A CB    1 
ATOM   461  N  N     . PHE A 1 60  ? 15.202 -40.967 31.267  1.00 25.72 ? 57  PHE A N     1 
ATOM   462  C  CA    . PHE A 1 60  ? 15.422 -41.917 32.355  1.00 26.81 ? 57  PHE A CA    1 
ATOM   463  C  C     . PHE A 1 60  ? 16.832 -42.511 32.288  1.00 29.02 ? 57  PHE A C     1 
ATOM   464  O  O     . PHE A 1 60  ? 17.185 -43.368 33.097  1.00 28.02 ? 57  PHE A O     1 
ATOM   465  C  CB    . PHE A 1 60  ? 14.406 -43.058 32.312  1.00 27.29 ? 57  PHE A CB    1 
ATOM   466  C  CG    . PHE A 1 60  ? 12.988 -42.649 32.622  1.00 27.20 ? 57  PHE A CG    1 
ATOM   467  C  CD1   . PHE A 1 60  ? 12.151 -42.179 31.616  1.00 21.51 ? 57  PHE A CD1   1 
ATOM   468  C  CD2   . PHE A 1 60  ? 12.477 -42.785 33.912  1.00 25.71 ? 57  PHE A CD2   1 
ATOM   469  C  CE1   . PHE A 1 60  ? 10.836 -41.826 31.885  1.00 22.46 ? 57  PHE A CE1   1 
ATOM   470  C  CE2   . PHE A 1 60  ? 11.156 -42.434 34.198  1.00 24.34 ? 57  PHE A CE2   1 
ATOM   471  C  CZ    . PHE A 1 60  ? 10.328 -41.956 33.178  1.00 23.98 ? 57  PHE A CZ    1 
ATOM   472  N  N     . GLY A 1 61  ? 17.625 -42.079 31.307  1.00 26.75 ? 58  GLY A N     1 
ATOM   473  C  CA    . GLY A 1 61  ? 18.967 -42.620 31.131  1.00 25.24 ? 58  GLY A CA    1 
ATOM   474  C  C     . GLY A 1 61  ? 19.074 -43.824 30.210  1.00 25.00 ? 58  GLY A C     1 
ATOM   475  O  O     . GLY A 1 61  ? 20.116 -44.461 30.150  1.00 24.62 ? 58  GLY A O     1 
ATOM   476  N  N     . VAL A 1 62  ? 17.998 -44.152 29.492  1.00 26.68 ? 59  VAL A N     1 
ATOM   477  C  CA    . VAL A 1 62  ? 18.036 -45.249 28.517  1.00 24.06 ? 59  VAL A CA    1 
ATOM   478  C  C     . VAL A 1 62  ? 18.893 -44.838 27.324  1.00 24.38 ? 59  VAL A C     1 
ATOM   479  O  O     . VAL A 1 62  ? 18.741 -43.737 26.800  1.00 23.74 ? 59  VAL A O     1 
ATOM   480  C  CB    . VAL A 1 62  ? 16.634 -45.635 28.015  1.00 22.80 ? 59  VAL A CB    1 
ATOM   481  C  CG1   . VAL A 1 62  ? 16.725 -46.794 27.041  1.00 24.30 ? 59  VAL A CG1   1 
ATOM   482  C  CG2   . VAL A 1 62  ? 15.690 -45.971 29.179  1.00 21.64 ? 59  VAL A CG2   1 
ATOM   483  N  N     . THR A 1 63  ? 19.804 -45.712 26.915  1.00 23.29 ? 60  THR A N     1 
ATOM   484  C  CA    . THR A 1 63  ? 20.748 -45.397 25.855  1.00 24.09 ? 60  THR A CA    1 
ATOM   485  C  C     . THR A 1 63  ? 20.861 -46.509 24.827  1.00 27.45 ? 60  THR A C     1 
ATOM   486  O  O     . THR A 1 63  ? 20.519 -47.675 25.088  1.00 25.72 ? 60  THR A O     1 
ATOM   487  C  CB    . THR A 1 63  ? 22.188 -45.136 26.398  1.00 25.62 ? 60  THR A CB    1 
ATOM   488  O  OG1   . THR A 1 63  ? 22.709 -46.333 27.000  1.00 29.49 ? 60  THR A OG1   1 
ATOM   489  C  CG2   . THR A 1 63  ? 22.200 -44.030 27.428  1.00 24.25 ? 60  THR A CG2   1 
ATOM   490  N  N     . ARG A 1 64  ? 21.378 -46.129 23.665  1.00 23.66 ? 61  ARG A N     1 
ATOM   491  C  CA    . ARG A 1 64  ? 21.882 -47.077 22.693  1.00 26.44 ? 61  ARG A CA    1 
ATOM   492  C  C     . ARG A 1 64  ? 22.832 -48.067 23.367  1.00 31.30 ? 61  ARG A C     1 
ATOM   493  O  O     . ARG A 1 64  ? 23.519 -47.709 24.335  1.00 30.12 ? 61  ARG A O     1 
ATOM   494  C  CB    . ARG A 1 64  ? 22.593 -46.328 21.561  1.00 27.43 ? 61  ARG A CB    1 
ATOM   495  C  CG    . ARG A 1 64  ? 23.186 -47.227 20.533  1.00 31.22 ? 61  ARG A CG    1 
ATOM   496  C  CD    . ARG A 1 64  ? 23.720 -46.484 19.321  1.00 34.95 ? 61  ARG A CD    1 
ATOM   497  N  NE    . ARG A 1 64  ? 24.374 -47.455 18.445  1.00 44.03 ? 61  ARG A NE    1 
ATOM   498  C  CZ    . ARG A 1 64  ? 25.671 -47.746 18.492  1.00 44.82 ? 61  ARG A CZ    1 
ATOM   499  N  NH1   . ARG A 1 64  ? 26.460 -47.095 19.347  1.00 42.55 ? 61  ARG A NH1   1 
ATOM   500  N  NH2   . ARG A 1 64  ? 26.180 -48.671 17.674  1.00 38.32 ? 61  ARG A NH2   1 
ATOM   501  N  N     . SER A 1 65  ? 22.852 -49.302 22.864  1.00 29.33 ? 62  SER A N     1 
ATOM   502  C  CA    . SER A 1 65  ? 23.779 -50.344 23.321  1.00 30.84 ? 62  SER A CA    1 
ATOM   503  C  C     . SER A 1 65  ? 23.477 -50.870 24.706  1.00 31.60 ? 62  SER A C     1 
ATOM   504  O  O     . SER A 1 65  ? 24.309 -51.520 25.335  1.00 35.71 ? 62  SER A O     1 
ATOM   505  C  CB    . SER A 1 65  ? 25.218 -49.846 23.296  1.00 36.40 ? 62  SER A CB    1 
ATOM   506  O  OG    . SER A 1 65  ? 26.033 -50.735 24.030  1.00 48.62 ? 62  SER A OG    1 
ATOM   507  N  N     . MET A 1 66  ? 22.279 -50.583 25.184  1.00 34.59 ? 63  MET A N     1 
ATOM   508  C  CA    . MET A 1 66  ? 21.788 -51.155 26.429  1.00 32.11 ? 63  MET A CA    1 
ATOM   509  C  C     . MET A 1 66  ? 20.982 -52.406 26.113  1.00 28.67 ? 63  MET A C     1 
ATOM   510  O  O     . MET A 1 66  ? 20.320 -52.455 25.073  1.00 30.55 ? 63  MET A O     1 
ATOM   511  C  CB    . MET A 1 66  ? 20.922 -50.141 27.172  1.00 28.95 ? 63  MET A CB    1 
ATOM   512  C  CG    . MET A 1 66  ? 21.431 -49.734 28.515  1.00 31.29 ? 63  MET A CG    1 
ATOM   513  S  SD    . MET A 1 66  ? 20.320 -48.552 29.306  1.00 27.45 ? 63  MET A SD    1 
ATOM   514  C  CE    . MET A 1 66  ? 21.535 -47.560 30.170  1.00 29.76 ? 63  MET A CE    1 
ATOM   515  N  N     . TRP A 1 67  ? 21.039 -53.412 26.983  1.00 25.99 ? 64  TRP A N     1 
ATOM   516  C  CA    . TRP A 1 67  ? 20.065 -54.508 26.914  1.00 29.86 ? 64  TRP A CA    1 
ATOM   517  C  C     . TRP A 1 67  ? 18.706 -54.027 27.437  1.00 28.06 ? 64  TRP A C     1 
ATOM   518  O  O     . TRP A 1 67  ? 18.652 -53.296 28.424  1.00 28.01 ? 64  TRP A O     1 
ATOM   519  C  CB    . TRP A 1 67  ? 20.542 -55.727 27.705  1.00 29.97 ? 64  TRP A CB    1 
ATOM   520  C  CG    . TRP A 1 67  ? 21.759 -56.343 27.132  1.00 35.41 ? 64  TRP A CG    1 
ATOM   521  C  CD1   . TRP A 1 67  ? 22.981 -56.456 27.729  1.00 34.35 ? 64  TRP A CD1   1 
ATOM   522  C  CD2   . TRP A 1 67  ? 21.890 -56.931 25.824  1.00 36.04 ? 64  TRP A CD2   1 
ATOM   523  N  NE1   . TRP A 1 67  ? 23.864 -57.087 26.877  1.00 43.44 ? 64  TRP A NE1   1 
ATOM   524  C  CE2   . TRP A 1 67  ? 23.221 -57.382 25.703  1.00 42.63 ? 64  TRP A CE2   1 
ATOM   525  C  CE3   . TRP A 1 67  ? 21.012 -57.115 24.746  1.00 32.99 ? 64  TRP A CE3   1 
ATOM   526  C  CZ2   . TRP A 1 67  ? 23.693 -58.012 24.542  1.00 42.86 ? 64  TRP A CZ2   1 
ATOM   527  C  CZ3   . TRP A 1 67  ? 21.482 -57.738 23.602  1.00 30.93 ? 64  TRP A CZ3   1 
ATOM   528  C  CH2   . TRP A 1 67  ? 22.809 -58.183 23.512  1.00 35.51 ? 64  TRP A CH2   1 
ATOM   529  N  N     . ALA A 1 68  ? 17.616 -54.420 26.776  1.00 27.44 ? 65  ALA A N     1 
ATOM   530  C  CA    . ALA A 1 68  ? 16.278 -53.928 27.150  1.00 26.92 ? 65  ALA A CA    1 
ATOM   531  C  C     . ALA A 1 68  ? 15.914 -54.261 28.605  1.00 26.63 ? 65  ALA A C     1 
ATOM   532  O  O     . ALA A 1 68  ? 15.288 -53.463 29.294  1.00 25.15 ? 65  ALA A O     1 
ATOM   533  C  CB    . ALA A 1 68  ? 15.218 -54.487 26.201  1.00 22.25 ? 65  ALA A CB    1 
ATOM   534  N  N     . ASP A 1 69  ? 16.318 -55.442 29.070  1.00 27.93 ? 66  ASP A N     1 
ATOM   535  C  CA    . ASP A 1 69  ? 16.031 -55.832 30.444  1.00 30.98 ? 66  ASP A CA    1 
ATOM   536  C  C     . ASP A 1 69  ? 16.715 -54.891 31.441  1.00 28.86 ? 66  ASP A C     1 
ATOM   537  O  O     . ASP A 1 69  ? 16.199 -54.631 32.519  1.00 26.09 ? 66  ASP A O     1 
ATOM   538  C  CB    . ASP A 1 69  ? 16.450 -57.287 30.693  1.00 29.66 ? 66  ASP A CB    1 
ATOM   539  C  CG    . ASP A 1 69  ? 15.481 -58.279 30.085  1.00 30.67 ? 66  ASP A CG    1 
ATOM   540  O  OD1   . ASP A 1 69  ? 14.384 -57.855 29.657  1.00 28.78 ? 66  ASP A OD1   1 
ATOM   541  O  OD2   . ASP A 1 69  ? 15.802 -59.486 30.054  1.00 35.37 ? 66  ASP A OD2   1 
ATOM   542  N  N     . ASP A 1 70  ? 17.873 -54.364 31.075  1.00 29.47 ? 67  ASP A N     1 
ATOM   543  C  CA    . ASP A 1 70  ? 18.531 -53.393 31.939  1.00 27.32 ? 67  ASP A CA    1 
ATOM   544  C  C     . ASP A 1 70  ? 17.833 -52.045 31.853  1.00 24.75 ? 67  ASP A C     1 
ATOM   545  O  O     . ASP A 1 70  ? 17.678 -51.351 32.853  1.00 24.22 ? 67  ASP A O     1 
ATOM   546  C  CB    . ASP A 1 70  ? 20.009 -53.270 31.564  1.00 28.46 ? 67  ASP A CB    1 
ATOM   547  C  CG    . ASP A 1 70  ? 20.763 -54.580 31.763  1.00 32.56 ? 67  ASP A CG    1 
ATOM   548  O  OD1   . ASP A 1 70  ? 20.428 -55.331 32.711  1.00 34.86 ? 67  ASP A OD1   1 
ATOM   549  O  OD2   . ASP A 1 70  ? 21.681 -54.867 30.974  1.00 30.28 ? 67  ASP A OD2   1 
ATOM   550  N  N     . ALA A 1 71  ? 17.393 -51.695 30.650  1.00 22.66 ? 68  ALA A N     1 
ATOM   551  C  CA    . ALA A 1 71  ? 16.734 -50.414 30.400  1.00 26.02 ? 68  ALA A CA    1 
ATOM   552  C  C     . ALA A 1 71  ? 15.446 -50.261 31.197  1.00 26.83 ? 68  ALA A C     1 
ATOM   553  O  O     . ALA A 1 71  ? 15.095 -49.152 31.618  1.00 24.62 ? 68  ALA A O     1 
ATOM   554  C  CB    . ALA A 1 71  ? 16.440 -50.256 28.925  1.00 24.13 ? 68  ALA A CB    1 
ATOM   555  N  N     . LYS A 1 72  ? 14.744 -51.380 31.369  1.00 23.70 ? 69  LYS A N     1 
ATOM   556  C  CA    . LYS A 1 72  ? 13.510 -51.443 32.160  1.00 27.30 ? 69  LYS A CA    1 
ATOM   557  C  C     . LYS A 1 72  ? 13.761 -51.181 33.646  1.00 24.11 ? 69  LYS A C     1 
ATOM   558  O  O     . LYS A 1 72  ? 12.857 -50.810 34.366  1.00 23.16 ? 69  LYS A O     1 
ATOM   559  C  CB    . LYS A 1 72  ? 12.844 -52.817 32.000  1.00 26.42 ? 69  LYS A CB    1 
ATOM   560  C  CG    . LYS A 1 72  ? 12.474 -53.182 30.589  1.00 24.06 ? 69  LYS A CG    1 
ATOM   561  C  CD    . LYS A 1 72  ? 11.181 -52.538 30.209  1.00 26.02 ? 69  LYS A CD    1 
ATOM   562  C  CE    . LYS A 1 72  ? 10.738 -52.985 28.843  1.00 31.67 ? 69  LYS A CE    1 
ATOM   563  N  NZ    . LYS A 1 72  ? 10.125 -54.348 28.845  1.00 32.64 ? 69  LYS A NZ    1 
ATOM   564  N  N     . LYS A 1 73  ? 14.985 -51.401 34.111  1.00 27.18 ? 70  LYS A N     1 
ATOM   565  C  CA    . LYS A 1 73  ? 15.286 -51.154 35.515  1.00 27.27 ? 70  LYS A CA    1 
ATOM   566  C  C     . LYS A 1 73  ? 15.341 -49.653 35.742  1.00 25.81 ? 70  LYS A C     1 
ATOM   567  O  O     . LYS A 1 73  ? 15.026 -49.161 36.817  1.00 26.80 ? 70  LYS A O     1 
ATOM   568  C  CB    . LYS A 1 73  ? 16.600 -51.815 35.931  1.00 24.34 ? 70  LYS A CB    1 
ATOM   569  C  CG    . LYS A 1 73  ? 16.703 -53.275 35.548  1.00 23.31 ? 70  LYS A CG    1 
ATOM   570  C  CD    . LYS A 1 73  ? 18.122 -53.806 35.819  1.00 24.44 ? 70  LYS A CD    1 
ATOM   571  C  CE    . LYS A 1 73  ? 18.245 -55.262 35.364  1.00 27.83 ? 70  LYS A CE    1 
ATOM   572  N  NZ    . LYS A 1 73  ? 19.546 -55.901 35.741  1.00 37.29 ? 70  LYS A NZ    1 
ATOM   573  N  N     . LEU A 1 74  ? 15.747 -48.931 34.709  1.00 27.29 ? 71  LEU A N     1 
ATOM   574  C  CA    . LEU A 1 74  ? 15.790 -47.482 34.763  1.00 25.74 ? 71  LEU A CA    1 
ATOM   575  C  C     . LEU A 1 74  ? 14.422 -46.901 34.430  1.00 26.64 ? 71  LEU A C     1 
ATOM   576  O  O     . LEU A 1 74  ? 14.045 -45.869 34.954  1.00 25.28 ? 71  LEU A O     1 
ATOM   577  C  CB    . LEU A 1 74  ? 16.838 -46.950 33.785  1.00 24.05 ? 71  LEU A CB    1 
ATOM   578  C  CG    . LEU A 1 74  ? 18.278 -47.401 33.993  1.00 26.43 ? 71  LEU A CG    1 
ATOM   579  C  CD1   . LEU A 1 74  ? 19.130 -46.992 32.811  1.00 25.47 ? 71  LEU A CD1   1 
ATOM   580  C  CD2   . LEU A 1 74  ? 18.830 -46.790 35.269  1.00 26.34 ? 71  LEU A CD2   1 
ATOM   581  N  N     . CYS A 1 75  ? 13.688 -47.581 33.550  1.00 26.81 ? 72  CYS A N     1 
ATOM   582  C  CA    . CYS A 1 75  ? 12.437 -47.074 33.001  1.00 24.56 ? 72  CYS A CA    1 
ATOM   583  C  C     . CYS A 1 75  ? 11.394 -48.197 32.853  1.00 26.13 ? 72  CYS A C     1 
ATOM   584  O  O     . CYS A 1 75  ? 11.315 -48.834 31.800  1.00 25.48 ? 72  CYS A O     1 
ATOM   585  C  CB    . CYS A 1 75  ? 12.707 -46.409 31.642  1.00 27.17 ? 72  CYS A CB    1 
ATOM   586  S  SG    . CYS A 1 75  ? 11.251 -45.643 30.850  1.00 31.08 ? 72  CYS A SG    1 
ATOM   587  N  N     . PRO A 1 76  ? 10.601 -48.449 33.912  1.00 23.02 ? 73  PRO A N     1 
ATOM   588  C  CA    . PRO A 1 76  ? 9.642  -49.568 33.952  1.00 23.14 ? 73  PRO A CA    1 
ATOM   589  C  C     . PRO A 1 76  ? 8.481  -49.458 32.962  1.00 28.03 ? 73  PRO A C     1 
ATOM   590  O  O     . PRO A 1 76  ? 7.850  -50.468 32.633  1.00 30.13 ? 73  PRO A O     1 
ATOM   591  C  CB    . PRO A 1 76  ? 9.108  -49.532 35.391  1.00 26.42 ? 73  PRO A CB    1 
ATOM   592  C  CG    . PRO A 1 76  ? 10.138 -48.755 36.178  1.00 24.49 ? 73  PRO A CG    1 
ATOM   593  C  CD    . PRO A 1 76  ? 10.724 -47.766 35.213  1.00 21.74 ? 73  PRO A CD    1 
ATOM   594  N  N     . ASP A 1 77  ? 8.192  -48.257 32.487  1.00 28.85 ? 74  ASP A N     1 
ATOM   595  C  CA    . ASP A 1 77  ? 7.111  -48.091 31.523  1.00 29.17 ? 74  ASP A CA    1 
ATOM   596  C  C     . ASP A 1 77  ? 7.617  -48.049 30.070  1.00 30.72 ? 74  ASP A C     1 
ATOM   597  O  O     . ASP A 1 77  ? 6.858  -47.709 29.156  1.00 29.74 ? 74  ASP A O     1 
ATOM   598  C  CB    . ASP A 1 77  ? 6.321  -46.816 31.847  1.00 36.88 ? 74  ASP A CB    1 
ATOM   599  C  CG    . ASP A 1 77  ? 5.539  -46.924 33.156  1.00 41.41 ? 74  ASP A CG    1 
ATOM   600  O  OD1   . ASP A 1 77  ? 4.871  -47.959 33.369  1.00 41.22 ? 74  ASP A OD1   1 
ATOM   601  O  OD2   . ASP A 1 77  ? 5.604  -45.977 33.973  1.00 41.12 ? 74  ASP A OD2   1 
ATOM   602  N  N     . LEU A 1 78  ? 8.893  -48.394 29.872  1.00 26.26 ? 75  LEU A N     1 
ATOM   603  C  CA    . LEU A 1 78  ? 9.527  -48.343 28.558  1.00 25.54 ? 75  LEU A CA    1 
ATOM   604  C  C     . LEU A 1 78  ? 8.837  -49.272 27.572  1.00 26.28 ? 75  LEU A C     1 
ATOM   605  O  O     . LEU A 1 78  ? 8.777  -50.491 27.772  1.00 24.41 ? 75  LEU A O     1 
ATOM   606  C  CB    . LEU A 1 78  ? 11.010 -48.710 28.653  1.00 25.18 ? 75  LEU A CB    1 
ATOM   607  C  CG    . LEU A 1 78  ? 11.833 -48.812 27.369  1.00 20.12 ? 75  LEU A CG    1 
ATOM   608  C  CD1   . LEU A 1 78  ? 12.015 -47.472 26.751  1.00 18.78 ? 75  LEU A CD1   1 
ATOM   609  C  CD2   . LEU A 1 78  ? 13.191 -49.431 27.663  1.00 21.95 ? 75  LEU A CD2   1 
ATOM   610  N  N     . LEU A 1 79  ? 8.315  -48.679 26.509  1.00 24.71 ? 76  LEU A N     1 
ATOM   611  C  CA    . LEU A 1 79  ? 7.708  -49.434 25.441  1.00 22.23 ? 76  LEU A CA    1 
ATOM   612  C  C     . LEU A 1 79  ? 8.799  -49.790 24.450  1.00 21.03 ? 76  LEU A C     1 
ATOM   613  O  O     . LEU A 1 79  ? 9.809  -49.115 24.373  1.00 24.96 ? 76  LEU A O     1 
ATOM   614  C  CB    . LEU A 1 79  ? 6.575  -48.639 24.795  1.00 21.13 ? 76  LEU A CB    1 
ATOM   615  C  CG    . LEU A 1 79  ? 5.431  -48.274 25.752  1.00 22.76 ? 76  LEU A CG    1 
ATOM   616  C  CD1   . LEU A 1 79  ? 4.408  -47.374 25.084  1.00 20.90 ? 76  LEU A CD1   1 
ATOM   617  C  CD2   . LEU A 1 79  ? 4.759  -49.541 26.294  1.00 21.18 ? 76  LEU A CD2   1 
ATOM   618  N  N     . LEU A 1 80  ? 8.592  -50.876 23.716  1.00 24.96 ? 77  LEU A N     1 
ATOM   619  C  CA    . LEU A 1 80  ? 9.592  -51.460 22.836  1.00 23.71 ? 77  LEU A CA    1 
ATOM   620  C  C     . LEU A 1 80  ? 8.970  -51.879 21.519  1.00 26.67 ? 77  LEU A C     1 
ATOM   621  O  O     . LEU A 1 80  ? 7.815  -52.308 21.477  1.00 30.21 ? 77  LEU A O     1 
ATOM   622  C  CB    . LEU A 1 80  ? 10.248 -52.688 23.483  1.00 22.99 ? 77  LEU A CB    1 
ATOM   623  C  CG    . LEU A 1 80  ? 11.047 -52.440 24.756  1.00 27.10 ? 77  LEU A CG    1 
ATOM   624  C  CD1   . LEU A 1 80  ? 11.556 -53.761 25.318  1.00 25.27 ? 77  LEU A CD1   1 
ATOM   625  C  CD2   . LEU A 1 80  ? 12.192 -51.499 24.471  1.00 22.83 ? 77  LEU A CD2   1 
ATOM   626  N  N     . ALA A 1 81  ? 9.747  -51.762 20.450  1.00 22.49 ? 78  ALA A N     1 
ATOM   627  C  CA    . ALA A 1 81  ? 9.379  -52.307 19.156  1.00 23.25 ? 78  ALA A CA    1 
ATOM   628  C  C     . ALA A 1 81  ? 10.590 -53.078 18.665  1.00 23.61 ? 78  ALA A C     1 
ATOM   629  O  O     . ALA A 1 81  ? 11.728 -52.627 18.841  1.00 22.74 ? 78  ALA A O     1 
ATOM   630  C  CB    . ALA A 1 81  ? 8.982  -51.206 18.190  1.00 21.32 ? 78  ALA A CB    1 
ATOM   631  N  N     . GLN A 1 82  ? 10.381 -54.255 18.093  1.00 25.08 ? 79  GLN A N     1 
ATOM   632  C  CA    . GLN A 1 82  ? 11.539 -55.056 17.722  1.00 26.99 ? 79  GLN A CA    1 
ATOM   633  C  C     . GLN A 1 82  ? 11.743 -55.064 16.210  1.00 26.25 ? 79  GLN A C     1 
ATOM   634  O  O     . GLN A 1 82  ? 10.792 -54.973 15.433  1.00 25.36 ? 79  GLN A O     1 
ATOM   635  C  CB    . GLN A 1 82  ? 11.423 -56.485 18.281  1.00 27.92 ? 79  GLN A CB    1 
ATOM   636  C  CG    . GLN A 1 82  ? 10.276 -57.336 17.757  1.00 27.78 ? 79  GLN A CG    1 
ATOM   637  C  CD    . GLN A 1 82  ? 9.881  -58.438 18.750  1.00 34.73 ? 79  GLN A CD    1 
ATOM   638  O  OE1   . GLN A 1 82  ? 9.560  -58.157 19.901  1.00 36.34 ? 79  GLN A OE1   1 
ATOM   639  N  NE2   . GLN A 1 82  ? 9.918  -59.689 18.308  1.00 30.50 ? 79  GLN A NE2   1 
ATOM   640  N  N     . VAL A 1 83  ? 13.003 -55.128 15.808  1.00 25.18 ? 80  VAL A N     1 
ATOM   641  C  CA    . VAL A 1 83  ? 13.363 -55.185 14.395  1.00 27.95 ? 80  VAL A CA    1 
ATOM   642  C  C     . VAL A 1 83  ? 12.900 -56.498 13.760  1.00 28.63 ? 80  VAL A C     1 
ATOM   643  O  O     . VAL A 1 83  ? 13.069 -57.569 14.350  1.00 26.92 ? 80  VAL A O     1 
ATOM   644  C  CB    . VAL A 1 83  ? 14.889 -55.031 14.218  1.00 28.67 ? 80  VAL A CB    1 
ATOM   645  C  CG1   . VAL A 1 83  ? 15.296 -55.132 12.762  1.00 26.59 ? 80  VAL A CG1   1 
ATOM   646  C  CG2   . VAL A 1 83  ? 15.357 -53.709 14.823  1.00 30.52 ? 80  VAL A CG2   1 
ATOM   647  N  N     . ARG A 1 84  ? 12.313 -56.399 12.566  1.00 30.29 ? 81  ARG A N     1 
ATOM   648  C  CA    . ARG A 1 84  ? 11.980 -57.556 11.731  1.00 28.46 ? 81  ARG A CA    1 
ATOM   649  C  C     . ARG A 1 84  ? 13.132 -58.550 11.680  1.00 34.02 ? 81  ARG A C     1 
ATOM   650  O  O     . ARG A 1 84  ? 14.293 -58.158 11.561  1.00 34.56 ? 81  ARG A O     1 
ATOM   651  C  CB    . ARG A 1 84  ? 11.648 -57.128 10.296  1.00 29.83 ? 81  ARG A CB    1 
ATOM   652  C  CG    . ARG A 1 84  ? 10.957 -58.222 9.472   1.00 34.44 ? 81  ARG A CG    1 
ATOM   653  C  CD    . ARG A 1 84  ? 11.320 -58.207 7.990   1.00 37.73 ? 81  ARG A CD    1 
ATOM   654  N  NE    . ARG A 1 84  ? 10.564 -57.225 7.217   1.00 49.98 ? 81  ARG A NE    1 
ATOM   655  C  CZ    . ARG A 1 84  ? 10.695 -57.029 5.901   1.00 49.67 ? 81  ARG A CZ    1 
ATOM   656  N  NH1   . ARG A 1 84  ? 11.546 -57.761 5.179   1.00 43.65 ? 81  ARG A NH1   1 
ATOM   657  N  NH2   . ARG A 1 84  ? 9.964  -56.095 5.303   1.00 53.50 ? 81  ARG A NH2   1 
ATOM   658  N  N     . GLU A 1 85  ? 12.811 -59.834 11.766  1.00 30.98 ? 82  GLU A N     1 
ATOM   659  C  CA    . GLU A 1 85  ? 13.810 -60.868 11.605  1.00 28.62 ? 82  GLU A CA    1 
ATOM   660  C  C     . GLU A 1 85  ? 13.483 -61.735 10.424  1.00 30.42 ? 82  GLU A C     1 
ATOM   661  O  O     . GLU A 1 85  ? 12.386 -62.256 10.340  1.00 31.39 ? 82  GLU A O     1 
ATOM   662  C  CB    . GLU A 1 85  ? 13.904 -61.735 12.851  1.00 35.91 ? 82  GLU A CB    1 
ATOM   663  C  CG    . GLU A 1 85  ? 14.965 -61.311 13.803  1.00 31.85 ? 82  GLU A CG    1 
ATOM   664  C  CD    . GLU A 1 85  ? 15.180 -62.342 14.869  1.00 38.39 ? 82  GLU A CD    1 
ATOM   665  O  OE1   . GLU A 1 85  ? 15.776 -63.394 14.562  1.00 36.56 ? 82  GLU A OE1   1 
ATOM   666  O  OE2   . GLU A 1 85  ? 14.734 -62.102 16.007  1.00 43.26 ? 82  GLU A OE2   1 
ATOM   667  N  N     . SER A 1 86  ? 14.450 -61.915 9.528   1.00 36.51 ? 83  SER A N     1 
ATOM   668  C  CA    . SER A 1 86  ? 14.266 -62.765 8.359   1.00 31.00 ? 83  SER A CA    1 
ATOM   669  C  C     . SER A 1 86  ? 15.440 -63.690 8.177   1.00 32.61 ? 83  SER A C     1 
ATOM   670  O  O     . SER A 1 86  ? 16.590 -63.248 8.211   1.00 33.80 ? 83  SER A O     1 
ATOM   671  C  CB    . SER A 1 86  ? 14.082 -61.923 7.104   1.00 28.15 ? 83  SER A CB    1 
ATOM   672  O  OG    . SER A 1 86  ? 12.973 -61.070 7.271   1.00 40.87 ? 83  SER A OG    1 
ATOM   673  N  N     . ARG A 1 87  ? 15.144 -64.966 7.955   1.00 29.09 ? 84  ARG A N     1 
ATOM   674  C  CA    . ARG A 1 87  ? 16.179 -65.971 7.771   1.00 31.76 ? 84  ARG A CA    1 
ATOM   675  C  C     . ARG A 1 87  ? 17.121 -66.000 8.956   1.00 29.43 ? 84  ARG A C     1 
ATOM   676  O  O     . ARG A 1 87  ? 18.325 -66.166 8.795   1.00 29.33 ? 84  ARG A O     1 
ATOM   677  C  CB    . ARG A 1 87  ? 16.968 -65.711 6.488   1.00 31.20 ? 84  ARG A CB    1 
ATOM   678  C  CG    . ARG A 1 87  ? 16.097 -65.387 5.319   1.00 30.50 ? 84  ARG A CG    1 
ATOM   679  C  CD    . ARG A 1 87  ? 16.871 -65.427 4.013   1.00 38.34 ? 84  ARG A CD    1 
ATOM   680  N  NE    . ARG A 1 87  ? 15.998 -65.053 2.903   1.00 37.85 ? 84  ARG A NE    1 
ATOM   681  C  CZ    . ARG A 1 87  ? 15.658 -63.799 2.629   1.00 41.23 ? 84  ARG A CZ    1 
ATOM   682  N  NH1   . ARG A 1 87  ? 14.834 -63.546 1.622   1.00 47.01 ? 84  ARG A NH1   1 
ATOM   683  N  NH2   . ARG A 1 87  ? 16.132 -62.797 3.373   1.00 37.85 ? 84  ARG A NH2   1 
ATOM   684  N  N     . GLY A 1 88  ? 16.568 -65.819 10.147  1.00 32.98 ? 85  GLY A N     1 
ATOM   685  C  CA    . GLY A 1 88  ? 17.355 -65.869 11.362  1.00 30.56 ? 85  GLY A CA    1 
ATOM   686  C  C     . GLY A 1 88  ? 18.234 -64.658 11.624  1.00 30.81 ? 85  GLY A C     1 
ATOM   687  O  O     . GLY A 1 88  ? 19.145 -64.728 12.453  1.00 29.01 ? 85  GLY A O     1 
ATOM   688  N  N     . LYS A 1 89  ? 17.992 -63.548 10.931  1.00 26.73 ? 86  LYS A N     1 
ATOM   689  C  CA    . LYS A 1 89  ? 18.746 -62.351 11.258  1.00 25.64 ? 86  LYS A CA    1 
ATOM   690  C  C     . LYS A 1 89  ? 17.931 -61.069 11.217  1.00 26.57 ? 86  LYS A C     1 
ATOM   691  O  O     . LYS A 1 89  ? 16.805 -61.033 10.730  1.00 27.30 ? 86  LYS A O     1 
ATOM   692  C  CB    . LYS A 1 89  ? 19.955 -62.215 10.329  1.00 25.34 ? 86  LYS A CB    1 
ATOM   693  C  CG    . LYS A 1 89  ? 19.609 -61.904 8.893   1.00 27.70 ? 86  LYS A CG    1 
ATOM   694  C  CD    . LYS A 1 89  ? 20.860 -61.778 8.020   1.00 29.23 ? 86  LYS A CD    1 
ATOM   695  C  CE    . LYS A 1 89  ? 21.701 -60.580 8.401   1.00 26.55 ? 86  LYS A CE    1 
ATOM   696  N  NZ    . LYS A 1 89  ? 21.008 -59.337 7.981   1.00 29.85 ? 86  LYS A NZ    1 
ATOM   697  N  N     . ALA A 1 90  ? 18.542 -60.017 11.748  1.00 26.94 ? 87  ALA A N     1 
ATOM   698  C  CA    . ALA A 1 90  ? 18.012 -58.671 11.689  1.00 26.66 ? 87  ALA A CA    1 
ATOM   699  C  C     . ALA A 1 90  ? 17.780 -58.279 10.253  1.00 30.92 ? 87  ALA A C     1 
ATOM   700  O  O     . ALA A 1 90  ? 18.608 -58.561 9.376   1.00 35.42 ? 87  ALA A O     1 
ATOM   701  C  CB    . ALA A 1 90  ? 18.960 -57.703 12.351  1.00 27.40 ? 87  ALA A CB    1 
ATOM   702  N  N     . ASN A 1 91  ? 16.649 -57.633 10.004  1.00 29.50 ? 88  ASN A N     1 
ATOM   703  C  CA    . ASN A 1 91  ? 16.303 -57.208 8.656   1.00 28.83 ? 88  ASN A CA    1 
ATOM   704  C  C     . ASN A 1 91  ? 15.891 -55.755 8.703   1.00 29.03 ? 88  ASN A C     1 
ATOM   705  O  O     . ASN A 1 91  ? 14.855 -55.424 9.278   1.00 26.18 ? 88  ASN A O     1 
ATOM   706  C  CB    . ASN A 1 91  ? 15.184 -58.077 8.091   1.00 31.80 ? 88  ASN A CB    1 
ATOM   707  C  CG    . ASN A 1 91  ? 14.937 -57.829 6.625   1.00 34.81 ? 88  ASN A CG    1 
ATOM   708  O  OD1   . ASN A 1 91  ? 14.727 -56.697 6.197   1.00 32.49 ? 88  ASN A OD1   1 
ATOM   709  N  ND2   . ASN A 1 91  ? 14.968 -58.894 5.841   1.00 36.19 ? 88  ASN A ND2   1 
ATOM   710  N  N     . LEU A 1 92  ? 16.691 -54.885 8.097   1.00 27.67 ? 89  LEU A N     1 
ATOM   711  C  CA    . LEU A 1 92  ? 16.497 -53.457 8.312   1.00 30.48 ? 89  LEU A CA    1 
ATOM   712  C  C     . LEU A 1 92  ? 15.714 -52.804 7.189   1.00 26.19 ? 89  LEU A C     1 
ATOM   713  O  O     . LEU A 1 92  ? 15.715 -51.581 7.051   1.00 25.06 ? 89  LEU A O     1 
ATOM   714  C  CB    . LEU A 1 92  ? 17.847 -52.753 8.486   1.00 27.90 ? 89  LEU A CB    1 
ATOM   715  C  CG    . LEU A 1 92  ? 18.699 -53.259 9.660   1.00 25.39 ? 89  LEU A CG    1 
ATOM   716  C  CD1   . LEU A 1 92  ? 19.985 -52.455 9.757   1.00 29.29 ? 89  LEU A CD1   1 
ATOM   717  C  CD2   . LEU A 1 92  ? 17.930 -53.184 10.949  1.00 21.59 ? 89  LEU A CD2   1 
ATOM   718  N  N     . THR A 1 93  ? 15.038 -53.621 6.396   1.00 22.06 ? 90  THR A N     1 
ATOM   719  C  CA    . THR A 1 93  ? 14.363 -53.127 5.197   1.00 26.93 ? 90  THR A CA    1 
ATOM   720  C  C     . THR A 1 93  ? 13.405 -51.936 5.439   1.00 24.67 ? 90  THR A C     1 
ATOM   721  O  O     . THR A 1 93  ? 13.367 -51.011 4.636   1.00 23.92 ? 90  THR A O     1 
ATOM   722  C  CB    . THR A 1 93  ? 13.601 -54.296 4.507   1.00 26.43 ? 90  THR A CB    1 
ATOM   723  O  OG1   . THR A 1 93  ? 14.556 -55.272 4.078   1.00 28.86 ? 90  THR A OG1   1 
ATOM   724  C  CG2   . THR A 1 93  ? 12.824 -53.826 3.308   1.00 21.71 ? 90  THR A CG2   1 
ATOM   725  N  N     . LYS A 1 94  ? 12.660 -51.948 6.547   1.00 20.50 ? 91  LYS A N     1 
ATOM   726  C  CA    . LYS A 1 94  ? 11.691 -50.888 6.828   1.00 23.64 ? 91  LYS A CA    1 
ATOM   727  C  C     . LYS A 1 94  ? 12.333 -49.506 7.040   1.00 21.47 ? 91  LYS A C     1 
ATOM   728  O  O     . LYS A 1 94  ? 11.778 -48.509 6.605   1.00 23.78 ? 91  LYS A O     1 
ATOM   729  C  CB    . LYS A 1 94  ? 10.847 -51.266 8.043   1.00 23.21 ? 91  LYS A CB    1 
ATOM   730  C  CG    . LYS A 1 94  ? 9.559  -50.503 8.179   1.00 21.57 ? 91  LYS A CG    1 
ATOM   731  C  CD    . LYS A 1 94  ? 9.049  -50.522 9.629   1.00 21.21 ? 91  LYS A CD    1 
ATOM   732  C  CE    . LYS A 1 94  ? 8.600  -51.905 10.054  1.00 23.63 ? 91  LYS A CE    1 
ATOM   733  N  NZ    . LYS A 1 94  ? 8.228  -51.936 11.491  1.00 25.80 ? 91  LYS A NZ    1 
ATOM   734  N  N     . TYR A 1 95  ? 13.506 -49.454 7.670   1.00 19.81 ? 92  TYR A N     1 
ATOM   735  C  CA    . TYR A 1 95  ? 14.220 -48.196 7.907   1.00 19.77 ? 92  TYR A CA    1 
ATOM   736  C  C     . TYR A 1 95  ? 14.958 -47.696 6.656   1.00 23.65 ? 92  TYR A C     1 
ATOM   737  O  O     . TYR A 1 95  ? 14.965 -46.490 6.369   1.00 23.85 ? 92  TYR A O     1 
ATOM   738  C  CB    . TYR A 1 95  ? 15.185 -48.366 9.093   1.00 20.84 ? 92  TYR A CB    1 
ATOM   739  C  CG    . TYR A 1 95  ? 14.500 -49.108 10.210  1.00 23.30 ? 92  TYR A CG    1 
ATOM   740  C  CD1   . TYR A 1 95  ? 13.472 -48.511 10.926  1.00 22.35 ? 92  TYR A CD1   1 
ATOM   741  C  CD2   . TYR A 1 95  ? 14.816 -50.422 10.501  1.00 26.09 ? 92  TYR A CD2   1 
ATOM   742  C  CE1   . TYR A 1 95  ? 12.808 -49.178 11.914  1.00 21.46 ? 92  TYR A CE1   1 
ATOM   743  C  CE2   . TYR A 1 95  ? 14.145 -51.110 11.507  1.00 25.43 ? 92  TYR A CE2   1 
ATOM   744  C  CZ    . TYR A 1 95  ? 13.139 -50.475 12.205  1.00 24.82 ? 92  TYR A CZ    1 
ATOM   745  O  OH    . TYR A 1 95  ? 12.440 -51.138 13.195  1.00 25.27 ? 92  TYR A OH    1 
ATOM   746  N  N     . ARG A 1 96  ? 15.552 -48.616 5.898   1.00 24.11 ? 93  ARG A N     1 
ATOM   747  C  CA    . ARG A 1 96  ? 16.135 -48.264 4.601   1.00 24.41 ? 93  ARG A CA    1 
ATOM   748  C  C     . ARG A 1 96  ? 15.075 -47.614 3.719   1.00 25.62 ? 93  ARG A C     1 
ATOM   749  O  O     . ARG A 1 96  ? 15.314 -46.576 3.097   1.00 26.20 ? 93  ARG A O     1 
ATOM   750  C  CB    . ARG A 1 96  ? 16.722 -49.496 3.912   1.00 23.64 ? 93  ARG A CB    1 
ATOM   751  C  CG    . ARG A 1 96  ? 17.954 -50.052 4.593   1.00 25.79 ? 93  ARG A CG    1 
ATOM   752  C  CD    . ARG A 1 96  ? 18.758 -51.012 3.714   1.00 27.49 ? 93  ARG A CD    1 
ATOM   753  N  NE    . ARG A 1 96  ? 19.828 -51.602 4.515   1.00 32.92 ? 93  ARG A NE    1 
ATOM   754  C  CZ    . ARG A 1 96  ? 19.761 -52.774 5.151   1.00 30.33 ? 93  ARG A CZ    1 
ATOM   755  N  NH1   . ARG A 1 96  ? 20.802 -53.178 5.872   1.00 30.70 ? 93  ARG A NH1   1 
ATOM   756  N  NH2   . ARG A 1 96  ? 18.674 -53.543 5.073   1.00 28.67 ? 93  ARG A NH2   1 
ATOM   757  N  N     . GLU A 1 97  ? 13.885 -48.212 3.686   1.00 25.11 ? 94  GLU A N     1 
ATOM   758  C  CA    . GLU A 1 97  ? 12.790 -47.642 2.897   1.00 25.22 ? 94  GLU A CA    1 
ATOM   759  C  C     . GLU A 1 97  ? 12.350 -46.303 3.457   1.00 26.54 ? 94  GLU A C     1 
ATOM   760  O  O     . GLU A 1 97  ? 11.988 -45.404 2.703   1.00 31.51 ? 94  GLU A O     1 
ATOM   761  C  CB    . GLU A 1 97  ? 11.598 -48.597 2.844   1.00 25.35 ? 94  GLU A CB    1 
ATOM   762  C  CG    . GLU A 1 97  ? 11.884 -49.865 2.066   1.00 29.86 ? 94  GLU A CG    1 
ATOM   763  C  CD    . GLU A 1 97  ? 10.677 -50.776 1.935   1.00 38.21 ? 94  GLU A CD    1 
ATOM   764  O  OE1   . GLU A 1 97  ? 9.712  -50.619 2.724   1.00 37.26 ? 94  GLU A OE1   1 
ATOM   765  O  OE2   . GLU A 1 97  ? 10.699 -51.646 1.029   1.00 46.49 ? 94  GLU A OE2   1 
ATOM   766  N  N     . ALA A 1 98  ? 12.349 -46.175 4.782   1.00 26.14 ? 95  ALA A N     1 
ATOM   767  C  CA    . ALA A 1 98  ? 11.898 -44.938 5.400   1.00 24.03 ? 95  ALA A CA    1 
ATOM   768  C  C     . ALA A 1 98  ? 12.898 -43.851 5.073   1.00 24.77 ? 95  ALA A C     1 
ATOM   769  O  O     . ALA A 1 98  ? 12.530 -42.697 4.868   1.00 25.13 ? 95  ALA A O     1 
ATOM   770  C  CB    . ALA A 1 98  ? 11.749 -45.102 6.884   1.00 23.94 ? 95  ALA A CB    1 
ATOM   771  N  N     . SER A 1 99  ? 14.169 -44.245 5.015   1.00 27.67 ? 96  SER A N     1 
ATOM   772  C  CA    . SER A 1 99  ? 15.274 -43.346 4.695   1.00 25.07 ? 96  SER A CA    1 
ATOM   773  C  C     . SER A 1 99  ? 15.147 -42.758 3.290   1.00 25.12 ? 96  SER A C     1 
ATOM   774  O  O     . SER A 1 99  ? 15.380 -41.574 3.076   1.00 24.89 ? 96  SER A O     1 
ATOM   775  C  CB    . SER A 1 99  ? 16.600 -44.097 4.826   1.00 25.19 ? 96  SER A CB    1 
ATOM   776  O  OG    . SER A 1 99  ? 17.719 -43.258 4.567   1.00 25.88 ? 96  SER A OG    1 
ATOM   777  N  N     . VAL A 1 100 ? 14.800 -43.609 2.335   1.00 25.29 ? 97  VAL A N     1 
ATOM   778  C  CA    . VAL A 1 100 ? 14.502 -43.177 0.974   1.00 27.16 ? 97  VAL A CA    1 
ATOM   779  C  C     . VAL A 1 100 ? 13.372 -42.142 0.923   1.00 28.28 ? 97  VAL A C     1 
ATOM   780  O  O     . VAL A 1 100 ? 13.423 -41.210 0.118   1.00 27.31 ? 97  VAL A O     1 
ATOM   781  C  CB    . VAL A 1 100 ? 14.144 -44.394 0.081   1.00 26.38 ? 97  VAL A CB    1 
ATOM   782  C  CG1   . VAL A 1 100 ? 13.519 -43.960 -1.243  1.00 29.67 ? 97  VAL A CG1   1 
ATOM   783  C  CG2   . VAL A 1 100 ? 15.391 -45.235 -0.172  1.00 24.57 ? 97  VAL A CG2   1 
ATOM   784  N  N     . GLU A 1 101 ? 12.358 -42.290 1.777   1.00 28.85 ? 98  GLU A N     1 
ATOM   785  C  CA    . GLU A 1 101 ? 11.320 -41.259 1.871   1.00 28.27 ? 98  GLU A CA    1 
ATOM   786  C  C     . GLU A 1 101 ? 11.920 -39.904 2.177   1.00 26.84 ? 98  GLU A C     1 
ATOM   787  O  O     . GLU A 1 101 ? 11.585 -38.907 1.542   1.00 27.86 ? 98  GLU A O     1 
ATOM   788  C  CB    . GLU A 1 101 ? 10.296 -41.575 2.959   1.00 26.19 ? 98  GLU A CB    1 
ATOM   789  C  CG    . GLU A 1 101 ? 9.279  -42.641 2.624   1.00 30.90 ? 98  GLU A CG    1 
ATOM   790  C  CD    . GLU A 1 101 ? 8.209  -42.718 3.693   1.00 32.36 ? 98  GLU A CD    1 
ATOM   791  O  OE1   . GLU A 1 101 ? 7.393  -41.778 3.769   1.00 31.34 ? 98  GLU A OE1   1 
ATOM   792  O  OE2   . GLU A 1 101 ? 8.221  -43.683 4.487   1.00 29.60 ? 98  GLU A OE2   1 
ATOM   793  N  N     . VAL A 1 102 ? 12.787 -39.885 3.184   1.00 26.12 ? 99  VAL A N     1 
ATOM   794  C  CA    . VAL A 1 102 ? 13.414 -38.655 3.643   1.00 28.30 ? 99  VAL A CA    1 
ATOM   795  C  C     . VAL A 1 102 ? 14.375 -38.094 2.617   1.00 28.32 ? 99  VAL A C     1 
ATOM   796  O  O     . VAL A 1 102 ? 14.339 -36.895 2.322   1.00 27.76 ? 99  VAL A O     1 
ATOM   797  C  CB    . VAL A 1 102 ? 14.176 -38.868 4.951   1.00 25.57 ? 99  VAL A CB    1 
ATOM   798  C  CG1   . VAL A 1 102 ? 14.887 -37.582 5.342   1.00 27.07 ? 99  VAL A CG1   1 
ATOM   799  C  CG2   . VAL A 1 102 ? 13.218 -39.322 6.032   1.00 27.70 ? 99  VAL A CG2   1 
ATOM   800  N  N     . MET A 1 103 ? 15.235 -38.963 2.084   1.00 25.61 ? 100 MET A N     1 
ATOM   801  C  CA    . MET A 1 103 ? 16.273 -38.537 1.144   1.00 26.90 ? 100 MET A CA    1 
ATOM   802  C  C     . MET A 1 103 ? 15.670 -37.880 -0.099  1.00 28.93 ? 100 MET A C     1 
ATOM   803  O  O     . MET A 1 103 ? 16.150 -36.854 -0.561  1.00 31.51 ? 100 MET A O     1 
ATOM   804  C  CB    . MET A 1 103 ? 17.158 -39.720 0.727   1.00 29.77 ? 100 MET A CB    1 
ATOM   805  C  CG    . MET A 1 103 ? 17.944 -40.400 1.859   1.00 28.41 ? 100 MET A CG    1 
ATOM   806  S  SD    . MET A 1 103 ? 19.110 -39.267 2.603   1.00 35.77 ? 100 MET A SD    1 
ATOM   807  C  CE    . MET A 1 103 ? 19.967 -40.267 3.811   1.00 25.65 ? 100 MET A CE    1 
ATOM   808  N  N     . GLU A 1 104 ? 14.601 -38.461 -0.619  1.00 26.87 ? 101 GLU A N     1 
ATOM   809  C  CA    . GLU A 1 104 ? 13.992 -37.969 -1.842  1.00 31.66 ? 101 GLU A CA    1 
ATOM   810  C  C     . GLU A 1 104 ? 13.443 -36.559 -1.707  1.00 28.62 ? 101 GLU A C     1 
ATOM   811  O  O     . GLU A 1 104 ? 13.624 -35.733 -2.593  1.00 32.19 ? 101 GLU A O     1 
ATOM   812  C  CB    . GLU A 1 104 ? 12.891 -38.925 -2.300  1.00 33.17 ? 101 GLU A CB    1 
ATOM   813  C  CG    . GLU A 1 104 ? 13.459 -40.195 -2.918  1.00 38.00 ? 101 GLU A CG    1 
ATOM   814  C  CD    . GLU A 1 104 ? 12.393 -41.123 -3.468  1.00 43.50 ? 101 GLU A CD    1 
ATOM   815  O  OE1   . GLU A 1 104 ? 11.207 -40.979 -3.080  1.00 39.80 ? 101 GLU A OE1   1 
ATOM   816  O  OE2   . GLU A 1 104 ? 12.749 -41.994 -4.293  1.00 43.50 ? 101 GLU A OE2   1 
ATOM   817  N  N     . ILE A 1 105 ? 12.786 -36.274 -0.594  1.00 30.43 ? 102 ILE A N     1 
ATOM   818  C  CA    . ILE A 1 105 ? 12.287 -34.924 -0.348  1.00 31.51 ? 102 ILE A CA    1 
ATOM   819  C  C     . ILE A 1 105 ? 13.438 -33.918 -0.229  1.00 28.05 ? 102 ILE A C     1 
ATOM   820  O  O     . ILE A 1 105 ? 13.383 -32.829 -0.813  1.00 27.24 ? 102 ILE A O     1 
ATOM   821  C  CB    . ILE A 1 105 ? 11.427 -34.889 0.911   1.00 28.43 ? 102 ILE A CB    1 
ATOM   822  C  CG1   . ILE A 1 105 ? 10.301 -35.897 0.766   1.00 27.32 ? 102 ILE A CG1   1 
ATOM   823  C  CG2   . ILE A 1 105 ? 10.850 -33.511 1.136   1.00 28.60 ? 102 ILE A CG2   1 
ATOM   824  C  CD1   . ILE A 1 105 ? 9.658  -36.240 2.067   1.00 28.69 ? 102 ILE A CD1   1 
ATOM   825  N  N     . MET A 1 106 ? 14.486 -34.297 0.498   1.00 26.69 ? 103 MET A N     1 
ATOM   826  C  CA    . MET A 1 106 ? 15.666 -33.445 0.643   1.00 27.05 ? 103 MET A CA    1 
ATOM   827  C  C     . MET A 1 106 ? 16.257 -33.132 -0.707  1.00 26.07 ? 103 MET A C     1 
ATOM   828  O  O     . MET A 1 106 ? 16.719 -32.032 -0.941  1.00 27.98 ? 103 MET A O     1 
ATOM   829  C  CB    . MET A 1 106 ? 16.729 -34.107 1.531   1.00 26.66 ? 103 MET A CB    1 
ATOM   830  C  CG    . MET A 1 106 ? 16.336 -34.192 2.994   1.00 25.49 ? 103 MET A CG    1 
ATOM   831  S  SD    . MET A 1 106 ? 17.694 -34.735 4.070   1.00 26.66 ? 103 MET A SD    1 
ATOM   832  C  CE    . MET A 1 106 ? 18.787 -33.351 3.883   1.00 28.79 ? 103 MET A CE    1 
ATOM   833  N  N     . SER A 1 107 ? 16.213 -34.111 -1.600  1.00 27.84 ? 104 SER A N     1 
ATOM   834  C  CA    . SER A 1 107 ? 16.764 -33.968 -2.937  1.00 29.32 ? 104 SER A CA    1 
ATOM   835  C  C     . SER A 1 107 ? 16.034 -32.957 -3.814  1.00 31.55 ? 104 SER A C     1 
ATOM   836  O  O     . SER A 1 107 ? 16.595 -32.504 -4.795  1.00 30.56 ? 104 SER A O     1 
ATOM   837  C  CB    . SER A 1 107 ? 16.772 -35.319 -3.642  1.00 31.46 ? 104 SER A CB    1 
ATOM   838  O  OG    . SER A 1 107 ? 17.873 -36.089 -3.176  1.00 41.52 ? 104 SER A OG    1 
ATOM   839  N  N     . ARG A 1 108 ? 14.793 -32.605 -3.485  1.00 29.42 ? 105 ARG A N     1 
ATOM   840  C  CA    . ARG A 1 108 ? 14.101 -31.601 -4.294  1.00 30.38 ? 105 ARG A CA    1 
ATOM   841  C  C     . ARG A 1 108 ? 14.750 -30.228 -4.131  1.00 29.35 ? 105 ARG A C     1 
ATOM   842  O  O     . ARG A 1 108 ? 14.724 -29.421 -5.054  1.00 30.99 ? 105 ARG A O     1 
ATOM   843  C  CB    . ARG A 1 108 ? 12.615 -31.524 -3.934  1.00 28.94 ? 105 ARG A CB    1 
ATOM   844  C  CG    . ARG A 1 108 ? 11.922 -32.864 -3.912  1.00 28.66 ? 105 ARG A CG    1 
ATOM   845  C  CD    . ARG A 1 108 ? 10.470 -32.677 -4.153  1.00 31.01 ? 105 ARG A CD    1 
ATOM   846  N  NE    . ARG A 1 108 ? 9.869  -31.801 -3.158  1.00 36.76 ? 105 ARG A NE    1 
ATOM   847  C  CZ    . ARG A 1 108 ? 9.037  -32.223 -2.211  1.00 28.96 ? 105 ARG A CZ    1 
ATOM   848  N  NH1   . ARG A 1 108 ? 8.526  -31.364 -1.351  1.00 25.40 ? 105 ARG A NH1   1 
ATOM   849  N  NH2   . ARG A 1 108 ? 8.707  -33.505 -2.138  1.00 27.97 ? 105 ARG A NH2   1 
ATOM   850  N  N     . PHE A 1 109 ? 15.359 -29.987 -2.968  1.00 30.15 ? 106 PHE A N     1 
ATOM   851  C  CA    . PHE A 1 109 ? 15.945 -28.686 -2.634  1.00 26.87 ? 106 PHE A CA    1 
ATOM   852  C  C     . PHE A 1 109 ? 17.379 -28.488 -3.131  1.00 31.06 ? 106 PHE A C     1 
ATOM   853  O  O     . PHE A 1 109 ? 17.760 -27.388 -3.561  1.00 27.07 ? 106 PHE A O     1 
ATOM   854  C  CB    . PHE A 1 109 ? 15.916 -28.484 -1.120  1.00 25.10 ? 106 PHE A CB    1 
ATOM   855  C  CG    . PHE A 1 109 ? 14.530 -28.454 -0.537  1.00 25.52 ? 106 PHE A CG    1 
ATOM   856  C  CD1   . PHE A 1 109 ? 13.826 -29.619 -0.324  1.00 24.71 ? 106 PHE A CD1   1 
ATOM   857  C  CD2   . PHE A 1 109 ? 13.935 -27.252 -0.181  1.00 29.77 ? 106 PHE A CD2   1 
ATOM   858  C  CE1   . PHE A 1 109 ? 12.556 -29.582 0.229   1.00 26.02 ? 106 PHE A CE1   1 
ATOM   859  C  CE2   . PHE A 1 109 ? 12.666 -27.211 0.378   1.00 21.35 ? 106 PHE A CE2   1 
ATOM   860  C  CZ    . PHE A 1 109 ? 11.979 -28.370 0.574   1.00 25.54 ? 106 PHE A CZ    1 
ATOM   861  N  N     . ALA A 1 110 ? 18.182 -29.546 -3.065  1.00 32.58 ? 107 ALA A N     1 
ATOM   862  C  CA    . ALA A 1 110 ? 19.600 -29.412 -3.362  1.00 30.92 ? 107 ALA A CA    1 
ATOM   863  C  C     . ALA A 1 110 ? 20.246 -30.759 -3.582  1.00 34.09 ? 107 ALA A C     1 
ATOM   864  O  O     . ALA A 1 110 ? 19.646 -31.791 -3.319  1.00 33.33 ? 107 ALA A O     1 
ATOM   865  C  CB    . ALA A 1 110 ? 20.305 -28.675 -2.241  1.00 27.04 ? 107 ALA A CB    1 
ATOM   866  N  N     . VAL A 1 111 ? 21.483 -30.749 -4.060  1.00 37.35 ? 108 VAL A N     1 
ATOM   867  C  CA    . VAL A 1 111 ? 22.223 -31.989 -4.187  1.00 40.53 ? 108 VAL A CA    1 
ATOM   868  C  C     . VAL A 1 111 ? 22.661 -32.446 -2.797  1.00 41.02 ? 108 VAL A C     1 
ATOM   869  O  O     . VAL A 1 111 ? 23.215 -31.651 -2.034  1.00 37.10 ? 108 VAL A O     1 
ATOM   870  C  CB    . VAL A 1 111 ? 23.433 -31.834 -5.096  1.00 40.06 ? 108 VAL A CB    1 
ATOM   871  C  CG1   . VAL A 1 111 ? 24.512 -32.863 -4.722  1.00 36.33 ? 108 VAL A CG1   1 
ATOM   872  C  CG2   . VAL A 1 111 ? 23.005 -31.964 -6.557  1.00 41.17 ? 108 VAL A CG2   1 
ATOM   873  N  N     . ILE A 1 112 ? 22.398 -33.712 -2.469  1.00 35.78 ? 109 ILE A N     1 
ATOM   874  C  CA    . ILE A 1 112 ? 22.710 -34.232 -1.139  1.00 34.97 ? 109 ILE A CA    1 
ATOM   875  C  C     . ILE A 1 112 ? 23.762 -35.351 -1.141  1.00 32.11 ? 109 ILE A C     1 
ATOM   876  O  O     . ILE A 1 112 ? 23.932 -36.070 -2.130  1.00 36.20 ? 109 ILE A O     1 
ATOM   877  C  CB    . ILE A 1 112 ? 21.426 -34.763 -0.432  1.00 32.90 ? 109 ILE A CB    1 
ATOM   878  C  CG1   . ILE A 1 112 ? 21.019 -36.129 -0.993  1.00 33.21 ? 109 ILE A CG1   1 
ATOM   879  C  CG2   . ILE A 1 112 ? 20.294 -33.744 -0.552  1.00 29.89 ? 109 ILE A CG2   1 
ATOM   880  C  CD1   . ILE A 1 112 ? 19.945 -36.847 -0.172  1.00 30.97 ? 109 ILE A CD1   1 
ATOM   881  N  N     . GLU A 1 113 ? 24.480 -35.466 -0.028  1.00 30.15 ? 110 GLU A N     1 
ATOM   882  C  CA    . GLU A 1 113 ? 25.331 -36.617 0.249   1.00 27.52 ? 110 GLU A CA    1 
ATOM   883  C  C     . GLU A 1 113 ? 24.741 -37.413 1.392   1.00 27.53 ? 110 GLU A C     1 
ATOM   884  O  O     . GLU A 1 113 ? 24.724 -36.953 2.534   1.00 27.08 ? 110 GLU A O     1 
ATOM   885  C  CB    . GLU A 1 113 ? 26.753 -36.189 0.610   1.00 28.22 ? 110 GLU A CB    1 
ATOM   886  C  CG    . GLU A 1 113 ? 27.690 -37.354 0.936   1.00 27.81 ? 110 GLU A CG    1 
ATOM   887  C  CD    . GLU A 1 113 ? 29.108 -36.908 1.275   1.00 28.49 ? 110 GLU A CD    1 
ATOM   888  O  OE1   . GLU A 1 113 ? 29.920 -37.755 1.700   1.00 36.17 ? 110 GLU A OE1   1 
ATOM   889  O  OE2   . GLU A 1 113 ? 29.423 -35.718 1.114   1.00 26.86 ? 110 GLU A OE2   1 
ATOM   890  N  N     . ARG A 1 114 ? 24.242 -38.600 1.077   1.00 29.46 ? 111 ARG A N     1 
ATOM   891  C  CA    . ARG A 1 114 ? 23.754 -39.539 2.085   1.00 29.56 ? 111 ARG A CA    1 
ATOM   892  C  C     . ARG A 1 114 ? 24.902 -39.993 2.980   1.00 30.32 ? 111 ARG A C     1 
ATOM   893  O  O     . ARG A 1 114 ? 25.865 -40.627 2.500   1.00 31.16 ? 111 ARG A O     1 
ATOM   894  C  CB    . ARG A 1 114 ? 23.101 -40.742 1.404   1.00 32.43 ? 111 ARG A CB    1 
ATOM   895  C  CG    . ARG A 1 114 ? 22.746 -41.879 2.322   1.00 28.73 ? 111 ARG A CG    1 
ATOM   896  C  CD    . ARG A 1 114 ? 22.561 -43.160 1.524   1.00 30.73 ? 111 ARG A CD    1 
ATOM   897  N  NE    . ARG A 1 114 ? 21.657 -44.073 2.211   1.00 30.58 ? 111 ARG A NE    1 
ATOM   898  C  CZ    . ARG A 1 114 ? 22.039 -44.963 3.122   1.00 34.02 ? 111 ARG A CZ    1 
ATOM   899  N  NH1   . ARG A 1 114 ? 23.324 -45.082 3.445   1.00 27.12 ? 111 ARG A NH1   1 
ATOM   900  N  NH2   . ARG A 1 114 ? 21.128 -45.741 3.708   1.00 36.00 ? 111 ARG A NH2   1 
ATOM   901  N  N     . ALA A 1 115 ? 24.824 -39.670 4.271   1.00 22.86 ? 112 ALA A N     1 
ATOM   902  C  CA    . ALA A 1 115 ? 25.956 -39.954 5.143   1.00 22.20 ? 112 ALA A CA    1 
ATOM   903  C  C     . ALA A 1 115 ? 25.700 -41.177 6.002   1.00 23.62 ? 112 ALA A C     1 
ATOM   904  O  O     . ALA A 1 115 ? 26.629 -41.827 6.462   1.00 29.57 ? 112 ALA A O     1 
ATOM   905  C  CB    . ALA A 1 115 ? 26.278 -38.750 6.008   1.00 23.53 ? 112 ALA A CB    1 
ATOM   906  N  N     . SER A 1 116 ? 24.434 -41.492 6.214   1.00 22.75 ? 113 SER A N     1 
ATOM   907  C  CA    . SER A 1 116 ? 24.055 -42.658 6.998   1.00 25.34 ? 113 SER A CA    1 
ATOM   908  C  C     . SER A 1 116 ? 22.645 -43.008 6.580   1.00 21.90 ? 113 SER A C     1 
ATOM   909  O  O     . SER A 1 116 ? 22.087 -42.322 5.738   1.00 22.20 ? 113 SER A O     1 
ATOM   910  C  CB    . SER A 1 116 ? 24.139 -42.376 8.508   1.00 24.57 ? 113 SER A CB    1 
ATOM   911  O  OG    . SER A 1 116 ? 23.118 -41.478 8.923   1.00 24.59 ? 113 SER A OG    1 
ATOM   912  N  N     . ILE A 1 117 ? 22.055 -44.045 7.167   1.00 20.84 ? 114 ILE A N     1 
ATOM   913  C  CA    . ILE A 1 117 ? 20.657 -44.347 6.892   1.00 20.62 ? 114 ILE A CA    1 
ATOM   914  C  C     . ILE A 1 117 ? 19.732 -43.174 7.257   1.00 26.62 ? 114 ILE A C     1 
ATOM   915  O  O     . ILE A 1 117 ? 18.644 -43.055 6.713   1.00 28.88 ? 114 ILE A O     1 
ATOM   916  C  CB    . ILE A 1 117 ? 20.198 -45.604 7.649   1.00 27.77 ? 114 ILE A CB    1 
ATOM   917  C  CG1   . ILE A 1 117 ? 18.873 -46.136 7.077   1.00 21.82 ? 114 ILE A CG1   1 
ATOM   918  C  CG2   . ILE A 1 117 ? 20.128 -45.351 9.167   1.00 25.18 ? 114 ILE A CG2   1 
ATOM   919  C  CD1   . ILE A 1 117 ? 18.684 -47.631 7.377   1.00 23.47 ? 114 ILE A CD1   1 
ATOM   920  N  N     . ASP A 1 118 ? 20.207 -42.276 8.122   1.00 24.90 ? 115 ASP A N     1 
ATOM   921  C  CA    . ASP A 1 118 ? 19.384 -41.290 8.827   1.00 23.71 ? 115 ASP A CA    1 
ATOM   922  C  C     . ASP A 1 118 ? 19.734 -39.836 8.466   1.00 27.80 ? 115 ASP A C     1 
ATOM   923  O  O     . ASP A 1 118 ? 18.903 -38.947 8.628   1.00 28.05 ? 115 ASP A O     1 
ATOM   924  C  CB    . ASP A 1 118 ? 19.527 -41.593 10.342  1.00 27.58 ? 115 ASP A CB    1 
ATOM   925  C  CG    . ASP A 1 118 ? 19.319 -40.400 11.280  1.00 28.03 ? 115 ASP A CG    1 
ATOM   926  O  OD1   . ASP A 1 118 ? 19.490 -39.208 10.960  1.00 41.35 ? 115 ASP A OD1   1 
ATOM   927  O  OD2   . ASP A 1 118 ? 18.937 -40.655 12.427  1.00 29.29 ? 115 ASP A OD2   1 
ATOM   928  N  N     . GLU A 1 119 ? 20.950 -39.574 7.995   1.00 26.15 ? 116 GLU A N     1 
ATOM   929  C  CA    . GLU A 1 119 ? 21.354 -38.192 7.749   1.00 24.55 ? 116 GLU A CA    1 
ATOM   930  C  C     . GLU A 1 119 ? 21.972 -37.983 6.380   1.00 24.82 ? 116 GLU A C     1 
ATOM   931  O  O     . GLU A 1 119 ? 22.483 -38.923 5.770   1.00 22.05 ? 116 GLU A O     1 
ATOM   932  C  CB    . GLU A 1 119 ? 22.341 -37.714 8.825   1.00 23.84 ? 116 GLU A CB    1 
ATOM   933  C  CG    . GLU A 1 119 ? 23.686 -38.391 8.772   1.00 23.66 ? 116 GLU A CG    1 
ATOM   934  C  CD    . GLU A 1 119 ? 24.218 -38.719 10.159  1.00 27.17 ? 116 GLU A CD    1 
ATOM   935  O  OE1   . GLU A 1 119 ? 25.229 -38.121 10.579  1.00 28.82 ? 116 GLU A OE1   1 
ATOM   936  O  OE2   . GLU A 1 119 ? 23.627 -39.581 10.829  1.00 28.68 ? 116 GLU A OE2   1 
ATOM   937  N  N     . ALA A 1 120 ? 21.918 -36.728 5.930   1.00 21.93 ? 117 ALA A N     1 
ATOM   938  C  CA    . ALA A 1 120 ? 22.484 -36.276 4.677   1.00 22.24 ? 117 ALA A CA    1 
ATOM   939  C  C     . ALA A 1 120 ? 23.064 -34.861 4.822   1.00 25.13 ? 117 ALA A C     1 
ATOM   940  O  O     . ALA A 1 120 ? 22.528 -34.044 5.574   1.00 27.27 ? 117 ALA A O     1 
ATOM   941  C  CB    . ALA A 1 120 ? 21.436 -36.301 3.592   1.00 25.31 ? 117 ALA A CB    1 
ATOM   942  N  N     . TYR A 1 121 ? 24.157 -34.579 4.115   1.00 24.13 ? 118 TYR A N     1 
ATOM   943  C  CA    . TYR A 1 121 ? 24.640 -33.212 3.980   1.00 23.56 ? 118 TYR A CA    1 
ATOM   944  C  C     . TYR A 1 121 ? 24.030 -32.567 2.751   1.00 28.15 ? 118 TYR A C     1 
ATOM   945  O  O     . TYR A 1 121 ? 23.564 -33.246 1.825   1.00 24.47 ? 118 TYR A O     1 
ATOM   946  C  CB    . TYR A 1 121 ? 26.159 -33.151 3.893   1.00 25.01 ? 118 TYR A CB    1 
ATOM   947  C  CG    . TYR A 1 121 ? 26.846 -33.631 5.154   1.00 28.34 ? 118 TYR A CG    1 
ATOM   948  C  CD1   . TYR A 1 121 ? 27.211 -32.740 6.162   1.00 25.55 ? 118 TYR A CD1   1 
ATOM   949  C  CD2   . TYR A 1 121 ? 27.126 -34.986 5.338   1.00 24.03 ? 118 TYR A CD2   1 
ATOM   950  C  CE1   . TYR A 1 121 ? 27.849 -33.205 7.335   1.00 29.68 ? 118 TYR A CE1   1 
ATOM   951  C  CE2   . TYR A 1 121 ? 27.746 -35.447 6.481   1.00 22.23 ? 118 TYR A CE2   1 
ATOM   952  C  CZ    . TYR A 1 121 ? 28.115 -34.568 7.474   1.00 27.08 ? 118 TYR A CZ    1 
ATOM   953  O  OH    . TYR A 1 121 ? 28.751 -35.057 8.600   1.00 28.20 ? 118 TYR A OH    1 
ATOM   954  N  N     . VAL A 1 122 ? 24.037 -31.241 2.757   1.00 25.99 ? 119 VAL A N     1 
ATOM   955  C  CA    . VAL A 1 122 ? 23.348 -30.448 1.759   1.00 26.84 ? 119 VAL A CA    1 
ATOM   956  C  C     . VAL A 1 122 ? 24.209 -29.257 1.398   1.00 28.03 ? 119 VAL A C     1 
ATOM   957  O  O     . VAL A 1 122 ? 24.565 -28.478 2.286   1.00 26.95 ? 119 VAL A O     1 
ATOM   958  C  CB    . VAL A 1 122 ? 21.983 -29.922 2.298   1.00 29.51 ? 119 VAL A CB    1 
ATOM   959  C  CG1   . VAL A 1 122 ? 21.105 -29.464 1.159   1.00 29.25 ? 119 VAL A CG1   1 
ATOM   960  C  CG2   . VAL A 1 122 ? 21.267 -30.978 3.147   1.00 28.86 ? 119 VAL A CG2   1 
ATOM   961  N  N     . ASP A 1 123 ? 24.557 -29.088 0.126   1.00 30.12 ? 120 ASP A N     1 
ATOM   962  C  CA    . ASP A 1 123 ? 25.274 -27.867 -0.254  1.00 27.56 ? 120 ASP A CA    1 
ATOM   963  C  C     . ASP A 1 123 ? 24.240 -26.848 -0.718  1.00 30.50 ? 120 ASP A C     1 
ATOM   964  O  O     . ASP A 1 123 ? 23.688 -26.972 -1.810  1.00 27.57 ? 120 ASP A O     1 
ATOM   965  C  CB    . ASP A 1 123 ? 26.326 -28.133 -1.336  1.00 27.31 ? 120 ASP A CB    1 
ATOM   966  C  CG    . ASP A 1 123 ? 27.217 -26.920 -1.598  1.00 32.06 ? 120 ASP A CG    1 
ATOM   967  O  OD1   . ASP A 1 123 ? 26.686 -25.799 -1.734  1.00 31.45 ? 120 ASP A OD1   1 
ATOM   968  O  OD2   . ASP A 1 123 ? 28.459 -27.074 -1.666  1.00 36.01 ? 120 ASP A OD2   1 
ATOM   969  N  N     . LEU A 1 124 ? 23.965 -25.856 0.128   1.00 28.08 ? 121 LEU A N     1 
ATOM   970  C  CA    . LEU A 1 124 ? 22.917 -24.868 -0.141  1.00 26.51 ? 121 LEU A CA    1 
ATOM   971  C  C     . LEU A 1 124 ? 23.461 -23.578 -0.744  1.00 25.15 ? 121 LEU A C     1 
ATOM   972  O  O     . LEU A 1 124 ? 22.742 -22.590 -0.839  1.00 24.83 ? 121 LEU A O     1 
ATOM   973  C  CB    . LEU A 1 124 ? 22.151 -24.547 1.146   1.00 24.53 ? 121 LEU A CB    1 
ATOM   974  C  CG    . LEU A 1 124 ? 21.359 -25.720 1.746   1.00 30.98 ? 121 LEU A CG    1 
ATOM   975  C  CD1   . LEU A 1 124 ? 20.999 -25.497 3.208   1.00 23.78 ? 121 LEU A CD1   1 
ATOM   976  C  CD2   . LEU A 1 124 ? 20.102 -25.988 0.928   1.00 28.18 ? 121 LEU A CD2   1 
ATOM   977  N  N     . THR A 1 125 ? 24.731 -23.589 -1.130  1.00 26.25 ? 122 THR A N     1 
ATOM   978  C  CA    . THR A 1 125 ? 25.388 -22.399 -1.671  1.00 27.60 ? 122 THR A CA    1 
ATOM   979  C  C     . THR A 1 125 ? 24.617 -21.765 -2.835  1.00 28.05 ? 122 THR A C     1 
ATOM   980  O  O     . THR A 1 125 ? 24.320 -20.574 -2.804  1.00 28.45 ? 122 THR A O     1 
ATOM   981  C  CB    . THR A 1 125 ? 26.804 -22.729 -2.139  1.00 26.79 ? 122 THR A CB    1 
ATOM   982  O  OG1   . THR A 1 125 ? 27.531 -23.341 -1.065  1.00 30.08 ? 122 THR A OG1   1 
ATOM   983  C  CG2   . THR A 1 125 ? 27.529 -21.469 -2.597  1.00 20.94 ? 122 THR A CG2   1 
ATOM   984  N  N     . SER A 1 126 ? 24.288 -22.566 -3.851  1.00 26.16 ? 123 SER A N     1 
ATOM   985  C  CA    . SER A 1 126 ? 23.511 -22.086 -4.997  1.00 29.14 ? 123 SER A CA    1 
ATOM   986  C  C     . SER A 1 126 ? 22.063 -21.674 -4.707  1.00 32.60 ? 123 SER A C     1 
ATOM   987  O  O     . SER A 1 126 ? 21.569 -20.698 -5.262  1.00 32.56 ? 123 SER A O     1 
ATOM   988  C  CB    . SER A 1 126 ? 23.501 -23.145 -6.076  1.00 30.22 ? 123 SER A CB    1 
ATOM   989  O  OG    . SER A 1 126 ? 24.756 -23.182 -6.710  1.00 34.94 ? 123 SER A OG    1 
ATOM   990  N  N     . ALA A 1 127 ? 21.382 -22.430 -3.855  1.00 28.44 ? 124 ALA A N     1 
ATOM   991  C  CA    . ALA A 1 127 ? 20.008 -22.114 -3.484  1.00 30.88 ? 124 ALA A CA    1 
ATOM   992  C  C     . ALA A 1 127 ? 19.943 -20.812 -2.702  1.00 31.24 ? 124 ALA A C     1 
ATOM   993  O  O     . ALA A 1 127 ? 18.989 -20.048 -2.818  1.00 35.32 ? 124 ALA A O     1 
ATOM   994  C  CB    . ALA A 1 127 ? 19.396 -23.263 -2.663  1.00 26.35 ? 124 ALA A CB    1 
ATOM   995  N  N     . VAL A 1 128 ? 20.960 -20.576 -1.883  1.00 31.07 ? 125 VAL A N     1 
ATOM   996  C  CA    . VAL A 1 128 ? 21.065 -19.327 -1.139  1.00 35.52 ? 125 VAL A CA    1 
ATOM   997  C  C     . VAL A 1 128 ? 21.185 -18.116 -2.060  1.00 36.46 ? 125 VAL A C     1 
ATOM   998  O  O     . VAL A 1 128 ? 20.457 -17.149 -1.895  1.00 38.37 ? 125 VAL A O     1 
ATOM   999  C  CB    . VAL A 1 128 ? 22.264 -19.352 -0.179  1.00 28.90 ? 125 VAL A CB    1 
ATOM   1000 C  CG1   . VAL A 1 128 ? 22.720 -17.934 0.161   1.00 28.83 ? 125 VAL A CG1   1 
ATOM   1001 C  CG2   . VAL A 1 128 ? 21.884 -20.115 1.069   1.00 28.02 ? 125 VAL A CG2   1 
ATOM   1002 N  N     . GLN A 1 129 ? 22.094 -18.168 -3.032  1.00 37.98 ? 126 GLN A N     1 
ATOM   1003 C  CA    . GLN A 1 129 ? 22.282 -17.020 -3.906  1.00 40.48 ? 126 GLN A CA    1 
ATOM   1004 C  C     . GLN A 1 129 ? 21.055 -16.810 -4.769  1.00 42.94 ? 126 GLN A C     1 
ATOM   1005 O  O     . GLN A 1 129 ? 20.740 -15.681 -5.135  1.00 46.34 ? 126 GLN A O     1 
ATOM   1006 C  CB    . GLN A 1 129 ? 23.526 -17.172 -4.775  1.00 37.95 ? 126 GLN A CB    1 
ATOM   1007 C  CG    . GLN A 1 129 ? 24.614 -16.160 -4.419  1.00 48.12 ? 126 GLN A CG    1 
ATOM   1008 C  CD    . GLN A 1 129 ? 24.137 -14.692 -4.444  1.00 60.64 ? 126 GLN A CD    1 
ATOM   1009 O  OE1   . GLN A 1 129 ? 23.294 -14.306 -5.264  1.00 63.84 ? 126 GLN A OE1   1 
ATOM   1010 N  NE2   . GLN A 1 129 ? 24.688 -13.868 -3.540  1.00 58.35 ? 126 GLN A NE2   1 
ATOM   1011 N  N     . GLU A 1 130 ? 20.343 -17.886 -5.080  1.00 41.32 ? 127 GLU A N     1 
ATOM   1012 C  CA    . GLU A 1 130 ? 19.150 -17.748 -5.912  1.00 45.29 ? 127 GLU A CA    1 
ATOM   1013 C  C     . GLU A 1 130 ? 18.021 -17.092 -5.106  1.00 46.07 ? 127 GLU A C     1 
ATOM   1014 O  O     . GLU A 1 130 ? 17.343 -16.194 -5.593  1.00 48.53 ? 127 GLU A O     1 
ATOM   1015 C  CB    . GLU A 1 130 ? 18.713 -19.105 -6.474  1.00 44.74 ? 127 GLU A CB    1 
ATOM   1016 C  CG    . GLU A 1 130 ? 17.214 -19.223 -6.747  1.00 55.44 ? 127 GLU A CG    1 
ATOM   1017 C  CD    . GLU A 1 130 ? 16.855 -20.437 -7.596  1.00 70.93 ? 127 GLU A CD    1 
ATOM   1018 O  OE1   . GLU A 1 130 ? 17.775 -21.084 -8.150  1.00 70.66 ? 127 GLU A OE1   1 
ATOM   1019 O  OE2   . GLU A 1 130 ? 15.648 -20.738 -7.718  1.00 74.45 ? 127 GLU A OE2   1 
ATOM   1020 N  N     . ARG A 1 131 ? 17.835 -17.528 -3.863  1.00 42.06 ? 128 ARG A N     1 
ATOM   1021 C  CA    . ARG A 1 131 ? 16.841 -16.920 -2.983  1.00 41.08 ? 128 ARG A CA    1 
ATOM   1022 C  C     . ARG A 1 131 ? 17.219 -15.476 -2.660  1.00 43.82 ? 128 ARG A C     1 
ATOM   1023 O  O     . ARG A 1 131 ? 16.373 -14.594 -2.664  1.00 49.71 ? 128 ARG A O     1 
ATOM   1024 C  CB    . ARG A 1 131 ? 16.706 -17.729 -1.695  1.00 39.01 ? 128 ARG A CB    1 
ATOM   1025 C  CG    . ARG A 1 131 ? 15.732 -17.138 -0.700  1.00 42.24 ? 128 ARG A CG    1 
ATOM   1026 C  CD    . ARG A 1 131 ? 14.290 -17.422 -1.099  1.00 37.98 ? 128 ARG A CD    1 
ATOM   1027 N  NE    . ARG A 1 131 ? 14.007 -18.839 -0.914  1.00 38.84 ? 128 ARG A NE    1 
ATOM   1028 C  CZ    . ARG A 1 131 ? 13.298 -19.344 0.088   1.00 36.67 ? 128 ARG A CZ    1 
ATOM   1029 N  NH1   . ARG A 1 131 ? 13.119 -20.654 0.162   1.00 34.63 ? 128 ARG A NH1   1 
ATOM   1030 N  NH2   . ARG A 1 131 ? 12.746 -18.546 0.997   1.00 35.86 ? 128 ARG A NH2   1 
ATOM   1031 N  N     . LEU A 1 132 ? 18.501 -15.250 -2.392  1.00 42.67 ? 129 LEU A N     1 
ATOM   1032 C  CA    . LEU A 1 132 ? 19.028 -13.929 -2.053  1.00 43.97 ? 129 LEU A CA    1 
ATOM   1033 C  C     . LEU A 1 132 ? 18.706 -12.867 -3.105  1.00 53.19 ? 129 LEU A C     1 
ATOM   1034 O  O     . LEU A 1 132 ? 18.441 -11.718 -2.764  1.00 59.55 ? 129 LEU A O     1 
ATOM   1035 C  CB    . LEU A 1 132 ? 20.542 -13.995 -1.842  1.00 45.43 ? 129 LEU A CB    1 
ATOM   1036 C  CG    . LEU A 1 132 ? 21.061 -13.991 -0.397  1.00 44.10 ? 129 LEU A CG    1 
ATOM   1037 C  CD1   . LEU A 1 132 ? 22.574 -14.113 -0.353  1.00 42.18 ? 129 LEU A CD1   1 
ATOM   1038 C  CD2   . LEU A 1 132 ? 20.618 -12.728 0.331   1.00 43.83 ? 129 LEU A CD2   1 
ATOM   1039 N  N     . GLN A 1 133 ? 18.746 -13.249 -4.378  1.00 56.97 ? 130 GLN A N     1 
ATOM   1040 C  CA    . GLN A 1 133 ? 18.325 -12.370 -5.473  1.00 61.89 ? 130 GLN A CA    1 
ATOM   1041 C  C     . GLN A 1 133 ? 16.857 -12.007 -5.284  1.00 63.80 ? 130 GLN A C     1 
ATOM   1042 O  O     . GLN A 1 133 ? 16.520 -10.867 -4.965  1.00 69.32 ? 130 GLN A O     1 
ATOM   1043 C  CB    . GLN A 1 133 ? 18.561 -13.057 -6.833  1.00 57.25 ? 130 GLN A CB    1 
ATOM   1044 C  CG    . GLN A 1 133 ? 18.036 -12.352 -8.112  1.00 69.62 ? 130 GLN A CG    1 
ATOM   1045 C  CD    . GLN A 1 133 ? 18.068 -10.821 -8.063  1.00 78.26 ? 130 GLN A CD    1 
ATOM   1046 O  OE1   . GLN A 1 133 ? 17.110 -10.183 -7.626  1.00 78.78 ? 130 GLN A OE1   1 
ATOM   1047 N  NE2   . GLN A 1 133 ? 19.176 -10.231 -8.510  1.00 73.58 ? 130 GLN A NE2   1 
ATOM   1048 N  N     . LYS A 1 134 ? 16.002 -13.011 -5.427  1.00 62.98 ? 131 LYS A N     1 
ATOM   1049 C  CA    . LYS A 1 134 ? 14.563 -12.819 -5.466  1.00 62.81 ? 131 LYS A CA    1 
ATOM   1050 C  C     . LYS A 1 134 ? 13.980 -12.337 -4.141  1.00 65.20 ? 131 LYS A C     1 
ATOM   1051 O  O     . LYS A 1 134 ? 12.780 -12.060 -4.057  1.00 64.45 ? 131 LYS A O     1 
ATOM   1052 C  CB    . LYS A 1 134 ? 13.890 -14.123 -5.918  1.00 66.39 ? 131 LYS A CB    1 
ATOM   1053 C  CG    . LYS A 1 134 ? 14.680 -14.839 -7.016  1.00 66.75 ? 131 LYS A CG    1 
ATOM   1054 C  CD    . LYS A 1 134 ? 13.783 -15.522 -8.042  1.00 69.78 ? 131 LYS A CD    1 
ATOM   1055 C  CE    . LYS A 1 134 ? 14.545 -15.727 -9.353  1.00 63.55 ? 131 LYS A CE    1 
ATOM   1056 N  NZ    . LYS A 1 134 ? 13.882 -16.688 -10.274 1.00 59.93 ? 131 LYS A NZ    1 
ATOM   1057 N  N     . LEU A 1 135 ? 14.828 -12.206 -3.122  1.00 63.73 ? 132 LEU A N     1 
ATOM   1058 C  CA    . LEU A 1 135 ? 14.419 -11.534 -1.899  1.00 66.97 ? 132 LEU A CA    1 
ATOM   1059 C  C     . LEU A 1 135 ? 14.586 -10.030 -2.053  1.00 73.89 ? 132 LEU A C     1 
ATOM   1060 O  O     . LEU A 1 135 ? 14.499 -9.297  -1.066  1.00 78.43 ? 132 LEU A O     1 
ATOM   1061 C  CB    . LEU A 1 135 ? 15.217 -12.019 -0.680  1.00 67.58 ? 132 LEU A CB    1 
ATOM   1062 C  CG    . LEU A 1 135 ? 15.011 -13.419 -0.093  1.00 61.26 ? 132 LEU A CG    1 
ATOM   1063 C  CD1   . LEU A 1 135 ? 16.001 -13.657 1.039   1.00 53.40 ? 132 LEU A CD1   1 
ATOM   1064 C  CD2   . LEU A 1 135 ? 13.578 -13.598 0.397   1.00 55.80 ? 132 LEU A CD2   1 
ATOM   1065 N  N     . GLN A 1 136 ? 14.840 -9.579  -3.283  1.00 72.38 ? 133 GLN A N     1 
ATOM   1066 C  CA    . GLN A 1 136 ? 14.993 -8.154  -3.594  1.00 77.19 ? 133 GLN A CA    1 
ATOM   1067 C  C     . GLN A 1 136 ? 16.079 -7.486  -2.740  1.00 79.20 ? 133 GLN A C     1 
ATOM   1068 O  O     . GLN A 1 136 ? 17.151 -7.133  -3.235  1.00 83.87 ? 133 GLN A O     1 
ATOM   1069 C  CB    . GLN A 1 136 ? 13.649 -7.424  -3.419  1.00 76.97 ? 133 GLN A CB    1 
ATOM   1070 C  CG    . GLN A 1 136 ? 13.686 -5.926  -3.754  1.00 82.56 ? 133 GLN A CG    1 
ATOM   1071 C  CD    . GLN A 1 136 ? 12.342 -5.230  -3.551  1.00 84.06 ? 133 GLN A CD    1 
ATOM   1072 O  OE1   . GLN A 1 136 ? 11.760 -5.286  -2.466  1.00 84.94 ? 133 GLN A OE1   1 
ATOM   1073 N  NE2   . GLN A 1 136 ? 11.857 -4.553  -4.591  1.00 76.93 ? 133 GLN A NE2   1 
ATOM   1074 N  N     . GLY A 1 137 ? 15.782 -7.313  -1.457  1.00 74.76 ? 134 GLY A N     1 
ATOM   1075 C  CA    . GLY A 1 137 ? 16.694 -6.699  -0.511  1.00 72.67 ? 134 GLY A CA    1 
ATOM   1076 C  C     . GLY A 1 137 ? 15.958 -6.567  0.807   1.00 69.08 ? 134 GLY A C     1 
ATOM   1077 O  O     . GLY A 1 137 ? 16.400 -5.880  1.727   1.00 67.19 ? 134 GLY A O     1 
ATOM   1078 N  N     . GLN A 1 138 ? 14.812 -7.238  0.876   1.00 66.68 ? 135 GLN A N     1 
ATOM   1079 C  CA    . GLN A 1 138 ? 13.970 -7.236  2.060   1.00 65.18 ? 135 GLN A CA    1 
ATOM   1080 C  C     . GLN A 1 138 ? 14.704 -7.840  3.243   1.00 62.51 ? 135 GLN A C     1 
ATOM   1081 O  O     . GLN A 1 138 ? 15.534 -8.735  3.067   1.00 60.83 ? 135 GLN A O     1 
ATOM   1082 C  CB    . GLN A 1 138 ? 12.685 -8.017  1.795   1.00 69.48 ? 135 GLN A CB    1 
ATOM   1083 C  CG    . GLN A 1 138 ? 12.155 -7.865  0.385   1.00 73.91 ? 135 GLN A CG    1 
ATOM   1084 C  CD    . GLN A 1 138 ? 11.210 -8.979  0.005   1.00 78.88 ? 135 GLN A CD    1 
ATOM   1085 O  OE1   . GLN A 1 138 ? 11.182 -10.031 0.643   1.00 80.81 ? 135 GLN A OE1   1 
ATOM   1086 N  NE2   . GLN A 1 138 ? 10.433 -8.760  -1.047  1.00 87.38 ? 135 GLN A NE2   1 
ATOM   1087 N  N     . PRO A 1 139 ? 14.400 -7.357  4.457   1.00 57.98 ? 136 PRO A N     1 
ATOM   1088 C  CA    . PRO A 1 139 ? 14.990 -7.960  5.651   1.00 53.13 ? 136 PRO A CA    1 
ATOM   1089 C  C     . PRO A 1 139 ? 14.429 -9.352  5.865   1.00 51.75 ? 136 PRO A C     1 
ATOM   1090 O  O     . PRO A 1 139 ? 13.441 -9.738  5.229   1.00 55.83 ? 136 PRO A O     1 
ATOM   1091 C  CB    . PRO A 1 139 ? 14.563 -7.018  6.767   1.00 49.28 ? 136 PRO A CB    1 
ATOM   1092 C  CG    . PRO A 1 139 ? 13.253 -6.490  6.291   1.00 54.14 ? 136 PRO A CG    1 
ATOM   1093 C  CD    . PRO A 1 139 ? 13.404 -6.330  4.803   1.00 58.32 ? 136 PRO A CD    1 
ATOM   1094 N  N     . ILE A 1 140 ? 15.064 -10.100 6.752   1.00 47.87 ? 137 ILE A N     1 
ATOM   1095 C  CA    . ILE A 1 140 ? 14.643 -11.453 7.041   1.00 39.39 ? 137 ILE A CA    1 
ATOM   1096 C  C     . ILE A 1 140 ? 13.942 -11.466 8.377   1.00 36.96 ? 137 ILE A C     1 
ATOM   1097 O  O     . ILE A 1 140 ? 14.517 -11.086 9.394   1.00 38.35 ? 137 ILE A O     1 
ATOM   1098 C  CB    . ILE A 1 140 ? 15.833 -12.410 7.052   1.00 38.47 ? 137 ILE A CB    1 
ATOM   1099 C  CG1   . ILE A 1 140 ? 16.472 -12.442 5.665   1.00 37.72 ? 137 ILE A CG1   1 
ATOM   1100 C  CG2   . ILE A 1 140 ? 15.395 -13.805 7.476   1.00 32.50 ? 137 ILE A CG2   1 
ATOM   1101 C  CD1   . ILE A 1 140 ? 17.714 -13.298 5.587   1.00 35.16 ? 137 ILE A CD1   1 
ATOM   1102 N  N     . SER A 1 141 ? 12.691 -11.897 8.357   1.00 36.08 ? 138 SER A N     1 
ATOM   1103 C  CA    . SER A 1 141 ? 11.825 -11.891 9.529   1.00 32.60 ? 138 SER A CA    1 
ATOM   1104 C  C     . SER A 1 141 ? 12.107 -13.074 10.448  1.00 34.97 ? 138 SER A C     1 
ATOM   1105 O  O     . SER A 1 141 ? 12.458 -14.156 9.978   1.00 31.19 ? 138 SER A O     1 
ATOM   1106 C  CB    . SER A 1 141 ? 10.364 -11.911 9.080   1.00 31.10 ? 138 SER A CB    1 
ATOM   1107 O  OG    . SER A 1 141 ? 9.563  -12.610 10.008  1.00 34.71 ? 138 SER A OG    1 
ATOM   1108 N  N     . ALA A 1 142 ? 11.940 -12.876 11.752  1.00 32.33 ? 139 ALA A N     1 
ATOM   1109 C  CA    . ALA A 1 142 ? 12.151 -13.960 12.705  1.00 32.19 ? 139 ALA A CA    1 
ATOM   1110 C  C     . ALA A 1 142 ? 11.087 -15.049 12.544  1.00 35.84 ? 139 ALA A C     1 
ATOM   1111 O  O     . ALA A 1 142 ? 11.264 -16.189 12.996  1.00 28.02 ? 139 ALA A O     1 
ATOM   1112 C  CB    . ALA A 1 142 ? 12.150 -13.431 14.119  1.00 31.27 ? 139 ALA A CB    1 
ATOM   1113 N  N     . ASP A 1 143 ? 9.987  -14.682 11.894  1.00 33.79 ? 140 ASP A N     1 
ATOM   1114 C  CA    . ASP A 1 143 ? 8.917  -15.614 11.607  1.00 31.47 ? 140 ASP A CA    1 
ATOM   1115 C  C     . ASP A 1 143 ? 9.392  -16.687 10.663  1.00 28.94 ? 140 ASP A C     1 
ATOM   1116 O  O     . ASP A 1 143 ? 8.836  -17.781 10.636  1.00 31.95 ? 140 ASP A O     1 
ATOM   1117 C  CB    . ASP A 1 143 ? 7.708  -14.888 11.012  1.00 31.96 ? 140 ASP A CB    1 
ATOM   1118 C  CG    . ASP A 1 143 ? 6.870  -14.184 12.074  1.00 43.90 ? 140 ASP A CG    1 
ATOM   1119 O  OD1   . ASP A 1 143 ? 6.963  -14.590 13.256  1.00 40.72 ? 140 ASP A OD1   1 
ATOM   1120 O  OD2   . ASP A 1 143 ? 6.112  -13.238 11.734  1.00 47.16 ? 140 ASP A OD2   1 
ATOM   1121 N  N     . LEU A 1 144 ? 10.418 -16.377 9.881   1.00 26.53 ? 141 LEU A N     1 
ATOM   1122 C  CA    . LEU A 1 144 ? 10.914 -17.325 8.888   1.00 28.59 ? 141 LEU A CA    1 
ATOM   1123 C  C     . LEU A 1 144 ? 11.839 -18.360 9.511   1.00 28.33 ? 141 LEU A C     1 
ATOM   1124 O  O     . LEU A 1 144 ? 12.193 -19.363 8.886   1.00 25.62 ? 141 LEU A O     1 
ATOM   1125 C  CB    . LEU A 1 144 ? 11.641 -16.596 7.760   1.00 28.02 ? 141 LEU A CB    1 
ATOM   1126 C  CG    . LEU A 1 144 ? 10.748 -15.757 6.860   1.00 26.00 ? 141 LEU A CG    1 
ATOM   1127 C  CD1   . LEU A 1 144 ? 11.574 -15.090 5.780   1.00 30.29 ? 141 LEU A CD1   1 
ATOM   1128 C  CD2   . LEU A 1 144 ? 9.709  -16.658 6.261   1.00 26.88 ? 141 LEU A CD2   1 
ATOM   1129 N  N     . LEU A 1 145 ? 12.214 -18.111 10.756  1.00 27.53 ? 142 LEU A N     1 
ATOM   1130 C  CA    . LEU A 1 145 ? 13.172 -18.953 11.455  1.00 28.68 ? 142 LEU A CA    1 
ATOM   1131 C  C     . LEU A 1 145 ? 12.601 -19.470 12.787  1.00 26.59 ? 142 LEU A C     1 
ATOM   1132 O  O     . LEU A 1 145 ? 13.163 -19.234 13.842  1.00 23.03 ? 142 LEU A O     1 
ATOM   1133 C  CB    . LEU A 1 145 ? 14.465 -18.158 11.666  1.00 22.83 ? 142 LEU A CB    1 
ATOM   1134 C  CG    . LEU A 1 145 ? 15.139 -17.782 10.341  1.00 24.66 ? 142 LEU A CG    1 
ATOM   1135 C  CD1   . LEU A 1 145 ? 16.063 -16.578 10.460  1.00 25.86 ? 142 LEU A CD1   1 
ATOM   1136 C  CD2   . LEU A 1 145 ? 15.920 -18.966 9.821   1.00 24.49 ? 142 LEU A CD2   1 
ATOM   1137 N  N     . PRO A 1 146 ? 11.481 -20.196 12.729  1.00 27.80 ? 143 PRO A N     1 
ATOM   1138 C  CA    . PRO A 1 146 ? 10.750 -20.495 13.963  1.00 29.01 ? 143 PRO A CA    1 
ATOM   1139 C  C     . PRO A 1 146 ? 11.286 -21.650 14.801  1.00 28.60 ? 143 PRO A C     1 
ATOM   1140 O  O     . PRO A 1 146 ? 10.708 -21.886 15.857  1.00 29.79 ? 143 PRO A O     1 
ATOM   1141 C  CB    . PRO A 1 146 ? 9.352  -20.832 13.452  1.00 31.63 ? 143 PRO A CB    1 
ATOM   1142 C  CG    . PRO A 1 146 ? 9.594  -21.438 12.115  1.00 29.10 ? 143 PRO A CG    1 
ATOM   1143 C  CD    . PRO A 1 146 ? 10.778 -20.708 11.538  1.00 29.34 ? 143 PRO A CD    1 
ATOM   1144 N  N     . SER A 1 147 ? 12.331 -22.352 14.354  1.00 27.85 ? 144 SER A N     1 
ATOM   1145 C  CA    . SER A 1 147 ? 12.966 -23.385 15.184  1.00 26.76 ? 144 SER A CA    1 
ATOM   1146 C  C     . SER A 1 147 ? 14.486 -23.253 15.160  1.00 25.21 ? 144 SER A C     1 
ATOM   1147 O  O     . SER A 1 147 ? 15.199 -24.175 15.524  1.00 23.09 ? 144 SER A O     1 
ATOM   1148 C  CB    . SER A 1 147 ? 12.551 -24.799 14.739  1.00 28.12 ? 144 SER A CB    1 
ATOM   1149 O  OG    . SER A 1 147 ? 12.826 -25.039 13.362  1.00 28.02 ? 144 SER A OG    1 
ATOM   1150 N  N     . THR A 1 148 ? 14.979 -22.092 14.738  1.00 26.52 ? 145 THR A N     1 
ATOM   1151 C  CA    . THR A 1 148 ? 16.419 -21.903 14.577  1.00 27.05 ? 145 THR A CA    1 
ATOM   1152 C  C     . THR A 1 148 ? 17.106 -21.308 15.819  1.00 27.08 ? 145 THR A C     1 
ATOM   1153 O  O     . THR A 1 148 ? 16.608 -20.350 16.411  1.00 25.94 ? 145 THR A O     1 
ATOM   1154 C  CB    . THR A 1 148 ? 16.713 -21.001 13.356  1.00 26.28 ? 145 THR A CB    1 
ATOM   1155 O  OG1   . THR A 1 148 ? 16.241 -21.657 12.162  1.00 24.00 ? 145 THR A OG1   1 
ATOM   1156 C  CG2   . THR A 1 148 ? 18.227 -20.703 13.251  1.00 18.25 ? 145 THR A CG2   1 
ATOM   1157 N  N     . TYR A 1 149 ? 18.241 -21.899 16.211  1.00 29.04 ? 146 TYR A N     1 
ATOM   1158 C  CA    . TYR A 1 149 ? 19.106 -21.351 17.274  1.00 26.08 ? 146 TYR A CA    1 
ATOM   1159 C  C     . TYR A 1 149 ? 20.322 -20.704 16.665  1.00 22.99 ? 146 TYR A C     1 
ATOM   1160 O  O     . TYR A 1 149 ? 20.891 -21.252 15.732  1.00 25.17 ? 146 TYR A O     1 
ATOM   1161 C  CB    . TYR A 1 149 ? 19.565 -22.439 18.248  1.00 23.04 ? 146 TYR A CB    1 
ATOM   1162 C  CG    . TYR A 1 149 ? 18.540 -22.796 19.284  1.00 26.01 ? 146 TYR A CG    1 
ATOM   1163 C  CD1   . TYR A 1 149 ? 17.496 -23.665 18.980  1.00 23.18 ? 146 TYR A CD1   1 
ATOM   1164 C  CD2   . TYR A 1 149 ? 18.601 -22.252 20.562  1.00 21.38 ? 146 TYR A CD2   1 
ATOM   1165 C  CE1   . TYR A 1 149 ? 16.551 -23.996 19.922  1.00 27.25 ? 146 TYR A CE1   1 
ATOM   1166 C  CE2   . TYR A 1 149 ? 17.664 -22.578 21.518  1.00 26.33 ? 146 TYR A CE2   1 
ATOM   1167 C  CZ    . TYR A 1 149 ? 16.634 -23.448 21.197  1.00 31.18 ? 146 TYR A CZ    1 
ATOM   1168 O  OH    . TYR A 1 149 ? 15.686 -23.781 22.141  1.00 28.38 ? 146 TYR A OH    1 
ATOM   1169 N  N     . ILE A 1 150 ? 20.735 -19.558 17.198  1.00 24.09 ? 147 ILE A N     1 
ATOM   1170 C  CA    . ILE A 1 150 ? 22.025 -18.970 16.819  1.00 20.86 ? 147 ILE A CA    1 
ATOM   1171 C  C     . ILE A 1 150 ? 23.081 -19.252 17.886  1.00 22.16 ? 147 ILE A C     1 
ATOM   1172 O  O     . ILE A 1 150 ? 23.031 -18.691 18.975  1.00 23.64 ? 147 ILE A O     1 
ATOM   1173 C  CB    . ILE A 1 150 ? 21.933 -17.453 16.621  1.00 24.19 ? 147 ILE A CB    1 
ATOM   1174 C  CG1   . ILE A 1 150 ? 20.683 -17.093 15.812  1.00 25.85 ? 147 ILE A CG1   1 
ATOM   1175 C  CG2   . ILE A 1 150 ? 23.207 -16.939 15.956  1.00 23.47 ? 147 ILE A CG2   1 
ATOM   1176 C  CD1   . ILE A 1 150 ? 20.729 -17.562 14.348  1.00 22.38 ? 147 ILE A CD1   1 
ATOM   1177 N  N     . GLU A 1 151 ? 24.031 -20.128 17.587  1.00 22.60 ? 148 GLU A N     1 
ATOM   1178 C  CA    . GLU A 1 151 ? 25.023 -20.506 18.589  1.00 20.42 ? 148 GLU A CA    1 
ATOM   1179 C  C     . GLU A 1 151 ? 25.841 -19.297 19.085  1.00 24.97 ? 148 GLU A C     1 
ATOM   1180 O  O     . GLU A 1 151 ? 26.333 -18.476 18.294  1.00 21.06 ? 148 GLU A O     1 
ATOM   1181 C  CB    . GLU A 1 151 ? 25.951 -21.579 18.034  1.00 21.70 ? 148 GLU A CB    1 
ATOM   1182 C  CG    . GLU A 1 151 ? 27.080 -21.964 18.974  1.00 23.56 ? 148 GLU A CG    1 
ATOM   1183 C  CD    . GLU A 1 151 ? 26.591 -22.614 20.221  1.00 21.38 ? 148 GLU A CD    1 
ATOM   1184 O  OE1   . GLU A 1 151 ? 27.339 -22.598 21.213  1.00 24.39 ? 148 GLU A OE1   1 
ATOM   1185 O  OE2   . GLU A 1 151 ? 25.464 -23.155 20.206  1.00 23.97 ? 148 GLU A OE2   1 
ATOM   1186 N  N     . GLY A 1 152 ? 25.955 -19.186 20.406  1.00 25.95 ? 149 GLY A N     1 
ATOM   1187 C  CA    . GLY A 1 152 ? 26.685 -18.095 21.020  1.00 25.60 ? 149 GLY A CA    1 
ATOM   1188 C  C     . GLY A 1 152 ? 25.801 -16.953 21.466  1.00 29.69 ? 149 GLY A C     1 
ATOM   1189 O  O     . GLY A 1 152 ? 26.237 -16.097 22.245  1.00 30.83 ? 149 GLY A O     1 
ATOM   1190 N  N     . LEU A 1 153 ? 24.562 -16.939 20.968  1.00 28.36 ? 150 LEU A N     1 
ATOM   1191 C  CA    . LEU A 1 153 ? 23.572 -15.917 21.316  1.00 25.71 ? 150 LEU A CA    1 
ATOM   1192 C  C     . LEU A 1 153 ? 22.419 -16.509 22.126  1.00 25.42 ? 150 LEU A C     1 
ATOM   1193 O  O     . LEU A 1 153 ? 22.078 -17.659 21.943  1.00 23.99 ? 150 LEU A O     1 
ATOM   1194 C  CB    . LEU A 1 153 ? 23.030 -15.257 20.057  1.00 26.96 ? 150 LEU A CB    1 
ATOM   1195 C  CG    . LEU A 1 153 ? 24.081 -14.630 19.153  1.00 27.11 ? 150 LEU A CG    1 
ATOM   1196 C  CD1   . LEU A 1 153 ? 23.395 -13.804 18.116  1.00 22.48 ? 150 LEU A CD1   1 
ATOM   1197 C  CD2   . LEU A 1 153 ? 25.068 -13.790 19.967  1.00 31.06 ? 150 LEU A CD2   1 
ATOM   1198 N  N     . PRO A 1 154 ? 21.796 -15.716 23.012  1.00 27.72 ? 151 PRO A N     1 
ATOM   1199 C  CA    . PRO A 1 154 ? 22.036 -14.296 23.292  1.00 29.87 ? 151 PRO A CA    1 
ATOM   1200 C  C     . PRO A 1 154 ? 23.311 -14.056 24.068  1.00 30.87 ? 151 PRO A C     1 
ATOM   1201 O  O     . PRO A 1 154 ? 23.850 -14.970 24.687  1.00 32.44 ? 151 PRO A O     1 
ATOM   1202 C  CB    . PRO A 1 154 ? 20.831 -13.896 24.137  1.00 32.16 ? 151 PRO A CB    1 
ATOM   1203 C  CG    . PRO A 1 154 ? 20.470 -15.160 24.862  1.00 32.13 ? 151 PRO A CG    1 
ATOM   1204 C  CD    . PRO A 1 154 ? 20.745 -16.273 23.884  1.00 28.48 ? 151 PRO A CD    1 
ATOM   1205 N  N     . GLN A 1 155 ? 23.777 -12.820 24.018  1.00 34.28 ? 152 GLN A N     1 
ATOM   1206 C  CA    . GLN A 1 155 ? 24.915 -12.377 24.803  1.00 41.41 ? 152 GLN A CA    1 
ATOM   1207 C  C     . GLN A 1 155 ? 24.722 -10.913 25.196  1.00 45.26 ? 152 GLN A C     1 
ATOM   1208 O  O     . GLN A 1 155 ? 24.135 -10.141 24.432  1.00 44.54 ? 152 GLN A O     1 
ATOM   1209 C  CB    . GLN A 1 155 ? 26.199 -12.567 24.010  1.00 35.60 ? 152 GLN A CB    1 
ATOM   1210 C  CG    . GLN A 1 155 ? 27.269 -11.571 24.323  1.00 40.03 ? 152 GLN A CG    1 
ATOM   1211 C  CD    . GLN A 1 155 ? 28.072 -11.244 23.089  1.00 41.75 ? 152 GLN A CD    1 
ATOM   1212 O  OE1   . GLN A 1 155 ? 27.902 -10.186 22.469  1.00 35.93 ? 152 GLN A OE1   1 
ATOM   1213 N  NE2   . GLN A 1 155 ? 28.927 -12.181 22.693  1.00 38.86 ? 152 GLN A NE2   1 
ATOM   1214 N  N     . GLY A 1 156 ? 25.168 -10.543 26.397  1.00 50.48 ? 153 GLY A N     1 
ATOM   1215 C  CA    . GLY A 1 156 ? 25.294 -9.137  26.751  1.00 51.53 ? 153 GLY A CA    1 
ATOM   1216 C  C     . GLY A 1 156 ? 24.248 -8.529  27.674  1.00 60.34 ? 153 GLY A C     1 
ATOM   1217 O  O     . GLY A 1 156 ? 23.434 -9.244  28.275  1.00 59.98 ? 153 GLY A O     1 
ATOM   1218 N  N     . PRO A 1 157 ? 24.278 -7.186  27.798  1.00 63.97 ? 154 PRO A N     1 
ATOM   1219 C  CA    . PRO A 1 157 ? 23.364 -6.385  28.622  1.00 60.15 ? 154 PRO A CA    1 
ATOM   1220 C  C     . PRO A 1 157 ? 22.136 -5.889  27.852  1.00 61.77 ? 154 PRO A C     1 
ATOM   1221 O  O     . PRO A 1 157 ? 21.712 -6.532  26.885  1.00 64.03 ? 154 PRO A O     1 
ATOM   1222 C  CB    . PRO A 1 157 ? 24.242 -5.210  29.051  1.00 56.86 ? 154 PRO A CB    1 
ATOM   1223 C  CG    . PRO A 1 157 ? 25.156 -5.000  27.857  1.00 55.27 ? 154 PRO A CG    1 
ATOM   1224 C  CD    . PRO A 1 157 ? 25.355 -6.356  27.215  1.00 56.08 ? 154 PRO A CD    1 
ATOM   1225 N  N     . THR A 1 163 ? 14.905 -13.932 29.518  1.00 52.33 ? 160 THR A N     1 
ATOM   1226 C  CA    . THR A 1 163 ? 13.899 -14.944 29.813  1.00 52.21 ? 160 THR A CA    1 
ATOM   1227 C  C     . THR A 1 163 ? 14.571 -16.113 30.527  1.00 55.97 ? 160 THR A C     1 
ATOM   1228 O  O     . THR A 1 163 ? 15.776 -16.328 30.389  1.00 58.63 ? 160 THR A O     1 
ATOM   1229 C  CB    . THR A 1 163 ? 13.173 -15.428 28.530  1.00 48.07 ? 160 THR A CB    1 
ATOM   1230 O  OG1   . THR A 1 163 ? 12.594 -14.304 27.857  1.00 57.82 ? 160 THR A OG1   1 
ATOM   1231 C  CG2   . THR A 1 163 ? 12.058 -16.431 28.846  1.00 48.01 ? 160 THR A CG2   1 
ATOM   1232 N  N     . VAL A 1 164 ? 13.797 -16.847 31.314  1.00 51.66 ? 161 VAL A N     1 
ATOM   1233 C  CA    . VAL A 1 164 ? 14.316 -18.010 31.999  1.00 49.68 ? 161 VAL A CA    1 
ATOM   1234 C  C     . VAL A 1 164 ? 13.920 -19.300 31.288  1.00 52.25 ? 161 VAL A C     1 
ATOM   1235 O  O     . VAL A 1 164 ? 14.288 -20.384 31.735  1.00 55.80 ? 161 VAL A O     1 
ATOM   1236 C  CB    . VAL A 1 164 ? 13.814 -18.056 33.439  1.00 49.88 ? 161 VAL A CB    1 
ATOM   1237 C  CG1   . VAL A 1 164 ? 14.345 -16.845 34.216  1.00 50.56 ? 161 VAL A CG1   1 
ATOM   1238 C  CG2   . VAL A 1 164 ? 12.299 -18.085 33.450  1.00 51.45 ? 161 VAL A CG2   1 
ATOM   1239 N  N     . GLN A 1 165 ? 13.167 -19.193 30.191  1.00 52.28 ? 162 GLN A N     1 
ATOM   1240 C  CA    . GLN A 1 165 ? 12.773 -20.378 29.420  1.00 46.45 ? 162 GLN A CA    1 
ATOM   1241 C  C     . GLN A 1 165 ? 13.519 -20.505 28.103  1.00 39.85 ? 162 GLN A C     1 
ATOM   1242 O  O     . GLN A 1 165 ? 13.993 -19.512 27.546  1.00 35.38 ? 162 GLN A O     1 
ATOM   1243 C  CB    . GLN A 1 165 ? 11.271 -20.386 29.141  1.00 45.92 ? 162 GLN A CB    1 
ATOM   1244 C  CG    . GLN A 1 165 ? 10.430 -20.955 30.274  1.00 54.54 ? 162 GLN A CG    1 
ATOM   1245 C  CD    . GLN A 1 165 ? 11.261 -21.693 31.318  1.00 57.76 ? 162 GLN A CD    1 
ATOM   1246 O  OE1   . GLN A 1 165 ? 11.618 -21.123 32.353  1.00 58.03 ? 162 GLN A OE1   1 
ATOM   1247 N  NE2   . GLN A 1 165 ? 11.564 -22.967 31.057  1.00 56.33 ? 162 GLN A NE2   1 
ATOM   1248 N  N     . LYS A 1 166 ? 13.588 -21.745 27.617  1.00 39.34 ? 163 LYS A N     1 
ATOM   1249 C  CA    . LYS A 1 166 ? 14.346 -22.115 26.424  1.00 41.82 ? 163 LYS A CA    1 
ATOM   1250 C  C     . LYS A 1 166 ? 13.897 -21.375 25.158  1.00 34.10 ? 163 LYS A C     1 
ATOM   1251 O  O     . LYS A 1 166 ? 14.723 -20.816 24.435  1.00 31.47 ? 163 LYS A O     1 
ATOM   1252 C  CB    . LYS A 1 166 ? 14.244 -23.627 26.198  1.00 46.85 ? 163 LYS A CB    1 
ATOM   1253 C  CG    . LYS A 1 166 ? 13.748 -24.398 27.420  1.00 50.31 ? 163 LYS A CG    1 
ATOM   1254 C  CD    . LYS A 1 166 ? 14.196 -25.844 27.360  1.00 52.14 ? 163 LYS A CD    1 
ATOM   1255 C  CE    . LYS A 1 166 ? 13.651 -26.664 28.533  1.00 58.98 ? 163 LYS A CE    1 
ATOM   1256 N  NZ    . LYS A 1 166 ? 14.264 -26.323 29.841  1.00 62.97 ? 163 LYS A NZ    1 
ATOM   1257 N  N     . GLU A 1 167 ? 12.598 -21.380 24.880  1.00 33.85 ? 164 GLU A N     1 
ATOM   1258 C  CA    . GLU A 1 167 ? 12.097 -20.619 23.743  1.00 32.52 ? 164 GLU A CA    1 
ATOM   1259 C  C     . GLU A 1 167 ? 12.387 -19.132 23.929  1.00 30.10 ? 164 GLU A C     1 
ATOM   1260 O  O     . GLU A 1 167 ? 12.653 -18.417 22.968  1.00 31.73 ? 164 GLU A O     1 
ATOM   1261 C  CB    . GLU A 1 167 ? 10.597 -20.852 23.532  1.00 32.87 ? 164 GLU A CB    1 
ATOM   1262 C  CG    . GLU A 1 167 ? 10.016 -20.155 22.293  1.00 28.49 ? 164 GLU A CG    1 
ATOM   1263 C  CD    . GLU A 1 167 ? 10.650 -20.620 20.971  1.00 34.39 ? 164 GLU A CD    1 
ATOM   1264 O  OE1   . GLU A 1 167 ? 10.516 -19.888 19.967  1.00 37.77 ? 164 GLU A OE1   1 
ATOM   1265 O  OE2   . GLU A 1 167 ? 11.251 -21.722 20.915  1.00 36.61 ? 164 GLU A OE2   1 
ATOM   1266 N  N     . GLY A 1 168 ? 12.363 -18.674 25.172  1.00 33.69 ? 165 GLY A N     1 
ATOM   1267 C  CA    . GLY A 1 168 ? 12.687 -17.290 25.461  1.00 32.60 ? 165 GLY A CA    1 
ATOM   1268 C  C     . GLY A 1 168 ? 14.098 -16.924 25.055  1.00 31.97 ? 165 GLY A C     1 
ATOM   1269 O  O     . GLY A 1 168 ? 14.313 -15.912 24.405  1.00 32.26 ? 165 GLY A O     1 
ATOM   1270 N  N     . MET A 1 169 ? 15.056 -17.754 25.452  1.00 31.89 ? 166 MET A N     1 
ATOM   1271 C  CA    . MET A 1 169 ? 16.453 -17.570 25.092  1.00 29.67 ? 166 MET A CA    1 
ATOM   1272 C  C     . MET A 1 169 ? 16.634 -17.640 23.586  1.00 31.33 ? 166 MET A C     1 
ATOM   1273 O  O     . MET A 1 169 ? 17.326 -16.811 23.014  1.00 31.34 ? 166 MET A O     1 
ATOM   1274 C  CB    . MET A 1 169 ? 17.329 -18.631 25.762  1.00 34.52 ? 166 MET A CB    1 
ATOM   1275 C  CG    . MET A 1 169 ? 17.331 -18.576 27.275  1.00 42.88 ? 166 MET A CG    1 
ATOM   1276 S  SD    . MET A 1 169 ? 18.263 -17.155 27.887  1.00 58.14 ? 166 MET A SD    1 
ATOM   1277 C  CE    . MET A 1 169 ? 19.936 -17.620 27.356  1.00 37.80 ? 166 MET A CE    1 
ATOM   1278 N  N     . ARG A 1 170 ? 15.999 -18.629 22.955  1.00 28.01 ? 167 ARG A N     1 
ATOM   1279 C  CA    . ARG A 1 170 ? 16.106 -18.852 21.514  1.00 26.34 ? 167 ARG A CA    1 
ATOM   1280 C  C     . ARG A 1 170 ? 15.809 -17.591 20.718  1.00 27.76 ? 167 ARG A C     1 
ATOM   1281 O  O     . ARG A 1 170 ? 16.617 -17.174 19.900  1.00 29.70 ? 167 ARG A O     1 
ATOM   1282 C  CB    . ARG A 1 170 ? 15.157 -19.976 21.075  1.00 28.48 ? 167 ARG A CB    1 
ATOM   1283 C  CG    . ARG A 1 170 ? 15.382 -20.464 19.668  1.00 25.78 ? 167 ARG A CG    1 
ATOM   1284 C  CD    . ARG A 1 170 ? 14.246 -21.336 19.145  1.00 25.00 ? 167 ARG A CD    1 
ATOM   1285 N  NE    . ARG A 1 170 ? 13.051 -20.565 18.832  1.00 25.27 ? 167 ARG A NE    1 
ATOM   1286 C  CZ    . ARG A 1 170 ? 12.897 -19.820 17.741  1.00 25.03 ? 167 ARG A CZ    1 
ATOM   1287 N  NH1   . ARG A 1 170 ? 13.869 -19.723 16.848  1.00 26.78 ? 167 ARG A NH1   1 
ATOM   1288 N  NH2   . ARG A 1 170 ? 11.767 -19.169 17.539  1.00 26.36 ? 167 ARG A NH2   1 
ATOM   1289 N  N     . LYS A 1 171 ? 14.661 -16.971 20.982  1.00 29.24 ? 168 LYS A N     1 
ATOM   1290 C  CA    . LYS A 1 171 ? 14.235 -15.794 20.230  1.00 29.01 ? 168 LYS A CA    1 
ATOM   1291 C  C     . LYS A 1 171 ? 15.166 -14.632 20.465  1.00 29.27 ? 168 LYS A C     1 
ATOM   1292 O  O     . LYS A 1 171 ? 15.470 -13.888 19.541  1.00 33.79 ? 168 LYS A O     1 
ATOM   1293 C  CB    . LYS A 1 171 ? 12.819 -15.363 20.598  1.00 29.89 ? 168 LYS A CB    1 
ATOM   1294 C  CG    . LYS A 1 171 ? 11.710 -16.284 20.137  1.00 37.89 ? 168 LYS A CG    1 
ATOM   1295 C  CD    . LYS A 1 171 ? 10.385 -15.881 20.812  1.00 45.89 ? 168 LYS A CD    1 
ATOM   1296 C  CE    . LYS A 1 171 ? 9.163  -16.450 20.079  1.00 48.13 ? 168 LYS A CE    1 
ATOM   1297 N  NZ    . LYS A 1 171 ? 8.872  -15.698 18.819  1.00 47.74 ? 168 LYS A NZ    1 
ATOM   1298 N  N     . GLN A 1 172 ? 15.601 -14.469 21.708  1.00 27.26 ? 169 GLN A N     1 
ATOM   1299 C  CA    . GLN A 1 172 ? 16.454 -13.358 22.069  1.00 30.36 ? 169 GLN A CA    1 
ATOM   1300 C  C     . GLN A 1 172 ? 17.775 -13.468 21.305  1.00 33.02 ? 169 GLN A C     1 
ATOM   1301 O  O     . GLN A 1 172 ? 18.253 -12.484 20.739  1.00 36.94 ? 169 GLN A O     1 
ATOM   1302 C  CB    . GLN A 1 172 ? 16.678 -13.328 23.585  1.00 33.80 ? 169 GLN A CB    1 
ATOM   1303 C  CG    . GLN A 1 172 ? 17.461 -12.118 24.103  1.00 41.57 ? 169 GLN A CG    1 
ATOM   1304 C  CD    . GLN A 1 172 ? 17.459 -12.026 25.634  1.00 52.44 ? 169 GLN A CD    1 
ATOM   1305 O  OE1   . GLN A 1 172 ? 16.758 -12.792 26.311  1.00 54.03 ? 169 GLN A OE1   1 
ATOM   1306 N  NE2   . GLN A 1 172 ? 18.251 -11.093 26.184  1.00 46.38 ? 169 GLN A NE2   1 
ATOM   1307 N  N     . GLY A 1 173 ? 18.339 -14.675 21.271  1.00 28.62 ? 170 GLY A N     1 
ATOM   1308 C  CA    . GLY A 1 173 ? 19.481 -14.950 20.428  1.00 29.24 ? 170 GLY A CA    1 
ATOM   1309 C  C     . GLY A 1 173 ? 19.173 -14.617 18.980  1.00 27.43 ? 170 GLY A C     1 
ATOM   1310 O  O     . GLY A 1 173 ? 19.968 -13.961 18.306  1.00 32.64 ? 170 GLY A O     1 
ATOM   1311 N  N     . LEU A 1 174 ? 18.002 -15.037 18.511  1.00 27.04 ? 171 LEU A N     1 
ATOM   1312 C  CA    . LEU A 1 174 ? 17.627 -14.841 17.116  1.00 29.97 ? 171 LEU A CA    1 
ATOM   1313 C  C     . LEU A 1 174 ? 17.378 -13.349 16.825  1.00 28.50 ? 171 LEU A C     1 
ATOM   1314 O  O     . LEU A 1 174 ? 17.829 -12.839 15.802  1.00 30.78 ? 171 LEU A O     1 
ATOM   1315 C  CB    . LEU A 1 174 ? 16.407 -15.706 16.767  1.00 24.03 ? 171 LEU A CB    1 
ATOM   1316 C  CG    . LEU A 1 174 ? 15.864 -15.699 15.332  1.00 25.61 ? 171 LEU A CG    1 
ATOM   1317 C  CD1   . LEU A 1 174 ? 16.851 -16.247 14.338  1.00 22.94 ? 171 LEU A CD1   1 
ATOM   1318 C  CD2   . LEU A 1 174 ? 14.577 -16.496 15.240  1.00 25.30 ? 171 LEU A CD2   1 
ATOM   1319 N  N     . PHE A 1 175 ? 16.705 -12.643 17.727  1.00 24.24 ? 172 PHE A N     1 
ATOM   1320 C  CA    . PHE A 1 175 ? 16.519 -11.200 17.560  1.00 26.74 ? 172 PHE A CA    1 
ATOM   1321 C  C     . PHE A 1 175 ? 17.859 -10.476 17.488  1.00 29.65 ? 172 PHE A C     1 
ATOM   1322 O  O     . PHE A 1 175 ? 18.089 -9.704  16.563  1.00 31.38 ? 172 PHE A O     1 
ATOM   1323 C  CB    . PHE A 1 175 ? 15.688 -10.610 18.697  1.00 31.24 ? 172 PHE A CB    1 
ATOM   1324 C  CG    . PHE A 1 175 ? 14.280 -11.099 18.730  1.00 36.35 ? 172 PHE A CG    1 
ATOM   1325 C  CD1   . PHE A 1 175 ? 13.659 -11.554 17.565  1.00 34.91 ? 172 PHE A CD1   1 
ATOM   1326 C  CD2   . PHE A 1 175 ? 13.568 -11.120 19.930  1.00 39.77 ? 172 PHE A CD2   1 
ATOM   1327 C  CE1   . PHE A 1 175 ? 12.352 -12.017 17.593  1.00 39.09 ? 172 PHE A CE1   1 
ATOM   1328 C  CE2   . PHE A 1 175 ? 12.247 -11.582 19.968  1.00 43.39 ? 172 PHE A CE2   1 
ATOM   1329 C  CZ    . PHE A 1 175 ? 11.638 -12.028 18.794  1.00 40.74 ? 172 PHE A CZ    1 
ATOM   1330 N  N     . GLN A 1 176 ? 18.737 -10.719 18.462  1.00 28.73 ? 173 GLN A N     1 
ATOM   1331 C  CA    . GLN A 1 176 ? 20.068 -10.118 18.444  1.00 32.81 ? 173 GLN A CA    1 
ATOM   1332 C  C     . GLN A 1 176 ? 20.748 -10.348 17.109  1.00 28.01 ? 173 GLN A C     1 
ATOM   1333 O  O     . GLN A 1 176 ? 21.200 -9.400  16.487  1.00 32.85 ? 173 GLN A O     1 
ATOM   1334 C  CB    . GLN A 1 176 ? 20.941 -10.665 19.575  1.00 32.72 ? 173 GLN A CB    1 
ATOM   1335 C  CG    . GLN A 1 176 ? 20.646 -10.032 20.910  1.00 33.09 ? 173 GLN A CG    1 
ATOM   1336 C  CD    . GLN A 1 176 ? 21.507 -10.581 22.030  1.00 35.97 ? 173 GLN A CD    1 
ATOM   1337 O  OE1   . GLN A 1 176 ? 22.550 -11.197 21.792  1.00 35.76 ? 173 GLN A OE1   1 
ATOM   1338 N  NE2   . GLN A 1 176 ? 21.061 -10.375 23.267  1.00 41.97 ? 173 GLN A NE2   1 
ATOM   1339 N  N     . TRP A 1 177 ? 20.790 -11.600 16.668  1.00 27.21 ? 174 TRP A N     1 
ATOM   1340 C  CA    . TRP A 1 177 ? 21.399 -11.947 15.380  1.00 32.63 ? 174 TRP A CA    1 
ATOM   1341 C  C     . TRP A 1 177 ? 20.796 -11.179 14.202  1.00 31.07 ? 174 TRP A C     1 
ATOM   1342 O  O     . TRP A 1 177 ? 21.515 -10.498 13.472  1.00 31.51 ? 174 TRP A O     1 
ATOM   1343 C  CB    . TRP A 1 177 ? 21.275 -13.450 15.132  1.00 30.74 ? 174 TRP A CB    1 
ATOM   1344 C  CG    . TRP A 1 177 ? 21.731 -13.937 13.758  1.00 32.13 ? 174 TRP A CG    1 
ATOM   1345 C  CD1   . TRP A 1 177 ? 20.940 -14.185 12.676  1.00 28.47 ? 174 TRP A CD1   1 
ATOM   1346 C  CD2   . TRP A 1 177 ? 23.072 -14.270 13.356  1.00 29.20 ? 174 TRP A CD2   1 
ATOM   1347 N  NE1   . TRP A 1 177 ? 21.699 -14.645 11.630  1.00 29.24 ? 174 TRP A NE1   1 
ATOM   1348 C  CE2   . TRP A 1 177 ? 23.011 -14.702 12.019  1.00 28.80 ? 174 TRP A CE2   1 
ATOM   1349 C  CE3   . TRP A 1 177 ? 24.316 -14.239 13.999  1.00 27.60 ? 174 TRP A CE3   1 
ATOM   1350 C  CZ2   . TRP A 1 177 ? 24.149 -15.108 11.309  1.00 27.44 ? 174 TRP A CZ2   1 
ATOM   1351 C  CZ3   . TRP A 1 177 ? 25.439 -14.631 13.296  1.00 27.70 ? 174 TRP A CZ3   1 
ATOM   1352 C  CH2   . TRP A 1 177 ? 25.346 -15.064 11.959  1.00 29.60 ? 174 TRP A CH2   1 
ATOM   1353 N  N     . LEU A 1 178 ? 19.480 -11.283 14.028  1.00 33.77 ? 175 LEU A N     1 
ATOM   1354 C  CA    . LEU A 1 178 ? 18.789 -10.600 12.930  1.00 34.17 ? 175 LEU A CA    1 
ATOM   1355 C  C     . LEU A 1 178 ? 18.998 -9.090  12.937  1.00 34.91 ? 175 LEU A C     1 
ATOM   1356 O  O     . LEU A 1 178 ? 19.273 -8.499  11.896  1.00 40.39 ? 175 LEU A O     1 
ATOM   1357 C  CB    . LEU A 1 178 ? 17.292 -10.917 12.972  1.00 32.58 ? 175 LEU A CB    1 
ATOM   1358 C  CG    . LEU A 1 178 ? 16.960 -12.383 12.654  1.00 33.58 ? 175 LEU A CG    1 
ATOM   1359 C  CD1   . LEU A 1 178 ? 15.474 -12.632 12.747  1.00 26.71 ? 175 LEU A CD1   1 
ATOM   1360 C  CD2   . LEU A 1 178 ? 17.502 -12.820 11.271  1.00 33.17 ? 175 LEU A CD2   1 
ATOM   1361 N  N     . ASP A 1 179 ? 18.891 -8.476  14.112  1.00 35.03 ? 176 ASP A N     1 
ATOM   1362 C  CA    . ASP A 1 179 ? 19.012 -7.021  14.241  1.00 36.79 ? 176 ASP A CA    1 
ATOM   1363 C  C     . ASP A 1 179 ? 20.422 -6.544  13.912  1.00 33.89 ? 176 ASP A C     1 
ATOM   1364 O  O     . ASP A 1 179 ? 20.628 -5.363  13.657  1.00 41.85 ? 176 ASP A O     1 
ATOM   1365 C  CB    . ASP A 1 179 ? 18.615 -6.550  15.658  1.00 32.23 ? 176 ASP A CB    1 
ATOM   1366 C  CG    . ASP A 1 179 ? 17.119 -6.706  15.932  1.00 36.87 ? 176 ASP A CG    1 
ATOM   1367 O  OD1   . ASP A 1 179 ? 16.350 -6.804  14.958  1.00 42.07 ? 176 ASP A OD1   1 
ATOM   1368 O  OD2   . ASP A 1 179 ? 16.697 -6.727  17.112  1.00 39.27 ? 176 ASP A OD2   1 
ATOM   1369 N  N     . SER A 1 180 ? 21.390 -7.453  13.940  1.00 33.07 ? 177 SER A N     1 
ATOM   1370 C  CA    . SER A 1 180 ? 22.755 -7.137  13.523  1.00 34.86 ? 177 SER A CA    1 
ATOM   1371 C  C     . SER A 1 180 ? 22.983 -7.368  12.038  1.00 37.80 ? 177 SER A C     1 
ATOM   1372 O  O     . SER A 1 180 ? 23.971 -6.897  11.478  1.00 44.31 ? 177 SER A O     1 
ATOM   1373 C  CB    . SER A 1 180 ? 23.769 -7.972  14.301  1.00 33.91 ? 177 SER A CB    1 
ATOM   1374 O  OG    . SER A 1 180 ? 23.932 -7.478  15.609  1.00 40.60 ? 177 SER A OG    1 
ATOM   1375 N  N     . LEU A 1 181 ? 22.077 -8.102  11.407  1.00 35.43 ? 178 LEU A N     1 
ATOM   1376 C  CA    . LEU A 1 181 ? 22.329 -8.619  10.067  1.00 41.37 ? 178 LEU A CA    1 
ATOM   1377 C  C     . LEU A 1 181 ? 22.451 -7.526  8.998   1.00 48.59 ? 178 LEU A C     1 
ATOM   1378 O  O     . LEU A 1 181 ? 21.709 -6.538  9.008   1.00 48.77 ? 178 LEU A O     1 
ATOM   1379 C  CB    . LEU A 1 181 ? 21.228 -9.610  9.683   1.00 42.33 ? 178 LEU A CB    1 
ATOM   1380 C  CG    . LEU A 1 181 ? 21.595 -10.679 8.652   1.00 45.02 ? 178 LEU A CG    1 
ATOM   1381 C  CD1   . LEU A 1 181 ? 22.924 -11.377 9.001   1.00 41.48 ? 178 LEU A CD1   1 
ATOM   1382 C  CD2   . LEU A 1 181 ? 20.470 -11.702 8.545   1.00 37.76 ? 178 LEU A CD2   1 
ATOM   1383 N  N     . GLN A 1 182 ? 23.396 -7.732  8.078   1.00 51.09 ? 179 GLN A N     1 
ATOM   1384 C  CA    . GLN A 1 182 ? 23.669 -6.812  6.969   1.00 52.74 ? 179 GLN A CA    1 
ATOM   1385 C  C     . GLN A 1 182 ? 23.071 -7.278  5.630   1.00 59.04 ? 179 GLN A C     1 
ATOM   1386 O  O     . GLN A 1 182 ? 23.752 -7.944  4.837   1.00 60.37 ? 179 GLN A O     1 
ATOM   1387 C  CB    . GLN A 1 182 ? 25.184 -6.618  6.813   1.00 53.42 ? 179 GLN A CB    1 
ATOM   1388 C  CG    . GLN A 1 182 ? 26.020 -7.922  6.801   1.00 52.17 ? 179 GLN A CG    1 
ATOM   1389 C  CD    . GLN A 1 182 ? 26.455 -8.383  8.197   1.00 55.43 ? 179 GLN A CD    1 
ATOM   1390 O  OE1   . GLN A 1 182 ? 25.634 -8.849  8.996   1.00 52.16 ? 179 GLN A OE1   1 
ATOM   1391 N  NE2   . GLN A 1 182 ? 27.757 -8.255  8.492   1.00 44.64 ? 179 GLN A NE2   1 
ATOM   1392 N  N     . ILE A 1 183 ? 21.814 -6.915  5.367   1.00 55.24 ? 180 ILE A N     1 
ATOM   1393 C  CA    . ILE A 1 183 ? 21.138 -7.345  4.138   1.00 60.14 ? 180 ILE A CA    1 
ATOM   1394 C  C     . ILE A 1 183 ? 21.495 -6.444  2.943   1.00 68.27 ? 180 ILE A C     1 
ATOM   1395 O  O     . ILE A 1 183 ? 21.183 -6.755  1.787   1.00 65.95 ? 180 ILE A O     1 
ATOM   1396 C  CB    . ILE A 1 183 ? 19.596 -7.403  4.336   1.00 60.81 ? 180 ILE A CB    1 
ATOM   1397 C  CG1   . ILE A 1 183 ? 19.062 -6.120  4.983   1.00 60.64 ? 180 ILE A CG1   1 
ATOM   1398 C  CG2   . ILE A 1 183 ? 19.222 -8.604  5.184   1.00 52.74 ? 180 ILE A CG2   1 
ATOM   1399 C  CD1   . ILE A 1 183 ? 18.585 -5.088  3.995   1.00 62.72 ? 180 ILE A CD1   1 
ATOM   1400 N  N     . ASP A 1 184 ? 22.150 -5.328  3.256   1.00 71.64 ? 181 ASP A N     1 
ATOM   1401 C  CA    . ASP A 1 184 ? 22.810 -4.452  2.291   1.00 69.48 ? 181 ASP A CA    1 
ATOM   1402 C  C     . ASP A 1 184 ? 23.769 -5.248  1.398   1.00 70.27 ? 181 ASP A C     1 
ATOM   1403 O  O     . ASP A 1 184 ? 23.832 -5.038  0.185   1.00 75.72 ? 181 ASP A O     1 
ATOM   1404 C  CB    . ASP A 1 184 ? 23.557 -3.341  3.058   1.00 74.74 ? 181 ASP A CB    1 
ATOM   1405 C  CG    . ASP A 1 184 ? 24.357 -2.401  2.155   1.00 78.63 ? 181 ASP A CG    1 
ATOM   1406 O  OD1   . ASP A 1 184 ? 25.224 -2.852  1.370   1.00 81.51 ? 181 ASP A OD1   1 
ATOM   1407 O  OD2   . ASP A 1 184 ? 24.108 -1.179  2.242   1.00 81.45 ? 181 ASP A OD2   1 
ATOM   1408 N  N     . ASN A 1 185 ? 24.507 -6.169  2.012   1.00 67.38 ? 182 ASN A N     1 
ATOM   1409 C  CA    . ASN A 1 185 ? 25.552 -6.932  1.333   1.00 64.76 ? 182 ASN A CA    1 
ATOM   1410 C  C     . ASN A 1 185 ? 25.135 -8.381  1.065   1.00 60.60 ? 182 ASN A C     1 
ATOM   1411 O  O     . ASN A 1 185 ? 25.033 -9.180  1.996   1.00 58.64 ? 182 ASN A O     1 
ATOM   1412 C  CB    . ASN A 1 185 ? 26.837 -6.892  2.171   1.00 63.61 ? 182 ASN A CB    1 
ATOM   1413 C  CG    . ASN A 1 185 ? 28.005 -7.594  1.503   1.00 62.49 ? 182 ASN A CG    1 
ATOM   1414 O  OD1   . ASN A 1 185 ? 28.032 -7.770  0.282   1.00 62.95 ? 182 ASN A OD1   1 
ATOM   1415 N  ND2   . ASN A 1 185 ? 28.986 -7.996  2.308   1.00 61.77 ? 182 ASN A ND2   1 
ATOM   1416 N  N     . LEU A 1 186 ? 24.906 -8.707  -0.209  1.00 57.01 ? 183 LEU A N     1 
ATOM   1417 C  CA    . LEU A 1 186 ? 24.520 -10.058 -0.629  1.00 56.03 ? 183 LEU A CA    1 
ATOM   1418 C  C     . LEU A 1 186 ? 25.637 -11.080 -0.437  1.00 55.73 ? 183 LEU A C     1 
ATOM   1419 O  O     . LEU A 1 186 ? 25.388 -12.287 -0.416  1.00 54.30 ? 183 LEU A O     1 
ATOM   1420 C  CB    . LEU A 1 186 ? 24.103 -10.071 -2.102  1.00 55.38 ? 183 LEU A CB    1 
ATOM   1421 C  CG    . LEU A 1 186 ? 22.861 -9.322  -2.576  1.00 60.01 ? 183 LEU A CG    1 
ATOM   1422 C  CD1   . LEU A 1 186 ? 22.791 -9.419  -4.087  1.00 62.24 ? 183 LEU A CD1   1 
ATOM   1423 C  CD2   . LEU A 1 186 ? 21.588 -9.870  -1.937  1.00 55.92 ? 183 LEU A CD2   1 
ATOM   1424 N  N     . THR A 1 187 ? 26.865 -10.590 -0.307  1.00 58.82 ? 184 THR A N     1 
ATOM   1425 C  CA    . THR A 1 187 ? 28.035 -11.461 -0.240  1.00 55.24 ? 184 THR A CA    1 
ATOM   1426 C  C     . THR A 1 187 ? 28.541 -11.703 1.187   1.00 47.03 ? 184 THR A C     1 
ATOM   1427 O  O     . THR A 1 187 ? 29.572 -12.338 1.371   1.00 50.69 ? 184 THR A O     1 
ATOM   1428 C  CB    . THR A 1 187 ? 29.204 -10.894 -1.099  1.00 61.91 ? 184 THR A CB    1 
ATOM   1429 O  OG1   . THR A 1 187 ? 29.667 -9.651  -0.548  1.00 58.90 ? 184 THR A OG1   1 
ATOM   1430 C  CG2   . THR A 1 187 ? 28.761 -10.688 -2.560  1.00 58.29 ? 184 THR A CG2   1 
ATOM   1431 N  N     . SER A 1 188 ? 27.819 -11.222 2.195   1.00 48.02 ? 185 SER A N     1 
ATOM   1432 C  CA    . SER A 1 188 ? 28.190 -11.515 3.579   1.00 40.76 ? 185 SER A CA    1 
ATOM   1433 C  C     . SER A 1 188 ? 27.838 -12.942 4.001   1.00 32.96 ? 185 SER A C     1 
ATOM   1434 O  O     . SER A 1 188 ? 26.680 -13.354 3.946   1.00 31.61 ? 185 SER A O     1 
ATOM   1435 C  CB    . SER A 1 188 ? 27.526 -10.537 4.539   1.00 40.80 ? 185 SER A CB    1 
ATOM   1436 O  OG    . SER A 1 188 ? 27.760 -10.934 5.881   1.00 37.38 ? 185 SER A OG    1 
ATOM   1437 N  N     . PRO A 1 189 ? 28.850 -13.695 4.438   1.00 34.97 ? 186 PRO A N     1 
ATOM   1438 C  CA    . PRO A 1 189 ? 28.731 -15.069 4.946   1.00 29.33 ? 186 PRO A CA    1 
ATOM   1439 C  C     . PRO A 1 189 ? 27.617 -15.257 5.965   1.00 29.29 ? 186 PRO A C     1 
ATOM   1440 O  O     . PRO A 1 189 ? 26.948 -16.272 5.917   1.00 28.15 ? 186 PRO A O     1 
ATOM   1441 C  CB    . PRO A 1 189 ? 30.088 -15.312 5.603   1.00 28.18 ? 186 PRO A CB    1 
ATOM   1442 C  CG    . PRO A 1 189 ? 31.020 -14.460 4.819   1.00 33.26 ? 186 PRO A CG    1 
ATOM   1443 C  CD    . PRO A 1 189 ? 30.249 -13.238 4.411   1.00 32.91 ? 186 PRO A CD    1 
ATOM   1444 N  N     . ASP A 1 190 ? 27.423 -14.314 6.882   1.00 28.77 ? 187 ASP A N     1 
ATOM   1445 C  CA    . ASP A 1 190 ? 26.376 -14.485 7.876   1.00 27.87 ? 187 ASP A CA    1 
ATOM   1446 C  C     . ASP A 1 190 ? 25.003 -14.426 7.258   1.00 28.59 ? 187 ASP A C     1 
ATOM   1447 O  O     . ASP A 1 190 ? 24.114 -15.164 7.671   1.00 28.32 ? 187 ASP A O     1 
ATOM   1448 C  CB    . ASP A 1 190 ? 26.482 -13.435 8.968   1.00 31.47 ? 187 ASP A CB    1 
ATOM   1449 C  CG    . ASP A 1 190 ? 27.772 -13.536 9.723   1.00 33.33 ? 187 ASP A CG    1 
ATOM   1450 O  OD1   . ASP A 1 190 ? 28.337 -14.652 9.780   1.00 29.66 ? 187 ASP A OD1   1 
ATOM   1451 O  OD2   . ASP A 1 190 ? 28.221 -12.501 10.240  1.00 33.28 ? 187 ASP A OD2   1 
ATOM   1452 N  N     . LEU A 1 191 ? 24.833 -13.533 6.285   1.00 27.47 ? 188 LEU A N     1 
ATOM   1453 C  CA    . LEU A 1 191 ? 23.593 -13.441 5.539   1.00 28.44 ? 188 LEU A CA    1 
ATOM   1454 C  C     . LEU A 1 191 ? 23.347 -14.737 4.769   1.00 26.96 ? 188 LEU A C     1 
ATOM   1455 O  O     . LEU A 1 191 ? 22.240 -15.267 4.780   1.00 26.20 ? 188 LEU A O     1 
ATOM   1456 C  CB    . LEU A 1 191 ? 23.619 -12.252 4.573   1.00 30.78 ? 188 LEU A CB    1 
ATOM   1457 C  CG    . LEU A 1 191 ? 22.285 -11.985 3.862   1.00 35.90 ? 188 LEU A CG    1 
ATOM   1458 C  CD1   . LEU A 1 191 ? 21.173 -11.694 4.871   1.00 35.06 ? 188 LEU A CD1   1 
ATOM   1459 C  CD2   . LEU A 1 191 ? 22.402 -10.838 2.876   1.00 38.56 ? 188 LEU A CD2   1 
ATOM   1460 N  N     . GLN A 1 192 ? 24.386 -15.233 4.100   1.00 26.03 ? 189 GLN A N     1 
ATOM   1461 C  CA    . GLN A 1 192 ? 24.311 -16.508 3.391   1.00 27.76 ? 189 GLN A CA    1 
ATOM   1462 C  C     . GLN A 1 192 ? 23.779 -17.609 4.321   1.00 25.61 ? 189 GLN A C     1 
ATOM   1463 O  O     . GLN A 1 192 ? 22.779 -18.252 4.018   1.00 24.82 ? 189 GLN A O     1 
ATOM   1464 C  CB    . GLN A 1 192 ? 25.684 -16.906 2.843   1.00 27.52 ? 189 GLN A CB    1 
ATOM   1465 C  CG    . GLN A 1 192 ? 26.264 -16.033 1.723   1.00 32.00 ? 189 GLN A CG    1 
ATOM   1466 C  CD    . GLN A 1 192 ? 27.746 -16.329 1.482   1.00 35.98 ? 189 GLN A CD    1 
ATOM   1467 O  OE1   . GLN A 1 192 ? 28.279 -17.359 1.929   1.00 36.00 ? 189 GLN A OE1   1 
ATOM   1468 N  NE2   . GLN A 1 192 ? 28.424 -15.419 0.801   1.00 42.39 ? 189 GLN A NE2   1 
ATOM   1469 N  N     . LEU A 1 193 ? 24.455 -17.800 5.453   1.00 24.26 ? 190 LEU A N     1 
ATOM   1470 C  CA    . LEU A 1 193 ? 24.022 -18.732 6.498   1.00 23.97 ? 190 LEU A CA    1 
ATOM   1471 C  C     . LEU A 1 193 ? 22.583 -18.524 6.914   1.00 23.14 ? 190 LEU A C     1 
ATOM   1472 O  O     . LEU A 1 193 ? 21.823 -19.482 6.986   1.00 23.90 ? 190 LEU A O     1 
ATOM   1473 C  CB    . LEU A 1 193 ? 24.908 -18.618 7.734   1.00 22.47 ? 190 LEU A CB    1 
ATOM   1474 C  CG    . LEU A 1 193 ? 26.354 -19.088 7.603   1.00 22.30 ? 190 LEU A CG    1 
ATOM   1475 C  CD1   . LEU A 1 193 ? 27.025 -19.149 8.973   1.00 22.73 ? 190 LEU A CD1   1 
ATOM   1476 C  CD2   . LEU A 1 193 ? 26.390 -20.422 6.926   1.00 19.17 ? 190 LEU A CD2   1 
ATOM   1477 N  N     . THR A 1 194 ? 22.209 -17.269 7.170   1.00 23.58 ? 191 THR A N     1 
ATOM   1478 C  CA    . THR A 1 194 ? 20.840 -16.944 7.582   1.00 25.37 ? 191 THR A CA    1 
ATOM   1479 C  C     . THR A 1 194 ? 19.800 -17.456 6.578   1.00 28.19 ? 191 THR A C     1 
ATOM   1480 O  O     . THR A 1 194 ? 18.811 -18.080 6.968   1.00 25.54 ? 191 THR A O     1 
ATOM   1481 C  CB    . THR A 1 194 ? 20.657 -15.438 7.773   1.00 23.82 ? 191 THR A CB    1 
ATOM   1482 O  OG1   . THR A 1 194 ? 21.672 -14.956 8.660   1.00 25.85 ? 191 THR A OG1   1 
ATOM   1483 C  CG2   . THR A 1 194 ? 19.275 -15.126 8.356   1.00 23.19 ? 191 THR A CG2   1 
ATOM   1484 N  N     . VAL A 1 195 ? 20.040 -17.204 5.292   1.00 28.08 ? 192 VAL A N     1 
ATOM   1485 C  CA    . VAL A 1 195 ? 19.117 -17.613 4.240   1.00 27.62 ? 192 VAL A CA    1 
ATOM   1486 C  C     . VAL A 1 195 ? 19.189 -19.130 4.038   1.00 26.76 ? 192 VAL A C     1 
ATOM   1487 O  O     . VAL A 1 195 ? 18.176 -19.792 3.788   1.00 29.24 ? 192 VAL A O     1 
ATOM   1488 C  CB    . VAL A 1 195 ? 19.415 -16.861 2.911   1.00 28.36 ? 192 VAL A CB    1 
ATOM   1489 C  CG1   . VAL A 1 195 ? 18.551 -17.388 1.783   1.00 27.52 ? 192 VAL A CG1   1 
ATOM   1490 C  CG2   . VAL A 1 195 ? 19.185 -15.369 3.086   1.00 29.29 ? 192 VAL A CG2   1 
ATOM   1491 N  N     . GLY A 1 196 ? 20.383 -19.691 4.152   1.00 22.59 ? 193 GLY A N     1 
ATOM   1492 C  CA    . GLY A 1 196 ? 20.500 -21.137 4.235   1.00 23.57 ? 193 GLY A CA    1 
ATOM   1493 C  C     . GLY A 1 196 ? 19.603 -21.744 5.314   1.00 26.52 ? 193 GLY A C     1 
ATOM   1494 O  O     . GLY A 1 196 ? 18.941 -22.764 5.096   1.00 28.46 ? 193 GLY A O     1 
ATOM   1495 N  N     . ALA A 1 197 ? 19.567 -21.108 6.479   1.00 23.98 ? 194 ALA A N     1 
ATOM   1496 C  CA    . ALA A 1 197 ? 18.746 -21.582 7.584   1.00 22.42 ? 194 ALA A CA    1 
ATOM   1497 C  C     . ALA A 1 197 ? 17.245 -21.450 7.298   1.00 25.12 ? 194 ALA A C     1 
ATOM   1498 O  O     . ALA A 1 197 ? 16.410 -22.213 7.831   1.00 25.58 ? 194 ALA A O     1 
ATOM   1499 C  CB    . ALA A 1 197 ? 19.115 -20.820 8.863   1.00 21.18 ? 194 ALA A CB    1 
ATOM   1500 N  N     . VAL A 1 198 ? 16.889 -20.468 6.479   1.00 23.41 ? 195 VAL A N     1 
ATOM   1501 C  CA    . VAL A 1 198 ? 15.491 -20.282 6.128   1.00 21.26 ? 195 VAL A CA    1 
ATOM   1502 C  C     . VAL A 1 198 ? 15.085 -21.464 5.241   1.00 24.42 ? 195 VAL A C     1 
ATOM   1503 O  O     . VAL A 1 198 ? 14.017 -22.055 5.402   1.00 24.00 ? 195 VAL A O     1 
ATOM   1504 C  CB    . VAL A 1 198 ? 15.257 -18.943 5.422   1.00 23.45 ? 195 VAL A CB    1 
ATOM   1505 C  CG1   . VAL A 1 198 ? 13.956 -18.967 4.617   1.00 23.53 ? 195 VAL A CG1   1 
ATOM   1506 C  CG2   . VAL A 1 198 ? 15.284 -17.790 6.427   1.00 21.66 ? 195 VAL A CG2   1 
ATOM   1507 N  N     . ILE A 1 199 ? 15.967 -21.837 4.327   1.00 25.67 ? 196 ILE A N     1 
ATOM   1508 C  CA    . ILE A 1 199 ? 15.698 -22.973 3.444   1.00 25.73 ? 196 ILE A CA    1 
ATOM   1509 C  C     . ILE A 1 199 ? 15.593 -24.286 4.230   1.00 23.01 ? 196 ILE A C     1 
ATOM   1510 O  O     . ILE A 1 199 ? 14.677 -25.080 4.001   1.00 23.56 ? 196 ILE A O     1 
ATOM   1511 C  CB    . ILE A 1 199 ? 16.771 -23.062 2.352   1.00 18.62 ? 196 ILE A CB    1 
ATOM   1512 C  CG1   . ILE A 1 199 ? 16.655 -21.820 1.458   1.00 23.53 ? 196 ILE A CG1   1 
ATOM   1513 C  CG2   . ILE A 1 199 ? 16.596 -24.296 1.540   1.00 19.79 ? 196 ILE A CG2   1 
ATOM   1514 C  CD1   . ILE A 1 199 ? 17.844 -21.567 0.558   1.00 22.80 ? 196 ILE A CD1   1 
ATOM   1515 N  N     . VAL A 1 200 ? 16.491 -24.506 5.186   1.00 24.70 ? 197 VAL A N     1 
ATOM   1516 C  CA    . VAL A 1 200 ? 16.403 -25.718 6.003   1.00 21.15 ? 197 VAL A CA    1 
ATOM   1517 C  C     . VAL A 1 200 ? 15.118 -25.795 6.840   1.00 20.94 ? 197 VAL A C     1 
ATOM   1518 O  O     . VAL A 1 200 ? 14.581 -26.877 7.032   1.00 23.69 ? 197 VAL A O     1 
ATOM   1519 C  CB    . VAL A 1 200 ? 17.606 -25.847 6.920   1.00 20.29 ? 197 VAL A CB    1 
ATOM   1520 C  CG1   . VAL A 1 200 ? 17.562 -27.181 7.620   1.00 19.19 ? 197 VAL A CG1   1 
ATOM   1521 C  CG2   . VAL A 1 200 ? 18.875 -25.750 6.099   1.00 21.68 ? 197 VAL A CG2   1 
ATOM   1522 N  N     . GLU A 1 201 ? 14.625 -24.660 7.336   1.00 22.63 ? 198 GLU A N     1 
ATOM   1523 C  CA    . GLU A 1 201 ? 13.272 -24.598 7.914   1.00 23.52 ? 198 GLU A CA    1 
ATOM   1524 C  C     . GLU A 1 201 ? 12.204 -25.175 6.975   1.00 22.15 ? 198 GLU A C     1 
ATOM   1525 O  O     . GLU A 1 201 ? 11.387 -25.999 7.372   1.00 23.92 ? 198 GLU A O     1 
ATOM   1526 C  CB    . GLU A 1 201 ? 12.895 -23.150 8.268   1.00 24.47 ? 198 GLU A CB    1 
ATOM   1527 C  CG    . GLU A 1 201 ? 13.633 -22.561 9.472   1.00 25.96 ? 198 GLU A CG    1 
ATOM   1528 C  CD    . GLU A 1 201 ? 13.128 -23.067 10.830  1.00 25.93 ? 198 GLU A CD    1 
ATOM   1529 O  OE1   . GLU A 1 201 ? 12.274 -23.983 10.878  1.00 26.07 ? 198 GLU A OE1   1 
ATOM   1530 O  OE2   . GLU A 1 201 ? 13.596 -22.538 11.858  1.00 24.98 ? 198 GLU A OE2   1 
ATOM   1531 N  N     . GLU A 1 202 ? 12.227 -24.733 5.724   1.00 23.28 ? 199 GLU A N     1 
ATOM   1532 C  CA    . GLU A 1 202 ? 11.281 -25.185 4.716   1.00 23.44 ? 199 GLU A CA    1 
ATOM   1533 C  C     . GLU A 1 202 ? 11.444 -26.679 4.420   1.00 24.17 ? 199 GLU A C     1 
ATOM   1534 O  O     . GLU A 1 202 ? 10.462 -27.431 4.388   1.00 22.33 ? 199 GLU A O     1 
ATOM   1535 C  CB    . GLU A 1 202 ? 11.461 -24.370 3.436   1.00 21.81 ? 199 GLU A CB    1 
ATOM   1536 C  CG    . GLU A 1 202 ? 11.256 -22.894 3.663   1.00 29.38 ? 199 GLU A CG    1 
ATOM   1537 C  CD    . GLU A 1 202 ? 11.851 -22.035 2.575   1.00 27.70 ? 199 GLU A CD    1 
ATOM   1538 O  OE1   . GLU A 1 202 ? 11.679 -20.798 2.628   1.00 31.70 ? 199 GLU A OE1   1 
ATOM   1539 O  OE2   . GLU A 1 202 ? 12.495 -22.596 1.669   1.00 32.08 ? 199 GLU A OE2   1 
ATOM   1540 N  N     . MET A 1 203 ? 12.689 -27.079 4.178   1.00 19.75 ? 200 MET A N     1 
ATOM   1541 C  CA    . MET A 1 203 ? 13.045 -28.463 3.966   1.00 22.24 ? 200 MET A CA    1 
ATOM   1542 C  C     . MET A 1 203 ? 12.569 -29.328 5.139   1.00 26.46 ? 200 MET A C     1 
ATOM   1543 O  O     . MET A 1 203 ? 11.905 -30.360 4.956   1.00 24.15 ? 200 MET A O     1 
ATOM   1544 C  CB    . MET A 1 203 ? 14.556 -28.575 3.783   1.00 26.37 ? 200 MET A CB    1 
ATOM   1545 C  CG    . MET A 1 203 ? 15.059 -29.947 3.401   1.00 27.83 ? 200 MET A CG    1 
ATOM   1546 S  SD    . MET A 1 203 ? 16.844 -29.925 3.166   1.00 43.55 ? 200 MET A SD    1 
ATOM   1547 C  CE    . MET A 1 203 ? 17.052 -28.384 2.307   1.00 23.65 ? 200 MET A CE    1 
ATOM   1548 N  N     . ARG A 1 204 ? 12.880 -28.901 6.355   1.00 23.66 ? 201 ARG A N     1 
ATOM   1549 C  CA    . ARG A 1 204 ? 12.501 -29.720 7.494   1.00 27.74 ? 201 ARG A CA    1 
ATOM   1550 C  C     . ARG A 1 204 ? 10.987 -29.777 7.618   1.00 26.65 ? 201 ARG A C     1 
ATOM   1551 O  O     . ARG A 1 204 ? 10.439 -30.808 7.989   1.00 25.20 ? 201 ARG A O     1 
ATOM   1552 C  CB    . ARG A 1 204 ? 13.138 -29.201 8.781   1.00 26.28 ? 201 ARG A CB    1 
ATOM   1553 C  CG    . ARG A 1 204 ? 14.621 -29.453 8.832   1.00 23.82 ? 201 ARG A CG    1 
ATOM   1554 C  CD    . ARG A 1 204 ? 15.229 -28.873 10.084  1.00 24.77 ? 201 ARG A CD    1 
ATOM   1555 N  NE    . ARG A 1 204 ? 14.489 -29.307 11.261  1.00 28.53 ? 201 ARG A NE    1 
ATOM   1556 C  CZ    . ARG A 1 204 ? 13.885 -28.476 12.100  1.00 27.52 ? 201 ARG A CZ    1 
ATOM   1557 N  NH1   . ARG A 1 204 ? 13.221 -28.954 13.147  1.00 23.20 ? 201 ARG A NH1   1 
ATOM   1558 N  NH2   . ARG A 1 204 ? 13.977 -27.170 11.897  1.00 23.00 ? 201 ARG A NH2   1 
ATOM   1559 N  N     . ALA A 1 205 ? 10.312 -28.676 7.288   1.00 27.39 ? 202 ALA A N     1 
ATOM   1560 C  CA    . ALA A 1 205 ? 8.848  -28.650 7.322   1.00 27.52 ? 202 ALA A CA    1 
ATOM   1561 C  C     . ALA A 1 205 ? 8.290  -29.650 6.312   1.00 28.59 ? 202 ALA A C     1 
ATOM   1562 O  O     . ALA A 1 205 ? 7.343  -30.384 6.593   1.00 25.77 ? 202 ALA A O     1 
ATOM   1563 C  CB    . ALA A 1 205 ? 8.328  -27.256 7.035   1.00 23.93 ? 202 ALA A CB    1 
ATOM   1564 N  N     . ALA A 1 206 ? 8.916  -29.683 5.141   1.00 26.55 ? 203 ALA A N     1 
ATOM   1565 C  CA    . ALA A 1 206 ? 8.509  -30.578 4.061   1.00 27.22 ? 203 ALA A CA    1 
ATOM   1566 C  C     . ALA A 1 206 ? 8.615  -32.052 4.464   1.00 26.16 ? 203 ALA A C     1 
ATOM   1567 O  O     . ALA A 1 206 ? 7.705  -32.850 4.202   1.00 24.98 ? 203 ALA A O     1 
ATOM   1568 C  CB    . ALA A 1 206 ? 9.351  -30.301 2.820   1.00 24.98 ? 203 ALA A CB    1 
ATOM   1569 N  N     . ILE A 1 207 ? 9.729  -32.402 5.105   1.00 26.64 ? 204 ILE A N     1 
ATOM   1570 C  CA    . ILE A 1 207 ? 9.956  -33.764 5.588   1.00 24.41 ? 204 ILE A CA    1 
ATOM   1571 C  C     . ILE A 1 207 ? 8.878  -34.178 6.575   1.00 21.84 ? 204 ILE A C     1 
ATOM   1572 O  O     . ILE A 1 207 ? 8.329  -35.275 6.482   1.00 23.66 ? 204 ILE A O     1 
ATOM   1573 C  CB    . ILE A 1 207 ? 11.341 -33.907 6.256   1.00 23.66 ? 204 ILE A CB    1 
ATOM   1574 C  CG1   . ILE A 1 207 ? 12.453 -33.740 5.220   1.00 24.93 ? 204 ILE A CG1   1 
ATOM   1575 C  CG2   . ILE A 1 207 ? 11.470 -35.234 6.977   1.00 18.81 ? 204 ILE A CG2   1 
ATOM   1576 C  CD1   . ILE A 1 207 ? 13.874 -33.676 5.819   1.00 20.93 ? 204 ILE A CD1   1 
ATOM   1577 N  N     . GLU A 1 208 ? 8.562  -33.309 7.520   1.00 20.68 ? 205 GLU A N     1 
ATOM   1578 C  CA    . GLU A 1 208 ? 7.578  -33.683 8.514   1.00 24.13 ? 205 GLU A CA    1 
ATOM   1579 C  C     . GLU A 1 208 ? 6.187  -33.720 7.913   1.00 23.64 ? 205 GLU A C     1 
ATOM   1580 O  O     . GLU A 1 208 ? 5.405  -34.608 8.243   1.00 29.27 ? 205 GLU A O     1 
ATOM   1581 C  CB    . GLU A 1 208 ? 7.598  -32.742 9.716   1.00 26.15 ? 205 GLU A CB    1 
ATOM   1582 C  CG    . GLU A 1 208 ? 6.606  -33.148 10.834  1.00 23.68 ? 205 GLU A CG    1 
ATOM   1583 C  CD    . GLU A 1 208 ? 6.702  -32.244 12.054  1.00 28.07 ? 205 GLU A CD    1 
ATOM   1584 O  OE1   . GLU A 1 208 ? 6.211  -32.625 13.133  1.00 31.94 ? 205 GLU A OE1   1 
ATOM   1585 O  OE2   . GLU A 1 208 ? 7.290  -31.149 11.940  1.00 29.94 ? 205 GLU A OE2   1 
ATOM   1586 N  N     . ARG A 1 209 ? 5.869  -32.781 7.034   1.00 22.18 ? 206 ARG A N     1 
ATOM   1587 C  CA    . ARG A 1 209 ? 4.532  -32.771 6.429   1.00 26.30 ? 206 ARG A CA    1 
ATOM   1588 C  C     . ARG A 1 209 ? 4.315  -33.994 5.551   1.00 22.66 ? 206 ARG A C     1 
ATOM   1589 O  O     . ARG A 1 209 ? 3.206  -34.500 5.439   1.00 28.00 ? 206 ARG A O     1 
ATOM   1590 C  CB    . ARG A 1 209 ? 4.282  -31.498 5.598   1.00 27.83 ? 206 ARG A CB    1 
ATOM   1591 C  CG    . ARG A 1 209 ? 2.886  -31.496 4.925   1.00 35.37 ? 206 ARG A CG    1 
ATOM   1592 C  CD    . ARG A 1 209 ? 2.639  -30.393 3.889   1.00 32.98 ? 206 ARG A CD    1 
ATOM   1593 N  NE    . ARG A 1 209 ? 3.065  -30.748 2.531   1.00 35.93 ? 206 ARG A NE    1 
ATOM   1594 C  CZ    . ARG A 1 209 ? 2.419  -31.598 1.733   1.00 31.12 ? 206 ARG A CZ    1 
ATOM   1595 N  NH1   . ARG A 1 209 ? 2.884  -31.851 0.512   1.00 29.81 ? 206 ARG A NH1   1 
ATOM   1596 N  NH2   . ARG A 1 209 ? 1.320  -32.202 2.162   1.00 28.15 ? 206 ARG A NH2   1 
ATOM   1597 N  N     . GLU A 1 210 ? 5.372  -34.480 4.928   1.00 21.48 ? 207 GLU A N     1 
ATOM   1598 C  CA    . GLU A 1 210 ? 5.188  -35.520 3.943   1.00 20.85 ? 207 GLU A CA    1 
ATOM   1599 C  C     . GLU A 1 210 ? 5.515  -36.911 4.450   1.00 22.53 ? 207 GLU A C     1 
ATOM   1600 O  O     . GLU A 1 210 ? 5.167  -37.888 3.802   1.00 20.53 ? 207 GLU A O     1 
ATOM   1601 C  CB    . GLU A 1 210 ? 6.004  -35.188 2.721   1.00 22.29 ? 207 GLU A CB    1 
ATOM   1602 C  CG    . GLU A 1 210 ? 5.500  -33.934 2.053   1.00 22.29 ? 207 GLU A CG    1 
ATOM   1603 C  CD    . GLU A 1 210 ? 6.297  -33.550 0.845   1.00 23.53 ? 207 GLU A CD    1 
ATOM   1604 O  OE1   . GLU A 1 210 ? 6.941  -34.433 0.242   1.00 24.44 ? 207 GLU A OE1   1 
ATOM   1605 O  OE2   . GLU A 1 210 ? 6.269  -32.359 0.492   1.00 28.45 ? 207 GLU A OE2   1 
ATOM   1606 N  N     . THR A 1 211 ? 6.147  -37.000 5.625   1.00 23.18 ? 208 THR A N     1 
ATOM   1607 C  CA    . THR A 1 211 ? 6.509  -38.289 6.194   1.00 21.85 ? 208 THR A CA    1 
ATOM   1608 C  C     . THR A 1 211 ? 6.057  -38.526 7.638   1.00 22.65 ? 208 THR A C     1 
ATOM   1609 O  O     . THR A 1 211 ? 5.976  -39.670 8.059   1.00 24.47 ? 208 THR A O     1 
ATOM   1610 C  CB    . THR A 1 211 ? 8.041  -38.521 6.152   1.00 25.15 ? 208 THR A CB    1 
ATOM   1611 O  OG1   . THR A 1 211 ? 8.691  -37.733 7.157   1.00 24.27 ? 208 THR A OG1   1 
ATOM   1612 C  CG2   . THR A 1 211 ? 8.579  -38.163 4.823   1.00 24.03 ? 208 THR A CG2   1 
ATOM   1613 N  N     . GLY A 1 212 ? 5.781  -37.470 8.397   1.00 24.34 ? 209 GLY A N     1 
ATOM   1614 C  CA    . GLY A 1 212 ? 5.481  -37.615 9.818   1.00 25.22 ? 209 GLY A CA    1 
ATOM   1615 C  C     . GLY A 1 212 ? 6.722  -37.602 10.708  1.00 26.50 ? 209 GLY A C     1 
ATOM   1616 O  O     . GLY A 1 212 ? 6.634  -37.563 11.931  1.00 27.37 ? 209 GLY A O     1 
ATOM   1617 N  N     . PHE A 1 213 ? 7.887  -37.617 10.075  1.00 23.05 ? 210 PHE A N     1 
ATOM   1618 C  CA    . PHE A 1 213 ? 9.157  -37.698 10.759  1.00 22.11 ? 210 PHE A CA    1 
ATOM   1619 C  C     . PHE A 1 213 ? 9.716  -36.312 11.083  1.00 25.38 ? 210 PHE A C     1 
ATOM   1620 O  O     . PHE A 1 213 ? 9.826  -35.465 10.190  1.00 23.43 ? 210 PHE A O     1 
ATOM   1621 C  CB    . PHE A 1 213 ? 10.152 -38.468 9.891   1.00 21.16 ? 210 PHE A CB    1 
ATOM   1622 C  CG    . PHE A 1 213 ? 9.734  -39.896 9.590   1.00 24.15 ? 210 PHE A CG    1 
ATOM   1623 C  CD1   . PHE A 1 213 ? 8.996  -40.635 10.509  1.00 21.03 ? 210 PHE A CD1   1 
ATOM   1624 C  CD2   . PHE A 1 213 ? 10.073 -40.494 8.386   1.00 19.99 ? 210 PHE A CD2   1 
ATOM   1625 C  CE1   . PHE A 1 213 ? 8.620  -41.935 10.232  1.00 20.19 ? 210 PHE A CE1   1 
ATOM   1626 C  CE2   . PHE A 1 213 ? 9.700  -41.795 8.111   1.00 20.63 ? 210 PHE A CE2   1 
ATOM   1627 C  CZ    . PHE A 1 213 ? 8.972  -42.519 9.041   1.00 19.71 ? 210 PHE A CZ    1 
ATOM   1628 N  N     . GLN A 1 214 ? 10.076 -36.093 12.348  1.00 17.87 ? 211 GLN A N     1 
ATOM   1629 C  CA    . GLN A 1 214 ? 10.813 -34.894 12.755  1.00 21.26 ? 211 GLN A CA    1 
ATOM   1630 C  C     . GLN A 1 214 ? 12.327 -35.076 12.664  1.00 21.33 ? 211 GLN A C     1 
ATOM   1631 O  O     . GLN A 1 214 ? 12.829 -36.190 12.721  1.00 22.20 ? 211 GLN A O     1 
ATOM   1632 C  CB    . GLN A 1 214 ? 10.444 -34.502 14.179  1.00 21.24 ? 211 GLN A CB    1 
ATOM   1633 C  CG    . GLN A 1 214 ? 9.040  -33.982 14.309  1.00 23.46 ? 211 GLN A CG    1 
ATOM   1634 C  CD    . GLN A 1 214 ? 8.735  -33.558 15.715  1.00 29.65 ? 211 GLN A CD    1 
ATOM   1635 O  OE1   . GLN A 1 214 ? 9.455  -33.935 16.649  1.00 22.29 ? 211 GLN A OE1   1 
ATOM   1636 N  NE2   . GLN A 1 214 ? 7.670  -32.757 15.885  1.00 27.41 ? 211 GLN A NE2   1 
ATOM   1637 N  N     . CYS A 1 215 ? 13.059 -33.975 12.549  1.00 23.21 ? 212 CYS A N     1 
ATOM   1638 C  CA    . CYS A 1 215 ? 14.509 -34.049 12.438  1.00 22.65 ? 212 CYS A CA    1 
ATOM   1639 C  C     . CYS A 1 215 ? 15.192 -32.796 12.937  1.00 22.96 ? 212 CYS A C     1 
ATOM   1640 O  O     . CYS A 1 215 ? 14.549 -31.763 13.168  1.00 24.49 ? 212 CYS A O     1 
ATOM   1641 C  CB    . CYS A 1 215 ? 14.917 -34.311 10.989  1.00 23.30 ? 212 CYS A CB    1 
ATOM   1642 S  SG    . CYS A 1 215 ? 14.466 -33.015 9.838   1.00 29.11 ? 212 CYS A SG    1 
ATOM   1643 N  N     . SER A 1 216 ? 16.508 -32.881 13.105  1.00 24.39 ? 213 SER A N     1 
ATOM   1644 C  CA    . SER A 1 216 ? 17.289 -31.690 13.431  1.00 25.77 ? 213 SER A CA    1 
ATOM   1645 C  C     . SER A 1 216 ? 18.299 -31.376 12.328  1.00 23.12 ? 213 SER A C     1 
ATOM   1646 O  O     . SER A 1 216 ? 18.576 -32.220 11.497  1.00 23.86 ? 213 SER A O     1 
ATOM   1647 C  CB    . SER A 1 216 ? 17.982 -31.873 14.768  1.00 23.34 ? 213 SER A CB    1 
ATOM   1648 O  OG    . SER A 1 216 ? 17.002 -32.088 15.760  1.00 28.90 ? 213 SER A OG    1 
ATOM   1649 N  N     . ALA A 1 217 ? 18.826 -30.155 12.318  1.00 22.52 ? 214 ALA A N     1 
ATOM   1650 C  CA    . ALA A 1 217 ? 19.820 -29.761 11.328  1.00 20.91 ? 214 ALA A CA    1 
ATOM   1651 C  C     . ALA A 1 217 ? 20.868 -28.800 11.870  1.00 25.10 ? 214 ALA A C     1 
ATOM   1652 O  O     . ALA A 1 217 ? 20.616 -28.012 12.784  1.00 23.79 ? 214 ALA A O     1 
ATOM   1653 C  CB    . ALA A 1 217 ? 19.150 -29.134 10.117  1.00 24.59 ? 214 ALA A CB    1 
ATOM   1654 N  N     . GLY A 1 218 ? 22.057 -28.876 11.286  1.00 25.97 ? 215 GLY A N     1 
ATOM   1655 C  CA    . GLY A 1 218 ? 23.061 -27.864 11.499  1.00 22.86 ? 215 GLY A CA    1 
ATOM   1656 C  C     . GLY A 1 218 ? 23.263 -27.091 10.207  1.00 23.01 ? 215 GLY A C     1 
ATOM   1657 O  O     . GLY A 1 218 ? 23.287 -27.686 9.118   1.00 24.55 ? 215 GLY A O     1 
ATOM   1658 N  N     . ILE A 1 219 ? 23.396 -25.773 10.326  1.00 19.46 ? 216 ILE A N     1 
ATOM   1659 C  CA    . ILE A 1 219 ? 23.771 -24.928 9.203   1.00 18.71 ? 216 ILE A CA    1 
ATOM   1660 C  C     . ILE A 1 219 ? 25.060 -24.232 9.530   1.00 19.58 ? 216 ILE A C     1 
ATOM   1661 O  O     . ILE A 1 219 ? 25.146 -23.550 10.549  1.00 23.30 ? 216 ILE A O     1 
ATOM   1662 C  CB    . ILE A 1 219 ? 22.709 -23.870 8.867   1.00 19.26 ? 216 ILE A CB    1 
ATOM   1663 C  CG1   . ILE A 1 219 ? 21.345 -24.525 8.604   1.00 19.83 ? 216 ILE A CG1   1 
ATOM   1664 C  CG2   . ILE A 1 219 ? 23.153 -23.081 7.631   1.00 20.35 ? 216 ILE A CG2   1 
ATOM   1665 C  CD1   . ILE A 1 219 ? 20.404 -24.529 9.789   1.00 20.37 ? 216 ILE A CD1   1 
ATOM   1666 N  N     . SER A 1 220 ? 26.063 -24.412 8.676   1.00 22.95 ? 217 SER A N     1 
ATOM   1667 C  CA    . SER A 1 220 ? 27.323 -23.683 8.784   1.00 20.39 ? 217 SER A CA    1 
ATOM   1668 C  C     . SER A 1 220 ? 28.031 -23.598 7.409   1.00 24.52 ? 217 SER A C     1 
ATOM   1669 O  O     . SER A 1 220 ? 27.368 -23.589 6.368   1.00 23.09 ? 217 SER A O     1 
ATOM   1670 C  CB    . SER A 1 220 ? 28.229 -24.336 9.828   1.00 22.06 ? 217 SER A CB    1 
ATOM   1671 O  OG    . SER A 1 220 ? 29.423 -23.593 10.000  1.00 22.98 ? 217 SER A OG    1 
ATOM   1672 N  N     . HIS A 1 221 ? 29.364 -23.517 7.407   1.00 22.70 ? 218 HIS A N     1 
ATOM   1673 C  CA    . HIS A 1 221 ? 30.124 -23.325 6.167   1.00 23.96 ? 218 HIS A CA    1 
ATOM   1674 C  C     . HIS A 1 221 ? 30.794 -24.597 5.642   1.00 21.46 ? 218 HIS A C     1 
ATOM   1675 O  O     . HIS A 1 221 ? 31.278 -24.632 4.525   1.00 24.32 ? 218 HIS A O     1 
ATOM   1676 C  CB    . HIS A 1 221 ? 31.196 -22.252 6.362   1.00 22.39 ? 218 HIS A CB    1 
ATOM   1677 C  CG    . HIS A 1 221 ? 30.658 -20.862 6.505   1.00 23.17 ? 218 HIS A CG    1 
ATOM   1678 N  ND1   . HIS A 1 221 ? 30.121 -20.158 5.452   1.00 22.46 ? 218 HIS A ND1   1 
ATOM   1679 C  CD2   . HIS A 1 221 ? 30.624 -20.025 7.570   1.00 23.55 ? 218 HIS A CD2   1 
ATOM   1680 C  CE1   . HIS A 1 221 ? 29.748 -18.961 5.866   1.00 21.39 ? 218 HIS A CE1   1 
ATOM   1681 N  NE2   . HIS A 1 221 ? 30.057 -18.849 7.144   1.00 24.62 ? 218 HIS A NE2   1 
ATOM   1682 N  N     . ASN A 1 222 ? 30.841 -25.634 6.457   1.00 19.46 ? 219 ASN A N     1 
ATOM   1683 C  CA    . ASN A 1 222 ? 31.450 -26.892 6.058   1.00 21.85 ? 219 ASN A CA    1 
ATOM   1684 C  C     . ASN A 1 222 ? 30.705 -28.025 6.743   1.00 26.03 ? 219 ASN A C     1 
ATOM   1685 O  O     . ASN A 1 222 ? 29.819 -27.772 7.566   1.00 25.89 ? 219 ASN A O     1 
ATOM   1686 C  CB    . ASN A 1 222 ? 32.941 -26.912 6.416   1.00 24.03 ? 219 ASN A CB    1 
ATOM   1687 C  CG    . ASN A 1 222 ? 33.196 -26.484 7.855   1.00 25.57 ? 219 ASN A CG    1 
ATOM   1688 O  OD1   . ASN A 1 222 ? 32.889 -27.213 8.788   1.00 20.91 ? 219 ASN A OD1   1 
ATOM   1689 N  ND2   . ASN A 1 222 ? 33.724 -25.275 8.034   1.00 27.08 ? 219 ASN A ND2   1 
ATOM   1690 N  N     . LYS A 1 223 ? 31.059 -29.268 6.427   1.00 26.84 ? 220 LYS A N     1 
ATOM   1691 C  CA    . LYS A 1 223 ? 30.308 -30.431 6.912   1.00 22.52 ? 220 LYS A CA    1 
ATOM   1692 C  C     . LYS A 1 223 ? 30.541 -30.688 8.399   1.00 27.16 ? 220 LYS A C     1 
ATOM   1693 O  O     . LYS A 1 223 ? 29.636 -31.106 9.117   1.00 29.30 ? 220 LYS A O     1 
ATOM   1694 C  CB    . LYS A 1 223 ? 30.688 -31.682 6.106   1.00 24.75 ? 220 LYS A CB    1 
ATOM   1695 C  CG    . LYS A 1 223 ? 30.380 -31.586 4.619   1.00 26.21 ? 220 LYS A CG    1 
ATOM   1696 C  CD    . LYS A 1 223 ? 31.227 -32.557 3.819   1.00 30.04 ? 220 LYS A CD    1 
ATOM   1697 C  CE    . LYS A 1 223 ? 30.812 -33.996 4.032   1.00 28.26 ? 220 LYS A CE    1 
ATOM   1698 N  NZ    . LYS A 1 223 ? 31.409 -34.878 2.991   1.00 28.78 ? 220 LYS A NZ    1 
ATOM   1699 N  N     . VAL A 1 224 ? 31.760 -30.449 8.862   1.00 25.62 ? 221 VAL A N     1 
ATOM   1700 C  CA    . VAL A 1 224 ? 32.098 -30.740 10.240  1.00 23.84 ? 221 VAL A CA    1 
ATOM   1701 C  C     . VAL A 1 224 ? 31.385 -29.791 11.216  1.00 25.62 ? 221 VAL A C     1 
ATOM   1702 O  O     . VAL A 1 224 ? 30.948 -30.192 12.304  1.00 24.41 ? 221 VAL A O     1 
ATOM   1703 C  CB    . VAL A 1 224 ? 33.631 -30.668 10.452  1.00 26.49 ? 221 VAL A CB    1 
ATOM   1704 C  CG1   . VAL A 1 224 ? 33.981 -30.687 11.929  1.00 26.58 ? 221 VAL A CG1   1 
ATOM   1705 C  CG2   . VAL A 1 224 ? 34.313 -31.831 9.736   1.00 31.69 ? 221 VAL A CG2   1 
ATOM   1706 N  N     . LEU A 1 225 ? 31.259 -28.532 10.835  1.00 21.98 ? 222 LEU A N     1 
ATOM   1707 C  CA    . LEU A 1 225 ? 30.577 -27.582 11.704  1.00 23.05 ? 222 LEU A CA    1 
ATOM   1708 C  C     . LEU A 1 225 ? 29.067 -27.810 11.651  1.00 22.30 ? 222 LEU A C     1 
ATOM   1709 O  O     . LEU A 1 225 ? 28.365 -27.645 12.651  1.00 21.80 ? 222 LEU A O     1 
ATOM   1710 C  CB    . LEU A 1 225 ? 30.931 -26.135 11.318  1.00 21.50 ? 222 LEU A CB    1 
ATOM   1711 C  CG    . LEU A 1 225 ? 32.295 -25.609 11.778  1.00 23.05 ? 222 LEU A CG    1 
ATOM   1712 C  CD1   . LEU A 1 225 ? 32.434 -24.117 11.461  1.00 24.39 ? 222 LEU A CD1   1 
ATOM   1713 C  CD2   . LEU A 1 225 ? 32.498 -25.844 13.260  1.00 22.13 ? 222 LEU A CD2   1 
ATOM   1714 N  N     . ALA A 1 226 ? 28.566 -28.194 10.481  1.00 22.51 ? 223 ALA A N     1 
ATOM   1715 C  CA    . ALA A 1 226 ? 27.143 -28.454 10.337  1.00 24.23 ? 223 ALA A CA    1 
ATOM   1716 C  C     . ALA A 1 226 ? 26.756 -29.653 11.182  1.00 25.72 ? 223 ALA A C     1 
ATOM   1717 O  O     . ALA A 1 226 ? 25.713 -29.638 11.852  1.00 26.15 ? 223 ALA A O     1 
ATOM   1718 C  CB    . ALA A 1 226 ? 26.767 -28.683 8.877   1.00 22.61 ? 223 ALA A CB    1 
ATOM   1719 N  N     . LYS A 1 227 ? 27.590 -30.692 11.140  1.00 24.30 ? 224 LYS A N     1 
ATOM   1720 C  CA    . LYS A 1 227 ? 27.336 -31.911 11.906  1.00 20.94 ? 224 LYS A CA    1 
ATOM   1721 C  C     . LYS A 1 227 ? 27.336 -31.638 13.406  1.00 20.40 ? 224 LYS A C     1 
ATOM   1722 O  O     . LYS A 1 227 ? 26.428 -32.051 14.103  1.00 21.50 ? 224 LYS A O     1 
ATOM   1723 C  CB    . LYS A 1 227 ? 28.366 -32.983 11.563  1.00 21.67 ? 224 LYS A CB    1 
ATOM   1724 C  CG    . LYS A 1 227 ? 28.314 -34.245 12.442  1.00 24.15 ? 224 LYS A CG    1 
ATOM   1725 C  CD    . LYS A 1 227 ? 27.027 -35.040 12.234  1.00 28.90 ? 224 LYS A CD    1 
ATOM   1726 C  CE    . LYS A 1 227 ? 27.014 -36.311 13.091  1.00 29.27 ? 224 LYS A CE    1 
ATOM   1727 N  NZ    . LYS A 1 227 ? 25.747 -37.093 12.914  1.00 29.75 ? 224 LYS A NZ    1 
ATOM   1728 N  N     . LEU A 1 228 ? 28.356 -30.936 13.885  1.00 20.68 ? 225 LEU A N     1 
ATOM   1729 C  CA    . LEU A 1 228 ? 28.447 -30.546 15.286  1.00 22.73 ? 225 LEU A CA    1 
ATOM   1730 C  C     . LEU A 1 228 ? 27.266 -29.657 15.698  1.00 22.50 ? 225 LEU A C     1 
ATOM   1731 O  O     . LEU A 1 228 ? 26.640 -29.887 16.723  1.00 22.21 ? 225 LEU A O     1 
ATOM   1732 C  CB    . LEU A 1 228 ? 29.774 -29.825 15.552  1.00 20.47 ? 225 LEU A CB    1 
ATOM   1733 C  CG    . LEU A 1 228 ? 30.083 -29.353 16.972  1.00 23.19 ? 225 LEU A CG    1 
ATOM   1734 C  CD1   . LEU A 1 228 ? 30.417 -30.522 17.893  1.00 22.20 ? 225 LEU A CD1   1 
ATOM   1735 C  CD2   . LEU A 1 228 ? 31.224 -28.360 16.943  1.00 22.59 ? 225 LEU A CD2   1 
ATOM   1736 N  N     . ALA A 1 229 ? 26.974 -28.652 14.881  1.00 19.56 ? 226 ALA A N     1 
ATOM   1737 C  CA    . ALA A 1 229 ? 25.828 -27.778 15.076  1.00 20.97 ? 226 ALA A CA    1 
ATOM   1738 C  C     . ALA A 1 229 ? 24.517 -28.542 15.246  1.00 24.28 ? 226 ALA A C     1 
ATOM   1739 O  O     . ALA A 1 229 ? 23.751 -28.268 16.166  1.00 23.43 ? 226 ALA A O     1 
ATOM   1740 C  CB    . ALA A 1 229 ? 25.709 -26.805 13.894  1.00 23.40 ? 226 ALA A CB    1 
ATOM   1741 N  N     . CYS A 1 230 ? 24.265 -29.496 14.349  1.00 25.95 ? 227 CYS A N     1 
ATOM   1742 C  CA    . CYS A 1 230 ? 23.026 -30.267 14.369  1.00 24.36 ? 227 CYS A CA    1 
ATOM   1743 C  C     . CYS A 1 230 ? 22.773 -30.831 15.764  1.00 22.54 ? 227 CYS A C     1 
ATOM   1744 O  O     . CYS A 1 230 ? 21.662 -30.746 16.294  1.00 21.50 ? 227 CYS A O     1 
ATOM   1745 C  CB    . CYS A 1 230 ? 23.082 -31.390 13.342  1.00 23.69 ? 227 CYS A CB    1 
ATOM   1746 S  SG    . CYS A 1 230 ? 21.602 -32.385 13.251  1.00 24.88 ? 227 CYS A SG    1 
ATOM   1747 N  N     . GLY A 1 231 ? 23.825 -31.362 16.375  1.00 25.29 ? 228 GLY A N     1 
ATOM   1748 C  CA    . GLY A 1 231 ? 23.698 -31.974 17.687  1.00 24.66 ? 228 GLY A CA    1 
ATOM   1749 C  C     . GLY A 1 231 ? 23.494 -31.019 18.853  1.00 21.20 ? 228 GLY A C     1 
ATOM   1750 O  O     . GLY A 1 231 ? 23.212 -31.461 19.943  1.00 27.01 ? 228 GLY A O     1 
ATOM   1751 N  N     . LEU A 1 232 ? 23.619 -29.718 18.640  1.00 20.09 ? 229 LEU A N     1 
ATOM   1752 C  CA    . LEU A 1 232 ? 23.624 -28.795 19.767  1.00 21.45 ? 229 LEU A CA    1 
ATOM   1753 C  C     . LEU A 1 232 ? 22.238 -28.532 20.360  1.00 27.10 ? 229 LEU A C     1 
ATOM   1754 O  O     . LEU A 1 232 ? 22.119 -28.092 21.515  1.00 24.56 ? 229 LEU A O     1 
ATOM   1755 C  CB    . LEU A 1 232 ? 24.263 -27.464 19.356  1.00 18.45 ? 229 LEU A CB    1 
ATOM   1756 C  CG    . LEU A 1 232 ? 25.773 -27.548 19.119  1.00 22.14 ? 229 LEU A CG    1 
ATOM   1757 C  CD1   . LEU A 1 232 ? 26.348 -26.187 18.745  1.00 20.22 ? 229 LEU A CD1   1 
ATOM   1758 C  CD2   . LEU A 1 232 ? 26.525 -28.221 20.293  1.00 14.35 ? 229 LEU A CD2   1 
ATOM   1759 N  N     . ASN A 1 233 ? 21.193 -28.779 19.575  1.00 21.08 ? 230 ASN A N     1 
ATOM   1760 C  CA    . ASN A 1 233 ? 19.852 -28.444 20.031  1.00 23.95 ? 230 ASN A CA    1 
ATOM   1761 C  C     . ASN A 1 233 ? 18.792 -29.467 19.630  1.00 24.05 ? 230 ASN A C     1 
ATOM   1762 O  O     . ASN A 1 233 ? 17.624 -29.143 19.509  1.00 26.74 ? 230 ASN A O     1 
ATOM   1763 C  CB    . ASN A 1 233 ? 19.475 -27.055 19.528  1.00 22.91 ? 230 ASN A CB    1 
ATOM   1764 C  CG    . ASN A 1 233 ? 20.181 -25.953 20.304  1.00 26.48 ? 230 ASN A CG    1 
ATOM   1765 O  OD1   . ASN A 1 233 ? 19.846 -25.682 21.464  1.00 24.18 ? 230 ASN A OD1   1 
ATOM   1766 N  ND2   . ASN A 1 233 ? 21.159 -25.316 19.670  1.00 23.24 ? 230 ASN A ND2   1 
ATOM   1767 N  N     . LYS A 1 234 ? 19.216 -30.706 19.436  1.00 23.61 ? 231 LYS A N     1 
ATOM   1768 C  CA    . LYS A 1 234 ? 18.290 -31.811 19.280  1.00 28.01 ? 231 LYS A CA    1 
ATOM   1769 C  C     . LYS A 1 234 ? 17.410 -31.886 20.519  1.00 27.29 ? 231 LYS A C     1 
ATOM   1770 O  O     . LYS A 1 234 ? 17.867 -31.564 21.612  1.00 30.18 ? 231 LYS A O     1 
ATOM   1771 C  CB    . LYS A 1 234 ? 19.046 -33.132 19.059  1.00 24.27 ? 231 LYS A CB    1 
ATOM   1772 C  CG    . LYS A 1 234 ? 19.525 -33.326 17.635  1.00 24.83 ? 231 LYS A CG    1 
ATOM   1773 C  CD    . LYS A 1 234 ? 20.071 -34.735 17.345  1.00 24.04 ? 231 LYS A CD    1 
ATOM   1774 C  CE    . LYS A 1 234 ? 20.115 -35.002 15.824  1.00 25.42 ? 231 LYS A CE    1 
ATOM   1775 N  NZ    . LYS A 1 234 ? 18.910 -35.790 15.334  1.00 23.43 ? 231 LYS A NZ    1 
ATOM   1776 N  N     . PRO A 1 235 ? 16.144 -32.311 20.366  1.00 28.27 ? 232 PRO A N     1 
ATOM   1777 C  CA    . PRO A 1 235 ? 15.440 -32.703 19.144  1.00 24.82 ? 232 PRO A CA    1 
ATOM   1778 C  C     . PRO A 1 235 ? 14.594 -31.609 18.488  1.00 24.57 ? 232 PRO A C     1 
ATOM   1779 O  O     . PRO A 1 235 ? 14.312 -30.570 19.101  1.00 22.32 ? 232 PRO A O     1 
ATOM   1780 C  CB    . PRO A 1 235 ? 14.511 -33.803 19.650  1.00 26.72 ? 232 PRO A CB    1 
ATOM   1781 C  CG    . PRO A 1 235 ? 14.101 -33.252 21.010  1.00 22.78 ? 232 PRO A CG    1 
ATOM   1782 C  CD    . PRO A 1 235 ? 15.378 -32.708 21.570  1.00 22.58 ? 232 PRO A CD    1 
ATOM   1783 N  N     . ASN A 1 236 ? 14.163 -31.900 17.258  1.00 22.89 ? 233 ASN A N     1 
ATOM   1784 C  CA    . ASN A 1 236 ? 13.243 -31.067 16.496  1.00 25.43 ? 233 ASN A CA    1 
ATOM   1785 C  C     . ASN A 1 236 ? 13.639 -29.580 16.467  1.00 24.56 ? 233 ASN A C     1 
ATOM   1786 O  O     . ASN A 1 236 ? 12.791 -28.706 16.544  1.00 25.64 ? 233 ASN A O     1 
ATOM   1787 C  CB    . ASN A 1 236 ? 11.820 -31.239 17.052  1.00 23.57 ? 233 ASN A CB    1 
ATOM   1788 C  CG    . ASN A 1 236 ? 10.743 -30.654 16.132  1.00 23.78 ? 233 ASN A CG    1 
ATOM   1789 O  OD1   . ASN A 1 236 ? 10.888 -30.631 14.912  1.00 24.36 ? 233 ASN A OD1   1 
ATOM   1790 N  ND2   . ASN A 1 236 ? 9.668  -30.165 16.728  1.00 22.70 ? 233 ASN A ND2   1 
ATOM   1791 N  N     . ARG A 1 237 ? 14.935 -29.300 16.364  1.00 24.42 ? 234 ARG A N     1 
ATOM   1792 C  CA    . ARG A 1 237 ? 15.419 -27.916 16.257  1.00 25.29 ? 234 ARG A CA    1 
ATOM   1793 C  C     . ARG A 1 237 ? 16.570 -27.821 15.265  1.00 23.38 ? 234 ARG A C     1 
ATOM   1794 O  O     . ARG A 1 237 ? 17.156 -28.835 14.895  1.00 26.26 ? 234 ARG A O     1 
ATOM   1795 C  CB    . ARG A 1 237 ? 15.889 -27.392 17.616  1.00 23.34 ? 234 ARG A CB    1 
ATOM   1796 C  CG    . ARG A 1 237 ? 14.805 -27.252 18.640  1.00 26.21 ? 234 ARG A CG    1 
ATOM   1797 C  CD    . ARG A 1 237 ? 13.832 -26.186 18.202  1.00 27.41 ? 234 ARG A CD    1 
ATOM   1798 N  NE    . ARG A 1 237 ? 12.816 -25.945 19.212  1.00 28.29 ? 234 ARG A NE    1 
ATOM   1799 C  CZ    . ARG A 1 237 ? 11.635 -26.542 19.233  1.00 32.68 ? 234 ARG A CZ    1 
ATOM   1800 N  NH1   . ARG A 1 237 ? 11.313 -27.422 18.293  1.00 27.59 ? 234 ARG A NH1   1 
ATOM   1801 N  NH2   . ARG A 1 237 ? 10.779 -26.260 20.204  1.00 39.96 ? 234 ARG A NH2   1 
ATOM   1802 N  N     . GLN A 1 238 ? 16.929 -26.616 14.855  1.00 20.85 ? 235 GLN A N     1 
ATOM   1803 C  CA    . GLN A 1 238 ? 18.104 -26.487 14.006  1.00 24.09 ? 235 GLN A CA    1 
ATOM   1804 C  C     . GLN A 1 238 ? 19.010 -25.376 14.513  1.00 23.94 ? 235 GLN A C     1 
ATOM   1805 O  O     . GLN A 1 238 ? 18.548 -24.437 15.162  1.00 25.05 ? 235 GLN A O     1 
ATOM   1806 C  CB    . GLN A 1 238 ? 17.706 -26.241 12.550  1.00 19.55 ? 235 GLN A CB    1 
ATOM   1807 C  CG    . GLN A 1 238 ? 17.031 -24.921 12.315  1.00 22.62 ? 235 GLN A CG    1 
ATOM   1808 C  CD    . GLN A 1 238 ? 16.515 -24.766 10.885  1.00 23.25 ? 235 GLN A CD    1 
ATOM   1809 O  OE1   . GLN A 1 238 ? 15.725 -25.575 10.399  1.00 20.52 ? 235 GLN A OE1   1 
ATOM   1810 N  NE2   . GLN A 1 238 ? 16.978 -23.727 10.209  1.00 20.68 ? 235 GLN A NE2   1 
ATOM   1811 N  N     . THR A 1 239 ? 20.300 -25.483 14.203  1.00 22.28 ? 236 THR A N     1 
ATOM   1812 C  CA    . THR A 1 239 ? 21.293 -24.584 14.769  1.00 21.73 ? 236 THR A CA    1 
ATOM   1813 C  C     . THR A 1 239 ? 22.219 -24.005 13.714  1.00 21.86 ? 236 THR A C     1 
ATOM   1814 O  O     . THR A 1 239 ? 22.772 -24.737 12.897  1.00 20.58 ? 236 THR A O     1 
ATOM   1815 C  CB    . THR A 1 239 ? 22.148 -25.297 15.819  1.00 20.54 ? 236 THR A CB    1 
ATOM   1816 O  OG1   . THR A 1 239 ? 21.306 -26.087 16.668  1.00 26.75 ? 236 THR A OG1   1 
ATOM   1817 C  CG2   . THR A 1 239 ? 22.936 -24.289 16.655  1.00 22.36 ? 236 THR A CG2   1 
ATOM   1818 N  N     . LEU A 1 240 ? 22.394 -22.689 13.768  1.00 18.50 ? 237 LEU A N     1 
ATOM   1819 C  CA    . LEU A 1 240 ? 23.286 -21.973 12.884  1.00 18.00 ? 237 LEU A CA    1 
ATOM   1820 C  C     . LEU A 1 240 ? 24.585 -21.681 13.659  1.00 24.96 ? 237 LEU A C     1 
ATOM   1821 O  O     . LEU A 1 240 ? 24.578 -21.029 14.737  1.00 20.28 ? 237 LEU A O     1 
ATOM   1822 C  CB    . LEU A 1 240 ? 22.597 -20.703 12.359  1.00 17.55 ? 237 LEU A CB    1 
ATOM   1823 C  CG    . LEU A 1 240 ? 23.256 -19.885 11.236  1.00 23.49 ? 237 LEU A CG    1 
ATOM   1824 C  CD1   . LEU A 1 240 ? 22.260 -18.945 10.577  1.00 16.74 ? 237 LEU A CD1   1 
ATOM   1825 C  CD2   . LEU A 1 240 ? 24.452 -19.072 11.748  1.00 21.42 ? 237 LEU A CD2   1 
ATOM   1826 N  N     . VAL A 1 241 ? 25.691 -22.213 13.129  1.00 20.67 ? 238 VAL A N     1 
ATOM   1827 C  CA    . VAL A 1 241 ? 27.001 -21.987 13.697  1.00 16.91 ? 238 VAL A CA    1 
ATOM   1828 C  C     . VAL A 1 241 ? 27.767 -21.123 12.724  1.00 22.89 ? 238 VAL A C     1 
ATOM   1829 O  O     . VAL A 1 241 ? 28.237 -21.597 11.685  1.00 23.62 ? 238 VAL A O     1 
ATOM   1830 C  CB    . VAL A 1 241 ? 27.768 -23.288 13.960  1.00 21.10 ? 238 VAL A CB    1 
ATOM   1831 C  CG1   . VAL A 1 241 ? 29.254 -23.004 14.203  1.00 16.90 ? 238 VAL A CG1   1 
ATOM   1832 C  CG2   . VAL A 1 241 ? 27.170 -24.039 15.146  1.00 20.23 ? 238 VAL A CG2   1 
ATOM   1833 N  N     . SER A 1 242 ? 27.871 -19.842 13.049  1.00 22.97 ? 239 SER A N     1 
ATOM   1834 C  CA    . SER A 1 242 ? 28.565 -18.908 12.169  1.00 24.93 ? 239 SER A CA    1 
ATOM   1835 C  C     . SER A 1 242 ? 30.084 -19.021 12.320  1.00 24.82 ? 239 SER A C     1 
ATOM   1836 O  O     . SER A 1 242 ? 30.592 -19.620 13.277  1.00 21.03 ? 239 SER A O     1 
ATOM   1837 C  CB    . SER A 1 242 ? 28.108 -17.486 12.453  1.00 24.75 ? 239 SER A CB    1 
ATOM   1838 O  OG    . SER A 1 242 ? 28.387 -17.150 13.798  1.00 29.47 ? 239 SER A OG    1 
ATOM   1839 N  N     . HIS A 1 243 ? 30.808 -18.453 11.363  1.00 26.25 ? 240 HIS A N     1 
ATOM   1840 C  CA    . HIS A 1 243 ? 32.253 -18.479 11.420  1.00 24.16 ? 240 HIS A CA    1 
ATOM   1841 C  C     . HIS A 1 243 ? 32.718 -17.768 12.701  1.00 25.70 ? 240 HIS A C     1 
ATOM   1842 O  O     . HIS A 1 243 ? 33.659 -18.216 13.358  1.00 21.34 ? 240 HIS A O     1 
ATOM   1843 C  CB    . HIS A 1 243 ? 32.862 -17.833 10.166  1.00 23.56 ? 240 HIS A CB    1 
ATOM   1844 C  CG    . HIS A 1 243 ? 34.353 -17.683 10.221  1.00 29.20 ? 240 HIS A CG    1 
ATOM   1845 N  ND1   . HIS A 1 243 ? 35.221 -18.742 10.032  1.00 28.06 ? 240 HIS A ND1   1 
ATOM   1846 C  CD2   . HIS A 1 243 ? 35.131 -16.597 10.455  1.00 24.46 ? 240 HIS A CD2   1 
ATOM   1847 C  CE1   . HIS A 1 243 ? 36.465 -18.314 10.151  1.00 29.13 ? 240 HIS A CE1   1 
ATOM   1848 N  NE2   . HIS A 1 243 ? 36.437 -17.015 10.403  1.00 28.69 ? 240 HIS A NE2   1 
ATOM   1849 N  N     . GLY A 1 244 ? 32.038 -16.676 13.053  1.00 24.90 ? 241 GLY A N     1 
ATOM   1850 C  CA    . GLY A 1 244 ? 32.443 -15.845 14.179  1.00 22.17 ? 241 GLY A CA    1 
ATOM   1851 C  C     . GLY A 1 244 ? 32.265 -16.548 15.510  1.00 24.71 ? 241 GLY A C     1 
ATOM   1852 O  O     . GLY A 1 244 ? 32.925 -16.213 16.504  1.00 20.98 ? 241 GLY A O     1 
ATOM   1853 N  N     . SER A 1 245 ? 31.370 -17.533 15.530  1.00 19.52 ? 242 SER A N     1 
ATOM   1854 C  CA    . SER A 1 245 ? 31.023 -18.192 16.770  1.00 21.93 ? 242 SER A CA    1 
ATOM   1855 C  C     . SER A 1 245 ? 32.037 -19.267 17.137  1.00 17.22 ? 242 SER A C     1 
ATOM   1856 O  O     . SER A 1 245 ? 31.998 -19.811 18.229  1.00 23.61 ? 242 SER A O     1 
ATOM   1857 C  CB    . SER A 1 245 ? 29.608 -18.786 16.675  1.00 23.18 ? 242 SER A CB    1 
ATOM   1858 O  OG    . SER A 1 245 ? 29.633 -20.110 16.175  1.00 18.93 ? 242 SER A OG    1 
ATOM   1859 N  N     . VAL A 1 246 ? 32.966 -19.542 16.235  1.00 20.31 ? 243 VAL A N     1 
ATOM   1860 C  CA    . VAL A 1 246 ? 33.881 -20.664 16.378  1.00 19.68 ? 243 VAL A CA    1 
ATOM   1861 C  C     . VAL A 1 246 ? 34.864 -20.570 17.585  1.00 18.94 ? 243 VAL A C     1 
ATOM   1862 O  O     . VAL A 1 246 ? 34.931 -21.502 18.369  1.00 19.30 ? 243 VAL A O     1 
ATOM   1863 C  CB    . VAL A 1 246 ? 34.668 -20.882 15.056  1.00 21.63 ? 243 VAL A CB    1 
ATOM   1864 C  CG1   . VAL A 1 246 ? 35.858 -21.852 15.257  1.00 21.71 ? 243 VAL A CG1   1 
ATOM   1865 C  CG2   . VAL A 1 246 ? 33.739 -21.401 13.955  1.00 20.04 ? 243 VAL A CG2   1 
ATOM   1866 N  N     . PRO A 1 247 ? 35.612 -19.460 17.746  1.00 20.35 ? 244 PRO A N     1 
ATOM   1867 C  CA    . PRO A 1 247 ? 36.560 -19.430 18.876  1.00 21.28 ? 244 PRO A CA    1 
ATOM   1868 C  C     . PRO A 1 247 ? 35.938 -19.686 20.273  1.00 25.28 ? 244 PRO A C     1 
ATOM   1869 O  O     . PRO A 1 247 ? 36.504 -20.483 21.033  1.00 21.45 ? 244 PRO A O     1 
ATOM   1870 C  CB    . PRO A 1 247 ? 37.143 -18.014 18.800  1.00 22.68 ? 244 PRO A CB    1 
ATOM   1871 C  CG    . PRO A 1 247 ? 37.084 -17.682 17.321  1.00 25.94 ? 244 PRO A CG    1 
ATOM   1872 C  CD    . PRO A 1 247 ? 35.736 -18.249 16.903  1.00 22.87 ? 244 PRO A CD    1 
ATOM   1873 N  N     . GLN A 1 248 ? 34.812 -19.059 20.604  1.00 19.28 ? 245 GLN A N     1 
ATOM   1874 C  CA    . GLN A 1 248 ? 34.202 -19.346 21.894  1.00 21.33 ? 245 GLN A CA    1 
ATOM   1875 C  C     . GLN A 1 248 ? 33.698 -20.791 21.961  1.00 24.95 ? 245 GLN A C     1 
ATOM   1876 O  O     . GLN A 1 248 ? 33.993 -21.509 22.916  1.00 22.48 ? 245 GLN A O     1 
ATOM   1877 C  CB    . GLN A 1 248 ? 33.066 -18.370 22.196  1.00 22.43 ? 245 GLN A CB    1 
ATOM   1878 C  CG    . GLN A 1 248 ? 33.503 -16.910 22.261  1.00 28.80 ? 245 GLN A CG    1 
ATOM   1879 C  CD    . GLN A 1 248 ? 32.773 -16.111 23.354  1.00 37.91 ? 245 GLN A CD    1 
ATOM   1880 O  OE1   . GLN A 1 248 ? 31.994 -15.177 23.063  1.00 36.08 ? 245 GLN A OE1   1 
ATOM   1881 N  NE2   . GLN A 1 248 ? 33.047 -16.460 24.621  1.00 35.72 ? 245 GLN A NE2   1 
ATOM   1882 N  N     . LEU A 1 249 ? 32.945 -21.213 20.945  1.00 25.36 ? 246 LEU A N     1 
ATOM   1883 C  CA    . LEU A 1 249 ? 32.478 -22.585 20.854  1.00 22.13 ? 246 LEU A CA    1 
ATOM   1884 C  C     . LEU A 1 249 ? 33.609 -23.597 21.002  1.00 21.69 ? 246 LEU A C     1 
ATOM   1885 O  O     . LEU A 1 249 ? 33.526 -24.515 21.810  1.00 24.20 ? 246 LEU A O     1 
ATOM   1886 C  CB    . LEU A 1 249 ? 31.766 -22.803 19.525  1.00 25.84 ? 246 LEU A CB    1 
ATOM   1887 C  CG    . LEU A 1 249 ? 31.262 -24.219 19.257  1.00 26.82 ? 246 LEU A CG    1 
ATOM   1888 C  CD1   . LEU A 1 249 ? 30.154 -24.531 20.242  1.00 26.75 ? 246 LEU A CD1   1 
ATOM   1889 C  CD2   . LEU A 1 249 ? 30.777 -24.371 17.802  1.00 26.81 ? 246 LEU A CD2   1 
ATOM   1890 N  N     . PHE A 1 250 ? 34.683 -23.417 20.247  1.00 21.67 ? 247 PHE A N     1 
ATOM   1891 C  CA    . PHE A 1 250 ? 35.765 -24.397 20.288  1.00 23.68 ? 247 PHE A CA    1 
ATOM   1892 C  C     . PHE A 1 250 ? 36.635 -24.291 21.546  1.00 24.44 ? 247 PHE A C     1 
ATOM   1893 O  O     . PHE A 1 250 ? 37.456 -25.168 21.790  1.00 25.68 ? 247 PHE A O     1 
ATOM   1894 C  CB    . PHE A 1 250 ? 36.662 -24.283 19.046  1.00 22.61 ? 247 PHE A CB    1 
ATOM   1895 C  CG    . PHE A 1 250 ? 36.131 -25.009 17.818  1.00 23.55 ? 247 PHE A CG    1 
ATOM   1896 C  CD1   . PHE A 1 250 ? 34.884 -25.618 17.822  1.00 20.54 ? 247 PHE A CD1   1 
ATOM   1897 C  CD2   . PHE A 1 250 ? 36.904 -25.087 16.657  1.00 22.11 ? 247 PHE A CD2   1 
ATOM   1898 C  CE1   . PHE A 1 250 ? 34.413 -26.276 16.686  1.00 21.23 ? 247 PHE A CE1   1 
ATOM   1899 C  CE2   . PHE A 1 250 ? 36.439 -25.746 15.525  1.00 21.59 ? 247 PHE A CE2   1 
ATOM   1900 C  CZ    . PHE A 1 250 ? 35.190 -26.338 15.538  1.00 20.87 ? 247 PHE A CZ    1 
ATOM   1901 N  N     . SER A 1 251 ? 36.468 -23.245 22.349  1.00 23.05 ? 248 SER A N     1 
ATOM   1902 C  CA    . SER A 1 251 ? 37.365 -23.057 23.490  1.00 24.17 ? 248 SER A CA    1 
ATOM   1903 C  C     . SER A 1 251 ? 37.084 -24.031 24.651  1.00 23.76 ? 248 SER A C     1 
ATOM   1904 O  O     . SER A 1 251 ? 37.938 -24.228 25.504  1.00 23.97 ? 248 SER A O     1 
ATOM   1905 C  CB    . SER A 1 251 ? 37.311 -21.606 23.988  1.00 22.05 ? 248 SER A CB    1 
ATOM   1906 O  OG    . SER A 1 251 ? 36.075 -21.297 24.585  1.00 17.11 ? 248 SER A OG    1 
ATOM   1907 N  N     . GLN A 1 252 ? 35.904 -24.647 24.667  1.00 24.84 ? 249 GLN A N     1 
ATOM   1908 C  CA    . GLN A 1 252 ? 35.566 -25.641 25.681  1.00 25.39 ? 249 GLN A CA    1 
ATOM   1909 C  C     . GLN A 1 252 ? 35.011 -26.874 25.020  1.00 25.05 ? 249 GLN A C     1 
ATOM   1910 O  O     . GLN A 1 252 ? 34.385 -27.716 25.658  1.00 29.90 ? 249 GLN A O     1 
ATOM   1911 C  CB    . GLN A 1 252 ? 34.543 -25.107 26.674  1.00 26.45 ? 249 GLN A CB    1 
ATOM   1912 C  CG    . GLN A 1 252 ? 34.959 -23.849 27.371  1.00 26.70 ? 249 GLN A CG    1 
ATOM   1913 C  CD    . GLN A 1 252 ? 34.081 -23.548 28.550  1.00 30.33 ? 249 GLN A CD    1 
ATOM   1914 O  OE1   . GLN A 1 252 ? 34.236 -24.133 29.627  1.00 31.93 ? 249 GLN A OE1   1 
ATOM   1915 N  NE2   . GLN A 1 252 ? 33.141 -22.638 28.357  1.00 29.75 ? 249 GLN A NE2   1 
ATOM   1916 N  N     . MET A 1 253 ? 35.217 -26.962 23.721  1.00 25.73 ? 250 MET A N     1 
ATOM   1917 C  CA    . MET A 1 253 ? 34.746 -28.104 22.978  1.00 25.32 ? 250 MET A CA    1 
ATOM   1918 C  C     . MET A 1 253 ? 35.814 -29.184 23.050  1.00 25.49 ? 250 MET A C     1 
ATOM   1919 O  O     . MET A 1 253 ? 36.886 -29.018 22.454  1.00 25.73 ? 250 MET A O     1 
ATOM   1920 C  CB    . MET A 1 253 ? 34.450 -27.728 21.523  1.00 23.37 ? 250 MET A CB    1 
ATOM   1921 C  CG    . MET A 1 253 ? 33.831 -28.856 20.692  1.00 26.09 ? 250 MET A CG    1 
ATOM   1922 S  SD    . MET A 1 253 ? 32.219 -29.353 21.342  1.00 27.69 ? 250 MET A SD    1 
ATOM   1923 C  CE    . MET A 1 253 ? 31.294 -27.839 21.146  1.00 25.30 ? 250 MET A CE    1 
ATOM   1924 N  N     . PRO A 1 254 ? 35.529 -30.290 23.775  1.00 23.73 ? 251 PRO A N     1 
ATOM   1925 C  CA    . PRO A 1 254 ? 36.472 -31.409 23.776  1.00 24.55 ? 251 PRO A CA    1 
ATOM   1926 C  C     . PRO A 1 254 ? 36.776 -31.859 22.352  1.00 25.56 ? 251 PRO A C     1 
ATOM   1927 O  O     . PRO A 1 254 ? 35.940 -31.785 21.455  1.00 25.52 ? 251 PRO A O     1 
ATOM   1928 C  CB    . PRO A 1 254 ? 35.738 -32.505 24.560  1.00 24.36 ? 251 PRO A CB    1 
ATOM   1929 C  CG    . PRO A 1 254 ? 34.741 -31.797 25.362  1.00 24.15 ? 251 PRO A CG    1 
ATOM   1930 C  CD    . PRO A 1 254 ? 34.291 -30.645 24.485  1.00 25.98 ? 251 PRO A CD    1 
ATOM   1931 N  N     . ILE A 1 255 ? 37.999 -32.304 22.158  1.00 23.69 ? 252 ILE A N     1 
ATOM   1932 C  CA    . ILE A 1 255 ? 38.460 -32.684 20.847  1.00 24.93 ? 252 ILE A CA    1 
ATOM   1933 C  C     . ILE A 1 255 ? 37.656 -33.866 20.300  1.00 25.93 ? 252 ILE A C     1 
ATOM   1934 O  O     . ILE A 1 255 ? 37.355 -33.896 19.105  1.00 27.64 ? 252 ILE A O     1 
ATOM   1935 C  CB    . ILE A 1 255 ? 39.973 -32.980 20.900  1.00 24.47 ? 252 ILE A CB    1 
ATOM   1936 C  CG1   . ILE A 1 255 ? 40.715 -31.663 21.188  1.00 23.55 ? 252 ILE A CG1   1 
ATOM   1937 C  CG2   . ILE A 1 255 ? 40.455 -33.623 19.615  1.00 24.37 ? 252 ILE A CG2   1 
ATOM   1938 C  CD1   . ILE A 1 255 ? 42.219 -31.772 21.267  1.00 25.88 ? 252 ILE A CD1   1 
ATOM   1939 N  N     . ARG A 1 256 ? 37.254 -34.796 21.174  1.00 24.62 ? 253 ARG A N     1 
ATOM   1940 C  CA    . ARG A 1 256 ? 36.622 -36.047 20.735  1.00 29.12 ? 253 ARG A CA    1 
ATOM   1941 C  C     . ARG A 1 256 ? 35.256 -35.846 20.096  1.00 28.74 ? 253 ARG A C     1 
ATOM   1942 O  O     . ARG A 1 256 ? 34.693 -36.780 19.533  1.00 33.12 ? 253 ARG A O     1 
ATOM   1943 C  CB    . ARG A 1 256 ? 36.471 -37.022 21.901  1.00 31.06 ? 253 ARG A CB    1 
ATOM   1944 C  CG    . ARG A 1 256 ? 35.391 -36.616 22.885  1.00 32.64 ? 253 ARG A CG    1 
ATOM   1945 C  CD    . ARG A 1 256 ? 35.263 -37.627 24.003  1.00 35.31 ? 253 ARG A CD    1 
ATOM   1946 N  NE    . ARG A 1 256 ? 34.504 -37.056 25.111  1.00 44.21 ? 253 ARG A NE    1 
ATOM   1947 C  CZ    . ARG A 1 256 ? 35.040 -36.320 26.083  1.00 39.77 ? 253 ARG A CZ    1 
ATOM   1948 N  NH1   . ARG A 1 256 ? 36.348 -36.081 26.098  1.00 39.80 ? 253 ARG A NH1   1 
ATOM   1949 N  NH2   . ARG A 1 256 ? 34.269 -35.825 27.040  1.00 37.40 ? 253 ARG A NH2   1 
ATOM   1950 N  N     . LYS A 1 257 ? 34.733 -34.629 20.174  1.00 26.45 ? 254 LYS A N     1 
ATOM   1951 C  CA    . LYS A 1 257 ? 33.396 -34.350 19.683  1.00 27.86 ? 254 LYS A CA    1 
ATOM   1952 C  C     . LYS A 1 257 ? 33.395 -33.921 18.222  1.00 29.75 ? 254 LYS A C     1 
ATOM   1953 O  O     . LYS A 1 257 ? 32.329 -33.846 17.592  1.00 26.74 ? 254 LYS A O     1 
ATOM   1954 C  CB    . LYS A 1 257 ? 32.740 -33.265 20.538  1.00 26.80 ? 254 LYS A CB    1 
ATOM   1955 C  CG    . LYS A 1 257 ? 32.780 -33.563 22.017  1.00 28.17 ? 254 LYS A CG    1 
ATOM   1956 C  CD    . LYS A 1 257 ? 31.756 -34.606 22.413  1.00 34.19 ? 254 LYS A CD    1 
ATOM   1957 C  CE    . LYS A 1 257 ? 31.673 -34.700 23.928  1.00 40.90 ? 254 LYS A CE    1 
ATOM   1958 N  NZ    . LYS A 1 257 ? 30.670 -35.699 24.401  1.00 43.88 ? 254 LYS A NZ    1 
ATOM   1959 N  N     . ILE A 1 258 ? 34.568 -33.602 17.681  1.00 26.59 ? 255 ILE A N     1 
ATOM   1960 C  CA    . ILE A 1 258 ? 34.618 -33.237 16.274  1.00 30.76 ? 255 ILE A CA    1 
ATOM   1961 C  C     . ILE A 1 258 ? 34.700 -34.527 15.454  1.00 31.79 ? 255 ILE A C     1 
ATOM   1962 O  O     . ILE A 1 258 ? 35.368 -35.489 15.848  1.00 32.61 ? 255 ILE A O     1 
ATOM   1963 C  CB    . ILE A 1 258 ? 35.795 -32.277 15.954  1.00 33.51 ? 255 ILE A CB    1 
ATOM   1964 C  CG1   . ILE A 1 258 ? 35.312 -30.825 15.934  1.00 29.98 ? 255 ILE A CG1   1 
ATOM   1965 C  CG2   . ILE A 1 258 ? 36.431 -32.590 14.593  1.00 29.73 ? 255 ILE A CG2   1 
ATOM   1966 C  CD1   . ILE A 1 258 ? 34.825 -30.308 17.259  1.00 28.74 ? 255 ILE A CD1   1 
ATOM   1967 N  N     . ARG A 1 259 ? 33.979 -34.543 14.334  1.00 36.92 ? 256 ARG A N     1 
ATOM   1968 C  CA    . ARG A 1 259 ? 33.880 -35.713 13.462  1.00 34.05 ? 256 ARG A CA    1 
ATOM   1969 C  C     . ARG A 1 259 ? 35.261 -36.219 13.062  1.00 33.20 ? 256 ARG A C     1 
ATOM   1970 O  O     . ARG A 1 259 ? 36.127 -35.431 12.680  1.00 37.33 ? 256 ARG A O     1 
ATOM   1971 C  CB    . ARG A 1 259 ? 33.039 -35.383 12.220  1.00 35.81 ? 256 ARG A CB    1 
ATOM   1972 C  CG    . ARG A 1 259 ? 32.766 -36.578 11.324  1.00 48.14 ? 256 ARG A CG    1 
ATOM   1973 C  CD    . ARG A 1 259 ? 31.681 -36.294 10.295  1.00 46.59 ? 256 ARG A CD    1 
ATOM   1974 N  NE    . ARG A 1 259 ? 32.086 -35.298 9.302   1.00 52.12 ? 256 ARG A NE    1 
ATOM   1975 C  CZ    . ARG A 1 259 ? 32.852 -35.571 8.247   1.00 58.31 ? 256 ARG A CZ    1 
ATOM   1976 N  NH1   . ARG A 1 259 ? 33.175 -34.613 7.381   1.00 63.18 ? 256 ARG A NH1   1 
ATOM   1977 N  NH2   . ARG A 1 259 ? 33.305 -36.808 8.064   1.00 61.74 ? 256 ARG A NH2   1 
ATOM   1978 N  N     . SER A 1 260 ? 35.442 -37.533 13.206  1.00 33.80 ? 257 SER A N     1 
ATOM   1979 C  CA    . SER A 1 260 ? 36.666 -38.286 12.900  1.00 30.90 ? 257 SER A CA    1 
ATOM   1980 C  C     . SER A 1 260 ? 37.718 -38.195 13.990  1.00 29.81 ? 257 SER A C     1 
ATOM   1981 O  O     . SER A 1 260 ? 38.785 -38.771 13.846  1.00 25.20 ? 257 SER A O     1 
ATOM   1982 C  CB    . SER A 1 260 ? 37.290 -37.849 11.576  1.00 29.58 ? 257 SER A CB    1 
ATOM   1983 O  OG    . SER A 1 260 ? 38.055 -36.669 11.741  1.00 37.20 ? 257 SER A OG    1 
ATOM   1984 N  N     . LEU A 1 261 ? 37.420 -37.495 15.081  1.00 32.20 ? 258 LEU A N     1 
ATOM   1985 C  CA    . LEU A 1 261 ? 38.404 -37.334 16.160  1.00 30.24 ? 258 LEU A CA    1 
ATOM   1986 C  C     . LEU A 1 261 ? 37.988 -38.049 17.429  1.00 31.73 ? 258 LEU A C     1 
ATOM   1987 O  O     . LEU A 1 261 ? 38.533 -37.792 18.492  1.00 30.92 ? 258 LEU A O     1 
ATOM   1988 C  CB    . LEU A 1 261 ? 38.644 -35.855 16.475  1.00 32.12 ? 258 LEU A CB    1 
ATOM   1989 C  CG    . LEU A 1 261 ? 39.463 -35.024 15.476  1.00 31.95 ? 258 LEU A CG    1 
ATOM   1990 C  CD1   . LEU A 1 261 ? 39.655 -33.618 16.010  1.00 26.66 ? 258 LEU A CD1   1 
ATOM   1991 C  CD2   . LEU A 1 261 ? 40.806 -35.666 15.175  1.00 30.27 ? 258 LEU A CD2   1 
ATOM   1992 N  N     . GLY A 1 262 ? 37.024 -38.955 17.313  1.00 34.43 ? 259 GLY A N     1 
ATOM   1993 C  CA    . GLY A 1 262 ? 36.504 -39.659 18.471  1.00 30.43 ? 259 GLY A CA    1 
ATOM   1994 C  C     . GLY A 1 262 ? 37.242 -40.954 18.753  1.00 31.44 ? 259 GLY A C     1 
ATOM   1995 O  O     . GLY A 1 262 ? 36.944 -41.646 19.719  1.00 33.50 ? 259 GLY A O     1 
ATOM   1996 N  N     . GLY A 1 263 ? 38.213 -41.285 17.913  1.00 33.07 ? 260 GLY A N     1 
ATOM   1997 C  CA    . GLY A 1 263 ? 38.941 -42.533 18.068  1.00 31.32 ? 260 GLY A CA    1 
ATOM   1998 C  C     . GLY A 1 263 ? 40.378 -42.335 18.499  1.00 33.24 ? 260 GLY A C     1 
ATOM   1999 O  O     . GLY A 1 263 ? 40.668 -41.510 19.365  1.00 34.31 ? 260 GLY A O     1 
ATOM   2000 N  N     . LYS A 1 264 ? 41.281 -43.098 17.891  1.00 34.13 ? 261 LYS A N     1 
ATOM   2001 C  CA    . LYS A 1 264 ? 42.687 -43.101 18.280  1.00 34.34 ? 261 LYS A CA    1 
ATOM   2002 C  C     . LYS A 1 264 ? 43.425 -41.801 17.910  1.00 31.83 ? 261 LYS A C     1 
ATOM   2003 O  O     . LYS A 1 264 ? 44.257 -41.323 18.675  1.00 29.71 ? 261 LYS A O     1 
ATOM   2004 C  CB    . LYS A 1 264 ? 43.394 -44.306 17.654  1.00 32.96 ? 261 LYS A CB    1 
ATOM   2005 C  CG    . LYS A 1 264 ? 42.864 -45.654 18.128  1.00 37.28 ? 261 LYS A CG    1 
ATOM   2006 C  CD    . LYS A 1 264 ? 43.628 -46.812 17.483  1.00 43.04 ? 261 LYS A CD    1 
ATOM   2007 C  CE    . LYS A 1 264 ? 43.263 -48.161 18.110  1.00 47.91 ? 261 LYS A CE    1 
ATOM   2008 N  NZ    . LYS A 1 264 ? 44.034 -49.288 17.498  1.00 46.28 ? 261 LYS A NZ    1 
ATOM   2009 N  N     . LEU A 1 265 ? 43.117 -41.227 16.751  1.00 29.53 ? 262 LEU A N     1 
ATOM   2010 C  CA    . LEU A 1 265 ? 43.758 -39.975 16.352  1.00 29.69 ? 262 LEU A CA    1 
ATOM   2011 C  C     . LEU A 1 265 ? 43.489 -38.854 17.371  1.00 32.91 ? 262 LEU A C     1 
ATOM   2012 O  O     . LEU A 1 265 ? 44.410 -38.121 17.746  1.00 30.51 ? 262 LEU A O     1 
ATOM   2013 C  CB    . LEU A 1 265 ? 43.291 -39.552 14.964  1.00 31.19 ? 262 LEU A CB    1 
ATOM   2014 C  CG    . LEU A 1 265 ? 43.888 -38.263 14.393  1.00 35.28 ? 262 LEU A CG    1 
ATOM   2015 C  CD1   . LEU A 1 265 ? 45.397 -38.361 14.321  1.00 28.19 ? 262 LEU A CD1   1 
ATOM   2016 C  CD2   . LEU A 1 265 ? 43.314 -37.966 13.004  1.00 29.07 ? 262 LEU A CD2   1 
ATOM   2017 N  N     . GLY A 1 266 ? 42.242 -38.747 17.835  1.00 28.75 ? 263 GLY A N     1 
ATOM   2018 C  CA    . GLY A 1 266 ? 41.848 -37.702 18.767  1.00 28.26 ? 263 GLY A CA    1 
ATOM   2019 C  C     . GLY A 1 266 ? 42.566 -37.825 20.100  1.00 27.96 ? 263 GLY A C     1 
ATOM   2020 O  O     . GLY A 1 266 ? 43.056 -36.846 20.659  1.00 25.04 ? 263 GLY A O     1 
ATOM   2021 N  N     . ALA A 1 267 ? 42.627 -39.052 20.590  1.00 27.77 ? 264 ALA A N     1 
ATOM   2022 C  CA    . ALA A 1 267 ? 43.376 -39.398 21.781  1.00 28.71 ? 264 ALA A CA    1 
ATOM   2023 C  C     . ALA A 1 267 ? 44.860 -39.046 21.666  1.00 31.78 ? 264 ALA A C     1 
ATOM   2024 O  O     . ALA A 1 267 ? 45.487 -38.598 22.637  1.00 31.62 ? 264 ALA A O     1 
ATOM   2025 C  CB    . ALA A 1 267 ? 43.212 -40.895 22.071  1.00 30.38 ? 264 ALA A CB    1 
ATOM   2026 N  N     . SER A 1 268 ? 45.444 -39.269 20.496  1.00 28.87 ? 265 SER A N     1 
ATOM   2027 C  CA    . SER A 1 268 ? 46.856 -38.949 20.351  1.00 29.02 ? 265 SER A CA    1 
ATOM   2028 C  C     . SER A 1 268 ? 47.037 -37.433 20.261  1.00 27.94 ? 265 SER A C     1 
ATOM   2029 O  O     . SER A 1 268 ? 48.070 -36.905 20.646  1.00 30.63 ? 265 SER A O     1 
ATOM   2030 C  CB    . SER A 1 268 ? 47.457 -39.648 19.135  1.00 24.68 ? 265 SER A CB    1 
ATOM   2031 O  OG    . SER A 1 268 ? 47.024 -39.012 17.943  1.00 37.57 ? 265 SER A OG    1 
ATOM   2032 N  N     . VAL A 1 269 ? 46.033 -36.725 19.762  1.00 26.91 ? 266 VAL A N     1 
ATOM   2033 C  CA    . VAL A 1 269 ? 46.140 -35.279 19.731  1.00 29.58 ? 266 VAL A CA    1 
ATOM   2034 C  C     . VAL A 1 269 ? 46.180 -34.810 21.177  1.00 27.47 ? 266 VAL A C     1 
ATOM   2035 O  O     . VAL A 1 269 ? 47.011 -33.995 21.553  1.00 28.74 ? 266 VAL A O     1 
ATOM   2036 C  CB    . VAL A 1 269 ? 44.968 -34.605 18.956  1.00 28.81 ? 266 VAL A CB    1 
ATOM   2037 C  CG1   . VAL A 1 269 ? 44.991 -33.099 19.148  1.00 22.37 ? 266 VAL A CG1   1 
ATOM   2038 C  CG2   . VAL A 1 269 ? 45.033 -34.946 17.472  1.00 27.28 ? 266 VAL A CG2   1 
ATOM   2039 N  N     . ILE A 1 270 ? 45.286 -35.371 21.984  1.00 29.40 ? 267 ILE A N     1 
ATOM   2040 C  CA    . ILE A 1 270 ? 45.173 -35.047 23.396  1.00 24.26 ? 267 ILE A CA    1 
ATOM   2041 C  C     . ILE A 1 270 ? 46.442 -35.394 24.145  1.00 28.43 ? 267 ILE A C     1 
ATOM   2042 O  O     . ILE A 1 270 ? 46.959 -34.574 24.903  1.00 26.54 ? 267 ILE A O     1 
ATOM   2043 C  CB    . ILE A 1 270 ? 43.977 -35.784 24.033  1.00 25.78 ? 267 ILE A CB    1 
ATOM   2044 C  CG1   . ILE A 1 270 ? 42.662 -35.139 23.598  1.00 28.64 ? 267 ILE A CG1   1 
ATOM   2045 C  CG2   . ILE A 1 270 ? 44.082 -35.811 25.557  1.00 22.27 ? 267 ILE A CG2   1 
ATOM   2046 C  CD1   . ILE A 1 270 ? 41.444 -35.842 24.152  1.00 26.17 ? 267 ILE A CD1   1 
ATOM   2047 N  N     . GLU A 1 271 ? 46.959 -36.598 23.899  1.00 31.68 ? 268 GLU A N     1 
ATOM   2048 C  CA    . GLU A 1 271 ? 48.100 -37.125 24.647  1.00 33.11 ? 268 GLU A CA    1 
ATOM   2049 C  C     . GLU A 1 271 ? 49.422 -36.473 24.265  1.00 35.01 ? 268 GLU A C     1 
ATOM   2050 O  O     . GLU A 1 271 ? 50.173 -36.015 25.126  1.00 36.37 ? 268 GLU A O     1 
ATOM   2051 C  CB    . GLU A 1 271 ? 48.207 -38.640 24.454  1.00 42.16 ? 268 GLU A CB    1 
ATOM   2052 C  CG    . GLU A 1 271 ? 47.902 -39.428 25.720  1.00 51.22 ? 268 GLU A CG    1 
ATOM   2053 C  CD    . GLU A 1 271 ? 48.566 -38.823 26.947  1.00 59.76 ? 268 GLU A CD    1 
ATOM   2054 O  OE1   . GLU A 1 271 ? 49.823 -38.700 26.936  1.00 59.47 ? 268 GLU A OE1   1 
ATOM   2055 O  OE2   . GLU A 1 271 ? 47.830 -38.455 27.902  1.00 60.15 ? 268 GLU A OE2   1 
ATOM   2056 N  N     . ILE A 1 272 ? 49.700 -36.429 22.969  1.00 34.28 ? 269 ILE A N     1 
ATOM   2057 C  CA    . ILE A 1 272 ? 50.948 -35.871 22.491  1.00 27.96 ? 269 ILE A CA    1 
ATOM   2058 C  C     . ILE A 1 272 ? 51.001 -34.366 22.731  1.00 31.26 ? 269 ILE A C     1 
ATOM   2059 O  O     . ILE A 1 272 ? 52.028 -33.842 23.149  1.00 31.68 ? 269 ILE A O     1 
ATOM   2060 C  CB    . ILE A 1 272 ? 51.157 -36.196 20.995  1.00 30.78 ? 269 ILE A CB    1 
ATOM   2061 C  CG1   . ILE A 1 272 ? 51.810 -37.575 20.843  1.00 26.52 ? 269 ILE A CG1   1 
ATOM   2062 C  CG2   . ILE A 1 272 ? 52.017 -35.140 20.303  1.00 30.41 ? 269 ILE A CG2   1 
ATOM   2063 C  CD1   . ILE A 1 272 ? 51.476 -38.257 19.533  1.00 27.17 ? 269 ILE A CD1   1 
ATOM   2064 N  N     . LEU A 1 273 ? 49.904 -33.656 22.505  1.00 32.16 ? 270 LEU A N     1 
ATOM   2065 C  CA    . LEU A 1 273 ? 49.995 -32.197 22.602  1.00 31.54 ? 270 LEU A CA    1 
ATOM   2066 C  C     . LEU A 1 273 ? 49.766 -31.663 24.008  1.00 27.65 ? 270 LEU A C     1 
ATOM   2067 O  O     . LEU A 1 273 ? 50.116 -30.522 24.310  1.00 27.99 ? 270 LEU A O     1 
ATOM   2068 C  CB    . LEU A 1 273 ? 49.015 -31.530 21.643  1.00 28.90 ? 270 LEU A CB    1 
ATOM   2069 C  CG    . LEU A 1 273 ? 49.296 -31.790 20.170  1.00 29.38 ? 270 LEU A CG    1 
ATOM   2070 C  CD1   . LEU A 1 273 ? 48.570 -30.744 19.324  1.00 29.09 ? 270 LEU A CD1   1 
ATOM   2071 C  CD2   . LEU A 1 273 ? 50.785 -31.781 19.911  1.00 27.07 ? 270 LEU A CD2   1 
ATOM   2072 N  N     . GLY A 1 274 ? 49.160 -32.478 24.860  1.00 30.12 ? 271 GLY A N     1 
ATOM   2073 C  CA    . GLY A 1 274 ? 48.836 -32.050 26.208  1.00 25.60 ? 271 GLY A CA    1 
ATOM   2074 C  C     . GLY A 1 274 ? 47.641 -31.119 26.279  1.00 27.25 ? 271 GLY A C     1 
ATOM   2075 O  O     . GLY A 1 274 ? 47.651 -30.187 27.083  1.00 31.83 ? 271 GLY A O     1 
ATOM   2076 N  N     . ILE A 1 275 ? 46.605 -31.365 25.470  1.00 26.13 ? 272 ILE A N     1 
ATOM   2077 C  CA    . ILE A 1 275 ? 45.416 -30.486 25.474  1.00 27.59 ? 272 ILE A CA    1 
ATOM   2078 C  C     . ILE A 1 275 ? 44.101 -31.241 25.630  1.00 26.60 ? 272 ILE A C     1 
ATOM   2079 O  O     . ILE A 1 275 ? 44.077 -32.465 25.556  1.00 27.12 ? 272 ILE A O     1 
ATOM   2080 C  CB    . ILE A 1 275 ? 45.318 -29.635 24.188  1.00 25.11 ? 272 ILE A CB    1 
ATOM   2081 C  CG1   . ILE A 1 275 ? 45.128 -30.519 22.950  1.00 24.07 ? 272 ILE A CG1   1 
ATOM   2082 C  CG2   . ILE A 1 275 ? 46.542 -28.738 24.041  1.00 24.97 ? 272 ILE A CG2   1 
ATOM   2083 C  CD1   . ILE A 1 275 ? 45.166 -29.746 21.657  1.00 24.96 ? 272 ILE A CD1   1 
ATOM   2084 N  N     . GLU A 1 276 ? 43.019 -30.493 25.860  1.00 28.50 ? 273 GLU A N     1 
ATOM   2085 C  CA    . GLU A 1 276 ? 41.655 -31.044 25.952  1.00 27.97 ? 273 GLU A CA    1 
ATOM   2086 C  C     . GLU A 1 276 ? 40.706 -30.487 24.886  1.00 25.70 ? 273 GLU A C     1 
ATOM   2087 O  O     . GLU A 1 276 ? 39.859 -31.218 24.380  1.00 26.66 ? 273 GLU A O     1 
ATOM   2088 C  CB    . GLU A 1 276 ? 41.034 -30.764 27.325  1.00 26.51 ? 273 GLU A CB    1 
ATOM   2089 C  CG    . GLU A 1 276 ? 41.736 -31.392 28.483  1.00 32.88 ? 273 GLU A CG    1 
ATOM   2090 C  CD    . GLU A 1 276 ? 41.365 -30.740 29.810  1.00 38.93 ? 273 GLU A CD    1 
ATOM   2091 O  OE1   . GLU A 1 276 ? 42.205 -30.004 30.369  1.00 41.96 ? 273 GLU A OE1   1 
ATOM   2092 O  OE2   . GLU A 1 276 ? 40.239 -30.969 30.304  1.00 46.27 ? 273 GLU A OE2   1 
ATOM   2093 N  N     . TYR A 1 277 ? 40.822 -29.196 24.567  1.00 20.78 ? 274 TYR A N     1 
ATOM   2094 C  CA    . TYR A 1 277 ? 39.806 -28.532 23.745  1.00 22.38 ? 274 TYR A CA    1 
ATOM   2095 C  C     . TYR A 1 277 ? 40.306 -28.144 22.360  1.00 25.31 ? 274 TYR A C     1 
ATOM   2096 O  O     . TYR A 1 277 ? 41.446 -27.699 22.174  1.00 24.20 ? 274 TYR A O     1 
ATOM   2097 C  CB    . TYR A 1 277 ? 39.270 -27.277 24.446  1.00 24.47 ? 274 TYR A CB    1 
ATOM   2098 C  CG    . TYR A 1 277 ? 38.878 -27.492 25.892  1.00 24.91 ? 274 TYR A CG    1 
ATOM   2099 C  CD1   . TYR A 1 277 ? 37.851 -28.355 26.227  1.00 22.43 ? 274 TYR A CD1   1 
ATOM   2100 C  CD2   . TYR A 1 277 ? 39.549 -26.837 26.920  1.00 26.05 ? 274 TYR A CD2   1 
ATOM   2101 C  CE1   . TYR A 1 277 ? 37.492 -28.573 27.540  1.00 25.69 ? 274 TYR A CE1   1 
ATOM   2102 C  CE2   . TYR A 1 277 ? 39.189 -27.044 28.249  1.00 31.51 ? 274 TYR A CE2   1 
ATOM   2103 C  CZ    . TYR A 1 277 ? 38.153 -27.916 28.551  1.00 28.47 ? 274 TYR A CZ    1 
ATOM   2104 O  OH    . TYR A 1 277 ? 37.785 -28.127 29.869  1.00 33.32 ? 274 TYR A OH    1 
ATOM   2105 N  N     . MET A 1 278 ? 39.414 -28.309 21.395  1.00 25.73 ? 275 MET A N     1 
ATOM   2106 C  CA    . MET A 1 278 ? 39.682 -28.046 19.990  1.00 25.46 ? 275 MET A CA    1 
ATOM   2107 C  C     . MET A 1 278 ? 40.373 -26.682 19.756  1.00 26.97 ? 275 MET A C     1 
ATOM   2108 O  O     . MET A 1 278 ? 41.236 -26.557 18.886  1.00 26.68 ? 275 MET A O     1 
ATOM   2109 C  CB    . MET A 1 278 ? 38.358 -28.131 19.212  1.00 22.57 ? 275 MET A CB    1 
ATOM   2110 C  CG    . MET A 1 278 ? 38.503 -28.325 17.720  1.00 23.23 ? 275 MET A CG    1 
ATOM   2111 S  SD    . MET A 1 278 ? 39.200 -29.912 17.250  1.00 27.82 ? 275 MET A SD    1 
ATOM   2112 C  CE    . MET A 1 278 ? 39.356 -29.613 15.490  1.00 30.31 ? 275 MET A CE    1 
ATOM   2113 N  N     . GLY A 1 279 ? 40.011 -25.675 20.547  1.00 22.92 ? 276 GLY A N     1 
ATOM   2114 C  CA    . GLY A 1 279 ? 40.558 -24.343 20.362  1.00 25.35 ? 276 GLY A CA    1 
ATOM   2115 C  C     . GLY A 1 279 ? 42.045 -24.265 20.663  1.00 27.44 ? 276 GLY A C     1 
ATOM   2116 O  O     . GLY A 1 279 ? 42.786 -23.547 19.992  1.00 25.94 ? 276 GLY A O     1 
ATOM   2117 N  N     . GLU A 1 280 ? 42.487 -25.025 21.662  1.00 28.15 ? 277 GLU A N     1 
ATOM   2118 C  CA    . GLU A 1 280 ? 43.906 -25.103 22.005  1.00 25.29 ? 277 GLU A CA    1 
ATOM   2119 C  C     . GLU A 1 280 ? 44.796 -25.496 20.817  1.00 25.65 ? 277 GLU A C     1 
ATOM   2120 O  O     . GLU A 1 280 ? 45.995 -25.267 20.851  1.00 29.94 ? 277 GLU A O     1 
ATOM   2121 C  CB    . GLU A 1 280 ? 44.121 -26.096 23.151  1.00 25.75 ? 277 GLU A CB    1 
ATOM   2122 C  CG    . GLU A 1 280 ? 43.481 -25.722 24.483  1.00 24.65 ? 277 GLU A CG    1 
ATOM   2123 C  CD    . GLU A 1 280 ? 43.852 -26.699 25.575  1.00 24.18 ? 277 GLU A CD    1 
ATOM   2124 O  OE1   . GLU A 1 280 ? 43.067 -27.619 25.852  1.00 26.85 ? 277 GLU A OE1   1 
ATOM   2125 O  OE2   . GLU A 1 280 ? 44.951 -26.576 26.144  1.00 28.30 ? 277 GLU A OE2   1 
ATOM   2126 N  N     . LEU A 1 281 ? 44.223 -26.082 19.769  1.00 22.45 ? 278 LEU A N     1 
ATOM   2127 C  CA    . LEU A 1 281 ? 45.025 -26.468 18.603  1.00 27.01 ? 278 LEU A CA    1 
ATOM   2128 C  C     . LEU A 1 281 ? 45.575 -25.275 17.809  1.00 26.64 ? 278 LEU A C     1 
ATOM   2129 O  O     . LEU A 1 281 ? 46.561 -25.428 17.103  1.00 26.85 ? 278 LEU A O     1 
ATOM   2130 C  CB    . LEU A 1 281 ? 44.219 -27.374 17.668  1.00 26.66 ? 278 LEU A CB    1 
ATOM   2131 C  CG    . LEU A 1 281 ? 44.066 -28.844 18.067  1.00 27.49 ? 278 LEU A CG    1 
ATOM   2132 C  CD1   . LEU A 1 281 ? 42.981 -29.536 17.234  1.00 28.70 ? 278 LEU A CD1   1 
ATOM   2133 C  CD2   . LEU A 1 281 ? 45.390 -29.573 17.930  1.00 23.22 ? 278 LEU A CD2   1 
ATOM   2134 N  N     . THR A 1 282 ? 44.969 -24.093 17.948  1.00 29.20 ? 279 THR A N     1 
ATOM   2135 C  CA    . THR A 1 282 ? 45.406 -22.909 17.195  1.00 31.78 ? 279 THR A CA    1 
ATOM   2136 C  C     . THR A 1 282 ? 46.804 -22.388 17.553  1.00 27.34 ? 279 THR A C     1 
ATOM   2137 O  O     . THR A 1 282 ? 47.363 -21.586 16.823  1.00 29.41 ? 279 THR A O     1 
ATOM   2138 C  CB    . THR A 1 282 ? 44.434 -21.707 17.363  1.00 30.04 ? 279 THR A CB    1 
ATOM   2139 O  OG1   . THR A 1 282 ? 44.381 -21.308 18.741  1.00 31.33 ? 279 THR A OG1   1 
ATOM   2140 C  CG2   . THR A 1 282 ? 43.040 -22.029 16.832  1.00 25.15 ? 279 THR A CG2   1 
ATOM   2141 N  N     . GLN A 1 283 ? 47.373 -22.829 18.663  1.00 28.77 ? 280 GLN A N     1 
ATOM   2142 C  CA    . GLN A 1 283 ? 48.679 -22.304 19.047  1.00 31.94 ? 280 GLN A CA    1 
ATOM   2143 C  C     . GLN A 1 283 ? 49.844 -23.084 18.426  1.00 31.82 ? 280 GLN A C     1 
ATOM   2144 O  O     . GLN A 1 283 ? 51.003 -22.788 18.707  1.00 35.54 ? 280 GLN A O     1 
ATOM   2145 C  CB    . GLN A 1 283 ? 48.809 -22.263 20.578  1.00 30.36 ? 280 GLN A CB    1 
ATOM   2146 C  CG    . GLN A 1 283 ? 48.711 -23.594 21.257  1.00 30.55 ? 280 GLN A CG    1 
ATOM   2147 C  CD    . GLN A 1 283 ? 48.436 -23.488 22.754  1.00 41.11 ? 280 GLN A CD    1 
ATOM   2148 O  OE1   . GLN A 1 283 ? 49.120 -22.752 23.487  1.00 43.75 ? 280 GLN A OE1   1 
ATOM   2149 N  NE2   . GLN A 1 283 ? 47.428 -24.239 23.221  1.00 35.04 ? 280 GLN A NE2   1 
ATOM   2150 N  N     . PHE A 1 284 ? 49.530 -24.053 17.566  1.00 30.84 ? 281 PHE A N     1 
ATOM   2151 C  CA    . PHE A 1 284 ? 50.533 -24.872 16.890  1.00 27.23 ? 281 PHE A CA    1 
ATOM   2152 C  C     . PHE A 1 284 ? 50.624 -24.526 15.403  1.00 31.54 ? 281 PHE A C     1 
ATOM   2153 O  O     . PHE A 1 284 ? 49.602 -24.319 14.738  1.00 31.21 ? 281 PHE A O     1 
ATOM   2154 C  CB    . PHE A 1 284 ? 50.215 -26.361 17.050  1.00 28.56 ? 281 PHE A CB    1 
ATOM   2155 C  CG    . PHE A 1 284 ? 50.210 -26.829 18.472  1.00 24.53 ? 281 PHE A CG    1 
ATOM   2156 C  CD1   . PHE A 1 284 ? 51.389 -27.211 19.093  1.00 24.11 ? 281 PHE A CD1   1 
ATOM   2157 C  CD2   . PHE A 1 284 ? 49.029 -26.870 19.194  1.00 25.86 ? 281 PHE A CD2   1 
ATOM   2158 C  CE1   . PHE A 1 284 ? 51.385 -27.636 20.415  1.00 29.68 ? 281 PHE A CE1   1 
ATOM   2159 C  CE2   . PHE A 1 284 ? 49.015 -27.290 20.512  1.00 27.24 ? 281 PHE A CE2   1 
ATOM   2160 C  CZ    . PHE A 1 284 ? 50.192 -27.683 21.129  1.00 24.56 ? 281 PHE A CZ    1 
ATOM   2161 N  N     . THR A 1 285 ? 51.846 -24.443 14.883  1.00 31.18 ? 282 THR A N     1 
ATOM   2162 C  CA    . THR A 1 285 ? 52.032 -24.201 13.450  1.00 30.91 ? 282 THR A CA    1 
ATOM   2163 C  C     . THR A 1 285 ? 51.579 -25.425 12.687  1.00 28.35 ? 282 THR A C     1 
ATOM   2164 O  O     . THR A 1 285 ? 51.555 -26.527 13.250  1.00 28.46 ? 282 THR A O     1 
ATOM   2165 C  CB    . THR A 1 285 ? 53.485 -23.928 13.084  1.00 22.37 ? 282 THR A CB    1 
ATOM   2166 O  OG1   . THR A 1 285 ? 54.204 -25.164 13.145  1.00 23.35 ? 282 THR A OG1   1 
ATOM   2167 C  CG2   . THR A 1 285 ? 54.104 -22.913 14.042  1.00 22.72 ? 282 THR A CG2   1 
ATOM   2168 N  N     . GLU A 1 286 ? 51.239 -25.245 11.415  1.00 25.30 ? 283 GLU A N     1 
ATOM   2169 C  CA    . GLU A 1 286 ? 50.853 -26.379 10.596  1.00 25.46 ? 283 GLU A CA    1 
ATOM   2170 C  C     . GLU A 1 286 ? 51.981 -27.419 10.537  1.00 29.07 ? 283 GLU A C     1 
ATOM   2171 O  O     . GLU A 1 286 ? 51.731 -28.622 10.638  1.00 30.20 ? 283 GLU A O     1 
ATOM   2172 C  CB    . GLU A 1 286 ? 50.460 -25.915 9.194   1.00 25.32 ? 283 GLU A CB    1 
ATOM   2173 C  CG    . GLU A 1 286 ? 49.781 -26.995 8.356   1.00 26.13 ? 283 GLU A CG    1 
ATOM   2174 C  CD    . GLU A 1 286 ? 49.305 -26.483 7.013   1.00 29.93 ? 283 GLU A CD    1 
ATOM   2175 O  OE1   . GLU A 1 286 ? 49.695 -25.355 6.641   1.00 32.05 ? 283 GLU A OE1   1 
ATOM   2176 O  OE2   . GLU A 1 286 ? 48.552 -27.210 6.322   1.00 31.80 ? 283 GLU A OE2   1 
ATOM   2177 N  N     . SER A 1 287 ? 53.222 -26.959 10.422  1.00 26.44 ? 284 SER A N     1 
ATOM   2178 C  CA    . SER A 1 287 ? 54.350 -27.883 10.317  1.00 28.26 ? 284 SER A CA    1 
ATOM   2179 C  C     . SER A 1 287 ? 54.480 -28.740 11.564  1.00 28.37 ? 284 SER A C     1 
ATOM   2180 O  O     . SER A 1 287 ? 54.803 -29.923 11.479  1.00 27.06 ? 284 SER A O     1 
ATOM   2181 C  CB    . SER A 1 287 ? 55.657 -27.128 10.063  1.00 27.33 ? 284 SER A CB    1 
ATOM   2182 O  OG    . SER A 1 287 ? 55.685 -26.633 8.734   1.00 32.97 ? 284 SER A OG    1 
ATOM   2183 N  N     . GLN A 1 288 ? 54.231 -28.134 12.720  1.00 27.92 ? 285 GLN A N     1 
ATOM   2184 C  CA    . GLN A 1 288 ? 54.208 -28.872 13.967  1.00 24.79 ? 285 GLN A CA    1 
ATOM   2185 C  C     . GLN A 1 288 ? 53.140 -29.964 13.935  1.00 30.50 ? 285 GLN A C     1 
ATOM   2186 O  O     . GLN A 1 288 ? 53.401 -31.115 14.302  1.00 26.50 ? 285 GLN A O     1 
ATOM   2187 C  CB    . GLN A 1 288 ? 53.953 -27.932 15.135  1.00 28.51 ? 285 GLN A CB    1 
ATOM   2188 C  CG    . GLN A 1 288 ? 55.179 -27.213 15.652  1.00 26.81 ? 285 GLN A CG    1 
ATOM   2189 C  CD    . GLN A 1 288 ? 54.812 -26.212 16.715  1.00 30.42 ? 285 GLN A CD    1 
ATOM   2190 O  OE1   . GLN A 1 288 ? 53.757 -25.583 16.650  1.00 34.89 ? 285 GLN A OE1   1 
ATOM   2191 N  NE2   . GLN A 1 288 ? 55.665 -26.066 17.707  1.00 36.12 ? 285 GLN A NE2   1 
ATOM   2192 N  N     . LEU A 1 289 ? 51.936 -29.604 13.486  1.00 26.37 ? 286 LEU A N     1 
ATOM   2193 C  CA    . LEU A 1 289 ? 50.852 -30.569 13.478  1.00 25.70 ? 286 LEU A CA    1 
ATOM   2194 C  C     . LEU A 1 289 ? 51.129 -31.678 12.481  1.00 28.30 ? 286 LEU A C     1 
ATOM   2195 O  O     . LEU A 1 289 ? 50.923 -32.857 12.785  1.00 25.07 ? 286 LEU A O     1 
ATOM   2196 C  CB    . LEU A 1 289 ? 49.520 -29.882 13.177  1.00 26.23 ? 286 LEU A CB    1 
ATOM   2197 C  CG    . LEU A 1 289 ? 49.119 -28.905 14.294  1.00 27.05 ? 286 LEU A CG    1 
ATOM   2198 C  CD1   . LEU A 1 289 ? 47.849 -28.162 13.922  1.00 25.41 ? 286 LEU A CD1   1 
ATOM   2199 C  CD2   . LEU A 1 289 ? 48.981 -29.650 15.635  1.00 21.78 ? 286 LEU A CD2   1 
ATOM   2200 N  N     . GLN A 1 290 ? 51.599 -31.289 11.295  1.00 29.44 ? 287 GLN A N     1 
ATOM   2201 C  CA    . GLN A 1 290 ? 51.998 -32.240 10.259  1.00 28.12 ? 287 GLN A CA    1 
ATOM   2202 C  C     . GLN A 1 290 ? 53.070 -33.181 10.795  1.00 31.55 ? 287 GLN A C     1 
ATOM   2203 O  O     . GLN A 1 290 ? 53.012 -34.392 10.572  1.00 31.23 ? 287 GLN A O     1 
ATOM   2204 C  CB    . GLN A 1 290 ? 52.482 -31.500 9.016   1.00 28.09 ? 287 GLN A CB    1 
ATOM   2205 C  CG    . GLN A 1 290 ? 51.329 -30.834 8.279   1.00 29.17 ? 287 GLN A CG    1 
ATOM   2206 C  CD    . GLN A 1 290 ? 51.752 -30.002 7.090   1.00 32.24 ? 287 GLN A CD    1 
ATOM   2207 O  OE1   . GLN A 1 290 ? 52.757 -29.284 7.134   1.00 32.33 ? 287 GLN A OE1   1 
ATOM   2208 N  NE2   . GLN A 1 290 ? 50.966 -30.076 6.015   1.00 33.17 ? 287 GLN A NE2   1 
ATOM   2209 N  N     . SER A 1 291 ? 54.012 -32.625 11.553  1.00 28.72 ? 288 SER A N     1 
ATOM   2210 C  CA    . SER A 1 291 ? 55.053 -33.427 12.171  1.00 30.13 ? 288 SER A CA    1 
ATOM   2211 C  C     . SER A 1 291 ? 54.534 -34.537 13.098  1.00 31.82 ? 288 SER A C     1 
ATOM   2212 O  O     . SER A 1 291 ? 55.156 -35.592 13.202  1.00 32.33 ? 288 SER A O     1 
ATOM   2213 C  CB    . SER A 1 291 ? 56.013 -32.532 12.959  1.00 29.55 ? 288 SER A CB    1 
ATOM   2214 O  OG    . SER A 1 291 ? 57.037 -33.312 13.535  1.00 33.18 ? 288 SER A OG    1 
ATOM   2215 N  N     . HIS A 1 292 ? 53.417 -34.307 13.782  1.00 31.32 ? 289 HIS A N     1 
ATOM   2216 C  CA    . HIS A 1 292 ? 52.961 -35.266 14.788  1.00 28.53 ? 289 HIS A CA    1 
ATOM   2217 C  C     . HIS A 1 292 ? 52.000 -36.283 14.220  1.00 27.55 ? 289 HIS A C     1 
ATOM   2218 O  O     . HIS A 1 292 ? 52.123 -37.475 14.479  1.00 29.43 ? 289 HIS A O     1 
ATOM   2219 C  CB    . HIS A 1 292 ? 52.276 -34.566 15.957  1.00 28.52 ? 289 HIS A CB    1 
ATOM   2220 C  CG    . HIS A 1 292 ? 53.211 -33.841 16.868  1.00 32.78 ? 289 HIS A CG    1 
ATOM   2221 N  ND1   . HIS A 1 292 ? 54.214 -34.480 17.567  1.00 27.53 ? 289 HIS A ND1   1 
ATOM   2222 C  CD2   . HIS A 1 292 ? 53.273 -32.532 17.222  1.00 29.48 ? 289 HIS A CD2   1 
ATOM   2223 C  CE1   . HIS A 1 292 ? 54.874 -33.589 18.287  1.00 30.96 ? 289 HIS A CE1   1 
ATOM   2224 N  NE2   . HIS A 1 292 ? 54.321 -32.401 18.098  1.00 30.21 ? 289 HIS A NE2   1 
ATOM   2225 N  N     . PHE A 1 293 ? 51.035 -35.794 13.452  1.00 28.70 ? 290 PHE A N     1 
ATOM   2226 C  CA    . PHE A 1 293 ? 49.915 -36.604 13.003  1.00 26.09 ? 290 PHE A CA    1 
ATOM   2227 C  C     . PHE A 1 293 ? 49.944 -36.781 11.490  1.00 32.81 ? 290 PHE A C     1 
ATOM   2228 O  O     . PHE A 1 293 ? 48.975 -37.278 10.881  1.00 33.11 ? 290 PHE A O     1 
ATOM   2229 C  CB    . PHE A 1 293 ? 48.608 -35.964 13.469  1.00 28.52 ? 290 PHE A CB    1 
ATOM   2230 C  CG    . PHE A 1 293 ? 48.684 -35.426 14.863  1.00 25.84 ? 290 PHE A CG    1 
ATOM   2231 C  CD1   . PHE A 1 293 ? 48.849 -36.285 15.936  1.00 27.60 ? 290 PHE A CD1   1 
ATOM   2232 C  CD2   . PHE A 1 293 ? 48.628 -34.067 15.099  1.00 25.67 ? 290 PHE A CD2   1 
ATOM   2233 C  CE1   . PHE A 1 293 ? 48.950 -35.805 17.222  1.00 28.75 ? 290 PHE A CE1   1 
ATOM   2234 C  CE2   . PHE A 1 293 ? 48.741 -33.574 16.393  1.00 28.42 ? 290 PHE A CE2   1 
ATOM   2235 C  CZ    . PHE A 1 293 ? 48.893 -34.446 17.452  1.00 29.74 ? 290 PHE A CZ    1 
ATOM   2236 N  N     . GLY A 1 294 ? 51.067 -36.389 10.888  1.00 27.25 ? 291 GLY A N     1 
ATOM   2237 C  CA    . GLY A 1 294 ? 51.275 -36.641 9.478   1.00 30.24 ? 291 GLY A CA    1 
ATOM   2238 C  C     . GLY A 1 294 ? 50.745 -35.498 8.655   1.00 29.13 ? 291 GLY A C     1 
ATOM   2239 O  O     . GLY A 1 294 ? 50.018 -34.652 9.152   1.00 27.88 ? 291 GLY A O     1 
ATOM   2240 N  N     . GLU A 1 295 ? 51.101 -35.491 7.381   1.00 31.91 ? 292 GLU A N     1 
ATOM   2241 C  CA    . GLU A 1 295 ? 50.874 -34.345 6.527   1.00 29.92 ? 292 GLU A CA    1 
ATOM   2242 C  C     . GLU A 1 295 ? 49.397 -34.005 6.354   1.00 31.38 ? 292 GLU A C     1 
ATOM   2243 O  O     . GLU A 1 295 ? 49.005 -32.852 6.484   1.00 30.76 ? 292 GLU A O     1 
ATOM   2244 C  CB    . GLU A 1 295 ? 51.526 -34.603 5.177   1.00 27.96 ? 292 GLU A CB    1 
ATOM   2245 C  CG    . GLU A 1 295 ? 51.196 -33.579 4.126   1.00 35.05 ? 292 GLU A CG    1 
ATOM   2246 C  CD    . GLU A 1 295 ? 51.739 -33.961 2.757   1.00 43.69 ? 292 GLU A CD    1 
ATOM   2247 O  OE1   . GLU A 1 295 ? 50.948 -34.014 1.786   1.00 47.68 ? 292 GLU A OE1   1 
ATOM   2248 O  OE2   . GLU A 1 295 ? 52.958 -34.216 2.652   1.00 40.72 ? 292 GLU A OE2   1 
ATOM   2249 N  N     . LYS A 1 296 ? 48.584 -35.019 6.078   1.00 32.10 ? 293 LYS A N     1 
ATOM   2250 C  CA    . LYS A 1 296 ? 47.152 -34.843 5.806   1.00 33.69 ? 293 LYS A CA    1 
ATOM   2251 C  C     . LYS A 1 296 ? 46.357 -34.408 7.042   1.00 29.59 ? 293 LYS A C     1 
ATOM   2252 O  O     . LYS A 1 296 ? 45.548 -33.481 6.990   1.00 27.12 ? 293 LYS A O     1 
ATOM   2253 C  CB    . LYS A 1 296 ? 46.570 -36.151 5.266   1.00 34.54 ? 293 LYS A CB    1 
ATOM   2254 C  CG    . LYS A 1 296 ? 45.313 -36.008 4.450   1.00 36.16 ? 293 LYS A CG    1 
ATOM   2255 C  CD    . LYS A 1 296 ? 44.715 -37.395 4.170   1.00 42.10 ? 293 LYS A CD    1 
ATOM   2256 C  CE    . LYS A 1 296 ? 43.738 -37.373 2.998   1.00 47.08 ? 293 LYS A CE    1 
ATOM   2257 N  NZ    . LYS A 1 296 ? 42.530 -36.542 3.251   1.00 46.62 ? 293 LYS A NZ    1 
ATOM   2258 N  N     . ASN A 1 297 ? 46.590 -35.112 8.144   1.00 31.58 ? 294 ASN A N     1 
ATOM   2259 C  CA    . ASN A 1 297 ? 45.926 -34.840 9.404   1.00 30.02 ? 294 ASN A CA    1 
ATOM   2260 C  C     . ASN A 1 297 ? 46.358 -33.472 9.906   1.00 30.58 ? 294 ASN A C     1 
ATOM   2261 O  O     . ASN A 1 297 ? 45.533 -32.703 10.408  1.00 31.55 ? 294 ASN A O     1 
ATOM   2262 C  CB    . ASN A 1 297 ? 46.245 -35.937 10.441  1.00 29.05 ? 294 ASN A CB    1 
ATOM   2263 C  CG    . ASN A 1 297 ? 45.611 -37.273 10.094  1.00 31.64 ? 294 ASN A CG    1 
ATOM   2264 O  OD1   . ASN A 1 297 ? 44.588 -37.320 9.409   1.00 32.24 ? 294 ASN A OD1   1 
ATOM   2265 N  ND2   . ASN A 1 297 ? 46.212 -38.368 10.566  1.00 26.61 ? 294 ASN A ND2   1 
ATOM   2266 N  N     . GLY A 1 298 ? 47.651 -33.182 9.750   1.00 25.83 ? 295 GLY A N     1 
ATOM   2267 C  CA    . GLY A 1 298 ? 48.240 -31.916 10.154  1.00 25.47 ? 295 GLY A CA    1 
ATOM   2268 C  C     . GLY A 1 298 ? 47.534 -30.740 9.510   1.00 25.82 ? 295 GLY A C     1 
ATOM   2269 O  O     . GLY A 1 298 ? 46.999 -29.875 10.211  1.00 26.38 ? 295 GLY A O     1 
ATOM   2270 N  N     . SER A 1 299 ? 47.524 -30.714 8.177   1.00 28.87 ? 296 SER A N     1 
ATOM   2271 C  CA    . SER A 1 299 ? 46.782 -29.703 7.412   1.00 28.07 ? 296 SER A CA    1 
ATOM   2272 C  C     . SER A 1 299 ? 45.321 -29.583 7.866   1.00 28.64 ? 296 SER A C     1 
ATOM   2273 O  O     . SER A 1 299 ? 44.811 -28.482 8.105   1.00 25.93 ? 296 SER A O     1 
ATOM   2274 C  CB    . SER A 1 299 ? 46.815 -30.035 5.920   1.00 24.91 ? 296 SER A CB    1 
ATOM   2275 O  OG    . SER A 1 299 ? 48.095 -29.809 5.382   1.00 34.68 ? 296 SER A OG    1 
ATOM   2276 N  N     . TRP A 1 300 ? 44.670 -30.737 7.996   1.00 26.12 ? 297 TRP A N     1 
ATOM   2277 C  CA    . TRP A 1 300 ? 43.260 -30.801 8.324   1.00 28.33 ? 297 TRP A CA    1 
ATOM   2278 C  C     . TRP A 1 300 ? 42.990 -30.202 9.704   1.00 28.47 ? 297 TRP A C     1 
ATOM   2279 O  O     . TRP A 1 300 ? 42.017 -29.453 9.874   1.00 22.78 ? 297 TRP A O     1 
ATOM   2280 C  CB    . TRP A 1 300 ? 42.760 -32.249 8.254   1.00 24.89 ? 297 TRP A CB    1 
ATOM   2281 C  CG    . TRP A 1 300 ? 41.277 -32.350 8.366   1.00 28.40 ? 297 TRP A CG    1 
ATOM   2282 C  CD1   . TRP A 1 300 ? 40.368 -32.291 7.344   1.00 27.12 ? 297 TRP A CD1   1 
ATOM   2283 C  CD2   . TRP A 1 300 ? 40.516 -32.535 9.569   1.00 25.79 ? 297 TRP A CD2   1 
ATOM   2284 N  NE1   . TRP A 1 300 ? 39.090 -32.441 7.838   1.00 29.65 ? 297 TRP A NE1   1 
ATOM   2285 C  CE2   . TRP A 1 300 ? 39.154 -32.582 9.199   1.00 25.34 ? 297 TRP A CE2   1 
ATOM   2286 C  CE3   . TRP A 1 300 ? 40.853 -32.668 10.918  1.00 26.79 ? 297 TRP A CE3   1 
ATOM   2287 C  CZ2   . TRP A 1 300 ? 38.138 -32.754 10.128  1.00 26.29 ? 297 TRP A CZ2   1 
ATOM   2288 C  CZ3   . TRP A 1 300 ? 39.838 -32.845 11.840  1.00 25.58 ? 297 TRP A CZ3   1 
ATOM   2289 C  CH2   . TRP A 1 300 ? 38.501 -32.885 11.443  1.00 28.17 ? 297 TRP A CH2   1 
ATOM   2290 N  N     . LEU A 1 301 ? 43.873 -30.511 10.662  1.00 24.78 ? 298 LEU A N     1 
ATOM   2291 C  CA    . LEU A 1 301 ? 43.753 -30.011 12.029  1.00 23.90 ? 298 LEU A CA    1 
ATOM   2292 C  C     . LEU A 1 301 ? 44.071 -28.516 12.125  1.00 27.13 ? 298 LEU A C     1 
ATOM   2293 O  O     . LEU A 1 301 ? 43.366 -27.762 12.809  1.00 24.03 ? 298 LEU A O     1 
ATOM   2294 C  CB    . LEU A 1 301 ? 44.669 -30.800 12.975  1.00 23.69 ? 298 LEU A CB    1 
ATOM   2295 C  CG    . LEU A 1 301 ? 44.242 -32.237 13.338  1.00 29.62 ? 298 LEU A CG    1 
ATOM   2296 C  CD1   . LEU A 1 301 ? 45.377 -33.045 13.955  1.00 24.89 ? 298 LEU A CD1   1 
ATOM   2297 C  CD2   . LEU A 1 301 ? 43.012 -32.255 14.257  1.00 20.93 ? 298 LEU A CD2   1 
ATOM   2298 N  N     . TYR A 1 302 ? 45.142 -28.088 11.457  1.00 29.16 ? 299 TYR A N     1 
ATOM   2299 C  CA    . TYR A 1 302 ? 45.501 -26.666 11.445  1.00 26.93 ? 299 TYR A CA    1 
ATOM   2300 C  C     . TYR A 1 302 ? 44.289 -25.812 11.034  1.00 24.53 ? 299 TYR A C     1 
ATOM   2301 O  O     . TYR A 1 302 ? 43.918 -24.875 11.739  1.00 25.95 ? 299 TYR A O     1 
ATOM   2302 C  CB    . TYR A 1 302 ? 46.696 -26.403 10.506  1.00 24.84 ? 299 TYR A CB    1 
ATOM   2303 C  CG    . TYR A 1 302 ? 47.174 -24.969 10.530  1.00 25.66 ? 299 TYR A CG    1 
ATOM   2304 C  CD1   . TYR A 1 302 ? 48.046 -24.521 11.515  1.00 25.29 ? 299 TYR A CD1   1 
ATOM   2305 C  CD2   . TYR A 1 302 ? 46.743 -24.054 9.578   1.00 25.31 ? 299 TYR A CD2   1 
ATOM   2306 C  CE1   . TYR A 1 302 ? 48.476 -23.203 11.551  1.00 25.74 ? 299 TYR A CE1   1 
ATOM   2307 C  CE2   . TYR A 1 302 ? 47.173 -22.735 9.605   1.00 26.56 ? 299 TYR A CE2   1 
ATOM   2308 C  CZ    . TYR A 1 302 ? 48.042 -22.317 10.596  1.00 25.94 ? 299 TYR A CZ    1 
ATOM   2309 O  OH    . TYR A 1 302 ? 48.458 -21.003 10.631  1.00 29.44 ? 299 TYR A OH    1 
ATOM   2310 N  N     . ALA A 1 303 ? 43.671 -26.162 9.912   1.00 24.24 ? 300 ALA A N     1 
ATOM   2311 C  CA    . ALA A 1 303 ? 42.469 -25.476 9.412   1.00 24.67 ? 300 ALA A CA    1 
ATOM   2312 C  C     . ALA A 1 303 ? 41.196 -25.720 10.239  1.00 21.79 ? 300 ALA A C     1 
ATOM   2313 O  O     . ALA A 1 303 ? 40.411 -24.792 10.462  1.00 25.77 ? 300 ALA A O     1 
ATOM   2314 C  CB    . ALA A 1 303 ? 42.207 -25.878 7.936   1.00 22.36 ? 300 ALA A CB    1 
ATOM   2315 N  N     . MET A 1 304 ? 40.978 -26.951 10.688  1.00 24.44 ? 301 MET A N     1 
ATOM   2316 C  CA    . MET A 1 304 ? 39.724 -27.271 11.372  1.00 23.13 ? 301 MET A CA    1 
ATOM   2317 C  C     . MET A 1 304 ? 39.595 -26.565 12.715  1.00 25.10 ? 301 MET A C     1 
ATOM   2318 O  O     . MET A 1 304 ? 38.501 -26.170 13.092  1.00 21.96 ? 301 MET A O     1 
ATOM   2319 C  CB    . MET A 1 304 ? 39.568 -28.765 11.582  1.00 22.25 ? 301 MET A CB    1 
ATOM   2320 C  CG    . MET A 1 304 ? 38.162 -29.157 12.016  1.00 24.71 ? 301 MET A CG    1 
ATOM   2321 S  SD    . MET A 1 304 ? 36.974 -28.950 10.686  1.00 27.62 ? 301 MET A SD    1 
ATOM   2322 C  CE    . MET A 1 304 ? 35.932 -27.641 11.311  1.00 22.83 ? 301 MET A CE    1 
ATOM   2323 N  N     . CYS A 1 305 ? 40.699 -26.382 13.436  1.00 26.07 ? 302 CYS A N     1 
ATOM   2324 C  CA    . CYS A 1 305 ? 40.600 -25.692 14.732  1.00 28.27 ? 302 CYS A CA    1 
ATOM   2325 C  C     . CYS A 1 305 ? 40.290 -24.190 14.548  1.00 23.98 ? 302 CYS A C     1 
ATOM   2326 O  O     . CYS A 1 305 ? 39.954 -23.490 15.494  1.00 23.43 ? 302 CYS A O     1 
ATOM   2327 C  CB    . CYS A 1 305 ? 41.875 -25.882 15.546  1.00 24.03 ? 302 CYS A CB    1 
ATOM   2328 S  SG    . CYS A 1 305 ? 43.254 -24.880 15.001  1.00 26.91 ? 302 CYS A SG    1 
ATOM   2329 N  N     . ARG A 1 306 ? 40.394 -23.723 13.310  1.00 26.92 ? 303 ARG A N     1 
ATOM   2330 C  CA    . ARG A 1 306 ? 40.001 -22.366 12.923  1.00 27.18 ? 303 ARG A CA    1 
ATOM   2331 C  C     . ARG A 1 306 ? 38.620 -22.336 12.254  1.00 23.74 ? 303 ARG A C     1 
ATOM   2332 O  O     . ARG A 1 306 ? 38.212 -21.323 11.701  1.00 24.41 ? 303 ARG A O     1 
ATOM   2333 C  CB    . ARG A 1 306 ? 41.057 -21.773 11.970  1.00 24.41 ? 303 ARG A CB    1 
ATOM   2334 C  CG    . ARG A 1 306 ? 42.352 -21.463 12.665  1.00 22.83 ? 303 ARG A CG    1 
ATOM   2335 C  CD    . ARG A 1 306 ? 43.542 -21.290 11.736  1.00 20.37 ? 303 ARG A CD    1 
ATOM   2336 N  NE    . ARG A 1 306 ? 44.660 -20.755 12.517  1.00 26.21 ? 303 ARG A NE    1 
ATOM   2337 C  CZ    . ARG A 1 306 ? 45.442 -21.479 13.315  1.00 23.65 ? 303 ARG A CZ    1 
ATOM   2338 N  NH1   . ARG A 1 306 ? 46.421 -20.895 13.995  1.00 23.91 ? 303 ARG A NH1   1 
ATOM   2339 N  NH2   . ARG A 1 306 ? 45.257 -22.789 13.423  1.00 26.30 ? 303 ARG A NH2   1 
ATOM   2340 N  N     . GLY A 1 307 ? 37.920 -23.460 12.280  1.00 22.36 ? 304 GLY A N     1 
ATOM   2341 C  CA    . GLY A 1 307 ? 36.603 -23.554 11.683  1.00 21.51 ? 304 GLY A CA    1 
ATOM   2342 C  C     . GLY A 1 307 ? 36.623 -23.731 10.178  1.00 24.39 ? 304 GLY A C     1 
ATOM   2343 O  O     . GLY A 1 307 ? 35.624 -23.461 9.527   1.00 25.33 ? 304 GLY A O     1 
ATOM   2344 N  N     . ILE A 1 308 ? 37.748 -24.179 9.622   1.00 21.77 ? 305 ILE A N     1 
ATOM   2345 C  CA    . ILE A 1 308 ? 37.891 -24.266 8.166   1.00 24.65 ? 305 ILE A CA    1 
ATOM   2346 C  C     . ILE A 1 308 ? 38.102 -25.699 7.709   1.00 27.42 ? 305 ILE A C     1 
ATOM   2347 O  O     . ILE A 1 308 ? 39.013 -26.379 8.187   1.00 26.28 ? 305 ILE A O     1 
ATOM   2348 C  CB    . ILE A 1 308 ? 39.065 -23.425 7.644   1.00 26.48 ? 305 ILE A CB    1 
ATOM   2349 C  CG1   . ILE A 1 308 ? 38.967 -21.975 8.109   1.00 26.02 ? 305 ILE A CG1   1 
ATOM   2350 C  CG2   . ILE A 1 308 ? 39.131 -23.473 6.122   1.00 33.68 ? 305 ILE A CG2   1 
ATOM   2351 C  CD1   . ILE A 1 308 ? 40.246 -21.222 7.879   1.00 27.08 ? 305 ILE A CD1   1 
ATOM   2352 N  N     . GLU A 1 309 ? 37.252 -26.150 6.787   1.00 26.71 ? 306 GLU A N     1 
ATOM   2353 C  CA    . GLU A 1 309 ? 37.273 -27.528 6.287   1.00 27.23 ? 306 GLU A CA    1 
ATOM   2354 C  C     . GLU A 1 309 ? 36.761 -27.502 4.843   1.00 29.70 ? 306 GLU A C     1 
ATOM   2355 O  O     . GLU A 1 309 ? 35.799 -26.795 4.545   1.00 30.21 ? 306 GLU A O     1 
ATOM   2356 C  CB    . GLU A 1 309 ? 36.407 -28.426 7.172   1.00 26.61 ? 306 GLU A CB    1 
ATOM   2357 C  CG    . GLU A 1 309 ? 36.713 -29.897 7.106   1.00 27.34 ? 306 GLU A CG    1 
ATOM   2358 C  CD    . GLU A 1 309 ? 35.510 -30.700 6.711   1.00 29.81 ? 306 GLU A CD    1 
ATOM   2359 O  OE1   . GLU A 1 309 ? 34.430 -30.102 6.587   1.00 27.99 ? 306 GLU A OE1   1 
ATOM   2360 O  OE2   . GLU A 1 309 ? 35.641 -31.925 6.516   1.00 36.08 ? 306 GLU A OE2   1 
ATOM   2361 N  N     . HIS A 1 310 ? 37.399 -28.239 3.941   1.00 31.41 ? 307 HIS A N     1 
ATOM   2362 C  CA    . HIS A 1 310 ? 37.102 -28.076 2.509   1.00 36.45 ? 307 HIS A CA    1 
ATOM   2363 C  C     . HIS A 1 310 ? 36.379 -29.267 1.892   1.00 36.00 ? 307 HIS A C     1 
ATOM   2364 O  O     . HIS A 1 310 ? 35.939 -29.181 0.743   1.00 34.52 ? 307 HIS A O     1 
ATOM   2365 C  CB    . HIS A 1 310 ? 38.383 -27.823 1.707   1.00 34.98 ? 307 HIS A CB    1 
ATOM   2366 C  CG    . HIS A 1 310 ? 39.172 -26.643 2.175   1.00 44.42 ? 307 HIS A CG    1 
ATOM   2367 N  ND1   . HIS A 1 310 ? 38.767 -25.339 1.960   1.00 41.85 ? 307 HIS A ND1   1 
ATOM   2368 C  CD2   . HIS A 1 310 ? 40.350 -26.566 2.840   1.00 42.58 ? 307 HIS A CD2   1 
ATOM   2369 C  CE1   . HIS A 1 310 ? 39.660 -24.515 2.475   1.00 47.81 ? 307 HIS A CE1   1 
ATOM   2370 N  NE2   . HIS A 1 310 ? 40.629 -25.234 3.018   1.00 50.56 ? 307 HIS A NE2   1 
ATOM   2371 N  N     . ASP A 1 311 ? 36.284 -30.361 2.649   1.00 33.39 ? 308 ASP A N     1 
ATOM   2372 C  CA    . ASP A 1 311 ? 35.640 -31.596 2.195   1.00 33.54 ? 308 ASP A CA    1 
ATOM   2373 C  C     . ASP A 1 311 ? 34.291 -31.284 1.537   1.00 32.51 ? 308 ASP A C     1 
ATOM   2374 O  O     . ASP A 1 311 ? 33.401 -30.725 2.166   1.00 30.31 ? 308 ASP A O     1 
ATOM   2375 C  CB    . ASP A 1 311 ? 35.470 -32.564 3.374   1.00 31.10 ? 308 ASP A CB    1 
ATOM   2376 C  CG    . ASP A 1 311 ? 35.201 -34.002 2.938   1.00 40.54 ? 308 ASP A CG    1 
ATOM   2377 O  OD1   . ASP A 1 311 ? 35.545 -34.384 1.796   1.00 44.15 ? 308 ASP A OD1   1 
ATOM   2378 O  OD2   . ASP A 1 311 ? 34.643 -34.768 3.756   1.00 45.74 ? 308 ASP A OD2   1 
ATOM   2379 N  N     . PRO A 1 312 ? 34.151 -31.619 0.246   1.00 31.70 ? 309 PRO A N     1 
ATOM   2380 C  CA    . PRO A 1 312 ? 32.938 -31.219 -0.466  1.00 29.31 ? 309 PRO A CA    1 
ATOM   2381 C  C     . PRO A 1 312 ? 31.732 -32.099 -0.164  1.00 29.07 ? 309 PRO A C     1 
ATOM   2382 O  O     . PRO A 1 312 ? 31.878 -33.270 0.184   1.00 32.60 ? 309 PRO A O     1 
ATOM   2383 C  CB    . PRO A 1 312 ? 33.351 -31.342 -1.933  1.00 28.60 ? 309 PRO A CB    1 
ATOM   2384 C  CG    . PRO A 1 312 ? 34.369 -32.415 -1.934  1.00 29.17 ? 309 PRO A CG    1 
ATOM   2385 C  CD    . PRO A 1 312 ? 35.130 -32.255 -0.648  1.00 31.17 ? 309 PRO A CD    1 
ATOM   2386 N  N     . VAL A 1 313 ? 30.541 -31.525 -0.268  1.00 27.54 ? 310 VAL A N     1 
ATOM   2387 C  CA    . VAL A 1 313 ? 29.340 -32.342 -0.259  1.00 29.96 ? 310 VAL A CA    1 
ATOM   2388 C  C     . VAL A 1 313 ? 29.352 -33.099 -1.568  1.00 28.72 ? 310 VAL A C     1 
ATOM   2389 O  O     . VAL A 1 313 ? 29.268 -32.475 -2.625  1.00 27.83 ? 310 VAL A O     1 
ATOM   2390 C  CB    . VAL A 1 313 ? 28.062 -31.500 -0.133  1.00 29.60 ? 310 VAL A CB    1 
ATOM   2391 C  CG1   . VAL A 1 313 ? 26.819 -32.384 -0.075  1.00 24.30 ? 310 VAL A CG1   1 
ATOM   2392 C  CG2   . VAL A 1 313 ? 28.151 -30.591 1.096   1.00 27.09 ? 310 VAL A CG2   1 
ATOM   2393 N  N     . LYS A 1 314 ? 29.497 -34.422 -1.491  1.00 25.16 ? 311 LYS A N     1 
ATOM   2394 C  CA    . LYS A 1 314 ? 29.495 -35.293 -2.661  1.00 24.54 ? 311 LYS A CA    1 
ATOM   2395 C  C     . LYS A 1 314 ? 28.088 -35.587 -3.161  1.00 30.53 ? 311 LYS A C     1 
ATOM   2396 O  O     . LYS A 1 314 ? 27.195 -35.924 -2.382  1.00 32.55 ? 311 LYS A O     1 
ATOM   2397 C  CB    . LYS A 1 314 ? 30.197 -36.611 -2.350  1.00 28.58 ? 311 LYS A CB    1 
ATOM   2398 C  CG    . LYS A 1 314 ? 31.682 -36.488 -2.084  1.00 29.73 ? 311 LYS A CG    1 
ATOM   2399 C  CD    . LYS A 1 314 ? 32.219 -37.682 -1.333  1.00 39.42 ? 311 LYS A CD    1 
ATOM   2400 C  CE    . LYS A 1 314 ? 33.644 -37.412 -0.860  1.00 44.48 ? 311 LYS A CE    1 
ATOM   2401 N  NZ    . LYS A 1 314 ? 33.773 -36.047 -0.256  1.00 37.58 ? 311 LYS A NZ    1 
ATOM   2402 N  N     . PRO A 1 315 ? 27.872 -35.447 -4.469  1.00 28.35 ? 312 PRO A N     1 
ATOM   2403 C  CA    . PRO A 1 315 ? 26.577 -35.829 -5.036  1.00 30.20 ? 312 PRO A CA    1 
ATOM   2404 C  C     . PRO A 1 315 ? 26.409 -37.340 -5.067  1.00 30.99 ? 312 PRO A C     1 
ATOM   2405 O  O     . PRO A 1 315 ? 26.895 -37.987 -5.993  1.00 36.43 ? 312 PRO A O     1 
ATOM   2406 C  CB    . PRO A 1 315 ? 26.636 -35.251 -6.451  1.00 29.29 ? 312 PRO A CB    1 
ATOM   2407 C  CG    . PRO A 1 315 ? 28.064 -35.180 -6.759  1.00 29.63 ? 312 PRO A CG    1 
ATOM   2408 C  CD    . PRO A 1 315 ? 28.757 -34.845 -5.475  1.00 27.43 ? 312 PRO A CD    1 
ATOM   2409 N  N     . ARG A 1 316 ? 25.729 -37.889 -4.070  1.00 31.99 ? 313 ARG A N     1 
ATOM   2410 C  CA    . ARG A 1 316 ? 25.616 -39.334 -3.911  1.00 31.17 ? 313 ARG A CA    1 
ATOM   2411 C  C     . ARG A 1 316 ? 24.505 -39.661 -2.924  1.00 31.64 ? 313 ARG A C     1 
ATOM   2412 O  O     . ARG A 1 316 ? 24.688 -39.581 -1.710  1.00 32.14 ? 313 ARG A O     1 
ATOM   2413 C  CB    . ARG A 1 316 ? 26.938 -39.914 -3.426  1.00 32.94 ? 313 ARG A CB    1 
ATOM   2414 C  CG    . ARG A 1 316 ? 27.098 -41.413 -3.580  1.00 36.00 ? 313 ARG A CG    1 
ATOM   2415 C  CD    . ARG A 1 316 ? 28.286 -41.862 -2.749  1.00 34.77 ? 313 ARG A CD    1 
ATOM   2416 N  NE    . ARG A 1 316 ? 27.998 -41.662 -1.330  1.00 44.72 ? 313 ARG A NE    1 
ATOM   2417 C  CZ    . ARG A 1 316 ? 28.797 -41.039 -0.463  1.00 47.02 ? 313 ARG A CZ    1 
ATOM   2418 N  NH1   . ARG A 1 316 ? 28.423 -40.919 0.822   1.00 38.56 ? 313 ARG A NH1   1 
ATOM   2419 N  NH2   . ARG A 1 316 ? 29.965 -40.541 -0.872  1.00 42.48 ? 313 ARG A NH2   1 
ATOM   2420 N  N     . GLN A 1 317 ? 23.351 -40.024 -3.453  1.00 33.14 ? 314 GLN A N     1 
ATOM   2421 C  CA    . GLN A 1 317 ? 22.162 -40.268 -2.646  1.00 33.78 ? 314 GLN A CA    1 
ATOM   2422 C  C     . GLN A 1 317 ? 21.979 -41.753 -2.344  1.00 34.71 ? 314 GLN A C     1 
ATOM   2423 O  O     . GLN A 1 317 ? 21.156 -42.145 -1.516  1.00 38.79 ? 314 GLN A O     1 
ATOM   2424 C  CB    . GLN A 1 317 ? 20.946 -39.713 -3.379  1.00 37.32 ? 314 GLN A CB    1 
ATOM   2425 C  CG    . GLN A 1 317 ? 19.628 -39.919 -2.693  1.00 38.89 ? 314 GLN A CG    1 
ATOM   2426 C  CD    . GLN A 1 317 ? 18.540 -39.131 -3.367  1.00 43.03 ? 314 GLN A CD    1 
ATOM   2427 O  OE1   . GLN A 1 317 ? 18.820 -38.130 -4.041  1.00 46.40 ? 314 GLN A OE1   1 
ATOM   2428 N  NE2   . GLN A 1 317 ? 17.289 -39.574 -3.206  1.00 37.80 ? 314 GLN A NE2   1 
ATOM   2429 N  N     . LEU A 1 318 ? 22.773 -42.569 -3.021  1.00 32.27 ? 315 LEU A N     1 
ATOM   2430 C  CA    . LEU A 1 318 ? 22.739 -44.007 -2.868  1.00 35.06 ? 315 LEU A CA    1 
ATOM   2431 C  C     . LEU A 1 318 ? 24.015 -44.544 -2.196  1.00 35.13 ? 315 LEU A C     1 
ATOM   2432 O  O     . LEU A 1 318 ? 25.104 -44.003 -2.385  1.00 33.23 ? 315 LEU A O     1 
ATOM   2433 C  CB    . LEU A 1 318 ? 22.563 -44.675 -4.235  1.00 37.24 ? 315 LEU A CB    1 
ATOM   2434 C  CG    . LEU A 1 318 ? 21.406 -44.275 -5.158  1.00 36.15 ? 315 LEU A CG    1 
ATOM   2435 C  CD1   . LEU A 1 318 ? 21.522 -45.042 -6.446  1.00 27.17 ? 315 LEU A CD1   1 
ATOM   2436 C  CD2   . LEU A 1 318 ? 20.064 -44.542 -4.514  1.00 33.37 ? 315 LEU A CD2   1 
ATOM   2437 N  N     . PRO A 1 319 ? 23.879 -45.623 -1.418  1.00 33.36 ? 316 PRO A N     1 
ATOM   2438 C  CA    . PRO A 1 319 ? 25.052 -46.333 -0.891  1.00 36.40 ? 316 PRO A CA    1 
ATOM   2439 C  C     . PRO A 1 319 ? 25.993 -46.854 -2.004  1.00 38.19 ? 316 PRO A C     1 
ATOM   2440 O  O     . PRO A 1 319 ? 25.545 -47.088 -3.127  1.00 34.36 ? 316 PRO A O     1 
ATOM   2441 C  CB    . PRO A 1 319 ? 24.427 -47.496 -0.108  1.00 32.17 ? 316 PRO A CB    1 
ATOM   2442 C  CG    . PRO A 1 319 ? 23.048 -47.026 0.233   1.00 31.03 ? 316 PRO A CG    1 
ATOM   2443 C  CD    . PRO A 1 319 ? 22.611 -46.182 -0.912  1.00 29.48 ? 316 PRO A CD    1 
ATOM   2444 N  N     . LYS A 1 320 ? 27.277 -47.034 -1.680  1.00 39.15 ? 317 LYS A N     1 
ATOM   2445 C  CA    . LYS A 1 320 ? 28.275 -47.503 -2.642  1.00 35.61 ? 317 LYS A CA    1 
ATOM   2446 C  C     . LYS A 1 320 ? 28.481 -48.999 -2.539  1.00 35.10 ? 317 LYS A C     1 
ATOM   2447 O  O     . LYS A 1 320 ? 29.107 -49.607 -3.401  1.00 33.22 ? 317 LYS A O     1 
ATOM   2448 C  CB    . LYS A 1 320 ? 29.622 -46.809 -2.419  1.00 37.50 ? 317 LYS A CB    1 
ATOM   2449 C  CG    . LYS A 1 320 ? 29.505 -45.327 -2.167  1.00 42.48 ? 317 LYS A CG    1 
ATOM   2450 C  CD    . LYS A 1 320 ? 30.815 -44.739 -1.673  1.00 43.91 ? 317 LYS A CD    1 
ATOM   2451 C  CE    . LYS A 1 320 ? 31.774 -44.439 -2.806  1.00 40.61 ? 317 LYS A CE    1 
ATOM   2452 N  NZ    . LYS A 1 320 ? 32.702 -43.369 -2.359  1.00 44.66 ? 317 LYS A NZ    1 
ATOM   2453 N  N     . THR A 1 321 ? 27.986 -49.573 -1.448  1.00 34.84 ? 318 THR A N     1 
ATOM   2454 C  CA    . THR A 1 321 ? 28.079 -51.005 -1.194  1.00 33.38 ? 318 THR A CA    1 
ATOM   2455 C  C     . THR A 1 321 ? 26.762 -51.474 -0.589  1.00 35.64 ? 318 THR A C     1 
ATOM   2456 O  O     . THR A 1 321 ? 26.029 -50.684 0.004   1.00 40.33 ? 318 THR A O     1 
ATOM   2457 C  CB    . THR A 1 321 ? 29.276 -51.372 -0.253  1.00 32.72 ? 318 THR A CB    1 
ATOM   2458 O  OG1   . THR A 1 321 ? 29.192 -50.661 0.992   1.00 35.27 ? 318 THR A OG1   1 
ATOM   2459 C  CG2   . THR A 1 321 ? 30.595 -51.048 -0.911  1.00 33.09 ? 318 THR A CG2   1 
ATOM   2460 N  N     . ILE A 1 322 ? 26.444 -52.749 -0.768  1.00 35.77 ? 319 ILE A N     1 
ATOM   2461 C  CA    . ILE A 1 322 ? 25.242 -53.330 -0.178  1.00 34.90 ? 319 ILE A CA    1 
ATOM   2462 C  C     . ILE A 1 322 ? 25.647 -54.583 0.604   1.00 35.20 ? 319 ILE A C     1 
ATOM   2463 O  O     . ILE A 1 322 ? 26.123 -55.551 0.022   1.00 34.38 ? 319 ILE A O     1 
ATOM   2464 C  CB    . ILE A 1 322 ? 24.194 -53.657 -1.248  1.00 32.50 ? 319 ILE A CB    1 
ATOM   2465 C  CG1   . ILE A 1 322 ? 23.626 -52.359 -1.835  1.00 37.93 ? 319 ILE A CG1   1 
ATOM   2466 C  CG2   . ILE A 1 322 ? 23.069 -54.481 -0.667  1.00 28.57 ? 319 ILE A CG2   1 
ATOM   2467 C  CD1   . ILE A 1 322 ? 22.467 -52.565 -2.811  1.00 27.10 ? 319 ILE A CD1   1 
ATOM   2468 N  N     . GLY A 1 323 ? 25.476 -54.550 1.923   1.00 36.17 ? 320 GLY A N     1 
ATOM   2469 C  CA    . GLY A 1 323 ? 26.111 -55.532 2.787   1.00 32.34 ? 320 GLY A CA    1 
ATOM   2470 C  C     . GLY A 1 323 ? 25.217 -56.289 3.744   1.00 34.80 ? 320 GLY A C     1 
ATOM   2471 O  O     . GLY A 1 323 ? 24.135 -55.834 4.108   1.00 36.15 ? 320 GLY A O     1 
ATOM   2472 N  N     . CYS A 1 324 ? 25.702 -57.457 4.158   1.00 35.25 ? 321 CYS A N     1 
ATOM   2473 C  CA    . CYS A 1 324 ? 24.965 -58.400 4.988   1.00 32.49 ? 321 CYS A CA    1 
ATOM   2474 C  C     . CYS A 1 324 ? 25.866 -59.001 6.025   1.00 33.17 ? 321 CYS A C     1 
ATOM   2475 O  O     . CYS A 1 324 ? 26.818 -59.671 5.659   1.00 33.73 ? 321 CYS A O     1 
ATOM   2476 C  CB    . CYS A 1 324 ? 24.399 -59.538 4.145   1.00 32.07 ? 321 CYS A CB    1 
ATOM   2477 S  SG    . CYS A 1 324 ? 22.706 -59.336 3.791   1.00 47.94 ? 321 CYS A SG    1 
ATOM   2478 N  N     . SER A 1 325 ? 25.579 -58.805 7.307   1.00 32.33 ? 322 SER A N     1 
ATOM   2479 C  CA    . SER A 1 325 ? 26.394 -59.473 8.301   1.00 32.32 ? 322 SER A CA    1 
ATOM   2480 C  C     . SER A 1 325 ? 25.596 -59.965 9.485   1.00 31.26 ? 322 SER A C     1 
ATOM   2481 O  O     . SER A 1 325 ? 24.511 -59.467 9.795   1.00 31.48 ? 322 SER A O     1 
ATOM   2482 C  CB    . SER A 1 325 ? 27.523 -58.562 8.787   1.00 33.98 ? 322 SER A CB    1 
ATOM   2483 O  OG    . SER A 1 325 ? 27.029 -57.433 9.470   1.00 38.94 ? 322 SER A OG    1 
ATOM   2484 N  N     . LYS A 1 326 ? 26.159 -60.966 10.142  1.00 35.54 ? 323 LYS A N     1 
ATOM   2485 C  CA    . LYS A 1 326 ? 25.623 -61.450 11.399  1.00 35.33 ? 323 LYS A CA    1 
ATOM   2486 C  C     . LYS A 1 326 ? 26.761 -61.921 12.289  1.00 32.24 ? 323 LYS A C     1 
ATOM   2487 O  O     . LYS A 1 326 ? 27.690 -62.595 11.844  1.00 27.73 ? 323 LYS A O     1 
ATOM   2488 C  CB    . LYS A 1 326 ? 24.610 -62.580 11.172  1.00 31.55 ? 323 LYS A CB    1 
ATOM   2489 C  CG    . LYS A 1 326 ? 24.143 -63.220 12.469  1.00 31.57 ? 323 LYS A CG    1 
ATOM   2490 C  CD    . LYS A 1 326 ? 22.880 -64.019 12.283  1.00 30.06 ? 323 LYS A CD    1 
ATOM   2491 C  CE    . LYS A 1 326 ? 22.454 -64.646 13.602  1.00 31.79 ? 323 LYS A CE    1 
ATOM   2492 N  NZ    . LYS A 1 326 ? 22.350 -63.608 14.657  1.00 33.07 ? 323 LYS A NZ    1 
ATOM   2493 N  N     . ASN A 1 327 ? 26.691 -61.531 13.551  1.00 34.49 ? 324 ASN A N     1 
ATOM   2494 C  CA    . ASN A 1 327 ? 27.618 -62.035 14.536  1.00 35.02 ? 324 ASN A CA    1 
ATOM   2495 C  C     . ASN A 1 327 ? 27.122 -63.333 15.122  1.00 33.62 ? 324 ASN A C     1 
ATOM   2496 O  O     . ASN A 1 327 ? 25.927 -63.511 15.313  1.00 34.66 ? 324 ASN A O     1 
ATOM   2497 C  CB    . ASN A 1 327 ? 27.846 -61.012 15.638  1.00 33.01 ? 324 ASN A CB    1 
ATOM   2498 C  CG    . ASN A 1 327 ? 28.673 -59.849 15.166  1.00 40.42 ? 324 ASN A CG    1 
ATOM   2499 O  OD1   . ASN A 1 327 ? 29.384 -59.950 14.170  1.00 36.04 ? 324 ASN A OD1   1 
ATOM   2500 N  ND2   . ASN A 1 327 ? 28.589 -58.734 15.874  1.00 43.98 ? 324 ASN A ND2   1 
ATOM   2501 N  N     . PHE A 1 328 ? 28.065 -64.232 15.383  1.00 31.59 ? 325 PHE A N     1 
ATOM   2502 C  CA    . PHE A 1 328 ? 27.803 -65.521 16.003  1.00 35.77 ? 325 PHE A CA    1 
ATOM   2503 C  C     . PHE A 1 328 ? 28.592 -65.624 17.301  1.00 38.04 ? 325 PHE A C     1 
ATOM   2504 O  O     . PHE A 1 328 ? 29.589 -66.338 17.365  1.00 36.78 ? 325 PHE A O     1 
ATOM   2505 C  CB    . PHE A 1 328 ? 28.186 -66.644 15.048  1.00 36.44 ? 325 PHE A CB    1 
ATOM   2506 C  CG    . PHE A 1 328 ? 27.469 -66.577 13.744  1.00 28.62 ? 325 PHE A CG    1 
ATOM   2507 C  CD1   . PHE A 1 328 ? 26.214 -67.141 13.608  1.00 29.16 ? 325 PHE A CD1   1 
ATOM   2508 C  CD2   . PHE A 1 328 ? 28.033 -65.928 12.666  1.00 29.03 ? 325 PHE A CD2   1 
ATOM   2509 C  CE1   . PHE A 1 328 ? 25.534 -67.070 12.403  1.00 31.60 ? 325 PHE A CE1   1 
ATOM   2510 C  CE2   . PHE A 1 328 ? 27.366 -65.852 11.462  1.00 27.96 ? 325 PHE A CE2   1 
ATOM   2511 C  CZ    . PHE A 1 328 ? 26.112 -66.424 11.331  1.00 29.56 ? 325 PHE A CZ    1 
ATOM   2512 N  N     . PRO A 1 329 ? 28.146 -64.889 18.331  1.00 42.55 ? 326 PRO A N     1 
ATOM   2513 C  CA    . PRO A 1 329 ? 28.911 -64.663 19.566  1.00 43.15 ? 326 PRO A CA    1 
ATOM   2514 C  C     . PRO A 1 329 ? 29.169 -65.919 20.387  1.00 45.03 ? 326 PRO A C     1 
ATOM   2515 O  O     . PRO A 1 329 ? 28.355 -66.847 20.406  1.00 41.42 ? 326 PRO A O     1 
ATOM   2516 C  CB    . PRO A 1 329 ? 28.023 -63.691 20.355  1.00 44.89 ? 326 PRO A CB    1 
ATOM   2517 C  CG    . PRO A 1 329 ? 26.632 -63.982 19.871  1.00 44.59 ? 326 PRO A CG    1 
ATOM   2518 C  CD    . PRO A 1 329 ? 26.806 -64.271 18.397  1.00 40.18 ? 326 PRO A CD    1 
ATOM   2519 N  N     . GLY A 1 330 ? 30.323 -65.915 21.052  1.00 50.51 ? 327 GLY A N     1 
ATOM   2520 C  CA    . GLY A 1 330 ? 30.735 -66.948 21.983  1.00 48.01 ? 327 GLY A CA    1 
ATOM   2521 C  C     . GLY A 1 330 ? 30.436 -68.380 21.589  1.00 51.47 ? 327 GLY A C     1 
ATOM   2522 O  O     . GLY A 1 330 ? 31.126 -68.970 20.753  1.00 48.91 ? 327 GLY A O     1 
ATOM   2523 N  N     . LYS A 1 331 ? 29.387 -68.920 22.208  1.00 55.18 ? 328 LYS A N     1 
ATOM   2524 C  CA    . LYS A 1 331 ? 29.014 -70.323 22.091  1.00 53.55 ? 328 LYS A CA    1 
ATOM   2525 C  C     . LYS A 1 331 ? 28.205 -70.647 20.842  1.00 48.71 ? 328 LYS A C     1 
ATOM   2526 O  O     . LYS A 1 331 ? 28.198 -71.791 20.397  1.00 50.69 ? 328 LYS A O     1 
ATOM   2527 C  CB    . LYS A 1 331 ? 28.244 -70.757 23.343  1.00 55.44 ? 328 LYS A CB    1 
ATOM   2528 C  CG    . LYS A 1 331 ? 29.144 -71.147 24.507  1.00 57.49 ? 328 LYS A CG    1 
ATOM   2529 C  CD    . LYS A 1 331 ? 29.406 -70.000 25.488  1.00 66.87 ? 328 LYS A CD    1 
ATOM   2530 C  CE    . LYS A 1 331 ? 30.175 -70.530 26.705  1.00 72.57 ? 328 LYS A CE    1 
ATOM   2531 N  NZ    . LYS A 1 331 ? 29.978 -69.732 27.943  1.00 68.75 ? 328 LYS A NZ    1 
ATOM   2532 N  N     . THR A 1 332 ? 27.551 -69.654 20.252  1.00 51.12 ? 329 THR A N     1 
ATOM   2533 C  CA    . THR A 1 332 ? 26.852 -69.884 18.986  1.00 47.46 ? 329 THR A CA    1 
ATOM   2534 C  C     . THR A 1 332 ? 27.793 -69.830 17.788  1.00 43.17 ? 329 THR A C     1 
ATOM   2535 O  O     . THR A 1 332 ? 27.345 -69.856 16.649  1.00 43.16 ? 329 THR A O     1 
ATOM   2536 C  CB    . THR A 1 332 ? 25.738 -68.860 18.751  1.00 46.06 ? 329 THR A CB    1 
ATOM   2537 O  OG1   . THR A 1 332 ? 26.255 -67.540 18.967  1.00 42.47 ? 329 THR A OG1   1 
ATOM   2538 C  CG2   . THR A 1 332 ? 24.559 -69.121 19.688  1.00 45.99 ? 329 THR A CG2   1 
ATOM   2539 N  N     . ALA A 1 333 ? 29.091 -69.736 18.047  1.00 40.87 ? 330 ALA A N     1 
ATOM   2540 C  CA    . ALA A 1 333 ? 30.066 -69.693 16.972  1.00 38.12 ? 330 ALA A CA    1 
ATOM   2541 C  C     . ALA A 1 333 ? 29.919 -70.908 16.064  1.00 42.20 ? 330 ALA A C     1 
ATOM   2542 O  O     . ALA A 1 333 ? 29.693 -72.028 16.530  1.00 45.58 ? 330 ALA A O     1 
ATOM   2543 C  CB    . ALA A 1 333 ? 31.458 -69.603 17.535  1.00 38.36 ? 330 ALA A CB    1 
ATOM   2544 N  N     . LEU A 1 334 ? 30.019 -70.671 14.761  1.00 44.92 ? 331 LEU A N     1 
ATOM   2545 C  CA    . LEU A 1 334 ? 29.764 -71.708 13.764  1.00 42.49 ? 331 LEU A CA    1 
ATOM   2546 C  C     . LEU A 1 334 ? 30.937 -72.660 13.694  1.00 45.54 ? 331 LEU A C     1 
ATOM   2547 O  O     . LEU A 1 334 ? 32.046 -72.255 13.348  1.00 45.49 ? 331 LEU A O     1 
ATOM   2548 C  CB    . LEU A 1 334 ? 29.510 -71.095 12.394  1.00 40.58 ? 331 LEU A CB    1 
ATOM   2549 C  CG    . LEU A 1 334 ? 28.497 -69.963 12.361  1.00 36.14 ? 331 LEU A CG    1 
ATOM   2550 C  CD1   . LEU A 1 334 ? 28.115 -69.676 10.908  1.00 31.67 ? 331 LEU A CD1   1 
ATOM   2551 C  CD2   . LEU A 1 334 ? 27.290 -70.329 13.203  1.00 34.42 ? 331 LEU A CD2   1 
ATOM   2552 N  N     . ALA A 1 335 ? 30.683 -73.927 14.006  1.00 45.84 ? 332 ALA A N     1 
ATOM   2553 C  CA    . ALA A 1 335 ? 31.759 -74.865 14.275  1.00 45.40 ? 332 ALA A CA    1 
ATOM   2554 C  C     . ALA A 1 335 ? 31.718 -76.082 13.358  1.00 47.05 ? 332 ALA A C     1 
ATOM   2555 O  O     . ALA A 1 335 ? 32.576 -76.961 13.436  1.00 46.24 ? 332 ALA A O     1 
ATOM   2556 C  CB    . ALA A 1 335 ? 31.703 -75.290 15.730  1.00 47.45 ? 332 ALA A CB    1 
ATOM   2557 N  N     . THR A 1 336 ? 30.712 -76.129 12.493  1.00 44.66 ? 333 THR A N     1 
ATOM   2558 C  CA    . THR A 1 336 ? 30.599 -77.194 11.507  1.00 45.02 ? 333 THR A CA    1 
ATOM   2559 C  C     . THR A 1 336 ? 30.558 -76.596 10.113  1.00 50.14 ? 333 THR A C     1 
ATOM   2560 O  O     . THR A 1 336 ? 30.178 -75.433 9.946   1.00 46.70 ? 333 THR A O     1 
ATOM   2561 C  CB    . THR A 1 336 ? 29.345 -78.032 11.711  1.00 44.60 ? 333 THR A CB    1 
ATOM   2562 O  OG1   . THR A 1 336 ? 28.199 -77.255 11.349  1.00 46.89 ? 333 THR A OG1   1 
ATOM   2563 C  CG2   . THR A 1 336 ? 29.225 -78.477 13.154  1.00 45.34 ? 333 THR A CG2   1 
ATOM   2564 N  N     . ARG A 1 337 ? 30.931 -77.386 9.111   1.00 47.54 ? 334 ARG A N     1 
ATOM   2565 C  CA    . ARG A 1 337 ? 30.918 -76.895 7.744   1.00 49.22 ? 334 ARG A CA    1 
ATOM   2566 C  C     . ARG A 1 337 ? 29.473 -76.671 7.302   1.00 49.41 ? 334 ARG A C     1 
ATOM   2567 O  O     . ARG A 1 337 ? 29.186 -75.746 6.540   1.00 48.16 ? 334 ARG A O     1 
ATOM   2568 C  CB    . ARG A 1 337 ? 31.635 -77.868 6.803   1.00 51.89 ? 334 ARG A CB    1 
ATOM   2569 C  CG    . ARG A 1 337 ? 30.701 -78.755 5.995   1.00 60.17 ? 334 ARG A CG    1 
ATOM   2570 C  CD    . ARG A 1 337 ? 31.319 -80.101 5.666   1.00 68.55 ? 334 ARG A CD    1 
ATOM   2571 N  NE    . ARG A 1 337 ? 30.320 -81.028 5.140   1.00 73.53 ? 334 ARG A NE    1 
ATOM   2572 C  CZ    . ARG A 1 337 ? 30.610 -82.124 4.446   1.00 79.84 ? 334 ARG A CZ    1 
ATOM   2573 N  NH1   . ARG A 1 337 ? 31.878 -82.429 4.193   1.00 75.47 ? 334 ARG A NH1   1 
ATOM   2574 N  NH2   . ARG A 1 337 ? 29.634 -82.914 4.002   1.00 73.93 ? 334 ARG A NH2   1 
ATOM   2575 N  N     . GLU A 1 338 ? 28.561 -77.500 7.805   1.00 48.11 ? 335 GLU A N     1 
ATOM   2576 C  CA    . GLU A 1 338 ? 27.160 -77.409 7.403   1.00 52.69 ? 335 GLU A CA    1 
ATOM   2577 C  C     . GLU A 1 338 ? 26.535 -76.107 7.907   1.00 46.61 ? 335 GLU A C     1 
ATOM   2578 O  O     . GLU A 1 338 ? 25.659 -75.532 7.268   1.00 47.59 ? 335 GLU A O     1 
ATOM   2579 C  CB    . GLU A 1 338 ? 26.374 -78.609 7.926   1.00 53.29 ? 335 GLU A CB    1 
ATOM   2580 C  CG    . GLU A 1 338 ? 25.029 -78.801 7.259   1.00 56.02 ? 335 GLU A CG    1 
ATOM   2581 C  CD    . GLU A 1 338 ? 25.157 -79.153 5.791   1.00 61.48 ? 335 GLU A CD    1 
ATOM   2582 O  OE1   . GLU A 1 338 ? 25.979 -80.033 5.459   1.00 64.54 ? 335 GLU A OE1   1 
ATOM   2583 O  OE2   . GLU A 1 338 ? 24.436 -78.549 4.968   1.00 66.08 ? 335 GLU A OE2   1 
ATOM   2584 N  N     . GLN A 1 339 ? 26.997 -75.657 9.064   1.00 44.93 ? 336 GLN A N     1 
ATOM   2585 C  CA    . GLN A 1 339 ? 26.542 -74.402 9.639   1.00 45.77 ? 336 GLN A CA    1 
ATOM   2586 C  C     . GLN A 1 339 ? 26.991 -73.209 8.827   1.00 40.00 ? 336 GLN A C     1 
ATOM   2587 O  O     . GLN A 1 339 ? 26.219 -72.283 8.603   1.00 40.96 ? 336 GLN A O     1 
ATOM   2588 C  CB    . GLN A 1 339 ? 27.063 -74.235 11.060  1.00 44.58 ? 336 GLN A CB    1 
ATOM   2589 C  CG    . GLN A 1 339 ? 26.158 -74.743 12.147  1.00 42.32 ? 336 GLN A CG    1 
ATOM   2590 C  CD    . GLN A 1 339 ? 26.650 -74.312 13.497  1.00 42.12 ? 336 GLN A CD    1 
ATOM   2591 O  OE1   . GLN A 1 339 ? 27.835 -74.461 13.812  1.00 43.10 ? 336 GLN A OE1   1 
ATOM   2592 N  NE2   . GLN A 1 339 ? 25.756 -73.743 14.298  1.00 40.90 ? 336 GLN A NE2   1 
ATOM   2593 N  N     . VAL A 1 340 ? 28.253 -73.223 8.418   1.00 40.25 ? 337 VAL A N     1 
ATOM   2594 C  CA    . VAL A 1 340 ? 28.819 -72.089 7.718   1.00 40.91 ? 337 VAL A CA    1 
ATOM   2595 C  C     . VAL A 1 340 ? 28.119 -71.931 6.367   1.00 40.22 ? 337 VAL A C     1 
ATOM   2596 O  O     . VAL A 1 340 ? 27.793 -70.826 5.952   1.00 38.04 ? 337 VAL A O     1 
ATOM   2597 C  CB    . VAL A 1 340 ? 30.334 -72.241 7.536   1.00 38.13 ? 337 VAL A CB    1 
ATOM   2598 C  CG1   . VAL A 1 340 ? 30.905 -71.032 6.842   1.00 35.18 ? 337 VAL A CG1   1 
ATOM   2599 C  CG2   . VAL A 1 340 ? 31.008 -72.428 8.889   1.00 37.92 ? 337 VAL A CG2   1 
ATOM   2600 N  N     . GLN A 1 341 ? 27.856 -73.047 5.701   1.00 40.32 ? 338 GLN A N     1 
ATOM   2601 C  CA    . GLN A 1 341 ? 27.210 -72.997 4.406   1.00 40.72 ? 338 GLN A CA    1 
ATOM   2602 C  C     . GLN A 1 341 ? 25.766 -72.562 4.531   1.00 37.06 ? 338 GLN A C     1 
ATOM   2603 O  O     . GLN A 1 341 ? 25.255 -71.846 3.676   1.00 37.67 ? 338 GLN A O     1 
ATOM   2604 C  CB    . GLN A 1 341 ? 27.303 -74.354 3.706   1.00 44.92 ? 338 GLN A CB    1 
ATOM   2605 C  CG    . GLN A 1 341 ? 28.616 -74.530 2.955   1.00 47.45 ? 338 GLN A CG    1 
ATOM   2606 C  CD    . GLN A 1 341 ? 28.970 -75.980 2.701   1.00 51.79 ? 338 GLN A CD    1 
ATOM   2607 O  OE1   . GLN A 1 341 ? 28.099 -76.840 2.577   1.00 51.12 ? 338 GLN A OE1   1 
ATOM   2608 N  NE2   . GLN A 1 341 ? 30.262 -76.257 2.620   1.00 55.69 ? 338 GLN A NE2   1 
ATOM   2609 N  N     . TRP A 1 342 ? 25.102 -72.972 5.601   1.00 35.79 ? 339 TRP A N     1 
ATOM   2610 C  CA    . TRP A 1 342 ? 23.702 -72.613 5.732   1.00 37.38 ? 339 TRP A CA    1 
ATOM   2611 C  C     . TRP A 1 342 ? 23.536 -71.113 5.993   1.00 33.29 ? 339 TRP A C     1 
ATOM   2612 O  O     . TRP A 1 342 ? 22.578 -70.497 5.519   1.00 32.07 ? 339 TRP A O     1 
ATOM   2613 C  CB    . TRP A 1 342 ? 23.035 -73.430 6.838   1.00 36.92 ? 339 TRP A CB    1 
ATOM   2614 C  CG    . TRP A 1 342 ? 21.544 -73.229 6.885   1.00 35.50 ? 339 TRP A CG    1 
ATOM   2615 C  CD1   . TRP A 1 342 ? 20.608 -73.873 6.133   1.00 34.32 ? 339 TRP A CD1   1 
ATOM   2616 C  CD2   . TRP A 1 342 ? 20.824 -72.323 7.731   1.00 33.12 ? 339 TRP A CD2   1 
ATOM   2617 N  NE1   . TRP A 1 342 ? 19.354 -73.433 6.459   1.00 30.24 ? 339 TRP A NE1   1 
ATOM   2618 C  CE2   . TRP A 1 342 ? 19.456 -72.480 7.437   1.00 31.16 ? 339 TRP A CE2   1 
ATOM   2619 C  CE3   . TRP A 1 342 ? 21.206 -71.391 8.706   1.00 35.37 ? 339 TRP A CE3   1 
ATOM   2620 C  CZ2   . TRP A 1 342 ? 18.461 -71.731 8.073   1.00 32.65 ? 339 TRP A CZ2   1 
ATOM   2621 C  CZ3   . TRP A 1 342 ? 20.217 -70.653 9.346   1.00 33.95 ? 339 TRP A CZ3   1 
ATOM   2622 C  CH2   . TRP A 1 342 ? 18.859 -70.827 9.018   1.00 33.92 ? 339 TRP A CH2   1 
ATOM   2623 N  N     . TRP A 1 343 ? 24.474 -70.524 6.730   1.00 32.18 ? 340 TRP A N     1 
ATOM   2624 C  CA    . TRP A 1 343 ? 24.385 -69.096 7.046   1.00 33.00 ? 340 TRP A CA    1 
ATOM   2625 C  C     . TRP A 1 343 ? 24.843 -68.225 5.888   1.00 32.75 ? 340 TRP A C     1 
ATOM   2626 O  O     . TRP A 1 343 ? 24.230 -67.189 5.636   1.00 32.59 ? 340 TRP A O     1 
ATOM   2627 C  CB    . TRP A 1 343 ? 25.184 -68.752 8.307   1.00 29.20 ? 340 TRP A CB    1 
ATOM   2628 C  CG    . TRP A 1 343 ? 24.443 -69.108 9.549   1.00 33.02 ? 340 TRP A CG    1 
ATOM   2629 C  CD1   . TRP A 1 343 ? 24.702 -70.149 10.395  1.00 33.66 ? 340 TRP A CD1   1 
ATOM   2630 C  CD2   . TRP A 1 343 ? 23.292 -68.441 10.075  1.00 33.25 ? 340 TRP A CD2   1 
ATOM   2631 N  NE1   . TRP A 1 343 ? 23.799 -70.154 11.429  1.00 33.20 ? 340 TRP A NE1   1 
ATOM   2632 C  CE2   . TRP A 1 343 ? 22.916 -69.119 11.251  1.00 34.38 ? 340 TRP A CE2   1 
ATOM   2633 C  CE3   . TRP A 1 343 ? 22.546 -67.328 9.669   1.00 31.61 ? 340 TRP A CE3   1 
ATOM   2634 C  CZ2   . TRP A 1 343 ? 21.833 -68.718 12.027  1.00 28.74 ? 340 TRP A CZ2   1 
ATOM   2635 C  CZ3   . TRP A 1 343 ? 21.477 -66.937 10.436  1.00 30.73 ? 340 TRP A CZ3   1 
ATOM   2636 C  CH2   . TRP A 1 343 ? 21.129 -67.630 11.604  1.00 31.14 ? 340 TRP A CH2   1 
ATOM   2637 N  N     . LEU A 1 344 ? 25.901 -68.635 5.181   1.00 28.73 ? 341 LEU A N     1 
ATOM   2638 C  CA    . LEU A 1 344 ? 26.308 -67.896 3.985   1.00 33.23 ? 341 LEU A CA    1 
ATOM   2639 C  C     . LEU A 1 344 ? 25.126 -67.861 3.023   1.00 31.02 ? 341 LEU A C     1 
ATOM   2640 O  O     . LEU A 1 344 ? 24.864 -66.847 2.376   1.00 33.29 ? 341 LEU A O     1 
ATOM   2641 C  CB    . LEU A 1 344 ? 27.543 -68.521 3.317   1.00 33.57 ? 341 LEU A CB    1 
ATOM   2642 C  CG    . LEU A 1 344 ? 28.891 -68.353 4.030   1.00 31.83 ? 341 LEU A CG    1 
ATOM   2643 C  CD1   . LEU A 1 344 ? 29.931 -69.361 3.539   1.00 37.11 ? 341 LEU A CD1   1 
ATOM   2644 C  CD2   . LEU A 1 344 ? 29.427 -66.938 3.901   1.00 30.05 ? 341 LEU A CD2   1 
ATOM   2645 N  N     . LEU A 1 345 ? 24.381 -68.958 2.964   1.00 28.68 ? 342 LEU A N     1 
ATOM   2646 C  CA    . LEU A 1 345 ? 23.182 -68.981 2.132   1.00 34.65 ? 342 LEU A CA    1 
ATOM   2647 C  C     . LEU A 1 345 ? 22.076 -68.051 2.665   1.00 32.48 ? 342 LEU A C     1 
ATOM   2648 O  O     . LEU A 1 345 ? 21.379 -67.406 1.879   1.00 32.31 ? 342 LEU A O     1 
ATOM   2649 C  CB    . LEU A 1 345 ? 22.647 -70.408 1.992   1.00 33.69 ? 342 LEU A CB    1 
ATOM   2650 C  CG    . LEU A 1 345 ? 21.421 -70.488 1.075   1.00 37.14 ? 342 LEU A CG    1 
ATOM   2651 C  CD1   . LEU A 1 345 ? 21.747 -69.878 -0.296  1.00 36.54 ? 342 LEU A CD1   1 
ATOM   2652 C  CD2   . LEU A 1 345 ? 20.879 -71.915 0.947   1.00 30.94 ? 342 LEU A CD2   1 
ATOM   2653 N  N     . GLN A 1 346 ? 21.908 -67.970 3.983   1.00 30.96 ? 343 GLN A N     1 
ATOM   2654 C  CA    . GLN A 1 346 ? 20.939 -67.014 4.521   1.00 31.64 ? 343 GLN A CA    1 
ATOM   2655 C  C     . GLN A 1 346 ? 21.339 -65.603 4.102   1.00 32.12 ? 343 GLN A C     1 
ATOM   2656 O  O     . GLN A 1 346 ? 20.513 -64.817 3.615   1.00 26.34 ? 343 GLN A O     1 
ATOM   2657 C  CB    . GLN A 1 346 ? 20.830 -67.094 6.047   1.00 29.10 ? 343 GLN A CB    1 
ATOM   2658 C  CG    . GLN A 1 346 ? 20.352 -68.429 6.615   1.00 31.59 ? 343 GLN A CG    1 
ATOM   2659 C  CD    . GLN A 1 346 ? 19.381 -69.161 5.707   1.00 33.46 ? 343 GLN A CD    1 
ATOM   2660 O  OE1   . GLN A 1 346 ? 18.225 -68.750 5.532   1.00 33.90 ? 343 GLN A OE1   1 
ATOM   2661 N  NE2   . GLN A 1 346 ? 19.840 -70.265 5.137   1.00 31.37 ? 343 GLN A NE2   1 
ATOM   2662 N  N     . LEU A 1 347 ? 22.621 -65.300 4.278   1.00 30.31 ? 344 LEU A N     1 
ATOM   2663 C  CA    . LEU A 1 347 ? 23.136 -63.984 3.933   1.00 32.58 ? 344 LEU A CA    1 
ATOM   2664 C  C     . LEU A 1 347 ? 23.014 -63.744 2.439   1.00 30.30 ? 344 LEU A C     1 
ATOM   2665 O  O     . LEU A 1 347 ? 22.507 -62.699 2.023   1.00 31.02 ? 344 LEU A O     1 
ATOM   2666 C  CB    . LEU A 1 347 ? 24.585 -63.827 4.390   1.00 26.60 ? 344 LEU A CB    1 
ATOM   2667 C  CG    . LEU A 1 347 ? 24.707 -63.816 5.921   1.00 34.34 ? 344 LEU A CG    1 
ATOM   2668 C  CD1   . LEU A 1 347 ? 26.150 -63.715 6.361   1.00 34.26 ? 344 LEU A CD1   1 
ATOM   2669 C  CD2   . LEU A 1 347 ? 23.914 -62.666 6.486   1.00 30.80 ? 344 LEU A CD2   1 
ATOM   2670 N  N     . ALA A 1 348 ? 23.451 -64.713 1.642   1.00 27.45 ? 345 ALA A N     1 
ATOM   2671 C  CA    . ALA A 1 348 ? 23.381 -64.578 0.191   1.00 29.30 ? 345 ALA A CA    1 
ATOM   2672 C  C     . ALA A 1 348 ? 21.953 -64.310 -0.264  1.00 32.11 ? 345 ALA A C     1 
ATOM   2673 O  O     . ALA A 1 348 ? 21.743 -63.501 -1.167  1.00 32.64 ? 345 ALA A O     1 
ATOM   2674 C  CB    . ALA A 1 348 ? 23.929 -65.811 -0.499  1.00 27.40 ? 345 ALA A CB    1 
ATOM   2675 N  N     . GLN A 1 349 ? 20.977 -64.964 0.370   1.00 30.11 ? 346 GLN A N     1 
ATOM   2676 C  CA    . GLN A 1 349 ? 19.569 -64.795 -0.023  1.00 32.44 ? 346 GLN A CA    1 
ATOM   2677 C  C     . GLN A 1 349 ? 19.021 -63.390 0.251   1.00 29.87 ? 346 GLN A C     1 
ATOM   2678 O  O     . GLN A 1 349 ? 18.274 -62.839 -0.546  1.00 29.00 ? 346 GLN A O     1 
ATOM   2679 C  CB    . GLN A 1 349 ? 18.684 -65.832 0.678   1.00 33.75 ? 346 GLN A CB    1 
ATOM   2680 C  CG    . GLN A 1 349 ? 18.627 -67.175 -0.037  1.00 35.25 ? 346 GLN A CG    1 
ATOM   2681 C  CD    . GLN A 1 349 ? 17.836 -68.224 0.733   1.00 39.69 ? 346 GLN A CD    1 
ATOM   2682 O  OE1   . GLN A 1 349 ? 17.391 -67.988 1.860   1.00 39.76 ? 346 GLN A OE1   1 
ATOM   2683 N  NE2   . GLN A 1 349 ? 17.665 -69.394 0.128   1.00 39.56 ? 346 GLN A NE2   1 
ATOM   2684 N  N     . GLU A 1 350 ? 19.374 -62.815 1.390   1.00 31.93 ? 347 GLU A N     1 
ATOM   2685 C  CA    . GLU A 1 350 ? 18.923 -61.471 1.687   1.00 32.28 ? 347 GLU A CA    1 
ATOM   2686 C  C     . GLU A 1 350 ? 19.600 -60.488 0.736   1.00 28.88 ? 347 GLU A C     1 
ATOM   2687 O  O     . GLU A 1 350 ? 18.992 -59.503 0.325   1.00 30.44 ? 347 GLU A O     1 
ATOM   2688 C  CB    . GLU A 1 350 ? 19.210 -61.084 3.144   1.00 24.11 ? 347 GLU A CB    1 
ATOM   2689 C  CG    . GLU A 1 350 ? 18.639 -59.701 3.505   1.00 32.32 ? 347 GLU A CG    1 
ATOM   2690 C  CD    . GLU A 1 350 ? 19.260 -59.089 4.757   1.00 33.91 ? 347 GLU A CD    1 
ATOM   2691 O  OE1   . GLU A 1 350 ? 19.155 -59.699 5.841   1.00 35.54 ? 347 GLU A OE1   1 
ATOM   2692 O  OE2   . GLU A 1 350 ? 19.856 -57.997 4.653   1.00 35.08 ? 347 GLU A OE2   1 
ATOM   2693 N  N     . LEU A 1 351 ? 20.858 -60.754 0.406   1.00 23.40 ? 348 LEU A N     1 
ATOM   2694 C  CA    . LEU A 1 351 ? 21.639 -59.821 -0.390  1.00 27.47 ? 348 LEU A CA    1 
ATOM   2695 C  C     . LEU A 1 351 ? 21.101 -59.823 -1.820  1.00 29.63 ? 348 LEU A C     1 
ATOM   2696 O  O     . LEU A 1 351 ? 21.027 -58.777 -2.473  1.00 25.51 ? 348 LEU A O     1 
ATOM   2697 C  CB    . LEU A 1 351 ? 23.128 -60.190 -0.335  1.00 29.43 ? 348 LEU A CB    1 
ATOM   2698 C  CG    . LEU A 1 351 ? 24.145 -59.287 -1.043  1.00 32.58 ? 348 LEU A CG    1 
ATOM   2699 C  CD1   . LEU A 1 351 ? 24.122 -57.871 -0.473  1.00 29.08 ? 348 LEU A CD1   1 
ATOM   2700 C  CD2   . LEU A 1 351 ? 25.541 -59.875 -0.977  1.00 29.41 ? 348 LEU A CD2   1 
ATOM   2701 N  N     . GLU A 1 352 ? 20.683 -61.005 -2.278  1.00 28.89 ? 349 GLU A N     1 
ATOM   2702 C  CA    . GLU A 1 352 ? 20.107 -61.163 -3.614  1.00 35.37 ? 349 GLU A CA    1 
ATOM   2703 C  C     . GLU A 1 352 ? 18.819 -60.379 -3.726  1.00 32.40 ? 349 GLU A C     1 
ATOM   2704 O  O     . GLU A 1 352 ? 18.563 -59.721 -4.734  1.00 26.53 ? 349 GLU A O     1 
ATOM   2705 C  CB    . GLU A 1 352 ? 19.839 -62.643 -3.948  1.00 33.26 ? 349 GLU A CB    1 
ATOM   2706 C  CG    . GLU A 1 352 ? 18.710 -62.823 -4.965  1.00 36.45 ? 349 GLU A CG    1 
ATOM   2707 C  CD    . GLU A 1 352 ? 18.547 -64.255 -5.471  1.00 50.54 ? 349 GLU A CD    1 
ATOM   2708 O  OE1   . GLU A 1 352 ? 17.774 -64.427 -6.444  1.00 49.71 ? 349 GLU A OE1   1 
ATOM   2709 O  OE2   . GLU A 1 352 ? 19.179 -65.199 -4.918  1.00 48.59 ? 349 GLU A OE2   1 
ATOM   2710 N  N     . GLU A 1 353 ? 18.000 -60.483 -2.684  1.00 32.60 ? 350 GLU A N     1 
ATOM   2711 C  CA    . GLU A 1 353 ? 16.741 -59.770 -2.636  1.00 34.68 ? 350 GLU A CA    1 
ATOM   2712 C  C     . GLU A 1 353 ? 17.020 -58.275 -2.797  1.00 32.78 ? 350 GLU A C     1 
ATOM   2713 O  O     . GLU A 1 353 ? 16.454 -57.609 -3.663  1.00 33.37 ? 350 GLU A O     1 
ATOM   2714 C  CB    . GLU A 1 353 ? 16.023 -60.062 -1.323  1.00 38.60 ? 350 GLU A CB    1 
ATOM   2715 C  CG    . GLU A 1 353 ? 14.522 -60.082 -1.410  1.00 47.01 ? 350 GLU A CG    1 
ATOM   2716 C  CD    . GLU A 1 353 ? 13.872 -60.694 -0.169  1.00 53.72 ? 350 GLU A CD    1 
ATOM   2717 O  OE1   . GLU A 1 353 ? 14.539 -61.491 0.521   1.00 45.86 ? 350 GLU A OE1   1 
ATOM   2718 O  OE2   . GLU A 1 353 ? 12.691 -60.387 0.111   1.00 60.96 ? 350 GLU A OE2   1 
ATOM   2719 N  N     . ARG A 1 354 ? 17.935 -57.771 -1.980  1.00 29.25 ? 351 ARG A N     1 
ATOM   2720 C  CA    . ARG A 1 354 ? 18.283 -56.359 -1.994  1.00 33.26 ? 351 ARG A CA    1 
ATOM   2721 C  C     . ARG A 1 354 ? 19.002 -55.907 -3.269  1.00 32.28 ? 351 ARG A C     1 
ATOM   2722 O  O     . ARG A 1 354 ? 18.802 -54.776 -3.707  1.00 35.18 ? 351 ARG A O     1 
ATOM   2723 C  CB    . ARG A 1 354 ? 19.137 -56.028 -0.767  1.00 30.46 ? 351 ARG A CB    1 
ATOM   2724 C  CG    . ARG A 1 354 ? 18.355 -56.136 0.534   1.00 29.88 ? 351 ARG A CG    1 
ATOM   2725 C  CD    . ARG A 1 354 ? 19.261 -56.071 1.725   1.00 25.64 ? 351 ARG A CD    1 
ATOM   2726 N  NE    . ARG A 1 354 ? 20.016 -54.828 1.754   1.00 32.89 ? 351 ARG A NE    1 
ATOM   2727 C  CZ    . ARG A 1 354 ? 21.023 -54.614 2.593   1.00 36.96 ? 351 ARG A CZ    1 
ATOM   2728 N  NH1   . ARG A 1 354 ? 21.364 -55.565 3.464   1.00 34.17 ? 351 ARG A NH1   1 
ATOM   2729 N  NH2   . ARG A 1 354 ? 21.679 -53.461 2.569   1.00 34.19 ? 351 ARG A NH2   1 
ATOM   2730 N  N     . LEU A 1 355 ? 19.834 -56.761 -3.865  1.00 25.51 ? 352 LEU A N     1 
ATOM   2731 C  CA    . LEU A 1 355 ? 20.514 -56.362 -5.106  1.00 31.08 ? 352 LEU A CA    1 
ATOM   2732 C  C     . LEU A 1 355 ? 19.536 -56.306 -6.277  1.00 31.95 ? 352 LEU A C     1 
ATOM   2733 O  O     . LEU A 1 355 ? 19.608 -55.408 -7.117  1.00 28.55 ? 352 LEU A O     1 
ATOM   2734 C  CB    . LEU A 1 355 ? 21.667 -57.311 -5.451  1.00 29.04 ? 352 LEU A CB    1 
ATOM   2735 C  CG    . LEU A 1 355 ? 22.883 -57.272 -4.538  1.00 25.17 ? 352 LEU A CG    1 
ATOM   2736 C  CD1   . LEU A 1 355 ? 23.727 -58.509 -4.752  1.00 29.34 ? 352 LEU A CD1   1 
ATOM   2737 C  CD2   . LEU A 1 355 ? 23.675 -56.027 -4.825  1.00 27.78 ? 352 LEU A CD2   1 
ATOM   2738 N  N     . THR A 1 356 ? 18.626 -57.270 -6.337  1.00 28.17 ? 353 THR A N     1 
ATOM   2739 C  CA    . THR A 1 356 ? 17.643 -57.267 -7.398  1.00 31.39 ? 353 THR A CA    1 
ATOM   2740 C  C     . THR A 1 356 ? 16.813 -55.985 -7.313  1.00 32.29 ? 353 THR A C     1 
ATOM   2741 O  O     . THR A 1 356 ? 16.556 -55.345 -8.329  1.00 33.42 ? 353 THR A O     1 
ATOM   2742 C  CB    . THR A 1 356 ? 16.725 -58.505 -7.332  1.00 32.64 ? 353 THR A CB    1 
ATOM   2743 O  OG1   . THR A 1 356 ? 17.526 -59.685 -7.205  1.00 39.69 ? 353 THR A OG1   1 
ATOM   2744 C  CG2   . THR A 1 356 ? 15.900 -58.612 -8.594  1.00 28.95 ? 353 THR A CG2   1 
ATOM   2745 N  N     . LYS A 1 357 ? 16.400 -55.614 -6.101  1.00 32.39 ? 354 LYS A N     1 
ATOM   2746 C  CA    . LYS A 1 357 ? 15.670 -54.363 -5.886  1.00 33.30 ? 354 LYS A CA    1 
ATOM   2747 C  C     . LYS A 1 357 ? 16.517 -53.196 -6.410  1.00 33.36 ? 354 LYS A C     1 
ATOM   2748 O  O     . LYS A 1 357 ? 16.050 -52.365 -7.186  1.00 32.34 ? 354 LYS A O     1 
ATOM   2749 C  CB    . LYS A 1 357 ? 15.332 -54.194 -4.396  1.00 37.20 ? 354 LYS A CB    1 
ATOM   2750 C  CG    . LYS A 1 357 ? 14.742 -52.841 -3.962  1.00 36.46 ? 354 LYS A CG    1 
ATOM   2751 C  CD    . LYS A 1 357 ? 13.260 -52.705 -4.343  1.00 44.76 ? 354 LYS A CD    1 
ATOM   2752 C  CE    . LYS A 1 357 ? 12.604 -51.495 -3.682  1.00 39.90 ? 354 LYS A CE    1 
ATOM   2753 N  NZ    . LYS A 1 357 ? 11.171 -51.351 -4.084  1.00 49.30 ? 354 LYS A NZ    1 
ATOM   2754 N  N     . ASP A 1 358 ? 17.782 -53.180 -6.011  1.00 30.32 ? 355 ASP A N     1 
ATOM   2755 C  CA    . ASP A 1 358 ? 18.691 -52.102 -6.352  1.00 31.58 ? 355 ASP A CA    1 
ATOM   2756 C  C     . ASP A 1 358 ? 18.856 -51.968 -7.849  1.00 34.70 ? 355 ASP A C     1 
ATOM   2757 O  O     . ASP A 1 358 ? 18.892 -50.858 -8.366  1.00 38.11 ? 355 ASP A O     1 
ATOM   2758 C  CB    . ASP A 1 358 ? 20.061 -52.324 -5.701  1.00 31.48 ? 355 ASP A CB    1 
ATOM   2759 C  CG    . ASP A 1 358 ? 20.976 -51.118 -5.858  1.00 36.92 ? 355 ASP A CG    1 
ATOM   2760 O  OD1   . ASP A 1 358 ? 20.795 -50.144 -5.101  1.00 39.77 ? 355 ASP A OD1   1 
ATOM   2761 O  OD2   . ASP A 1 358 ? 21.868 -51.135 -6.737  1.00 36.80 ? 355 ASP A OD2   1 
ATOM   2762 N  N     . ARG A 1 359 ? 18.964 -53.099 -8.540  1.00 33.72 ? 356 ARG A N     1 
ATOM   2763 C  CA    . ARG A 1 359 ? 19.098 -53.105 -9.991  1.00 35.15 ? 356 ARG A CA    1 
ATOM   2764 C  C     . ARG A 1 359 ? 17.878 -52.472 -10.671 1.00 33.76 ? 356 ARG A C     1 
ATOM   2765 O  O     . ARG A 1 359 ? 18.028 -51.681 -11.588 1.00 37.96 ? 356 ARG A O     1 
ATOM   2766 C  CB    . ARG A 1 359 ? 19.312 -54.535 -10.510 1.00 31.68 ? 356 ARG A CB    1 
ATOM   2767 C  CG    . ARG A 1 359 ? 19.730 -54.610 -11.978 1.00 32.13 ? 356 ARG A CG    1 
ATOM   2768 C  CD    . ARG A 1 359 ? 20.075 -56.039 -12.384 1.00 31.73 ? 356 ARG A CD    1 
ATOM   2769 N  NE    . ARG A 1 359 ? 18.935 -56.933 -12.206 1.00 33.17 ? 356 ARG A NE    1 
ATOM   2770 C  CZ    . ARG A 1 359 ? 19.019 -58.247 -11.998 1.00 38.44 ? 356 ARG A CZ    1 
ATOM   2771 N  NH1   . ARG A 1 359 ? 20.205 -58.837 -11.936 1.00 32.73 ? 356 ARG A NH1   1 
ATOM   2772 N  NH2   . ARG A 1 359 ? 17.908 -58.973 -11.842 1.00 36.61 ? 356 ARG A NH2   1 
ATOM   2773 N  N     . ASN A 1 360 ? 16.677 -52.800 -10.207 1.00 32.76 ? 357 ASN A N     1 
ATOM   2774 C  CA    . ASN A 1 360 ? 15.461 -52.261 -10.810 1.00 33.91 ? 357 ASN A CA    1 
ATOM   2775 C  C     . ASN A 1 360 ? 15.234 -50.779 -10.484 1.00 34.15 ? 357 ASN A C     1 
ATOM   2776 O  O     . ASN A 1 360 ? 14.796 -50.007 -11.329 1.00 33.38 ? 357 ASN A O     1 
ATOM   2777 C  CB    . ASN A 1 360 ? 14.246 -53.082 -10.371 1.00 33.01 ? 357 ASN A CB    1 
ATOM   2778 C  CG    . ASN A 1 360 ? 14.233 -54.480 -10.972 1.00 32.89 ? 357 ASN A CG    1 
ATOM   2779 O  OD1   . ASN A 1 360 ? 14.739 -54.703 -12.066 1.00 37.09 ? 357 ASN A OD1   1 
ATOM   2780 N  ND2   . ASN A 1 360 ? 13.663 -55.429 -10.246 1.00 36.42 ? 357 ASN A ND2   1 
ATOM   2781 N  N     . ASP A 1 361 ? 15.533 -50.397 -9.248  1.00 38.16 ? 358 ASP A N     1 
ATOM   2782 C  CA    . ASP A 1 361 ? 15.370 -49.023 -8.790  1.00 32.57 ? 358 ASP A CA    1 
ATOM   2783 C  C     . ASP A 1 361 ? 16.382 -48.068 -9.389  1.00 31.83 ? 358 ASP A C     1 
ATOM   2784 O  O     . ASP A 1 361 ? 16.018 -47.010 -9.891  1.00 35.86 ? 358 ASP A O     1 
ATOM   2785 C  CB    . ASP A 1 361 ? 15.481 -48.948 -7.267  1.00 33.76 ? 358 ASP A CB    1 
ATOM   2786 C  CG    . ASP A 1 361 ? 14.293 -49.545 -6.567  1.00 36.68 ? 358 ASP A CG    1 
ATOM   2787 O  OD1   . ASP A 1 361 ? 13.246 -49.761 -7.225  1.00 39.60 ? 358 ASP A OD1   1 
ATOM   2788 O  OD2   . ASP A 1 361 ? 14.405 -49.788 -5.348  1.00 35.81 ? 358 ASP A OD2   1 
ATOM   2789 N  N     . ASN A 1 362 ? 17.657 -48.435 -9.311  1.00 34.30 ? 359 ASN A N     1 
ATOM   2790 C  CA    . ASN A 1 362 ? 18.735 -47.468 -9.538  1.00 37.16 ? 359 ASN A CA    1 
ATOM   2791 C  C     . ASN A 1 362 ? 19.568 -47.732 -10.790 1.00 34.67 ? 359 ASN A C     1 
ATOM   2792 O  O     . ASN A 1 362 ? 20.566 -47.063 -11.010 1.00 33.45 ? 359 ASN A O     1 
ATOM   2793 C  CB    . ASN A 1 362 ? 19.662 -47.420 -8.319  1.00 31.22 ? 359 ASN A CB    1 
ATOM   2794 C  CG    . ASN A 1 362 ? 18.903 -47.326 -7.004  1.00 34.89 ? 359 ASN A CG    1 
ATOM   2795 O  OD1   . ASN A 1 362 ? 17.970 -46.539 -6.865  1.00 33.56 ? 359 ASN A OD1   1 
ATOM   2796 N  ND2   . ASN A 1 362 ? 19.309 -48.135 -6.025  1.00 34.46 ? 359 ASN A ND2   1 
ATOM   2797 N  N     . ASP A 1 363 ? 19.158 -48.713 -11.592 1.00 36.67 ? 360 ASP A N     1 
ATOM   2798 C  CA    . ASP A 1 363 ? 19.809 -49.017 -12.871 1.00 39.77 ? 360 ASP A CA    1 
ATOM   2799 C  C     . ASP A 1 363 ? 21.313 -49.234 -12.763 1.00 38.65 ? 360 ASP A C     1 
ATOM   2800 O  O     . ASP A 1 363 ? 22.095 -48.571 -13.428 1.00 40.31 ? 360 ASP A O     1 
ATOM   2801 C  CB    . ASP A 1 363 ? 19.532 -47.897 -13.884 1.00 41.67 ? 360 ASP A CB    1 
ATOM   2802 C  CG    . ASP A 1 363 ? 18.048 -47.713 -14.162 1.00 45.82 ? 360 ASP A CG    1 
ATOM   2803 O  OD1   . ASP A 1 363 ? 17.342 -48.716 -14.422 1.00 40.71 ? 360 ASP A OD1   1 
ATOM   2804 O  OD2   . ASP A 1 363 ? 17.585 -46.554 -14.105 1.00 51.81 ? 360 ASP A OD2   1 
ATOM   2805 N  N     . ARG A 1 364 ? 21.720 -50.171 -11.924 1.00 43.47 ? 361 ARG A N     1 
ATOM   2806 C  CA    . ARG A 1 364 ? 23.136 -50.476 -11.764 1.00 37.28 ? 361 ARG A CA    1 
ATOM   2807 C  C     . ARG A 1 364 ? 23.281 -51.913 -11.283 1.00 40.64 ? 361 ARG A C     1 
ATOM   2808 O  O     . ARG A 1 364 ? 22.319 -52.516 -10.790 1.00 40.86 ? 361 ARG A O     1 
ATOM   2809 C  CB    . ARG A 1 364 ? 23.801 -49.510 -10.777 1.00 35.36 ? 361 ARG A CB    1 
ATOM   2810 C  CG    . ARG A 1 364 ? 23.216 -49.592 -9.381  1.00 37.51 ? 361 ARG A CG    1 
ATOM   2811 C  CD    . ARG A 1 364 ? 23.833 -48.598 -8.414  1.00 35.29 ? 361 ARG A CD    1 
ATOM   2812 N  NE    . ARG A 1 364 ? 23.417 -48.874 -7.039  1.00 36.02 ? 361 ARG A NE    1 
ATOM   2813 C  CZ    . ARG A 1 364 ? 24.027 -48.395 -5.963  1.00 36.76 ? 361 ARG A CZ    1 
ATOM   2814 N  NH1   . ARG A 1 364 ? 23.595 -48.707 -4.744  1.00 32.92 ? 361 ARG A NH1   1 
ATOM   2815 N  NH2   . ARG A 1 364 ? 25.074 -47.603 -6.108  1.00 38.21 ? 361 ARG A NH2   1 
ATOM   2816 N  N     . VAL A 1 365 ? 24.481 -52.460 -11.438 1.00 39.02 ? 362 VAL A N     1 
ATOM   2817 C  CA    . VAL A 1 365 ? 24.773 -53.799 -10.966 1.00 36.36 ? 362 VAL A CA    1 
ATOM   2818 C  C     . VAL A 1 365 ? 26.095 -53.838 -10.217 1.00 36.88 ? 362 VAL A C     1 
ATOM   2819 O  O     . VAL A 1 365 ? 27.080 -53.203 -10.618 1.00 35.41 ? 362 VAL A O     1 
ATOM   2820 C  CB    . VAL A 1 365 ? 24.817 -54.816 -12.121 1.00 40.85 ? 362 VAL A CB    1 
ATOM   2821 C  CG1   . VAL A 1 365 ? 23.420 -55.043 -12.661 1.00 44.01 ? 362 VAL A CG1   1 
ATOM   2822 C  CG2   . VAL A 1 365 ? 25.762 -54.350 -13.228 1.00 35.73 ? 362 VAL A CG2   1 
ATOM   2823 N  N     . ALA A 1 366 ? 26.098 -54.570 -9.111  1.00 32.01 ? 363 ALA A N     1 
ATOM   2824 C  CA    . ALA A 1 366 ? 27.325 -54.833 -8.383  1.00 30.65 ? 363 ALA A CA    1 
ATOM   2825 C  C     . ALA A 1 366 ? 28.127 -55.883 -9.139  1.00 33.12 ? 363 ALA A C     1 
ATOM   2826 O  O     . ALA A 1 366 ? 27.561 -56.828 -9.685  1.00 33.01 ? 363 ALA A O     1 
ATOM   2827 C  CB    . ALA A 1 366 ? 27.023 -55.298 -6.976  1.00 31.91 ? 363 ALA A CB    1 
ATOM   2828 N  N     . THR A 1 367 ? 29.446 -55.733 -9.143  1.00 35.45 ? 364 THR A N     1 
ATOM   2829 C  CA    . THR A 1 367 ? 30.300 -56.620 -9.916  1.00 36.44 ? 364 THR A CA    1 
ATOM   2830 C  C     . THR A 1 367 ? 31.303 -57.404 -9.072  1.00 40.64 ? 364 THR A C     1 
ATOM   2831 O  O     . THR A 1 367 ? 31.974 -58.314 -9.577  1.00 42.50 ? 364 THR A O     1 
ATOM   2832 C  CB    . THR A 1 367 ? 31.078 -55.822 -10.968 1.00 37.79 ? 364 THR A CB    1 
ATOM   2833 O  OG1   . THR A 1 367 ? 31.873 -54.833 -10.300 1.00 34.15 ? 364 THR A OG1   1 
ATOM   2834 C  CG2   . THR A 1 367 ? 30.114 -55.138 -11.929 1.00 34.05 ? 364 THR A CG2   1 
ATOM   2835 N  N     . GLN A 1 368 ? 31.439 -57.035 -7.802  1.00 40.63 ? 365 GLN A N     1 
ATOM   2836 C  CA    . GLN A 1 368 ? 32.411 -57.693 -6.935  1.00 36.77 ? 365 GLN A CA    1 
ATOM   2837 C  C     . GLN A 1 368 ? 31.782 -58.079 -5.602  1.00 39.99 ? 365 GLN A C     1 
ATOM   2838 O  O     . GLN A 1 368 ? 31.023 -57.311 -5.021  1.00 36.92 ? 365 GLN A O     1 
ATOM   2839 C  CB    . GLN A 1 368 ? 33.612 -56.792 -6.695  1.00 35.36 ? 365 GLN A CB    1 
ATOM   2840 C  CG    . GLN A 1 368 ? 34.784 -57.504 -6.074  1.00 41.89 ? 365 GLN A CG    1 
ATOM   2841 C  CD    . GLN A 1 368 ? 35.880 -56.547 -5.625  1.00 50.10 ? 365 GLN A CD    1 
ATOM   2842 O  OE1   . GLN A 1 368 ? 35.602 -55.447 -5.152  1.00 46.10 ? 365 GLN A OE1   1 
ATOM   2843 N  NE2   . GLN A 1 368 ? 37.135 -56.968 -5.770  1.00 56.59 ? 365 GLN A NE2   1 
ATOM   2844 N  N     . LEU A 1 369 ? 32.102 -59.271 -5.116  1.00 40.81 ? 366 LEU A N     1 
ATOM   2845 C  CA    . LEU A 1 369 ? 31.587 -59.715 -3.830  1.00 41.25 ? 366 LEU A CA    1 
ATOM   2846 C  C     . LEU A 1 369 ? 32.727 -59.859 -2.831  1.00 40.13 ? 366 LEU A C     1 
ATOM   2847 O  O     . LEU A 1 369 ? 33.746 -60.474 -3.133  1.00 40.16 ? 366 LEU A O     1 
ATOM   2848 C  CB    . LEU A 1 369 ? 30.836 -61.036 -3.977  1.00 37.75 ? 366 LEU A CB    1 
ATOM   2849 C  CG    . LEU A 1 369 ? 30.357 -61.672 -2.678  1.00 39.03 ? 366 LEU A CG    1 
ATOM   2850 C  CD1   . LEU A 1 369 ? 29.070 -60.987 -2.212  1.00 37.49 ? 366 LEU A CD1   1 
ATOM   2851 C  CD2   . LEU A 1 369 ? 30.161 -63.172 -2.860  1.00 36.86 ? 366 LEU A CD2   1 
ATOM   2852 N  N     . VAL A 1 370 ? 32.559 -59.270 -1.653  1.00 34.14 ? 367 VAL A N     1 
ATOM   2853 C  CA    . VAL A 1 370 ? 33.569 -59.368 -0.612  1.00 35.09 ? 367 VAL A CA    1 
ATOM   2854 C  C     . VAL A 1 370 ? 33.067 -60.267 0.520   1.00 36.81 ? 367 VAL A C     1 
ATOM   2855 O  O     . VAL A 1 370 ? 31.912 -60.173 0.939   1.00 33.87 ? 367 VAL A O     1 
ATOM   2856 C  CB    . VAL A 1 370 ? 33.940 -57.986 -0.065  1.00 36.27 ? 367 VAL A CB    1 
ATOM   2857 C  CG1   . VAL A 1 370 ? 35.139 -58.086 0.863   1.00 37.34 ? 367 VAL A CG1   1 
ATOM   2858 C  CG2   . VAL A 1 370 ? 34.237 -57.043 -1.216  1.00 36.24 ? 367 VAL A CG2   1 
ATOM   2859 N  N     . VAL A 1 371 ? 33.931 -61.159 0.991   1.00 33.96 ? 368 VAL A N     1 
ATOM   2860 C  CA    . VAL A 1 371 ? 33.576 -62.069 2.065   1.00 34.96 ? 368 VAL A CA    1 
ATOM   2861 C  C     . VAL A 1 371 ? 34.457 -61.780 3.270   1.00 36.02 ? 368 VAL A C     1 
ATOM   2862 O  O     . VAL A 1 371 ? 35.675 -61.869 3.182   1.00 39.70 ? 368 VAL A O     1 
ATOM   2863 C  CB    . VAL A 1 371 ? 33.728 -63.545 1.638   1.00 37.88 ? 368 VAL A CB    1 
ATOM   2864 C  CG1   . VAL A 1 371 ? 32.909 -64.450 2.558   1.00 37.06 ? 368 VAL A CG1   1 
ATOM   2865 C  CG2   . VAL A 1 371 ? 33.276 -63.715 0.195   1.00 35.73 ? 368 VAL A CG2   1 
ATOM   2866 N  N     . SER A 1 372 ? 33.825 -61.404 4.378   1.00 37.66 ? 369 SER A N     1 
ATOM   2867 C  CA    . SER A 1 372 ? 34.507 -61.107 5.631   1.00 37.53 ? 369 SER A CA    1 
ATOM   2868 C  C     . SER A 1 372 ? 34.114 -62.113 6.679   1.00 39.69 ? 369 SER A C     1 
ATOM   2869 O  O     . SER A 1 372 ? 32.950 -62.502 6.763   1.00 39.58 ? 369 SER A O     1 
ATOM   2870 C  CB    . SER A 1 372 ? 34.152 -59.712 6.145   1.00 40.38 ? 369 SER A CB    1 
ATOM   2871 O  OG    . SER A 1 372 ? 35.028 -58.721 5.655   1.00 46.99 ? 369 SER A OG    1 
ATOM   2872 N  N     . ILE A 1 373 ? 35.079 -62.521 7.493   1.00 41.26 ? 370 ILE A N     1 
ATOM   2873 C  CA    . ILE A 1 373 ? 34.798 -63.386 8.629   1.00 42.98 ? 370 ILE A CA    1 
ATOM   2874 C  C     . ILE A 1 373 ? 35.588 -62.938 9.856   1.00 45.14 ? 370 ILE A C     1 
ATOM   2875 O  O     . ILE A 1 373 ? 36.651 -62.317 9.729   1.00 42.08 ? 370 ILE A O     1 
ATOM   2876 C  CB    . ILE A 1 373 ? 35.136 -64.861 8.336   1.00 39.99 ? 370 ILE A CB    1 
ATOM   2877 C  CG1   . ILE A 1 373 ? 36.647 -65.039 8.180   1.00 43.05 ? 370 ILE A CG1   1 
ATOM   2878 C  CG2   . ILE A 1 373 ? 34.380 -65.367 7.109   1.00 37.93 ? 370 ILE A CG2   1 
ATOM   2879 C  CD1   . ILE A 1 373 ? 37.048 -66.415 7.745   1.00 40.07 ? 370 ILE A CD1   1 
ATOM   2880 N  N     . ARG A 1 374 ? 35.048 -63.236 11.038  1.00 42.77 ? 371 ARG A N     1 
ATOM   2881 C  CA    . ARG A 1 374 ? 35.811 -63.117 12.275  1.00 44.34 ? 371 ARG A CA    1 
ATOM   2882 C  C     . ARG A 1 374 ? 35.908 -64.472 12.935  1.00 47.10 ? 371 ARG A C     1 
ATOM   2883 O  O     . ARG A 1 374 ? 34.939 -65.241 12.948  1.00 42.67 ? 371 ARG A O     1 
ATOM   2884 C  CB    . ARG A 1 374 ? 35.195 -62.117 13.254  1.00 45.04 ? 371 ARG A CB    1 
ATOM   2885 C  CG    . ARG A 1 374 ? 36.143 -61.762 14.392  1.00 48.04 ? 371 ARG A CG    1 
ATOM   2886 C  CD    . ARG A 1 374 ? 35.469 -60.941 15.456  1.00 52.07 ? 371 ARG A CD    1 
ATOM   2887 N  NE    . ARG A 1 374 ? 34.594 -59.935 14.870  1.00 56.15 ? 371 ARG A NE    1 
ATOM   2888 C  CZ    . ARG A 1 374 ? 33.357 -59.681 15.288  1.00 54.36 ? 371 ARG A CZ    1 
ATOM   2889 N  NH1   . ARG A 1 374 ? 32.633 -58.746 14.683  1.00 54.37 ? 371 ARG A NH1   1 
ATOM   2890 N  NH2   . ARG A 1 374 ? 32.842 -60.364 16.304  1.00 52.58 ? 371 ARG A NH2   1 
ATOM   2891 N  N     . VAL A 1 375 ? 37.089 -64.742 13.485  1.00 51.11 ? 372 VAL A N     1 
ATOM   2892 C  CA    . VAL A 1 375 ? 37.403 -66.009 14.135  1.00 45.79 ? 372 VAL A CA    1 
ATOM   2893 C  C     . VAL A 1 375 ? 37.377 -65.864 15.662  1.00 49.92 ? 372 VAL A C     1 
ATOM   2894 O  O     . VAL A 1 375 ? 37.726 -64.807 16.202  1.00 50.25 ? 372 VAL A O     1 
ATOM   2895 C  CB    . VAL A 1 375 ? 38.770 -66.518 13.653  1.00 46.08 ? 372 VAL A CB    1 
ATOM   2896 C  CG1   . VAL A 1 375 ? 39.169 -67.758 14.377  1.00 54.93 ? 372 VAL A CG1   1 
ATOM   2897 C  CG2   . VAL A 1 375 ? 38.712 -66.797 12.165  1.00 49.42 ? 372 VAL A CG2   1 
ATOM   2898 N  N     . GLN A 1 376 ? 36.937 -66.916 16.350  1.00 50.36 ? 373 GLN A N     1 
ATOM   2899 C  CA    . GLN A 1 376 ? 36.838 -66.907 17.809  1.00 51.06 ? 373 GLN A CA    1 
ATOM   2900 C  C     . GLN A 1 376 ? 38.135 -66.505 18.510  1.00 51.92 ? 373 GLN A C     1 
ATOM   2901 O  O     . GLN A 1 376 ? 39.169 -67.142 18.332  1.00 47.96 ? 373 GLN A O     1 
ATOM   2902 C  CB    . GLN A 1 376 ? 36.409 -68.283 18.299  1.00 50.42 ? 373 GLN A CB    1 
ATOM   2903 C  CG    . GLN A 1 376 ? 35.942 -68.297 19.737  1.00 53.38 ? 373 GLN A CG    1 
ATOM   2904 C  CD    . GLN A 1 376 ? 34.853 -69.323 19.966  1.00 54.51 ? 373 GLN A CD    1 
ATOM   2905 O  OE1   . GLN A 1 376 ? 35.088 -70.528 19.836  1.00 57.39 ? 373 GLN A OE1   1 
ATOM   2906 N  NE2   . GLN A 1 376 ? 33.648 -68.853 20.290  1.00 47.12 ? 373 GLN A NE2   1 
ATOM   2907 N  N     . GLY A 1 377 ? 38.077 -65.443 19.308  1.00 53.46 ? 374 GLY A N     1 
ATOM   2908 C  CA    . GLY A 1 377 ? 39.241 -65.004 20.063  1.00 57.62 ? 374 GLY A CA    1 
ATOM   2909 C  C     . GLY A 1 377 ? 39.875 -63.714 19.567  1.00 61.90 ? 374 GLY A C     1 
ATOM   2910 O  O     . GLY A 1 377 ? 40.367 -62.906 20.359  1.00 62.48 ? 374 GLY A O     1 
ATOM   2911 N  N     . ASP A 1 378 ? 39.869 -63.530 18.250  1.00 61.04 ? 375 ASP A N     1 
ATOM   2912 C  CA    . ASP A 1 378 ? 40.380 -62.317 17.619  1.00 57.08 ? 375 ASP A CA    1 
ATOM   2913 C  C     . ASP A 1 378 ? 39.389 -61.163 17.776  1.00 61.91 ? 375 ASP A C     1 
ATOM   2914 O  O     . ASP A 1 378 ? 38.266 -61.231 17.274  1.00 62.85 ? 375 ASP A O     1 
ATOM   2915 C  CB    . ASP A 1 378 ? 40.668 -62.587 16.139  1.00 58.30 ? 375 ASP A CB    1 
ATOM   2916 C  CG    . ASP A 1 378 ? 41.184 -61.368 15.412  1.00 60.16 ? 375 ASP A CG    1 
ATOM   2917 O  OD1   . ASP A 1 378 ? 41.705 -60.440 16.074  1.00 61.43 ? 375 ASP A OD1   1 
ATOM   2918 O  OD2   . ASP A 1 378 ? 41.069 -61.343 14.173  1.00 57.20 ? 375 ASP A OD2   1 
ATOM   2919 N  N     . LYS A 1 379 ? 39.801 -60.101 18.469  1.00 67.69 ? 376 LYS A N     1 
ATOM   2920 C  CA    . LYS A 1 379 ? 38.877 -59.006 18.777  1.00 67.43 ? 376 LYS A CA    1 
ATOM   2921 C  C     . LYS A 1 379 ? 38.850 -57.977 17.649  1.00 69.18 ? 376 LYS A C     1 
ATOM   2922 O  O     . LYS A 1 379 ? 37.996 -57.080 17.636  1.00 67.89 ? 376 LYS A O     1 
ATOM   2923 C  CB    . LYS A 1 379 ? 39.229 -58.346 20.120  1.00 70.94 ? 376 LYS A CB    1 
ATOM   2924 C  CG    . LYS A 1 379 ? 39.960 -57.014 20.035  1.00 75.35 ? 376 LYS A CG    1 
ATOM   2925 C  CD    . LYS A 1 379 ? 39.826 -56.229 21.336  1.00 75.18 ? 376 LYS A CD    1 
ATOM   2926 C  CE    . LYS A 1 379 ? 40.420 -54.837 21.190  1.00 71.60 ? 376 LYS A CE    1 
ATOM   2927 N  NZ    . LYS A 1 379 ? 39.549 -53.970 20.358  1.00 63.65 ? 376 LYS A NZ    1 
ATOM   2928 N  N     . ARG A 1 380 ? 39.782 -58.117 16.704  1.00 69.13 ? 377 ARG A N     1 
ATOM   2929 C  CA    . ARG A 1 380 ? 39.673 -57.436 15.410  1.00 66.74 ? 377 ARG A CA    1 
ATOM   2930 C  C     . ARG A 1 380 ? 38.334 -57.795 14.793  1.00 62.69 ? 377 ARG A C     1 
ATOM   2931 O  O     . ARG A 1 380 ? 38.108 -58.951 14.422  1.00 63.70 ? 377 ARG A O     1 
ATOM   2932 C  CB    . ARG A 1 380 ? 40.808 -57.839 14.459  1.00 62.09 ? 377 ARG A CB    1 
ATOM   2933 C  CG    . ARG A 1 380 ? 42.155 -57.245 14.808  1.00 61.70 ? 377 ARG A CG    1 
ATOM   2934 C  CD    . ARG A 1 380 ? 43.297 -58.140 14.340  1.00 62.42 ? 377 ARG A CD    1 
ATOM   2935 N  NE    . ARG A 1 380 ? 43.360 -58.296 12.888  1.00 59.73 ? 377 ARG A NE    1 
ATOM   2936 C  CZ    . ARG A 1 380 ? 43.166 -59.442 12.242  1.00 56.89 ? 377 ARG A CZ    1 
ATOM   2937 N  NH1   . ARG A 1 380 ? 42.895 -60.553 12.911  1.00 55.08 ? 377 ARG A NH1   1 
ATOM   2938 N  NH2   . ARG A 1 380 ? 43.252 -59.476 10.919  1.00 58.32 ? 377 ARG A NH2   1 
ATOM   2939 N  N     . LEU A 1 381 ? 37.449 -56.810 14.677  1.00 60.55 ? 378 LEU A N     1 
ATOM   2940 C  CA    . LEU A 1 381 ? 36.078 -57.093 14.274  1.00 62.98 ? 378 LEU A CA    1 
ATOM   2941 C  C     . LEU A 1 381 ? 35.991 -57.632 12.833  1.00 59.51 ? 378 LEU A C     1 
ATOM   2942 O  O     . LEU A 1 381 ? 34.943 -58.095 12.393  1.00 57.77 ? 378 LEU A O     1 
ATOM   2943 C  CB    . LEU A 1 381 ? 35.201 -55.846 14.466  1.00 67.71 ? 378 LEU A CB    1 
ATOM   2944 C  CG    . LEU A 1 381 ? 34.980 -55.400 15.931  1.00 64.09 ? 378 LEU A CG    1 
ATOM   2945 C  CD1   . LEU A 1 381 ? 34.174 -54.094 16.040  1.00 57.34 ? 378 LEU A CD1   1 
ATOM   2946 C  CD2   . LEU A 1 381 ? 34.339 -56.502 16.789  1.00 58.44 ? 378 LEU A CD2   1 
ATOM   2947 N  N     . SER A 1 382 ? 37.105 -57.601 12.113  1.00 58.42 ? 379 SER A N     1 
ATOM   2948 C  CA    . SER A 1 382 ? 37.252 -58.420 10.909  1.00 55.37 ? 379 SER A CA    1 
ATOM   2949 C  C     . SER A 1 382 ? 38.574 -59.151 10.936  1.00 54.35 ? 379 SER A C     1 
ATOM   2950 O  O     . SER A 1 382 ? 39.629 -58.533 11.066  1.00 55.52 ? 379 SER A O     1 
ATOM   2951 C  CB    . SER A 1 382 ? 37.181 -57.597 9.633   1.00 51.59 ? 379 SER A CB    1 
ATOM   2952 O  OG    . SER A 1 382 ? 37.600 -58.404 8.545   1.00 49.61 ? 379 SER A OG    1 
ATOM   2953 N  N     . SER A 1 383 ? 38.521 -60.469 10.808  1.00 50.89 ? 380 SER A N     1 
ATOM   2954 C  CA    . SER A 1 383 ? 39.739 -61.251 10.901  1.00 50.87 ? 380 SER A CA    1 
ATOM   2955 C  C     . SER A 1 383 ? 40.327 -61.479 9.516   1.00 46.81 ? 380 SER A C     1 
ATOM   2956 O  O     . SER A 1 383 ? 41.542 -61.538 9.376   1.00 48.77 ? 380 SER A O     1 
ATOM   2957 C  CB    . SER A 1 383 ? 39.483 -62.587 11.625  1.00 50.02 ? 380 SER A CB    1 
ATOM   2958 O  OG    . SER A 1 383 ? 39.291 -63.659 10.715  1.00 53.69 ? 380 SER A OG    1 
ATOM   2959 N  N     . LEU A 1 384 ? 39.473 -61.570 8.495   1.00 46.80 ? 381 LEU A N     1 
ATOM   2960 C  CA    . LEU A 1 384 ? 39.932 -61.880 7.138   1.00 43.23 ? 381 LEU A CA    1 
ATOM   2961 C  C     . LEU A 1 384 ? 38.914 -61.535 6.032   1.00 41.34 ? 381 LEU A C     1 
ATOM   2962 O  O     . LEU A 1 384 ? 37.709 -61.732 6.179   1.00 42.97 ? 381 LEU A O     1 
ATOM   2963 C  CB    . LEU A 1 384 ? 40.317 -63.359 7.061   1.00 42.01 ? 381 LEU A CB    1 
ATOM   2964 C  CG    . LEU A 1 384 ? 40.605 -63.970 5.696   1.00 42.16 ? 381 LEU A CG    1 
ATOM   2965 C  CD1   . LEU A 1 384 ? 41.870 -64.804 5.743   1.00 48.96 ? 381 LEU A CD1   1 
ATOM   2966 C  CD2   . LEU A 1 384 ? 39.433 -64.823 5.263   1.00 44.24 ? 381 LEU A CD2   1 
ATOM   2967 N  N     . ARG A 1 385 ? 39.432 -61.039 4.912   1.00 41.86 ? 382 ARG A N     1 
ATOM   2968 C  CA    . ARG A 1 385 ? 38.630 -60.447 3.850   1.00 39.37 ? 382 ARG A CA    1 
ATOM   2969 C  C     . ARG A 1 385 ? 39.111 -60.925 2.477   1.00 38.98 ? 382 ARG A C     1 
ATOM   2970 O  O     . ARG A 1 385 ? 40.222 -60.610 2.056   1.00 38.97 ? 382 ARG A O     1 
ATOM   2971 C  CB    . ARG A 1 385 ? 38.708 -58.918 3.937   1.00 39.27 ? 382 ARG A CB    1 
ATOM   2972 C  CG    . ARG A 1 385 ? 37.383 -58.200 3.827   1.00 42.69 ? 382 ARG A CG    1 
ATOM   2973 C  CD    . ARG A 1 385 ? 37.491 -56.741 4.261   1.00 49.06 ? 382 ARG A CD    1 
ATOM   2974 N  NE    . ARG A 1 385 ? 38.330 -56.568 5.451   1.00 51.76 ? 382 ARG A NE    1 
ATOM   2975 C  CZ    . ARG A 1 385 ? 38.647 -55.390 5.995   1.00 46.48 ? 382 ARG A CZ    1 
ATOM   2976 N  NH1   . ARG A 1 385 ? 39.427 -55.341 7.072   1.00 44.05 ? 382 ARG A NH1   1 
ATOM   2977 N  NH2   . ARG A 1 385 ? 38.196 -54.257 5.461   1.00 44.26 ? 382 ARG A NH2   1 
ATOM   2978 N  N     . ARG A 1 386 ? 38.282 -61.691 1.783   1.00 36.74 ? 383 ARG A N     1 
ATOM   2979 C  CA    . ARG A 1 386 ? 38.623 -62.151 0.441   1.00 36.11 ? 383 ARG A CA    1 
ATOM   2980 C  C     . ARG A 1 386 ? 37.493 -61.783 -0.526  1.00 38.06 ? 383 ARG A C     1 
ATOM   2981 O  O     . ARG A 1 386 ? 36.362 -61.579 -0.106  1.00 38.89 ? 383 ARG A O     1 
ATOM   2982 C  CB    . ARG A 1 386 ? 38.881 -63.662 0.440   1.00 37.32 ? 383 ARG A CB    1 
ATOM   2983 C  CG    . ARG A 1 386 ? 40.006 -64.126 1.374   1.00 35.35 ? 383 ARG A CG    1 
ATOM   2984 C  CD    . ARG A 1 386 ? 41.361 -63.876 0.756   1.00 36.41 ? 383 ARG A CD    1 
ATOM   2985 N  NE    . ARG A 1 386 ? 42.457 -64.564 1.433   1.00 37.13 ? 383 ARG A NE    1 
ATOM   2986 C  CZ    . ARG A 1 386 ? 43.194 -64.016 2.396   1.00 41.87 ? 383 ARG A CZ    1 
ATOM   2987 N  NH1   . ARG A 1 386 ? 42.937 -62.778 2.810   1.00 44.84 ? 383 ARG A NH1   1 
ATOM   2988 N  NH2   . ARG A 1 386 ? 44.184 -64.700 2.955   1.00 41.06 ? 383 ARG A NH2   1 
ATOM   2989 N  N     . CYS A 1 387 ? 37.788 -61.678 -1.814  1.00 39.90 ? 384 CYS A N     1 
ATOM   2990 C  CA    . CYS A 1 387 ? 36.753 -61.270 -2.762  1.00 45.81 ? 384 CYS A CA    1 
ATOM   2991 C  C     . CYS A 1 387 ? 36.774 -62.083 -4.051  1.00 44.55 ? 384 CYS A C     1 
ATOM   2992 O  O     . CYS A 1 387 ? 37.782 -62.679 -4.407  1.00 46.05 ? 384 CYS A O     1 
ATOM   2993 C  CB    . CYS A 1 387 ? 36.872 -59.765 -3.087  1.00 45.80 ? 384 CYS A CB    1 
ATOM   2994 S  SG    . CYS A 1 387 ? 38.507 -59.172 -3.569  1.00 63.95 ? 384 CYS A SG    1 
ATOM   2995 N  N     . CYS A 1 388 ? 35.641 -62.109 -4.740  1.00 43.14 ? 385 CYS A N     1 
ATOM   2996 C  CA    . CYS A 1 388 ? 35.530 -62.823 -6.006  1.00 48.22 ? 385 CYS A CA    1 
ATOM   2997 C  C     . CYS A 1 388 ? 34.629 -62.047 -6.951  1.00 44.97 ? 385 CYS A C     1 
ATOM   2998 O  O     . CYS A 1 388 ? 34.166 -60.963 -6.606  1.00 47.59 ? 385 CYS A O     1 
ATOM   2999 C  CB    . CYS A 1 388 ? 34.990 -64.229 -5.775  1.00 47.53 ? 385 CYS A CB    1 
ATOM   3000 S  SG    . CYS A 1 388 ? 33.427 -64.240 -4.887  1.00 50.65 ? 385 CYS A SG    1 
ATOM   3001 N  N     . ALA A 1 389 ? 34.364 -62.580 -8.135  1.00 41.35 ? 386 ALA A N     1 
ATOM   3002 C  CA    . ALA A 1 389 ? 33.506 -61.856 -9.057  1.00 41.73 ? 386 ALA A CA    1 
ATOM   3003 C  C     . ALA A 1 389 ? 32.067 -62.062 -8.657  1.00 39.65 ? 386 ALA A C     1 
ATOM   3004 O  O     . ALA A 1 389 ? 31.707 -63.128 -8.169  1.00 43.75 ? 386 ALA A O     1 
ATOM   3005 C  CB    . ALA A 1 389 ? 33.732 -62.299 -10.500 1.00 43.21 ? 386 ALA A CB    1 
ATOM   3006 N  N     . LEU A 1 390 ? 31.250 -61.030 -8.846  1.00 41.10 ? 387 LEU A N     1 
ATOM   3007 C  CA    . LEU A 1 390 ? 29.802 -61.142 -8.679  1.00 41.15 ? 387 LEU A CA    1 
ATOM   3008 C  C     . LEU A 1 390 ? 29.167 -60.986 -10.053 1.00 39.55 ? 387 LEU A C     1 
ATOM   3009 O  O     . LEU A 1 390 ? 28.947 -59.867 -10.523 1.00 36.95 ? 387 LEU A O     1 
ATOM   3010 C  CB    . LEU A 1 390 ? 29.263 -60.085 -7.700  1.00 39.55 ? 387 LEU A CB    1 
ATOM   3011 C  CG    . LEU A 1 390 ? 27.977 -60.361 -6.893  1.00 34.95 ? 387 LEU A CG    1 
ATOM   3012 C  CD1   . LEU A 1 390 ? 27.710 -59.215 -5.943  1.00 31.59 ? 387 LEU A CD1   1 
ATOM   3013 C  CD2   . LEU A 1 390 ? 26.735 -60.597 -7.758  1.00 33.23 ? 387 LEU A CD2   1 
ATOM   3014 N  N     . THR A 1 391 ? 28.879 -62.113 -10.692 1.00 36.53 ? 388 THR A N     1 
ATOM   3015 C  CA    . THR A 1 391 ? 28.437 -62.110 -12.084 1.00 39.58 ? 388 THR A CA    1 
ATOM   3016 C  C     . THR A 1 391 ? 26.941 -62.347 -12.234 1.00 39.08 ? 388 THR A C     1 
ATOM   3017 O  O     . THR A 1 391 ? 26.347 -62.000 -13.257 1.00 46.16 ? 388 THR A O     1 
ATOM   3018 C  CB    . THR A 1 391 ? 29.190 -63.182 -12.900 1.00 44.68 ? 388 THR A CB    1 
ATOM   3019 O  OG1   . THR A 1 391 ? 29.001 -64.471 -12.293 1.00 45.87 ? 388 THR A OG1   1 
ATOM   3020 C  CG2   . THR A 1 391 ? 30.681 -62.863 -12.955 1.00 34.53 ? 388 THR A CG2   1 
ATOM   3021 N  N     . ARG A 1 392 ? 26.333 -62.954 -11.223 1.00 38.85 ? 389 ARG A N     1 
ATOM   3022 C  CA    . ARG A 1 392 ? 24.893 -63.207 -11.232 1.00 36.05 ? 389 ARG A CA    1 
ATOM   3023 C  C     . ARG A 1 392 ? 24.283 -62.932 -9.865  1.00 35.72 ? 389 ARG A C     1 
ATOM   3024 O  O     . ARG A 1 392 ? 24.881 -63.244 -8.842  1.00 37.42 ? 389 ARG A O     1 
ATOM   3025 C  CB    . ARG A 1 392 ? 24.596 -64.650 -11.648 1.00 39.76 ? 389 ARG A CB    1 
ATOM   3026 C  CG    . ARG A 1 392 ? 24.934 -64.977 -13.089 1.00 44.75 ? 389 ARG A CG    1 
ATOM   3027 C  CD    . ARG A 1 392 ? 23.921 -65.942 -13.661 1.00 52.81 ? 389 ARG A CD    1 
ATOM   3028 N  NE    . ARG A 1 392 ? 23.757 -67.105 -12.797 1.00 49.91 ? 389 ARG A NE    1 
ATOM   3029 C  CZ    . ARG A 1 392 ? 24.460 -68.228 -12.924 1.00 57.35 ? 389 ARG A CZ    1 
ATOM   3030 N  NH1   . ARG A 1 392 ? 24.251 -69.240 -12.083 1.00 55.83 ? 389 ARG A NH1   1 
ATOM   3031 N  NH2   . ARG A 1 392 ? 25.372 -68.343 -13.893 1.00 48.37 ? 389 ARG A NH2   1 
ATOM   3032 N  N     . TYR A 1 393 ? 23.096 -62.340 -9.849  1.00 38.24 ? 390 TYR A N     1 
ATOM   3033 C  CA    . TYR A 1 393 ? 22.361 -62.146 -8.608  1.00 34.96 ? 390 TYR A CA    1 
ATOM   3034 C  C     . TYR A 1 393 ? 21.674 -63.457 -8.255  1.00 39.45 ? 390 TYR A C     1 
ATOM   3035 O  O     . TYR A 1 393 ? 20.490 -63.652 -8.535  1.00 36.38 ? 390 TYR A O     1 
ATOM   3036 C  CB    . TYR A 1 393 ? 21.335 -61.013 -8.738  1.00 37.72 ? 390 TYR A CB    1 
ATOM   3037 C  CG    . TYR A 1 393 ? 21.940 -59.629 -8.786  1.00 33.35 ? 390 TYR A CG    1 
ATOM   3038 C  CD1   . TYR A 1 393 ? 23.318 -59.453 -8.773  1.00 34.82 ? 390 TYR A CD1   1 
ATOM   3039 C  CD2   . TYR A 1 393 ? 21.138 -58.505 -8.819  1.00 30.08 ? 390 TYR A CD2   1 
ATOM   3040 C  CE1   . TYR A 1 393 ? 23.873 -58.201 -8.796  1.00 33.97 ? 390 TYR A CE1   1 
ATOM   3041 C  CE2   . TYR A 1 393 ? 21.686 -57.243 -8.852  1.00 28.81 ? 390 TYR A CE2   1 
ATOM   3042 C  CZ    . TYR A 1 393 ? 23.053 -57.099 -8.832  1.00 32.54 ? 390 TYR A CZ    1 
ATOM   3043 O  OH    . TYR A 1 393 ? 23.625 -55.850 -8.864  1.00 36.88 ? 390 TYR A OH    1 
ATOM   3044 N  N     . ASP A 1 394 ? 22.439 -64.366 -7.663  1.00 41.44 ? 391 ASP A N     1 
ATOM   3045 C  CA    . ASP A 1 394 ? 21.949 -65.696 -7.336  1.00 37.74 ? 391 ASP A CA    1 
ATOM   3046 C  C     . ASP A 1 394 ? 22.528 -66.112 -5.993  1.00 36.67 ? 391 ASP A C     1 
ATOM   3047 O  O     . ASP A 1 394 ? 23.745 -66.168 -5.825  1.00 35.38 ? 391 ASP A O     1 
ATOM   3048 C  CB    . ASP A 1 394 ? 22.332 -66.692 -8.425  1.00 37.80 ? 391 ASP A CB    1 
ATOM   3049 C  CG    . ASP A 1 394 ? 21.991 -68.128 -8.056  1.00 39.20 ? 391 ASP A CG    1 
ATOM   3050 O  OD1   . ASP A 1 394 ? 20.824 -68.530 -8.228  1.00 44.92 ? 391 ASP A OD1   1 
ATOM   3051 O  OD2   . ASP A 1 394 ? 22.892 -68.859 -7.598  1.00 36.99 ? 391 ASP A OD2   1 
ATOM   3052 N  N     . ALA A 1 395 ? 21.650 -66.392 -5.039  1.00 35.25 ? 392 ALA A N     1 
ATOM   3053 C  CA    . ALA A 1 395 ? 22.075 -66.695 -3.689  1.00 32.93 ? 392 ALA A CA    1 
ATOM   3054 C  C     . ALA A 1 395 ? 22.965 -67.928 -3.642  1.00 34.31 ? 392 ALA A C     1 
ATOM   3055 O  O     . ALA A 1 395 ? 24.056 -67.887 -3.069  1.00 37.32 ? 392 ALA A O     1 
ATOM   3056 C  CB    . ALA A 1 395 ? 20.868 -66.875 -2.790  1.00 34.63 ? 392 ALA A CB    1 
ATOM   3057 N  N     . HIS A 1 396 ? 22.517 -69.020 -4.250  1.00 34.99 ? 393 HIS A N     1 
ATOM   3058 C  CA    . HIS A 1 396 ? 23.276 -70.263 -4.196  1.00 32.31 ? 393 HIS A CA    1 
ATOM   3059 C  C     . HIS A 1 396 ? 24.670 -70.119 -4.782  1.00 31.92 ? 393 HIS A C     1 
ATOM   3060 O  O     . HIS A 1 396 ? 25.649 -70.537 -4.153  1.00 35.53 ? 393 HIS A O     1 
ATOM   3061 C  CB    . HIS A 1 396 ? 22.505 -71.385 -4.885  1.00 35.22 ? 393 HIS A CB    1 
ATOM   3062 C  CG    . HIS A 1 396 ? 21.402 -71.940 -4.040  1.00 39.46 ? 393 HIS A CG    1 
ATOM   3063 N  ND1   . HIS A 1 396 ? 20.069 -71.673 -4.276  1.00 39.41 ? 393 HIS A ND1   1 
ATOM   3064 C  CD2   . HIS A 1 396 ? 21.441 -72.705 -2.922  1.00 39.84 ? 393 HIS A CD2   1 
ATOM   3065 C  CE1   . HIS A 1 396 ? 19.333 -72.274 -3.358  1.00 43.32 ? 393 HIS A CE1   1 
ATOM   3066 N  NE2   . HIS A 1 396 ? 20.142 -72.902 -2.521  1.00 44.79 ? 393 HIS A NE2   1 
ATOM   3067 N  N     . LYS A 1 397 ? 24.792 -69.497 -5.949  1.00 33.80 ? 394 LYS A N     1 
ATOM   3068 C  CA    . LYS A 1 397 ? 26.135 -69.238 -6.467  1.00 36.83 ? 394 LYS A CA    1 
ATOM   3069 C  C     . LYS A 1 397 ? 26.922 -68.311 -5.545  1.00 36.94 ? 394 LYS A C     1 
ATOM   3070 O  O     . LYS A 1 397 ? 28.102 -68.551 -5.272  1.00 39.63 ? 394 LYS A O     1 
ATOM   3071 C  CB    . LYS A 1 397 ? 26.118 -68.635 -7.877  1.00 33.89 ? 394 LYS A CB    1 
ATOM   3072 C  CG    . LYS A 1 397 ? 27.549 -68.520 -8.425  1.00 38.26 ? 394 LYS A CG    1 
ATOM   3073 C  CD    . LYS A 1 397 ? 27.651 -67.838 -9.784  1.00 40.53 ? 394 LYS A CD    1 
ATOM   3074 C  CE    . LYS A 1 397 ? 29.105 -67.501 -10.119 1.00 43.84 ? 394 LYS A CE    1 
ATOM   3075 N  NZ    . LYS A 1 397 ? 30.076 -68.642 -9.918  1.00 37.33 ? 394 LYS A NZ    1 
ATOM   3076 N  N     . MET A 1 398 ? 26.282 -67.260 -5.055  1.00 31.63 ? 395 MET A N     1 
ATOM   3077 C  CA    . MET A 1 398 ? 27.019 -66.293 -4.255  1.00 35.94 ? 395 MET A CA    1 
ATOM   3078 C  C     . MET A 1 398 ? 27.532 -66.887 -2.944  1.00 34.81 ? 395 MET A C     1 
ATOM   3079 O  O     . MET A 1 398 ? 28.647 -66.570 -2.513  1.00 33.97 ? 395 MET A O     1 
ATOM   3080 C  CB    . MET A 1 398 ? 26.163 -65.051 -3.984  1.00 32.84 ? 395 MET A CB    1 
ATOM   3081 C  CG    . MET A 1 398 ? 26.419 -63.951 -4.989  1.00 32.19 ? 395 MET A CG    1 
ATOM   3082 S  SD    . MET A 1 398 ? 25.536 -62.436 -4.631  1.00 45.41 ? 395 MET A SD    1 
ATOM   3083 C  CE    . MET A 1 398 ? 23.844 -62.963 -4.877  1.00 36.88 ? 395 MET A CE    1 
ATOM   3084 N  N     . SER A 1 399 ? 26.731 -67.742 -2.312  1.00 33.79 ? 396 SER A N     1 
ATOM   3085 C  CA    . SER A 1 399 ? 27.170 -68.397 -1.081  1.00 36.32 ? 396 SER A CA    1 
ATOM   3086 C  C     . SER A 1 399 ? 28.207 -69.472 -1.384  1.00 37.90 ? 396 SER A C     1 
ATOM   3087 O  O     . SER A 1 399 ? 29.177 -69.634 -0.644  1.00 35.89 ? 396 SER A O     1 
ATOM   3088 C  CB    . SER A 1 399 ? 25.991 -68.999 -0.322  1.00 33.92 ? 396 SER A CB    1 
ATOM   3089 O  OG    . SER A 1 399 ? 25.072 -69.640 -1.183  1.00 34.35 ? 396 SER A OG    1 
ATOM   3090 N  N     . HIS A 1 400 ? 28.005 -70.190 -2.486  1.00 39.60 ? 397 HIS A N     1 
ATOM   3091 C  CA    . HIS A 1 400 ? 28.987 -71.165 -2.952  1.00 38.98 ? 397 HIS A CA    1 
ATOM   3092 C  C     . HIS A 1 400 ? 30.341 -70.515 -3.225  1.00 38.37 ? 397 HIS A C     1 
ATOM   3093 O  O     . HIS A 1 400 ? 31.377 -71.062 -2.856  1.00 43.01 ? 397 HIS A O     1 
ATOM   3094 C  CB    . HIS A 1 400 ? 28.493 -71.876 -4.213  1.00 39.87 ? 397 HIS A CB    1 
ATOM   3095 C  CG    . HIS A 1 400 ? 29.368 -73.014 -4.635  1.00 47.85 ? 397 HIS A CG    1 
ATOM   3096 N  ND1   . HIS A 1 400 ? 30.384 -72.872 -5.556  1.00 53.61 ? 397 HIS A ND1   1 
ATOM   3097 C  CD2   . HIS A 1 400 ? 29.395 -74.311 -4.241  1.00 52.36 ? 397 HIS A CD2   1 
ATOM   3098 C  CE1   . HIS A 1 400 ? 30.994 -74.035 -5.717  1.00 53.92 ? 397 HIS A CE1   1 
ATOM   3099 N  NE2   . HIS A 1 400 ? 30.413 -74.923 -4.932  1.00 50.02 ? 397 HIS A NE2   1 
ATOM   3100 N  N     . ASP A 1 401 ? 30.332 -69.347 -3.860  1.00 36.28 ? 398 ASP A N     1 
ATOM   3101 C  CA    . ASP A 1 401 ? 31.574 -68.633 -4.144  1.00 39.20 ? 398 ASP A CA    1 
ATOM   3102 C  C     . ASP A 1 401 ? 32.232 -68.141 -2.864  1.00 40.14 ? 398 ASP A C     1 
ATOM   3103 O  O     . ASP A 1 401 ? 33.443 -68.278 -2.687  1.00 39.38 ? 398 ASP A O     1 
ATOM   3104 C  CB    . ASP A 1 401 ? 31.328 -67.450 -5.090  1.00 36.78 ? 398 ASP A CB    1 
ATOM   3105 C  CG    . ASP A 1 401 ? 30.912 -67.891 -6.471  1.00 40.87 ? 398 ASP A CG    1 
ATOM   3106 O  OD1   . ASP A 1 401 ? 31.266 -69.023 -6.865  1.00 39.23 ? 398 ASP A OD1   1 
ATOM   3107 O  OD2   . ASP A 1 401 ? 30.228 -67.109 -7.165  1.00 42.26 ? 398 ASP A OD2   1 
ATOM   3108 N  N     . ALA A 1 402 ? 31.428 -67.562 -1.974  1.00 43.38 ? 399 ALA A N     1 
ATOM   3109 C  CA    . ALA A 1 402 ? 31.927 -67.071 -0.693  1.00 37.20 ? 399 ALA A CA    1 
ATOM   3110 C  C     . ALA A 1 402 ? 32.555 -68.195 0.098   1.00 34.44 ? 399 ALA A C     1 
ATOM   3111 O  O     . ALA A 1 402 ? 33.527 -67.994 0.812   1.00 39.31 ? 399 ALA A O     1 
ATOM   3112 C  CB    . ALA A 1 402 ? 30.810 -66.432 0.102   1.00 39.50 ? 399 ALA A CB    1 
ATOM   3113 N  N     . PHE A 1 403 ? 31.993 -69.385 -0.012  1.00 33.96 ? 400 PHE A N     1 
ATOM   3114 C  CA    . PHE A 1 403 ? 32.565 -70.506 0.711   1.00 42.35 ? 400 PHE A CA    1 
ATOM   3115 C  C     . PHE A 1 403 ? 33.911 -70.901 0.108   1.00 41.63 ? 400 PHE A C     1 
ATOM   3116 O  O     . PHE A 1 403 ? 34.911 -71.005 0.822   1.00 42.33 ? 400 PHE A O     1 
ATOM   3117 C  CB    . PHE A 1 403 ? 31.617 -71.704 0.719   1.00 44.43 ? 400 PHE A CB    1 
ATOM   3118 C  CG    . PHE A 1 403 ? 32.120 -72.849 1.552   1.00 45.63 ? 400 PHE A CG    1 
ATOM   3119 C  CD1   . PHE A 1 403 ? 31.799 -72.936 2.889   1.00 43.13 ? 400 PHE A CD1   1 
ATOM   3120 C  CD2   . PHE A 1 403 ? 32.945 -73.821 0.997   1.00 50.14 ? 400 PHE A CD2   1 
ATOM   3121 C  CE1   . PHE A 1 403 ? 32.273 -73.976 3.664   1.00 51.56 ? 400 PHE A CE1   1 
ATOM   3122 C  CE2   . PHE A 1 403 ? 33.426 -74.865 1.767   1.00 51.47 ? 400 PHE A CE2   1 
ATOM   3123 C  CZ    . PHE A 1 403 ? 33.089 -74.939 3.105   1.00 53.40 ? 400 PHE A CZ    1 
ATOM   3124 N  N     . THR A 1 404 ? 33.918 -71.131 -1.201  1.00 39.20 ? 401 THR A N     1 
ATOM   3125 C  CA    . THR A 1 404 ? 35.148 -71.380 -1.946  1.00 41.24 ? 401 THR A CA    1 
ATOM   3126 C  C     . THR A 1 404 ? 36.315 -70.499 -1.485  1.00 41.68 ? 401 THR A C     1 
ATOM   3127 O  O     . THR A 1 404 ? 37.381 -71.003 -1.153  1.00 46.35 ? 401 THR A O     1 
ATOM   3128 C  CB    . THR A 1 404 ? 34.931 -71.167 -3.453  1.00 41.30 ? 401 THR A CB    1 
ATOM   3129 O  OG1   . THR A 1 404 ? 34.047 -72.178 -3.959  1.00 48.99 ? 401 THR A OG1   1 
ATOM   3130 C  CG2   . THR A 1 404 ? 36.246 -71.234 -4.201  1.00 36.49 ? 401 THR A CG2   1 
ATOM   3131 N  N     . VAL A 1 405 ? 36.099 -69.191 -1.413  1.00 43.74 ? 402 VAL A N     1 
ATOM   3132 C  CA    . VAL A 1 405 ? 37.193 -68.275 -1.096  1.00 41.02 ? 402 VAL A CA    1 
ATOM   3133 C  C     . VAL A 1 405 ? 37.571 -68.201 0.395   1.00 44.08 ? 402 VAL A C     1 
ATOM   3134 O  O     . VAL A 1 405 ? 38.581 -67.587 0.720   1.00 46.10 ? 402 VAL A O     1 
ATOM   3135 C  CB    . VAL A 1 405 ? 36.878 -66.843 -1.597  1.00 36.31 ? 402 VAL A CB    1 
ATOM   3136 C  CG1   . VAL A 1 405 ? 36.534 -66.864 -3.075  1.00 41.27 ? 402 VAL A CG1   1 
ATOM   3137 C  CG2   . VAL A 1 405 ? 35.744 -66.245 -0.825  1.00 39.97 ? 402 VAL A CG2   1 
ATOM   3138 N  N     . ILE A 1 406 ? 36.790 -68.810 1.295   1.00 43.63 ? 403 ILE A N     1 
ATOM   3139 C  CA    . ILE A 1 406 ? 37.163 -68.846 2.722   1.00 44.28 ? 403 ILE A CA    1 
ATOM   3140 C  C     . ILE A 1 406 ? 37.491 -70.242 3.288   1.00 47.65 ? 403 ILE A C     1 
ATOM   3141 O  O     . ILE A 1 406 ? 38.165 -70.345 4.319   1.00 46.01 ? 403 ILE A O     1 
ATOM   3142 C  CB    . ILE A 1 406 ? 36.057 -68.280 3.649   1.00 42.46 ? 403 ILE A CB    1 
ATOM   3143 C  CG1   . ILE A 1 406 ? 34.792 -69.130 3.536   1.00 43.06 ? 403 ILE A CG1   1 
ATOM   3144 C  CG2   . ILE A 1 406 ? 35.811 -66.809 3.388   1.00 41.39 ? 403 ILE A CG2   1 
ATOM   3145 C  CD1   . ILE A 1 406 ? 33.947 -69.087 4.743   1.00 43.67 ? 403 ILE A CD1   1 
ATOM   3146 N  N     . LYS A 1 407 ? 37.001 -71.295 2.631   1.00 46.35 ? 404 LYS A N     1 
ATOM   3147 C  CA    . LYS A 1 407 ? 37.130 -72.671 3.119   1.00 46.34 ? 404 LYS A CA    1 
ATOM   3148 C  C     . LYS A 1 407 ? 38.545 -73.095 3.531   1.00 51.07 ? 404 LYS A C     1 
ATOM   3149 O  O     . LYS A 1 407 ? 38.714 -74.019 4.329   1.00 53.35 ? 404 LYS A O     1 
ATOM   3150 C  CB    . LYS A 1 407 ? 36.612 -73.643 2.066   1.00 46.25 ? 404 LYS A CB    1 
ATOM   3151 C  CG    . LYS A 1 407 ? 37.402 -73.675 0.783   1.00 44.36 ? 404 LYS A CG    1 
ATOM   3152 C  CD    . LYS A 1 407 ? 36.733 -74.628 -0.203  1.00 46.05 ? 404 LYS A CD    1 
ATOM   3153 C  CE    . LYS A 1 407 ? 37.620 -74.936 -1.396  1.00 52.18 ? 404 LYS A CE    1 
ATOM   3154 N  NZ    . LYS A 1 407 ? 38.120 -73.691 -2.053  1.00 53.07 ? 404 LYS A NZ    1 
ATOM   3155 N  N     . ASN A 1 408 ? 39.560 -72.422 3.007   1.00 51.01 ? 405 ASN A N     1 
ATOM   3156 C  CA    . ASN A 1 408 ? 40.934 -72.765 3.354   1.00 53.67 ? 405 ASN A CA    1 
ATOM   3157 C  C     . ASN A 1 408 ? 41.352 -72.224 4.718   1.00 56.67 ? 405 ASN A C     1 
ATOM   3158 O  O     . ASN A 1 408 ? 42.453 -72.504 5.187   1.00 58.99 ? 405 ASN A O     1 
ATOM   3159 C  CB    . ASN A 1 408 ? 41.891 -72.256 2.280   1.00 53.09 ? 405 ASN A CB    1 
ATOM   3160 C  CG    . ASN A 1 408 ? 41.650 -70.805 1.941   1.00 58.98 ? 405 ASN A CG    1 
ATOM   3161 O  OD1   . ASN A 1 408 ? 40.616 -70.456 1.356   1.00 54.50 ? 405 ASN A OD1   1 
ATOM   3162 N  ND2   . ASN A 1 408 ? 42.606 -69.946 2.298   1.00 57.71 ? 405 ASN A ND2   1 
ATOM   3163 N  N     . CYS A 1 409 ? 40.478 -71.456 5.359   1.00 52.15 ? 406 CYS A N     1 
ATOM   3164 C  CA    . CYS A 1 409 ? 40.779 -70.963 6.696   1.00 52.63 ? 406 CYS A CA    1 
ATOM   3165 C  C     . CYS A 1 409 ? 40.494 -72.036 7.735   1.00 58.73 ? 406 CYS A C     1 
ATOM   3166 O  O     . CYS A 1 409 ? 40.904 -71.913 8.891   1.00 62.42 ? 406 CYS A O     1 
ATOM   3167 C  CB    . CYS A 1 409 ? 39.978 -69.703 7.014   1.00 51.14 ? 406 CYS A CB    1 
ATOM   3168 S  SG    . CYS A 1 409 ? 40.651 -68.197 6.283   1.00 64.25 ? 406 CYS A SG    1 
ATOM   3169 N  N     . ASN A 1 410 ? 39.795 -73.089 7.318   1.00 56.77 ? 407 ASN A N     1 
ATOM   3170 C  CA    . ASN A 1 410 ? 39.446 -74.184 8.216   1.00 57.51 ? 407 ASN A CA    1 
ATOM   3171 C  C     . ASN A 1 410 ? 40.653 -75.070 8.550   1.00 60.34 ? 407 ASN A C     1 
ATOM   3172 O  O     . ASN A 1 410 ? 41.084 -75.885 7.733   1.00 56.24 ? 407 ASN A O     1 
ATOM   3173 C  CB    . ASN A 1 410 ? 38.325 -75.028 7.607   1.00 53.59 ? 407 ASN A CB    1 
ATOM   3174 C  CG    . ASN A 1 410 ? 37.724 -75.991 8.601   1.00 56.19 ? 407 ASN A CG    1 
ATOM   3175 O  OD1   . ASN A 1 410 ? 38.126 -76.022 9.763   1.00 58.91 ? 407 ASN A OD1   1 
ATOM   3176 N  ND2   . ASN A 1 410 ? 36.745 -76.773 8.159   1.00 54.67 ? 407 ASN A ND2   1 
ATOM   3177 N  N     . THR A 1 411 ? 41.183 -74.909 9.760   1.00 59.41 ? 408 THR A N     1 
ATOM   3178 C  CA    . THR A 1 411 ? 42.354 -75.664 10.188  1.00 63.31 ? 408 THR A CA    1 
ATOM   3179 C  C     . THR A 1 411 ? 42.013 -77.085 10.631  1.00 64.23 ? 408 THR A C     1 
ATOM   3180 O  O     . THR A 1 411 ? 42.918 -77.883 10.878  1.00 68.91 ? 408 THR A O     1 
ATOM   3181 C  CB    . THR A 1 411 ? 43.091 -74.968 11.353  1.00 63.49 ? 408 THR A CB    1 
ATOM   3182 O  OG1   . THR A 1 411 ? 42.266 -74.986 12.523  1.00 65.86 ? 408 THR A OG1   1 
ATOM   3183 C  CG2   . THR A 1 411 ? 43.431 -73.533 11.001  1.00 62.90 ? 408 THR A CG2   1 
ATOM   3184 N  N     . SER A 1 412 ? 40.721 -77.399 10.730  1.00 63.64 ? 409 SER A N     1 
ATOM   3185 C  CA    . SER A 1 412 ? 40.283 -78.719 11.200  1.00 65.71 ? 409 SER A CA    1 
ATOM   3186 C  C     . SER A 1 412 ? 40.592 -79.856 10.251  1.00 69.68 ? 409 SER A C     1 
ATOM   3187 O  O     . SER A 1 412 ? 40.097 -79.886 9.123   1.00 73.01 ? 409 SER A O     1 
ATOM   3188 C  CB    . SER A 1 412 ? 38.784 -78.728 11.469  1.00 63.36 ? 409 SER A CB    1 
ATOM   3189 O  OG    . SER A 1 412 ? 38.525 -78.489 12.836  1.00 63.74 ? 409 SER A OG    1 
ATOM   3190 N  N     . GLY A 1 413 ? 41.379 -80.812 10.734  1.00 71.00 ? 410 GLY A N     1 
ATOM   3191 C  CA    . GLY A 1 413 ? 41.704 -81.996 9.960   1.00 76.72 ? 410 GLY A CA    1 
ATOM   3192 C  C     . GLY A 1 413 ? 40.479 -82.829 9.619   1.00 74.56 ? 410 GLY A C     1 
ATOM   3193 O  O     . GLY A 1 413 ? 40.477 -83.566 8.636   1.00 76.28 ? 410 GLY A O     1 
ATOM   3194 N  N     . ILE A 1 414 ? 39.439 -82.711 10.439  1.00 74.99 ? 411 ILE A N     1 
ATOM   3195 C  CA    . ILE A 1 414 ? 38.189 -83.424 10.212  1.00 74.91 ? 411 ILE A CA    1 
ATOM   3196 C  C     . ILE A 1 414 ? 37.516 -82.864 8.969   1.00 76.01 ? 411 ILE A C     1 
ATOM   3197 O  O     . ILE A 1 414 ? 37.675 -81.684 8.661   1.00 76.23 ? 411 ILE A O     1 
ATOM   3198 C  CB    . ILE A 1 414 ? 37.231 -83.295 11.418  1.00 70.95 ? 411 ILE A CB    1 
ATOM   3199 C  CG1   . ILE A 1 414 ? 38.008 -83.326 12.736  1.00 71.81 ? 411 ILE A CG1   1 
ATOM   3200 C  CG2   . ILE A 1 414 ? 36.153 -84.375 11.379  1.00 67.30 ? 411 ILE A CG2   1 
ATOM   3201 C  CD1   . ILE A 1 414 ? 38.770 -84.611 12.972  1.00 76.26 ? 411 ILE A CD1   1 
ATOM   3202 N  N     . GLN A 1 415 ? 36.769 -83.703 8.255   1.00 76.10 ? 412 GLN A N     1 
ATOM   3203 C  CA    . GLN A 1 415 ? 36.048 -83.257 7.061   1.00 77.60 ? 412 GLN A CA    1 
ATOM   3204 C  C     . GLN A 1 415 ? 34.899 -82.298 7.391   1.00 73.90 ? 412 GLN A C     1 
ATOM   3205 O  O     . GLN A 1 415 ? 34.739 -81.257 6.747   1.00 73.23 ? 412 GLN A O     1 
ATOM   3206 C  CB    . GLN A 1 415 ? 35.508 -84.465 6.276   1.00 81.10 ? 412 GLN A CB    1 
ATOM   3207 C  CG    . GLN A 1 415 ? 34.501 -85.348 7.038   1.00 79.84 ? 412 GLN A CG    1 
ATOM   3208 C  CD    . GLN A 1 415 ? 34.010 -86.534 6.218   1.00 82.78 ? 412 GLN A CD    1 
ATOM   3209 O  OE1   . GLN A 1 415 ? 34.636 -86.917 5.229   1.00 86.98 ? 412 GLN A OE1   1 
ATOM   3210 N  NE2   . GLN A 1 415 ? 32.890 -87.124 6.631   1.00 71.01 ? 412 GLN A NE2   1 
ATOM   3211 N  N     . THR A 1 416 ? 34.124 -82.645 8.414   1.00 70.46 ? 413 THR A N     1 
ATOM   3212 C  CA    . THR A 1 416 ? 32.831 -82.023 8.658   1.00 66.31 ? 413 THR A CA    1 
ATOM   3213 C  C     . THR A 1 416 ? 32.865 -80.905 9.695   1.00 60.64 ? 413 THR A C     1 
ATOM   3214 O  O     . THR A 1 416 ? 31.833 -80.327 10.017  1.00 57.40 ? 413 THR A O     1 
ATOM   3215 C  CB    . THR A 1 416 ? 31.812 -83.077 9.114   1.00 69.56 ? 413 THR A CB    1 
ATOM   3216 O  OG1   . THR A 1 416 ? 30.597 -82.432 9.516   1.00 71.65 ? 413 THR A OG1   1 
ATOM   3217 C  CG2   . THR A 1 416 ? 32.374 -83.886 10.283  1.00 66.83 ? 413 THR A CG2   1 
ATOM   3218 N  N     . GLU A 1 417 ? 34.050 -80.606 10.211  1.00 59.02 ? 414 GLU A N     1 
ATOM   3219 C  CA    . GLU A 1 417 ? 34.182 -79.631 11.280  1.00 58.85 ? 414 GLU A CA    1 
ATOM   3220 C  C     . GLU A 1 417 ? 34.811 -78.338 10.807  1.00 57.89 ? 414 GLU A C     1 
ATOM   3221 O  O     . GLU A 1 417 ? 35.497 -78.293 9.785   1.00 57.76 ? 414 GLU A O     1 
ATOM   3222 C  CB    . GLU A 1 417 ? 35.010 -80.208 12.425  1.00 59.50 ? 414 GLU A CB    1 
ATOM   3223 C  CG    . GLU A 1 417 ? 34.529 -81.563 12.888  1.00 59.37 ? 414 GLU A CG    1 
ATOM   3224 C  CD    . GLU A 1 417 ? 33.150 -81.506 13.473  1.00 57.54 ? 414 GLU A CD    1 
ATOM   3225 O  OE1   . GLU A 1 417 ? 32.977 -80.799 14.486  1.00 56.34 ? 414 GLU A OE1   1 
ATOM   3226 O  OE2   . GLU A 1 417 ? 32.241 -82.152 12.913  1.00 58.44 ? 414 GLU A OE2   1 
ATOM   3227 N  N     . TRP A 1 418 ? 34.578 -77.277 11.565  1.00 54.55 ? 415 TRP A N     1 
ATOM   3228 C  CA    . TRP A 1 418 ? 35.170 -76.005 11.227  1.00 53.53 ? 415 TRP A CA    1 
ATOM   3229 C  C     . TRP A 1 418 ? 35.939 -75.445 12.408  1.00 52.96 ? 415 TRP A C     1 
ATOM   3230 O  O     . TRP A 1 418 ? 35.390 -75.280 13.488  1.00 56.98 ? 415 TRP A O     1 
ATOM   3231 C  CB    . TRP A 1 418 ? 34.104 -75.005 10.764  1.00 51.67 ? 415 TRP A CB    1 
ATOM   3232 C  CG    . TRP A 1 418 ? 34.742 -73.853 10.091  1.00 51.12 ? 415 TRP A CG    1 
ATOM   3233 C  CD1   . TRP A 1 418 ? 35.417 -72.829 10.689  1.00 48.79 ? 415 TRP A CD1   1 
ATOM   3234 C  CD2   . TRP A 1 418 ? 34.836 -73.626 8.681   1.00 52.02 ? 415 TRP A CD2   1 
ATOM   3235 N  NE1   . TRP A 1 418 ? 35.909 -71.970 9.741   1.00 55.53 ? 415 TRP A NE1   1 
ATOM   3236 C  CE2   . TRP A 1 418 ? 35.565 -72.434 8.495   1.00 49.38 ? 415 TRP A CE2   1 
ATOM   3237 C  CE3   . TRP A 1 418 ? 34.361 -74.310 7.553   1.00 53.57 ? 415 TRP A CE3   1 
ATOM   3238 C  CZ2   . TRP A 1 418 ? 35.830 -71.904 7.236   1.00 48.93 ? 415 TRP A CZ2   1 
ATOM   3239 C  CZ3   . TRP A 1 418 ? 34.626 -73.782 6.294   1.00 50.27 ? 415 TRP A CZ3   1 
ATOM   3240 C  CH2   . TRP A 1 418 ? 35.350 -72.588 6.150   1.00 49.81 ? 415 TRP A CH2   1 
ATOM   3241 N  N     . SER A 1 419 ? 37.213 -75.141 12.204  1.00 55.04 ? 416 SER A N     1 
ATOM   3242 C  CA    . SER A 1 419 ? 37.995 -74.543 13.274  1.00 57.90 ? 416 SER A CA    1 
ATOM   3243 C  C     . SER A 1 419 ? 38.969 -73.506 12.743  1.00 58.76 ? 416 SER A C     1 
ATOM   3244 O  O     . SER A 1 419 ? 39.513 -73.670 11.648  1.00 59.21 ? 416 SER A O     1 
ATOM   3245 C  CB    . SER A 1 419 ? 38.755 -75.612 14.056  1.00 61.01 ? 416 SER A CB    1 
ATOM   3246 O  OG    . SER A 1 419 ? 39.248 -75.076 15.274  1.00 65.59 ? 416 SER A OG    1 
ATOM   3247 N  N     . PRO A 1 420 ? 39.174 -72.418 13.510  1.00 59.05 ? 417 PRO A N     1 
ATOM   3248 C  CA    . PRO A 1 420 ? 38.423 -72.111 14.738  1.00 55.75 ? 417 PRO A CA    1 
ATOM   3249 C  C     . PRO A 1 420 ? 37.010 -71.657 14.400  1.00 53.87 ? 417 PRO A C     1 
ATOM   3250 O  O     . PRO A 1 420 ? 36.787 -71.231 13.271  1.00 55.53 ? 417 PRO A O     1 
ATOM   3251 C  CB    . PRO A 1 420 ? 39.231 -70.980 15.382  1.00 55.16 ? 417 PRO A CB    1 
ATOM   3252 C  CG    . PRO A 1 420 ? 40.553 -70.962 14.655  1.00 62.03 ? 417 PRO A CG    1 
ATOM   3253 C  CD    . PRO A 1 420 ? 40.253 -71.445 13.276  1.00 62.37 ? 417 PRO A CD    1 
ATOM   3254 N  N     . PRO A 1 421 ? 36.069 -71.773 15.346  1.00 51.93 ? 418 PRO A N     1 
ATOM   3255 C  CA    . PRO A 1 421 ? 34.667 -71.460 15.042  1.00 53.30 ? 418 PRO A CA    1 
ATOM   3256 C  C     . PRO A 1 421 ? 34.481 -70.013 14.593  1.00 47.71 ? 418 PRO A C     1 
ATOM   3257 O  O     . PRO A 1 421 ? 35.162 -69.129 15.123  1.00 48.29 ? 418 PRO A O     1 
ATOM   3258 C  CB    . PRO A 1 421 ? 33.953 -71.719 16.374  1.00 47.47 ? 418 PRO A CB    1 
ATOM   3259 C  CG    . PRO A 1 421 ? 34.851 -72.621 17.124  1.00 48.54 ? 418 PRO A CG    1 
ATOM   3260 C  CD    . PRO A 1 421 ? 36.238 -72.212 16.741  1.00 52.47 ? 418 PRO A CD    1 
ATOM   3261 N  N     . LEU A 1 422 ? 33.586 -69.785 13.631  1.00 41.04 ? 419 LEU A N     1 
ATOM   3262 C  CA    . LEU A 1 422 ? 33.386 -68.447 13.070  1.00 42.57 ? 419 LEU A CA    1 
ATOM   3263 C  C     . LEU A 1 422 ? 32.413 -67.581 13.869  1.00 37.90 ? 419 LEU A C     1 
ATOM   3264 O  O     . LEU A 1 422 ? 31.261 -67.965 14.079  1.00 41.08 ? 419 LEU A O     1 
ATOM   3265 C  CB    . LEU A 1 422 ? 32.895 -68.549 11.627  1.00 43.00 ? 419 LEU A CB    1 
ATOM   3266 C  CG    . LEU A 1 422 ? 33.858 -69.184 10.629  1.00 42.84 ? 419 LEU A CG    1 
ATOM   3267 C  CD1   . LEU A 1 422 ? 33.363 -68.926 9.225   1.00 39.95 ? 419 LEU A CD1   1 
ATOM   3268 C  CD2   . LEU A 1 422 ? 35.273 -68.662 10.827  1.00 38.47 ? 419 LEU A CD2   1 
ATOM   3269 N  N     . THR A 1 423 ? 32.866 -66.404 14.284  1.00 36.28 ? 420 THR A N     1 
ATOM   3270 C  CA    . THR A 1 423 ? 32.037 -65.510 15.083  1.00 38.37 ? 420 THR A CA    1 
ATOM   3271 C  C     . THR A 1 423 ? 31.419 -64.356 14.277  1.00 36.47 ? 420 THR A C     1 
ATOM   3272 O  O     . THR A 1 423 ? 30.649 -63.555 14.808  1.00 33.90 ? 420 THR A O     1 
ATOM   3273 C  CB    . THR A 1 423 ? 32.835 -64.931 16.251  1.00 39.40 ? 420 THR A CB    1 
ATOM   3274 O  OG1   . THR A 1 423 ? 34.063 -64.391 15.757  1.00 43.91 ? 420 THR A OG1   1 
ATOM   3275 C  CG2   . THR A 1 423 ? 33.148 -66.028 17.261  1.00 43.31 ? 420 THR A CG2   1 
ATOM   3276 N  N     . MET A 1 424 ? 31.745 -64.270 12.997  1.00 33.49 ? 421 MET A N     1 
ATOM   3277 C  CA    . MET A 1 424 ? 31.031 -63.347 12.124  1.00 32.51 ? 421 MET A CA    1 
ATOM   3278 C  C     . MET A 1 424 ? 31.067 -63.805 10.674  1.00 35.25 ? 421 MET A C     1 
ATOM   3279 O  O     . MET A 1 424 ? 32.087 -64.310 10.193  1.00 38.74 ? 421 MET A O     1 
ATOM   3280 C  CB    . MET A 1 424 ? 31.613 -61.940 12.232  1.00 37.84 ? 421 MET A CB    1 
ATOM   3281 C  CG    . MET A 1 424 ? 30.750 -60.877 11.563  1.00 36.31 ? 421 MET A CG    1 
ATOM   3282 S  SD    . MET A 1 424 ? 31.712 -59.537 10.866  1.00 50.26 ? 421 MET A SD    1 
ATOM   3283 C  CE    . MET A 1 424 ? 32.890 -60.497 9.920   1.00 37.96 ? 421 MET A CE    1 
ATOM   3284 N  N     . LEU A 1 425 ? 29.937 -63.645 9.993   1.00 30.60 ? 422 LEU A N     1 
ATOM   3285 C  CA    . LEU A 1 425 ? 29.882 -63.742 8.545   1.00 29.29 ? 422 LEU A CA    1 
ATOM   3286 C  C     . LEU A 1 425 ? 29.406 -62.401 7.960   1.00 35.45 ? 422 LEU A C     1 
ATOM   3287 O  O     . LEU A 1 425 ? 28.452 -61.798 8.467   1.00 33.35 ? 422 LEU A O     1 
ATOM   3288 C  CB    . LEU A 1 425 ? 28.966 -64.886 8.105   1.00 28.46 ? 422 LEU A CB    1 
ATOM   3289 C  CG    . LEU A 1 425 ? 29.359 -66.345 8.364   1.00 29.97 ? 422 LEU A CG    1 
ATOM   3290 C  CD1   . LEU A 1 425 ? 28.377 -67.291 7.680   1.00 26.66 ? 422 LEU A CD1   1 
ATOM   3291 C  CD2   . LEU A 1 425 ? 30.794 -66.658 7.929   1.00 30.74 ? 422 LEU A CD2   1 
ATOM   3292 N  N     . PHE A 1 426 ? 30.082 -61.937 6.903   1.00 34.50 ? 423 PHE A N     1 
ATOM   3293 C  CA    . PHE A 1 426 ? 29.777 -60.655 6.256   1.00 31.01 ? 423 PHE A CA    1 
ATOM   3294 C  C     . PHE A 1 426 ? 29.906 -60.786 4.738   1.00 33.04 ? 423 PHE A C     1 
ATOM   3295 O  O     . PHE A 1 426 ? 30.975 -61.122 4.219   1.00 35.91 ? 423 PHE A O     1 
ATOM   3296 C  CB    . PHE A 1 426 ? 30.712 -59.559 6.786   1.00 31.46 ? 423 PHE A CB    1 
ATOM   3297 C  CG    . PHE A 1 426 ? 30.338 -58.155 6.373   1.00 37.50 ? 423 PHE A CG    1 
ATOM   3298 C  CD1   . PHE A 1 426 ? 29.064 -57.844 5.933   1.00 38.78 ? 423 PHE A CD1   1 
ATOM   3299 C  CD2   . PHE A 1 426 ? 31.260 -57.125 6.468   1.00 46.62 ? 423 PHE A CD2   1 
ATOM   3300 C  CE1   . PHE A 1 426 ? 28.715 -56.536 5.580   1.00 37.13 ? 423 PHE A CE1   1 
ATOM   3301 C  CE2   . PHE A 1 426 ? 30.919 -55.817 6.113   1.00 43.72 ? 423 PHE A CE2   1 
ATOM   3302 C  CZ    . PHE A 1 426 ? 29.638 -55.528 5.671   1.00 36.30 ? 423 PHE A CZ    1 
ATOM   3303 N  N     . LEU A 1 427 ? 28.816 -60.538 4.028   1.00 28.71 ? 424 LEU A N     1 
ATOM   3304 C  CA    . LEU A 1 427 ? 28.834 -60.553 2.568   1.00 30.89 ? 424 LEU A CA    1 
ATOM   3305 C  C     . LEU A 1 427 ? 28.612 -59.149 2.068   1.00 28.90 ? 424 LEU A C     1 
ATOM   3306 O  O     . LEU A 1 427 ? 27.667 -58.502 2.490   1.00 36.44 ? 424 LEU A O     1 
ATOM   3307 C  CB    . LEU A 1 427 ? 27.754 -61.486 1.999   1.00 32.47 ? 424 LEU A CB    1 
ATOM   3308 C  CG    . LEU A 1 427 ? 28.003 -62.997 1.999   1.00 33.53 ? 424 LEU A CG    1 
ATOM   3309 C  CD1   . LEU A 1 427 ? 26.850 -63.732 1.323   1.00 30.83 ? 424 LEU A CD1   1 
ATOM   3310 C  CD2   . LEU A 1 427 ? 29.319 -63.341 1.313   1.00 30.88 ? 424 LEU A CD2   1 
ATOM   3311 N  N     . CYS A 1 428 ? 29.460 -58.659 1.174   1.00 28.96 ? 425 CYS A N     1 
ATOM   3312 C  CA    . CYS A 1 428 ? 29.281 -57.281 0.692   1.00 36.89 ? 425 CYS A CA    1 
ATOM   3313 C  C     . CYS A 1 428 ? 29.409 -57.145 -0.835  1.00 36.81 ? 425 CYS A C     1 
ATOM   3314 O  O     . CYS A 1 428 ? 30.419 -57.530 -1.445  1.00 32.89 ? 425 CYS A O     1 
ATOM   3315 C  CB    . CYS A 1 428 ? 30.275 -56.334 1.390   1.00 35.73 ? 425 CYS A CB    1 
ATOM   3316 S  SG    . CYS A 1 428 ? 29.951 -54.557 1.159   1.00 39.59 ? 425 CYS A SG    1 
ATOM   3317 N  N     . ALA A 1 429 ? 28.364 -56.595 -1.442  1.00 32.38 ? 426 ALA A N     1 
ATOM   3318 C  CA    . ALA A 1 429 ? 28.379 -56.339 -2.863  1.00 33.17 ? 426 ALA A CA    1 
ATOM   3319 C  C     . ALA A 1 429 ? 28.936 -54.933 -3.113  1.00 34.95 ? 426 ALA A C     1 
ATOM   3320 O  O     . ALA A 1 429 ? 28.394 -53.939 -2.620  1.00 31.23 ? 426 ALA A O     1 
ATOM   3321 C  CB    . ALA A 1 429 ? 26.999 -56.483 -3.440  1.00 26.81 ? 426 ALA A CB    1 
ATOM   3322 N  N     . THR A 1 430 ? 30.033 -54.865 -3.860  1.00 26.77 ? 427 THR A N     1 
ATOM   3323 C  CA    . THR A 1 430 ? 30.694 -53.606 -4.142  1.00 33.11 ? 427 THR A CA    1 
ATOM   3324 C  C     . THR A 1 430 ? 30.923 -53.469 -5.639  1.00 33.72 ? 427 THR A C     1 
ATOM   3325 O  O     . THR A 1 430 ? 30.562 -54.360 -6.406  1.00 33.40 ? 427 THR A O     1 
ATOM   3326 C  CB    . THR A 1 430 ? 32.042 -53.503 -3.435  1.00 30.65 ? 427 THR A CB    1 
ATOM   3327 O  OG1   . THR A 1 430 ? 32.997 -54.269 -4.173  1.00 41.54 ? 427 THR A OG1   1 
ATOM   3328 C  CG2   . THR A 1 430 ? 31.968 -54.079 -2.030  1.00 34.30 ? 427 THR A CG2   1 
ATOM   3329 N  N     . LYS A 1 431 ? 31.530 -52.347 -6.033  1.00 35.33 ? 428 LYS A N     1 
ATOM   3330 C  CA    . LYS A 1 431 ? 31.942 -52.095 -7.412  1.00 30.94 ? 428 LYS A CA    1 
ATOM   3331 C  C     . LYS A 1 431 ? 30.773 -52.048 -8.392  1.00 30.43 ? 428 LYS A C     1 
ATOM   3332 O  O     . LYS A 1 431 ? 30.625 -52.932 -9.228  1.00 35.33 ? 428 LYS A O     1 
ATOM   3333 C  CB    . LYS A 1 431 ? 32.945 -53.159 -7.864  1.00 33.51 ? 428 LYS A CB    1 
ATOM   3334 C  CG    . LYS A 1 431 ? 34.156 -53.268 -6.985  1.00 37.40 ? 428 LYS A CG    1 
ATOM   3335 C  CD    . LYS A 1 431 ? 35.192 -52.210 -7.309  1.00 43.91 ? 428 LYS A CD    1 
ATOM   3336 C  CE    . LYS A 1 431 ? 36.512 -52.481 -6.574  1.00 46.50 ? 428 LYS A CE    1 
ATOM   3337 N  NZ    . LYS A 1 431 ? 37.089 -53.808 -6.931  1.00 41.28 ? 428 LYS A NZ    1 
ATOM   3338 N  N     . PHE A 1 432 ? 29.957 -51.010 -8.298  1.00 30.32 ? 429 PHE A N     1 
ATOM   3339 C  CA    . PHE A 1 432 ? 28.783 -50.892 -9.147  1.00 35.84 ? 429 PHE A CA    1 
ATOM   3340 C  C     . PHE A 1 432 ? 29.101 -50.342 -10.526 1.00 40.12 ? 429 PHE A C     1 
ATOM   3341 O  O     . PHE A 1 432 ? 29.985 -49.497 -10.675 1.00 43.66 ? 429 PHE A O     1 
ATOM   3342 C  CB    . PHE A 1 432 ? 27.732 -50.019 -8.461  1.00 35.52 ? 429 PHE A CB    1 
ATOM   3343 C  CG    . PHE A 1 432 ? 27.018 -50.720 -7.341  1.00 38.48 ? 429 PHE A CG    1 
ATOM   3344 C  CD1   . PHE A 1 432 ? 25.845 -51.426 -7.581  1.00 36.36 ? 429 PHE A CD1   1 
ATOM   3345 C  CD2   . PHE A 1 432 ? 27.536 -50.710 -6.055  1.00 36.25 ? 429 PHE A CD2   1 
ATOM   3346 C  CE1   . PHE A 1 432 ? 25.193 -52.087 -6.554  1.00 34.18 ? 429 PHE A CE1   1 
ATOM   3347 C  CE2   . PHE A 1 432 ? 26.885 -51.379 -5.022  1.00 36.66 ? 429 PHE A CE2   1 
ATOM   3348 C  CZ    . PHE A 1 432 ? 25.719 -52.066 -5.273  1.00 34.28 ? 429 PHE A CZ    1 
ATOM   3349 N  N     . SER A 1 433 ? 28.381 -50.853 -11.524 1.00 38.81 ? 430 SER A N     1 
ATOM   3350 C  CA    . SER A 1 433 ? 28.405 -50.354 -12.900 1.00 36.47 ? 430 SER A CA    1 
ATOM   3351 C  C     . SER A 1 433 ? 26.988 -50.065 -13.367 1.00 39.14 ? 430 SER A C     1 
ATOM   3352 O  O     . SER A 1 433 ? 26.059 -50.753 -12.973 1.00 39.35 ? 430 SER A O     1 
ATOM   3353 C  CB    . SER A 1 433 ? 29.051 -51.363 -13.846 1.00 40.86 ? 430 SER A CB    1 
ATOM   3354 O  OG    . SER A 1 433 ? 30.449 -51.416 -13.649 1.00 51.54 ? 430 SER A OG    1 
ATOM   3355 N  N     . ALA A 1 434 ? 26.826 -49.065 -14.223 1.00 43.61 ? 431 ALA A N     1 
ATOM   3356 C  CA    . ALA A 1 434 ? 25.503 -48.697 -14.725 1.00 46.30 ? 431 ALA A CA    1 
ATOM   3357 C  C     . ALA A 1 434 ? 24.865 -49.817 -15.557 1.00 47.90 ? 431 ALA A C     1 
ATOM   3358 O  O     . ALA A 1 434 ? 25.473 -50.349 -16.493 1.00 46.29 ? 431 ALA A O     1 
ATOM   3359 C  CB    . ALA A 1 434 ? 25.586 -47.414 -15.544 1.00 49.86 ? 431 ALA A CB    1 
ATOM   3360 N  N     . SER A 1 435 ? 23.635 -50.172 -15.192 1.00 47.69 ? 432 SER A N     1 
ATOM   3361 C  CA    . SER A 1 435 ? 22.875 -51.198 -15.889 1.00 44.21 ? 432 SER A CA    1 
ATOM   3362 C  C     . SER A 1 435 ? 21.757 -50.517 -16.659 1.00 47.88 ? 432 SER A C     1 
ATOM   3363 O  O     . SER A 1 435 ? 21.993 -49.797 -17.629 1.00 52.26 ? 432 SER A O     1 
ATOM   3364 C  CB    . SER A 1 435 ? 22.313 -52.232 -14.901 1.00 44.95 ? 432 SER A CB    1 
ATOM   3365 O  OG    . SER A 1 435 ? 21.401 -53.141 -15.517 1.00 46.23 ? 432 SER A OG    1 
ATOM   3366 O  OXT   . SER A 1 435 ? 20.588 -50.647 -16.316 1.00 51.09 ? 432 SER A OXT   1 
ATOM   3367 O  "O5'" . DA  B 2 1   ? 41.910 -56.542 -5.334  1.00 47.37 ? 1   DA  P "O5'" 1 
ATOM   3368 C  "C5'" . DA  B 2 1   ? 42.825 -57.556 -5.743  1.00 45.15 ? 1   DA  P "C5'" 1 
ATOM   3369 C  "C4'" . DA  B 2 1   ? 43.662 -58.022 -4.568  1.00 46.16 ? 1   DA  P "C4'" 1 
ATOM   3370 O  "O4'" . DA  B 2 1   ? 44.555 -56.957 -4.165  1.00 40.78 ? 1   DA  P "O4'" 1 
ATOM   3371 C  "C3'" . DA  B 2 1   ? 42.867 -58.406 -3.318  1.00 47.41 ? 1   DA  P "C3'" 1 
ATOM   3372 O  "O3'" . DA  B 2 1   ? 43.506 -59.485 -2.640  1.00 48.97 ? 1   DA  P "O3'" 1 
ATOM   3373 C  "C2'" . DA  B 2 1   ? 42.883 -57.128 -2.480  1.00 44.13 ? 1   DA  P "C2'" 1 
ATOM   3374 C  "C1'" . DA  B 2 1   ? 44.223 -56.493 -2.863  1.00 43.24 ? 1   DA  P "C1'" 1 
ATOM   3375 N  N9    . DA  B 2 1   ? 44.158 -55.033 -2.895  1.00 37.29 ? 1   DA  P N9    1 
ATOM   3376 C  C8    . DA  B 2 1   ? 43.340 -54.266 -3.687  1.00 37.91 ? 1   DA  P C8    1 
ATOM   3377 N  N7    . DA  B 2 1   ? 43.480 -52.970 -3.500  1.00 40.12 ? 1   DA  P N7    1 
ATOM   3378 C  C5    . DA  B 2 1   ? 44.443 -52.885 -2.504  1.00 34.22 ? 1   DA  P C5    1 
ATOM   3379 C  C6    . DA  B 2 1   ? 45.036 -51.792 -1.861  1.00 35.44 ? 1   DA  P C6    1 
ATOM   3380 N  N6    . DA  B 2 1   ? 44.719 -50.523 -2.142  1.00 35.61 ? 1   DA  P N6    1 
ATOM   3381 N  N1    . DA  B 2 1   ? 45.979 -52.049 -0.914  1.00 34.51 ? 1   DA  P N1    1 
ATOM   3382 C  C2    . DA  B 2 1   ? 46.298 -53.320 -0.645  1.00 31.14 ? 1   DA  P C2    1 
ATOM   3383 N  N3    . DA  B 2 1   ? 45.810 -54.437 -1.193  1.00 36.81 ? 1   DA  P N3    1 
ATOM   3384 C  C4    . DA  B 2 1   ? 44.875 -54.147 -2.122  1.00 34.94 ? 1   DA  P C4    1 
ATOM   3385 P  P     . DG  B 2 2   ? 42.673 -60.427 -1.632  1.00 49.28 ? 2   DG  P P     1 
ATOM   3386 O  OP1   . DG  B 2 2   ? 43.355 -61.737 -1.678  1.00 43.10 ? 2   DG  P OP1   1 
ATOM   3387 O  OP2   . DG  B 2 2   ? 41.224 -60.303 -1.935  1.00 42.18 ? 2   DG  P OP2   1 
ATOM   3388 O  "O5'" . DG  B 2 2   ? 42.945 -59.792 -0.187  1.00 41.73 ? 2   DG  P "O5'" 1 
ATOM   3389 C  "C5'" . DG  B 2 2   ? 44.146 -60.117 0.510   1.00 37.97 ? 2   DG  P "C5'" 1 
ATOM   3390 C  "C4'" . DG  B 2 2   ? 44.393 -59.134 1.628   1.00 36.00 ? 2   DG  P "C4'" 1 
ATOM   3391 O  "O4'" . DG  B 2 2   ? 44.286 -57.794 1.114   1.00 38.14 ? 2   DG  P "O4'" 1 
ATOM   3392 C  "C3'" . DG  B 2 2   ? 43.398 -59.220 2.794   1.00 40.52 ? 2   DG  P "C3'" 1 
ATOM   3393 O  "O3'" . DG  B 2 2   ? 44.108 -59.534 3.986   1.00 40.83 ? 2   DG  P "O3'" 1 
ATOM   3394 C  "C2'" . DG  B 2 2   ? 42.742 -57.827 2.849   1.00 33.74 ? 2   DG  P "C2'" 1 
ATOM   3395 C  "C1'" . DG  B 2 2   ? 43.762 -56.970 2.114   1.00 39.69 ? 2   DG  P "C1'" 1 
ATOM   3396 N  N9    . DG  B 2 2   ? 43.209 -55.754 1.500   1.00 35.60 ? 2   DG  P N9    1 
ATOM   3397 C  C8    . DG  B 2 2   ? 42.178 -55.665 0.597   1.00 34.31 ? 2   DG  P C8    1 
ATOM   3398 N  N7    . DG  B 2 2   ? 41.910 -54.441 0.234   1.00 31.42 ? 2   DG  P N7    1 
ATOM   3399 C  C5    . DG  B 2 2   ? 42.834 -53.668 0.938   1.00 36.04 ? 2   DG  P C5    1 
ATOM   3400 C  C6    . DG  B 2 2   ? 43.040 -52.263 0.958   1.00 32.67 ? 2   DG  P C6    1 
ATOM   3401 O  O6    . DG  B 2 2   ? 42.437 -51.385 0.333   1.00 33.73 ? 2   DG  P O6    1 
ATOM   3402 N  N1    . DG  B 2 2   ? 44.076 -51.911 1.803   1.00 34.58 ? 2   DG  P N1    1 
ATOM   3403 C  C2    . DG  B 2 2   ? 44.826 -52.795 2.534   1.00 34.24 ? 2   DG  P C2    1 
ATOM   3404 N  N2    . DG  B 2 2   ? 45.797 -52.269 3.294   1.00 33.25 ? 2   DG  P N2    1 
ATOM   3405 N  N3    . DG  B 2 2   ? 44.645 -54.098 2.523   1.00 33.34 ? 2   DG  P N3    1 
ATOM   3406 C  C4    . DG  B 2 2   ? 43.637 -54.464 1.713   1.00 33.92 ? 2   DG  P C4    1 
ATOM   3407 P  P     . DC  B 2 3   ? 43.344 -59.729 5.383   1.00 39.40 ? 3   DC  P P     1 
ATOM   3408 O  OP1   . DC  B 2 3   ? 44.074 -60.822 6.051   1.00 44.65 ? 3   DC  P OP1   1 
ATOM   3409 O  OP2   . DC  B 2 3   ? 41.883 -59.815 5.202   1.00 39.73 ? 3   DC  P OP2   1 
ATOM   3410 O  "O5'" . DC  B 2 3   ? 43.626 -58.355 6.133   1.00 43.85 ? 3   DC  P "O5'" 1 
ATOM   3411 C  "C5'" . DC  B 2 3   ? 44.948 -57.875 6.237   1.00 42.15 ? 3   DC  P "C5'" 1 
ATOM   3412 C  "C4'" . DC  B 2 3   ? 44.958 -56.468 6.794   1.00 45.11 ? 3   DC  P "C4'" 1 
ATOM   3413 O  "O4'" . DC  B 2 3   ? 44.424 -55.566 5.800   1.00 42.38 ? 3   DC  P "O4'" 1 
ATOM   3414 C  "C3'" . DC  B 2 3   ? 44.110 -56.261 8.060   1.00 43.70 ? 3   DC  P "C3'" 1 
ATOM   3415 O  "O3'" . DC  B 2 3   ? 44.903 -55.695 9.094   1.00 44.89 ? 3   DC  P "O3'" 1 
ATOM   3416 C  "C2'" . DC  B 2 3   ? 43.010 -55.294 7.611   1.00 43.35 ? 3   DC  P "C2'" 1 
ATOM   3417 C  "C1'" . DC  B 2 3   ? 43.683 -54.579 6.454   1.00 40.34 ? 3   DC  P "C1'" 1 
ATOM   3418 N  N1    . DC  B 2 3   ? 42.730 -54.024 5.505   1.00 38.66 ? 3   DC  P N1    1 
ATOM   3419 C  C2    . DC  B 2 3   ? 42.696 -52.651 5.306   1.00 34.01 ? 3   DC  P C2    1 
ATOM   3420 O  O2    . DC  B 2 3   ? 43.480 -51.938 5.934   1.00 37.56 ? 3   DC  P O2    1 
ATOM   3421 N  N3    . DC  B 2 3   ? 41.804 -52.142 4.439   1.00 34.68 ? 3   DC  P N3    1 
ATOM   3422 C  C4    . DC  B 2 3   ? 40.967 -52.950 3.790   1.00 35.89 ? 3   DC  P C4    1 
ATOM   3423 N  N4    . DC  B 2 3   ? 40.092 -52.395 2.945   1.00 34.48 ? 3   DC  P N4    1 
ATOM   3424 C  C5    . DC  B 2 3   ? 40.990 -54.359 3.979   1.00 37.52 ? 3   DC  P C5    1 
ATOM   3425 C  C6    . DC  B 2 3   ? 41.878 -54.850 4.844   1.00 36.28 ? 3   DC  P C6    1 
ATOM   3426 P  P     . DG  B 2 4   ? 44.290 -55.495 10.570  1.00 52.87 ? 4   DG  P P     1 
ATOM   3427 O  OP1   . DG  B 2 4   ? 45.357 -55.957 11.484  1.00 58.15 ? 4   DG  P OP1   1 
ATOM   3428 O  OP2   . DG  B 2 4   ? 42.920 -56.067 10.663  1.00 41.85 ? 4   DG  P OP2   1 
ATOM   3429 O  "O5'" . DG  B 2 4   ? 44.139 -53.908 10.722  1.00 45.99 ? 4   DG  P "O5'" 1 
ATOM   3430 C  "C5'" . DG  B 2 4   ? 45.116 -53.041 10.161  1.00 46.94 ? 4   DG  P "C5'" 1 
ATOM   3431 C  "C4'" . DG  B 2 4   ? 44.748 -51.581 10.402  1.00 48.51 ? 4   DG  P "C4'" 1 
ATOM   3432 O  "O4'" . DG  B 2 4   ? 43.902 -51.088 9.323   1.00 44.69 ? 4   DG  P "O4'" 1 
ATOM   3433 C  "C3'" . DG  B 2 4   ? 43.984 -51.307 11.695  1.00 43.58 ? 4   DG  P "C3'" 1 
ATOM   3434 O  "O3'" . DG  B 2 4   ? 44.423 -50.068 12.238  1.00 49.63 ? 4   DG  P "O3'" 1 
ATOM   3435 C  "C2'" . DG  B 2 4   ? 42.530 -51.240 11.226  1.00 38.78 ? 4   DG  P "C2'" 1 
ATOM   3436 C  "C1'" . DG  B 2 4   ? 42.678 -50.607 9.846   1.00 38.70 ? 4   DG  P "C1'" 1 
ATOM   3437 N  N9    . DG  B 2 4   ? 41.623 -50.993 8.921   1.00 36.23 ? 4   DG  P N9    1 
ATOM   3438 C  C8    . DG  B 2 4   ? 41.192 -52.267 8.661   1.00 37.49 ? 4   DG  P C8    1 
ATOM   3439 N  N7    . DG  B 2 4   ? 40.242 -52.324 7.782   1.00 34.26 ? 4   DG  P N7    1 
ATOM   3440 C  C5    . DG  B 2 4   ? 40.040 -51.008 7.419   1.00 33.41 ? 4   DG  P C5    1 
ATOM   3441 C  C6    . DG  B 2 4   ? 39.129 -50.462 6.501   1.00 34.22 ? 4   DG  P C6    1 
ATOM   3442 O  O6    . DG  B 2 4   ? 38.296 -51.061 5.805   1.00 38.19 ? 4   DG  P O6    1 
ATOM   3443 N  N1    . DG  B 2 4   ? 39.230 -49.077 6.436   1.00 31.87 ? 4   DG  P N1    1 
ATOM   3444 C  C2    . DG  B 2 4   ? 40.101 -48.320 7.175   1.00 33.04 ? 4   DG  P C2    1 
ATOM   3445 N  N2    . DG  B 2 4   ? 40.056 -46.993 6.973   1.00 29.66 ? 4   DG  P N2    1 
ATOM   3446 N  N3    . DG  B 2 4   ? 40.967 -48.827 8.043   1.00 34.03 ? 4   DG  P N3    1 
ATOM   3447 C  C4    . DG  B 2 4   ? 40.878 -50.172 8.112   1.00 32.93 ? 4   DG  P C4    1 
ATOM   3448 P  P     . DT  B 2 5   ? 43.802 -49.489 13.609  1.00 53.40 ? 5   DT  P P     1 
ATOM   3449 O  OP1   . DT  B 2 5   ? 44.956 -48.811 14.246  1.00 41.92 ? 5   DT  P OP1   1 
ATOM   3450 O  OP2   . DT  B 2 5   ? 43.048 -50.551 14.315  1.00 38.67 ? 5   DT  P OP2   1 
ATOM   3451 O  "O5'" . DT  B 2 5   ? 42.741 -48.388 13.114  1.00 38.87 ? 5   DT  P "O5'" 1 
ATOM   3452 C  "C5'" . DT  B 2 5   ? 43.216 -47.244 12.431  1.00 34.18 ? 5   DT  P "C5'" 1 
ATOM   3453 C  "C4'" . DT  B 2 5   ? 42.089 -46.289 12.105  1.00 35.15 ? 5   DT  P "C4'" 1 
ATOM   3454 O  "O4'" . DT  B 2 5   ? 41.206 -46.878 11.136  1.00 33.82 ? 5   DT  P "O4'" 1 
ATOM   3455 C  "C3'" . DT  B 2 5   ? 41.218 -45.870 13.288  1.00 34.68 ? 5   DT  P "C3'" 1 
ATOM   3456 O  "O3'" . DT  B 2 5   ? 41.243 -44.452 13.379  1.00 36.60 ? 5   DT  P "O3'" 1 
ATOM   3457 C  "C2'" . DT  B 2 5   ? 39.817 -46.397 12.939  1.00 26.14 ? 5   DT  P "C2'" 1 
ATOM   3458 C  "C1'" . DT  B 2 5   ? 39.894 -46.498 11.422  1.00 31.87 ? 5   DT  P "C1'" 1 
ATOM   3459 N  N1    . DT  B 2 5   ? 39.000 -47.520 10.788  1.00 30.41 ? 5   DT  P N1    1 
ATOM   3460 C  C2    . DT  B 2 5   ? 38.016 -47.099 9.934   1.00 30.32 ? 5   DT  P C2    1 
ATOM   3461 O  O2    . DT  B 2 5   ? 37.794 -45.930 9.711   1.00 32.29 ? 5   DT  P O2    1 
ATOM   3462 N  N3    . DT  B 2 5   ? 37.273 -48.097 9.379   1.00 31.08 ? 5   DT  P N3    1 
ATOM   3463 C  C4    . DT  B 2 5   ? 37.429 -49.456 9.570   1.00 29.89 ? 5   DT  P C4    1 
ATOM   3464 O  O4    . DT  B 2 5   ? 36.716 -50.275 9.018   1.00 34.61 ? 5   DT  P O4    1 
ATOM   3465 C  C5    . DT  B 2 5   ? 38.484 -49.836 10.467  1.00 31.06 ? 5   DT  P C5    1 
ATOM   3466 C  C7    . DT  B 2 5   ? 38.741 -51.281 10.753  1.00 30.68 ? 5   DT  P C7    1 
ATOM   3467 C  C6    . DT  B 2 5   ? 39.214 -48.859 11.029  1.00 31.05 ? 5   DT  P C6    1 
ATOM   3468 P  P     . DC  B 2 6   ? 40.598 -43.720 14.644  1.00 34.42 ? 6   DC  P P     1 
ATOM   3469 O  OP1   . DC  B 2 6   ? 41.277 -42.414 14.829  1.00 35.30 ? 6   DC  P OP1   1 
ATOM   3470 O  OP2   . DC  B 2 6   ? 40.556 -44.725 15.722  1.00 31.99 ? 6   DC  P OP2   1 
ATOM   3471 O  "O5'" . DC  B 2 6   ? 39.101 -43.419 14.186  1.00 35.84 ? 6   DC  P "O5'" 1 
ATOM   3472 C  "C5'" . DC  B 2 6   ? 38.852 -42.590 13.063  1.00 29.68 ? 6   DC  P "C5'" 1 
ATOM   3473 C  "C4'" . DC  B 2 6   ? 37.371 -42.573 12.764  1.00 34.89 ? 6   DC  P "C4'" 1 
ATOM   3474 O  "O4'" . DC  B 2 6   ? 36.992 -43.805 12.108  1.00 37.09 ? 6   DC  P "O4'" 1 
ATOM   3475 C  "C3'" . DC  B 2 6   ? 36.491 -42.471 14.007  1.00 35.69 ? 6   DC  P "C3'" 1 
ATOM   3476 O  "O3'" . DC  B 2 6   ? 35.837 -41.206 14.023  1.00 32.60 ? 6   DC  P "O3'" 1 
ATOM   3477 C  "C2'" . DC  B 2 6   ? 35.502 -43.648 13.892  1.00 29.97 ? 6   DC  P "C2'" 1 
ATOM   3478 C  "C1'" . DC  B 2 6   ? 35.675 -44.121 12.456  1.00 30.85 ? 6   DC  P "C1'" 1 
ATOM   3479 N  N1    . DC  B 2 6   ? 35.491 -45.613 12.290  1.00 32.36 ? 6   DC  P N1    1 
ATOM   3480 C  C2    . DC  B 2 6   ? 34.656 -46.115 11.274  1.00 31.20 ? 6   DC  P C2    1 
ATOM   3481 O  O2    . DC  B 2 6   ? 34.084 -45.325 10.502  1.00 31.19 ? 6   DC  P O2    1 
ATOM   3482 N  N3    . DC  B 2 6   ? 34.514 -47.457 11.154  1.00 29.10 ? 6   DC  P N3    1 
ATOM   3483 C  C4    . DC  B 2 6   ? 35.149 -48.274 11.995  1.00 29.12 ? 6   DC  P C4    1 
ATOM   3484 N  N4    . DC  B 2 6   ? 34.969 -49.592 11.845  1.00 30.22 ? 6   DC  P N4    1 
ATOM   3485 C  C5    . DC  B 2 6   ? 35.992 -47.783 13.034  1.00 27.32 ? 6   DC  P C5    1 
ATOM   3486 C  C6    . DC  B 2 6   ? 36.133 -46.466 13.145  1.00 29.54 ? 6   DC  P C6    1 
ATOM   3487 P  P     . DA  B 2 7   ? 34.807 -40.844 15.192  1.00 39.40 ? 7   DA  P P     1 
ATOM   3488 O  OP1   . DA  B 2 7   ? 34.773 -39.367 15.288  1.00 37.10 ? 7   DA  P OP1   1 
ATOM   3489 O  OP2   . DA  B 2 7   ? 35.111 -41.675 16.383  1.00 29.57 ? 7   DA  P OP2   1 
ATOM   3490 O  "O5'" . DA  B 2 7   ? 33.412 -41.343 14.617  1.00 34.45 ? 7   DA  P "O5'" 1 
ATOM   3491 C  "C5'" . DA  B 2 7   ? 33.055 -41.014 13.318  1.00 33.67 ? 7   DA  P "C5'" 1 
ATOM   3492 C  "C4'" . DA  B 2 7   ? 31.834 -41.801 12.902  1.00 40.28 ? 7   DA  P "C4'" 1 
ATOM   3493 O  "O4'" . DA  B 2 7   ? 32.210 -43.154 12.591  1.00 40.58 ? 7   DA  P "O4'" 1 
ATOM   3494 C  "C3'" . DA  B 2 7   ? 30.782 -41.947 13.985  1.00 42.02 ? 7   DA  P "C3'" 1 
ATOM   3495 O  "O3'" . DA  B 2 7   ? 29.855 -40.838 13.917  1.00 51.42 ? 7   DA  P "O3'" 1 
ATOM   3496 C  "C2'" . DA  B 2 7   ? 30.106 -43.284 13.645  1.00 45.73 ? 7   DA  P "C2'" 1 
ATOM   3497 C  "C1'" . DA  B 2 7   ? 31.050 -43.934 12.615  1.00 37.16 ? 7   DA  P "C1'" 1 
ATOM   3498 N  N9    . DA  B 2 7   ? 31.396 -45.320 12.944  1.00 37.93 ? 7   DA  P N9    1 
ATOM   3499 C  C8    . DA  B 2 7   ? 32.298 -45.758 13.880  1.00 34.43 ? 7   DA  P C8    1 
ATOM   3500 N  N7    . DA  B 2 7   ? 32.371 -47.069 13.972  1.00 31.05 ? 7   DA  P N7    1 
ATOM   3501 C  C5    . DA  B 2 7   ? 31.454 -47.519 13.037  1.00 32.59 ? 7   DA  P C5    1 
ATOM   3502 C  C6    . DA  B 2 7   ? 31.058 -48.811 12.645  1.00 34.59 ? 7   DA  P C6    1 
ATOM   3503 N  N6    . DA  B 2 7   ? 31.567 -49.942 13.177  1.00 30.15 ? 7   DA  P N6    1 
ATOM   3504 N  N1    . DA  B 2 7   ? 30.113 -48.903 11.685  1.00 34.42 ? 7   DA  P N1    1 
ATOM   3505 C  C2    . DA  B 2 7   ? 29.607 -47.781 11.158  1.00 35.27 ? 7   DA  P C2    1 
ATOM   3506 N  N3    . DA  B 2 7   ? 29.901 -46.517 11.442  1.00 34.91 ? 7   DA  P N3    1 
ATOM   3507 C  C4    . DA  B 2 7   ? 30.841 -46.455 12.398  1.00 35.43 ? 7   DA  P C4    1 
ATOM   3508 P  P     . DT  B 2 8   ? 28.596 -40.749 14.924  1.00 54.93 ? 8   DT  P P     1 
ATOM   3509 O  OP1   . DT  B 2 8   ? 28.099 -39.355 14.883  1.00 48.24 ? 8   DT  P OP1   1 
ATOM   3510 O  OP2   . DT  B 2 8   ? 28.976 -41.398 16.206  1.00 37.70 ? 8   DT  P OP2   1 
ATOM   3511 O  "O5'" . DT  B 2 8   ? 27.461 -41.594 14.173  1.00 51.82 ? 8   DT  P "O5'" 1 
ATOM   3512 C  "C5'" . DT  B 2 8   ? 27.178 -41.305 12.775  1.00 46.71 ? 8   DT  P "C5'" 1 
ATOM   3513 C  "C4'" . DT  B 2 8   ? 26.097 -42.221 12.264  1.00 37.75 ? 8   DT  P "C4'" 1 
ATOM   3514 O  "O4'" . DT  B 2 8   ? 26.592 -43.589 12.278  1.00 42.39 ? 8   DT  P "O4'" 1 
ATOM   3515 C  "C3'" . DT  B 2 8   ? 24.836 -42.218 13.125  1.00 42.53 ? 8   DT  P "C3'" 1 
ATOM   3516 O  "O3'" . DT  B 2 8   ? 23.633 -42.184 12.289  1.00 37.98 ? 8   DT  P "O3'" 1 
ATOM   3517 C  "C2'" . DT  B 2 8   ? 24.960 -43.507 13.965  1.00 38.29 ? 8   DT  P "C2'" 1 
ATOM   3518 C  "C1'" . DT  B 2 8   ? 25.720 -44.425 13.021  1.00 39.38 ? 8   DT  P "C1'" 1 
ATOM   3519 N  N1    . DT  B 2 8   ? 26.548 -45.472 13.701  1.00 40.20 ? 8   DT  P N1    1 
ATOM   3520 C  C2    . DT  B 2 8   ? 26.447 -46.790 13.283  1.00 38.60 ? 8   DT  P C2    1 
ATOM   3521 O  O2    . DT  B 2 8   ? 25.687 -47.152 12.397  1.00 34.58 ? 8   DT  P O2    1 
ATOM   3522 N  N3    . DT  B 2 8   ? 27.266 -47.674 13.952  1.00 32.21 ? 8   DT  P N3    1 
ATOM   3523 C  C4    . DT  B 2 8   ? 28.151 -47.377 14.968  1.00 36.40 ? 8   DT  P C4    1 
ATOM   3524 O  O4    . DT  B 2 8   ? 28.851 -48.237 15.505  1.00 37.24 ? 8   DT  P O4    1 
ATOM   3525 C  C5    . DT  B 2 8   ? 28.207 -45.976 15.353  1.00 41.48 ? 8   DT  P C5    1 
ATOM   3526 C  C7    . DT  B 2 8   ? 29.139 -45.531 16.444  1.00 39.04 ? 8   DT  P C7    1 
ATOM   3527 C  C6    . DT  B 2 8   ? 27.413 -45.103 14.704  1.00 37.13 ? 8   DT  P C6    1 
ATOM   3528 P  P     . DA  C 3 2   ? 28.762 -61.937 32.049  1.00 95.21 ? 2   DA  T P     1 
ATOM   3529 O  OP1   . DA  C 3 2   ? 29.423 -61.202 33.159  1.00 88.28 ? 2   DA  T OP1   1 
ATOM   3530 O  OP2   . DA  C 3 2   ? 27.963 -63.154 32.346  1.00 87.12 ? 2   DA  T OP2   1 
ATOM   3531 O  "O5'" . DA  C 3 2   ? 27.851 -60.945 31.164  1.00 81.56 ? 2   DA  T "O5'" 1 
ATOM   3532 C  "C5'" . DA  C 3 2   ? 28.457 -59.902 30.379  1.00 76.65 ? 2   DA  T "C5'" 1 
ATOM   3533 C  "C4'" . DA  C 3 2   ? 28.431 -60.249 28.898  1.00 72.70 ? 2   DA  T "C4'" 1 
ATOM   3534 O  "O4'" . DA  C 3 2   ? 27.779 -61.525 28.717  1.00 70.03 ? 2   DA  T "O4'" 1 
ATOM   3535 C  "C3'" . DA  C 3 2   ? 27.685 -59.247 27.995  1.00 72.44 ? 2   DA  T "C3'" 1 
ATOM   3536 O  "O3'" . DA  C 3 2   ? 28.553 -58.790 26.943  1.00 72.86 ? 2   DA  T "O3'" 1 
ATOM   3537 C  "C2'" . DA  C 3 2   ? 26.491 -60.048 27.453  1.00 66.48 ? 2   DA  T "C2'" 1 
ATOM   3538 C  "C1'" . DA  C 3 2   ? 26.994 -61.481 27.556  1.00 67.96 ? 2   DA  T "C1'" 1 
ATOM   3539 N  N9    . DA  C 3 2   ? 25.930 -62.470 27.693  1.00 64.22 ? 2   DA  T N9    1 
ATOM   3540 C  C8    . DA  C 3 2   ? 24.906 -62.465 28.603  1.00 66.29 ? 2   DA  T C8    1 
ATOM   3541 N  N7    . DA  C 3 2   ? 24.092 -63.493 28.491  1.00 62.62 ? 2   DA  T N7    1 
ATOM   3542 C  C5    . DA  C 3 2   ? 24.630 -64.228 27.445  1.00 56.95 ? 2   DA  T C5    1 
ATOM   3543 C  C6    . DA  C 3 2   ? 24.238 -65.432 26.833  1.00 58.56 ? 2   DA  T C6    1 
ATOM   3544 N  N6    . DA  C 3 2   ? 23.166 -66.133 27.215  1.00 64.40 ? 2   DA  T N6    1 
ATOM   3545 N  N1    . DA  C 3 2   ? 24.988 -65.890 25.805  1.00 63.44 ? 2   DA  T N1    1 
ATOM   3546 C  C2    . DA  C 3 2   ? 26.066 -65.187 25.424  1.00 65.77 ? 2   DA  T C2    1 
ATOM   3547 N  N3    . DA  C 3 2   ? 26.534 -64.040 25.923  1.00 66.88 ? 2   DA  T N3    1 
ATOM   3548 C  C4    . DA  C 3 2   ? 25.763 -63.612 26.943  1.00 62.38 ? 2   DA  T C4    1 
ATOM   3549 P  P     . DT  C 3 3   ? 27.977 -57.943 25.702  1.00 68.89 ? 3   DT  T P     1 
ATOM   3550 O  OP1   . DT  C 3 3   ? 29.094 -57.236 25.026  1.00 59.86 ? 3   DT  T OP1   1 
ATOM   3551 O  OP2   . DT  C 3 3   ? 26.808 -57.178 26.211  1.00 63.07 ? 3   DT  T OP2   1 
ATOM   3552 O  "O5'" . DT  C 3 3   ? 27.505 -59.074 24.669  1.00 65.27 ? 3   DT  T "O5'" 1 
ATOM   3553 C  "C5'" . DT  C 3 3   ? 28.442 -60.024 24.182  1.00 58.40 ? 3   DT  T "C5'" 1 
ATOM   3554 C  "C4'" . DT  C 3 3   ? 27.776 -60.981 23.227  1.00 50.33 ? 3   DT  T "C4'" 1 
ATOM   3555 O  "O4'" . DT  C 3 3   ? 26.838 -61.806 23.945  1.00 53.43 ? 3   DT  T "O4'" 1 
ATOM   3556 C  "C3'" . DT  C 3 3   ? 26.977 -60.312 22.094  1.00 54.14 ? 3   DT  T "C3'" 1 
ATOM   3557 O  "O3'" . DT  C 3 3   ? 27.540 -60.655 20.837  1.00 54.02 ? 3   DT  T "O3'" 1 
ATOM   3558 C  "C2'" . DT  C 3 3   ? 25.564 -60.887 22.234  1.00 48.88 ? 3   DT  T "C2'" 1 
ATOM   3559 C  "C1'" . DT  C 3 3   ? 25.800 -62.142 23.062  1.00 52.36 ? 3   DT  T "C1'" 1 
ATOM   3560 N  N1    . DT  C 3 3   ? 24.625 -62.511 23.840  1.00 53.32 ? 3   DT  T N1    1 
ATOM   3561 C  C2    . DT  C 3 3   ? 23.968 -63.684 23.563  1.00 53.01 ? 3   DT  T C2    1 
ATOM   3562 O  O2    . DT  C 3 3   ? 24.343 -64.466 22.712  1.00 50.12 ? 3   DT  T O2    1 
ATOM   3563 N  N3    . DT  C 3 3   ? 22.860 -63.920 24.349  1.00 49.89 ? 3   DT  T N3    1 
ATOM   3564 C  C4    . DT  C 3 3   ? 22.359 -63.096 25.345  1.00 48.29 ? 3   DT  T C4    1 
ATOM   3565 O  O4    . DT  C 3 3   ? 21.363 -63.376 25.995  1.00 47.10 ? 3   DT  T O4    1 
ATOM   3566 C  C5    . DT  C 3 3   ? 23.096 -61.878 25.567  1.00 50.96 ? 3   DT  T C5    1 
ATOM   3567 C  C7    . DT  C 3 3   ? 22.653 -60.912 26.608  1.00 45.46 ? 3   DT  T C7    1 
ATOM   3568 C  C6    . DT  C 3 3   ? 24.171 -61.643 24.810  1.00 55.72 ? 3   DT  T C6    1 
HETATM 3569 P  P     . 5DB C 3 4   ? 27.769 -59.537 19.709  1.00 48.17 ? 4   5DB T P     1 
HETATM 3570 O  OP1   . 5DB C 3 4   ? 28.604 -60.151 18.613  1.00 49.36 ? 4   5DB T OP1   1 
HETATM 3571 O  "O5'" . 5DB C 3 4   ? 26.296 -59.196 19.159  1.00 46.23 ? 4   5DB T "O5'" 1 
HETATM 3572 C  "C5'" . 5DB C 3 4   ? 25.623 -60.043 18.224  1.00 44.16 ? 4   5DB T "C5'" 1 
HETATM 3573 C  "C4'" . 5DB C 3 4   ? 24.471 -59.251 17.625  1.00 41.79 ? 4   5DB T "C4'" 1 
HETATM 3574 C  "C3'" . 5DB C 3 4   ? 24.927 -58.162 16.662  1.00 40.51 ? 4   5DB T "C3'" 1 
HETATM 3575 O  "O3'" . 5DB C 3 4   ? 23.930 -58.063 15.648  1.00 31.52 ? 4   5DB T "O3'" 1 
HETATM 3576 C  "C2'" . 5DB C 3 4   ? 24.951 -56.869 17.451  1.00 36.43 ? 4   5DB T "C2'" 1 
HETATM 3577 C  "C1'" . 5DB C 3 4   ? 23.850 -57.151 18.454  1.00 36.88 ? 4   5DB T "C1'" 1 
HETATM 3578 O  "O4'" . 5DB C 3 4   ? 23.854 -58.556 18.704  1.00 42.51 ? 4   5DB T "O4'" 1 
HETATM 3579 N  N1    . 5DB C 3 4   ? 24.061 -56.501 19.735  1.00 44.96 ? 4   5DB T N1    1 
HETATM 3580 C  C6    . 5DB C 3 4   ? 25.218 -56.652 20.396  1.00 43.59 ? 4   5DB T C6    1 
HETATM 3581 C  C5    . 5DB C 3 4   ? 25.393 -56.028 21.626  1.00 46.13 ? 4   5DB T C5    1 
HETATM 3582 C  C7    . 5DB C 3 4   ? 26.695 -56.171 22.387  1.00 43.71 ? 4   5DB T C7    1 
HETATM 3583 C  C4    . 5DB C 3 4   ? 24.259 -55.224 22.168  1.00 44.63 ? 4   5DB T C4    1 
HETATM 3584 N  N3    . 5DB C 3 4   ? 23.113 -55.119 21.455  1.00 41.13 ? 4   5DB T N3    1 
HETATM 3585 C  C2    . 5DB C 3 4   ? 22.991 -55.740 20.256  1.00 43.48 ? 4   5DB T C2    1 
HETATM 3586 O  O2    . 5DB C 3 4   ? 21.931 -55.655 19.581  1.00 39.65 ? 4   5DB T O2    1 
HETATM 3587 O  O4    . 5DB C 3 4   ? 24.368 -54.581 23.378  1.00 45.17 ? 4   5DB T O4    1 
HETATM 3588 O  OP2   . 5DB C 3 4   ? 28.397 -58.283 20.278  1.00 47.39 ? 4   5DB T OP2   1 
HETATM 3589 C  C1    . 5DB C 3 4   ? 23.201 -54.266 24.141  1.00 35.13 ? 4   5DB T C1    1 
ATOM   3590 P  P     . DA  C 3 5   ? 24.147 -58.825 14.265  1.00 30.99 ? 5   DA  T P     1 
ATOM   3591 O  OP1   . DA  C 3 5   ? 23.127 -59.884 14.141  1.00 32.33 ? 5   DA  T OP1   1 
ATOM   3592 O  OP2   . DA  C 3 5   ? 25.580 -59.171 14.130  1.00 35.55 ? 5   DA  T OP2   1 
ATOM   3593 O  "O5'" . DA  C 3 5   ? 23.861 -57.708 13.187  1.00 31.38 ? 5   DA  T "O5'" 1 
ATOM   3594 C  "C5'" . DA  C 3 5   ? 22.565 -57.144 13.114  1.00 33.68 ? 5   DA  T "C5'" 1 
ATOM   3595 C  "C4'" . DA  C 3 5   ? 22.522 -56.007 12.111  1.00 33.82 ? 5   DA  T "C4'" 1 
ATOM   3596 O  "O4'" . DA  C 3 5   ? 23.287 -54.867 12.605  1.00 38.01 ? 5   DA  T "O4'" 1 
ATOM   3597 C  "C3'" . DA  C 3 5   ? 23.080 -56.325 10.732  1.00 32.34 ? 5   DA  T "C3'" 1 
ATOM   3598 O  "O3'" . DA  C 3 5   ? 22.255 -55.695 9.788   1.00 32.85 ? 5   DA  T "O3'" 1 
ATOM   3599 C  "C2'" . DA  C 3 5   ? 24.489 -55.704 10.776  1.00 34.43 ? 5   DA  T "C2'" 1 
ATOM   3600 C  "C1'" . DA  C 3 5   ? 24.246 -54.474 11.646  1.00 36.41 ? 5   DA  T "C1'" 1 
ATOM   3601 N  N9    . DA  C 3 5   ? 25.414 -54.027 12.385  1.00 35.17 ? 5   DA  T N9    1 
ATOM   3602 C  C8    . DA  C 3 5   ? 26.316 -54.812 13.036  1.00 32.09 ? 5   DA  T C8    1 
ATOM   3603 N  N7    . DA  C 3 5   ? 27.254 -54.137 13.649  1.00 36.38 ? 5   DA  T N7    1 
ATOM   3604 C  C5    . DA  C 3 5   ? 26.936 -52.810 13.395  1.00 34.20 ? 5   DA  T C5    1 
ATOM   3605 C  C6    . DA  C 3 5   ? 27.557 -51.593 13.765  1.00 39.00 ? 5   DA  T C6    1 
ATOM   3606 N  N6    . DA  C 3 5   ? 28.668 -51.528 14.513  1.00 33.06 ? 5   DA  T N6    1 
ATOM   3607 N  N1    . DA  C 3 5   ? 26.989 -50.447 13.334  1.00 36.51 ? 5   DA  T N1    1 
ATOM   3608 C  C2    . DA  C 3 5   ? 25.879 -50.524 12.586  1.00 35.50 ? 5   DA  T C2    1 
ATOM   3609 N  N3    . DA  C 3 5   ? 25.211 -51.604 12.174  1.00 35.53 ? 5   DA  T N3    1 
ATOM   3610 C  C4    . DA  C 3 5   ? 25.802 -52.725 12.618  1.00 32.73 ? 5   DA  T C4    1 
ATOM   3611 P  P     . DT  C 3 6   ? 22.443 -55.953 8.220   1.00 31.80 ? 6   DT  T P     1 
ATOM   3612 O  OP1   . DT  C 3 6   ? 21.416 -55.143 7.536   1.00 35.95 ? 6   DT  T OP1   1 
ATOM   3613 O  OP2   . DT  C 3 6   ? 22.521 -57.396 7.901   1.00 33.99 ? 6   DT  T OP2   1 
ATOM   3614 O  "O5'" . DT  C 3 6   ? 23.847 -55.323 7.931   1.00 35.19 ? 6   DT  T "O5'" 1 
ATOM   3615 C  "C5'" . DT  C 3 6   ? 23.993 -54.501 6.849   1.00 39.03 ? 6   DT  T "C5'" 1 
ATOM   3616 C  "C4'" . DT  C 3 6   ? 24.452 -53.137 7.274   1.00 34.64 ? 6   DT  T "C4'" 1 
ATOM   3617 O  "O4'" . DT  C 3 6   ? 25.340 -53.237 8.389   1.00 37.39 ? 6   DT  T "O4'" 1 
ATOM   3618 C  "C3'" . DT  C 3 6   ? 25.258 -52.431 6.213   1.00 38.47 ? 6   DT  T "C3'" 1 
ATOM   3619 O  "O3'" . DT  C 3 6   ? 24.393 -51.608 5.451   1.00 33.93 ? 6   DT  T "O3'" 1 
ATOM   3620 C  "C2'" . DT  C 3 6   ? 26.320 -51.626 7.000   1.00 41.50 ? 6   DT  T "C2'" 1 
ATOM   3621 C  "C1'" . DT  C 3 6   ? 26.057 -52.037 8.447   1.00 37.89 ? 6   DT  T "C1'" 1 
ATOM   3622 N  N1    . DT  C 3 6   ? 27.284 -52.230 9.286   1.00 37.43 ? 6   DT  T N1    1 
ATOM   3623 C  C2    . DT  C 3 6   ? 27.921 -51.123 9.769   1.00 36.60 ? 6   DT  T C2    1 
ATOM   3624 O  O2    . DT  C 3 6   ? 27.564 -49.991 9.508   1.00 38.48 ? 6   DT  T O2    1 
ATOM   3625 N  N3    . DT  C 3 6   ? 29.008 -51.380 10.560  1.00 37.75 ? 6   DT  T N3    1 
ATOM   3626 C  C4    . DT  C 3 6   ? 29.504 -52.609 10.925  1.00 34.57 ? 6   DT  T C4    1 
ATOM   3627 O  O4    . DT  C 3 6   ? 30.490 -52.727 11.643  1.00 36.22 ? 6   DT  T O4    1 
ATOM   3628 C  C5    . DT  C 3 6   ? 28.788 -53.744 10.396  1.00 36.28 ? 6   DT  T C5    1 
ATOM   3629 C  C7    . DT  C 3 6   ? 29.245 -55.141 10.728  1.00 29.39 ? 6   DT  T C7    1 
ATOM   3630 C  C6    . DT  C 3 6   ? 27.711 -53.505 9.616   1.00 36.23 ? 6   DT  T C6    1 
ATOM   3631 P  P     . DG  C 3 7   ? 24.726 -51.389 3.913   1.00 45.39 ? 7   DG  T P     1 
ATOM   3632 O  OP1   . DG  C 3 7   ? 23.473 -51.049 3.207   1.00 46.64 ? 7   DG  T OP1   1 
ATOM   3633 O  OP2   . DG  C 3 7   ? 25.547 -52.553 3.488   1.00 43.00 ? 7   DG  T OP2   1 
ATOM   3634 O  "O5'" . DG  C 3 7   ? 25.767 -50.154 3.921   1.00 41.37 ? 7   DG  T "O5'" 1 
ATOM   3635 C  "C5'" . DG  C 3 7   ? 25.413 -48.924 4.496   1.00 37.48 ? 7   DG  T "C5'" 1 
ATOM   3636 C  "C4'" . DG  C 3 7   ? 26.640 -48.057 4.700   1.00 40.13 ? 7   DG  T "C4'" 1 
ATOM   3637 O  "O4'" . DG  C 3 7   ? 27.366 -48.507 5.856   1.00 38.27 ? 7   DG  T "O4'" 1 
ATOM   3638 C  "C3'" . DG  C 3 7   ? 27.657 -48.074 3.548   1.00 41.33 ? 7   DG  T "C3'" 1 
ATOM   3639 O  "O3'" . DG  C 3 7   ? 27.565 -46.860 2.781   1.00 36.99 ? 7   DG  T "O3'" 1 
ATOM   3640 C  "C2'" . DG  C 3 7   ? 29.022 -48.198 4.248   1.00 39.33 ? 7   DG  T "C2'" 1 
ATOM   3641 C  "C1'" . DG  C 3 7   ? 28.674 -48.043 5.727   1.00 37.22 ? 7   DG  T "C1'" 1 
ATOM   3642 N  N9    . DG  C 3 7   ? 29.542 -48.816 6.602   1.00 36.22 ? 7   DG  T N9    1 
ATOM   3643 C  C8    . DG  C 3 7   ? 29.605 -50.178 6.715   1.00 31.91 ? 7   DG  T C8    1 
ATOM   3644 N  N7    . DG  C 3 7   ? 30.499 -50.580 7.574   1.00 34.02 ? 7   DG  T N7    1 
ATOM   3645 C  C5    . DG  C 3 7   ? 31.065 -49.411 8.059   1.00 32.36 ? 7   DG  T C5    1 
ATOM   3646 C  C6    . DG  C 3 7   ? 32.087 -49.221 9.013   1.00 33.49 ? 7   DG  T C6    1 
ATOM   3647 O  O6    . DG  C 3 7   ? 32.711 -50.082 9.647   1.00 35.45 ? 7   DG  T O6    1 
ATOM   3648 N  N1    . DG  C 3 7   ? 32.365 -47.871 9.210   1.00 30.82 ? 7   DG  T N1    1 
ATOM   3649 C  C2    . DG  C 3 7   ? 31.728 -46.837 8.564   1.00 34.08 ? 7   DG  T C2    1 
ATOM   3650 N  N2    . DG  C 3 7   ? 32.129 -45.594 8.875   1.00 34.40 ? 7   DG  T N2    1 
ATOM   3651 N  N3    . DG  C 3 7   ? 30.768 -47.005 7.674   1.00 34.81 ? 7   DG  T N3    1 
ATOM   3652 C  C4    . DG  C 3 7   ? 30.493 -48.316 7.468   1.00 36.40 ? 7   DG  T C4    1 
ATOM   3653 P  P     . DA  C 3 8   ? 28.586 -46.573 1.568   1.00 45.08 ? 8   DA  T P     1 
ATOM   3654 O  OP1   . DA  C 3 8   ? 27.846 -45.775 0.569   1.00 40.25 ? 8   DA  T OP1   1 
ATOM   3655 O  OP2   . DA  C 3 8   ? 29.263 -47.827 1.145   1.00 35.74 ? 8   DA  T OP2   1 
ATOM   3656 O  "O5'" . DA  C 3 8   ? 29.719 -45.659 2.242   1.00 45.66 ? 8   DA  T "O5'" 1 
ATOM   3657 C  "C5'" . DA  C 3 8   ? 29.377 -44.468 2.957   1.00 37.04 ? 8   DA  T "C5'" 1 
ATOM   3658 C  "C4'" . DA  C 3 8   ? 30.642 -43.751 3.393   1.00 37.05 ? 8   DA  T "C4'" 1 
ATOM   3659 O  "O4'" . DA  C 3 8   ? 31.253 -44.492 4.486   1.00 33.56 ? 8   DA  T "O4'" 1 
ATOM   3660 C  "C3'" . DA  C 3 8   ? 31.704 -43.634 2.295   1.00 40.02 ? 8   DA  T "C3'" 1 
ATOM   3661 O  "O3'" . DA  C 3 8   ? 32.256 -42.305 2.219   1.00 43.94 ? 8   DA  T "O3'" 1 
ATOM   3662 C  "C2'" . DA  C 3 8   ? 32.765 -44.664 2.682   1.00 38.56 ? 8   DA  T "C2'" 1 
ATOM   3663 C  "C1'" . DA  C 3 8   ? 32.609 -44.768 4.195   1.00 35.00 ? 8   DA  T "C1'" 1 
ATOM   3664 N  N9    . DA  C 3 8   ? 32.935 -46.099 4.688   1.00 28.66 ? 8   DA  T N9    1 
ATOM   3665 C  C8    . DA  C 3 8   ? 32.458 -47.292 4.210   1.00 33.54 ? 8   DA  T C8    1 
ATOM   3666 N  N7    . DA  C 3 8   ? 32.931 -48.347 4.833   1.00 31.55 ? 8   DA  T N7    1 
ATOM   3667 C  C5    . DA  C 3 8   ? 33.796 -47.807 5.776   1.00 31.69 ? 8   DA  T C5    1 
ATOM   3668 C  C6    . DA  C 3 8   ? 34.627 -48.396 6.760   1.00 28.77 ? 8   DA  T C6    1 
ATOM   3669 N  N6    . DA  C 3 8   ? 34.726 -49.712 6.956   1.00 27.19 ? 8   DA  T N6    1 
ATOM   3670 N  N1    . DA  C 3 8   ? 35.358 -47.566 7.531   1.00 31.70 ? 8   DA  T N1    1 
ATOM   3671 C  C2    . DA  C 3 8   ? 35.254 -46.242 7.339   1.00 30.12 ? 8   DA  T C2    1 
ATOM   3672 N  N3    . DA  C 3 8   ? 34.518 -45.574 6.450   1.00 27.74 ? 8   DA  T N3    1 
ATOM   3673 C  C4    . DA  C 3 8   ? 33.810 -46.419 5.691   1.00 31.73 ? 8   DA  T C4    1 
ATOM   3674 P  P     . DC  C 3 9   ? 33.216 -41.917 0.982   1.00 45.74 ? 9   DC  T P     1 
ATOM   3675 O  OP1   . DC  C 3 9   ? 32.997 -40.493 0.646   1.00 51.40 ? 9   DC  T OP1   1 
ATOM   3676 O  OP2   . DC  C 3 9   ? 33.100 -42.954 -0.065  1.00 39.14 ? 9   DC  T OP2   1 
ATOM   3677 O  "O5'" . DC  C 3 9   ? 34.695 -42.090 1.567   1.00 42.35 ? 9   DC  T "O5'" 1 
ATOM   3678 C  "C5'" . DC  C 3 9   ? 35.029 -41.532 2.815   1.00 37.18 ? 9   DC  T "C5'" 1 
ATOM   3679 C  "C4'" . DC  C 3 9   ? 36.295 -42.167 3.359   1.00 41.40 ? 9   DC  T "C4'" 1 
ATOM   3680 O  "O4'" . DC  C 3 9   ? 36.048 -43.537 3.813   1.00 40.07 ? 9   DC  T "O4'" 1 
ATOM   3681 C  "C3'" . DC  C 3 9   ? 37.444 -42.267 2.351   1.00 35.88 ? 9   DC  T "C3'" 1 
ATOM   3682 O  "O3'" . DC  C 3 9   ? 38.588 -41.722 2.920   1.00 36.16 ? 9   DC  T "O3'" 1 
ATOM   3683 C  "C2'" . DC  C 3 9   ? 37.605 -43.766 2.150   1.00 36.48 ? 9   DC  T "C2'" 1 
ATOM   3684 C  "C1'" . DC  C 3 9   ? 37.204 -44.269 3.516   1.00 34.69 ? 9   DC  T "C1'" 1 
ATOM   3685 N  N1    . DC  C 3 9   ? 36.939 -45.731 3.564   1.00 31.83 ? 9   DC  T N1    1 
ATOM   3686 C  C2    . DC  C 3 9   ? 37.552 -46.483 4.551   1.00 31.77 ? 9   DC  T C2    1 
ATOM   3687 O  O2    . DC  C 3 9   ? 38.264 -45.906 5.374   1.00 36.72 ? 9   DC  T O2    1 
ATOM   3688 N  N3    . DC  C 3 9   ? 37.340 -47.820 4.596   1.00 31.05 ? 9   DC  T N3    1 
ATOM   3689 C  C4    . DC  C 3 9   ? 36.563 -48.401 3.686   1.00 29.45 ? 9   DC  T C4    1 
ATOM   3690 N  N4    . DC  C 3 9   ? 36.397 -49.717 3.769   1.00 25.38 ? 9   DC  T N4    1 
ATOM   3691 C  C5    . DC  C 3 9   ? 35.929 -47.654 2.654   1.00 32.71 ? 9   DC  T C5    1 
ATOM   3692 C  C6    . DC  C 3 9   ? 36.154 -46.329 2.621   1.00 34.86 ? 9   DC  T C6    1 
ATOM   3693 P  P     . DG  C 3 10  ? 39.783 -41.191 1.991   1.00 37.42 ? 10  DG  T P     1 
ATOM   3694 O  OP1   . DG  C 3 10  ? 39.557 -39.748 1.794   1.00 43.06 ? 10  DG  T OP1   1 
ATOM   3695 O  OP2   . DG  C 3 10  ? 39.878 -42.116 0.844   1.00 34.50 ? 10  DG  T OP2   1 
ATOM   3696 O  "O5'" . DG  C 3 10  ? 41.060 -41.371 2.930   1.00 40.73 ? 10  DG  T "O5'" 1 
ATOM   3697 C  "C5'" . DG  C 3 10  ? 40.863 -41.575 4.331   1.00 33.96 ? 10  DG  T "C5'" 1 
ATOM   3698 C  "C4'" . DG  C 3 10  ? 42.076 -42.204 4.973   1.00 32.79 ? 10  DG  T "C4'" 1 
ATOM   3699 O  "O4'" . DG  C 3 10  ? 41.831 -43.605 5.230   1.00 36.83 ? 10  DG  T "O4'" 1 
ATOM   3700 C  "C3'" . DG  C 3 10  ? 43.341 -42.150 4.143   1.00 39.90 ? 10  DG  T "C3'" 1 
ATOM   3701 O  "O3'" . DG  C 3 10  ? 44.455 -42.061 5.021   1.00 44.42 ? 10  DG  T "O3'" 1 
ATOM   3702 C  "C2'" . DG  C 3 10  ? 43.304 -43.479 3.397   1.00 35.37 ? 10  DG  T "C2'" 1 
ATOM   3703 C  "C1'" . DG  C 3 10  ? 42.687 -44.407 4.438   1.00 35.29 ? 10  DG  T "C1'" 1 
ATOM   3704 N  N9    . DG  C 3 10  ? 41.903 -45.499 3.849   1.00 33.97 ? 10  DG  T N9    1 
ATOM   3705 C  C8    . DG  C 3 10  ? 40.889 -45.383 2.926   1.00 31.26 ? 10  DG  T C8    1 
ATOM   3706 N  N7    . DG  C 3 10  ? 40.380 -46.522 2.564   1.00 29.82 ? 10  DG  T N7    1 
ATOM   3707 C  C5    . DG  C 3 10  ? 41.088 -47.461 3.296   1.00 32.21 ? 10  DG  T C5    1 
ATOM   3708 C  C6    . DG  C 3 10  ? 40.977 -48.877 3.318   1.00 31.21 ? 10  DG  T C6    1 
ATOM   3709 O  O6    . DG  C 3 10  ? 40.194 -49.600 2.685   1.00 31.79 ? 10  DG  T O6    1 
ATOM   3710 N  N1    . DG  C 3 10  ? 41.901 -49.450 4.182   1.00 34.24 ? 10  DG  T N1    1 
ATOM   3711 C  C2    . DG  C 3 10  ? 42.814 -48.748 4.943   1.00 36.48 ? 10  DG  T C2    1 
ATOM   3712 N  N2    . DG  C 3 10  ? 43.626 -49.482 5.719   1.00 36.52 ? 10  DG  T N2    1 
ATOM   3713 N  N3    . DG  C 3 10  ? 42.932 -47.419 4.933   1.00 34.66 ? 10  DG  T N3    1 
ATOM   3714 C  C4    . DG  C 3 10  ? 42.040 -46.845 4.089   1.00 33.58 ? 10  DG  T C4    1 
ATOM   3715 P  P     . DC  C 3 11  ? 45.954 -41.991 4.454   1.00 45.98 ? 11  DC  T P     1 
ATOM   3716 O  OP1   . DC  C 3 11  ? 46.656 -41.068 5.365   1.00 43.14 ? 11  DC  T OP1   1 
ATOM   3717 O  OP2   . DC  C 3 11  ? 45.969 -41.743 2.991   1.00 33.94 ? 11  DC  T OP2   1 
ATOM   3718 O  "O5'" . DC  C 3 11  ? 46.486 -43.479 4.678   1.00 36.51 ? 11  DC  T "O5'" 1 
ATOM   3719 C  "C5'" . DC  C 3 11  ? 46.518 -44.027 5.967   1.00 35.60 ? 11  DC  T "C5'" 1 
ATOM   3720 C  "C4'" . DC  C 3 11  ? 47.369 -45.284 5.974   1.00 37.75 ? 11  DC  T "C4'" 1 
ATOM   3721 O  "O4'" . DC  C 3 11  ? 46.611 -46.415 5.462   1.00 39.39 ? 11  DC  T "O4'" 1 
ATOM   3722 C  "C3'" . DC  C 3 11  ? 48.636 -45.214 5.130   1.00 36.19 ? 11  DC  T "C3'" 1 
ATOM   3723 O  "O3'" . DC  C 3 11  ? 49.650 -45.942 5.791   1.00 34.22 ? 11  DC  T "O3'" 1 
ATOM   3724 C  "C2'" . DC  C 3 11  ? 48.214 -45.874 3.808   1.00 31.35 ? 11  DC  T "C2'" 1 
ATOM   3725 C  "C1'" . DC  C 3 11  ? 47.239 -46.942 4.303   1.00 37.45 ? 11  DC  T "C1'" 1 
ATOM   3726 N  N1    . DC  C 3 11  ? 46.167 -47.333 3.303   1.00 33.53 ? 11  DC  T N1    1 
ATOM   3727 C  C2    . DC  C 3 11  ? 45.808 -48.682 3.166   1.00 36.34 ? 11  DC  T C2    1 
ATOM   3728 O  O2    . DC  C 3 11  ? 46.376 -49.528 3.866   1.00 37.89 ? 11  DC  T O2    1 
ATOM   3729 N  N3    . DC  C 3 11  ? 44.834 -49.023 2.272   1.00 36.29 ? 11  DC  T N3    1 
ATOM   3730 C  C4    . DC  C 3 11  ? 44.245 -48.080 1.532   1.00 32.27 ? 11  DC  T C4    1 
ATOM   3731 N  N4    . DC  C 3 11  ? 43.302 -48.465 0.664   1.00 31.20 ? 11  DC  T N4    1 
ATOM   3732 C  C5    . DC  C 3 11  ? 44.600 -46.706 1.651   1.00 33.63 ? 11  DC  T C5    1 
ATOM   3733 C  C6    . DC  C 3 11  ? 45.554 -46.378 2.543   1.00 36.96 ? 11  DC  T C6    1 
ATOM   3734 P  P     . DT  C 3 12  ? 51.150 -45.923 5.246   1.00 32.88 ? 12  DT  T P     1 
ATOM   3735 O  OP1   . DT  C 3 12  ? 52.099 -46.077 6.373   1.00 33.88 ? 12  DT  T OP1   1 
ATOM   3736 O  OP2   . DT  C 3 12  ? 51.236 -44.763 4.355   1.00 35.32 ? 12  DT  T OP2   1 
ATOM   3737 O  "O5'" . DT  C 3 12  ? 51.254 -47.262 4.397   1.00 36.05 ? 12  DT  T "O5'" 1 
ATOM   3738 C  "C5'" . DT  C 3 12  ? 51.477 -48.481 5.063   1.00 35.99 ? 12  DT  T "C5'" 1 
ATOM   3739 C  "C4'" . DT  C 3 12  ? 51.416 -49.617 4.088   1.00 32.46 ? 12  DT  T "C4'" 1 
ATOM   3740 O  "O4'" . DT  C 3 12  ? 50.127 -49.593 3.436   1.00 34.01 ? 12  DT  T "O4'" 1 
ATOM   3741 C  "C3'" . DT  C 3 12  ? 52.467 -49.542 2.964   1.00 32.56 ? 12  DT  T "C3'" 1 
ATOM   3742 O  "O3'" . DT  C 3 12  ? 53.197 -50.757 2.881   1.00 35.17 ? 12  DT  T "O3'" 1 
ATOM   3743 C  "C2'" . DT  C 3 12  ? 51.636 -49.305 1.704   1.00 35.85 ? 12  DT  T "C2'" 1 
ATOM   3744 C  "C1'" . DT  C 3 12  ? 50.320 -49.956 2.090   1.00 38.32 ? 12  DT  T "C1'" 1 
ATOM   3745 N  N1    . DT  C 3 12  ? 49.162 -49.491 1.273   1.00 35.60 ? 12  DT  T N1    1 
ATOM   3746 C  C2    . DT  C 3 12  ? 48.240 -50.408 0.835   1.00 36.10 ? 12  DT  T C2    1 
ATOM   3747 O  O2    . DT  C 3 12  ? 48.304 -51.595 1.094   1.00 42.71 ? 12  DT  T O2    1 
ATOM   3748 N  N3    . DT  C 3 12  ? 47.229 -49.888 0.077   1.00 37.30 ? 12  DT  T N3    1 
ATOM   3749 C  C4    . DT  C 3 12  ? 47.046 -48.565 -0.282  1.00 37.57 ? 12  DT  T C4    1 
ATOM   3750 O  O4    . DT  C 3 12  ? 46.093 -48.201 -0.968  1.00 38.74 ? 12  DT  T O4    1 
ATOM   3751 C  C5    . DT  C 3 12  ? 48.058 -47.648 0.206   1.00 38.01 ? 12  DT  T C5    1 
ATOM   3752 C  C7    . DT  C 3 12  ? 47.977 -46.178 -0.112  1.00 37.16 ? 12  DT  T C7    1 
ATOM   3753 C  C6    . DT  C 3 12  ? 49.059 -48.154 0.946   1.00 36.96 ? 12  DT  T C6    1 
HETATM 3754 C  C1    . GOL D 4 .   ? 40.766 -20.434 20.201  1.00 29.23 ? 501 GOL A C1    1 
HETATM 3755 O  O1    . GOL D 4 .   ? 40.060 -19.692 19.230  1.00 27.56 ? 501 GOL A O1    1 
HETATM 3756 C  C2    . GOL D 4 .   ? 39.880 -20.663 21.422  1.00 28.92 ? 501 GOL A C2    1 
HETATM 3757 O  O2    . GOL D 4 .   ? 39.048 -21.782 21.185  1.00 25.79 ? 501 GOL A O2    1 
HETATM 3758 C  C3    . GOL D 4 .   ? 40.729 -20.859 22.692  1.00 24.75 ? 501 GOL A C3    1 
HETATM 3759 O  O3    . GOL D 4 .   ? 41.489 -22.054 22.613  1.00 26.62 ? 501 GOL A O3    1 
HETATM 3760 MG MG    . MG  E 5 .   ? 19.393 -39.296 13.922  1.00 24.21 ? 502 MG  A MG    1 
HETATM 3761 MG MG    . MG  F 5 .   ? 22.213 -40.161 11.987  1.00 33.05 ? 503 MG  A MG    1 
HETATM 3762 N  N1    . XG4 G 6 .   ? 23.156 -51.109 15.109  1.00 32.79 ? 504 XG4 A N1    1 
HETATM 3763 C  C2    . XG4 G 6 .   ? 22.089 -50.947 14.292  1.00 35.97 ? 504 XG4 A C2    1 
HETATM 3764 N  N2    . XG4 G 6 .   ? 21.513 -52.033 13.702  1.00 32.86 ? 504 XG4 A N2    1 
HETATM 3765 N  N3    . XG4 G 6 .   ? 21.557 -49.718 14.045  1.00 33.72 ? 504 XG4 A N3    1 
HETATM 3766 C  C4    . XG4 G 6 .   ? 22.077 -48.598 14.614  1.00 31.51 ? 504 XG4 A C4    1 
HETATM 3767 C  C5    . XG4 G 6 .   ? 23.238 -48.705 15.504  1.00 31.34 ? 504 XG4 A C5    1 
HETATM 3768 C  C6    . XG4 G 6 .   ? 23.764 -50.078 15.724  1.00 34.15 ? 504 XG4 A C6    1 
HETATM 3769 O  O6    . XG4 G 6 .   ? 24.754 -50.285 16.467  1.00 40.89 ? 504 XG4 A O6    1 
HETATM 3770 N  N7    . XG4 G 6 .   ? 23.533 -47.441 15.904  1.00 31.97 ? 504 XG4 A N7    1 
HETATM 3771 C  C8    . XG4 G 6 .   ? 22.635 -46.603 15.309  1.00 29.84 ? 504 XG4 A C8    1 
HETATM 3772 N  N9    . XG4 G 6 .   ? 21.765 -47.305 14.544  1.00 29.99 ? 504 XG4 A N9    1 
HETATM 3773 P  PA    . XG4 G 6 .   ? 21.632 -41.852 14.975  1.00 26.60 ? 504 XG4 A PA    1 
HETATM 3774 P  PB    . XG4 G 6 .   ? 19.009 -41.596 16.339  1.00 24.24 ? 504 XG4 A PB    1 
HETATM 3775 P  PG    . XG4 G 6 .   ? 19.381 -38.939 17.282  1.00 23.37 ? 504 XG4 A PG    1 
HETATM 3776 C  "C1'" . XG4 G 6 .   ? 20.616 -46.818 13.733  1.00 27.86 ? 504 XG4 A "C1'" 1 
HETATM 3777 O  O1A   . XG4 G 6 .   ? 21.230 -40.606 14.286  1.00 24.92 ? 504 XG4 A O1A   1 
HETATM 3778 O  O1B   . XG4 G 6 .   ? 18.693 -41.078 14.996  1.00 22.18 ? 504 XG4 A O1B   1 
HETATM 3779 O  O1G   . XG4 G 6 .   ? 20.004 -38.796 15.922  1.00 26.32 ? 504 XG4 A O1G   1 
HETATM 3780 C  "C2'" . XG4 G 6 .   ? 19.428 -46.549 14.657  1.00 24.73 ? 504 XG4 A "C2'" 1 
HETATM 3781 O  O2A   . XG4 G 6 .   ? 23.129 -41.767 15.542  1.00 32.38 ? 504 XG4 A O2A   1 
HETATM 3782 O  O2B   . XG4 G 6 .   ? 18.066 -42.835 16.674  1.00 24.14 ? 504 XG4 A O2B   1 
HETATM 3783 O  O2G   . XG4 G 6 .   ? 20.358 -38.692 18.415  1.00 27.56 ? 504 XG4 A O2G   1 
HETATM 3784 C  "C3'" . XG4 G 6 .   ? 19.321 -45.035 14.622  1.00 26.05 ? 504 XG4 A "C3'" 1 
HETATM 3785 O  "O3'" . XG4 G 6 .   ? 17.984 -44.582 14.785  1.00 20.97 ? 504 XG4 A "O3'" 1 
HETATM 3786 N  N3A   . XG4 G 6 .   ? 20.675 -42.148 16.417  1.00 28.40 ? 504 XG4 A N3A   1 
HETATM 3787 O  O3B   . XG4 G 6 .   ? 18.812 -40.445 17.446  1.00 25.76 ? 504 XG4 A O3B   1 
HETATM 3788 O  O3G   . XG4 G 6 .   ? 18.238 -37.977 17.399  1.00 22.65 ? 504 XG4 A O3G   1 
HETATM 3789 C  "C4'" . XG4 G 6 .   ? 19.842 -44.688 13.240  1.00 25.85 ? 504 XG4 A "C4'" 1 
HETATM 3790 O  "O4'" . XG4 G 6 .   ? 20.914 -45.606 13.022  1.00 26.78 ? 504 XG4 A "O4'" 1 
HETATM 3791 C  "C5'" . XG4 G 6 .   ? 20.345 -43.264 13.176  1.00 24.73 ? 504 XG4 A "C5'" 1 
HETATM 3792 O  "O5'" . XG4 G 6 .   ? 21.491 -43.105 13.997  1.00 27.02 ? 504 XG4 A "O5'" 1 
HETATM 3793 O  O     . HOH H 7 .   ? 54.725 -33.855 3.761   1.00 32.09 ? 601 HOH A O     1 
HETATM 3794 O  O     . HOH H 7 .   ? 23.703 -62.261 15.723  1.00 30.26 ? 602 HOH A O     1 
HETATM 3795 O  O     . HOH H 7 .   ? 29.094 -10.052 7.462   1.00 41.48 ? 603 HOH A O     1 
HETATM 3796 O  O     . HOH H 7 .   ? 20.341 -8.153  27.680  1.00 52.63 ? 604 HOH A O     1 
HETATM 3797 O  O     . HOH H 7 .   ? 24.979 -67.730 -16.056 1.00 36.45 ? 605 HOH A O     1 
HETATM 3798 O  O     . HOH H 7 .   ? 33.177 -29.699 4.647   1.00 21.26 ? 606 HOH A O     1 
HETATM 3799 O  O     . HOH H 7 .   ? 11.518 -34.901 17.223  1.00 17.66 ? 607 HOH A O     1 
HETATM 3800 O  O     . HOH H 7 .   ? 30.647 -33.905 15.891  1.00 28.79 ? 608 HOH A O     1 
HETATM 3801 O  O     . HOH H 7 .   ? 27.707 -16.521 17.991  1.00 25.62 ? 609 HOH A O     1 
HETATM 3802 O  O     . HOH H 7 .   ? 40.868 -18.117 17.579  1.00 34.71 ? 610 HOH A O     1 
HETATM 3803 O  O     . HOH H 7 .   ? 43.451 -67.839 3.174   1.00 48.41 ? 611 HOH A O     1 
HETATM 3804 O  O     . HOH H 7 .   ? 26.494 -9.982  10.987  1.00 37.25 ? 612 HOH A O     1 
HETATM 3805 O  O     . HOH H 7 .   ? 29.576 -25.439 -3.159  1.00 35.10 ? 613 HOH A O     1 
HETATM 3806 O  O     . HOH H 7 .   ? 35.285 -37.175 3.730   1.00 43.38 ? 614 HOH A O     1 
HETATM 3807 O  O     . HOH H 7 .   ? 7.107  -40.569 1.603   1.00 34.60 ? 615 HOH A O     1 
HETATM 3808 O  O     . HOH H 7 .   ? 19.574 -26.371 -4.968  1.00 33.40 ? 616 HOH A O     1 
HETATM 3809 O  O     . HOH H 7 .   ? 19.148 -44.122 2.092   1.00 25.57 ? 617 HOH A O     1 
HETATM 3810 O  O     . HOH H 7 .   ? 35.042 -27.535 -0.935  1.00 31.99 ? 618 HOH A O     1 
HETATM 3811 O  O     . HOH H 7 .   ? 40.104 -28.645 8.017   1.00 25.00 ? 619 HOH A O     1 
HETATM 3812 O  O     . HOH H 7 .   ? 10.305 -25.778 9.641   1.00 32.74 ? 620 HOH A O     1 
HETATM 3813 O  O     . HOH H 7 .   ? 22.722 -53.227 29.358  1.00 30.80 ? 621 HOH A O     1 
HETATM 3814 O  O     . HOH H 7 .   ? 9.434  -54.911 7.472   1.00 29.24 ? 622 HOH A O     1 
HETATM 3815 O  O     . HOH H 7 .   ? 16.018 -45.519 -5.567  1.00 44.71 ? 623 HOH A O     1 
HETATM 3816 O  O     . HOH H 7 .   ? 27.166 -40.407 -6.812  1.00 31.57 ? 624 HOH A O     1 
HETATM 3817 O  O     . HOH H 7 .   ? 0.802  -34.157 6.280   1.00 26.35 ? 625 HOH A O     1 
HETATM 3818 O  O     . HOH H 7 .   ? 34.988 -24.066 2.612   1.00 30.18 ? 626 HOH A O     1 
HETATM 3819 O  O     . HOH H 7 .   ? 40.756 -23.649 24.502  1.00 21.94 ? 627 HOH A O     1 
HETATM 3820 O  O     . HOH H 7 .   ? 17.858 -52.896 -2.211  1.00 34.68 ? 628 HOH A O     1 
HETATM 3821 O  O     . HOH H 7 .   ? 35.675 -26.136 30.393  1.00 36.96 ? 629 HOH A O     1 
HETATM 3822 O  O     . HOH H 7 .   ? 26.411 -46.588 -8.082  1.00 36.68 ? 630 HOH A O     1 
HETATM 3823 O  O     . HOH H 7 .   ? 47.116 -25.158 25.624  1.00 27.83 ? 631 HOH A O     1 
HETATM 3824 O  O     . HOH H 7 .   ? 23.840 -35.821 14.127  1.00 32.22 ? 632 HOH A O     1 
HETATM 3825 O  O     . HOH H 7 .   ? 27.368 -7.313  10.882  1.00 39.87 ? 633 HOH A O     1 
HETATM 3826 O  O     . HOH H 7 .   ? 32.535 -24.858 24.190  1.00 27.64 ? 634 HOH A O     1 
HETATM 3827 O  O     . HOH H 7 .   ? 27.828 -37.310 9.517   1.00 28.99 ? 635 HOH A O     1 
HETATM 3828 O  O     . HOH H 7 .   ? 25.402 -25.331 -3.958  1.00 25.22 ? 636 HOH A O     1 
HETATM 3829 O  O     . HOH H 7 .   ? 12.840 -53.936 8.542   1.00 25.78 ? 637 HOH A O     1 
HETATM 3830 O  O     . HOH H 7 .   ? 22.520 -38.127 15.698  1.00 28.34 ? 638 HOH A O     1 
HETATM 3831 O  O     . HOH H 7 .   ? 34.251 -21.303 8.982   1.00 32.01 ? 639 HOH A O     1 
HETATM 3832 O  O     . HOH H 7 .   ? 30.596 -28.971 -0.835  1.00 31.75 ? 640 HOH A O     1 
HETATM 3833 O  O     . HOH H 7 .   ? 23.502 -39.525 13.505  1.00 27.80 ? 641 HOH A O     1 
HETATM 3834 O  O     . HOH H 7 .   ? 52.350 -29.278 23.688  1.00 35.07 ? 642 HOH A O     1 
HETATM 3835 O  O     . HOH H 7 .   ? 46.983 -24.493 14.495  1.00 25.48 ? 643 HOH A O     1 
HETATM 3836 O  O     . HOH H 7 .   ? 49.253 -30.326 3.052   1.00 36.10 ? 644 HOH A O     1 
HETATM 3837 O  O     . HOH H 7 .   ? 18.143 -43.031 19.321  1.00 27.75 ? 645 HOH A O     1 
HETATM 3838 O  O     . HOH H 7 .   ? 21.270 -24.104 23.061  1.00 28.18 ? 646 HOH A O     1 
HETATM 3839 O  O     . HOH H 7 .   ? 26.745 -31.842 18.524  1.00 25.98 ? 647 HOH A O     1 
HETATM 3840 O  O     . HOH H 7 .   ? 21.891 -40.656 19.348  1.00 28.45 ? 648 HOH A O     1 
HETATM 3841 O  O     . HOH H 7 .   ? 20.044 -28.421 16.461  1.00 22.17 ? 649 HOH A O     1 
HETATM 3842 O  O     . HOH H 7 .   ? 9.702  -39.560 19.040  1.00 25.97 ? 650 HOH A O     1 
HETATM 3843 O  O     . HOH H 7 .   ? 29.229 -79.906 8.770   1.00 50.16 ? 651 HOH A O     1 
HETATM 3844 O  O     . HOH H 7 .   ? 6.115  -52.228 23.565  1.00 26.67 ? 652 HOH A O     1 
HETATM 3845 O  O     . HOH H 7 .   ? 53.785 -26.805 6.804   1.00 31.54 ? 653 HOH A O     1 
HETATM 3846 O  O     . HOH H 7 .   ? 11.121 -17.450 15.547  1.00 26.46 ? 654 HOH A O     1 
HETATM 3847 O  O     . HOH H 7 .   ? 39.208 -20.967 16.984  1.00 27.73 ? 655 HOH A O     1 
HETATM 3848 O  O     . HOH H 7 .   ? 28.835 -47.443 -15.101 1.00 35.05 ? 656 HOH A O     1 
HETATM 3849 O  O     . HOH H 7 .   ? 22.376 -24.975 -3.701  1.00 28.83 ? 657 HOH A O     1 
HETATM 3850 O  O     . HOH H 7 .   ? 30.485 -49.219 -5.735  1.00 32.85 ? 658 HOH A O     1 
HETATM 3851 O  O     . HOH H 7 .   ? 40.400 -62.269 -3.698  1.00 40.51 ? 659 HOH A O     1 
HETATM 3852 O  O     . HOH H 7 .   ? 12.487 -24.074 21.608  1.00 36.70 ? 660 HOH A O     1 
HETATM 3853 O  O     . HOH H 7 .   ? 30.686 -14.808 11.551  1.00 29.78 ? 661 HOH A O     1 
HETATM 3854 O  O     . HOH H 7 .   ? 33.403 -17.070 19.081  1.00 25.98 ? 662 HOH A O     1 
HETATM 3855 O  O     . HOH H 7 .   ? 8.158  -52.005 30.363  1.00 30.34 ? 663 HOH A O     1 
HETATM 3856 O  O     . HOH H 7 .   ? 31.445 -13.845 0.013   1.00 42.94 ? 664 HOH A O     1 
HETATM 3857 O  O     . HOH H 7 .   ? 29.807 -17.017 9.198   1.00 25.22 ? 665 HOH A O     1 
HETATM 3858 O  O     . HOH H 7 .   ? 26.520 -44.603 -4.694  1.00 33.89 ? 666 HOH A O     1 
HETATM 3859 O  O     . HOH H 7 .   ? 10.725 -45.664 0.233   1.00 28.31 ? 667 HOH A O     1 
HETATM 3860 O  O     . HOH H 7 .   ? 6.381  -46.202 9.538   1.00 23.87 ? 668 HOH A O     1 
HETATM 3861 O  O     . HOH H 7 .   ? 31.627 -37.891 22.968  1.00 37.41 ? 669 HOH A O     1 
HETATM 3862 O  O     . HOH H 7 .   ? 8.302  -61.789 19.191  1.00 32.80 ? 670 HOH A O     1 
HETATM 3863 O  O     . HOH H 7 .   ? 16.700 -53.872 2.953   1.00 25.15 ? 671 HOH A O     1 
HETATM 3864 O  O     . HOH H 7 .   ? 16.932 -61.393 5.682   1.00 34.43 ? 672 HOH A O     1 
HETATM 3865 O  O     . HOH H 7 .   ? 9.129  -47.805 6.032   1.00 24.78 ? 673 HOH A O     1 
HETATM 3866 O  O     . HOH H 7 .   ? 26.398 -18.999 15.399  1.00 21.63 ? 674 HOH A O     1 
HETATM 3867 O  O     . HOH H 7 .   ? 45.228 -28.123 28.476  1.00 32.32 ? 675 HOH A O     1 
HETATM 3868 O  O     . HOH H 7 .   ? 38.205 -34.051 0.943   1.00 38.45 ? 676 HOH A O     1 
HETATM 3869 O  O     . HOH H 7 .   ? 14.427 -58.795 16.523  1.00 30.72 ? 677 HOH A O     1 
HETATM 3870 O  O     . HOH H 7 .   ? 31.846 -32.565 13.605  1.00 26.07 ? 678 HOH A O     1 
HETATM 3871 O  O     . HOH H 7 .   ? 6.173  -39.879 18.756  1.00 26.86 ? 679 HOH A O     1 
HETATM 3872 O  O     . HOH H 7 .   ? 26.302 -52.649 16.908  1.00 33.94 ? 680 HOH A O     1 
HETATM 3873 O  O     . HOH H 7 .   ? 19.188 -18.366 19.458  1.00 24.70 ? 681 HOH A O     1 
HETATM 3874 O  O     . HOH H 7 .   ? 37.713 -22.823 -1.721  1.00 47.84 ? 682 HOH A O     1 
HETATM 3875 O  O     . HOH H 7 .   ? 24.217 -53.683 15.812  1.00 34.53 ? 683 HOH A O     1 
HETATM 3876 O  O     . HOH H 7 .   ? 54.062 -23.382 18.485  1.00 34.78 ? 684 HOH A O     1 
HETATM 3877 O  O     . HOH H 7 .   ? 7.129  -39.234 14.942  1.00 33.88 ? 685 HOH A O     1 
HETATM 3878 O  O     . HOH H 7 .   ? 9.274  -49.809 -2.545  1.00 50.20 ? 686 HOH A O     1 
HETATM 3879 O  O     . HOH H 7 .   ? 55.010 -29.898 19.369  1.00 33.27 ? 687 HOH A O     1 
HETATM 3880 O  O     . HOH H 7 .   ? 7.920  -40.100 21.607  1.00 31.52 ? 688 HOH A O     1 
HETATM 3881 O  O     . HOH H 7 .   ? 22.410 -36.417 -4.567  1.00 41.70 ? 689 HOH A O     1 
HETATM 3882 O  O     . HOH H 7 .   ? 21.549 -43.365 22.788  1.00 27.46 ? 690 HOH A O     1 
HETATM 3883 O  O     . HOH H 7 .   ? 38.437 -15.057 11.211  1.00 29.25 ? 691 HOH A O     1 
HETATM 3884 O  O     . HOH H 7 .   ? 19.282 -29.659 23.304  1.00 34.25 ? 692 HOH A O     1 
HETATM 3885 O  O     . HOH H 7 .   ? 21.410 -44.338 18.203  1.00 27.96 ? 693 HOH A O     1 
HETATM 3886 O  O     . HOH H 7 .   ? 9.158  -39.029 -0.081  1.00 29.51 ? 694 HOH A O     1 
HETATM 3887 O  O     . HOH H 7 .   ? 5.333  -50.232 15.409  1.00 30.71 ? 695 HOH A O     1 
HETATM 3888 O  O     . HOH H 7 .   ? 36.447 -17.343 13.607  1.00 26.78 ? 696 HOH A O     1 
HETATM 3889 O  O     . HOH H 7 .   ? 10.628 -23.410 18.572  1.00 37.15 ? 697 HOH A O     1 
HETATM 3890 O  O     . HOH H 7 .   ? 10.619 -27.756 13.886  1.00 31.19 ? 698 HOH A O     1 
HETATM 3891 O  O     . HOH H 7 .   ? 18.903 -43.647 -0.324  1.00 35.22 ? 699 HOH A O     1 
HETATM 3892 O  O     . HOH H 7 .   ? 39.683 -29.716 5.108   1.00 37.11 ? 700 HOH A O     1 
HETATM 3893 O  O     . HOH H 7 .   ? 38.314 -35.092 23.943  1.00 30.32 ? 701 HOH A O     1 
HETATM 3894 O  O     . HOH H 7 .   ? 18.635 -46.559 2.292   1.00 29.28 ? 702 HOH A O     1 
HETATM 3895 O  O     . HOH H 7 .   ? 29.830 -12.027 7.760   1.00 31.56 ? 703 HOH A O     1 
HETATM 3896 O  O     . HOH H 7 .   ? 23.476 -45.443 9.409   1.00 32.24 ? 704 HOH A O     1 
HETATM 3897 O  O     . HOH H 7 .   ? 11.232 -38.826 21.078  1.00 25.75 ? 705 HOH A O     1 
HETATM 3898 O  O     . HOH H 7 .   ? -0.379 -37.911 16.160  1.00 31.18 ? 706 HOH A O     1 
HETATM 3899 O  O     . HOH H 7 .   ? 25.180 -46.758 28.670  1.00 43.85 ? 707 HOH A O     1 
HETATM 3900 O  O     . HOH H 7 .   ? 10.744 -20.613 6.557   1.00 28.38 ? 708 HOH A O     1 
HETATM 3901 O  O     . HOH H 7 .   ? 9.715  -36.046 -3.411  1.00 29.32 ? 709 HOH A O     1 
HETATM 3902 O  O     . HOH H 7 .   ? 30.968 -38.675 8.453   1.00 39.38 ? 710 HOH A O     1 
HETATM 3903 O  O     . HOH H 7 .   ? 31.262 -36.865 5.260   1.00 40.77 ? 711 HOH A O     1 
HETATM 3904 O  O     . HOH H 7 .   ? 35.321 -24.044 5.781   1.00 27.03 ? 712 HOH A O     1 
HETATM 3905 O  O     . HOH H 7 .   ? 9.832  -38.692 29.678  1.00 31.39 ? 713 HOH A O     1 
HETATM 3906 O  O     . HOH H 7 .   ? 57.200 -24.943 12.758  1.00 24.75 ? 714 HOH A O     1 
HETATM 3907 O  O     . HOH H 7 .   ? 12.268 -29.890 21.266  1.00 34.03 ? 715 HOH A O     1 
HETATM 3908 O  O     . HOH H 7 .   ? 47.940 -37.849 8.004   1.00 32.17 ? 716 HOH A O     1 
HETATM 3909 O  O     . HOH H 7 .   ? 38.976 -33.771 25.809  1.00 34.58 ? 717 HOH A O     1 
HETATM 3910 O  O     . HOH H 7 .   ? 29.996 -20.706 21.641  1.00 25.83 ? 718 HOH A O     1 
HETATM 3911 O  O     . HOH H 7 .   ? 17.622 -12.558 29.939  1.00 47.66 ? 719 HOH A O     1 
HETATM 3912 O  O     . HOH H 7 .   ? 27.403 -24.694 23.471  1.00 39.94 ? 720 HOH A O     1 
HETATM 3913 O  O     . HOH H 7 .   ? 23.199 -34.340 21.062  1.00 35.67 ? 721 HOH A O     1 
HETATM 3914 O  O     . HOH H 7 .   ? 22.859 -76.041 4.090   1.00 48.56 ? 722 HOH A O     1 
HETATM 3915 O  O     . HOH H 7 .   ? 38.273 -43.435 21.870  1.00 41.07 ? 723 HOH A O     1 
HETATM 3916 O  O     . HOH H 7 .   ? 11.778 -9.912  12.670  1.00 39.35 ? 724 HOH A O     1 
HETATM 3917 O  O     . HOH H 7 .   ? 21.989 -2.574  13.452  1.00 40.95 ? 725 HOH A O     1 
HETATM 3918 O  O     . HOH H 7 .   ? 35.788 -17.430 2.205   1.00 35.86 ? 726 HOH A O     1 
HETATM 3919 O  O     . HOH H 7 .   ? 44.047 -32.358 4.495   1.00 33.69 ? 727 HOH A O     1 
HETATM 3920 O  O     . HOH H 7 .   ? 32.167 -12.950 9.267   1.00 41.26 ? 728 HOH A O     1 
HETATM 3921 O  O     . HOH H 7 .   ? 27.700 -74.316 17.293  1.00 45.68 ? 729 HOH A O     1 
HETATM 3922 O  O     . HOH H 7 .   ? 26.466 -5.086  12.054  1.00 38.54 ? 730 HOH A O     1 
HETATM 3923 O  O     . HOH H 7 .   ? 31.490 -9.088  3.873   1.00 43.95 ? 731 HOH A O     1 
HETATM 3924 O  O     . HOH H 7 .   ? 24.444 -42.165 -5.695  1.00 34.63 ? 732 HOH A O     1 
HETATM 3925 O  O     . HOH H 7 .   ? 22.703 -57.856 34.758  1.00 39.32 ? 733 HOH A O     1 
HETATM 3926 O  O     . HOH H 7 .   ? 43.195 -27.089 29.489  1.00 35.60 ? 734 HOH A O     1 
HETATM 3927 O  O     . HOH H 7 .   ? 50.079 -21.656 7.938   1.00 43.10 ? 735 HOH A O     1 
HETATM 3928 O  O     . HOH H 7 .   ? 21.702 -3.735  10.619  1.00 46.63 ? 736 HOH A O     1 
HETATM 3929 O  O     . HOH H 7 .   ? 13.322 -13.549 32.366  1.00 46.88 ? 737 HOH A O     1 
HETATM 3930 O  O     . HOH H 7 .   ? 6.736  -37.648 -0.411  1.00 35.49 ? 738 HOH A O     1 
HETATM 3931 O  O     . HOH H 7 .   ? 40.951 -36.640 10.143  1.00 36.00 ? 739 HOH A O     1 
HETATM 3932 O  O     . HOH H 7 .   ? 8.312  -46.897 3.700   1.00 31.11 ? 740 HOH A O     1 
HETATM 3933 O  O     . HOH H 7 .   ? 45.447 -31.064 29.406  1.00 37.62 ? 741 HOH A O     1 
HETATM 3934 O  O     . HOH H 7 .   ? 19.254 -42.887 35.654  1.00 42.74 ? 742 HOH A O     1 
HETATM 3935 O  O     . HOH H 7 .   ? 54.338 -24.920 20.578  1.00 43.89 ? 743 HOH A O     1 
HETATM 3936 O  O     . HOH H 7 .   ? 38.329 -53.903 -10.058 1.00 45.39 ? 744 HOH A O     1 
HETATM 3937 O  O     . HOH H 7 .   ? 17.698 -9.283  8.693   1.00 42.11 ? 745 HOH A O     1 
HETATM 3938 O  O     . HOH H 7 .   ? 5.126  -52.332 17.663  1.00 33.90 ? 746 HOH A O     1 
HETATM 3939 O  O     . HOH H 7 .   ? 18.515 -57.791 -15.471 1.00 36.12 ? 747 HOH A O     1 
HETATM 3940 O  O     . HOH H 7 .   ? 51.966 -22.067 10.430  1.00 36.16 ? 748 HOH A O     1 
HETATM 3941 O  O     . HOH H 7 .   ? 27.432 -52.297 21.334  1.00 46.97 ? 749 HOH A O     1 
HETATM 3942 O  O     . HOH H 7 .   ? 21.613 -36.151 20.355  1.00 36.28 ? 750 HOH A O     1 
HETATM 3943 O  O     . HOH H 7 .   ? 7.081  -47.600 7.499   1.00 27.53 ? 751 HOH A O     1 
HETATM 3944 O  O     . HOH H 7 .   ? 4.163  -39.590 13.240  1.00 32.50 ? 752 HOH A O     1 
HETATM 3945 O  O     . HOH H 7 .   ? 2.027  -47.050 28.548  1.00 27.00 ? 753 HOH A O     1 
HETATM 3946 O  O     . HOH H 7 .   ? 14.175 -39.008 35.796  1.00 43.19 ? 754 HOH A O     1 
HETATM 3947 O  O     . HOH H 7 .   ? 15.156 -10.499 30.056  1.00 45.80 ? 755 HOH A O     1 
HETATM 3948 O  O     . HOH H 7 .   ? 44.922 -41.419 11.664  1.00 41.28 ? 756 HOH A O     1 
HETATM 3949 O  O     . HOH H 7 .   ? -2.946 -43.550 20.266  1.00 39.48 ? 757 HOH A O     1 
HETATM 3950 O  O     . HOH H 7 .   ? 18.735 -44.247 -9.395  1.00 41.28 ? 758 HOH A O     1 
HETATM 3951 O  O     . HOH H 7 .   ? 47.667 -19.471 19.635  1.00 39.43 ? 759 HOH A O     1 
HETATM 3952 O  O     . HOH H 7 .   ? 41.836 -35.912 7.704   1.00 36.16 ? 760 HOH A O     1 
HETATM 3953 O  O     . HOH H 7 .   ? 18.337 -30.184 -6.819  1.00 34.20 ? 761 HOH A O     1 
HETATM 3954 O  O     . HOH H 7 .   ? -2.927 -44.463 22.817  1.00 40.22 ? 762 HOH A O     1 
HETATM 3955 O  O     . HOH H 7 .   ? 21.485 -9.493  31.229  1.00 46.96 ? 763 HOH A O     1 
HETATM 3956 O  O     . HOH H 7 .   ? 23.508 -37.618 -7.034  1.00 42.71 ? 764 HOH A O     1 
HETATM 3957 O  O     . HOH H 7 .   ? 34.685 -22.546 32.789  1.00 38.27 ? 765 HOH A O     1 
HETATM 3958 O  O     . HOH H 7 .   ? 45.686 -60.029 15.074  1.00 48.96 ? 766 HOH A O     1 
HETATM 3959 O  O     . HOH H 7 .   ? 40.424 -8.298  6.119   1.00 44.91 ? 767 HOH A O     1 
HETATM 3960 O  O     . HOH H 7 .   ? 17.110 -47.111 -3.404  1.00 44.14 ? 768 HOH A O     1 
HETATM 3961 O  O     . HOH H 7 .   ? 24.014 -20.693 23.067  1.00 32.50 ? 769 HOH A O     1 
HETATM 3962 O  O     . HOH H 7 .   ? 7.051  -32.253 -5.420  1.00 41.28 ? 770 HOH A O     1 
HETATM 3963 O  O     . HOH H 7 .   ? 4.653  -39.830 15.595  1.00 29.29 ? 771 HOH A O     1 
HETATM 3964 O  O     . HOH H 7 .   ? 38.482 -18.196 1.411   1.00 48.43 ? 772 HOH A O     1 
HETATM 3965 O  O     . HOH H 7 .   ? 50.588 -20.514 15.461  1.00 36.00 ? 773 HOH A O     1 
HETATM 3966 O  O     . HOH H 7 .   ? 12.307 -56.143 -6.806  1.00 36.11 ? 774 HOH A O     1 
HETATM 3967 O  O     . HOH H 7 .   ? 43.163 -18.029 14.750  1.00 36.12 ? 775 HOH A O     1 
HETATM 3968 O  O     . HOH H 7 .   ? 18.685 -39.493 34.592  1.00 42.65 ? 776 HOH A O     1 
HETATM 3969 O  O     . HOH H 7 .   ? 41.283 -45.019 21.272  1.00 38.83 ? 777 HOH A O     1 
HETATM 3970 O  O     . HOH H 7 .   ? 39.004 -32.013 0.283   1.00 41.01 ? 778 HOH A O     1 
HETATM 3971 O  O     . HOH H 7 .   ? 52.230 -32.206 27.357  1.00 30.96 ? 779 HOH A O     1 
HETATM 3972 O  O     . HOH H 7 .   ? 16.621 -57.467 38.000  1.00 31.86 ? 780 HOH A O     1 
HETATM 3973 O  O     . HOH H 7 .   ? 40.006 -19.418 15.100  1.00 25.94 ? 781 HOH A O     1 
HETATM 3974 O  O     . HOH H 7 .   ? 49.014 -26.202 26.723  1.00 30.26 ? 782 HOH A O     1 
HETATM 3975 O  O     . HOH H 7 .   ? 26.657 -4.401  9.516   1.00 38.45 ? 783 HOH A O     1 
HETATM 3976 O  O     . HOH H 7 .   ? 20.405 -20.712 24.195  1.00 40.39 ? 784 HOH A O     1 
HETATM 3977 O  O     . HOH H 7 .   ? 46.020 -27.590 2.555   1.00 37.79 ? 785 HOH A O     1 
HETATM 3978 O  O     . HOH H 7 .   ? 42.710 -66.093 9.959   1.00 54.80 ? 786 HOH A O     1 
HETATM 3979 O  O     . HOH H 7 .   ? 16.955 -2.963  19.471  1.00 41.07 ? 787 HOH A O     1 
HETATM 3980 O  O     . HOH H 7 .   ? 24.112 -51.086 31.002  1.00 36.93 ? 788 HOH A O     1 
HETATM 3981 O  O     . HOH H 7 .   ? 41.118 -68.504 22.152  1.00 42.59 ? 789 HOH A O     1 
HETATM 3982 O  O     . HOH H 7 .   ? 20.229 -50.040 0.004   1.00 33.24 ? 790 HOH A O     1 
HETATM 3983 O  O     . HOH H 7 .   ? 33.856 -14.455 2.003   1.00 39.80 ? 791 HOH A O     1 
HETATM 3984 O  O     . HOH H 7 .   ? 24.035 -45.522 -18.369 1.00 41.82 ? 792 HOH A O     1 
HETATM 3985 O  O     . HOH H 7 .   ? 15.725 -53.285 -0.193  1.00 38.93 ? 793 HOH A O     1 
HETATM 3986 O  O     . HOH H 7 .   ? 18.076 -5.404  -8.772  1.00 47.90 ? 794 HOH A O     1 
HETATM 3987 O  O     . HOH H 7 .   ? 36.087 -47.562 -1.976  1.00 52.36 ? 795 HOH A O     1 
HETATM 3988 O  O     . HOH H 7 .   ? 1.908  -16.536 14.523  1.00 42.91 ? 796 HOH A O     1 
HETATM 3989 O  O     . HOH I 7 .   ? 40.654 -50.327 14.079  1.00 32.99 ? 101 HOH P O     1 
HETATM 3990 O  O     . HOH I 7 .   ? 32.996 -37.805 16.502  1.00 35.25 ? 102 HOH P O     1 
HETATM 3991 O  O     . HOH I 7 .   ? 45.918 -52.184 7.054   1.00 42.11 ? 103 HOH P O     1 
HETATM 3992 O  O     . HOH I 7 .   ? 39.953 -40.344 15.945  1.00 29.50 ? 104 HOH P O     1 
HETATM 3993 O  O     . HOH I 7 .   ? 42.225 -41.495 12.168  1.00 32.26 ? 105 HOH P O     1 
HETATM 3994 O  O     . HOH I 7 .   ? 30.615 -36.752 15.070  1.00 33.94 ? 106 HOH P O     1 
HETATM 3995 O  O     . HOH I 7 .   ? 37.155 -46.079 16.115  1.00 34.14 ? 107 HOH P O     1 
HETATM 3996 O  O     . HOH I 7 .   ? 34.424 -49.892 15.522  1.00 40.89 ? 108 HOH P O     1 
HETATM 3997 O  O     . HOH I 7 .   ? 38.530 -40.602 10.000  1.00 38.74 ? 109 HOH P O     1 
HETATM 3998 O  O     . HOH I 7 .   ? 38.073 -56.089 0.184   1.00 37.84 ? 110 HOH P O     1 
HETATM 3999 O  O     . HOH J 7 .   ? 45.815 -39.596 6.901   1.00 31.34 ? 101 HOH T O     1 
HETATM 4000 O  O     . HOH J 7 .   ? 27.950 -65.437 32.736  1.00 47.05 ? 102 HOH T O     1 
HETATM 4001 O  O     . HOH J 7 .   ? 31.721 -48.402 0.978   1.00 35.04 ? 103 HOH T O     1 
HETATM 4002 O  O     . HOH J 7 .   ? 26.330 -44.198 1.881   1.00 38.86 ? 104 HOH T O     1 
HETATM 4003 O  O     . HOH J 7 .   ? 19.007 -55.846 6.578   1.00 28.21 ? 105 HOH T O     1 
HETATM 4004 O  O     . HOH J 7 .   ? 38.673 -49.283 0.416   1.00 38.46 ? 106 HOH T O     1 
HETATM 4005 O  O     . HOH J 7 .   ? 28.811 -56.121 18.555  1.00 43.54 ? 107 HOH T O     1 
HETATM 4006 O  O     . HOH J 7 .   ? 32.265 -50.852 3.776   1.00 36.99 ? 108 HOH T O     1 
HETATM 4007 O  O     . HOH J 7 .   ? 27.442 -58.008 12.377  1.00 37.88 ? 109 HOH T O     1 
HETATM 4008 O  O     . HOH J 7 .   ? 22.864 -52.315 20.860  1.00 35.61 ? 110 HOH T O     1 
HETATM 4009 O  O     . HOH J 7 .   ? 50.346 -42.138 5.675   1.00 37.27 ? 111 HOH T O     1 
HETATM 4010 O  O     . HOH J 7 .   ? 26.044 -46.263 7.544   1.00 39.58 ? 112 HOH T O     1 
HETATM 4011 O  O     . HOH J 7 .   ? 26.576 -54.106 25.618  1.00 42.98 ? 113 HOH T O     1 
HETATM 4012 O  O     . HOH J 7 .   ? 49.047 -39.988 3.311   1.00 41.60 ? 114 HOH T O     1 
HETATM 4013 O  O     . HOH J 7 .   ? 34.031 -50.420 1.412   1.00 40.57 ? 115 HOH T O     1 
HETATM 4014 O  O     . HOH J 7 .   ? 34.018 -53.218 11.442  1.00 33.32 ? 116 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DA  1   1   1   DA  DA  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DC  3   3   3   DC  DC  P . n 
B 2 4   DG  4   4   4   DG  DG  P . n 
B 2 5   DT  5   5   5   DT  DT  P . n 
B 2 6   DC  6   6   6   DC  DC  P . n 
B 2 7   DA  7   7   7   DA  DA  P . n 
B 2 8   DT  8   8   8   DT  DT  P . n 
C 3 1   DC  1   1   ?   ?   ?   T . n 
C 3 2   DA  2   2   2   DA  DA  T . n 
C 3 3   DT  3   3   3   DT  DT  T . n 
C 3 4   5DB 4   4   4   5DB OMT T . n 
C 3 5   DA  5   5   5   DA  DA  T . n 
C 3 6   DT  6   6   6   DT  DT  T . n 
C 3 7   DG  7   7   7   DG  DG  T . n 
C 3 8   DA  8   8   8   DA  DA  T . n 
C 3 9   DC  9   9   9   DC  DC  T . n 
C 3 10  DG  10  10  10  DG  DG  T . n 
C 3 11  DC  11  11  11  DC  DC  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 GOL 1   501 1   GOL GOL A . 
E 5 MG  1   502 1   MG  MG  A . 
F 5 MG  1   503 2   MG  MG  A . 
G 6 XG4 1   504 1   XG4 XG4 A . 
H 7 HOH 1   601 52  HOH HOH A . 
H 7 HOH 2   602 31  HOH HOH A . 
H 7 HOH 3   603 39  HOH HOH A . 
H 7 HOH 4   604 130 HOH HOH A . 
H 7 HOH 5   605 102 HOH HOH A . 
H 7 HOH 6   606 7   HOH HOH A . 
H 7 HOH 7   607 13  HOH HOH A . 
H 7 HOH 8   608 134 HOH HOH A . 
H 7 HOH 9   609 44  HOH HOH A . 
H 7 HOH 10  610 146 HOH HOH A . 
H 7 HOH 11  611 154 HOH HOH A . 
H 7 HOH 12  612 40  HOH HOH A . 
H 7 HOH 13  613 9   HOH HOH A . 
H 7 HOH 14  614 204 HOH HOH A . 
H 7 HOH 15  615 94  HOH HOH A . 
H 7 HOH 16  616 202 HOH HOH A . 
H 7 HOH 17  617 64  HOH HOH A . 
H 7 HOH 18  618 47  HOH HOH A . 
H 7 HOH 19  619 188 HOH HOH A . 
H 7 HOH 20  620 164 HOH HOH A . 
H 7 HOH 21  621 103 HOH HOH A . 
H 7 HOH 22  622 92  HOH HOH A . 
H 7 HOH 23  623 66  HOH HOH A . 
H 7 HOH 24  624 77  HOH HOH A . 
H 7 HOH 25  625 150 HOH HOH A . 
H 7 HOH 26  626 45  HOH HOH A . 
H 7 HOH 27  627 20  HOH HOH A . 
H 7 HOH 28  628 174 HOH HOH A . 
H 7 HOH 29  629 144 HOH HOH A . 
H 7 HOH 30  630 149 HOH HOH A . 
H 7 HOH 31  631 208 HOH HOH A . 
H 7 HOH 32  632 22  HOH HOH A . 
H 7 HOH 33  633 62  HOH HOH A . 
H 7 HOH 34  634 131 HOH HOH A . 
H 7 HOH 35  635 27  HOH HOH A . 
H 7 HOH 36  636 11  HOH HOH A . 
H 7 HOH 37  637 91  HOH HOH A . 
H 7 HOH 38  638 2   HOH HOH A . 
H 7 HOH 39  639 218 HOH HOH A . 
H 7 HOH 40  640 8   HOH HOH A . 
H 7 HOH 41  641 1   HOH HOH A . 
H 7 HOH 42  642 107 HOH HOH A . 
H 7 HOH 43  643 32  HOH HOH A . 
H 7 HOH 44  644 112 HOH HOH A . 
H 7 HOH 45  645 5   HOH HOH A . 
H 7 HOH 46  646 100 HOH HOH A . 
H 7 HOH 47  647 21  HOH HOH A . 
H 7 HOH 48  648 3   HOH HOH A . 
H 7 HOH 49  649 42  HOH HOH A . 
H 7 HOH 50  650 14  HOH HOH A . 
H 7 HOH 51  651 209 HOH HOH A . 
H 7 HOH 52  652 41  HOH HOH A . 
H 7 HOH 53  653 56  HOH HOH A . 
H 7 HOH 54  654 121 HOH HOH A . 
H 7 HOH 55  655 145 HOH HOH A . 
H 7 HOH 56  656 6   HOH HOH A . 
H 7 HOH 57  657 12  HOH HOH A . 
H 7 HOH 58  658 190 HOH HOH A . 
H 7 HOH 59  659 216 HOH HOH A . 
H 7 HOH 60  660 165 HOH HOH A . 
H 7 HOH 61  661 36  HOH HOH A . 
H 7 HOH 62  662 30  HOH HOH A . 
H 7 HOH 63  663 205 HOH HOH A . 
H 7 HOH 64  664 215 HOH HOH A . 
H 7 HOH 65  665 35  HOH HOH A . 
H 7 HOH 66  666 76  HOH HOH A . 
H 7 HOH 67  667 172 HOH HOH A . 
H 7 HOH 68  668 19  HOH HOH A . 
H 7 HOH 69  669 118 HOH HOH A . 
H 7 HOH 70  670 73  HOH HOH A . 
H 7 HOH 71  671 28  HOH HOH A . 
H 7 HOH 72  672 87  HOH HOH A . 
H 7 HOH 73  673 89  HOH HOH A . 
H 7 HOH 74  674 115 HOH HOH A . 
H 7 HOH 75  675 109 HOH HOH A . 
H 7 HOH 76  676 50  HOH HOH A . 
H 7 HOH 77  677 199 HOH HOH A . 
H 7 HOH 78  678 25  HOH HOH A . 
H 7 HOH 79  679 16  HOH HOH A . 
H 7 HOH 80  680 186 HOH HOH A . 
H 7 HOH 81  681 122 HOH HOH A . 
H 7 HOH 82  682 48  HOH HOH A . 
H 7 HOH 83  683 187 HOH HOH A . 
H 7 HOH 84  684 167 HOH HOH A . 
H 7 HOH 85  685 18  HOH HOH A . 
H 7 HOH 86  686 143 HOH HOH A . 
H 7 HOH 87  687 98  HOH HOH A . 
H 7 HOH 88  688 163 HOH HOH A . 
H 7 HOH 89  689 219 HOH HOH A . 
H 7 HOH 90  690 4   HOH HOH A . 
H 7 HOH 91  691 222 HOH HOH A . 
H 7 HOH 92  692 151 HOH HOH A . 
H 7 HOH 93  693 43  HOH HOH A . 
H 7 HOH 94  694 93  HOH HOH A . 
H 7 HOH 95  695 51  HOH HOH A . 
H 7 HOH 96  696 148 HOH HOH A . 
H 7 HOH 97  697 166 HOH HOH A . 
H 7 HOH 98  698 153 HOH HOH A . 
H 7 HOH 99  699 178 HOH HOH A . 
H 7 HOH 100 700 214 HOH HOH A . 
H 7 HOH 101 701 117 HOH HOH A . 
H 7 HOH 102 702 63  HOH HOH A . 
H 7 HOH 103 703 38  HOH HOH A . 
H 7 HOH 104 704 82  HOH HOH A . 
H 7 HOH 105 705 15  HOH HOH A . 
H 7 HOH 106 706 207 HOH HOH A . 
H 7 HOH 107 707 105 HOH HOH A . 
H 7 HOH 108 708 170 HOH HOH A . 
H 7 HOH 109 709 95  HOH HOH A . 
H 7 HOH 110 710 26  HOH HOH A . 
H 7 HOH 111 711 85  HOH HOH A . 
H 7 HOH 112 712 46  HOH HOH A . 
H 7 HOH 113 713 173 HOH HOH A . 
H 7 HOH 114 714 54  HOH HOH A . 
H 7 HOH 115 715 181 HOH HOH A . 
H 7 HOH 116 716 72  HOH HOH A . 
H 7 HOH 117 717 193 HOH HOH A . 
H 7 HOH 118 718 196 HOH HOH A . 
H 7 HOH 119 719 127 HOH HOH A . 
H 7 HOH 120 720 133 HOH HOH A . 
H 7 HOH 121 721 60  HOH HOH A . 
H 7 HOH 122 722 220 HOH HOH A . 
H 7 HOH 123 723 120 HOH HOH A . 
H 7 HOH 124 724 160 HOH HOH A . 
H 7 HOH 125 725 155 HOH HOH A . 
H 7 HOH 126 726 123 HOH HOH A . 
H 7 HOH 127 727 114 HOH HOH A . 
H 7 HOH 128 728 37  HOH HOH A . 
H 7 HOH 129 729 195 HOH HOH A . 
H 7 HOH 130 730 184 HOH HOH A . 
H 7 HOH 131 731 125 HOH HOH A . 
H 7 HOH 132 732 79  HOH HOH A . 
H 7 HOH 133 733 10  HOH HOH A . 
H 7 HOH 134 734 110 HOH HOH A . 
H 7 HOH 135 735 57  HOH HOH A . 
H 7 HOH 136 736 156 HOH HOH A . 
H 7 HOH 137 737 185 HOH HOH A . 
H 7 HOH 138 738 221 HOH HOH A . 
H 7 HOH 139 739 113 HOH HOH A . 
H 7 HOH 140 740 81  HOH HOH A . 
H 7 HOH 141 741 111 HOH HOH A . 
H 7 HOH 142 742 78  HOH HOH A . 
H 7 HOH 143 743 200 HOH HOH A . 
H 7 HOH 144 744 141 HOH HOH A . 
H 7 HOH 145 745 217 HOH HOH A . 
H 7 HOH 146 746 53  HOH HOH A . 
H 7 HOH 147 747 132 HOH HOH A . 
H 7 HOH 148 748 34  HOH HOH A . 
H 7 HOH 149 749 158 HOH HOH A . 
H 7 HOH 150 750 59  HOH HOH A . 
H 7 HOH 151 751 90  HOH HOH A . 
H 7 HOH 152 752 17  HOH HOH A . 
H 7 HOH 153 753 55  HOH HOH A . 
H 7 HOH 154 754 140 HOH HOH A . 
H 7 HOH 155 755 128 HOH HOH A . 
H 7 HOH 156 756 70  HOH HOH A . 
H 7 HOH 157 757 201 HOH HOH A . 
H 7 HOH 158 758 179 HOH HOH A . 
H 7 HOH 159 759 211 HOH HOH A . 
H 7 HOH 160 760 67  HOH HOH A . 
H 7 HOH 161 761 203 HOH HOH A . 
H 7 HOH 162 762 96  HOH HOH A . 
H 7 HOH 163 763 129 HOH HOH A . 
H 7 HOH 164 764 80  HOH HOH A . 
H 7 HOH 165 765 97  HOH HOH A . 
H 7 HOH 166 766 171 HOH HOH A . 
H 7 HOH 167 767 180 HOH HOH A . 
H 7 HOH 168 768 65  HOH HOH A . 
H 7 HOH 169 769 99  HOH HOH A . 
H 7 HOH 170 770 213 HOH HOH A . 
H 7 HOH 171 771 126 HOH HOH A . 
H 7 HOH 172 772 206 HOH HOH A . 
H 7 HOH 173 773 33  HOH HOH A . 
H 7 HOH 174 774 210 HOH HOH A . 
H 7 HOH 175 775 142 HOH HOH A . 
H 7 HOH 176 776 191 HOH HOH A . 
H 7 HOH 177 777 119 HOH HOH A . 
H 7 HOH 178 778 49  HOH HOH A . 
H 7 HOH 179 779 108 HOH HOH A . 
H 7 HOH 180 780 168 HOH HOH A . 
H 7 HOH 181 781 147 HOH HOH A . 
H 7 HOH 182 782 189 HOH HOH A . 
H 7 HOH 183 783 61  HOH HOH A . 
H 7 HOH 184 784 101 HOH HOH A . 
H 7 HOH 185 785 212 HOH HOH A . 
H 7 HOH 186 786 58  HOH HOH A . 
H 7 HOH 187 787 183 HOH HOH A . 
H 7 HOH 188 788 104 HOH HOH A . 
H 7 HOH 189 789 169 HOH HOH A . 
H 7 HOH 190 790 162 HOH HOH A . 
H 7 HOH 191 791 124 HOH HOH A . 
H 7 HOH 192 792 106 HOH HOH A . 
H 7 HOH 193 793 175 HOH HOH A . 
H 7 HOH 194 794 192 HOH HOH A . 
H 7 HOH 195 795 139 HOH HOH A . 
H 7 HOH 196 796 182 HOH HOH A . 
I 7 HOH 1   101 161 HOH HOH P . 
I 7 HOH 2   102 24  HOH HOH P . 
I 7 HOH 3   103 197 HOH HOH P . 
I 7 HOH 4   104 86  HOH HOH P . 
I 7 HOH 5   105 69  HOH HOH P . 
I 7 HOH 6   106 23  HOH HOH P . 
I 7 HOH 7   107 177 HOH HOH P . 
I 7 HOH 8   108 176 HOH HOH P . 
I 7 HOH 9   109 68  HOH HOH P . 
I 7 HOH 10  110 194 HOH HOH P . 
J 7 HOH 1   101 71  HOH HOH T . 
J 7 HOH 2   102 198 HOH HOH T . 
J 7 HOH 3   103 135 HOH HOH T . 
J 7 HOH 4   104 84  HOH HOH T . 
J 7 HOH 5   105 29  HOH HOH T . 
J 7 HOH 6   106 138 HOH HOH T . 
J 7 HOH 7   107 159 HOH HOH T . 
J 7 HOH 8   108 136 HOH HOH T . 
J 7 HOH 9   109 116 HOH HOH T . 
J 7 HOH 10  110 88  HOH HOH T . 
J 7 HOH 11  111 75  HOH HOH T . 
J 7 HOH 12  112 83  HOH HOH T . 
J 7 HOH 13  113 157 HOH HOH T . 
J 7 HOH 14  114 74  HOH HOH T . 
J 7 HOH 15  115 137 HOH HOH T . 
J 7 HOH 16  116 152 HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4440  ? 
1 MORE         -41   ? 
1 'SSA (A^2)'  22310 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 93.9  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 74.4  ? 
3  O     ? A MET 17  ? A MET 14  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 90.0  ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 120.2 ? 
5  O     ? A MET 17  ? A MET 14  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 91.1  ? 
6  OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 46.0  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 101.6 ? 
8  O     ? A MET 17  ? A MET 14  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 163.7 ? 
9  OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 98.6  ? 
10 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 85.2  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B   ? G XG4 .   ? A XG4 504 ? 1_555 163.5 ? 
12 O     ? A MET 17  ? A MET 14  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B   ? G XG4 .   ? A XG4 504 ? 1_555 90.4  ? 
13 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B   ? G XG4 .   ? A XG4 504 ? 1_555 121.6 ? 
14 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B   ? G XG4 .   ? A XG4 504 ? 1_555 75.5  ? 
15 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1B   ? G XG4 .   ? A XG4 504 ? 1_555 73.3  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? G XG4 .   ? A XG4 504 ? 1_555 83.7  ? 
17 O     ? A MET 17  ? A MET 14  ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? G XG4 .   ? A XG4 504 ? 1_555 101.4 ? 
18 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? G XG4 .   ? A XG4 504 ? 1_555 155.9 ? 
19 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? G XG4 .   ? A XG4 504 ? 1_555 152.4 ? 
20 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? G XG4 .   ? A XG4 504 ? 1_555 75.9  ? 
21 O1B   ? G XG4 .   ? A XG4 504 ? 1_555 MG ? E MG . ? A MG 502 ? 1_555 O1G   ? G XG4 .   ? A XG4 504 ? 1_555 79.9  ? 
22 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 80.8  ? 
23 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" ? B DT  8   ? P DT  8   ? 1_555 151.0 ? 
24 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 "O3'" ? B DT  8   ? P DT  8   ? 1_555 84.2  ? 
25 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 93.7  ? 
26 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 152.3 ? 
27 "O3'" ? B DT  8   ? P DT  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 88.2  ? 
28 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? H HOH .   ? A HOH 641 ? 1_555 74.9  ? 
29 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? H HOH .   ? A HOH 641 ? 1_555 83.8  ? 
30 "O3'" ? B DT  8   ? P DT  8   ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? H HOH .   ? A HOH 641 ? 1_555 78.9  ? 
31 O1A   ? G XG4 .   ? A XG4 504 ? 1_555 MG ? F MG . ? A MG 503 ? 1_555 O     ? H HOH .   ? A HOH 641 ? 1_555 68.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-08-10 
2 'Structure model' 1 1 2018-04-18 
3 'Structure model' 1 2 2019-01-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
4 3 'Structure model' 'Data collection'      
5 3 'Structure model' 'Source and taxonomy'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' pdbx_prerelease_seq   
4 2 'Structure model' pdbx_struct_oper_list 
5 3 'Structure model' pdbx_entity_src_syn   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_ISSN'                 
2 2 'Structure model' '_citation.pdbx_database_id_PubMed'         
3 2 'Structure model' '_citation.title'                           
4 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
5 3 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id'     
6 3 'Structure model' '_pdbx_entity_src_syn.organism_scientific'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE2 A GLU 292 ? ? O A HOH 601 ? ? 2.12 
2 1 O   A HOH 603 ? ? O A HOH 703 ? ? 2.13 
3 1 NZ  A LYS 323 ? ? O A HOH 602 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NZ 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    LYS 
_pdbx_validate_symm_contact.auth_seq_id_1     254 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OXT 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    SER 
_pdbx_validate_symm_contact.auth_seq_id_2     432 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_545 
_pdbx_validate_symm_contact.dist              2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB    A ASP 115 ? ? CG    A ASP 115 ? ? OD1 A ASP 115 ? ? 124.69 118.30 6.39 0.90 N 
2 1 "O4'" T DC  9   ? ? "C1'" T DC  9   ? ? N1  T DC  9   ? ? 111.11 108.30 2.81 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 25.01   61.38   
2 1 TYR A 39  ? ? 74.23   81.51   
3 1 GLN A 133 ? ? 55.76   -71.32  
4 1 SER A 217 ? ? -155.30 -151.33 
5 1 ASN A 230 ? ? -141.85 26.35   
6 1 SER A 257 ? ? 80.33   1.49    
7 1 ARG A 313 ? ? -165.32 100.06  
8 1 LYS A 428 ? ? 62.73   69.75   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
6 1 Y 1 T DC  1   ? C DC  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5DLG 'double helix'        
5DLG 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 1 1_555 C DT 12 1_555 -0.427 -0.303 -0.369 -16.194 -0.957 3.163  1 P_DA1:DT12_T P 1 ? T 12 ? 20 1 
1 B DG 2 1_555 C DC 11 1_555 0.037  0.041  -0.084 -0.193  -4.519 1.561  2 P_DG2:DC11_T P 2 ? T 11 ? 19 1 
1 B DC 3 1_555 C DG 10 1_555 0.266  -0.308 0.020  1.530   -0.224 2.694  3 P_DC3:DG10_T P 3 ? T 10 ? 19 1 
1 B DG 4 1_555 C DC 9  1_555 -0.484 -0.132 -0.440 -9.868  -3.898 4.277  4 P_DG4:DC9_T  P 4 ? T 9  ? 19 1 
1 B DT 5 1_555 C DA 8  1_555 -0.348 -0.202 0.114  -8.763  -1.514 2.146  5 P_DT5:DA8_T  P 5 ? T 8  ? 20 1 
1 B DC 6 1_555 C DG 7  1_555 0.656  -0.129 -0.325 7.491   -3.526 6.306  6 P_DC6:DG7_T  P 6 ? T 7  ? 19 1 
1 B DA 7 1_555 C DT 6  1_555 -0.091 0.032  0.302  5.483   -7.532 7.236  7 P_DA7:DT6_T  P 7 ? T 6  ? 20 1 
1 B DT 8 1_555 C DA 5  1_555 -0.210 0.052  -0.007 13.271  -9.837 10.866 8 P_DT8:DA5_T  P 8 ? T 5  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 1 1_555 C DT 12 1_555 B DG 2 1_555 C DC 11 1_555 -0.275 0.031  3.053 -0.139 3.858  30.563 -0.645 0.492  3.035 7.283  0.262  
30.800 1 PP_DA1DG2:DC11DT12_TT P 1 ? T 12 ? P 2 ? T 11 ? 
1 B DG 2 1_555 C DC 11 1_555 B DC 3 1_555 C DG 10 1_555 0.370  -0.625 3.376 -1.263 -0.676 35.008 -0.934 -0.810 3.372 -1.123 2.099  
35.037 2 PP_DG2DC3:DG10DC11_TT P 2 ? T 11 ? P 3 ? T 10 ? 
1 B DC 3 1_555 C DG 10 1_555 B DG 4 1_555 C DC 9  1_555 0.377  -0.597 3.715 5.174  4.380  36.728 -1.589 0.186  3.640 6.879  -8.125 
37.327 3 PP_DC3DG4:DC9DG10_TT  P 3 ? T 10 ? P 4 ? T 9  ? 
1 B DG 4 1_555 C DC 9  1_555 B DT 5 1_555 C DA 8  1_555 -0.700 -0.915 3.449 -5.529 2.020  28.136 -2.328 0.088  3.448 4.099  11.217 
28.733 4 PP_DG4DT5:DA8DC9_TT   P 4 ? T 9  ? P 5 ? T 8  ? 
1 B DT 5 1_555 C DA 8  1_555 B DC 6 1_555 C DG 7  1_555 0.538  -0.313 3.016 3.163  0.166  37.108 -0.511 -0.453 3.049 0.261  -4.958 
37.238 5 PP_DT5DC6:DG7DA8_TT   P 5 ? T 8  ? P 6 ? T 7  ? 
1 B DC 6 1_555 C DG 7  1_555 B DA 7 1_555 C DT 6  1_555 0.599  -1.227 3.332 -4.094 5.202  25.256 -4.091 -2.408 2.893 11.645 9.165  
26.096 6 PP_DC6DA7:DT6DG7_TT   P 6 ? T 7  ? P 7 ? T 6  ? 
1 B DA 7 1_555 C DT 6  1_555 B DT 8 1_555 C DA 5  1_555 -0.659 -0.588 3.326 3.351  2.116  26.205 -1.840 2.322  3.162 4.633  -7.336 
26.498 7 PP_DA7DT8:DA5DT6_TT   P 7 ? T 6  ? P 8 ? T 5  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 GLYCEROL                                                                                     GOL 
5 'MAGNESIUM ION'                                                                              MG  
6 "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]guanosine" XG4 
7 water                                                                                        HOH 
#