data_5DNM
# 
_entry.id   5DNM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DNM         
WWPDB D_1000213215 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5DNN 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DNM 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adhireksan, Z.' 1 
'Muhammad, R.'   2 
'Davey, C.A.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                14860 
_citation.page_last                 14860 
_citation.title                     'Allosteric cross-talk in chromatin can mediate drug-drug synergy' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms14860 
_citation.pdbx_database_id_PubMed   28358030 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Adhireksan, Z.'    1 
primary 'Palermo, G.'       2 
primary 'Riedel, T.'        3 
primary 'Ma, Z.'            4 
primary 'Muhammad, R.'      5 
primary 'Rothlisberger, U.' 6 
primary 'Dyson, P.J.'       7 
primary 'Davey, C.A.'       8 
# 
_cell.entry_id           5DNM 
_cell.length_a           106.680 
_cell.length_b           109.820 
_cell.length_c           182.340 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5DNM 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2' 15303.930 2 ? ? ? ? 
2 polymer     man 'Histone H4' 11263.231 2 ? ? ? ? 
3 polymer     man 'Histone H2A' 13907.163 2 ? ? ? ? 
4 polymer     man 'Histone H2B 1.1' 13848.097 2 ? ? ? ? 
5 polymer     syn 'DNA (145-MER)' 44749.664 1 ? ? ? ? 
6 polymer     syn 'DNA (145-MER)' 44740.648 1 ? ? ? ? 
7 non-polymer syn 'SULFATE ION' 96.063    3 ? ? ? ? 
8 non-polymer syn 'MAGNESIUM ION' 24.305    1 ? ? ? ? 
9 non-polymer syn 
'dichloro[(1,2,3,4,5,6-eta)-6-methylbenzene]1,3,5-triaza-7lambda~5~-phosphatricyclo[3.3.1.1~3,7~]dec-7-ylruthenium' 421.268   2 ? 
? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 LYS n 
3 127 SER n 
3 128 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 128 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 125 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 145 'synthetic construct' ? 32630 ? 
6 1 sample 1 145 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
4 UNP H2B11_XENLA  P02281 ? 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 
5 PDB 5DNM         5DNM   ? 5 ? 1 
6 PDB 5DNM         5DNM   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5DNM A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 5DNM B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 5DNM C 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
4  4 5DNM D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 5DNM E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 5DNM F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 5DNM G 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
8  4 5DNM H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 5DNM I 1 ? 145 ? 5DNM   -72 ? 72  ? -72 72  
10 6 5DNM J 1 ? 145 ? 5DNM   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DNM ALA A 102 ? UNP P84233 GLY 103 variant  102 1 
3 5DNM ?   C ?   ? UNP Q6AZJ8 ALA 127 deletion ?   2 
4 5DNM THR D 32  ? UNP P02281 SER 33  variant  29  3 
5 5DNM ALA E 102 ? UNP P84233 GLY 103 variant  102 4 
7 5DNM ?   G ?   ? UNP Q6AZJ8 ALA 127 deletion ?   5 
8 5DNM THR H 32  ? UNP P02281 SER 33  variant  29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'        121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'     331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'      307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'     347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P'     322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'      156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'          115.130 
RAX non-polymer         . 
'dichloro[(1,2,3,4,5,6-eta)-6-methylbenzene]1,3,5-triaza-7lambda~5~-phosphatricyclo[3.3.1.1~3,7~]dec-7-ylruthenium' ? 
'C13 H20 Cl2 N3 P Ru' 421.268 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'          105.093 
SO4 non-polymer         . 'SULFATE ION' ? 'O4 S -2'             96.063  
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'          119.119 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DNM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.70 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.37 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '40 mM MnCl2, 30 mM KCl, 20 mM K-Cacodylate' 
_exptl_crystal_grow.pdbx_pH_range   6.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DNM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.81 
_reflns.d_resolution_low                 60.78 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       50790 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.6 
_reflns.pdbx_Rmerge_I_obs                0.059 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.81 
_reflns_shell.d_res_low                   2.96 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        78.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.501 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5DNM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     49694 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             58.612 
_refine.ls_d_res_high                            2.81 
_refine.ls_percent_reflns_obs                    95.86 
_refine.ls_R_factor_obs                          0.20892 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20824 
_refine.ls_R_factor_R_free                       0.24052 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1035 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.B_iso_mean                               94.519 
_refine.aniso_B[1][1]                            2.64 
_refine.aniso_B[2][2]                            -4.80 
_refine.aniso_B[3][3]                            2.16 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      3MNN 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.764 
_refine.pdbx_overall_ESU_R_Free                  0.340 
_refine.overall_SU_ML                            0.292 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             15.185 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12077 
_refine_hist.d_res_high                       2.81 
_refine_hist.d_res_low                        58.612 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.015  ? 12893 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 9462  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.499  1.549  ? 18698 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.266  3.000  ? 21762 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.395  5.000  ? 757   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.649 21.255 ? 271   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.121 15.000 ? 1183  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.962 15.000 ? 86    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.107  0.200  ? 1836  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 10330 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2849  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  5.103  6.770  ? 3052  'X-RAY DIFFRACTION' ? 
r_mcbond_other               5.096  6.767  ? 3051  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 7.440  10.125 ? 3801  'X-RAY DIFFRACTION' ? 
r_mcangle_other              7.440  10.129 ? 3802  'X-RAY DIFFRACTION' ? 
r_scbond_it                  7.603  11.335 ? 9841  'X-RAY DIFFRACTION' ? 
r_scbond_other               7.603  11.336 ? 9842  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              11.286 16.976 ? 14850 'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       14.583 .      ? 16405 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         14.583 .      ? 16406 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.810 
_refine_ls_shell.d_res_low                        2.883 
_refine_ls_shell.number_reflns_R_work             2756 
_refine_ls_shell.R_factor_R_work                  0.341 
_refine_ls_shell.percent_reflns_obs               72.81 
_refine_ls_shell.R_factor_R_free                  0.392 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5DNM 
_struct.title                        'Nucleosome core particle containing adducts of ruthenium(II)-toluene PTA complex' 
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DNM 
_struct_keywords.text            'nucleosome, ruthenium antitumour compound, histone binding, STRUCTURAL PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 8 ? 
M N N 7 ? 
N N N 9 ? 
O N N 7 ? 
P N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASP B 24  ? ILE B 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  AA6 THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 AB3 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO D 103 ? SER D 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 AC1 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 AC6 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 AD3 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 AD4 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO H 103 ? ALA H 124 ? PRO H 100 ALA H 121 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 L MG  .   MG ? ? E ASP 77  E MG  1001 1_555 ? ? ? ? ? ? ?               2.080 ? 
metalc2   metalc ? ? G GLU 61  OE2 ? ? ? 1_555 N RAX .   RU ? ? G GLU 61  G RAX 202  1_555 ? ? ? ? ? ? ?               2.477 ? 
metalc3   metalc ? ? G GLU 64  OE1 ? ? ? 1_555 N RAX .   RU ? ? G GLU 64  G RAX 202  1_555 ? ? ? ? ? ? ?               2.392 ? 
metalc4   metalc ? ? H HIS 109 NE2 ? ? ? 1_555 P RAX .   RU ? ? H HIS 106 H RAX 202  1_555 ? ? ? ? ? ? ?               2.234 ? 
metalc5   metalc ? ? D VAL 48  O   ? ? ? 1_555 L MG  .   MG ? ? D VAL 45  E MG  1001 3_555 ? ? ? ? ? ? ?               2.337 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT  145 N3 ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT  145 O4 ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA  144 N1 ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA  144 N6 ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG  143 N2 ? ? I DC  -70 J DG  70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog6   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT  142 N3 ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J DT  142 O4 ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT  141 N3 ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  5   N6  ? ? ? 1_555 J DT  141 O4 ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA  140 N1 ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA  140 N6 ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT  139 N3 ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT  139 O4 ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA  138 N1 ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA  138 N6 ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  137 N1 ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  137 O6 ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  137 N2 ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  136 N1 ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG  136 O6 ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  136 N2 ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT  135 N3 ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J DT  135 O4 ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG  134 N2 ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog25  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG  133 N2 ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog26  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA  132 N1 ? ? I DT  -59 J DA  59   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog27  hydrog ? ? I DT  14  O2  ? ? ? 1_555 J DG  133 N2 ? ? I DT  -59 J DG  60   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog28  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC  131 N3 ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J DC  131 O2 ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J DC  131 N4 ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG  130 N1 ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG  130 O6 ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG  130 N2 ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT  129 N3 ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J DT  129 O4 ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC  128 N3 ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J DC  128 O2 ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J DC  128 N4 ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J DT  127 N3 ? ? I DA  -54 J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT  127 O4 ? ? I DA  -54 J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J DA  126 N6 ? ? I DT  -53 J DA  53   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog42  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT  125 N3 ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT  125 O4 ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG  124 N1 ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog45  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J DA  123 N1 ? ? I DT  -50 J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J DA  123 N6 ? ? I DT  -50 J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DG  121 O6 ? ? I DA  -49 J DG  48   1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ?     ? 
hydrog48  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DT  122 N3 ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DT  122 O4 ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG  121 N1 ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  121 O6 ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  121 N2 ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG  120 N2 ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog54  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT  119 N3 ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT  119 O4 ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT  118 N3 ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT  118 O4 ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  116 O4 ? ? I DA  -44 J DT  43   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog59  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT  117 N3 ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  117 O4 ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J DT  116 N3 ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J DT  116 O4 ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DG  31  N1  ? ? ? 1_555 J DC  115 N3 ? ? I DG  -42 J DC  42   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog64  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J DA  114 N1 ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J DA  114 N6 ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC  113 N3 ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J DC  113 O2 ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J DC  113 N4 ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA  112 N1 ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA  112 N6 ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J DT  111 N3 ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT  111 O4 ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J DA  110 N1 ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J DA  110 N6 ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA  109 N1 ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  109 N6 ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA  108 N1 ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DA  108 N6 ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC  106 N3 ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog80  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC  107 O2 ? ? I DG  -33 J DC  34   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog81  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J DT  105 N3 ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J DT  105 O4 ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT  104 N3 ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J DT  104 O4 ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT  103 N3 ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT  103 O4 ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG  102 N2 ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog88  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  101 N1 ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  101 N6 ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J DC  100 N3 ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC  100 O2 ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J DC  100 N4 ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG  99  N1 ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG  99  O6 ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG  99  N2 ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA  98  N1 ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DT  48  O4  ? ? ? 1_555 J DA  98  N6 ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG  97  N1 ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG  97  O6 ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG  97  N2 ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DC  50  N3  ? ? ? 1_555 J DG  96  N1 ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  50  N4  ? ? ? 1_555 J DG  96  O6 ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  50  O2  ? ? ? 1_555 J DG  96  N2 ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT  95  N3 ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J DT  95  O4 ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J DA  94  N1 ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DA  94  N6 ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG  93  N1 ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG  93  O6 ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG  93  N2 ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DT  92  N3 ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DT  92  O4 ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J DT  91  N3 ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J DT  91  O4 ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  89  O4 ? ? I DA  -17 J DT  16   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog116 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT  90  N3 ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  90  O4 ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J DT  89  N3 ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J DT  89  O4 ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  87  N3 ? ? I DG  -15 J DC  14   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog121 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  88  N3 ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog122 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J DG  86  O6 ? ? I DG  -14 J DG  13   1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog123 hydrog ? ? I DC  60  N4  ? ? ? 1_555 J DT  85  O4 ? ? I DC  -13 J DT  12   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog124 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J DG  86  N1 ? ? I DC  -13 J DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog125 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DA  84  N1 ? ? I DA  -12 J DA  11   1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog126 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT  85  N3 ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT  85  O4 ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J DA  84  N1 ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J DA  84  N6 ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC  83  N3 ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC  83  O2 ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC  83  N4 ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J DA  82  N1 ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J DA  82  N6 ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J DA  81  N1 ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J DA  81  N6 ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J DG  80  N1 ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J DG  80  O6 ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J DG  80  N2 ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J DT  79  N3 ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J DT  79  O4 ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC  78  N3 ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC  78  O2 ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC  78  N4 ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG  77  N1 ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG  77  O6 ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG  77  N2 ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J DA  76  N1 ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J DA  76  N6 ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J DC  75  N3 ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J DC  75  O2 ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J DC  75  N4 ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT  74  N3 ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT  74  O4 ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT  73  N3 ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT  73  O4 ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA  72  N1 ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA  72  N6 ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG  71  N1 ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG  71  O6 ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG  71  N2 ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J DT  70  N3 ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J DT  70  O4 ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC  69  N3 ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J DC  69  O2 ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J DC  69  N4 ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG  68  N1 ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG  68  O6 ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG  68  N2 ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA  67  N1 ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA  67  N6 ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J DC  66  N3 ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC  66  O2 ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J DC  66  N4 ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J DT  65  N3 ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J DT  65  O4 ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT  64  N3 ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J DT  64  O4 ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  63  N1 ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  63  O6 ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  63  N2 ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J DT  62  N3 ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J DT  62  O4 ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA  61  N1 ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA  61  N6 ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC  60  N3 ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC  60  O2 ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC  60  N4 ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG  59  N1 ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG  59  O6 ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG  59  N2 ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J DG  58  N2 ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog193 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA  57  N1 ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA  57  N6 ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J DA  55  N1 ? ? I DT  18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DT  91  O4  ? ? ? 1_555 J DA  55  N6 ? ? I DT  18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J DA  54  N1 ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J DA  54  N6 ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J DA  54  N1 ? ? I DG  20  J DA  -19  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog200 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J DA  54  N6 ? ? I DG  20  J DA  -19  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog201 hydrog ? ? I DG  96  N1  ? ? ? 1_555 J DC  50  N3 ? ? I DG  23  J DC  -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog202 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC  49  N3 ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC  49  O2 ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC  49  N4 ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DC  47  N3 ? ? I DA  25  J DC  -26  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog206 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J DT  48  N3 ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DT  48  O4 ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC  47  N3 ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J DC  47  O2 ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J DC  47  N4 ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J DG  46  N2 ? ? I DC  27  J DG  -27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog212 hydrog ? ? I DA  101 N1  ? ? ? 1_555 J DT  45  N3 ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DA  101 N6  ? ? ? 1_555 J DT  45  O4 ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DC  44  O2 ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog215 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA  43  N1 ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DT  103 O4  ? ? ? 1_555 J DA  43  N6 ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA  42  N1 ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DA  42  N6 ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA  41  N1 ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA  41  N6 ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DC  106 N3  ? ? ? 1_555 J DG  40  N1 ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DC  106 N4  ? ? ? 1_555 J DG  40  O6 ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J DG  40  N2 ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DG  39  N1 ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J DG  39  O6 ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG  39  N2 ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT  37  O4 ? ? I DA  35  J DT  -36  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog228 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J DT  38  N3 ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT  38  O4 ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT  37  N3 ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT  37  O4 ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT  36  N3 ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT  36  O4 ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA  35  N1 ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog235 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT  34  N3 ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT  34  O4 ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG  33  N1 ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG  33  O6 ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG  33  N2 ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DT  32  N3 ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DT  32  O4 ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG  31  N1 ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG  31  O6 ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG  31  N2 ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DA  30  N1 ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J DA  30  N6 ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA  28  N6 ? ? I DT  44  J DA  -45  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog248 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA  29  N1 ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA  29  N6 ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  27  N6 ? ? I DT  45  J DA  -46  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog251 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA  28  N1 ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  28  N6 ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J DC  26  N4 ? ? I DT  46  J DC  -47  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog254 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J DA  27  N1 ? ? I DT  46  J DA  -46  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog255 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC  26  N3 ? ? I DG  47  J DC  -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog256 hydrog ? ? I DG  121 N1  ? ? ? 1_555 J DA  24  N1 ? ? I DG  48  J DA  -49  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog257 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DA  24  N6 ? ? I DG  48  J DA  -49  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog258 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC  25  O2 ? ? I DG  48  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog259 hydrog ? ? I DA  123 N6  ? ? ? 1_555 J DC  22  N3 ? ? I DA  50  J DC  -51  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog260 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT  23  N3 ? ? I DA  50  J DT  -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog261 hydrog ? ? I DG  124 N1  ? ? ? 1_555 J DA  21  N1 ? ? I DG  51  J DA  -52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog262 hydrog ? ? I DG  124 O6  ? ? ? 1_555 J DA  21  N6 ? ? I DG  51  J DA  -52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog263 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA  19  N1 ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J DA  19  N6 ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG  18  N1 ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG  18  O6 ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG  18  N2 ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J DA  17  N1 ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J DA  17  N6 ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC  16  N3 ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC  16  O2 ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC  16  N4 ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DT  14  O4 ? ? I DC  58  J DT  -59  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog274 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG  15  N1 ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DG  15  O6 ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG  15  N2 ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT  14  N3 ? ? I DA  59  J DT  -59  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog278 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J DC  13  N3 ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DG  133 N2  ? ? ? 1_555 J DC  13  O2 ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DG  133 O6  ? ? ? 1_555 J DC  13  N4 ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC  12  N3 ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC  12  O2 ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC  12  N4 ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA  11  N1 ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J DA  11  N6 ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC  10  N3 ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC  10  O2 ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC  10  N4 ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC  9   N3 ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC  9   O2 ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC  9   N4 ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT  8   N3 ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT  8   O4 ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA  7   N1 ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA  7   N6 ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT  6   N3 ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT  6   O4 ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA  5   N1 ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA  5   N6 ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA  4   N1 ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA  4   N6 ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC  3   N3 ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC  3   O2 ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC  3   N4 ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  2   N3 ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  2   O4 ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA  1   N1 ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA  1   N6 ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
AA1 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
AA2 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
AA2 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
AA3 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
AA3 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA4 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA4 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
AA5 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
AA5 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
AA6 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
AA6 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
AA7 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
AA7 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
AA8 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
AA8 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
AA9 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA9 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
AB1 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AB1 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
AA2 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
AA3 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
AA4 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
AA5 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
AA6 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
AA7 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
AA8 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
AA9 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
AB1 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D SO4 1101 ? 6 'binding site for residue SO4 D 1101' 
AC2 Software E MG  1001 ? 2 'binding site for residue MG E 1001'  
AC3 Software G SO4 201  ? 7 'binding site for residue SO4 G 201'  
AC4 Software G RAX 202  ? 3 'binding site for residue RAX G 202'  
AC5 Software H SO4 201  ? 4 'binding site for residue SO4 H 201'  
AC6 Software H RAX 202  ? 3 'binding site for residue RAX H 202'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLY C 44  ? GLY C 44  . ? 1_555 ? 
2  AC1 6 ALA C 45  ? ALA C 45  . ? 1_555 ? 
3  AC1 6 GLY C 46  ? GLY C 46  . ? 1_555 ? 
4  AC1 6 ALA C 47  ? ALA C 47  . ? 1_555 ? 
5  AC1 6 THR D 90  ? THR D 87  . ? 1_555 ? 
6  AC1 6 SER D 91  ? SER D 88  . ? 1_555 ? 
7  AC2 2 VAL D 48  ? VAL D 45  . ? 3_545 ? 
8  AC2 2 ASP E 77  ? ASP E 77  . ? 1_555 ? 
9  AC3 7 GLY G 44  ? GLY G 44  . ? 1_555 ? 
10 AC3 7 ALA G 45  ? ALA G 45  . ? 1_555 ? 
11 AC3 7 GLY G 46  ? GLY G 46  . ? 1_555 ? 
12 AC3 7 ALA G 47  ? ALA G 47  . ? 1_555 ? 
13 AC3 7 THR H 90  ? THR H 87  . ? 1_555 ? 
14 AC3 7 SER H 91  ? SER H 88  . ? 1_555 ? 
15 AC3 7 DA  I 110 ? DA  I 37  . ? 1_555 ? 
16 AC4 3 GLU G 61  ? GLU G 61  . ? 1_555 ? 
17 AC4 3 GLU G 64  ? GLU G 64  . ? 1_555 ? 
18 AC4 3 RAX P .   ? RAX H 202 . ? 1_555 ? 
19 AC5 4 HIS H 49  ? HIS H 46  . ? 1_555 ? 
20 AC5 4 PRO H 50  ? PRO H 47  . ? 1_555 ? 
21 AC5 4 ASP H 51  ? ASP H 48  . ? 1_555 ? 
22 AC5 4 THR H 52  ? THR H 49  . ? 1_555 ? 
23 AC6 3 RAX N .   ? RAX G 202 . ? 1_555 ? 
24 AC6 3 GLU H 105 ? GLU H 102 . ? 1_555 ? 
25 AC6 3 HIS H 109 ? HIS H 106 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DNM 
_atom_sites.fract_transf_matrix[1][1]   0.009374 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009106 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005484 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1 38  ? -60.606 -29.193 80.584 1.00 142.31 ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1 38  ? -59.393 -28.599 81.164 1.00 145.56 ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1 38  ? -58.129 -29.369 80.762 1.00 151.46 ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1 38  ? -57.541 -30.063 81.596 1.00 153.03 ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1 38  ? -59.646 -28.704 82.677 1.00 137.17 ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1 38  ? -60.540 -29.902 82.826 1.00 135.55 ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1 38  ? -61.334 -30.042 81.548 1.00 134.53 ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1 39  ? -57.721 -29.251 79.496 1.00 150.12 ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1 39  ? -56.641 -30.090 78.944 1.00 142.74 ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1 39  ? -55.625 -29.298 78.130 1.00 126.10 ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1 39  ? -55.947 -28.711 77.093 1.00 103.09 ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1 39  ? -57.227 -31.213 78.087 1.00 153.19 ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1 39  ? -56.226 -31.891 77.206 1.00 150.67 ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1 39  ? -55.937 -31.446 75.931 1.00 141.81 ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1 39  ? -55.455 -32.985 77.412 1.00 142.14 ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1 39  ? -55.032 -32.239 75.390 1.00 142.26 ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1 39  ? -54.724 -33.180 76.266 1.00 147.37 ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1 40  ? -54.383 -29.335 78.602 1.00 126.72 ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1 40  ? -53.300 -28.530 78.050 1.00 118.01 ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1 40  ? -52.172 -29.447 77.556 1.00 115.55 ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1 40  ? -51.924 -30.512 78.155 1.00 115.86 ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1 40  ? -52.795 -27.586 79.140 1.00 103.62 ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1 40  ? -52.069 -26.357 78.644 1.00 101.89 ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1 40  ? -51.824 -25.423 79.813 1.00 95.44  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1 40  ? -50.949 -24.307 79.483 1.00 98.93  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1 40  ? -51.308 -23.233 78.780 1.00 107.16 ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1 40  ? -52.541 -23.114 78.274 1.00 109.31 ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1 40  ? -50.411 -22.270 78.563 1.00 105.92 ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1 41  ? -51.515 -29.046 76.458 1.00 103.77 ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1 41  ? -50.348 -29.774 75.933 1.00 96.85  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1 41  ? -49.014 -29.228 76.493 1.00 91.21  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1 41  ? -48.813 -28.009 76.647 1.00 89.38  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1 41  ? -50.319 -29.756 74.397 1.00 92.32  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1 41  ? -51.155 -30.831 73.712 1.00 88.09  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1 41  ? -52.140 -30.489 72.782 1.00 83.86  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1 41  ? -50.935 -32.189 73.967 1.00 85.77  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1 41  ? -52.891 -31.460 72.142 1.00 84.44  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1 41  ? -51.690 -33.168 73.335 1.00 89.91  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1 41  ? -52.670 -32.799 72.424 1.00 89.41  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1 41  ? -53.416 -33.770 71.782 1.00 92.00  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1 42  ? -48.095 -30.140 76.778 1.00 82.95  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1 42  ? -46.815 -29.762 77.366 1.00 84.98  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1 42  ? -46.008 -28.908 76.394 1.00 89.34  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1 42  ? -46.097 -29.101 75.180 1.00 96.75  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1 42  ? -46.002 -31.008 77.711 1.00 88.87  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1 42  ? -46.713 -32.027 78.598 1.00 95.60  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1 42  ? -46.667 -31.630 80.058 1.00 100.16 ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1 42  ? -45.355 -31.926 80.605 1.00 108.97 ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1 42  ? -45.057 -32.982 81.354 1.00 116.26 ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1 42  ? -45.985 -33.872 81.686 1.00 120.98 ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1 42  ? -43.810 -33.133 81.794 1.00 127.43 ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1 43  ? -45.187 -27.979 76.914 1.00 92.73  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1 43  ? -44.346 -27.217 76.002 1.00 91.75  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1 43  ? -43.555 -28.141 75.106 1.00 89.81  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1 43  ? -42.864 -29.042 75.609 1.00 81.42  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1 43  ? -43.403 -26.465 76.935 1.00 90.80  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1 43  ? -44.143 -26.367 78.219 1.00 90.99  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1 43  ? -44.873 -27.668 78.317 1.00 96.65  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1 44  ? -43.696 -27.946 73.795 1.00 83.07  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1 44  ? -42.844 -28.640 72.834 1.00 89.80  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1 44  ? -43.495 -29.839 72.198 1.00 87.54  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1 44  ? -42.914 -30.476 71.335 1.00 94.50  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1 45  ? -44.704 -30.149 72.625 1.00 81.53  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1 45  ? -45.431 -31.221 72.025 1.00 78.17  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1 45  ? -46.001 -30.729 70.720 1.00 75.46  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1 45  ? -45.871 -31.368 69.679 1.00 84.84  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1 45  ? -46.523 -31.672 72.966 1.00 81.93  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 45  ? -45.920 -31.924 74.244 1.00 84.79  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 45  ? -47.184 -32.933 72.445 1.00 83.11  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 46  ? -46.598 -29.567 70.759 1.00 74.12  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 46  ? -47.089 -28.991 69.532 1.00 85.28  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 46  ? -45.905 -28.662 68.613 1.00 86.60  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1 46  ? -45.994 -28.833 67.387 1.00 89.05  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 46  ? -47.946 -27.733 69.783 1.00 86.49  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 46  ? -48.755 -27.373 68.545 1.00 86.59  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 46  ? -48.893 -27.981 70.940 1.00 89.92  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1 47  ? -44.796 -28.208 69.198 1.00 80.42  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1 47  ? -43.616 -27.867 68.402 1.00 76.09  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1 47  ? -43.201 -29.067 67.571 1.00 74.95  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1 47  ? -43.058 -28.964 66.362 1.00 85.29  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1 47  ? -42.479 -27.431 69.287 1.00 79.47  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1 48  ? -43.029 -30.208 68.216 1.00 68.95  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1 48  ? -42.785 -31.448 67.506 1.00 70.27  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1 48  ? -43.864 -31.779 66.452 1.00 76.59  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1 48  ? -43.588 -32.290 65.352 1.00 73.02  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1 48  ? -42.682 -32.577 68.512 1.00 70.34  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1 48  ? -41.298 -32.964 69.045 1.00 79.00  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1 48  ? -40.141 -32.178 68.467 1.00 82.79  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1 48  ? -41.272 -32.878 70.564 1.00 85.66  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1 49  ? -45.106 -31.503 66.790 1.00 76.57  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1 49  ? -46.181 -31.895 65.915 1.00 75.29  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1 49  ? -46.056 -31.099 64.626 1.00 66.64  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1 49  ? -46.210 -31.636 63.529 1.00 67.14  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1 49  ? -47.518 -31.645 66.616 1.00 80.31  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1 49  ? -48.730 -32.212 65.890 1.00 88.07  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1 49  ? -49.824 -32.706 66.836 1.00 90.95  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1 49  ? -50.513 -31.624 67.523 1.00 90.31  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1 49  ? -50.610 -31.492 68.845 1.00 87.52  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1 49  ? -50.077 -32.391 69.685 1.00 75.34  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1 49  ? -51.268 -30.440 69.325 1.00 89.71  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1 50  ? -45.782 -29.813 64.774 1.00 62.16  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1 50  ? -45.626 -28.942 63.633 1.00 64.72  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1 50  ? -44.377 -29.319 62.812 1.00 69.96  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1 50  ? -44.405 -29.286 61.572 1.00 76.90  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1 50  ? -45.538 -27.497 64.078 1.00 66.72  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1 50  ? -46.802 -26.927 64.679 1.00 73.29  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1 50  ? -46.614 -25.588 65.418 1.00 85.05  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1 50  ? -45.595 -24.867 65.258 1.00 85.08  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1 50  ? -47.524 -25.227 66.188 1.00 96.44  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1 51  ? -43.291 -29.705 63.469 1.00 61.67  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1 51  ? -42.131 -30.120 62.702 1.00 64.30  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1 51  ? -42.540 -31.219 61.751 1.00 62.70  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1 51  ? -42.237 -31.176 60.567 1.00 66.13  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1 51  ? -40.982 -30.598 63.589 1.00 64.52  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1 51  ? -40.313 -29.391 64.242 1.00 69.79  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1 51  ? -39.955 -31.361 62.783 1.00 62.16  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1 51  ? -39.581 -29.723 65.534 1.00 72.57  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1 52  ? -43.258 -32.197 62.272 1.00 69.75  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1 52  ? -43.657 -33.336 61.454 1.00 68.58  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1 52  ? -44.588 -32.882 60.339 1.00 65.19  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1 52  ? -44.427 -33.279 59.187 1.00 67.15  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1 52  ? -44.277 -34.433 62.323 1.00 65.34  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1 52  ? -43.268 -34.979 63.315 1.00 74.92  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1 52  ? -43.617 -36.327 63.934 1.00 88.45  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1 52  ? -42.489 -36.831 64.751 1.00 99.68  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1 52  ? -42.362 -36.721 66.083 1.00 94.42  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1 52  ? -43.297 -36.135 66.830 1.00 78.53  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1 52  ? -41.275 -37.214 66.677 1.00 100.40 ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1 53  ? -45.530 -32.021 60.676 1.00 61.80  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1 53  ? -46.478 -31.553 59.698 1.00 69.60  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1 53  ? -45.738 -30.857 58.568 1.00 71.79  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1 53  ? -45.825 -31.231 57.400 1.00 72.96  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1 53  ? -47.466 -30.599 60.366 1.00 74.51  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1 53  ? -48.540 -30.058 59.447 1.00 78.36  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1 53  ? -49.360 -29.012 60.176 1.00 90.57  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1 53  ? -50.196 -28.259 59.236 1.00 100.49 ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1 53  ? -50.670 -27.027 59.443 1.00 103.79 ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1 53  ? -50.403 -26.365 60.571 1.00 107.51 ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1 53  ? -51.422 -26.449 58.512 1.00 102.67 ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1 54  ? -44.961 -29.858 58.926 1.00 70.86  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1 54  ? -44.358 -29.029 57.915 1.00 67.54  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1 54  ? -43.231 -29.699 57.116 1.00 63.63  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1 54  ? -42.962 -29.321 55.956 1.00 64.91  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1 54  ? -43.916 -27.747 58.574 1.00 66.25  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1 54  ? -45.101 -26.900 58.947 1.00 66.52  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1 54  ? -45.445 -26.686 60.264 1.00 70.77  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1 54  ? -45.894 -26.325 57.970 1.00 70.70  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1 54  ? -46.528 -25.896 60.608 1.00 70.43  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1 54  ? -46.974 -25.543 58.305 1.00 72.54  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1 54  ? -47.283 -25.329 59.629 1.00 70.71  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1 54  ? -48.367 -24.556 59.981 1.00 77.48  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1 55  ? -42.598 -30.705 57.711 1.00 56.32  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1 55  ? -41.575 -31.435 57.001 1.00 57.42  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1 55  ? -42.228 -32.283 55.952 1.00 61.52  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1 55  ? -41.607 -32.613 54.948 1.00 67.12  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1 55  ? -40.665 -32.229 57.952 1.00 58.01  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1 55  ? -39.605 -31.305 58.563 1.00 62.77  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1 55  ? -38.464 -31.971 59.333 1.00 67.23  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1 55  ? -38.425 -33.183 59.568 1.00 68.67  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1 55  ? -37.529 -31.145 59.755 1.00 66.80  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1 56  ? -43.507 -32.580 56.160 1.00 68.49  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1 56  ? -44.239 -33.480 55.275 1.00 73.22  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1 56  ? -44.785 -32.731 54.090 1.00 68.32  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1 56  ? -44.787 -33.271 52.987 1.00 70.91  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1 56  ? -45.387 -34.188 56.007 1.00 85.30  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1 56  ? -45.385 -35.706 55.837 1.00 99.47  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1 56  ? -45.486 -36.434 57.190 1.00 117.53 ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1 56  ? -44.416 -37.523 57.359 1.00 126.46 ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1 56  ? -44.230 -37.941 58.778 1.00 125.83 ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1 57  ? -45.237 -31.496 54.305 1.00 60.05  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1 57  ? -45.771 -30.700 53.214 1.00 60.92  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1 57  ? -44.701 -29.943 52.419 1.00 67.24  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1 57  ? -43.498 -29.983 52.751 1.00 75.95  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1 57  ? -46.811 -29.723 53.743 1.00 62.28  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1 57  ? -46.280 -28.913 54.760 1.00 71.61  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1 58  ? -45.169 -29.259 51.367 1.00 69.56  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1 58  ? -44.356 -28.336 50.575 1.00 64.76  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1 58  ? -44.967 -26.953 50.313 1.00 61.64  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1 58  ? -44.402 -26.183 49.552 1.00 55.74  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1 58  ? -44.072 -28.948 49.218 1.00 62.15  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1 58  ? -45.283 -29.006 48.496 1.00 67.21  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1 58  ? -43.559 -30.345 49.384 1.00 69.73  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1 59  ? -46.114 -26.622 50.905 1.00 67.35  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1 59  ? -46.657 -25.282 50.640 1.00 74.01  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1 59  ? -45.684 -24.253 51.158 1.00 70.96  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1 59  ? -44.933 -24.509 52.106 1.00 57.88  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1 59  ? -48.087 -24.959 51.167 1.00 72.26  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1 59  ? -48.803 -25.842 52.177 1.00 82.65  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1 59  ? -48.031 -26.108 53.438 1.00 89.71  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1 59  ? -48.538 -25.849 54.550 1.00 88.31  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1 59  ? -46.916 -26.625 53.298 1.00 105.97 ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1 60  ? -45.702 -23.107 50.492 1.00 64.50  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1 60  ? -45.065 -21.942 51.010 1.00 69.30  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1 60  ? -45.769 -21.516 52.296 1.00 68.94  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1 60  ? -46.978 -21.652 52.416 1.00 69.70  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1 60  ? -45.086 -20.814 49.985 1.00 75.95  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1 60  ? -44.330 -21.094 48.689 1.00 81.35  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1 60  ? -44.511 -19.949 47.717 1.00 89.19  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1 60  ? -42.851 -21.332 48.944 1.00 85.85  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1 61  ? -44.979 -20.991 53.232 1.00 68.38  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1 61  ? -45.377 -20.783 54.603 1.00 66.05  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1 61  ? -45.396 -19.293 54.943 1.00 69.30  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1 61  ? -45.596 -18.902 56.101 1.00 70.37  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1 61  ? -44.392 -21.529 55.496 1.00 68.57  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1 61  ? -44.129 -22.990 55.100 1.00 74.87  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1 61  ? -43.070 -23.644 55.972 1.00 78.44  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1 61  ? -45.402 -23.804 55.180 1.00 76.89  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1 62  ? -45.168 -18.456 53.938 1.00 70.07  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1 62  ? -45.309 -16.999 54.089 1.00 75.02  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1 62  ? -46.498 -16.580 53.215 1.00 70.08  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1 62  ? -46.693 -17.107 52.120 1.00 72.33  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1 62  ? -44.014 -16.241 53.648 1.00 72.32  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1 62  ? -42.844 -16.607 54.522 1.00 71.67  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1 62  ? -44.165 -14.733 53.758 1.00 75.15  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1 62  ? -41.571 -15.905 54.114 1.00 80.37  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1 63  ? -47.280 -15.618 53.667 1.00 67.36  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1 63  ? -48.494 -15.269 52.921 1.00 77.01  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1 63  ? -48.090 -14.488 51.682 1.00 69.89  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1 63  ? -47.256 -13.604 51.769 1.00 71.52  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1 63  ? -49.477 -14.441 53.757 1.00 80.53  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1 63  ? -49.686 -14.884 55.200 1.00 88.76  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1 63  ? -50.513 -16.149 55.299 1.00 100.44 ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1 63  ? -51.818 -16.013 54.657 1.00 123.02 ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1 63  ? -52.812 -15.237 55.103 1.00 136.45 ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1 63  ? -52.681 -14.471 56.196 1.00 131.47 ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1 63  ? -53.952 -15.211 54.432 1.00 140.88 ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1 64  ? -48.717 -14.785 50.555 1.00 68.03  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1 64  ? -48.279 -14.253 49.281 1.00 73.24  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1 64  ? -48.181 -12.741 49.273 1.00 73.12  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1 64  ? -47.183 -12.178 48.835 1.00 87.21  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1 64  ? -49.182 -14.740 48.144 1.00 78.22  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1 64  ? -49.182 -16.254 48.006 1.00 90.43  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1 64  ? -49.285 -16.710 46.563 1.00 99.06  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1 64  ? -49.103 -18.220 46.497 1.00 113.86 ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1 64  ? -49.139 -18.729 45.098 1.00 118.83 ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1 65  ? -49.194 -12.074 49.774 1.00 73.24  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1 65  ? -49.258 -10.628 49.616 1.00 80.20  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1 65  ? -48.154 -9.874  50.364 1.00 76.35  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1 65  ? -47.412 -9.123  49.716 1.00 76.48  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1 65  ? -50.647 -10.113 50.028 1.00 98.08  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1 65  ? -50.932 -8.604  49.952 1.00 97.79  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1 65  ? -51.134 -8.215  48.502 1.00 91.21  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1 65  ? -52.136 -8.218  50.815 1.00 97.68  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1 66  ? -48.043 -10.055 51.708 1.00 67.82  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1 66  ? -46.961 -9.388  52.451 1.00 77.42  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1 66  ? -45.627 -9.512  51.722 1.00 85.29  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1 66  ? -44.947 -8.508  51.519 1.00 82.89  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1 66  ? -46.874 -10.152 53.785 1.00 79.08  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1 66  ? -48.100 -10.963 53.896 1.00 77.10  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1 66  ? -48.772 -11.022 52.542 1.00 73.99  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1 67  ? -45.288 -10.743 51.319 1.00 79.64  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1 67  ? -44.079 -11.006 50.564 1.00 70.80  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1 67  ? -43.997 -10.174 49.306 1.00 73.82  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1 67  ? -42.990 -9.539  49.048 1.00 79.97  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1 67  ? -44.011 -12.462 50.177 1.00 73.50  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1 67  ? -42.693 -12.866 49.591 1.00 74.45  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1 67  ? -41.631 -13.186 50.408 1.00 68.57  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1 67  ? -42.518 -12.934 48.230 1.00 77.75  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1 67  ? -40.418 -13.545 49.874 1.00 63.42  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1 67  ? -41.306 -13.310 47.696 1.00 73.57  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1 67  ? -40.255 -13.609 48.522 1.00 66.54  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1 68  ? -45.064 -10.165 48.526 1.00 83.64  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1 68  ? -45.083 -9.402  47.270 1.00 88.21  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1 68  ? -44.769 -7.902  47.495 1.00 85.11  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1 68  ? -43.992 -7.266  46.755 1.00 70.33  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1 68  ? -46.444 -9.572  46.592 1.00 93.70  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1 68  ? -46.372 -9.500  45.081 1.00 104.41 ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1 68  ? -47.699 -9.818  44.439 1.00 108.87 ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1 68  ? -48.737 -9.486  44.998 1.00 117.35 ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1 68  ? -47.681 -10.446 43.259 1.00 106.28 ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1 69  ? -45.357 -7.341  48.541 1.00 78.67  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1 69  ? -45.076 -5.958  48.862 1.00 79.95  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1 69  ? -43.612 -5.789  49.167 1.00 70.76  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1 69  ? -42.964 -4.896  48.642 1.00 66.16  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1 69  ? -45.911 -5.492  50.058 1.00 91.66  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1 69  ? -47.413 -5.440  49.785 1.00 94.43  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1 69  ? -48.131 -4.494  50.745 1.00 91.16  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1 69  ? -47.982 -4.865  52.162 1.00 83.60  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1 69  ? -48.820 -5.638  52.859 1.00 84.18  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1 69  ? -49.912 -6.178  52.308 1.00 83.38  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1 69  ? -48.554 -5.887  54.135 1.00 86.30  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1 70  ? -43.091 -6.673  50.012 1.00 72.79  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1 70  ? -41.710 -6.558  50.468 1.00 66.38  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1 70  ? -40.797 -6.618  49.284 1.00 67.23  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1 70  ? -39.891 -5.808  49.184 1.00 68.50  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1 70  ? -41.352 -7.672  51.414 1.00 65.51  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 70  ? -39.957 -7.562  51.994 1.00 72.53  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 70  ? -39.875 -6.416  52.976 1.00 76.27  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 70  ? -39.616 -8.863  52.702 1.00 85.84  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1 71  ? -41.055 -7.551  48.371 1.00 57.01  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1 71  ? -40.289 -7.599  47.161 1.00 56.67  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1 71  ? -40.344 -6.256  46.451 1.00 62.06  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1 71  ? -39.320 -5.647  46.190 1.00 67.93  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1 71  ? -40.811 -8.674  46.229 1.00 66.28  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1 71  ? -40.129 -8.567  44.873 1.00 71.03  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1 71  ? -40.588 -10.062 46.822 1.00 68.14  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1 72  ? -41.539 -5.755  46.173 1.00 71.36  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1 72  ? -41.646 -4.502  45.402 1.00 69.96  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1 72  ? -40.951 -3.329  46.065 1.00 68.04  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1 72  ? -40.253 -2.568  45.397 1.00 74.59  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1 72  ? -43.088 -4.174  45.140 1.00 68.52  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1 72  ? -43.722 -5.182  44.199 1.00 74.93  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1 72  ? -45.230 -5.068  44.217 1.00 76.69  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1 72  ? -45.841 -6.065  43.352 1.00 82.79  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1 72  ? -45.863 -5.973  42.024 1.00 86.73  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1 72  ? -45.304 -4.938  41.393 1.00 86.93  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1 72  ? -46.453 -6.919  41.316 1.00 84.03  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1 73  ? -41.103 -3.218  47.379 1.00 61.38  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1 73  ? -40.494 -2.140  48.138 1.00 61.23  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1 73  ? -39.005 -2.154  47.918 1.00 69.55  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1 73  ? -38.390 -1.130  47.626 1.00 77.51  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1 73  ? -40.819 -2.327  49.612 1.00 68.52  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1 73  ? -39.972 -1.514  50.579 1.00 75.86  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1 73  ? -40.388 -1.759  52.028 1.00 85.92  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1 73  ? -41.590 -1.987  52.306 1.00 79.57  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1 73  ? -39.501 -1.731  52.898 1.00 91.46  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1 74  ? -38.428 -3.342  48.041 1.00 75.48  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1 74  ? -36.996 -3.508  47.921 1.00 70.27  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1 74  ? -36.569 -3.151  46.502 1.00 70.24  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1 74  ? -35.575 -2.442  46.314 1.00 73.78  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1 74  ? -36.572 -4.927  48.330 1.00 65.30  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 74  ? -36.596 -5.051  49.846 1.00 70.71  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 74  ? -35.170 -5.230  47.866 1.00 70.72  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 74  ? -36.656 -6.482  50.355 1.00 75.76  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1 75  ? -37.326 -3.602  45.507 1.00 63.77  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1 75  ? -36.947 -3.310  44.127 1.00 72.14  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1 75  ? -36.972 -1.808  43.806 1.00 75.91  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1 75  ? -36.139 -1.314  43.038 1.00 66.02  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1 75  ? -37.835 -4.062  43.177 1.00 69.34  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1 76  ? -37.905 -1.096  44.438 1.00 82.38  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1 76  ? -38.044 0.348   44.260 1.00 89.64  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1 76  ? -36.729 1.098   44.452 1.00 84.88  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1 76  ? -36.444 1.994   43.667 1.00 93.91  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1 76  ? -39.116 0.928   45.197 1.00 100.29 ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1 76  ? -39.632 2.327   44.819 1.00 108.69 ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1 76  ? -40.720 2.338   43.721 1.00 108.76 ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1 76  ? -41.504 1.399   43.589 1.00 113.54 ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1 76  ? -40.781 3.420   42.948 1.00 99.20  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1 77  ? -35.922 0.736   45.450 1.00 75.81  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1 77  ? -34.628 1.399   45.622 1.00 72.49  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1 77  ? -33.679 1.109   44.464 1.00 77.44  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1 77  ? -32.595 1.658   44.425 1.00 89.44  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1 77  ? -33.940 0.965   46.910 1.00 82.28  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1 77  ? -34.727 1.331   48.159 1.00 98.05  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1 77  ? -35.332 0.397   48.737 1.00 101.91 ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1 77  ? -34.729 2.529   48.576 1.00 98.80  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1 78  ? -34.026 0.227   43.534 1.00 75.68  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1 78  ? -33.090 -0.053  42.435 1.00 78.44  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1 78  ? -33.592 0.536   41.150 1.00 74.27  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1 78  ? -32.809 0.974   40.313 1.00 79.98  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1 78  ? -32.828 -1.570  42.268 1.00 80.32  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1 78  ? -32.292 -2.224  43.511 1.00 75.48  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1 78  ? -32.944 -3.309  44.091 1.00 72.26  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1 78  ? -31.155 -1.716  44.136 1.00 75.63  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1 78  ? -32.454 -3.889  45.258 1.00 72.65  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1 78  ? -30.663 -2.286  45.309 1.00 70.54  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1 78  ? -31.312 -3.374  45.866 1.00 73.44  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1 79  ? -34.900 0.495   40.963 1.00 74.91  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1 79  ? -35.507 1.165   39.830 1.00 78.48  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1 79  ? -36.974 1.343   40.118 1.00 85.76  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1 79  ? -37.612 0.472   40.728 1.00 91.99  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1 79  ? -35.290 0.401   38.533 1.00 77.65  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1 79  ? -36.144 0.900   37.390 1.00 88.00  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1 79  ? -35.537 0.603   36.030 1.00 100.60 ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1 79  ? -36.213 1.422   34.936 1.00 113.93 ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1 79  ? -35.663 1.112   33.586 1.00 119.47 ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1 80  ? -37.489 2.496   39.695 1.00 95.38  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1 80  ? -38.875 2.866   39.923 1.00 95.58  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1 80  ? -39.742 2.497   38.733 1.00 91.76  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1 80  ? -39.261 2.328   37.605 1.00 76.85  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1 80  ? -39.006 4.369   40.145 1.00 95.71  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1 80  ? -38.604 5.043   38.951 1.00 96.87  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1 80  ? -38.129 4.836   41.322 1.00 99.63  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1 81  ? -41.031 2.370   39.019 1.00 99.90  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1 81  ? -42.048 2.086   38.012 1.00 107.27 ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1 81  ? -41.856 0.670   37.467 1.00 104.73 ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1 81  ? -41.902 0.419   36.252 1.00 111.28 ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1 81  ? -42.024 3.156   36.899 1.00 110.70 ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1 81  ? -43.391 3.382   36.276 1.00 113.25 ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1 81  ? -44.401 3.157   36.994 1.00 94.92  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1 81  ? -43.448 3.788   35.083 1.00 112.83 ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1 82  ? -41.643 -0.258  38.391 1.00 93.49  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1 82  ? -41.343 -1.623  38.008 1.00 90.43  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1 82  ? -42.586 -2.464  38.033 1.00 77.30  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1 82  ? -43.455 -2.245  38.831 1.00 75.15  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1 82  ? -40.249 -2.225  38.904 1.00 82.59  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1 82  ? -38.824 -1.957  38.387 1.00 81.04  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1 82  ? -37.800 -2.490  39.364 1.00 80.55  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1 82  ? -38.571 -2.538  37.000 1.00 75.97  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1 83  ? -42.665 -3.424  37.134 1.00 75.10  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1 83  ? -43.713 -4.418  37.197 1.00 83.48  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1 83  ? -43.031 -5.794  37.279 1.00 90.88  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1 83  ? -41.859 -5.968  36.881 1.00 85.97  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1 83  ? -44.657 -4.289  35.989 1.00 91.20  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1 83  ? -45.194 -2.863  35.798 1.00 101.78 ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1 83  ? -46.135 -2.688  34.605 1.00 95.45  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1 83  ? -47.530 -2.853  35.006 1.00 102.87 ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1 83  ? -48.513 -3.262  34.210 1.00 109.62 ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1 83  ? -48.276 -3.550  32.932 1.00 121.09 ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1 83  ? -49.750 -3.387  34.696 1.00 106.38 ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1 84  ? -43.773 -6.755  37.820 1.00 80.82  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1 84  ? -43.259 -8.073  38.161 1.00 77.29  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1 84  ? -44.143 -9.122  37.536 1.00 68.65  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1 84  ? -45.336 -9.098  37.778 1.00 78.84  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1 84  ? -43.317 -8.276  39.691 1.00 76.90  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1 84  ? -42.098 -7.796  40.415 1.00 83.31  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1 84  ? -42.013 -6.492  40.863 1.00 86.54  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1 84  ? -41.019 -8.644  40.631 1.00 80.11  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1 84  ? -40.877 -6.039  41.506 1.00 82.92  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1 84  ? -39.888 -8.199  41.278 1.00 75.04  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1 84  ? -39.818 -6.895  41.713 1.00 80.03  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1 85  ? -43.586 -10.073 36.790 1.00 63.91  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1 85  ? -44.385 -11.230 36.393 1.00 65.48  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1 85  ? -44.843 -11.945 37.651 1.00 70.20  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1 85  ? -44.196 -11.867 38.678 1.00 75.19  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1 85  ? -43.615 -12.206 35.515 1.00 64.41  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1 85  ? -43.435 -11.752 34.087 1.00 63.97  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1 85  ? -42.785 -12.810 33.230 1.00 66.87  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1 85  ? -42.403 -13.873 33.711 1.00 69.80  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1 85  ? -42.655 -12.526 31.949 1.00 70.47  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1 86  ? -45.971 -12.632 37.558 1.00 79.13  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1 86  ? -46.516 -13.396 38.664 1.00 75.50  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1 86  ? -45.570 -14.520 39.022 1.00 78.35  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1 86  ? -45.362 -14.783 40.197 1.00 82.11  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1 86  ? -47.850 -14.009 38.272 1.00 78.96  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1 86  ? -48.158 -15.049 39.168 1.00 87.98  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1 87  ? -45.020 -15.191 38.006 1.00 74.61  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1 87  ? -44.061 -16.274 38.219 1.00 72.51  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1 87  ? -42.729 -15.774 38.802 1.00 73.52  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1 87  ? -42.069 -16.502 39.524 1.00 68.30  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1 87  ? -43.792 -17.004 36.910 1.00 67.57  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1 87  ? -43.231 -16.104 35.969 1.00 66.58  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1 88  ? -42.316 -14.554 38.467 1.00 77.47  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1 88  ? -41.099 -13.962 39.068 1.00 73.86  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1 88  ? -41.197 -13.800 40.586 1.00 66.97  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1 88  ? -40.268 -14.116 41.315 1.00 78.51  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1 88  ? -40.785 -12.624 38.435 1.00 69.62  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1 89  ? -42.321 -13.321 41.067 1.00 61.08  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1 89  ? -42.502 -13.193 42.497 1.00 62.09  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1 89  ? -42.507 -14.576 43.102 1.00 63.30  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1 89  ? -41.913 -14.790 44.128 1.00 66.83  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1 89  ? -43.813 -12.476 42.861 1.00 61.47  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1 89  ? -43.982 -12.410 44.370 1.00 65.40  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1 89  ? -43.835 -11.066 42.296 1.00 59.38  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1 90  ? -43.204 -15.504 42.468 1.00 73.87  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1 90  ? -43.234 -16.879 42.942 1.00 82.15  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1 90  ? -41.810 -17.404 43.048 1.00 74.47  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1 90  ? -41.398 -17.864 44.103 1.00 77.91  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1 90  ? -44.084 -17.790 42.023 1.00 91.29  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1 90  ? -45.582 -17.705 42.265 1.00 92.42  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1 90  ? -45.950 -17.859 44.029 1.00 108.89 ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1 90  ? -45.637 -19.624 44.280 1.00 116.12 ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1 91  ? -41.044 -17.301 41.977 1.00 70.46  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1 91  ? -39.691 -17.829 42.004 1.00 73.34  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1 91  ? -38.929 -17.248 43.205 1.00 70.41  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1 91  ? -38.351 -17.999 43.995 1.00 66.33  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1 91  ? -38.962 -17.577 40.686 1.00 67.13  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1 92  ? -38.991 -15.935 43.387 1.00 66.32  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1 92  ? -38.357 -15.323 44.558 1.00 67.59  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1 92  ? -38.821 -15.937 45.875 1.00 67.18  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1 92  ? -38.020 -16.122 46.788 1.00 74.71  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1 92  ? -38.595 -13.815 44.609 1.00 67.79  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1 92  ? -37.747 -12.977 43.650 1.00 71.86  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1 92  ? -38.228 -11.543 43.602 1.00 73.14  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1 92  ? -36.291 -12.975 44.053 1.00 71.37  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1 93  ? -40.097 -16.256 45.994 1.00 65.44  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1 93  ? -40.588 -16.824 47.249 1.00 68.08  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1 93  ? -40.068 -18.229 47.440 1.00 62.33  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1 93  ? -39.611 -18.572 48.522 1.00 61.45  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1 93  ? -42.119 -16.823 47.348 1.00 68.30  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1 93  ? -42.595 -16.590 48.767 1.00 67.57  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1 93  ? -44.093 -16.663 48.911 1.00 67.10  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1 93  ? -44.832 -16.089 48.123 1.00 75.79  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1 93  ? -44.551 -17.366 49.928 1.00 67.03  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1 94  ? -40.143 -19.034 46.397 1.00 56.81  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1 94  ? -39.653 -20.376 46.491 1.00 62.84  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1 94  ? -38.241 -20.343 47.032 1.00 61.39  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1 94  ? -37.909 -21.070 47.962 1.00 59.02  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1 94  ? -39.632 -21.044 45.119 1.00 73.30  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1 94  ? -40.983 -21.530 44.632 1.00 82.02  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1 94  ? -41.555 -22.645 45.479 1.00 82.46  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1 94  ? -42.727 -22.530 45.888 1.00 87.98  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1 94  ? -40.842 -23.633 45.725 1.00 78.15  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1 95  ? -37.422 -19.486 46.432 1.00 59.41  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1 95  ? -35.997 -19.439 46.719 1.00 55.82  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1 95  ? -35.732 -18.946 48.127 1.00 56.84  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1 95  ? -34.952 -19.556 48.855 1.00 55.56  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1 95  ? -35.284 -18.551 45.705 1.00 54.25  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1 96  ? -36.380 -17.848 48.506 1.00 54.07  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1 96  ? -36.243 -17.334 49.865 1.00 57.35  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1 96  ? -36.635 -18.332 50.959 1.00 56.39  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1 96  ? -35.995 -18.411 52.015 1.00 55.51  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1 96  ? -37.066 -16.074 50.043 1.00 56.15  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1 96  ? -36.647 -15.103 49.123 1.00 59.32  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1 97  ? -37.698 -19.082 50.734 1.00 59.27  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1 97  ? -38.152 -19.986 51.774 1.00 61.16  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1 97  ? -37.209 -21.174 51.859 1.00 54.86  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1 97  ? -36.892 -21.654 52.944 1.00 49.64  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1 97  ? -39.595 -20.413 51.546 1.00 68.02  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1 97  ? -40.608 -19.262 51.679 1.00 75.91  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1 97  ? -42.030 -19.760 52.001 1.00 84.08  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1 97  ? -42.176 -20.988 52.224 1.00 81.27  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1 97  ? -43.002 -18.949 52.049 1.00 73.47  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1 98  ? -36.722 -21.622 50.713 1.00 52.99  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1 98  ? -35.748 -22.696 50.691 1.00 47.82  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1 98  ? -34.527 -22.236 51.450 1.00 49.61  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1 98  ? -34.033 -22.934 52.318 1.00 51.37  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1 98  ? -35.384 -23.020 49.267 1.00 47.10  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1 99  ? -34.076 -21.032 51.120 1.00 54.47  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1 99  ? -32.920 -20.436 51.744 1.00 53.92  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1 99  ? -33.072 -20.374 53.238 1.00 55.47  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1 99  ? -32.153 -20.740 53.979 1.00 63.99  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1 99  ? -32.686 -19.017 51.229 1.00 54.05  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1 99  ? -31.642 -18.263 52.036 1.00 55.11  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1 99  ? -30.283 -18.517 51.893 1.00 50.50  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1 99  ? -32.021 -17.340 52.962 1.00 55.79  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1 99  ? -29.341 -17.830 52.631 1.00 51.85  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1 99  ? -31.089 -16.670 53.714 1.00 60.17  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1 99  ? -29.748 -16.900 53.544 1.00 58.12  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1 99  ? -28.835 -16.191 54.335 1.00 66.04  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1 100 ? -34.212 -19.880 53.685 1.00 56.30  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1 100 ? -34.399 -19.676 55.113 1.00 57.62  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1 100 ? -34.590 -20.996 55.832 1.00 62.51  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1 100 ? -34.078 -21.175 56.944 1.00 65.86  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1 100 ? -35.587 -18.779 55.380 1.00 55.06  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 100 ? -35.432 -17.304 55.073 1.00 58.52  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 100 ? -36.743 -16.639 55.391 1.00 62.17  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 100 ? -34.338 -16.627 55.873 1.00 59.06  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1 101 ? -35.317 -21.927 55.217 1.00 58.02  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1 101 ? -35.494 -23.222 55.856 1.00 56.74  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1 101 ? -34.141 -23.865 56.121 1.00 56.84  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1 101 ? -33.916 -24.420 57.214 1.00 51.13  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1 101 ? -36.310 -24.189 55.013 1.00 54.11  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1 101 ? -36.151 -25.592 55.548 1.00 53.95  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1 101 ? -37.758 -23.793 55.058 1.00 56.79  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1 102 ? -33.247 -23.783 55.125 1.00 51.41  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1 102 ? -31.951 -24.463 55.224 1.00 48.73  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1 102 ? -31.064 -23.755 56.221 1.00 50.73  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1 102 ? -30.356 -24.379 56.994 1.00 60.90  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1 102 ? -31.288 -24.549 53.884 1.00 46.58  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1 103 ? -31.148 -22.450 56.265 1.00 48.50  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1 103 ? -30.439 -21.726 57.309 1.00 52.85  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1 103 ? -30.940 -22.059 58.694 1.00 53.63  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1 103 ? -30.206 -21.933 59.662 1.00 57.87  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1 103 ? -30.558 -20.217 57.090 1.00 52.50  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1 103 ? -29.874 -19.273 58.062 1.00 49.00  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1 103 ? -28.407 -19.478 57.947 1.00 50.22  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1 103 ? -30.239 -17.818 57.752 1.00 51.62  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1 104 ? -32.203 -22.421 58.824 1.00 56.10  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1 104 ? -32.656 -22.820 60.136 1.00 55.45  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1 104 ? -32.063 -24.192 60.446 1.00 55.64  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1 104 ? -31.859 -24.518 61.568 1.00 53.78  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1 104 ? -34.175 -22.821 60.229 1.00 56.44  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1 104 ? -34.795 -21.440 60.451 1.00 57.72  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1 104 ? -35.703 -20.905 59.555 1.00 58.51  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1 104 ? -34.521 -20.717 61.582 1.00 55.36  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1 104 ? -36.287 -19.674 59.783 1.00 53.49  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1 104 ? -35.071 -19.469 61.795 1.00 50.79  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1 104 ? -35.954 -18.950 60.900 1.00 52.99  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1 105 ? -31.760 -25.010 59.453 1.00 55.84  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1 105 ? -31.222 -26.299 59.785 1.00 51.72  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1 105 ? -29.886 -26.000 60.446 1.00 54.40  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1 105 ? -29.675 -26.362 61.593 1.00 60.52  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1 105 ? -31.083 -27.182 58.545 1.00 56.09  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1 105 ? -32.388 -27.754 58.003 1.00 66.52  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1 105 ? -32.343 -28.200 56.522 1.00 74.85  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1 105 ? -31.272 -28.648 56.067 1.00 82.31  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1 105 ? -33.383 -28.126 55.803 1.00 78.33  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1 106 ? -29.007 -25.284 59.748 1.00 54.96  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1 106 ? -27.639 -25.020 60.230 1.00 53.12  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1 106 ? -27.656 -24.299 61.570 1.00 52.60  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1 106 ? -26.855 -24.574 62.472 1.00 51.00  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1 106 ? -26.926 -24.124 59.251 1.00 53.57  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1 106 ? -26.773 -24.739 57.888 1.00 58.77  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1 106 ? -27.266 -25.878 57.667 1.00 66.83  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1 106 ? -26.157 -24.068 57.016 1.00 62.93  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1 107 ? -28.588 -23.365 61.677 1.00 53.44  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1 107 ? -28.783 -22.623 62.905 1.00 58.90  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1 107 ? -29.053 -23.575 64.045 1.00 58.72  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1 107 ? -28.410 -23.509 65.102 1.00 57.48  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1 107 ? -29.917 -21.601 62.767 1.00 57.03  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1 107 ? -29.532 -20.615 61.796 1.00 60.09  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1 107 ? -30.136 -20.906 64.064 1.00 55.52  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1 108 ? -29.974 -24.493 63.801 1.00 60.99  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1 108 ? -30.355 -25.456 64.815 1.00 59.26  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1 108 ? -29.134 -26.267 65.172 1.00 56.65  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1 108 ? -28.874 -26.464 66.350 1.00 56.13  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1 108 ? -31.476 -26.365 64.338 1.00 62.09  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1 108 ? -32.216 -27.026 65.472 1.00 65.99  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1 108 ? -32.382 -26.452 66.541 1.00 78.53  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1 108 ? -32.709 -28.221 65.229 1.00 70.31  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1 109 ? -28.344 -26.687 64.185 1.00 51.18  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1 109 ? -27.119 -27.412 64.535 1.00 55.25  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1 109 ? -26.190 -26.568 65.419 1.00 55.21  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1 109 ? -25.641 -27.058 66.399 1.00 56.24  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1 109 ? -26.379 -27.883 63.310 1.00 55.98  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1 109 ? -27.104 -28.890 62.432 1.00 55.76  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1 109 ? -26.240 -29.153 61.233 1.00 57.43  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1 109 ? -27.298 -30.194 63.144 1.00 56.89  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1 110 ? -26.052 -25.296 65.110 1.00 51.78  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1 110 ? -25.275 -24.454 65.978 1.00 56.88  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1 110 ? -25.819 -24.370 67.439 1.00 60.19  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1 110 ? -25.032 -24.428 68.398 1.00 55.74  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1 110 ? -25.159 -23.067 65.374 1.00 58.54  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1 110 ? -24.296 -23.058 63.796 1.00 58.60  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1 111 ? -27.136 -24.240 67.625 1.00 55.46  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1 111 ? -27.703 -24.281 68.993 1.00 50.95  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1 111 ? -27.404 -25.611 69.665 1.00 48.35  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1 111 ? -26.927 -25.683 70.768 1.00 52.85  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1 111 ? -29.182 -24.065 68.956 1.00 51.57  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1 112 ? -27.633 -26.689 68.975 1.00 49.71  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1 112 ? -27.313 -27.950 69.565 1.00 54.04  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1 112 ? -25.816 -28.039 69.919 1.00 61.43  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1 112 ? -25.442 -28.619 70.947 1.00 61.88  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1 112 ? -27.769 -29.077 68.646 1.00 52.62  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1 112 ? -29.289 -29.150 68.659 1.00 54.84  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1 112 ? -27.284 -30.424 69.123 1.00 53.54  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1 112 ? -29.874 -29.782 67.409 1.00 58.28  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1 113 ? -24.955 -27.444 69.105 1.00 60.14  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1 113 ? -23.520 -27.528 69.373 1.00 56.57  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1 113 ? -23.178 -26.930 70.714 1.00 57.49  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1 113 ? -22.213 -27.352 71.376 1.00 54.88  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1 113 ? -22.750 -26.781 68.296 1.00 58.23  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1 113 ? -21.265 -26.928 68.377 1.00 53.89  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1 113 ? -20.599 -28.051 67.941 1.00 55.56  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1 113 ? -20.316 -26.060 68.781 1.00 54.99  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1 113 ? -19.302 -27.879 68.100 1.00 55.09  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1 113 ? -19.105 -26.678 68.611 1.00 54.84  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1 114 ? -23.960 -25.921 71.090 1.00 56.67  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1 114 ? -23.710 -25.184 72.309 1.00 55.42  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1 114 ? -24.549 -25.750 73.423 1.00 63.51  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1 114 ? -24.773 -25.092 74.447 1.00 63.96  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1 114 ? -24.031 -23.733 72.102 1.00 53.68  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1 115 ? -25.009 -26.980 73.208 1.00 63.53  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1 115 ? -25.735 -27.736 74.203 1.00 63.50  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1 115 ? -27.036 -27.075 74.599 1.00 64.48  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1 115 ? -27.427 -27.122 75.752 1.00 68.76  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1 115 ? -24.848 -28.003 75.396 1.00 60.34  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1 115 ? -23.688 -28.889 75.014 1.00 65.83  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1 115 ? -22.745 -29.114 76.177 1.00 79.14  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1 115 ? -21.730 -30.212 75.861 1.00 92.68  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1 115 ? -21.076 -30.821 77.069 1.00 101.32 ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1 116 ? -27.699 -26.488 73.610 1.00 57.67  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1 116 ? -29.004 -25.913 73.770 1.00 55.45  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1 116 ? -30.025 -26.605 72.844 1.00 56.09  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1 116 ? -29.679 -27.471 72.062 1.00 63.03  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1 116 ? -28.929 -24.422 73.453 1.00 56.02  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1 116 ? -28.109 -23.617 74.438 1.00 56.46  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1 116 ? -28.268 -22.113 74.232 1.00 57.57  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1 116 ? -27.295 -21.519 73.308 1.00 57.79  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1 116 ? -27.510 -21.262 72.014 1.00 63.53  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1 116 ? -28.655 -21.568 71.433 1.00 65.68  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1 116 ? -26.559 -20.699 71.271 1.00 69.98  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1 117 ? -31.290 -26.219 72.980 1.00 55.54  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1 117 ? -32.356 -26.586 72.061 1.00 53.75  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1 117 ? -33.124 -25.344 71.602 1.00 58.59  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1 117 ? -34.165 -25.441 70.953 1.00 68.25  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1 117 ? -33.376 -27.577 72.676 1.00 56.98  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1 117 ? -32.703 -28.879 73.103 1.00 58.85  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1 117 ? -34.122 -26.962 73.847 1.00 63.04  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1 118 ? -32.597 -24.170 71.896 1.00 59.27  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1 118 ? -33.296 -22.948 71.595 1.00 62.98  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1 118 ? -32.485 -22.124 70.626 1.00 62.32  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1 118 ? -31.453 -21.597 70.998 1.00 62.71  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1 118 ? -33.496 -22.096 72.873 1.00 61.82  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1 118 ? -33.966 -22.930 73.948 1.00 63.84  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1 118 ? -34.481 -20.965 72.586 1.00 62.12  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1 119 ? -32.952 -21.936 69.403 1.00 62.14  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1 119 ? -32.166 -21.099 68.498 1.00 61.94  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1 119 ? -32.130 -19.599 68.904 1.00 62.70  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1 119 ? -33.136 -19.003 69.278 1.00 56.75  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1 119 ? -32.566 -21.256 67.034 1.00 53.18  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1 119 ? -33.942 -20.713 66.801 1.00 52.21  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1 119 ? -32.468 -22.717 66.603 1.00 58.08  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1 119 ? -34.236 -20.544 65.331 1.00 56.52  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1 120 ? -30.946 -19.011 68.800 1.00 59.06  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1 120 ? -30.740 -17.643 69.169 1.00 62.09  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1 120 ? -30.020 -16.942 68.053 1.00 65.30  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1 120 ? -29.460 -17.592 67.184 1.00 66.06  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1 120 ? -29.910 -17.573 70.433 1.00 65.40  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1 120 ? -30.400 -18.505 71.519 1.00 69.78  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1 120 ? -29.625 -18.158 73.104 1.00 73.09  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1 120 ? -30.730 -19.062 74.213 1.00 74.55  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1 121 ? -30.027 -15.605 68.075 1.00 64.65  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1 121 ? -29.449 -14.882 66.978 1.00 65.27  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1 121 ? -27.982 -15.247 66.790 1.00 63.47  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1 121 ? -27.479 -15.249 65.665 1.00 61.01  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1 121 ? -29.628 -13.419 67.403 1.00 62.87  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1 121 ? -30.871 -13.450 68.206 1.00 63.30  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1 121 ? -30.693 -14.694 69.015 1.00 66.30  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1 122 ? -27.290 -15.567 67.869 1.00 56.18  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1 122 ? -25.903 -15.904 67.679 1.00 55.03  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1 122 ? -25.760 -17.130 66.810 1.00 55.51  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1 122 ? -24.861 -17.188 65.983 1.00 59.18  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1 122 ? -25.120 -16.039 68.988 1.00 57.46  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1 122 ? -25.775 -16.786 70.111 1.00 65.90  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1 122 ? -24.923 -16.744 71.363 1.00 68.62  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1 122 ? -25.792 -17.084 72.557 1.00 82.93  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1 122 ? -24.985 -17.138 73.796 1.00 95.83  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1 123 ? -26.656 -18.098 66.968 1.00 56.42  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1 123 ? -26.608 -19.307 66.146 1.00 51.76  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1 123 ? -26.812 -18.970 64.671 1.00 50.94  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1 123 ? -26.120 -19.478 63.830 1.00 57.37  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1 123 ? -27.678 -20.301 66.575 1.00 54.10  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1 123 ? -27.596 -20.666 68.044 1.00 55.52  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1 123 ? -26.497 -20.936 68.547 1.00 56.89  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1 123 ? -28.647 -20.697 68.713 1.00 56.84  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1 124 ? -27.758 -18.106 64.357 1.00 51.36  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1 124 ? -27.893 -17.619 62.996 1.00 54.38  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1 124 ? -26.607 -16.936 62.537 1.00 54.44  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1 124 ? -26.177 -17.097 61.412 1.00 56.86  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1 124 ? -29.050 -16.614 62.852 1.00 56.27  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1 124 ? -30.374 -17.292 63.150 1.00 60.14  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1 124 ? -29.166 -16.137 61.424 1.00 61.21  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1 124 ? -31.586 -16.416 62.898 1.00 59.75  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1 125 ? -25.997 -16.163 63.410 1.00 58.71  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1 125 ? -24.807 -15.428 63.037 1.00 56.27  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1 125 ? -23.657 -16.367 62.769 1.00 53.58  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1 125 ? -22.939 -16.222 61.806 1.00 60.07  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1 125 ? -24.448 -14.444 64.130 1.00 59.16  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 125 ? -25.334 -13.215 64.128 1.00 66.14  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 125 ? -25.486 -12.560 65.490 1.00 70.35  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 125 ? -24.685 -12.767 66.399 1.00 73.57  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 125 ? -26.526 -11.753 65.628 1.00 72.36  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1 126 ? -23.488 -17.349 63.618 1.00 52.89  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1 126 ? -22.401 -18.290 63.429 1.00 53.27  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1 126 ? -22.561 -19.006 62.112 1.00 53.67  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1 126 ? -21.593 -19.178 61.382 1.00 53.45  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1 126 ? -22.396 -19.316 64.549 1.00 48.45  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1 126 ? -21.278 -20.286 64.465 1.00 49.42  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1 126 ? -19.956 -19.559 64.538 1.00 52.43  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1 126 ? -21.418 -21.245 65.617 1.00 56.15  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1 127 ? -23.786 -19.432 61.816 1.00 52.12  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1 127 ? -24.039 -20.147 60.580 1.00 53.31  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1 127 ? -23.733 -19.259 59.397 1.00 53.14  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1 127 ? -23.028 -19.661 58.484 1.00 55.42  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1 127 ? -25.456 -20.650 60.519 1.00 57.87  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1 128 ? -24.183 -18.021 59.426 1.00 48.74  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1 128 ? -23.877 -17.173 58.299 1.00 49.38  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1 128 ? -22.404 -16.878 58.164 1.00 48.68  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1 128 ? -21.873 -16.803 57.072 1.00 51.16  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1 128 ? -24.682 -15.926 58.365 1.00 49.79  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1 128 ? -26.152 -16.244 58.161 1.00 53.67  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1 128 ? -26.963 -14.997 58.026 1.00 55.47  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1 128 ? -26.638 -14.266 56.799 1.00 60.35  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1 128 ? -26.308 -12.983 56.763 1.00 56.92  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1 128 ? -26.249 -12.309 57.882 1.00 60.48  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1 128 ? -26.067 -12.364 55.619 1.00 63.31  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1 129 ? -21.712 -16.759 59.269 1.00 51.42  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1 129 ? -20.264 -16.490 59.194 1.00 52.69  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1 129 ? -19.531 -17.678 58.569 1.00 52.64  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1 129 ? -18.739 -17.515 57.672 1.00 49.07  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1 129 ? -19.734 -16.083 60.574 1.00 47.36  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1 129 ? -18.263 -16.157 60.813 1.00 49.57  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1 129 ? -17.445 -15.333 59.869 1.00 63.77  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1 129 ? -16.021 -15.587 60.135 1.00 69.96  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1 129 ? -15.355 -16.644 59.671 1.00 65.75  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1 129 ? -15.957 -17.526 58.888 1.00 62.24  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1 129 ? -14.087 -16.831 59.995 1.00 67.79  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1 130 ? -19.864 -18.885 58.983 1.00 60.41  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1 130 ? -19.175 -20.059 58.473 1.00 58.46  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1 130 ? -19.498 -20.326 57.010 1.00 57.48  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1 130 ? -18.632 -20.728 56.227 1.00 55.60  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1 130 ? -19.447 -21.244 59.375 1.00 55.24  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1 130 ? -18.761 -20.960 60.701 1.00 60.64  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1 130 ? -18.869 -22.511 58.810 1.00 56.77  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1 130 ? -19.321 -21.774 61.848 1.00 67.29  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1 131 ? -20.731 -20.053 56.631 1.00 62.72  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1 131 ? -21.133 -20.179 55.225 1.00 61.26  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1 131 ? -20.404 -19.160 54.345 1.00 61.08  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1 131 ? -20.471 -19.234 53.139 1.00 58.12  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1 131 ? -22.621 -19.919 55.089 1.00 57.07  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1 131 ? -23.536 -21.028 55.526 1.00 55.45  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1 131 ? -24.951 -20.453 55.561 1.00 62.70  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1 131 ? -26.020 -21.440 55.674 1.00 60.11  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1 131 ? -27.148 -21.401 54.976 1.00 64.59  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1 131 ? -27.354 -20.421 54.121 1.00 71.26  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1 131 ? -28.085 -22.336 55.125 1.00 66.84  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1 132 ? -19.754 -18.176 54.944 1.00 62.57  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1 132 ? -19.096 -17.154 54.161 1.00 65.11  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1 132 ? -20.054 -16.075 53.715 1.00 67.64  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1 132 ? -19.824 -15.419 52.716 1.00 85.35  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1 133 ? -21.120 -15.847 54.459 1.00 68.82  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1 133 ? -21.987 -14.707 54.174 1.00 67.34  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1 133 ? -21.532 -13.470 54.962 1.00 79.83  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1 133 ? -21.920 -12.357 54.602 1.00 89.49  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1 133 ? -23.471 -15.072 54.434 1.00 64.60  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1 133 ? -24.017 -16.105 53.438 1.00 62.51  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1 133 ? -25.373 -16.715 53.779 1.00 65.10  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1 133 ? -26.169 -16.063 54.491 1.00 67.60  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1 133 ? -25.657 -17.851 53.305 1.00 62.29  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1 134 ? -20.687 -13.652 55.995 1.00 95.16  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1 134 ? -20.178 -12.532 56.840 1.00 111.57 ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1 134 ? -18.652 -12.328 56.712 1.00 112.10 ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A 1 134 ? -17.978 -11.910 57.676 1.00 105.90 ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1 134 ? -20.524 -12.729 58.338 1.00 115.33 ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1 134 ? -21.931 -13.227 58.642 1.00 119.24 ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1 134 ? -22.449 -12.774 60.009 1.00 123.35 ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1 134 ? -22.871 -11.369 59.939 1.00 139.08 ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1 134 ? -23.989 -10.853 60.459 1.00 130.58 ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1 134 ? -24.875 -11.617 61.112 1.00 113.75 ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1 134 ? -24.229 -9.548  60.300 1.00 122.23 ? 134  ARG A NH2   1 
ATOM   803   N  N     . VAL B 2 21  ? -53.473 1.893   60.505 1.00 171.89 ? 21   VAL B N     1 
ATOM   804   C  CA    . VAL B 2 21  ? -52.544 0.996   61.279 1.00 168.50 ? 21   VAL B CA    1 
ATOM   805   C  C     . VAL B 2 21  ? -51.186 0.888   60.526 1.00 166.30 ? 21   VAL B C     1 
ATOM   806   O  O     . VAL B 2 21  ? -50.793 -0.191  60.050 1.00 142.86 ? 21   VAL B O     1 
ATOM   807   C  CB    . VAL B 2 21  ? -53.198 -0.395  61.584 1.00 164.61 ? 21   VAL B CB    1 
ATOM   808   C  CG1   . VAL B 2 21  ? -52.420 -1.142  62.665 1.00 157.67 ? 21   VAL B CG1   1 
ATOM   809   C  CG2   . VAL B 2 21  ? -54.667 -0.248  62.014 1.00 148.15 ? 21   VAL B CG2   1 
ATOM   810   N  N     . LEU B 2 22  ? -50.489 2.033   60.447 1.00 168.82 ? 22   LEU B N     1 
ATOM   811   C  CA    . LEU B 2 22  ? -49.257 2.217   59.639 1.00 170.35 ? 22   LEU B CA    1 
ATOM   812   C  C     . LEU B 2 22  ? -48.122 1.264   60.040 1.00 170.55 ? 22   LEU B C     1 
ATOM   813   O  O     . LEU B 2 22  ? -47.767 1.179   61.218 1.00 175.36 ? 22   LEU B O     1 
ATOM   814   C  CB    . LEU B 2 22  ? -48.776 3.690   59.703 1.00 170.43 ? 22   LEU B CB    1 
ATOM   815   C  CG    . LEU B 2 22  ? -48.410 4.351   61.056 1.00 166.80 ? 22   LEU B CG    1 
ATOM   816   C  CD1   . LEU B 2 22  ? -46.899 4.488   61.256 1.00 158.02 ? 22   LEU B CD1   1 
ATOM   817   C  CD2   . LEU B 2 22  ? -49.067 5.722   61.196 1.00 157.48 ? 22   LEU B CD2   1 
ATOM   818   N  N     . ARG B 2 23  ? -47.550 0.560   59.060 1.00 159.25 ? 23   ARG B N     1 
ATOM   819   C  CA    . ARG B 2 23  ? -46.620 -0.543  59.344 1.00 149.08 ? 23   ARG B CA    1 
ATOM   820   C  C     . ARG B 2 23  ? -45.677 -0.868  58.166 1.00 141.16 ? 23   ARG B C     1 
ATOM   821   O  O     . ARG B 2 23  ? -46.119 -0.918  57.012 1.00 136.04 ? 23   ARG B O     1 
ATOM   822   C  CB    . ARG B 2 23  ? -47.441 -1.782  59.716 1.00 149.52 ? 23   ARG B CB    1 
ATOM   823   C  CG    . ARG B 2 23  ? -46.703 -2.804  60.564 1.00 150.63 ? 23   ARG B CG    1 
ATOM   824   C  CD    . ARG B 2 23  ? -47.588 -3.997  60.902 1.00 149.60 ? 23   ARG B CD    1 
ATOM   825   N  NE    . ARG B 2 23  ? -48.526 -4.326  59.824 1.00 154.23 ? 23   ARG B NE    1 
ATOM   826   C  CZ    . ARG B 2 23  ? -48.203 -4.900  58.659 1.00 153.34 ? 23   ARG B CZ    1 
ATOM   827   N  NH1   . ARG B 2 23  ? -46.946 -5.218  58.366 1.00 153.72 ? 23   ARG B NH1   1 
ATOM   828   N  NH2   . ARG B 2 23  ? -49.153 -5.151  57.766 1.00 146.06 ? 23   ARG B NH2   1 
ATOM   829   N  N     . ASP B 2 24  ? -44.387 -1.087  58.466 1.00 131.55 ? 24   ASP B N     1 
ATOM   830   C  CA    . ASP B 2 24  ? -43.369 -1.487  57.460 1.00 121.27 ? 24   ASP B CA    1 
ATOM   831   C  C     . ASP B 2 24  ? -43.729 -2.819  56.841 1.00 109.24 ? 24   ASP B C     1 
ATOM   832   O  O     . ASP B 2 24  ? -44.315 -3.674  57.510 1.00 107.14 ? 24   ASP B O     1 
ATOM   833   C  CB    . ASP B 2 24  ? -41.993 -1.677  58.101 1.00 131.40 ? 24   ASP B CB    1 
ATOM   834   C  CG    . ASP B 2 24  ? -41.365 -0.384  58.540 1.00 141.24 ? 24   ASP B CG    1 
ATOM   835   O  OD1   . ASP B 2 24  ? -41.012 0.432   57.661 1.00 153.14 ? 24   ASP B OD1   1 
ATOM   836   O  OD2   . ASP B 2 24  ? -41.204 -0.198  59.764 1.00 140.82 ? 24   ASP B OD2   1 
ATOM   837   N  N     . ASN B 2 25  ? -43.357 -3.027  55.584 1.00 97.44  ? 25   ASN B N     1 
ATOM   838   C  CA    . ASN B 2 25  ? -43.721 -4.288  54.921 1.00 92.65  ? 25   ASN B CA    1 
ATOM   839   C  C     . ASN B 2 25  ? -42.955 -5.499  55.431 1.00 87.79  ? 25   ASN B C     1 
ATOM   840   O  O     . ASN B 2 25  ? -43.476 -6.619  55.410 1.00 85.81  ? 25   ASN B O     1 
ATOM   841   C  CB    . ASN B 2 25  ? -43.537 -4.179  53.428 1.00 94.21  ? 25   ASN B CB    1 
ATOM   842   C  CG    . ASN B 2 25  ? -44.612 -3.357  52.784 1.00 90.38  ? 25   ASN B CG    1 
ATOM   843   O  OD1   . ASN B 2 25  ? -45.788 -3.654  52.936 1.00 94.50  ? 25   ASN B OD1   1 
ATOM   844   N  ND2   . ASN B 2 25  ? -44.223 -2.338  52.046 1.00 91.32  ? 25   ASN B ND2   1 
ATOM   845   N  N     . ILE B 2 26  ? -41.727 -5.267  55.889 1.00 81.43  ? 26   ILE B N     1 
ATOM   846   C  CA    . ILE B 2 26  ? -40.906 -6.321  56.476 1.00 83.99  ? 26   ILE B CA    1 
ATOM   847   C  C     . ILE B 2 26  ? -41.621 -7.010  57.643 1.00 79.18  ? 26   ILE B C     1 
ATOM   848   O  O     . ILE B 2 26  ? -41.439 -8.205  57.917 1.00 74.84  ? 26   ILE B O     1 
ATOM   849   C  CB    . ILE B 2 26  ? -39.526 -5.759  56.923 1.00 87.38  ? 26   ILE B CB    1 
ATOM   850   C  CG1   . ILE B 2 26  ? -38.570 -6.861  57.400 1.00 82.49  ? 26   ILE B CG1   1 
ATOM   851   C  CG2   . ILE B 2 26  ? -39.676 -4.729  58.024 1.00 88.86  ? 26   ILE B CG2   1 
ATOM   852   C  CD1   . ILE B 2 26  ? -38.249 -7.872  56.327 1.00 86.22  ? 26   ILE B CD1   1 
ATOM   853   N  N     . GLN B 2 27  ? -42.465 -6.255  58.317 1.00 79.46  ? 27   GLN B N     1 
ATOM   854   C  CA    . GLN B 2 27  ? -43.162 -6.772  59.477 1.00 81.48  ? 27   GLN B CA    1 
ATOM   855   C  C     . GLN B 2 27  ? -44.346 -7.641  59.092 1.00 82.01  ? 27   GLN B C     1 
ATOM   856   O  O     . GLN B 2 27  ? -44.903 -8.360  59.941 1.00 73.40  ? 27   GLN B O     1 
ATOM   857   C  CB    . GLN B 2 27  ? -43.590 -5.614  60.345 1.00 80.26  ? 27   GLN B CB    1 
ATOM   858   C  CG    . GLN B 2 27  ? -42.406 -4.835  60.896 1.00 76.45  ? 27   GLN B CG    1 
ATOM   859   C  CD    . GLN B 2 27  ? -41.638 -5.635  61.918 1.00 82.14  ? 27   GLN B CD    1 
ATOM   860   O  OE1   . GLN B 2 27  ? -42.208 -6.440  62.658 1.00 85.05  ? 27   GLN B OE1   1 
ATOM   861   N  NE2   . GLN B 2 27  ? -40.336 -5.429  61.962 1.00 91.97  ? 27   GLN B NE2   1 
ATOM   862   N  N     . GLY B 2 28  ? -44.692 -7.595  57.804 1.00 82.16  ? 28   GLY B N     1 
ATOM   863   C  CA    . GLY B 2 28  ? -45.685 -8.490  57.223 1.00 90.04  ? 28   GLY B CA    1 
ATOM   864   C  C     . GLY B 2 28  ? -45.226 -9.927  57.245 1.00 89.58  ? 28   GLY B C     1 
ATOM   865   O  O     . GLY B 2 28  ? -46.033 -10.855 57.161 1.00 92.05  ? 28   GLY B O     1 
ATOM   866   N  N     . ILE B 2 29  ? -43.913 -10.093 57.334 1.00 79.30  ? 29   ILE B N     1 
ATOM   867   C  CA    . ILE B 2 29  ? -43.326 -11.379 57.523 1.00 73.28  ? 29   ILE B CA    1 
ATOM   868   C  C     . ILE B 2 29  ? -43.428 -11.625 59.024 1.00 70.67  ? 29   ILE B C     1 
ATOM   869   O  O     . ILE B 2 29  ? -42.626 -11.158 59.830 1.00 67.37  ? 29   ILE B O     1 
ATOM   870   C  CB    . ILE B 2 29  ? -41.869 -11.399 57.052 1.00 73.88  ? 29   ILE B CB    1 
ATOM   871   C  CG1   . ILE B 2 29  ? -41.736 -10.815 55.635 1.00 66.84  ? 29   ILE B CG1   1 
ATOM   872   C  CG2   . ILE B 2 29  ? -41.291 -12.815 57.144 1.00 73.49  ? 29   ILE B CG2   1 
ATOM   873   C  CD1   . ILE B 2 29  ? -42.413 -11.597 54.547 1.00 66.46  ? 29   ILE B CD1   1 
ATOM   874   N  N     . THR B 2 30  ? -44.437 -12.375 59.389 1.00 64.77  ? 30   THR B N     1 
ATOM   875   C  CA    . THR B 2 30  ? -44.904 -12.354 60.747 1.00 72.69  ? 30   THR B CA    1 
ATOM   876   C  C     . THR B 2 30  ? -44.252 -13.418 61.587 1.00 63.22  ? 30   THR B C     1 
ATOM   877   O  O     . THR B 2 30  ? -43.708 -14.371 61.072 1.00 71.27  ? 30   THR B O     1 
ATOM   878   C  CB    . THR B 2 30  ? -46.432 -12.582 60.754 1.00 77.66  ? 30   THR B CB    1 
ATOM   879   O  OG1   . THR B 2 30  ? -46.723 -13.930 60.351 1.00 79.04  ? 30   THR B OG1   1 
ATOM   880   C  CG2   . THR B 2 30  ? -47.136 -11.602 59.787 1.00 74.16  ? 30   THR B CG2   1 
ATOM   881   N  N     . LYS B 2 31  ? -44.360 -13.269 62.888 1.00 63.25  ? 31   LYS B N     1 
ATOM   882   C  CA    . LYS B 2 31  ? -43.944 -14.319 63.818 1.00 66.64  ? 31   LYS B CA    1 
ATOM   883   C  C     . LYS B 2 31  ? -44.377 -15.736 63.436 1.00 67.64  ? 31   LYS B C     1 
ATOM   884   O  O     . LYS B 2 31  ? -43.544 -16.625 63.381 1.00 73.85  ? 31   LYS B O     1 
ATOM   885   C  CB    . LYS B 2 31  ? -44.392 -13.995 65.248 1.00 62.26  ? 31   LYS B CB    1 
ATOM   886   C  CG    . LYS B 2 31  ? -44.302 -15.167 66.192 1.00 73.10  ? 31   LYS B CG    1 
ATOM   887   C  CD    . LYS B 2 31  ? -44.144 -14.687 67.630 1.00 83.25  ? 31   LYS B CD    1 
ATOM   888   C  CE    . LYS B 2 31  ? -44.202 -15.838 68.626 1.00 82.84  ? 31   LYS B CE    1 
ATOM   889   N  NZ    . LYS B 2 31  ? -43.808 -15.374 69.988 1.00 86.47  ? 31   LYS B NZ    1 
ATOM   890   N  N     . PRO B 2 32  ? -45.666 -15.961 63.172 1.00 72.41  ? 32   PRO B N     1 
ATOM   891   C  CA    . PRO B 2 32  ? -46.135 -17.322 62.871 1.00 71.49  ? 32   PRO B CA    1 
ATOM   892   C  C     . PRO B 2 32  ? -45.606 -17.904 61.573 1.00 72.44  ? 32   PRO B C     1 
ATOM   893   O  O     . PRO B 2 32  ? -45.376 -19.105 61.498 1.00 72.94  ? 32   PRO B O     1 
ATOM   894   C  CB    . PRO B 2 32  ? -47.630 -17.149 62.726 1.00 78.33  ? 32   PRO B CB    1 
ATOM   895   C  CG    . PRO B 2 32  ? -47.939 -15.842 63.363 1.00 81.59  ? 32   PRO B CG    1 
ATOM   896   C  CD    . PRO B 2 32  ? -46.757 -14.991 63.115 1.00 74.22  ? 32   PRO B CD    1 
ATOM   897   N  N     . ALA B 2 33  ? -45.454 -17.059 60.554 1.00 75.94  ? 33   ALA B N     1 
ATOM   898   C  CA    . ALA B 2 33  ? -44.828 -17.466 59.290 1.00 75.18  ? 33   ALA B CA    1 
ATOM   899   C  C     . ALA B 2 33  ? -43.362 -17.843 59.477 1.00 76.59  ? 33   ALA B C     1 
ATOM   900   O  O     . ALA B 2 33  ? -42.884 -18.845 58.913 1.00 75.78  ? 33   ALA B O     1 
ATOM   901   C  CB    . ALA B 2 33  ? -44.923 -16.353 58.280 1.00 71.67  ? 33   ALA B CB    1 
ATOM   902   N  N     . ILE B 2 34  ? -42.645 -17.038 60.256 1.00 67.24  ? 34   ILE B N     1 
ATOM   903   C  CA    . ILE B 2 34  ? -41.241 -17.332 60.536 1.00 65.99  ? 34   ILE B CA    1 
ATOM   904   C  C     . ILE B 2 34  ? -41.131 -18.602 61.365 1.00 64.60  ? 34   ILE B C     1 
ATOM   905   O  O     . ILE B 2 34  ? -40.268 -19.453 61.140 1.00 69.61  ? 34   ILE B O     1 
ATOM   906   C  CB    . ILE B 2 34  ? -40.552 -16.176 61.255 1.00 65.41  ? 34   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2 34  ? -40.456 -14.958 60.346 1.00 64.26  ? 34   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2 34  ? -39.149 -16.564 61.639 1.00 70.62  ? 34   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2 34  ? -40.158 -13.695 61.124 1.00 67.64  ? 34   ILE B CD1   1 
ATOM   910   N  N     . ARG B 2 35  ? -42.042 -18.743 62.305 1.00 66.08  ? 35   ARG B N     1 
ATOM   911   C  CA    . ARG B 2 35  ? -42.099 -19.933 63.130 1.00 64.79  ? 35   ARG B CA    1 
ATOM   912   C  C     . ARG B 2 35  ? -42.314 -21.184 62.274 1.00 68.62  ? 35   ARG B C     1 
ATOM   913   O  O     . ARG B 2 35  ? -41.659 -22.205 62.492 1.00 65.94  ? 35   ARG B O     1 
ATOM   914   C  CB    . ARG B 2 35  ? -43.184 -19.713 64.152 1.00 71.15  ? 35   ARG B CB    1 
ATOM   915   C  CG    . ARG B 2 35  ? -43.607 -20.876 65.019 1.00 83.79  ? 35   ARG B CG    1 
ATOM   916   C  CD    . ARG B 2 35  ? -44.417 -20.312 66.185 1.00 84.92  ? 35   ARG B CD    1 
ATOM   917   N  NE    . ARG B 2 35  ? -43.503 -19.937 67.253 1.00 78.74  ? 35   ARG B NE    1 
ATOM   918   C  CZ    . ARG B 2 35  ? -43.474 -20.519 68.451 1.00 87.41  ? 35   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B 2 35  ? -44.359 -21.461 68.800 1.00 93.77  ? 35   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B 2 35  ? -42.575 -20.134 69.334 1.00 89.62  ? 35   ARG B NH2   1 
ATOM   921   N  N     . ARG B 2 36  ? -43.181 -21.098 61.265 1.00 72.36  ? 36   ARG B N     1 
ATOM   922   C  CA    . ARG B 2 36  ? -43.437 -22.252 60.381 1.00 67.77  ? 36   ARG B CA    1 
ATOM   923   C  C     . ARG B 2 36  ? -42.169 -22.694 59.623 1.00 67.26  ? 36   ARG B C     1 
ATOM   924   O  O     . ARG B 2 36  ? -41.827 -23.901 59.577 1.00 61.18  ? 36   ARG B O     1 
ATOM   925   C  CB    . ARG B 2 36  ? -44.577 -21.943 59.400 1.00 71.70  ? 36   ARG B CB    1 
ATOM   926   C  CG    . ARG B 2 36  ? -45.982 -21.992 60.005 1.00 70.98  ? 36   ARG B CG    1 
ATOM   927   C  CD    . ARG B 2 36  ? -47.051 -22.017 58.920 1.00 71.33  ? 36   ARG B CD    1 
ATOM   928   N  NE    . ARG B 2 36  ? -47.164 -20.773 58.143 1.00 73.04  ? 36   ARG B NE    1 
ATOM   929   C  CZ    . ARG B 2 36  ? -47.794 -19.677 58.559 1.00 70.70  ? 36   ARG B CZ    1 
ATOM   930   N  NH1   . ARG B 2 36  ? -48.350 -19.635 59.751 1.00 70.28  ? 36   ARG B NH1   1 
ATOM   931   N  NH2   . ARG B 2 36  ? -47.855 -18.607 57.793 1.00 73.37  ? 36   ARG B NH2   1 
ATOM   932   N  N     . LEU B 2 37  ? -41.454 -21.716 59.063 1.00 62.64  ? 37   LEU B N     1 
ATOM   933   C  CA    . LEU B 2 37  ? -40.215 -22.003 58.344 1.00 57.40  ? 37   LEU B CA    1 
ATOM   934   C  C     . LEU B 2 37  ? -39.232 -22.702 59.258 1.00 58.98  ? 37   LEU B C     1 
ATOM   935   O  O     . LEU B 2 37  ? -38.672 -23.743 58.930 1.00 62.66  ? 37   LEU B O     1 
ATOM   936   C  CB    . LEU B 2 37  ? -39.577 -20.725 57.872 1.00 58.49  ? 37   LEU B CB    1 
ATOM   937   C  CG    . LEU B 2 37  ? -40.282 -20.056 56.719 1.00 61.67  ? 37   LEU B CG    1 
ATOM   938   C  CD1   . LEU B 2 37  ? -39.888 -18.580 56.673 1.00 62.02  ? 37   LEU B CD1   1 
ATOM   939   C  CD2   . LEU B 2 37  ? -39.976 -20.795 55.422 1.00 59.33  ? 37   LEU B CD2   1 
ATOM   940   N  N     . ALA B 2 38  ? -39.021 -22.136 60.427 1.00 56.31  ? 38   ALA B N     1 
ATOM   941   C  CA    . ALA B 2 38  ? -38.154 -22.787 61.371 1.00 58.89  ? 38   ALA B CA    1 
ATOM   942   C  C     . ALA B 2 38  ? -38.564 -24.244 61.524 1.00 60.96  ? 38   ALA B C     1 
ATOM   943   O  O     . ALA B 2 38  ? -37.712 -25.123 61.606 1.00 57.30  ? 38   ALA B O     1 
ATOM   944   C  CB    . ALA B 2 38  ? -38.230 -22.080 62.716 1.00 61.44  ? 38   ALA B CB    1 
ATOM   945   N  N     . ARG B 2 39  ? -39.879 -24.486 61.574 1.00 64.43  ? 39   ARG B N     1 
ATOM   946   C  CA    . ARG B 2 39  ? -40.412 -25.808 61.895 1.00 65.88  ? 39   ARG B CA    1 
ATOM   947   C  C     . ARG B 2 39  ? -40.073 -26.751 60.785 1.00 64.43  ? 39   ARG B C     1 
ATOM   948   O  O     . ARG B 2 39  ? -39.655 -27.901 61.020 1.00 63.02  ? 39   ARG B O     1 
ATOM   949   C  CB    . ARG B 2 39  ? -41.923 -25.748 62.100 1.00 68.48  ? 39   ARG B CB    1 
ATOM   950   C  CG    . ARG B 2 39  ? -42.356 -24.995 63.357 1.00 68.41  ? 39   ARG B CG    1 
ATOM   951   C  CD    . ARG B 2 39  ? -42.183 -25.872 64.595 1.00 74.57  ? 39   ARG B CD    1 
ATOM   952   N  NE    . ARG B 2 39  ? -42.814 -25.319 65.806 1.00 77.09  ? 39   ARG B NE    1 
ATOM   953   C  CZ    . ARG B 2 39  ? -42.200 -24.600 66.743 1.00 81.54  ? 39   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B 2 39  ? -40.920 -24.294 66.647 1.00 78.37  ? 39   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B 2 39  ? -42.878 -24.172 67.792 1.00 90.64  ? 39   ARG B NH2   1 
ATOM   956   N  N     . ARG B 2 40  ? -40.211 -26.255 59.562 1.00 60.19  ? 40   ARG B N     1 
ATOM   957   C  CA    . ARG B 2 40  ? -39.830 -27.064 58.428 1.00 61.02  ? 40   ARG B CA    1 
ATOM   958   C  C     . ARG B 2 40  ? -38.375 -27.414 58.552 1.00 61.70  ? 40   ARG B C     1 
ATOM   959   O  O     . ARG B 2 40  ? -37.978 -28.518 58.206 1.00 68.28  ? 40   ARG B O     1 
ATOM   960   C  CB    . ARG B 2 40  ? -40.099 -26.336 57.123 1.00 63.98  ? 40   ARG B CB    1 
ATOM   961   C  CG    . ARG B 2 40  ? -39.941 -27.217 55.894 1.00 66.74  ? 40   ARG B CG    1 
ATOM   962   C  CD    . ARG B 2 40  ? -40.635 -26.629 54.681 1.00 67.94  ? 40   ARG B CD    1 
ATOM   963   N  NE    . ARG B 2 40  ? -42.019 -27.079 54.536 1.00 74.69  ? 40   ARG B NE    1 
ATOM   964   C  CZ    . ARG B 2 40  ? -42.920 -26.464 53.772 1.00 78.57  ? 40   ARG B CZ    1 
ATOM   965   N  NH1   . ARG B 2 40  ? -42.609 -25.360 53.102 1.00 71.90  ? 40   ARG B NH1   1 
ATOM   966   N  NH2   . ARG B 2 40  ? -44.146 -26.944 53.685 1.00 79.98  ? 40   ARG B NH2   1 
ATOM   967   N  N     . GLY B 2 41  ? -37.592 -26.469 59.077 1.00 61.81  ? 41   GLY B N     1 
ATOM   968   C  CA    . GLY B 2 41  ? -36.153 -26.666 59.342 1.00 58.82  ? 41   GLY B CA    1 
ATOM   969   C  C     . GLY B 2 41  ? -35.758 -27.470 60.560 1.00 52.93  ? 41   GLY B C     1 
ATOM   970   O  O     . GLY B 2 41  ? -34.587 -27.576 60.870 1.00 53.78  ? 41   GLY B O     1 
ATOM   971   N  N     . GLY B 2 42  ? -36.735 -28.040 61.249 1.00 56.26  ? 42   GLY B N     1 
ATOM   972   C  CA    . GLY B 2 42  ? -36.472 -28.938 62.365 1.00 55.01  ? 42   GLY B CA    1 
ATOM   973   C  C     . GLY B 2 42  ? -36.259 -28.254 63.682 1.00 52.91  ? 42   GLY B C     1 
ATOM   974   O  O     . GLY B 2 42  ? -35.719 -28.868 64.597 1.00 56.44  ? 42   GLY B O     1 
ATOM   975   N  N     . VAL B 2 43  ? -36.713 -27.009 63.789 1.00 52.46  ? 43   VAL B N     1 
ATOM   976   C  CA    . VAL B 2 43  ? -36.512 -26.230 64.993 1.00 61.11  ? 43   VAL B CA    1 
ATOM   977   C  C     . VAL B 2 43  ? -37.666 -26.348 65.986 1.00 62.06  ? 43   VAL B C     1 
ATOM   978   O  O     . VAL B 2 43  ? -38.801 -26.074 65.643 1.00 63.80  ? 43   VAL B O     1 
ATOM   979   C  CB    . VAL B 2 43  ? -36.321 -24.756 64.634 1.00 70.97  ? 43   VAL B CB    1 
ATOM   980   C  CG1   . VAL B 2 43  ? -36.035 -23.929 65.876 1.00 68.96  ? 43   VAL B CG1   1 
ATOM   981   C  CG2   . VAL B 2 43  ? -35.166 -24.611 63.651 1.00 78.40  ? 43   VAL B CG2   1 
ATOM   982   N  N     . LYS B 2 44  ? -37.344 -26.699 67.230 1.00 67.13  ? 44   LYS B N     1 
ATOM   983   C  CA    . LYS B 2 44  ? -38.325 -26.959 68.297 1.00 65.74  ? 44   LYS B CA    1 
ATOM   984   C  C     . LYS B 2 44  ? -38.653 -25.730 69.158 1.00 68.38  ? 44   LYS B C     1 
ATOM   985   O  O     . LYS B 2 44  ? -39.813 -25.473 69.471 1.00 84.19  ? 44   LYS B O     1 
ATOM   986   C  CB    . LYS B 2 44  ? -37.757 -28.026 69.215 1.00 66.77  ? 44   LYS B CB    1 
ATOM   987   C  CG    . LYS B 2 44  ? -38.700 -28.472 70.298 1.00 76.16  ? 44   LYS B CG    1 
ATOM   988   C  CD    . LYS B 2 44  ? -38.102 -29.604 71.130 1.00 81.42  ? 44   LYS B CD    1 
ATOM   989   C  CE    . LYS B 2 44  ? -39.165 -30.229 72.021 1.00 83.17  ? 44   LYS B CE    1 
ATOM   990   N  NZ    . LYS B 2 44  ? -38.586 -31.252 72.913 1.00 91.78  ? 44   LYS B NZ    1 
ATOM   991   N  N     . ARG B 2 45  ? -37.625 -24.991 69.559 1.00 67.11  ? 45   ARG B N     1 
ATOM   992   C  CA    . ARG B 2 45  ? -37.765 -23.895 70.493 1.00 63.36  ? 45   ARG B CA    1 
ATOM   993   C  C     . ARG B 2 45  ? -37.041 -22.677 69.934 1.00 66.20  ? 45   ARG B C     1 
ATOM   994   O  O     . ARG B 2 45  ? -35.920 -22.796 69.442 1.00 56.74  ? 45   ARG B O     1 
ATOM   995   C  CB    . ARG B 2 45  ? -37.166 -24.303 71.842 1.00 69.38  ? 45   ARG B CB    1 
ATOM   996   C  CG    . ARG B 2 45  ? -37.720 -23.542 73.039 1.00 74.79  ? 45   ARG B CG    1 
ATOM   997   C  CD    . ARG B 2 45  ? -37.393 -24.203 74.386 1.00 73.70  ? 45   ARG B CD    1 
ATOM   998   N  NE    . ARG B 2 45  ? -37.920 -23.328 75.433 1.00 87.57  ? 45   ARG B NE    1 
ATOM   999   C  CZ    . ARG B 2 45  ? -37.301 -22.250 75.933 1.00 90.46  ? 45   ARG B CZ    1 
ATOM   1000  N  NH1   . ARG B 2 45  ? -36.077 -21.914 75.558 1.00 81.36  ? 45   ARG B NH1   1 
ATOM   1001  N  NH2   . ARG B 2 45  ? -37.909 -21.503 76.847 1.00 103.62 ? 45   ARG B NH2   1 
ATOM   1002  N  N     . ILE B 2 46  ? -37.671 -21.504 70.058 1.00 67.00  ? 46   ILE B N     1 
ATOM   1003  C  CA    . ILE B 2 46  ? -37.221 -20.295 69.378 1.00 60.02  ? 46   ILE B CA    1 
ATOM   1004  C  C     . ILE B 2 46  ? -37.142 -19.027 70.253 1.00 57.93  ? 46   ILE B C     1 
ATOM   1005  O  O     . ILE B 2 46  ? -38.134 -18.477 70.644 1.00 70.77  ? 46   ILE B O     1 
ATOM   1006  C  CB    . ILE B 2 46  ? -38.162 -20.019 68.197 1.00 58.52  ? 46   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B 2 46  ? -38.174 -21.207 67.232 1.00 57.02  ? 46   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B 2 46  ? -37.767 -18.750 67.450 1.00 60.12  ? 46   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B 2 46  ? -39.317 -21.155 66.233 1.00 58.02  ? 46   ILE B CD1   1 
ATOM   1010  N  N     . SER B 2 47  ? -35.949 -18.524 70.496 1.00 63.78  ? 47   SER B N     1 
ATOM   1011  C  CA    . SER B 2 47  ? -35.764 -17.239 71.161 1.00 61.75  ? 47   SER B CA    1 
ATOM   1012  C  C     . SER B 2 47  ? -36.562 -16.149 70.500 1.00 58.87  ? 47   SER B C     1 
ATOM   1013  O  O     . SER B 2 47  ? -36.642 -16.089 69.310 1.00 58.33  ? 47   SER B O     1 
ATOM   1014  C  CB    . SER B 2 47  ? -34.283 -16.839 71.138 1.00 67.23  ? 47   SER B CB    1 
ATOM   1015  O  OG    . SER B 2 47  ? -34.084 -15.433 71.224 1.00 75.23  ? 47   SER B OG    1 
ATOM   1016  N  N     . GLY B 2 48  ? -37.098 -15.242 71.303 1.00 68.67  ? 48   GLY B N     1 
ATOM   1017  C  CA    . GLY B 2 48  ? -37.954 -14.162 70.824 1.00 61.50  ? 48   GLY B CA    1 
ATOM   1018  C  C     . GLY B 2 48  ? -37.240 -13.205 69.913 1.00 67.21  ? 48   GLY B C     1 
ATOM   1019  O  O     . GLY B 2 48  ? -37.888 -12.493 69.137 1.00 69.04  ? 48   GLY B O     1 
ATOM   1020  N  N     . LEU B 2 49  ? -35.904 -13.173 69.983 1.00 66.95  ? 49   LEU B N     1 
ATOM   1021  C  CA    . LEU B 2 49  ? -35.147 -12.196 69.190 1.00 68.35  ? 49   LEU B CA    1 
ATOM   1022  C  C     . LEU B 2 49  ? -34.928 -12.670 67.755 1.00 68.34  ? 49   LEU B C     1 
ATOM   1023  O  O     . LEU B 2 49  ? -34.489 -11.895 66.874 1.00 65.66  ? 49   LEU B O     1 
ATOM   1024  C  CB    . LEU B 2 49  ? -33.826 -11.868 69.866 1.00 70.09  ? 49   LEU B CB    1 
ATOM   1025  C  CG    . LEU B 2 49  ? -33.997 -11.120 71.209 1.00 67.34  ? 49   LEU B CG    1 
ATOM   1026  C  CD1   . LEU B 2 49  ? -32.930 -11.536 72.213 1.00 65.60  ? 49   LEU B CD1   1 
ATOM   1027  C  CD2   . LEU B 2 49  ? -33.993 -9.616  70.986 1.00 63.54  ? 49   LEU B CD2   1 
ATOM   1028  N  N     . ILE B 2 50  ? -35.283 -13.932 67.519 1.00 61.17  ? 50   ILE B N     1 
ATOM   1029  C  CA    . ILE B 2 50  ? -35.075 -14.554 66.219 1.00 64.32  ? 50   ILE B CA    1 
ATOM   1030  C  C     . ILE B 2 50  ? -35.843 -13.831 65.120 1.00 66.26  ? 50   ILE B C     1 
ATOM   1031  O  O     . ILE B 2 50  ? -35.364 -13.718 63.998 1.00 72.22  ? 50   ILE B O     1 
ATOM   1032  C  CB    . ILE B 2 50  ? -35.455 -16.048 66.252 1.00 62.94  ? 50   ILE B CB    1 
ATOM   1033  C  CG1   . ILE B 2 50  ? -34.457 -16.873 67.118 1.00 64.97  ? 50   ILE B CG1   1 
ATOM   1034  C  CG2   . ILE B 2 50  ? -35.512 -16.604 64.858 1.00 64.00  ? 50   ILE B CG2   1 
ATOM   1035  C  CD1   . ILE B 2 50  ? -33.053 -17.036 66.554 1.00 66.00  ? 50   ILE B CD1   1 
ATOM   1036  N  N     . TYR B 2 51  ? -37.010 -13.304 65.452 1.00 65.82  ? 51   TYR B N     1 
ATOM   1037  C  CA    . TYR B 2 51  ? -37.923 -12.840 64.427 1.00 62.06  ? 51   TYR B CA    1 
ATOM   1038  C  C     . TYR B 2 51  ? -37.308 -11.619 63.796 1.00 66.23  ? 51   TYR B C     1 
ATOM   1039  O  O     . TYR B 2 51  ? -37.280 -11.494 62.574 1.00 65.36  ? 51   TYR B O     1 
ATOM   1040  C  CB    . TYR B 2 51  ? -39.333 -12.620 64.999 1.00 61.71  ? 51   TYR B CB    1 
ATOM   1041  C  CG    . TYR B 2 51  ? -39.819 -13.864 65.737 1.00 56.17  ? 51   TYR B CG    1 
ATOM   1042  C  CD1   . TYR B 2 51  ? -40.320 -14.949 65.053 1.00 53.47  ? 51   TYR B CD1   1 
ATOM   1043  C  CD2   . TYR B 2 51  ? -39.713 -13.958 67.098 1.00 52.59  ? 51   TYR B CD2   1 
ATOM   1044  C  CE1   . TYR B 2 51  ? -40.712 -16.088 65.716 1.00 56.47  ? 51   TYR B CE1   1 
ATOM   1045  C  CE2   . TYR B 2 51  ? -40.104 -15.086 67.781 1.00 54.01  ? 51   TYR B CE2   1 
ATOM   1046  C  CZ    . TYR B 2 51  ? -40.603 -16.162 67.099 1.00 61.29  ? 51   TYR B CZ    1 
ATOM   1047  O  OH    . TYR B 2 51  ? -40.961 -17.334 67.806 1.00 60.06  ? 51   TYR B OH    1 
ATOM   1048  N  N     . GLU B 2 52  ? -36.747 -10.735 64.609 1.00 75.10  ? 52   GLU B N     1 
ATOM   1049  C  CA    . GLU B 2 52  ? -36.115 -9.553  64.016 1.00 78.73  ? 52   GLU B CA    1 
ATOM   1050  C  C     . GLU B 2 52  ? -34.874 -9.962  63.239 1.00 70.86  ? 52   GLU B C     1 
ATOM   1051  O  O     . GLU B 2 52  ? -34.671 -9.519  62.121 1.00 70.60  ? 52   GLU B O     1 
ATOM   1052  C  CB    . GLU B 2 52  ? -35.811 -8.462  65.054 1.00 77.34  ? 52   GLU B CB    1 
ATOM   1053  C  CG    . GLU B 2 52  ? -37.007 -7.560  65.365 1.00 79.85  ? 52   GLU B CG    1 
ATOM   1054  C  CD    . GLU B 2 52  ? -37.608 -6.880  64.122 1.00 87.90  ? 52   GLU B CD    1 
ATOM   1055  O  OE1   . GLU B 2 52  ? -36.978 -5.955  63.577 1.00 90.26  ? 52   GLU B OE1   1 
ATOM   1056  O  OE2   . GLU B 2 52  ? -38.717 -7.258  63.669 1.00 88.52  ? 52   GLU B OE2   1 
ATOM   1057  N  N     . GLU B 2 53  ? -34.086 -10.860 63.805 1.00 65.62  ? 53   GLU B N     1 
ATOM   1058  C  CA    . GLU B 2 53  ? -32.889 -11.325 63.111 1.00 64.74  ? 53   GLU B CA    1 
ATOM   1059  C  C     . GLU B 2 53  ? -33.240 -11.901 61.728 1.00 61.27  ? 53   GLU B C     1 
ATOM   1060  O  O     . GLU B 2 53  ? -32.677 -11.493 60.701 1.00 59.35  ? 53   GLU B O     1 
ATOM   1061  C  CB    . GLU B 2 53  ? -32.149 -12.348 63.970 1.00 62.42  ? 53   GLU B CB    1 
ATOM   1062  C  CG    . GLU B 2 53  ? -30.740 -12.664 63.499 1.00 67.99  ? 53   GLU B CG    1 
ATOM   1063  C  CD    . GLU B 2 53  ? -29.727 -11.547 63.772 1.00 79.81  ? 53   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B 2 53  ? -29.916 -10.760 64.742 1.00 72.07  ? 53   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B 2 53  ? -28.715 -11.471 63.017 1.00 76.67  ? 53   GLU B OE2   1 
ATOM   1066  N  N     . THR B 2 54  ? -34.206 -12.805 61.708 1.00 55.27  ? 54   THR B N     1 
ATOM   1067  C  CA    . THR B 2 54  ? -34.610 -13.435 60.484 1.00 58.70  ? 54   THR B CA    1 
ATOM   1068  C  C     . THR B 2 54  ? -35.069 -12.445 59.421 1.00 60.76  ? 54   THR B C     1 
ATOM   1069  O  O     . THR B 2 54  ? -34.737 -12.575 58.227 1.00 61.11  ? 54   THR B O     1 
ATOM   1070  C  CB    . THR B 2 54  ? -35.732 -14.439 60.737 1.00 63.53  ? 54   THR B CB    1 
ATOM   1071  O  OG1   . THR B 2 54  ? -35.263 -15.493 61.598 1.00 58.85  ? 54   THR B OG1   1 
ATOM   1072  C  CG2   . THR B 2 54  ? -36.217 -15.049 59.429 1.00 63.47  ? 54   THR B CG2   1 
ATOM   1073  N  N     . ARG B 2 55  ? -35.817 -11.443 59.834 1.00 62.06  ? 55   ARG B N     1 
ATOM   1074  C  CA    . ARG B 2 55  ? -36.240 -10.437 58.857 1.00 66.31  ? 55   ARG B CA    1 
ATOM   1075  C  C     . ARG B 2 55  ? -35.019 -9.754  58.253 1.00 63.63  ? 55   ARG B C     1 
ATOM   1076  O  O     . ARG B 2 55  ? -34.977 -9.505  57.037 1.00 62.84  ? 55   ARG B O     1 
ATOM   1077  C  CB    . ARG B 2 55  ? -37.200 -9.426  59.477 1.00 71.17  ? 55   ARG B CB    1 
ATOM   1078  C  CG    . ARG B 2 55  ? -38.534 -10.047 59.910 1.00 76.43  ? 55   ARG B CG    1 
ATOM   1079  C  CD    . ARG B 2 55  ? -39.530 -9.010  60.453 1.00 82.32  ? 55   ARG B CD    1 
ATOM   1080  N  NE    . ARG B 2 55  ? -40.721 -9.648  61.009 1.00 69.39  ? 55   ARG B NE    1 
ATOM   1081  C  CZ    . ARG B 2 55  ? -40.922 -9.914  62.297 1.00 67.48  ? 55   ARG B CZ    1 
ATOM   1082  N  NH1   . ARG B 2 55  ? -40.034 -9.570  63.242 1.00 67.33  ? 55   ARG B NH1   1 
ATOM   1083  N  NH2   . ARG B 2 55  ? -42.036 -10.555 62.644 1.00 68.65  ? 55   ARG B NH2   1 
ATOM   1084  N  N     . GLY B 2 56  ? -34.011 -9.496  59.084 1.00 58.13  ? 56   GLY B N     1 
ATOM   1085  C  CA    . GLY B 2 56  ? -32.816 -8.818  58.609 1.00 61.07  ? 56   GLY B CA    1 
ATOM   1086  C  C     . GLY B 2 56  ? -32.120 -9.633  57.537 1.00 61.65  ? 56   GLY B C     1 
ATOM   1087  O  O     . GLY B 2 56  ? -31.756 -9.135  56.457 1.00 60.59  ? 56   GLY B O     1 
ATOM   1088  N  N     . VAL B 2 57  ? -31.950 -10.905 57.854 1.00 55.33  ? 57   VAL B N     1 
ATOM   1089  C  CA    . VAL B 2 57  ? -31.353 -11.846 56.944 1.00 55.67  ? 57   VAL B CA    1 
ATOM   1090  C  C     . VAL B 2 57  ? -32.157 -11.952 55.638 1.00 56.58  ? 57   VAL B C     1 
ATOM   1091  O  O     . VAL B 2 57  ? -31.591 -12.002 54.544 1.00 56.41  ? 57   VAL B O     1 
ATOM   1092  C  CB    . VAL B 2 57  ? -31.275 -13.233 57.618 1.00 56.95  ? 57   VAL B CB    1 
ATOM   1093  C  CG1   . VAL B 2 57  ? -31.089 -14.321 56.582 1.00 62.38  ? 57   VAL B CG1   1 
ATOM   1094  C  CG2   . VAL B 2 57  ? -30.137 -13.287 58.630 1.00 52.91  ? 57   VAL B CG2   1 
ATOM   1095  N  N     . LEU B 2 58  ? -33.479 -12.012 55.747 1.00 55.06  ? 58   LEU B N     1 
ATOM   1096  C  CA    . LEU B 2 58  ? -34.296 -12.135 54.547 1.00 54.59  ? 58   LEU B CA    1 
ATOM   1097  C  C     . LEU B 2 58  ? -34.184 -10.901 53.670 1.00 59.60  ? 58   LEU B C     1 
ATOM   1098  O  O     . LEU B 2 58  ? -34.191 -10.969 52.419 1.00 57.90  ? 58   LEU B O     1 
ATOM   1099  C  CB    . LEU B 2 58  ? -35.740 -12.362 54.930 1.00 53.14  ? 58   LEU B CB    1 
ATOM   1100  C  CG    . LEU B 2 58  ? -36.737 -12.283 53.771 1.00 54.34  ? 58   LEU B CG    1 
ATOM   1101  C  CD1   . LEU B 2 58  ? -36.459 -13.215 52.605 1.00 52.29  ? 58   LEU B CD1   1 
ATOM   1102  C  CD2   . LEU B 2 58  ? -38.121 -12.547 54.321 1.00 58.91  ? 58   LEU B CD2   1 
ATOM   1103  N  N     . LYS B 2 59  ? -34.095 -9.757  54.330 1.00 59.85  ? 59   LYS B N     1 
ATOM   1104  C  CA    . LYS B 2 59  ? -33.993 -8.526  53.602 1.00 62.11  ? 59   LYS B CA    1 
ATOM   1105  C  C     . LYS B 2 59  ? -32.685 -8.481  52.829 1.00 62.71  ? 59   LYS B C     1 
ATOM   1106  O  O     . LYS B 2 59  ? -32.673 -7.974  51.707 1.00 67.43  ? 59   LYS B O     1 
ATOM   1107  C  CB    . LYS B 2 59  ? -34.109 -7.352  54.546 1.00 68.01  ? 59   LYS B CB    1 
ATOM   1108  C  CG    . LYS B 2 59  ? -34.009 -5.988  53.883 1.00 73.82  ? 59   LYS B CG    1 
ATOM   1109  C  CD    . LYS B 2 59  ? -34.535 -4.894  54.820 1.00 78.37  ? 59   LYS B CD    1 
ATOM   1110  C  CE    . LYS B 2 59  ? -34.176 -3.493  54.342 1.00 78.88  ? 59   LYS B CE    1 
ATOM   1111  N  NZ    . LYS B 2 59  ? -32.859 -3.069  54.892 1.00 76.79  ? 59   LYS B NZ    1 
ATOM   1112  N  N     . VAL B 2 60  ? -31.592 -9.007  53.399 1.00 55.22  ? 60   VAL B N     1 
ATOM   1113  C  CA    . VAL B 2 60  ? -30.307 -8.960  52.684 1.00 50.92  ? 60   VAL B CA    1 
ATOM   1114  C  C     . VAL B 2 60  ? -30.367 -9.910  51.505 1.00 48.93  ? 60   VAL B C     1 
ATOM   1115  O  O     . VAL B 2 60  ? -29.808 -9.643  50.447 1.00 46.99  ? 60   VAL B O     1 
ATOM   1116  C  CB    . VAL B 2 60  ? -29.147 -9.405  53.551 1.00 51.07  ? 60   VAL B CB    1 
ATOM   1117  C  CG1   . VAL B 2 60  ? -27.942 -9.625  52.681 1.00 55.60  ? 60   VAL B CG1   1 
ATOM   1118  C  CG2   . VAL B 2 60  ? -28.811 -8.381  54.609 1.00 55.58  ? 60   VAL B CG2   1 
ATOM   1119  N  N     . PHE B 2 61  ? -31.052 -11.029 51.704 1.00 48.56  ? 61   PHE B N     1 
ATOM   1120  C  CA    . PHE B 2 61  ? -31.182 -12.023 50.661 1.00 52.20  ? 61   PHE B CA    1 
ATOM   1121  C  C     . PHE B 2 61  ? -31.877 -11.393 49.482 1.00 54.70  ? 61   PHE B C     1 
ATOM   1122  O  O     . PHE B 2 61  ? -31.352 -11.344 48.380 1.00 60.48  ? 61   PHE B O     1 
ATOM   1123  C  CB    . PHE B 2 61  ? -31.950 -13.250 51.166 1.00 53.11  ? 61   PHE B CB    1 
ATOM   1124  C  CG    . PHE B 2 61  ? -32.078 -14.358 50.137 1.00 57.69  ? 61   PHE B CG    1 
ATOM   1125  C  CD1   . PHE B 2 61  ? -31.063 -15.288 49.934 1.00 53.85  ? 61   PHE B CD1   1 
ATOM   1126  C  CD2   . PHE B 2 61  ? -33.228 -14.492 49.390 1.00 61.15  ? 61   PHE B CD2   1 
ATOM   1127  C  CE1   . PHE B 2 61  ? -31.190 -16.307 48.998 1.00 47.97  ? 61   PHE B CE1   1 
ATOM   1128  C  CE2   . PHE B 2 61  ? -33.351 -15.518 48.453 1.00 58.86  ? 61   PHE B CE2   1 
ATOM   1129  C  CZ    . PHE B 2 61  ? -32.329 -16.409 48.248 1.00 49.97  ? 61   PHE B CZ    1 
ATOM   1130  N  N     . LEU B 2 62  ? -33.045 -10.843 49.730 1.00 58.30  ? 62   LEU B N     1 
ATOM   1131  C  CA    . LEU B 2 62  ? -33.815 -10.308 48.637 1.00 58.88  ? 62   LEU B CA    1 
ATOM   1132  C  C     . LEU B 2 62  ? -33.090 -9.164  47.968 1.00 56.04  ? 62   LEU B C     1 
ATOM   1133  O  O     . LEU B 2 62  ? -33.086 -9.066  46.755 1.00 60.21  ? 62   LEU B O     1 
ATOM   1134  C  CB    . LEU B 2 62  ? -35.197 -9.879  49.121 1.00 60.76  ? 62   LEU B CB    1 
ATOM   1135  C  CG    . LEU B 2 62  ? -36.055 -11.090 49.476 1.00 61.29  ? 62   LEU B CG    1 
ATOM   1136  C  CD1   . LEU B 2 62  ? -37.327 -10.631 50.133 1.00 65.99  ? 62   LEU B CD1   1 
ATOM   1137  C  CD2   . LEU B 2 62  ? -36.384 -11.908 48.237 1.00 62.61  ? 62   LEU B CD2   1 
ATOM   1138  N  N     . GLU B 2 63  ? -32.473 -8.290  48.742 1.00 52.95  ? 63   GLU B N     1 
ATOM   1139  C  CA    . GLU B 2 63  ? -31.735 -7.212  48.126 1.00 52.13  ? 63   GLU B CA    1 
ATOM   1140  C  C     . GLU B 2 63  ? -30.796 -7.791  47.080 1.00 54.54  ? 63   GLU B C     1 
ATOM   1141  O  O     . GLU B 2 63  ? -30.870 -7.410  45.882 1.00 50.76  ? 63   GLU B O     1 
ATOM   1142  C  CB    . GLU B 2 63  ? -30.968 -6.414  49.165 1.00 54.06  ? 63   GLU B CB    1 
ATOM   1143  C  CG    . GLU B 2 63  ? -31.847 -5.449  49.916 1.00 59.89  ? 63   GLU B CG    1 
ATOM   1144  C  CD    . GLU B 2 63  ? -31.261 -4.927  51.222 1.00 70.18  ? 63   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B 2 63  ? -30.031 -5.056  51.467 1.00 73.56  ? 63   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B 2 63  ? -32.058 -4.347  52.001 1.00 72.46  ? 63   GLU B OE2   1 
ATOM   1147  N  N     . ASN B 2 64  ? -29.957 -8.746  47.512 1.00 54.92  ? 64   ASN B N     1 
ATOM   1148  C  CA    . ASN B 2 64  ? -28.853 -9.199  46.660 1.00 55.04  ? 64   ASN B CA    1 
ATOM   1149  C  C     . ASN B 2 64  ? -29.355 -9.792  45.380 1.00 56.37  ? 64   ASN B C     1 
ATOM   1150  O  O     . ASN B 2 64  ? -28.802 -9.509  44.300 1.00 57.03  ? 64   ASN B O     1 
ATOM   1151  C  CB    . ASN B 2 64  ? -27.941 -10.166 47.372 1.00 54.75  ? 64   ASN B CB    1 
ATOM   1152  C  CG    . ASN B 2 64  ? -27.092 -9.490  48.422 1.00 57.18  ? 64   ASN B CG    1 
ATOM   1153  O  OD1   . ASN B 2 64  ? -26.476 -8.479  48.174 1.00 75.93  ? 64   ASN B OD1   1 
ATOM   1154  N  ND2   . ASN B 2 64  ? -27.051 -10.048 49.594 1.00 63.85  ? 64   ASN B ND2   1 
ATOM   1155  N  N     . VAL B 2 65  ? -30.437 -10.558 45.509 1.00 51.17  ? 65   VAL B N     1 
ATOM   1156  C  CA    . VAL B 2 65  ? -31.013 -11.241 44.386 1.00 53.22  ? 65   VAL B CA    1 
ATOM   1157  C  C     . VAL B 2 65  ? -31.760 -10.304 43.463 1.00 56.85  ? 65   VAL B C     1 
ATOM   1158  O  O     . VAL B 2 65  ? -31.563 -10.346 42.243 1.00 55.11  ? 65   VAL B O     1 
ATOM   1159  C  CB    . VAL B 2 65  ? -31.994 -12.295 44.842 1.00 55.22  ? 65   VAL B CB    1 
ATOM   1160  C  CG1   . VAL B 2 65  ? -32.538 -13.025 43.631 1.00 56.50  ? 65   VAL B CG1   1 
ATOM   1161  C  CG2   . VAL B 2 65  ? -31.283 -13.277 45.742 1.00 62.02  ? 65   VAL B CG2   1 
ATOM   1162  N  N     . ILE B 2 66  ? -32.639 -9.498  44.055 1.00 58.83  ? 66   ILE B N     1 
ATOM   1163  C  CA    . ILE B 2 66  ? -33.450 -8.540  43.323 1.00 58.42  ? 66   ILE B CA    1 
ATOM   1164  C  C     . ILE B 2 66  ? -32.544 -7.547  42.600 1.00 60.55  ? 66   ILE B C     1 
ATOM   1165  O  O     . ILE B 2 66  ? -32.709 -7.296  41.398 1.00 55.45  ? 66   ILE B O     1 
ATOM   1166  C  CB    . ILE B 2 66  ? -34.418 -7.806  44.268 1.00 62.61  ? 66   ILE B CB    1 
ATOM   1167  C  CG1   . ILE B 2 66  ? -35.552 -8.744  44.646 1.00 61.47  ? 66   ILE B CG1   1 
ATOM   1168  C  CG2   . ILE B 2 66  ? -35.020 -6.571  43.598 1.00 70.50  ? 66   ILE B CG2   1 
ATOM   1169  C  CD1   . ILE B 2 66  ? -36.377 -8.283  45.821 1.00 59.89  ? 66   ILE B CD1   1 
ATOM   1170  N  N     . ARG B 2 67  ? -31.563 -7.002  43.312 1.00 59.12  ? 67   ARG B N     1 
ATOM   1171  C  CA    . ARG B 2 67  ? -30.610 -6.119  42.642 1.00 61.45  ? 67   ARG B CA    1 
ATOM   1172  C  C     . ARG B 2 67  ? -30.148 -6.722  41.314 1.00 55.06  ? 67   ARG B C     1 
ATOM   1173  O  O     . ARG B 2 67  ? -30.202 -6.078  40.292 1.00 56.71  ? 67   ARG B O     1 
ATOM   1174  C  CB    . ARG B 2 67  ? -29.420 -5.806  43.546 1.00 65.69  ? 67   ARG B CB    1 
ATOM   1175  C  CG    . ARG B 2 67  ? -28.341 -4.945  42.895 1.00 72.82  ? 67   ARG B CG    1 
ATOM   1176  C  CD    . ARG B 2 67  ? -27.049 -4.933  43.731 1.00 84.26  ? 67   ARG B CD    1 
ATOM   1177  N  NE    . ARG B 2 67  ? -27.163 -4.240  45.033 1.00 83.72  ? 67   ARG B NE    1 
ATOM   1178  C  CZ    . ARG B 2 67  ? -26.984 -4.800  46.233 1.00 84.13  ? 67   ARG B CZ    1 
ATOM   1179  N  NH1   . ARG B 2 67  ? -26.683 -6.086  46.363 1.00 91.60  ? 67   ARG B NH1   1 
ATOM   1180  N  NH2   . ARG B 2 67  ? -27.090 -4.059  47.323 1.00 82.82  ? 67   ARG B NH2   1 
ATOM   1181  N  N     . ASP B 2 68  ? -29.731 -7.978  41.352 1.00 58.81  ? 68   ASP B N     1 
ATOM   1182  C  CA    . ASP B 2 68  ? -29.168 -8.617  40.185 1.00 60.09  ? 68   ASP B CA    1 
ATOM   1183  C  C     . ASP B 2 68  ? -30.250 -8.818  39.151 1.00 62.40  ? 68   ASP B C     1 
ATOM   1184  O  O     . ASP B 2 68  ? -29.989 -8.608  37.987 1.00 66.77  ? 68   ASP B O     1 
ATOM   1185  C  CB    . ASP B 2 68  ? -28.501 -9.954  40.532 1.00 59.57  ? 68   ASP B CB    1 
ATOM   1186  C  CG    . ASP B 2 68  ? -27.088 -9.795  41.087 1.00 63.20  ? 68   ASP B CG    1 
ATOM   1187  O  OD1   . ASP B 2 68  ? -26.767 -8.782  41.754 1.00 70.13  ? 68   ASP B OD1   1 
ATOM   1188  O  OD2   . ASP B 2 68  ? -26.271 -10.710 40.872 1.00 65.25  ? 68   ASP B OD2   1 
ATOM   1189  N  N     . ALA B 2 69  ? -31.455 -9.215  39.568 1.00 63.03  ? 69   ALA B N     1 
ATOM   1190  C  CA    . ALA B 2 69  ? -32.594 -9.466  38.628 1.00 64.32  ? 69   ALA B CA    1 
ATOM   1191  C  C     . ALA B 2 69  ? -32.988 -8.218  37.852 1.00 61.34  ? 69   ALA B C     1 
ATOM   1192  O  O     . ALA B 2 69  ? -33.042 -8.200  36.627 1.00 58.04  ? 69   ALA B O     1 
ATOM   1193  C  CB    . ALA B 2 69  ? -33.811 -9.964  39.394 1.00 62.20  ? 69   ALA B CB    1 
ATOM   1194  N  N     . VAL B 2 70  ? -33.242 -7.161  38.602 1.00 63.89  ? 70   VAL B N     1 
ATOM   1195  C  CA    . VAL B 2 70  ? -33.512 -5.865  38.023 1.00 60.83  ? 70   VAL B CA    1 
ATOM   1196  C  C     . VAL B 2 70  ? -32.396 -5.472  37.055 1.00 60.07  ? 70   VAL B C     1 
ATOM   1197  O  O     . VAL B 2 70  ? -32.665 -5.024  35.966 1.00 63.97  ? 70   VAL B O     1 
ATOM   1198  C  CB    . VAL B 2 70  ? -33.675 -4.843  39.127 1.00 60.01  ? 70   VAL B CB    1 
ATOM   1199  C  CG1   . VAL B 2 70  ? -33.781 -3.449  38.562 1.00 64.71  ? 70   VAL B CG1   1 
ATOM   1200  C  CG2   . VAL B 2 70  ? -34.919 -5.180  39.929 1.00 65.44  ? 70   VAL B CG2   1 
ATOM   1201  N  N     . THR B 2 71  ? -31.147 -5.699  37.418 1.00 59.60  ? 71   THR B N     1 
ATOM   1202  C  CA    . THR B 2 71  ? -30.063 -5.365  36.520 1.00 55.38  ? 71   THR B CA    1 
ATOM   1203  C  C     . THR B 2 71  ? -30.202 -6.065  35.204 1.00 57.60  ? 71   THR B C     1 
ATOM   1204  O  O     . THR B 2 71  ? -29.771 -5.569  34.187 1.00 56.80  ? 71   THR B O     1 
ATOM   1205  C  CB    . THR B 2 71  ? -28.739 -5.752  37.116 1.00 54.84  ? 71   THR B CB    1 
ATOM   1206  O  OG1   . THR B 2 71  ? -28.620 -5.141  38.412 1.00 59.20  ? 71   THR B OG1   1 
ATOM   1207  C  CG2   . THR B 2 71  ? -27.618 -5.297  36.202 1.00 57.69  ? 71   THR B CG2   1 
ATOM   1208  N  N     . TYR B 2 72  ? -30.796 -7.241  35.230 1.00 64.14  ? 72   TYR B N     1 
ATOM   1209  C  CA    . TYR B 2 72  ? -31.072 -7.963  34.006 1.00 66.70  ? 72   TYR B CA    1 
ATOM   1210  C  C     . TYR B 2 72  ? -32.183 -7.291  33.236 1.00 68.65  ? 72   TYR B C     1 
ATOM   1211  O  O     . TYR B 2 72  ? -32.075 -7.125  32.033 1.00 62.17  ? 72   TYR B O     1 
ATOM   1212  C  CB    . TYR B 2 72  ? -31.458 -9.401  34.320 1.00 64.71  ? 72   TYR B CB    1 
ATOM   1213  C  CG    . TYR B 2 72  ? -30.259 -10.273 34.586 1.00 61.45  ? 72   TYR B CG    1 
ATOM   1214  C  CD1   . TYR B 2 72  ? -30.077 -10.897 35.804 1.00 55.76  ? 72   TYR B CD1   1 
ATOM   1215  C  CD2   . TYR B 2 72  ? -29.307 -10.479 33.590 1.00 59.06  ? 72   TYR B CD2   1 
ATOM   1216  C  CE1   . TYR B 2 72  ? -28.973 -11.703 36.016 1.00 56.58  ? 72   TYR B CE1   1 
ATOM   1217  C  CE2   . TYR B 2 72  ? -28.231 -11.294 33.794 1.00 57.69  ? 72   TYR B CE2   1 
ATOM   1218  C  CZ    . TYR B 2 72  ? -28.070 -11.897 35.012 1.00 53.34  ? 72   TYR B CZ    1 
ATOM   1219  O  OH    . TYR B 2 72  ? -26.981 -12.674 35.193 1.00 56.33  ? 72   TYR B OH    1 
ATOM   1220  N  N     . THR B 2 73  ? -33.242 -6.924  33.960 1.00 70.43  ? 73   THR B N     1 
ATOM   1221  C  CA    . THR B 2 73  ? -34.387 -6.210  33.412 1.00 69.72  ? 73   THR B CA    1 
ATOM   1222  C  C     . THR B 2 73  ? -33.963 -4.942  32.656 1.00 73.30  ? 73   THR B C     1 
ATOM   1223  O  O     . THR B 2 73  ? -34.207 -4.824  31.451 1.00 78.51  ? 73   THR B O     1 
ATOM   1224  C  CB    . THR B 2 73  ? -35.354 -5.812  34.526 1.00 63.77  ? 73   THR B CB    1 
ATOM   1225  O  OG1   . THR B 2 73  ? -35.632 -6.944  35.337 1.00 65.48  ? 73   THR B OG1   1 
ATOM   1226  C  CG2   . THR B 2 73  ? -36.638 -5.343  33.954 1.00 70.03  ? 73   THR B CG2   1 
ATOM   1227  N  N     . GLU B 2 74  ? -33.329 -4.012  33.368 1.00 70.46  ? 74   GLU B N     1 
ATOM   1228  C  CA    . GLU B 2 74  ? -32.732 -2.814  32.773 1.00 75.65  ? 74   GLU B CA    1 
ATOM   1229  C  C     . GLU B 2 74  ? -31.918 -3.158  31.532 1.00 77.61  ? 74   GLU B C     1 
ATOM   1230  O  O     . GLU B 2 74  ? -31.928 -2.417  30.544 1.00 81.51  ? 74   GLU B O     1 
ATOM   1231  C  CB    . GLU B 2 74  ? -31.819 -2.061  33.768 1.00 81.79  ? 74   GLU B CB    1 
ATOM   1232  C  CG    . GLU B 2 74  ? -32.515 -1.022  34.656 1.00 96.24  ? 74   GLU B CG    1 
ATOM   1233  C  CD    . GLU B 2 74  ? -31.638 -0.447  35.782 1.00 112.14 ? 74   GLU B CD    1 
ATOM   1234  O  OE1   . GLU B 2 74  ? -32.150 0.395   36.552 1.00 128.61 ? 74   GLU B OE1   1 
ATOM   1235  O  OE2   . GLU B 2 74  ? -30.448 -0.824  35.927 1.00 116.86 ? 74   GLU B OE2   1 
ATOM   1236  N  N     . HIS B 2 75  ? -31.204 -4.271  31.554 1.00 71.35  ? 75   HIS B N     1 
ATOM   1237  C  CA    . HIS B 2 75  ? -30.381 -4.553  30.392 1.00 72.24  ? 75   HIS B CA    1 
ATOM   1238  C  C     . HIS B 2 75  ? -31.250 -4.886  29.196 1.00 72.23  ? 75   HIS B C     1 
ATOM   1239  O  O     . HIS B 2 75  ? -30.951 -4.507  28.087 1.00 76.60  ? 75   HIS B O     1 
ATOM   1240  C  CB    . HIS B 2 75  ? -29.391 -5.669  30.645 1.00 65.58  ? 75   HIS B CB    1 
ATOM   1241  C  CG    . HIS B 2 75  ? -28.469 -5.894  29.503 1.00 59.21  ? 75   HIS B CG    1 
ATOM   1242  N  ND1   . HIS B 2 75  ? -27.298 -5.194  29.351 1.00 65.22  ? 75   HIS B ND1   1 
ATOM   1243  C  CD2   . HIS B 2 75  ? -28.552 -6.720  28.440 1.00 61.72  ? 75   HIS B CD2   1 
ATOM   1244  C  CE1   . HIS B 2 75  ? -26.682 -5.591  28.250 1.00 63.67  ? 75   HIS B CE1   1 
ATOM   1245  N  NE2   . HIS B 2 75  ? -27.430 -6.509  27.671 1.00 60.67  ? 75   HIS B NE2   1 
ATOM   1246  N  N     . ALA B 2 76  ? -32.334 -5.598  29.443 1.00 77.83  ? 76   ALA B N     1 
ATOM   1247  C  CA    . ALA B 2 76  ? -33.228 -6.035  28.395 1.00 76.67  ? 76   ALA B CA    1 
ATOM   1248  C  C     . ALA B 2 76  ? -34.182 -4.887  28.014 1.00 86.01  ? 76   ALA B C     1 
ATOM   1249  O  O     . ALA B 2 76  ? -35.163 -5.092  27.285 1.00 77.77  ? 76   ALA B O     1 
ATOM   1250  C  CB    . ALA B 2 76  ? -34.010 -7.236  28.887 1.00 73.94  ? 76   ALA B CB    1 
ATOM   1251  N  N     . LYS B 2 77  ? -33.889 -3.682  28.512 1.00 78.19  ? 77   LYS B N     1 
ATOM   1252  C  CA    . LYS B 2 77  ? -34.731 -2.520  28.286 1.00 79.26  ? 77   LYS B CA    1 
ATOM   1253  C  C     . LYS B 2 77  ? -36.212 -2.807  28.578 1.00 74.08  ? 77   LYS B C     1 
ATOM   1254  O  O     . LYS B 2 77  ? -37.075 -2.405  27.822 1.00 77.33  ? 77   LYS B O     1 
ATOM   1255  C  CB    . LYS B 2 77  ? -34.541 -2.013  26.856 1.00 77.97  ? 77   LYS B CB    1 
ATOM   1256  C  CG    . LYS B 2 77  ? -33.120 -1.581  26.538 1.00 87.40  ? 77   LYS B CG    1 
ATOM   1257  C  CD    . LYS B 2 77  ? -32.842 -1.648  25.039 1.00 98.90  ? 77   LYS B CD    1 
ATOM   1258  C  CE    . LYS B 2 77  ? -31.396 -1.279  24.707 1.00 106.64 ? 77   LYS B CE    1 
ATOM   1259  N  NZ    . LYS B 2 77  ? -31.110 -1.276  23.236 1.00 113.64 ? 77   LYS B NZ    1 
ATOM   1260  N  N     . ARG B 2 78  ? -36.504 -3.508  29.666 1.00 65.43  ? 78   ARG B N     1 
ATOM   1261  C  CA    . ARG B 2 78  ? -37.881 -3.811  30.019 1.00 71.99  ? 78   ARG B CA    1 
ATOM   1262  C  C     . ARG B 2 78  ? -38.271 -3.047  31.280 1.00 73.35  ? 78   ARG B C     1 
ATOM   1263  O  O     . ARG B 2 78  ? -37.448 -2.362  31.869 1.00 74.13  ? 78   ARG B O     1 
ATOM   1264  C  CB    . ARG B 2 78  ? -38.083 -5.324  30.208 1.00 80.55  ? 78   ARG B CB    1 
ATOM   1265  C  CG    . ARG B 2 78  ? -38.099 -6.146  28.922 1.00 79.25  ? 78   ARG B CG    1 
ATOM   1266  C  CD    . ARG B 2 78  ? -38.419 -7.630  29.163 1.00 82.77  ? 78   ARG B CD    1 
ATOM   1267  N  NE    . ARG B 2 78  ? -37.226 -8.397  29.519 1.00 83.64  ? 78   ARG B NE    1 
ATOM   1268  C  CZ    . ARG B 2 78  ? -36.835 -8.668  30.760 1.00 86.46  ? 78   ARG B CZ    1 
ATOM   1269  N  NH1   . ARG B 2 78  ? -37.554 -8.279  31.820 1.00 87.11  ? 78   ARG B NH1   1 
ATOM   1270  N  NH2   . ARG B 2 78  ? -35.717 -9.350  30.936 1.00 83.00  ? 78   ARG B NH2   1 
ATOM   1271  N  N     . LYS B 2 79  ? -39.546 -3.114  31.647 1.00 78.52  ? 79   LYS B N     1 
ATOM   1272  C  CA    . LYS B 2 79  ? -40.058 -2.483  32.861 1.00 81.44  ? 79   LYS B CA    1 
ATOM   1273  C  C     . LYS B 2 79  ? -40.681 -3.526  33.757 1.00 85.68  ? 79   LYS B C     1 
ATOM   1274  O  O     . LYS B 2 79  ? -41.231 -3.201  34.825 1.00 86.69  ? 79   LYS B O     1 
ATOM   1275  C  CB    . LYS B 2 79  ? -41.130 -1.460  32.517 1.00 89.15  ? 79   LYS B CB    1 
ATOM   1276  C  CG    . LYS B 2 79  ? -40.624 -0.206  31.819 1.00 97.98  ? 79   LYS B CG    1 
ATOM   1277  C  CD    . LYS B 2 79  ? -41.309 1.003   32.434 1.00 107.23 ? 79   LYS B CD    1 
ATOM   1278  C  CE    . LYS B 2 79  ? -41.175 2.231   31.577 1.00 115.75 ? 79   LYS B CE    1 
ATOM   1279  N  NZ    . LYS B 2 79  ? -42.030 3.291   32.171 1.00 125.56 ? 79   LYS B NZ    1 
ATOM   1280  N  N     . THR B 2 80  ? -40.604 -4.775  33.300 1.00 84.20  ? 80   THR B N     1 
ATOM   1281  C  CA    . THR B 2 80  ? -41.143 -5.917  34.008 1.00 82.06  ? 80   THR B CA    1 
ATOM   1282  C  C     . THR B 2 80  ? -39.997 -6.882  34.325 1.00 82.70  ? 80   THR B C     1 
ATOM   1283  O  O     . THR B 2 80  ? -39.226 -7.309  33.430 1.00 78.09  ? 80   THR B O     1 
ATOM   1284  C  CB    . THR B 2 80  ? -42.193 -6.684  33.175 1.00 83.15  ? 80   THR B CB    1 
ATOM   1285  O  OG1   . THR B 2 80  ? -42.982 -5.768  32.396 1.00 88.95  ? 80   THR B OG1   1 
ATOM   1286  C  CG2   . THR B 2 80  ? -43.080 -7.480  34.093 1.00 81.43  ? 80   THR B CG2   1 
ATOM   1287  N  N     . VAL B 2 81  ? -39.893 -7.216  35.603 1.00 74.63  ? 81   VAL B N     1 
ATOM   1288  C  CA    . VAL B 2 81  ? -39.002 -8.256  36.039 1.00 67.77  ? 81   VAL B CA    1 
ATOM   1289  C  C     . VAL B 2 81  ? -39.651 -9.567  35.652 1.00 65.96  ? 81   VAL B C     1 
ATOM   1290  O  O     . VAL B 2 81  ? -40.735 -9.874  36.153 1.00 66.50  ? 81   VAL B O     1 
ATOM   1291  C  CB    . VAL B 2 81  ? -38.844 -8.224  37.559 1.00 70.59  ? 81   VAL B CB    1 
ATOM   1292  C  CG1   . VAL B 2 81  ? -37.990 -9.391  38.016 1.00 79.09  ? 81   VAL B CG1   1 
ATOM   1293  C  CG2   . VAL B 2 81  ? -38.189 -6.933  37.990 1.00 71.07  ? 81   VAL B CG2   1 
ATOM   1294  N  N     . THR B 2 82  ? -39.012 -10.335 34.769 1.00 64.33  ? 82   THR B N     1 
ATOM   1295  C  CA    . THR B 2 82  ? -39.527 -11.655 34.389 1.00 63.90  ? 82   THR B CA    1 
ATOM   1296  C  C     . THR B 2 82  ? -39.007 -12.736 35.329 1.00 63.12  ? 82   THR B C     1 
ATOM   1297  O  O     . THR B 2 82  ? -38.010 -12.572 35.995 1.00 67.65  ? 82   THR B O     1 
ATOM   1298  C  CB    . THR B 2 82  ? -39.183 -12.001 32.925 1.00 71.45  ? 82   THR B CB    1 
ATOM   1299  O  OG1   . THR B 2 82  ? -37.771 -12.105 32.719 1.00 68.73  ? 82   THR B OG1   1 
ATOM   1300  C  CG2   . THR B 2 82  ? -39.677 -10.908 32.028 1.00 83.72  ? 82   THR B CG2   1 
ATOM   1301  N  N     . ALA B 2 83  ? -39.709 -13.844 35.404 1.00 68.26  ? 83   ALA B N     1 
ATOM   1302  C  CA    . ALA B 2 83  ? -39.206 -14.984 36.132 1.00 66.36  ? 83   ALA B CA    1 
ATOM   1303  C  C     . ALA B 2 83  ? -37.812 -15.366 35.652 1.00 60.87  ? 83   ALA B C     1 
ATOM   1304  O  O     . ALA B 2 83  ? -37.030 -15.768 36.473 1.00 66.28  ? 83   ALA B O     1 
ATOM   1305  C  CB    . ALA B 2 83  ? -40.150 -16.150 35.995 1.00 70.43  ? 83   ALA B CB    1 
ATOM   1306  N  N     . MET B 2 84  ? -37.481 -15.226 34.367 1.00 57.44  ? 84   MET B N     1 
ATOM   1307  C  CA    . MET B 2 84  ? -36.111 -15.544 33.919 1.00 60.12  ? 84   MET B CA    1 
ATOM   1308  C  C     . MET B 2 84  ? -35.120 -14.553 34.452 1.00 63.56  ? 84   MET B C     1 
ATOM   1309  O  O     . MET B 2 84  ? -33.950 -14.882 34.658 1.00 72.89  ? 84   MET B O     1 
ATOM   1310  C  CB    . MET B 2 84  ? -35.947 -15.550 32.409 1.00 62.44  ? 84   MET B CB    1 
ATOM   1311  C  CG    . MET B 2 84  ? -36.659 -16.689 31.715 1.00 70.64  ? 84   MET B CG    1 
ATOM   1312  S  SD    . MET B 2 84  ? -36.263 -18.274 32.437 1.00 77.24  ? 84   MET B SD    1 
ATOM   1313  C  CE    . MET B 2 84  ? -34.521 -18.416 31.985 1.00 77.78  ? 84   MET B CE    1 
ATOM   1314  N  N     . ASP B 2 85  ? -35.554 -13.327 34.652 1.00 57.69  ? 85   ASP B N     1 
ATOM   1315  C  CA    . ASP B 2 85  ? -34.670 -12.379 35.309 1.00 68.84  ? 85   ASP B CA    1 
ATOM   1316  C  C     . ASP B 2 85  ? -34.251 -12.924 36.690 1.00 67.64  ? 85   ASP B C     1 
ATOM   1317  O  O     . ASP B 2 85  ? -33.084 -12.841 37.078 1.00 74.12  ? 85   ASP B O     1 
ATOM   1318  C  CB    . ASP B 2 85  ? -35.325 -10.988 35.467 1.00 69.86  ? 85   ASP B CB    1 
ATOM   1319  C  CG    . ASP B 2 85  ? -35.249 -10.161 34.226 1.00 70.67  ? 85   ASP B CG    1 
ATOM   1320  O  OD1   . ASP B 2 85  ? -34.390 -10.451 33.368 1.00 81.56  ? 85   ASP B OD1   1 
ATOM   1321  O  OD2   . ASP B 2 85  ? -36.039 -9.207  34.118 1.00 74.14  ? 85   ASP B OD2   1 
ATOM   1322  N  N     . VAL B 2 86  ? -35.215 -13.461 37.423 1.00 59.46  ? 86   VAL B N     1 
ATOM   1323  C  CA    . VAL B 2 86  ? -34.975 -13.959 38.767 1.00 63.57  ? 86   VAL B CA    1 
ATOM   1324  C  C     . VAL B 2 86  ? -34.147 -15.240 38.750 1.00 64.39  ? 86   VAL B C     1 
ATOM   1325  O  O     . VAL B 2 86  ? -33.173 -15.403 39.486 1.00 65.93  ? 86   VAL B O     1 
ATOM   1326  C  CB    . VAL B 2 86  ? -36.301 -14.223 39.472 1.00 64.15  ? 86   VAL B CB    1 
ATOM   1327  C  CG1   . VAL B 2 86  ? -36.093 -15.054 40.708 1.00 66.23  ? 86   VAL B CG1   1 
ATOM   1328  C  CG2   . VAL B 2 86  ? -36.937 -12.900 39.841 1.00 70.24  ? 86   VAL B CG2   1 
ATOM   1329  N  N     . VAL B 2 87  ? -34.521 -16.135 37.868 1.00 58.80  ? 87   VAL B N     1 
ATOM   1330  C  CA    . VAL B 2 87  ? -33.799 -17.352 37.718 1.00 56.39  ? 87   VAL B CA    1 
ATOM   1331  C  C     . VAL B 2 87  ? -32.325 -17.140 37.400 1.00 57.33  ? 87   VAL B C     1 
ATOM   1332  O  O     . VAL B 2 87  ? -31.469 -17.772 38.000 1.00 61.99  ? 87   VAL B O     1 
ATOM   1333  C  CB    . VAL B 2 87  ? -34.464 -18.224 36.665 1.00 56.47  ? 87   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B 2 87  ? -33.586 -19.405 36.290 1.00 57.06  ? 87   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B 2 87  ? -35.775 -18.749 37.233 1.00 62.55  ? 87   VAL B CG2   1 
ATOM   1336  N  N     . TYR B 2 88  ? -32.024 -16.250 36.482 1.00 58.08  ? 88   TYR B N     1 
ATOM   1337  C  CA    . TYR B 2 88  ? -30.645 -15.972 36.178 1.00 60.01  ? 88   TYR B CA    1 
ATOM   1338  C  C     . TYR B 2 88  ? -29.899 -15.318 37.357 1.00 62.52  ? 88   TYR B C     1 
ATOM   1339  O  O     . TYR B 2 88  ? -28.673 -15.484 37.510 1.00 60.10  ? 88   TYR B O     1 
ATOM   1340  C  CB    . TYR B 2 88  ? -30.571 -15.051 34.974 1.00 68.80  ? 88   TYR B CB    1 
ATOM   1341  C  CG    . TYR B 2 88  ? -31.027 -15.640 33.657 1.00 69.59  ? 88   TYR B CG    1 
ATOM   1342  C  CD1   . TYR B 2 88  ? -31.626 -14.854 32.698 1.00 73.56  ? 88   TYR B CD1   1 
ATOM   1343  C  CD2   . TYR B 2 88  ? -30.825 -16.954 33.363 1.00 79.44  ? 88   TYR B CD2   1 
ATOM   1344  C  CE1   . TYR B 2 88  ? -32.025 -15.373 31.484 1.00 77.79  ? 88   TYR B CE1   1 
ATOM   1345  C  CE2   . TYR B 2 88  ? -31.219 -17.485 32.156 1.00 86.82  ? 88   TYR B CE2   1 
ATOM   1346  C  CZ    . TYR B 2 88  ? -31.816 -16.694 31.217 1.00 85.42  ? 88   TYR B CZ    1 
ATOM   1347  O  OH    . TYR B 2 88  ? -32.184 -17.282 30.025 1.00 89.11  ? 88   TYR B OH    1 
ATOM   1348  N  N     . ALA B 2 89  ? -30.623 -14.567 38.185 1.00 60.12  ? 89   ALA B N     1 
ATOM   1349  C  CA    . ALA B 2 89  ? -29.979 -13.861 39.302 1.00 60.64  ? 89   ALA B CA    1 
ATOM   1350  C  C     . ALA B 2 89  ? -29.623 -14.897 40.323 1.00 58.67  ? 89   ALA B C     1 
ATOM   1351  O  O     . ALA B 2 89  ? -28.503 -14.929 40.803 1.00 60.91  ? 89   ALA B O     1 
ATOM   1352  C  CB    . ALA B 2 89  ? -30.910 -12.837 39.923 1.00 64.10  ? 89   ALA B CB    1 
ATOM   1353  N  N     . LEU B 2 90  ? -30.590 -15.744 40.648 1.00 52.63  ? 90   LEU B N     1 
ATOM   1354  C  CA    . LEU B 2 90  ? -30.346 -16.856 41.540 1.00 53.71  ? 90   LEU B CA    1 
ATOM   1355  C  C     . LEU B 2 90  ? -29.162 -17.741 41.076 1.00 57.25  ? 90   LEU B C     1 
ATOM   1356  O  O     . LEU B 2 90  ? -28.389 -18.229 41.911 1.00 48.77  ? 90   LEU B O     1 
ATOM   1357  C  CB    . LEU B 2 90  ? -31.599 -17.697 41.668 1.00 52.45  ? 90   LEU B CB    1 
ATOM   1358  C  CG    . LEU B 2 90  ? -32.708 -17.032 42.469 1.00 56.18  ? 90   LEU B CG    1 
ATOM   1359  C  CD1   . LEU B 2 90  ? -34.056 -17.668 42.185 1.00 60.41  ? 90   LEU B CD1   1 
ATOM   1360  C  CD2   . LEU B 2 90  ? -32.439 -17.114 43.950 1.00 58.08  ? 90   LEU B CD2   1 
ATOM   1361  N  N     . LYS B 2 91  ? -29.003 -17.947 39.768 1.00 53.32  ? 91   LYS B N     1 
ATOM   1362  C  CA    . LYS B 2 91  ? -27.976 -18.862 39.344 1.00 53.45  ? 91   LYS B CA    1 
ATOM   1363  C  C     . LYS B 2 91  ? -26.635 -18.243 39.663 1.00 59.17  ? 91   LYS B C     1 
ATOM   1364  O  O     . LYS B 2 91  ? -25.771 -18.893 40.253 1.00 62.47  ? 91   LYS B O     1 
ATOM   1365  C  CB    . LYS B 2 91  ? -28.054 -19.222 37.876 1.00 53.12  ? 91   LYS B CB    1 
ATOM   1366  C  CG    . LYS B 2 91  ? -26.932 -20.160 37.457 1.00 56.63  ? 91   LYS B CG    1 
ATOM   1367  C  CD    . LYS B 2 91  ? -27.345 -21.193 36.423 1.00 66.48  ? 91   LYS B CD    1 
ATOM   1368  C  CE    . LYS B 2 91  ? -27.610 -20.564 35.059 1.00 81.28  ? 91   LYS B CE    1 
ATOM   1369  N  NZ    . LYS B 2 91  ? -28.306 -21.528 34.144 1.00 95.45  ? 91   LYS B NZ    1 
ATOM   1370  N  N     . ARG B 2 92  ? -26.435 -16.989 39.300 1.00 58.41  ? 92   ARG B N     1 
ATOM   1371  C  CA    . ARG B 2 92  ? -25.133 -16.396 39.608 1.00 58.13  ? 92   ARG B CA    1 
ATOM   1372  C  C     . ARG B 2 92  ? -24.909 -16.148 41.095 1.00 58.52  ? 92   ARG B C     1 
ATOM   1373  O  O     . ARG B 2 92  ? -23.742 -16.106 41.511 1.00 59.18  ? 92   ARG B O     1 
ATOM   1374  C  CB    . ARG B 2 92  ? -24.871 -15.121 38.829 1.00 57.56  ? 92   ARG B CB    1 
ATOM   1375  C  CG    . ARG B 2 92  ? -25.762 -13.960 39.202 1.00 58.24  ? 92   ARG B CG    1 
ATOM   1376  C  CD    . ARG B 2 92  ? -25.396 -12.777 38.325 1.00 62.82  ? 92   ARG B CD    1 
ATOM   1377  N  NE    . ARG B 2 92  ? -23.969 -12.578 38.384 1.00 64.94  ? 92   ARG B NE    1 
ATOM   1378  C  CZ    . ARG B 2 92  ? -23.345 -12.042 39.417 1.00 64.21  ? 92   ARG B CZ    1 
ATOM   1379  N  NH1   . ARG B 2 92  ? -24.035 -11.598 40.467 1.00 65.33  ? 92   ARG B NH1   1 
ATOM   1380  N  NH2   . ARG B 2 92  ? -22.025 -11.929 39.384 1.00 66.50  ? 92   ARG B NH2   1 
ATOM   1381  N  N     . GLN B 2 93  ? -25.979 -16.001 41.897 1.00 54.32  ? 93   GLN B N     1 
ATOM   1382  C  CA    . GLN B 2 93  ? -25.810 -15.959 43.359 1.00 55.77  ? 93   GLN B CA    1 
ATOM   1383  C  C     . GLN B 2 93  ? -25.448 -17.311 43.977 1.00 53.55  ? 93   GLN B C     1 
ATOM   1384  O  O     . GLN B 2 93  ? -25.346 -17.405 45.184 1.00 53.16  ? 93   GLN B O     1 
ATOM   1385  C  CB    . GLN B 2 93  ? -27.072 -15.473 44.067 1.00 60.47  ? 93   GLN B CB    1 
ATOM   1386  C  CG    . GLN B 2 93  ? -27.447 -14.037 43.783 1.00 66.99  ? 93   GLN B CG    1 
ATOM   1387  C  CD    . GLN B 2 93  ? -26.363 -13.040 44.121 1.00 67.94  ? 93   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B 2 93  ? -25.690 -13.146 45.152 1.00 68.99  ? 93   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B 2 93  ? -26.201 -12.044 43.256 1.00 71.51  ? 93   GLN B NE2   1 
ATOM   1390  N  N     . GLY B 2 94  ? -25.281 -18.348 43.164 1.00 50.58  ? 94   GLY B N     1 
ATOM   1391  C  CA    . GLY B 2 94  ? -25.114 -19.686 43.662 1.00 52.03  ? 94   GLY B CA    1 
ATOM   1392  C  C     . GLY B 2 94  ? -26.343 -20.372 44.243 1.00 53.14  ? 94   GLY B C     1 
ATOM   1393  O  O     . GLY B 2 94  ? -26.215 -21.353 44.931 1.00 55.30  ? 94   GLY B O     1 
ATOM   1394  N  N     . ARG B 2 95  ? -27.531 -19.873 43.946 1.00 59.28  ? 95   ARG B N     1 
ATOM   1395  C  CA    . ARG B 2 95  ? -28.758 -20.475 44.413 1.00 54.62  ? 95   ARG B CA    1 
ATOM   1396  C  C     . ARG B 2 95  ? -29.666 -20.967 43.267 1.00 50.03  ? 95   ARG B C     1 
ATOM   1397  O  O     . ARG B 2 95  ? -30.842 -20.688 43.267 1.00 51.98  ? 95   ARG B O     1 
ATOM   1398  C  CB    . ARG B 2 95  ? -29.547 -19.461 45.237 1.00 58.19  ? 95   ARG B CB    1 
ATOM   1399  C  CG    . ARG B 2 95  ? -28.768 -18.536 46.147 1.00 63.05  ? 95   ARG B CG    1 
ATOM   1400  C  CD    . ARG B 2 95  ? -28.542 -18.996 47.572 1.00 65.67  ? 95   ARG B CD    1 
ATOM   1401  N  NE    . ARG B 2 95  ? -29.567 -19.918 48.018 1.00 74.42  ? 95   ARG B NE    1 
ATOM   1402  C  CZ    . ARG B 2 95  ? -29.383 -20.806 48.989 1.00 75.81  ? 95   ARG B CZ    1 
ATOM   1403  N  NH1   . ARG B 2 95  ? -28.215 -20.845 49.652 1.00 74.37  ? 95   ARG B NH1   1 
ATOM   1404  N  NH2   . ARG B 2 95  ? -30.385 -21.628 49.321 1.00 72.55  ? 95   ARG B NH2   1 
ATOM   1405  N  N     . THR B 2 96  ? -29.133 -21.732 42.326 1.00 53.32  ? 96   THR B N     1 
ATOM   1406  C  CA    . THR B 2 96  ? -29.921 -22.272 41.198 1.00 47.44  ? 96   THR B CA    1 
ATOM   1407  C  C     . THR B 2 96  ? -31.241 -22.828 41.603 1.00 48.83  ? 96   THR B C     1 
ATOM   1408  O  O     . THR B 2 96  ? -31.301 -23.656 42.499 1.00 61.79  ? 96   THR B O     1 
ATOM   1409  C  CB    . THR B 2 96  ? -29.193 -23.431 40.536 1.00 45.16  ? 96   THR B CB    1 
ATOM   1410  O  OG1   . THR B 2 96  ? -28.072 -22.937 39.810 1.00 50.05  ? 96   THR B OG1   1 
ATOM   1411  C  CG2   . THR B 2 96  ? -30.050 -24.120 39.566 1.00 50.35  ? 96   THR B CG2   1 
ATOM   1412  N  N     . LEU B 2 97  ? -32.292 -22.389 40.907 1.00 56.04  ? 97   LEU B N     1 
ATOM   1413  C  CA    . LEU B 2 97  ? -33.686 -22.794 41.170 1.00 54.77  ? 97   LEU B CA    1 
ATOM   1414  C  C     . LEU B 2 97  ? -34.222 -23.524 39.959 1.00 55.40  ? 97   LEU B C     1 
ATOM   1415  O  O     . LEU B 2 97  ? -33.941 -23.135 38.845 1.00 58.42  ? 97   LEU B O     1 
ATOM   1416  C  CB    . LEU B 2 97  ? -34.526 -21.542 41.415 1.00 53.19  ? 97   LEU B CB    1 
ATOM   1417  C  CG    . LEU B 2 97  ? -36.023 -21.666 41.651 1.00 53.87  ? 97   LEU B CG    1 
ATOM   1418  C  CD1   . LEU B 2 97  ? -36.325 -22.289 42.999 1.00 58.45  ? 97   LEU B CD1   1 
ATOM   1419  C  CD2   . LEU B 2 97  ? -36.668 -20.292 41.587 1.00 54.01  ? 97   LEU B CD2   1 
ATOM   1420  N  N     . TYR B 2 98  ? -34.990 -24.580 40.172 1.00 59.60  ? 98   TYR B N     1 
ATOM   1421  C  CA    . TYR B 2 98  ? -35.576 -25.345 39.067 1.00 61.41  ? 98   TYR B CA    1 
ATOM   1422  C  C     . TYR B 2 98  ? -37.081 -25.224 39.110 1.00 64.23  ? 98   TYR B C     1 
ATOM   1423  O  O     . TYR B 2 98  ? -37.689 -25.237 40.193 1.00 64.67  ? 98   TYR B O     1 
ATOM   1424  C  CB    . TYR B 2 98  ? -35.266 -26.831 39.180 1.00 60.83  ? 98   TYR B CB    1 
ATOM   1425  C  CG    . TYR B 2 98  ? -33.884 -27.306 38.858 1.00 52.71  ? 98   TYR B CG    1 
ATOM   1426  C  CD1   . TYR B 2 98  ? -32.905 -26.468 38.345 1.00 52.77  ? 98   TYR B CD1   1 
ATOM   1427  C  CD2   . TYR B 2 98  ? -33.565 -28.620 39.065 1.00 51.76  ? 98   TYR B CD2   1 
ATOM   1428  C  CE1   . TYR B 2 98  ? -31.631 -26.952 38.015 1.00 51.14  ? 98   TYR B CE1   1 
ATOM   1429  C  CE2   . TYR B 2 98  ? -32.299 -29.104 38.769 1.00 57.20  ? 98   TYR B CE2   1 
ATOM   1430  C  CZ    . TYR B 2 98  ? -31.340 -28.263 38.232 1.00 56.01  ? 98   TYR B CZ    1 
ATOM   1431  O  OH    . TYR B 2 98  ? -30.106 -28.769 37.931 1.00 57.03  ? 98   TYR B OH    1 
ATOM   1432  N  N     . GLY B 2 99  ? -37.673 -25.134 37.922 1.00 70.04  ? 99   GLY B N     1 
ATOM   1433  C  CA    . GLY B 2 99  ? -39.126 -24.962 37.765 1.00 74.09  ? 99   GLY B CA    1 
ATOM   1434  C  C     . GLY B 2 99  ? -39.692 -23.614 37.349 1.00 62.51  ? 99   GLY B C     1 
ATOM   1435  O  O     . GLY B 2 99  ? -40.870 -23.418 37.429 1.00 78.70  ? 99   GLY B O     1 
ATOM   1436  N  N     . PHE B 2 100 ? -38.884 -22.673 36.917 1.00 60.08  ? 100  PHE B N     1 
ATOM   1437  C  CA    . PHE B 2 100 ? -39.427 -21.413 36.474 1.00 59.91  ? 100  PHE B CA    1 
ATOM   1438  C  C     . PHE B 2 100 ? -38.782 -20.964 35.178 1.00 68.23  ? 100  PHE B C     1 
ATOM   1439  O  O     . PHE B 2 100 ? -38.771 -19.784 34.864 1.00 70.45  ? 100  PHE B O     1 
ATOM   1440  C  CB    . PHE B 2 100 ? -39.245 -20.383 37.557 1.00 56.49  ? 100  PHE B CB    1 
ATOM   1441  C  CG    . PHE B 2 100 ? -40.077 -20.644 38.771 1.00 61.28  ? 100  PHE B CG    1 
ATOM   1442  C  CD1   . PHE B 2 100 ? -39.614 -21.454 39.788 1.00 66.05  ? 100  PHE B CD1   1 
ATOM   1443  C  CD2   . PHE B 2 100 ? -41.330 -20.079 38.900 1.00 62.57  ? 100  PHE B CD2   1 
ATOM   1444  C  CE1   . PHE B 2 100 ? -40.381 -21.678 40.920 1.00 66.49  ? 100  PHE B CE1   1 
ATOM   1445  C  CE2   . PHE B 2 100 ? -42.101 -20.293 40.026 1.00 63.94  ? 100  PHE B CE2   1 
ATOM   1446  C  CZ    . PHE B 2 100 ? -41.628 -21.096 41.041 1.00 65.37  ? 100  PHE B CZ    1 
ATOM   1447  N  N     . GLY B 2 101 ? -38.277 -21.922 34.409 1.00 75.52  ? 101  GLY B N     1 
ATOM   1448  C  CA    . GLY B 2 101 ? -37.728 -21.644 33.099 1.00 76.69  ? 101  GLY B CA    1 
ATOM   1449  C  C     . GLY B 2 101 ? -36.239 -21.847 33.087 1.00 80.11  ? 101  GLY B C     1 
ATOM   1450  O  O     . GLY B 2 101 ? -35.659 -22.244 34.084 1.00 87.10  ? 101  GLY B O     1 
ATOM   1451  N  N     . GLY B 2 102 ? -35.628 -21.599 31.934 1.00 95.03  ? 102  GLY B N     1 
ATOM   1452  C  CA    . GLY B 2 102 ? -34.184 -21.735 31.772 1.00 90.95  ? 102  GLY B CA    1 
ATOM   1453  C  C     . GLY B 2 102 ? -33.724 -23.176 31.827 1.00 88.36  ? 102  GLY B C     1 
ATOM   1454  O  O     . GLY B 2 102 ? -32.509 -23.371 31.692 1.00 77.07  ? 102  GLY B O     1 
ATOM   1455  O  OXT   . GLY B 2 102 ? -34.533 -24.120 32.004 1.00 83.46  ? 102  GLY B OXT   1 
ATOM   1456  N  N     . ALA C 3 14  ? -1.157  6.547   12.698 1.00 120.50 ? 14   ALA C N     1 
ATOM   1457  C  CA    . ALA C 3 14  ? -0.156  5.622   13.338 1.00 126.37 ? 14   ALA C CA    1 
ATOM   1458  C  C     . ALA C 3 14  ? -0.406  5.338   14.848 1.00 126.31 ? 14   ALA C C     1 
ATOM   1459  O  O     . ALA C 3 14  ? 0.460   4.766   15.516 1.00 121.67 ? 14   ALA C O     1 
ATOM   1460  C  CB    . ALA C 3 14  ? 1.262   6.166   13.116 1.00 118.37 ? 14   ALA C CB    1 
ATOM   1461  N  N     . LYS C 3 15  ? -1.598  5.683   15.354 1.00 121.50 ? 15   LYS C N     1 
ATOM   1462  C  CA    . LYS C 3 15  ? -1.904  5.704   16.796 1.00 118.33 ? 15   LYS C CA    1 
ATOM   1463  C  C     . LYS C 3 15  ? -2.631  4.456   17.311 1.00 110.36 ? 15   LYS C C     1 
ATOM   1464  O  O     . LYS C 3 15  ? -3.629  4.030   16.729 1.00 101.76 ? 15   LYS C O     1 
ATOM   1465  C  CB    . LYS C 3 15  ? -2.776  6.922   17.130 1.00 121.36 ? 15   LYS C CB    1 
ATOM   1466  C  CG    . LYS C 3 15  ? -2.032  8.243   17.042 1.00 131.51 ? 15   LYS C CG    1 
ATOM   1467  C  CD    . LYS C 3 15  ? -2.435  9.199   18.156 1.00 146.13 ? 15   LYS C CD    1 
ATOM   1468  C  CE    . LYS C 3 15  ? -1.608  10.477  18.108 1.00 154.95 ? 15   LYS C CE    1 
ATOM   1469  N  NZ    . LYS C 3 15  ? -1.995  11.446  19.175 1.00 161.99 ? 15   LYS C NZ    1 
ATOM   1470  N  N     . THR C 3 16  ? -2.162  3.910   18.433 1.00 98.36  ? 16   THR C N     1 
ATOM   1471  C  CA    . THR C 3 16  ? -2.854  2.790   19.078 1.00 85.40  ? 16   THR C CA    1 
ATOM   1472  C  C     . THR C 3 16  ? -4.201  3.229   19.650 1.00 82.53  ? 16   THR C C     1 
ATOM   1473  O  O     . THR C 3 16  ? -4.442  4.405   19.951 1.00 75.54  ? 16   THR C O     1 
ATOM   1474  C  CB    . THR C 3 16  ? -2.075  2.210   20.264 1.00 80.91  ? 16   THR C CB    1 
ATOM   1475  O  OG1   . THR C 3 16  ? -2.047  3.176   21.327 1.00 80.59  ? 16   THR C OG1   1 
ATOM   1476  C  CG2   . THR C 3 16  ? -0.662  1.796   19.867 1.00 82.59  ? 16   THR C CG2   1 
ATOM   1477  N  N     . ARG C 3 17  ? -5.060  2.246   19.849 1.00 79.07  ? 17   ARG C N     1 
ATOM   1478  C  CA    . ARG C 3 17  ? -6.390  2.491   20.382 1.00 79.54  ? 17   ARG C CA    1 
ATOM   1479  C  C     . ARG C 3 17  ? -6.315  2.801   21.865 1.00 80.14  ? 17   ARG C C     1 
ATOM   1480  O  O     . ARG C 3 17  ? -7.182  3.475   22.439 1.00 70.30  ? 17   ARG C O     1 
ATOM   1481  C  CB    . ARG C 3 17  ? -7.227  1.250   20.175 1.00 85.71  ? 17   ARG C CB    1 
ATOM   1482  C  CG    . ARG C 3 17  ? -7.088  0.691   18.772 1.00 87.02  ? 17   ARG C CG    1 
ATOM   1483  C  CD    . ARG C 3 17  ? -8.306  -0.097  18.399 1.00 83.26  ? 17   ARG C CD    1 
ATOM   1484  N  NE    . ARG C 3 17  ? -8.031  -1.517  18.452 1.00 84.34  ? 17   ARG C NE    1 
ATOM   1485  C  CZ    . ARG C 3 17  ? -8.966  -2.431  18.674 1.00 84.75  ? 17   ARG C CZ    1 
ATOM   1486  N  NH1   . ARG C 3 17  ? -10.244 -2.064  18.884 1.00 81.89  ? 17   ARG C NH1   1 
ATOM   1487  N  NH2   . ARG C 3 17  ? -8.596  -3.702  18.699 1.00 86.17  ? 17   ARG C NH2   1 
ATOM   1488  N  N     . SER C 3 18  ? -5.276  2.268   22.497 1.00 78.56  ? 18   SER C N     1 
ATOM   1489  C  CA    . SER C 3 18  ? -5.039  2.548   23.885 1.00 74.43  ? 18   SER C CA    1 
ATOM   1490  C  C     . SER C 3 18  ? -4.905  4.049   24.034 1.00 78.76  ? 18   SER C C     1 
ATOM   1491  O  O     . SER C 3 18  ? -5.815  4.666   24.585 1.00 74.47  ? 18   SER C O     1 
ATOM   1492  C  CB    . SER C 3 18  ? -3.815  1.793   24.376 1.00 71.66  ? 18   SER C CB    1 
ATOM   1493  O  OG    . SER C 3 18  ? -4.069  0.413   24.329 1.00 69.74  ? 18   SER C OG    1 
ATOM   1494  N  N     . SER C 3 19  ? -3.827  4.640   23.494 1.00 81.97  ? 19   SER C N     1 
ATOM   1495  C  CA    . SER C 3 19  ? -3.683  6.117   23.488 1.00 82.02  ? 19   SER C CA    1 
ATOM   1496  C  C     . SER C 3 19  ? -4.969  6.818   22.991 1.00 66.33  ? 19   SER C C     1 
ATOM   1497  O  O     . SER C 3 19  ? -5.441  7.753   23.613 1.00 65.21  ? 19   SER C O     1 
ATOM   1498  C  CB    . SER C 3 19  ? -2.434  6.596   22.713 1.00 80.93  ? 19   SER C CB    1 
ATOM   1499  O  OG    . SER C 3 19  ? -2.363  6.011   21.417 1.00 96.52  ? 19   SER C OG    1 
ATOM   1500  N  N     . ARG C 3 20  ? -5.584  6.337   21.929 1.00 62.86  ? 20   ARG C N     1 
ATOM   1501  C  CA    . ARG C 3 20  ? -6.857  6.900   21.547 1.00 70.10  ? 20   ARG C CA    1 
ATOM   1502  C  C     . ARG C 3 20  ? -7.849  6.955   22.705 1.00 71.92  ? 20   ARG C C     1 
ATOM   1503  O  O     . ARG C 3 20  ? -8.586  7.951   22.829 1.00 78.64  ? 20   ARG C O     1 
ATOM   1504  C  CB    . ARG C 3 20  ? -7.490  6.132   20.377 1.00 86.01  ? 20   ARG C CB    1 
ATOM   1505  C  CG    . ARG C 3 20  ? -6.854  6.352   19.014 1.00 94.93  ? 20   ARG C CG    1 
ATOM   1506  C  CD    . ARG C 3 20  ? -7.642  5.694   17.891 1.00 100.25 ? 20   ARG C CD    1 
ATOM   1507  N  NE    . ARG C 3 20  ? -6.758  5.426   16.747 1.00 130.84 ? 20   ARG C NE    1 
ATOM   1508  C  CZ    . ARG C 3 20  ? -6.550  6.245   15.705 1.00 141.27 ? 20   ARG C CZ    1 
ATOM   1509  N  NH1   . ARG C 3 20  ? -7.170  7.426   15.597 1.00 138.22 ? 20   ARG C NH1   1 
ATOM   1510  N  NH2   . ARG C 3 20  ? -5.711  5.872   14.743 1.00 141.11 ? 20   ARG C NH2   1 
ATOM   1511  N  N     . ALA C 3 21  ? -7.894  5.906   23.540 1.00 74.80  ? 21   ALA C N     1 
ATOM   1512  C  CA    . ALA C 3 21  ? -8.860  5.865   24.686 1.00 78.12  ? 21   ALA C CA    1 
ATOM   1513  C  C     . ALA C 3 21  ? -8.306  6.397   26.012 1.00 71.79  ? 21   ALA C C     1 
ATOM   1514  O  O     . ALA C 3 21  ? -9.022  6.526   26.981 1.00 72.62  ? 21   ALA C O     1 
ATOM   1515  C  CB    . ALA C 3 21  ? -9.403  4.468   24.889 1.00 80.75  ? 21   ALA C CB    1 
ATOM   1516  N  N     . GLY C 3 22  ? -7.031  6.727   26.039 1.00 69.88  ? 22   GLY C N     1 
ATOM   1517  C  CA    . GLY C 3 22  ? -6.429  7.319   27.199 1.00 70.09  ? 22   GLY C CA    1 
ATOM   1518  C  C     . GLY C 3 22  ? -6.062  6.273   28.207 1.00 69.59  ? 22   GLY C C     1 
ATOM   1519  O  O     . GLY C 3 22  ? -6.215  6.484   29.410 1.00 72.10  ? 22   GLY C O     1 
ATOM   1520  N  N     . LEU C 3 23  ? -5.527  5.158   27.715 1.00 69.39  ? 23   LEU C N     1 
ATOM   1521  C  CA    . LEU C 3 23  ? -5.335  3.980   28.548 1.00 62.58  ? 23   LEU C CA    1 
ATOM   1522  C  C     . LEU C 3 23  ? -3.930  3.441   28.440 1.00 62.85  ? 23   LEU C C     1 
ATOM   1523  O  O     . LEU C 3 23  ? -3.317  3.474   27.391 1.00 68.33  ? 23   LEU C O     1 
ATOM   1524  C  CB    . LEU C 3 23  ? -6.359  2.881   28.200 1.00 58.57  ? 23   LEU C CB    1 
ATOM   1525  C  CG    . LEU C 3 23  ? -7.874  3.152   28.435 1.00 57.72  ? 23   LEU C CG    1 
ATOM   1526  C  CD1   . LEU C 3 23  ? -8.687  1.953   27.999 1.00 60.21  ? 23   LEU C CD1   1 
ATOM   1527  C  CD2   . LEU C 3 23  ? -8.265  3.444   29.863 1.00 55.88  ? 23   LEU C CD2   1 
ATOM   1528  N  N     . GLN C 3 24  ? -3.423  2.952   29.561 1.00 68.66  ? 24   GLN C N     1 
ATOM   1529  C  CA    . GLN C 3 24  ? -2.178  2.212   29.594 1.00 65.61  ? 24   GLN C CA    1 
ATOM   1530  C  C     . GLN C 3 24  ? -2.418  0.785   29.157 1.00 61.26  ? 24   GLN C C     1 
ATOM   1531  O  O     . GLN C 3 24  ? -1.618  0.226   28.444 1.00 72.55  ? 24   GLN C O     1 
ATOM   1532  C  CB    . GLN C 3 24  ? -1.632  2.190   31.009 1.00 69.82  ? 24   GLN C CB    1 
ATOM   1533  C  CG    . GLN C 3 24  ? -1.513  3.558   31.656 1.00 72.42  ? 24   GLN C CG    1 
ATOM   1534  C  CD    . GLN C 3 24  ? -0.557  4.454   30.911 1.00 66.74  ? 24   GLN C CD    1 
ATOM   1535  O  OE1   . GLN C 3 24  ? 0.585   4.077   30.579 1.00 67.28  ? 24   GLN C OE1   1 
ATOM   1536  N  NE2   . GLN C 3 24  ? -1.025  5.634   30.614 1.00 69.36  ? 24   GLN C NE2   1 
ATOM   1537  N  N     . PHE C 3 25  ? -3.518  0.191   29.595 1.00 58.96  ? 25   PHE C N     1 
ATOM   1538  C  CA    . PHE C 3 25  ? -3.796  -1.211  29.287 1.00 70.33  ? 25   PHE C CA    1 
ATOM   1539  C  C     . PHE C 3 25  ? -4.097  -1.428  27.807 1.00 71.37  ? 25   PHE C C     1 
ATOM   1540  O  O     . PHE C 3 25  ? -4.596  -0.535  27.139 1.00 86.13  ? 25   PHE C O     1 
ATOM   1541  C  CB    . PHE C 3 25  ? -4.962  -1.714  30.128 1.00 72.96  ? 25   PHE C CB    1 
ATOM   1542  C  CG    . PHE C 3 25  ? -4.542  -2.409  31.376 1.00 68.06  ? 25   PHE C CG    1 
ATOM   1543  C  CD1   . PHE C 3 25  ? -3.668  -1.819  32.250 1.00 64.06  ? 25   PHE C CD1   1 
ATOM   1544  C  CD2   . PHE C 3 25  ? -5.035  -3.661  31.672 1.00 70.56  ? 25   PHE C CD2   1 
ATOM   1545  C  CE1   . PHE C 3 25  ? -3.292  -2.463  33.402 1.00 62.46  ? 25   PHE C CE1   1 
ATOM   1546  C  CE2   . PHE C 3 25  ? -4.667  -4.309  32.818 1.00 60.02  ? 25   PHE C CE2   1 
ATOM   1547  C  CZ    . PHE C 3 25  ? -3.800  -3.704  33.682 1.00 57.73  ? 25   PHE C CZ    1 
ATOM   1548  N  N     . PRO C 3 26  ? -3.822  -2.623  27.292 1.00 69.67  ? 26   PRO C N     1 
ATOM   1549  C  CA    . PRO C 3 26  ? -3.684  -2.764  25.863 1.00 68.81  ? 26   PRO C CA    1 
ATOM   1550  C  C     . PRO C 3 26  ? -4.960  -3.153  25.198 1.00 64.65  ? 26   PRO C C     1 
ATOM   1551  O  O     . PRO C 3 26  ? -5.360  -4.296  25.286 1.00 70.74  ? 26   PRO C O     1 
ATOM   1552  C  CB    . PRO C 3 26  ? -2.650  -3.880  25.729 1.00 69.24  ? 26   PRO C CB    1 
ATOM   1553  C  CG    . PRO C 3 26  ? -2.703  -4.628  27.011 1.00 72.21  ? 26   PRO C CG    1 
ATOM   1554  C  CD    . PRO C 3 26  ? -3.638  -3.912  27.954 1.00 78.76  ? 26   PRO C CD    1 
ATOM   1555  N  N     . VAL C 3 27  ? -5.583  -2.218  24.502 1.00 63.04  ? 27   VAL C N     1 
ATOM   1556  C  CA    . VAL C 3 27  ? -6.859  -2.511  23.845 1.00 67.14  ? 27   VAL C CA    1 
ATOM   1557  C  C     . VAL C 3 27  ? -6.780  -3.569  22.729 1.00 64.27  ? 27   VAL C C     1 
ATOM   1558  O  O     . VAL C 3 27  ? -7.621  -4.436  22.647 1.00 67.43  ? 27   VAL C O     1 
ATOM   1559  C  CB    . VAL C 3 27  ? -7.481  -1.240  23.311 1.00 66.86  ? 27   VAL C CB    1 
ATOM   1560  C  CG1   . VAL C 3 27  ? -8.871  -1.522  22.761 1.00 73.09  ? 27   VAL C CG1   1 
ATOM   1561  C  CG2   . VAL C 3 27  ? -7.568  -0.229  24.438 1.00 67.43  ? 27   VAL C CG2   1 
ATOM   1562  N  N     . GLY C 3 28  ? -5.765  -3.508  21.887 1.00 69.07  ? 28   GLY C N     1 
ATOM   1563  C  CA    . GLY C 3 28  ? -5.581  -4.524  20.872 1.00 71.90  ? 28   GLY C CA    1 
ATOM   1564  C  C     . GLY C 3 28  ? -5.593  -5.914  21.466 1.00 69.79  ? 28   GLY C C     1 
ATOM   1565  O  O     . GLY C 3 28  ? -6.314  -6.795  21.010 1.00 69.69  ? 28   GLY C O     1 
ATOM   1566  N  N     . ARG C 3 29  ? -4.789  -6.090  22.502 1.00 72.60  ? 29   ARG C N     1 
ATOM   1567  C  CA    . ARG C 3 29  ? -4.660  -7.373  23.202 1.00 70.35  ? 29   ARG C CA    1 
ATOM   1568  C  C     . ARG C 3 29  ? -6.004  -7.840  23.725 1.00 70.86  ? 29   ARG C C     1 
ATOM   1569  O  O     . ARG C 3 29  ? -6.420  -8.968  23.508 1.00 72.07  ? 29   ARG C O     1 
ATOM   1570  C  CB    . ARG C 3 29  ? -3.705  -7.219  24.395 1.00 68.66  ? 29   ARG C CB    1 
ATOM   1571  C  CG    . ARG C 3 29  ? -3.271  -8.523  25.036 1.00 68.15  ? 29   ARG C CG    1 
ATOM   1572  C  CD    . ARG C 3 29  ? -1.813  -8.775  24.745 1.00 71.39  ? 29   ARG C CD    1 
ATOM   1573  N  NE    . ARG C 3 29  ? -1.079  -8.850  25.982 1.00 74.62  ? 29   ARG C NE    1 
ATOM   1574  C  CZ    . ARG C 3 29  ? 0.247   -8.809  26.075 1.00 86.90  ? 29   ARG C CZ    1 
ATOM   1575  N  NH1   . ARG C 3 29  ? 1.026   -8.663  25.006 1.00 84.47  ? 29   ARG C NH1   1 
ATOM   1576  N  NH2   . ARG C 3 29  ? 0.796   -8.911  27.272 1.00 101.98 ? 29   ARG C NH2   1 
ATOM   1577  N  N     . VAL C 3 30  ? -6.680  -6.943  24.420 1.00 68.67  ? 30   VAL C N     1 
ATOM   1578  C  CA    . VAL C 3 30  ? -7.953  -7.248  25.001 1.00 65.46  ? 30   VAL C CA    1 
ATOM   1579  C  C     . VAL C 3 30  ? -8.962  -7.544  23.909 1.00 68.87  ? 30   VAL C C     1 
ATOM   1580  O  O     . VAL C 3 30  ? -9.842  -8.361  24.110 1.00 75.22  ? 30   VAL C O     1 
ATOM   1581  C  CB    . VAL C 3 30  ? -8.436  -6.103  25.913 1.00 66.74  ? 30   VAL C CB    1 
ATOM   1582  C  CG1   . VAL C 3 30  ? -9.845  -6.366  26.424 1.00 67.75  ? 30   VAL C CG1   1 
ATOM   1583  C  CG2   . VAL C 3 30  ? -7.506  -5.943  27.100 1.00 66.15  ? 30   VAL C CG2   1 
ATOM   1584  N  N     . HIS C 3 31  ? -8.845  -6.902  22.749 1.00 75.42  ? 31   HIS C N     1 
ATOM   1585  C  CA    . HIS C 3 31  ? -9.729  -7.262  21.646 1.00 78.60  ? 31   HIS C CA    1 
ATOM   1586  C  C     . HIS C 3 31  ? -9.448  -8.685  21.252 1.00 73.03  ? 31   HIS C C     1 
ATOM   1587  O  O     . HIS C 3 31  ? -10.364 -9.470  21.070 1.00 66.97  ? 31   HIS C O     1 
ATOM   1588  C  CB    . HIS C 3 31  ? -9.548  -6.386  20.408 1.00 86.02  ? 31   HIS C CB    1 
ATOM   1589  C  CG    . HIS C 3 31  ? -10.816 -6.203  19.628 1.00 91.01  ? 31   HIS C CG    1 
ATOM   1590  N  ND1   . HIS C 3 31  ? -11.704 -7.230  19.406 1.00 97.68  ? 31   HIS C ND1   1 
ATOM   1591  C  CD2   . HIS C 3 31  ? -11.366 -5.106  19.054 1.00 86.13  ? 31   HIS C CD2   1 
ATOM   1592  C  CE1   . HIS C 3 31  ? -12.748 -6.770  18.735 1.00 96.50  ? 31   HIS C CE1   1 
ATOM   1593  N  NE2   . HIS C 3 31  ? -12.565 -5.484  18.508 1.00 90.55  ? 31   HIS C NE2   1 
ATOM   1594  N  N     . ARG C 3 32  ? -8.167  -9.006  21.130 1.00 69.10  ? 32   ARG C N     1 
ATOM   1595  C  CA    . ARG C 3 32  ? -7.754  -10.288 20.592 1.00 72.64  ? 32   ARG C CA    1 
ATOM   1596  C  C     . ARG C 3 32  ? -8.249  -11.404 21.480 1.00 78.64  ? 32   ARG C C     1 
ATOM   1597  O  O     . ARG C 3 32  ? -8.826  -12.371 20.992 1.00 89.51  ? 32   ARG C O     1 
ATOM   1598  C  CB    . ARG C 3 32  ? -6.230  -10.348 20.451 1.00 71.28  ? 32   ARG C CB    1 
ATOM   1599  C  CG    . ARG C 3 32  ? -5.681  -11.680 19.957 1.00 72.17  ? 32   ARG C CG    1 
ATOM   1600  C  CD    . ARG C 3 32  ? -4.171  -11.750 20.136 1.00 75.43  ? 32   ARG C CD    1 
ATOM   1601  N  NE    . ARG C 3 32  ? -3.825  -12.037 21.521 1.00 80.66  ? 32   ARG C NE    1 
ATOM   1602  C  CZ    . ARG C 3 32  ? -2.763  -11.573 22.185 1.00 90.28  ? 32   ARG C CZ    1 
ATOM   1603  N  NH1   . ARG C 3 32  ? -1.869  -10.768 21.623 1.00 98.29  ? 32   ARG C NH1   1 
ATOM   1604  N  NH2   . ARG C 3 32  ? -2.609  -11.912 23.457 1.00 101.61 ? 32   ARG C NH2   1 
ATOM   1605  N  N     . LEU C 3 33  ? -8.041  -11.244 22.785 1.00 76.91  ? 33   LEU C N     1 
ATOM   1606  C  CA    . LEU C 3 33  ? -8.378  -12.267 23.755 1.00 65.69  ? 33   LEU C CA    1 
ATOM   1607  C  C     . LEU C 3 33  ? -9.879  -12.464 23.848 1.00 71.02  ? 33   LEU C C     1 
ATOM   1608  O  O     . LEU C 3 33  ? -10.326 -13.554 24.186 1.00 76.37  ? 33   LEU C O     1 
ATOM   1609  C  CB    . LEU C 3 33  ? -7.833  -11.910 25.119 1.00 60.62  ? 33   LEU C CB    1 
ATOM   1610  C  CG    . LEU C 3 33  ? -6.311  -11.834 25.232 1.00 64.07  ? 33   LEU C CG    1 
ATOM   1611  C  CD1   . LEU C 3 33  ? -5.895  -11.232 26.560 1.00 76.05  ? 33   LEU C CD1   1 
ATOM   1612  C  CD2   . LEU C 3 33  ? -5.636  -13.172 25.122 1.00 64.58  ? 33   LEU C CD2   1 
ATOM   1613  N  N     . LEU C 3 34  ? -10.662 -11.432 23.550 1.00 65.65  ? 34   LEU C N     1 
ATOM   1614  C  CA    . LEU C 3 34  ? -12.112 -11.599 23.557 1.00 70.30  ? 34   LEU C CA    1 
ATOM   1615  C  C     . LEU C 3 34  ? -12.590 -12.501 22.409 1.00 74.61  ? 34   LEU C C     1 
ATOM   1616  O  O     . LEU C 3 34  ? -13.499 -13.302 22.565 1.00 70.91  ? 34   LEU C O     1 
ATOM   1617  C  CB    . LEU C 3 34  ? -12.818 -10.244 23.464 1.00 73.18  ? 34   LEU C CB    1 
ATOM   1618  C  CG    . LEU C 3 34  ? -12.964 -9.336  24.689 1.00 73.94  ? 34   LEU C CG    1 
ATOM   1619  C  CD1   . LEU C 3 34  ? -13.598 -8.024  24.252 1.00 80.49  ? 34   LEU C CD1   1 
ATOM   1620  C  CD2   . LEU C 3 34  ? -13.813 -9.954  25.778 1.00 72.72  ? 34   LEU C CD2   1 
ATOM   1621  N  N     . ARG C 3 35  ? -11.990 -12.353 21.238 1.00 88.34  ? 35   ARG C N     1 
ATOM   1622  C  CA    . ARG C 3 35  ? -12.408 -13.139 20.071 1.00 91.04  ? 35   ARG C CA    1 
ATOM   1623  C  C     . ARG C 3 35  ? -12.135 -14.615 20.299 1.00 82.00  ? 35   ARG C C     1 
ATOM   1624  O  O     . ARG C 3 35  ? -13.032 -15.444 20.207 1.00 80.73  ? 35   ARG C O     1 
ATOM   1625  C  CB    . ARG C 3 35  ? -11.673 -12.678 18.812 1.00 93.88  ? 35   ARG C CB    1 
ATOM   1626  C  CG    . ARG C 3 35  ? -11.960 -11.234 18.439 1.00 95.93  ? 35   ARG C CG    1 
ATOM   1627  C  CD    . ARG C 3 35  ? -11.424 -10.844 17.054 1.00 93.00  ? 35   ARG C CD    1 
ATOM   1628  N  NE    . ARG C 3 35  ? -11.832 -9.476  16.690 1.00 93.68  ? 35   ARG C NE    1 
ATOM   1629  C  CZ    . ARG C 3 35  ? -13.097 -9.062  16.480 1.00 98.73  ? 35   ARG C CZ    1 
ATOM   1630  N  NH1   . ARG C 3 35  ? -14.152 -9.874  16.598 1.00 97.46  ? 35   ARG C NH1   1 
ATOM   1631  N  NH2   . ARG C 3 35  ? -13.328 -7.799  16.143 1.00 107.28 ? 35   ARG C NH2   1 
ATOM   1632  N  N     . LYS C 3 36  ? -10.888 -14.927 20.605 1.00 77.35  ? 36   LYS C N     1 
ATOM   1633  C  CA    . LYS C 3 36  ? -10.483 -16.311 20.817 1.00 94.19  ? 36   LYS C CA    1 
ATOM   1634  C  C     . LYS C 3 36  ? -11.061 -17.007 22.073 1.00 84.85  ? 36   LYS C C     1 
ATOM   1635  O  O     . LYS C 3 36  ? -10.953 -18.215 22.208 1.00 87.45  ? 36   LYS C O     1 
ATOM   1636  C  CB    . LYS C 3 36  ? -8.961  -16.413 20.834 1.00 100.15 ? 36   LYS C CB    1 
ATOM   1637  C  CG    . LYS C 3 36  ? -8.333  -15.690 22.001 1.00 112.49 ? 36   LYS C CG    1 
ATOM   1638  C  CD    . LYS C 3 36  ? -6.840  -15.942 22.070 1.00 122.70 ? 36   LYS C CD    1 
ATOM   1639  C  CE    . LYS C 3 36  ? -6.511  -17.135 22.954 1.00 125.04 ? 36   LYS C CE    1 
ATOM   1640  N  NZ    . LYS C 3 36  ? -5.064  -17.137 23.291 1.00 130.53 ? 36   LYS C NZ    1 
ATOM   1641  N  N     . GLY C 3 37  ? -11.670 -16.264 22.981 1.00 80.76  ? 37   GLY C N     1 
ATOM   1642  C  CA    . GLY C 3 37  ? -12.305 -16.875 24.144 1.00 73.14  ? 37   GLY C CA    1 
ATOM   1643  C  C     . GLY C 3 37  ? -13.733 -17.301 23.872 1.00 81.20  ? 37   GLY C C     1 
ATOM   1644  O  O     . GLY C 3 37  ? -14.383 -17.840 24.773 1.00 84.65  ? 37   GLY C O     1 
ATOM   1645  N  N     . ASN C 3 38  ? -14.225 -17.068 22.647 1.00 76.66  ? 38   ASN C N     1 
ATOM   1646  C  CA    . ASN C 3 38  ? -15.542 -17.538 22.230 1.00 81.77  ? 38   ASN C CA    1 
ATOM   1647  C  C     . ASN C 3 38  ? -16.603 -17.161 23.211 1.00 77.50  ? 38   ASN C C     1 
ATOM   1648  O  O     . ASN C 3 38  ? -17.316 -18.012 23.753 1.00 83.86  ? 38   ASN C O     1 
ATOM   1649  C  CB    . ASN C 3 38  ? -15.558 -19.056 22.043 1.00 97.77  ? 38   ASN C CB    1 
ATOM   1650  C  CG    . ASN C 3 38  ? -14.933 -19.477 20.741 1.00 113.71 ? 38   ASN C CG    1 
ATOM   1651  O  OD1   . ASN C 3 38  ? -14.034 -20.327 20.718 1.00 125.02 ? 38   ASN C OD1   1 
ATOM   1652  N  ND2   . ASN C 3 38  ? -15.399 -18.879 19.637 1.00 106.86 ? 38   ASN C ND2   1 
ATOM   1653  N  N     . TYR C 3 39  ? -16.709 -15.876 23.471 1.00 72.20  ? 39   TYR C N     1 
ATOM   1654  C  CA    . TYR C 3 39  ? -17.741 -15.430 24.391 1.00 71.89  ? 39   TYR C CA    1 
ATOM   1655  C  C     . TYR C 3 39  ? -19.030 -15.143 23.608 1.00 68.63  ? 39   TYR C C     1 
ATOM   1656  O  O     . TYR C 3 39  ? -20.110 -15.288 24.150 1.00 72.02  ? 39   TYR C O     1 
ATOM   1657  C  CB    . TYR C 3 39  ? -17.227 -14.242 25.210 1.00 68.72  ? 39   TYR C CB    1 
ATOM   1658  C  CG    . TYR C 3 39  ? -15.972 -14.555 26.044 1.00 63.52  ? 39   TYR C CG    1 
ATOM   1659  C  CD1   . TYR C 3 39  ? -14.695 -14.231 25.585 1.00 61.64  ? 39   TYR C CD1   1 
ATOM   1660  C  CD2   . TYR C 3 39  ? -16.072 -15.155 27.288 1.00 60.84  ? 39   TYR C CD2   1 
ATOM   1661  C  CE1   . TYR C 3 39  ? -13.558 -14.491 26.332 1.00 58.26  ? 39   TYR C CE1   1 
ATOM   1662  C  CE2   . TYR C 3 39  ? -14.939 -15.435 28.043 1.00 60.22  ? 39   TYR C CE2   1 
ATOM   1663  C  CZ    . TYR C 3 39  ? -13.682 -15.100 27.564 1.00 64.39  ? 39   TYR C CZ    1 
ATOM   1664  O  OH    . TYR C 3 39  ? -12.549 -15.389 28.318 1.00 64.93  ? 39   TYR C OH    1 
ATOM   1665  N  N     . ALA C 3 40  ? -18.892 -14.776 22.329 1.00 67.05  ? 40   ALA C N     1 
ATOM   1666  C  CA    . ALA C 3 40  ? -20.017 -14.538 21.419 1.00 71.97  ? 40   ALA C CA    1 
ATOM   1667  C  C     . ALA C 3 40  ? -19.556 -14.532 19.951 1.00 73.61  ? 40   ALA C C     1 
ATOM   1668  O  O     . ALA C 3 40  ? -18.340 -14.521 19.681 1.00 68.90  ? 40   ALA C O     1 
ATOM   1669  C  CB    . ALA C 3 40  ? -20.691 -13.230 21.766 1.00 70.99  ? 40   ALA C CB    1 
ATOM   1670  N  N     . GLU C 3 41  ? -20.498 -14.568 19.001 1.00 74.11  ? 41   GLU C N     1 
ATOM   1671  C  CA    . GLU C 3 41  ? -20.089 -14.524 17.576 1.00 84.32  ? 41   GLU C CA    1 
ATOM   1672  C  C     . GLU C 3 41  ? -19.253 -13.269 17.355 1.00 81.95  ? 41   GLU C C     1 
ATOM   1673  O  O     . GLU C 3 41  ? -18.119 -13.346 16.880 1.00 75.69  ? 41   GLU C O     1 
ATOM   1674  C  CB    . GLU C 3 41  ? -21.270 -14.496 16.565 1.00 86.82  ? 41   GLU C CB    1 
ATOM   1675  C  CG    . GLU C 3 41  ? -22.215 -15.689 16.547 1.00 96.64  ? 41   GLU C CG    1 
ATOM   1676  C  CD    . GLU C 3 41  ? -21.495 -17.023 16.639 1.00 110.29 ? 41   GLU C CD    1 
ATOM   1677  O  OE1   . GLU C 3 41  ? -20.509 -17.240 15.888 1.00 117.40 ? 41   GLU C OE1   1 
ATOM   1678  O  OE2   . GLU C 3 41  ? -21.918 -17.850 17.480 1.00 106.34 ? 41   GLU C OE2   1 
ATOM   1679  N  N     . ARG C 3 42  ? -19.821 -12.121 17.723 1.00 79.48  ? 42   ARG C N     1 
ATOM   1680  C  CA    . ARG C 3 42  ? -19.241 -10.829 17.374 1.00 90.20  ? 42   ARG C CA    1 
ATOM   1681  C  C     . ARG C 3 42  ? -18.772 -10.050 18.591 1.00 88.35  ? 42   ARG C C     1 
ATOM   1682  O  O     . ARG C 3 42  ? -19.398 -10.115 19.644 1.00 85.07  ? 42   ARG C O     1 
ATOM   1683  C  CB    . ARG C 3 42  ? -20.270 -9.968  16.645 1.00 97.22  ? 42   ARG C CB    1 
ATOM   1684  C  CG    . ARG C 3 42  ? -20.910 -10.617 15.437 1.00 95.15  ? 42   ARG C CG    1 
ATOM   1685  C  CD    . ARG C 3 42  ? -21.860 -9.675  14.714 1.00 94.36  ? 42   ARG C CD    1 
ATOM   1686  N  NE    . ARG C 3 42  ? -21.953 -10.127 13.332 1.00 105.24 ? 42   ARG C NE    1 
ATOM   1687  C  CZ    . ARG C 3 42  ? -21.876 -9.359  12.252 1.00 104.54 ? 42   ARG C CZ    1 
ATOM   1688  N  NH1   . ARG C 3 42  ? -21.731 -8.037  12.360 1.00 108.59 ? 42   ARG C NH1   1 
ATOM   1689  N  NH2   . ARG C 3 42  ? -21.951 -9.935  11.053 1.00 96.60  ? 42   ARG C NH2   1 
ATOM   1690  N  N     . VAL C 3 43  ? -17.698 -9.281  18.411 1.00 80.81  ? 43   VAL C N     1 
ATOM   1691  C  CA    . VAL C 3 43  ? -17.217 -8.368  19.428 1.00 82.63  ? 43   VAL C CA    1 
ATOM   1692  C  C     . VAL C 3 43  ? -17.188 -6.923  18.970 1.00 79.99  ? 43   VAL C C     1 
ATOM   1693  O  O     . VAL C 3 43  ? -16.318 -6.512  18.193 1.00 84.43  ? 43   VAL C O     1 
ATOM   1694  C  CB    . VAL C 3 43  ? -15.804 -8.722  19.848 1.00 83.12  ? 43   VAL C CB    1 
ATOM   1695  C  CG1   . VAL C 3 43  ? -15.297 -7.742  20.912 1.00 80.12  ? 43   VAL C CG1   1 
ATOM   1696  C  CG2   . VAL C 3 43  ? -15.796 -10.145 20.353 1.00 82.94  ? 43   VAL C CG2   1 
ATOM   1697  N  N     . GLY C 3 44  ? -18.104 -6.143  19.518 1.00 72.82  ? 44   GLY C N     1 
ATOM   1698  C  CA    . GLY C 3 44  ? -18.113 -4.712  19.296 1.00 79.52  ? 44   GLY C CA    1 
ATOM   1699  C  C     . GLY C 3 44  ? -16.827 -3.967  19.647 1.00 74.98  ? 44   GLY C C     1 
ATOM   1700  O  O     . GLY C 3 44  ? -15.955 -4.444  20.386 1.00 71.61  ? 44   GLY C O     1 
ATOM   1701  N  N     . ALA C 3 45  ? -16.745 -2.763  19.112 1.00 72.61  ? 45   ALA C N     1 
ATOM   1702  C  CA    . ALA C 3 45  ? -15.517 -2.001  19.115 1.00 76.56  ? 45   ALA C CA    1 
ATOM   1703  C  C     . ALA C 3 45  ? -15.281 -1.332  20.449 1.00 77.72  ? 45   ALA C C     1 
ATOM   1704  O  O     . ALA C 3 45  ? -14.152 -1.061  20.814 1.00 77.17  ? 45   ALA C O     1 
ATOM   1705  C  CB    . ALA C 3 45  ? -15.581 -0.947  18.026 1.00 84.38  ? 45   ALA C CB    1 
ATOM   1706  N  N     . GLY C 3 46  ? -16.352 -1.012  21.155 1.00 78.94  ? 46   GLY C N     1 
ATOM   1707  C  CA    . GLY C 3 46  ? -16.217 -0.429  22.476 1.00 78.95  ? 46   GLY C CA    1 
ATOM   1708  C  C     . GLY C 3 46  ? -15.885 -1.423  23.570 1.00 75.96  ? 46   GLY C C     1 
ATOM   1709  O  O     . GLY C 3 46  ? -15.337 -1.039  24.602 1.00 78.42  ? 46   GLY C O     1 
ATOM   1710  N  N     . ALA C 3 47  ? -16.215 -2.695  23.356 1.00 73.98  ? 47   ALA C N     1 
ATOM   1711  C  CA    . ALA C 3 47  ? -16.088 -3.689  24.414 1.00 72.18  ? 47   ALA C CA    1 
ATOM   1712  C  C     . ALA C 3 47  ? -14.664 -3.781  24.943 1.00 65.26  ? 47   ALA C C     1 
ATOM   1713  O  O     . ALA C 3 47  ? -14.441 -3.571  26.136 1.00 64.54  ? 47   ALA C O     1 
ATOM   1714  C  CB    . ALA C 3 47  ? -16.590 -5.042  23.953 1.00 72.78  ? 47   ALA C CB    1 
ATOM   1715  N  N     . PRO C 3 48  ? -13.692 -4.025  24.065 1.00 59.47  ? 48   PRO C N     1 
ATOM   1716  C  CA    . PRO C 3 48  ? -12.315 -4.130  24.574 1.00 66.04  ? 48   PRO C CA    1 
ATOM   1717  C  C     . PRO C 3 48  ? -11.811 -2.829  25.177 1.00 69.18  ? 48   PRO C C     1 
ATOM   1718  O  O     . PRO C 3 48  ? -10.934 -2.843  26.060 1.00 72.26  ? 48   PRO C O     1 
ATOM   1719  C  CB    . PRO C 3 48  ? -11.487 -4.487  23.338 1.00 63.23  ? 48   PRO C CB    1 
ATOM   1720  C  CG    . PRO C 3 48  ? -12.283 -3.916  22.224 1.00 68.64  ? 48   PRO C CG    1 
ATOM   1721  C  CD    . PRO C 3 48  ? -13.737 -4.098  22.603 1.00 64.15  ? 48   PRO C CD    1 
ATOM   1722  N  N     . VAL C 3 49  ? -12.359 -1.715  24.710 1.00 66.57  ? 49   VAL C N     1 
ATOM   1723  C  CA    . VAL C 3 49  ? -12.032 -0.412  25.296 1.00 65.24  ? 49   VAL C CA    1 
ATOM   1724  C  C     . VAL C 3 49  ? -12.562 -0.317  26.711 1.00 58.19  ? 49   VAL C C     1 
ATOM   1725  O  O     . VAL C 3 49  ? -11.810 -0.038  27.652 1.00 59.70  ? 49   VAL C O     1 
ATOM   1726  C  CB    . VAL C 3 49  ? -12.567 0.738   24.414 1.00 70.10  ? 49   VAL C CB    1 
ATOM   1727  C  CG1   . VAL C 3 49  ? -12.731 2.047   25.194 1.00 72.96  ? 49   VAL C CG1   1 
ATOM   1728  C  CG2   . VAL C 3 49  ? -11.624 0.919   23.228 1.00 65.93  ? 49   VAL C CG2   1 
ATOM   1729  N  N     . TYR C 3 50  ? -13.848 -0.593  26.868 1.00 56.60  ? 50   TYR C N     1 
ATOM   1730  C  CA    . TYR C 3 50  ? -14.481 -0.491  28.178 1.00 59.23  ? 50   TYR C CA    1 
ATOM   1731  C  C     . TYR C 3 50  ? -13.861 -1.462  29.152 1.00 61.69  ? 50   TYR C C     1 
ATOM   1732  O  O     . TYR C 3 50  ? -13.601 -1.129  30.297 1.00 67.49  ? 50   TYR C O     1 
ATOM   1733  C  CB    . TYR C 3 50  ? -15.946 -0.785  28.036 1.00 60.56  ? 50   TYR C CB    1 
ATOM   1734  C  CG    . TYR C 3 50  ? -16.845 -0.363  29.182 1.00 63.33  ? 50   TYR C CG    1 
ATOM   1735  C  CD1   . TYR C 3 50  ? -17.960 0.442   28.950 1.00 65.64  ? 50   TYR C CD1   1 
ATOM   1736  C  CD2   . TYR C 3 50  ? -16.645 -0.811  30.465 1.00 63.08  ? 50   TYR C CD2   1 
ATOM   1737  C  CE1   . TYR C 3 50  ? -18.829 0.803   29.965 1.00 62.42  ? 50   TYR C CE1   1 
ATOM   1738  C  CE2   . TYR C 3 50  ? -17.516 -0.457  31.478 1.00 68.28  ? 50   TYR C CE2   1 
ATOM   1739  C  CZ    . TYR C 3 50  ? -18.609 0.351   31.224 1.00 67.07  ? 50   TYR C CZ    1 
ATOM   1740  O  OH    . TYR C 3 50  ? -19.477 0.710   32.246 1.00 64.65  ? 50   TYR C OH    1 
ATOM   1741  N  N     . LEU C 3 51  ? -13.627 -2.676  28.693 1.00 61.78  ? 51   LEU C N     1 
ATOM   1742  C  CA    . LEU C 3 51  ? -13.074 -3.703  29.557 1.00 62.07  ? 51   LEU C CA    1 
ATOM   1743  C  C     . LEU C 3 51  ? -11.630 -3.379  29.952 1.00 64.22  ? 51   LEU C C     1 
ATOM   1744  O  O     . LEU C 3 51  ? -11.234 -3.526  31.114 1.00 64.82  ? 51   LEU C O     1 
ATOM   1745  C  CB    . LEU C 3 51  ? -13.151 -5.078  28.860 1.00 64.72  ? 51   LEU C CB    1 
ATOM   1746  C  CG    . LEU C 3 51  ? -12.479 -6.285  29.543 1.00 62.26  ? 51   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C 3 51  ? -12.872 -6.504  30.997 1.00 59.88  ? 51   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C 3 51  ? -12.829 -7.499  28.732 1.00 64.02  ? 51   LEU C CD2   1 
ATOM   1749  N  N     . ALA C 3 52  ? -10.828 -2.953  28.989 1.00 60.80  ? 52   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3 52  ? -9.449  -2.659  29.306 1.00 59.17  ? 52   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3 52  ? -9.404  -1.558  30.355 1.00 58.82  ? 52   ALA C C     1 
ATOM   1752  O  O     . ALA C 3 52  ? -8.511  -1.525  31.215 1.00 60.09  ? 52   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3 52  ? -8.706  -2.251  28.063 1.00 59.10  ? 52   ALA C CB    1 
ATOM   1754  N  N     . ALA C 3 53  ? -10.388 -0.673  30.306 1.00 54.95  ? 53   ALA C N     1 
ATOM   1755  C  CA    . ALA C 3 53  ? -10.461 0.413   31.277 1.00 61.38  ? 53   ALA C CA    1 
ATOM   1756  C  C     . ALA C 3 53  ? -10.764 -0.079  32.690 1.00 60.87  ? 53   ALA C C     1 
ATOM   1757  O  O     . ALA C 3 53  ? -10.140 0.341   33.675 1.00 60.72  ? 53   ALA C O     1 
ATOM   1758  C  CB    . ALA C 3 53  ? -11.538 1.404   30.848 1.00 64.96  ? 53   ALA C CB    1 
ATOM   1759  N  N     . VAL C 3 54  ? -11.775 -0.931  32.778 1.00 55.10  ? 54   VAL C N     1 
ATOM   1760  C  CA    . VAL C 3 54  ? -12.136 -1.517  34.035 1.00 57.12  ? 54   VAL C CA    1 
ATOM   1761  C  C     . VAL C 3 54  ? -10.938 -2.285  34.622 1.00 56.66  ? 54   VAL C C     1 
ATOM   1762  O  O     . VAL C 3 54  ? -10.569 -2.134  35.809 1.00 50.34  ? 54   VAL C O     1 
ATOM   1763  C  CB    . VAL C 3 54  ? -13.374 -2.391  33.844 1.00 57.60  ? 54   VAL C CB    1 
ATOM   1764  C  CG1   . VAL C 3 54  ? -13.554 -3.376  34.996 1.00 56.31  ? 54   VAL C CG1   1 
ATOM   1765  C  CG2   . VAL C 3 54  ? -14.590 -1.485  33.720 1.00 57.89  ? 54   VAL C CG2   1 
ATOM   1766  N  N     . LEU C 3 55  ? -10.294 -3.056  33.764 1.00 55.79  ? 55   LEU C N     1 
ATOM   1767  C  CA    . LEU C 3 55  ? -9.134  -3.821  34.185 1.00 59.06  ? 55   LEU C CA    1 
ATOM   1768  C  C     . LEU C 3 55  ? -8.111  -2.909  34.760 1.00 57.53  ? 55   LEU C C     1 
ATOM   1769  O  O     . LEU C 3 55  ? -7.629  -3.169  35.837 1.00 58.95  ? 55   LEU C O     1 
ATOM   1770  C  CB    . LEU C 3 55  ? -8.543  -4.612  33.032 1.00 60.66  ? 55   LEU C CB    1 
ATOM   1771  C  CG    . LEU C 3 55  ? -9.499  -5.751  32.618 1.00 63.93  ? 55   LEU C CG    1 
ATOM   1772  C  CD1   . LEU C 3 55  ? -9.097  -6.391  31.297 1.00 67.36  ? 55   LEU C CD1   1 
ATOM   1773  C  CD2   . LEU C 3 55  ? -9.586  -6.827  33.685 1.00 60.26  ? 55   LEU C CD2   1 
ATOM   1774  N  N     . GLU C 3 56  ? -7.835  -1.814  34.071 1.00 58.17  ? 56   GLU C N     1 
ATOM   1775  C  CA    . GLU C 3 56  ? -6.835  -0.858  34.521 1.00 58.74  ? 56   GLU C CA    1 
ATOM   1776  C  C     . GLU C 3 56  ? -7.275  -0.180  35.827 1.00 54.00  ? 56   GLU C C     1 
ATOM   1777  O  O     . GLU C 3 56  ? -6.444  0.067   36.739 1.00 52.25  ? 56   GLU C O     1 
ATOM   1778  C  CB    . GLU C 3 56  ? -6.612  0.169   33.414 1.00 62.51  ? 56   GLU C CB    1 
ATOM   1779  C  CG    . GLU C 3 56  ? -5.439  1.124   33.588 1.00 63.69  ? 56   GLU C CG    1 
ATOM   1780  C  CD    . GLU C 3 56  ? -5.357  2.107   32.428 1.00 68.53  ? 56   GLU C CD    1 
ATOM   1781  O  OE1   . GLU C 3 56  ? -5.295  1.670   31.245 1.00 70.12  ? 56   GLU C OE1   1 
ATOM   1782  O  OE2   . GLU C 3 56  ? -5.373  3.323   32.678 1.00 76.37  ? 56   GLU C OE2   1 
ATOM   1783  N  N     . TYR C 3 57  ? -8.572  0.112   35.925 1.00 48.85  ? 57   TYR C N     1 
ATOM   1784  C  CA    . TYR C 3 57  ? -9.082  0.772   37.120 1.00 51.70  ? 57   TYR C CA    1 
ATOM   1785  C  C     . TYR C 3 57  ? -8.819  -0.105  38.341 1.00 59.10  ? 57   TYR C C     1 
ATOM   1786  O  O     . TYR C 3 57  ? -8.149  0.329   39.265 1.00 56.78  ? 57   TYR C O     1 
ATOM   1787  C  CB    . TYR C 3 57  ? -10.565 1.054   37.000 1.00 52.23  ? 57   TYR C CB    1 
ATOM   1788  C  CG    . TYR C 3 57  ? -11.200 1.313   38.340 1.00 56.72  ? 57   TYR C CG    1 
ATOM   1789  C  CD1   . TYR C 3 57  ? -10.795 2.371   39.130 1.00 61.82  ? 57   TYR C CD1   1 
ATOM   1790  C  CD2   . TYR C 3 57  ? -12.195 0.491   38.819 1.00 62.63  ? 57   TYR C CD2   1 
ATOM   1791  C  CE1   . TYR C 3 57  ? -11.362 2.598   40.377 1.00 69.32  ? 57   TYR C CE1   1 
ATOM   1792  C  CE2   . TYR C 3 57  ? -12.786 0.713   40.052 1.00 68.23  ? 57   TYR C CE2   1 
ATOM   1793  C  CZ    . TYR C 3 57  ? -12.364 1.765   40.838 1.00 72.04  ? 57   TYR C CZ    1 
ATOM   1794  O  OH    . TYR C 3 57  ? -12.950 1.966   42.078 1.00 72.73  ? 57   TYR C OH    1 
ATOM   1795  N  N     . LEU C 3 58  ? -9.293  -1.358  38.301 1.00 57.30  ? 58   LEU C N     1 
ATOM   1796  C  CA    . LEU C 3 58  ? -9.039  -2.323  39.374 1.00 53.34  ? 58   LEU C CA    1 
ATOM   1797  C  C     . LEU C 3 58  ? -7.548  -2.534  39.705 1.00 56.50  ? 58   LEU C C     1 
ATOM   1798  O  O     . LEU C 3 58  ? -7.142  -2.586  40.898 1.00 57.51  ? 58   LEU C O     1 
ATOM   1799  C  CB    . LEU C 3 58  ? -9.657  -3.662  39.035 1.00 52.13  ? 58   LEU C CB    1 
ATOM   1800  C  CG    . LEU C 3 58  ? -11.181 -3.648  39.035 1.00 56.06  ? 58   LEU C CG    1 
ATOM   1801  C  CD1   . LEU C 3 58  ? -11.795 -4.937  38.475 1.00 53.74  ? 58   LEU C CD1   1 
ATOM   1802  C  CD2   . LEU C 3 58  ? -11.735 -3.327  40.415 1.00 58.19  ? 58   LEU C CD2   1 
ATOM   1803  N  N     . THR C 3 59  ? -6.709  -2.628  38.694 1.00 46.11  ? 59   THR C N     1 
ATOM   1804  C  CA    . THR C 3 59  ? -5.349  -2.934  39.042 1.00 49.14  ? 59   THR C CA    1 
ATOM   1805  C  C     . THR C 3 59  ? -4.727  -1.721  39.666 1.00 52.57  ? 59   THR C C     1 
ATOM   1806  O  O     . THR C 3 59  ? -3.789  -1.849  40.475 1.00 57.33  ? 59   THR C O     1 
ATOM   1807  C  CB    . THR C 3 59  ? -4.492  -3.529  37.908 1.00 51.52  ? 59   THR C CB    1 
ATOM   1808  O  OG1   . THR C 3 59  ? -3.357  -2.693  37.613 1.00 51.81  ? 59   THR C OG1   1 
ATOM   1809  C  CG2   . THR C 3 59  ? -5.309  -3.776  36.694 1.00 51.53  ? 59   THR C CG2   1 
ATOM   1810  N  N     . ALA C 3 60  ? -5.247  -0.544  39.335 1.00 50.58  ? 60   ALA C N     1 
ATOM   1811  C  CA    . ALA C 3 60  ? -4.730  0.667   39.993 1.00 53.18  ? 60   ALA C CA    1 
ATOM   1812  C  C     . ALA C 3 60  ? -5.107  0.722   41.477 1.00 52.06  ? 60   ALA C C     1 
ATOM   1813  O  O     . ALA C 3 60  ? -4.292  1.059   42.357 1.00 48.00  ? 60   ALA C O     1 
ATOM   1814  C  CB    . ALA C 3 60  ? -5.213  1.907   39.274 1.00 56.33  ? 60   ALA C CB    1 
ATOM   1815  N  N     . GLU C 3 61  ? -6.345  0.333   41.746 1.00 52.97  ? 61   GLU C N     1 
ATOM   1816  C  CA    . GLU C 3 61  ? -6.918  0.414   43.080 1.00 51.42  ? 61   GLU C CA    1 
ATOM   1817  C  C     . GLU C 3 61  ? -6.164  -0.529  43.998 1.00 54.79  ? 61   GLU C C     1 
ATOM   1818  O  O     . GLU C 3 61  ? -5.855  -0.198  45.133 1.00 52.41  ? 61   GLU C O     1 
ATOM   1819  C  CB    . GLU C 3 61  ? -8.393  0.053   42.977 1.00 56.72  ? 61   GLU C CB    1 
ATOM   1820  C  CG    . GLU C 3 61  ? -9.176  0.198   44.256 1.00 71.29  ? 61   GLU C CG    1 
ATOM   1821  C  CD    . GLU C 3 61  ? -9.642  1.616   44.583 1.00 84.30  ? 61   GLU C CD    1 
ATOM   1822  O  OE1   . GLU C 3 61  ? -9.748  2.473   43.654 1.00 78.00  ? 61   GLU C OE1   1 
ATOM   1823  O  OE2   . GLU C 3 61  ? -9.951  1.836   45.794 1.00 91.05  ? 61   GLU C OE2   1 
ATOM   1824  N  N     . ILE C 3 62  ? -5.828  -1.706  43.494 1.00 52.65  ? 62   ILE C N     1 
ATOM   1825  C  CA    . ILE C 3 62  ? -5.110  -2.648  44.327 1.00 54.94  ? 62   ILE C CA    1 
ATOM   1826  C  C     . ILE C 3 62  ? -3.639  -2.253  44.548 1.00 52.03  ? 62   ILE C C     1 
ATOM   1827  O  O     . ILE C 3 62  ? -3.073  -2.419  45.642 1.00 50.70  ? 62   ILE C O     1 
ATOM   1828  C  CB    . ILE C 3 62  ? -5.257  -4.074  43.788 1.00 57.64  ? 62   ILE C CB    1 
ATOM   1829  C  CG1   . ILE C 3 62  ? -4.359  -5.017  44.525 1.00 58.07  ? 62   ILE C CG1   1 
ATOM   1830  C  CG2   . ILE C 3 62  ? -4.830  -4.165  42.349 1.00 69.31  ? 62   ILE C CG2   1 
ATOM   1831  C  CD1   . ILE C 3 62  ? -4.943  -6.393  44.493 1.00 72.06  ? 62   ILE C CD1   1 
ATOM   1832  N  N     . LEU C 3 63  ? -3.028  -1.710  43.512 1.00 52.34  ? 63   LEU C N     1 
ATOM   1833  C  CA    . LEU C 3 63  ? -1.648  -1.273  43.627 1.00 50.87  ? 63   LEU C CA    1 
ATOM   1834  C  C     . LEU C 3 63  ? -1.524  -0.083  44.581 1.00 50.65  ? 63   LEU C C     1 
ATOM   1835  O  O     . LEU C 3 63  ? -0.542  0.055   45.296 1.00 45.19  ? 63   LEU C O     1 
ATOM   1836  C  CB    . LEU C 3 63  ? -1.118  -0.950  42.259 1.00 52.09  ? 63   LEU C CB    1 
ATOM   1837  C  CG    . LEU C 3 63  ? -0.858  -2.204  41.421 1.00 56.37  ? 63   LEU C CG    1 
ATOM   1838  C  CD1   . LEU C 3 63  ? -0.533  -1.858  39.993 1.00 57.82  ? 63   LEU C CD1   1 
ATOM   1839  C  CD2   . LEU C 3 63  ? 0.293   -3.000  42.007 1.00 58.05  ? 63   LEU C CD2   1 
ATOM   1840  N  N     . GLU C 3 64  ? -2.545  0.748   44.642 1.00 50.28  ? 64   GLU C N     1 
ATOM   1841  C  CA    . GLU C 3 64  ? -2.454  1.888   45.502 1.00 55.70  ? 64   GLU C CA    1 
ATOM   1842  C  C     . GLU C 3 64  ? -2.363  1.360   46.917 1.00 57.09  ? 64   GLU C C     1 
ATOM   1843  O  O     . GLU C 3 64  ? -1.432  1.650   47.668 1.00 61.53  ? 64   GLU C O     1 
ATOM   1844  C  CB    . GLU C 3 64  ? -3.677  2.765   45.309 1.00 61.95  ? 64   GLU C CB    1 
ATOM   1845  C  CG    . GLU C 3 64  ? -3.741  3.986   46.220 1.00 68.96  ? 64   GLU C CG    1 
ATOM   1846  C  CD    . GLU C 3 64  ? -2.629  4.987   45.986 1.00 65.95  ? 64   GLU C CD    1 
ATOM   1847  O  OE1   . GLU C 3 64  ? -2.316  5.776   46.886 1.00 71.64  ? 64   GLU C OE1   1 
ATOM   1848  O  OE2   . GLU C 3 64  ? -2.072  4.986   44.897 1.00 71.37  ? 64   GLU C OE2   1 
ATOM   1849  N  N     . LEU C 3 65  ? -3.327  0.528   47.258 1.00 65.41  ? 65   LEU C N     1 
ATOM   1850  C  CA    . LEU C 3 65  ? -3.451  -0.023  48.611 1.00 60.48  ? 65   LEU C CA    1 
ATOM   1851  C  C     . LEU C 3 65  ? -2.280  -0.927  48.998 1.00 62.02  ? 65   LEU C C     1 
ATOM   1852  O  O     . LEU C 3 65  ? -1.839  -0.914  50.174 1.00 55.92  ? 65   LEU C O     1 
ATOM   1853  C  CB    . LEU C 3 65  ? -4.742  -0.811  48.705 1.00 55.76  ? 65   LEU C CB    1 
ATOM   1854  C  CG    . LEU C 3 65  ? -6.016  0.032   48.603 1.00 53.39  ? 65   LEU C CG    1 
ATOM   1855  C  CD1   . LEU C 3 65  ? -7.208  -0.900  48.438 1.00 57.60  ? 65   LEU C CD1   1 
ATOM   1856  C  CD2   . LEU C 3 65  ? -6.218  0.876   49.838 1.00 48.88  ? 65   LEU C CD2   1 
ATOM   1857  N  N     . ALA C 3 66  ? -1.797  -1.704  48.022 1.00 54.53  ? 66   ALA C N     1 
ATOM   1858  C  CA    . ALA C 3 66  ? -0.632  -2.547  48.237 1.00 55.41  ? 66   ALA C CA    1 
ATOM   1859  C  C     . ALA C 3 66  ? 0.631   -1.712  48.473 1.00 57.34  ? 66   ALA C C     1 
ATOM   1860  O  O     . ALA C 3 66  ? 1.441   -1.976  49.384 1.00 49.34  ? 66   ALA C O     1 
ATOM   1861  C  CB    . ALA C 3 66  ? -0.446  -3.447  47.048 1.00 58.96  ? 66   ALA C CB    1 
ATOM   1862  N  N     . GLY C 3 67  ? 0.789   -0.676  47.667 1.00 58.11  ? 67   GLY C N     1 
ATOM   1863  C  CA    . GLY C 3 67  ? 1.865   0.261   47.912 1.00 61.39  ? 67   GLY C CA    1 
ATOM   1864  C  C     . GLY C 3 67  ? 1.845   0.774   49.355 1.00 59.20  ? 67   GLY C C     1 
ATOM   1865  O  O     . GLY C 3 67  ? 2.886   0.861   50.018 1.00 57.46  ? 67   GLY C O     1 
ATOM   1866  N  N     . ASN C 3 68  ? 0.675   1.105   49.877 1.00 53.15  ? 68   ASN C N     1 
ATOM   1867  C  CA    . ASN C 3 68  ? 0.669   1.640   51.236 1.00 55.92  ? 68   ASN C CA    1 
ATOM   1868  C  C     . ASN C 3 68  ? 1.059   0.593   52.237 1.00 58.07  ? 68   ASN C C     1 
ATOM   1869  O  O     . ASN C 3 68  ? 1.691   0.877   53.248 1.00 61.66  ? 68   ASN C O     1 
ATOM   1870  C  CB    . ASN C 3 68  ? -0.674  2.231   51.601 1.00 58.54  ? 68   ASN C CB    1 
ATOM   1871  C  CG    . ASN C 3 68  ? -1.120  3.297   50.614 1.00 61.82  ? 68   ASN C CG    1 
ATOM   1872  O  OD1   . ASN C 3 68  ? -0.304  3.905   49.912 1.00 60.47  ? 68   ASN C OD1   1 
ATOM   1873  N  ND2   . ASN C 3 68  ? -2.416  3.518   50.549 1.00 61.10  ? 68   ASN C ND2   1 
ATOM   1874  N  N     . ALA C 3 69  ? 0.731   -0.651  51.958 1.00 59.08  ? 69   ALA C N     1 
ATOM   1875  C  CA    . ALA C 3 69  ? 1.114   -1.664  52.898 1.00 60.02  ? 69   ALA C CA    1 
ATOM   1876  C  C     . ALA C 3 69  ? 2.611   -1.811  52.866 1.00 60.62  ? 69   ALA C C     1 
ATOM   1877  O  O     . ALA C 3 69  ? 3.239   -1.894  53.912 1.00 64.29  ? 69   ALA C O     1 
ATOM   1878  C  CB    . ALA C 3 69  ? 0.440   -2.971  52.587 1.00 66.33  ? 69   ALA C CB    1 
ATOM   1879  N  N     . ALA C 3 70  ? 3.192   -1.827  51.672 1.00 61.44  ? 70   ALA C N     1 
ATOM   1880  C  CA    . ALA C 3 70  ? 4.658   -1.825  51.561 1.00 62.35  ? 70   ALA C CA    1 
ATOM   1881  C  C     . ALA C 3 70  ? 5.259   -0.693  52.390 1.00 60.57  ? 70   ALA C C     1 
ATOM   1882  O  O     . ALA C 3 70  ? 6.184   -0.892  53.151 1.00 61.58  ? 70   ALA C O     1 
ATOM   1883  C  CB    . ALA C 3 70  ? 5.085   -1.665  50.121 1.00 59.06  ? 70   ALA C CB    1 
ATOM   1884  N  N     . ARG C 3 71  ? 4.725   0.505   52.241 1.00 63.23  ? 71   ARG C N     1 
ATOM   1885  C  CA    . ARG C 3 71  ? 5.309   1.634   52.920 1.00 62.30  ? 71   ARG C CA    1 
ATOM   1886  C  C     . ARG C 3 71  ? 5.073   1.526   54.402 1.00 54.89  ? 71   ARG C C     1 
ATOM   1887  O  O     . ARG C 3 71  ? 5.958   1.830   55.172 1.00 57.54  ? 71   ARG C O     1 
ATOM   1888  C  CB    . ARG C 3 71  ? 4.775   2.956   52.376 1.00 70.17  ? 71   ARG C CB    1 
ATOM   1889  C  CG    . ARG C 3 71  ? 4.891   4.100   53.375 1.00 80.05  ? 71   ARG C CG    1 
ATOM   1890  C  CD    . ARG C 3 71  ? 4.504   5.439   52.805 1.00 89.88  ? 71   ARG C CD    1 
ATOM   1891  N  NE    . ARG C 3 71  ? 5.485   5.905   51.825 1.00 106.20 ? 71   ARG C NE    1 
ATOM   1892  C  CZ    . ARG C 3 71  ? 5.533   7.140   51.332 1.00 116.49 ? 71   ARG C CZ    1 
ATOM   1893  N  NH1   . ARG C 3 71  ? 4.657   8.065   51.729 1.00 123.50 ? 71   ARG C NH1   1 
ATOM   1894  N  NH2   . ARG C 3 71  ? 6.462   7.454   50.434 1.00 115.40 ? 71   ARG C NH2   1 
ATOM   1895  N  N     . ASP C 3 72  ? 3.894   1.096   54.820 1.00 56.23  ? 72   ASP C N     1 
ATOM   1896  C  CA    . ASP C 3 72  ? 3.658   0.855   56.253 1.00 65.84  ? 72   ASP C CA    1 
ATOM   1897  C  C     . ASP C 3 72  ? 4.649   -0.174  56.905 1.00 72.54  ? 72   ASP C C     1 
ATOM   1898  O  O     . ASP C 3 72  ? 4.736   -0.245  58.123 1.00 77.90  ? 72   ASP C O     1 
ATOM   1899  C  CB    . ASP C 3 72  ? 2.233   0.335   56.486 1.00 64.77  ? 72   ASP C CB    1 
ATOM   1900  C  CG    . ASP C 3 72  ? 1.145   1.367   56.209 1.00 67.60  ? 72   ASP C CG    1 
ATOM   1901  O  OD1   . ASP C 3 72  ? 1.338   2.590   56.428 1.00 68.99  ? 72   ASP C OD1   1 
ATOM   1902  O  OD2   . ASP C 3 72  ? 0.050   0.930   55.781 1.00 69.18  ? 72   ASP C OD2   1 
ATOM   1903  N  N     . ASN C 3 73  ? 5.331   -0.991  56.096 1.00 72.61  ? 73   ASN C N     1 
ATOM   1904  C  CA    . ASN C 3 73  ? 6.331   -1.972  56.558 1.00 83.38  ? 73   ASN C CA    1 
ATOM   1905  C  C     . ASN C 3 73  ? 7.747   -1.524  56.233 1.00 80.11  ? 73   ASN C C     1 
ATOM   1906  O  O     . ASN C 3 73  ? 8.682   -2.313  56.242 1.00 85.36  ? 73   ASN C O     1 
ATOM   1907  C  CB    . ASN C 3 73  ? 6.149   -3.320  55.840 1.00 95.33  ? 73   ASN C CB    1 
ATOM   1908  C  CG    . ASN C 3 73  ? 5.007   -4.148  56.385 1.00 109.67 ? 73   ASN C CG    1 
ATOM   1909  O  OD1   . ASN C 3 73  ? 5.244   -5.242  56.883 1.00 115.97 ? 73   ASN C OD1   1 
ATOM   1910  N  ND2   . ASN C 3 73  ? 3.759   -3.661  56.249 1.00 107.95 ? 73   ASN C ND2   1 
ATOM   1911  N  N     . LYS C 3 74  ? 7.906   -0.265  55.901 1.00 79.19  ? 74   LYS C N     1 
ATOM   1912  C  CA    . LYS C 3 74  ? 9.191   0.248   55.431 1.00 79.90  ? 74   LYS C CA    1 
ATOM   1913  C  C     . LYS C 3 74  ? 9.817   -0.571  54.323 1.00 71.50  ? 74   LYS C C     1 
ATOM   1914  O  O     . LYS C 3 74  ? 10.998  -0.851  54.358 1.00 70.22  ? 74   LYS C O     1 
ATOM   1915  C  CB    . LYS C 3 74  ? 10.160  0.374   56.602 1.00 90.50  ? 74   LYS C CB    1 
ATOM   1916  C  CG    . LYS C 3 74  ? 9.691   1.344   57.684 1.00 102.76 ? 74   LYS C CG    1 
ATOM   1917  C  CD    . LYS C 3 74  ? 10.090  0.889   59.075 1.00 111.28 ? 74   LYS C CD    1 
ATOM   1918  C  CE    . LYS C 3 74  ? 9.050   1.320   60.092 1.00 119.62 ? 74   LYS C CE    1 
ATOM   1919  N  NZ    . LYS C 3 74  ? 9.401   0.783   61.432 1.00 127.52 ? 74   LYS C NZ    1 
ATOM   1920  N  N     . LYS C 3 75  ? 9.030   -0.933  53.322 1.00 69.17  ? 75   LYS C N     1 
ATOM   1921  C  CA    . LYS C 3 75  ? 9.568   -1.616  52.147 1.00 68.06  ? 75   LYS C CA    1 
ATOM   1922  C  C     . LYS C 3 75  ? 9.217   -0.848  50.912 1.00 63.49  ? 75   LYS C C     1 
ATOM   1923  O  O     . LYS C 3 75  ? 8.218   -0.140  50.864 1.00 72.84  ? 75   LYS C O     1 
ATOM   1924  C  CB    . LYS C 3 75  ? 8.940   -2.987  51.983 1.00 71.76  ? 75   LYS C CB    1 
ATOM   1925  C  CG    . LYS C 3 75  ? 9.091   -3.867  53.186 1.00 71.15  ? 75   LYS C CG    1 
ATOM   1926  C  CD    . LYS C 3 75  ? 10.442  -4.528  53.180 1.00 71.08  ? 75   LYS C CD    1 
ATOM   1927  C  CE    . LYS C 3 75  ? 10.589  -5.449  54.383 1.00 74.51  ? 75   LYS C CE    1 
ATOM   1928  N  NZ    . LYS C 3 75  ? 10.112  -4.852  55.667 1.00 75.45  ? 75   LYS C NZ    1 
ATOM   1929  N  N     . THR C 3 76  ? 10.012  -1.091  49.896 1.00 58.91  ? 76   THR C N     1 
ATOM   1930  C  CA    . THR C 3 76  ? 9.972   -0.411  48.634 1.00 60.87  ? 76   THR C CA    1 
ATOM   1931  C  C     . THR C 3 76  ? 9.444   -1.330  47.552 1.00 67.07  ? 76   THR C C     1 
ATOM   1932  O  O     . THR C 3 76  ? 8.983   -0.868  46.495 1.00 71.67  ? 76   THR C O     1 
ATOM   1933  C  CB    . THR C 3 76  ? 11.416  0.011   48.279 1.00 66.22  ? 76   THR C CB    1 
ATOM   1934  O  OG1   . THR C 3 76  ? 11.656  1.279   48.893 1.00 69.43  ? 76   THR C OG1   1 
ATOM   1935  C  CG2   . THR C 3 76  ? 11.696  0.074   46.733 1.00 65.07  ? 76   THR C CG2   1 
ATOM   1936  N  N     . ARG C 3 77  ? 9.552   -2.634  47.779 1.00 67.33  ? 77   ARG C N     1 
ATOM   1937  C  CA    . ARG C 3 77  ? 9.075   -3.587  46.812 1.00 63.53  ? 77   ARG C CA    1 
ATOM   1938  C  C     . ARG C 3 77  ? 7.854   -4.306  47.327 1.00 58.58  ? 77   ARG C C     1 
ATOM   1939  O  O     . ARG C 3 77  ? 7.913   -5.006  48.339 1.00 63.72  ? 77   ARG C O     1 
ATOM   1940  C  CB    . ARG C 3 77  ? 10.155  -4.583  46.504 1.00 68.81  ? 77   ARG C CB    1 
ATOM   1941  C  CG    . ARG C 3 77  ? 9.888   -5.291  45.192 1.00 76.61  ? 77   ARG C CG    1 
ATOM   1942  C  CD    . ARG C 3 77  ? 10.880  -6.397  45.001 1.00 80.44  ? 77   ARG C CD    1 
ATOM   1943  N  NE    . ARG C 3 77  ? 12.213  -5.854  44.793 1.00 84.97  ? 77   ARG C NE    1 
ATOM   1944  C  CZ    . ARG C 3 77  ? 13.273  -6.070  45.571 1.00 92.84  ? 77   ARG C CZ    1 
ATOM   1945  N  NH1   . ARG C 3 77  ? 13.198  -6.830  46.669 1.00 88.62  ? 77   ARG C NH1   1 
ATOM   1946  N  NH2   . ARG C 3 77  ? 14.433  -5.510  45.231 1.00 101.14 ? 77   ARG C NH2   1 
ATOM   1947  N  N     . ILE C 3 78  ? 6.747   -4.111  46.633 1.00 55.07  ? 78   ILE C N     1 
ATOM   1948  C  CA    . ILE C 3 78  ? 5.518   -4.824  46.929 1.00 56.37  ? 78   ILE C CA    1 
ATOM   1949  C  C     . ILE C 3 78  ? 5.748   -6.316  46.728 1.00 59.17  ? 78   ILE C C     1 
ATOM   1950  O  O     . ILE C 3 78  ? 6.185   -6.734  45.657 1.00 61.21  ? 78   ILE C O     1 
ATOM   1951  C  CB    . ILE C 3 78  ? 4.374   -4.424  45.972 1.00 54.35  ? 78   ILE C CB    1 
ATOM   1952  C  CG1   . ILE C 3 78  ? 3.862   -3.018  46.303 1.00 56.74  ? 78   ILE C CG1   1 
ATOM   1953  C  CG2   . ILE C 3 78  ? 3.239   -5.413  46.103 1.00 55.26  ? 78   ILE C CG2   1 
ATOM   1954  C  CD1   . ILE C 3 78  ? 2.962   -2.396  45.254 1.00 55.56  ? 78   ILE C CD1   1 
ATOM   1955  N  N     . ILE C 3 79  ? 5.411   -7.103  47.735 1.00 55.91  ? 79   ILE C N     1 
ATOM   1956  C  CA    . ILE C 3 79  ? 5.425   -8.569  47.660 1.00 57.32  ? 79   ILE C CA    1 
ATOM   1957  C  C     . ILE C 3 79  ? 4.008   -9.099  47.966 1.00 61.43  ? 79   ILE C C     1 
ATOM   1958  O  O     . ILE C 3 79  ? 3.110   -8.327  48.365 1.00 65.56  ? 79   ILE C O     1 
ATOM   1959  C  CB    . ILE C 3 79  ? 6.438   -9.129  48.683 1.00 54.09  ? 79   ILE C CB    1 
ATOM   1960  C  CG1   . ILE C 3 79  ? 5.992   -8.854  50.138 1.00 47.02  ? 79   ILE C CG1   1 
ATOM   1961  C  CG2   . ILE C 3 79  ? 7.782   -8.466  48.444 1.00 58.68  ? 79   ILE C CG2   1 
ATOM   1962  C  CD1   . ILE C 3 79  ? 6.938   -9.400  51.167 1.00 41.85  ? 79   ILE C CD1   1 
ATOM   1963  N  N     . PRO C 3 80  ? 3.795   -10.412 47.828 1.00 53.64  ? 80   PRO C N     1 
ATOM   1964  C  CA    . PRO C 3 80  ? 2.437   -10.936 48.017 1.00 49.74  ? 80   PRO C CA    1 
ATOM   1965  C  C     . PRO C 3 80  ? 1.825   -10.620 49.359 1.00 46.11  ? 80   PRO C C     1 
ATOM   1966  O  O     . PRO C 3 80  ? 0.654   -10.351 49.421 1.00 46.38  ? 80   PRO C O     1 
ATOM   1967  C  CB    . PRO C 3 80  ? 2.611   -12.440 47.815 1.00 47.93  ? 80   PRO C CB    1 
ATOM   1968  C  CG    . PRO C 3 80  ? 3.694   -12.510 46.793 1.00 49.96  ? 80   PRO C CG    1 
ATOM   1969  C  CD    . PRO C 3 80  ? 4.669   -11.417 47.217 1.00 56.35  ? 80   PRO C CD    1 
ATOM   1970  N  N     . ARG C 3 81  ? 2.589   -10.604 50.436 1.00 46.73  ? 81   ARG C N     1 
ATOM   1971  C  CA    . ARG C 3 81  ? 1.951   -10.236 51.714 1.00 45.23  ? 81   ARG C CA    1 
ATOM   1972  C  C     . ARG C 3 81  ? 1.282   -8.888  51.625 1.00 49.52  ? 81   ARG C C     1 
ATOM   1973  O  O     . ARG C 3 81  ? 0.182   -8.714  52.173 1.00 54.22  ? 81   ARG C O     1 
ATOM   1974  C  CB    . ARG C 3 81  ? 2.894   -10.279 52.911 1.00 40.90  ? 81   ARG C CB    1 
ATOM   1975  C  CG    . ARG C 3 81  ? 2.385   -9.433  54.035 1.00 49.88  ? 81   ARG C CG    1 
ATOM   1976  C  CD    . ARG C 3 81  ? 2.277   -10.062 55.427 1.00 53.46  ? 81   ARG C CD    1 
ATOM   1977  N  NE    . ARG C 3 81  ? 1.117   -10.922 55.469 1.00 57.08  ? 81   ARG C NE    1 
ATOM   1978  C  CZ    . ARG C 3 81  ? 0.307   -11.133 56.514 1.00 59.34  ? 81   ARG C CZ    1 
ATOM   1979  N  NH1   . ARG C 3 81  ? 0.449   -10.547 57.697 1.00 50.28  ? 81   ARG C NH1   1 
ATOM   1980  N  NH2   . ARG C 3 81  ? -0.680  -12.004 56.360 1.00 64.03  ? 81   ARG C NH2   1 
ATOM   1981  N  N     . HIS C 3 82  ? 1.893   -7.934  50.914 1.00 53.30  ? 82   HIS C N     1 
ATOM   1982  C  CA    . HIS C 3 82  ? 1.285   -6.576  50.801 1.00 50.13  ? 82   HIS C CA    1 
ATOM   1983  C  C     . HIS C 3 82  ? 0.010   -6.582  49.983 1.00 51.53  ? 82   HIS C C     1 
ATOM   1984  O  O     . HIS C 3 82  ? -0.941  -5.874  50.346 1.00 55.81  ? 82   HIS C O     1 
ATOM   1985  C  CB    . HIS C 3 82  ? 2.208   -5.546  50.191 1.00 47.61  ? 82   HIS C CB    1 
ATOM   1986  C  CG    . HIS C 3 82  ? 3.536   -5.451  50.861 1.00 47.01  ? 82   HIS C CG    1 
ATOM   1987  N  ND1   . HIS C 3 82  ? 4.715   -5.470  50.154 1.00 50.92  ? 82   HIS C ND1   1 
ATOM   1988  C  CD2   . HIS C 3 82  ? 3.881   -5.420  52.163 1.00 45.99  ? 82   HIS C CD2   1 
ATOM   1989  C  CE1   . HIS C 3 82  ? 5.734   -5.425  50.988 1.00 50.21  ? 82   HIS C CE1   1 
ATOM   1990  N  NE2   . HIS C 3 82  ? 5.255   -5.401  52.217 1.00 49.33  ? 82   HIS C NE2   1 
ATOM   1991  N  N     . LEU C 3 83  ? -0.016  -7.370  48.904 1.00 49.70  ? 83   LEU C N     1 
ATOM   1992  C  CA    . LEU C 3 83  ? -1.264  -7.598  48.148 1.00 51.92  ? 83   LEU C CA    1 
ATOM   1993  C  C     . LEU C 3 83  ? -2.365  -8.178  49.036 1.00 51.20  ? 83   LEU C C     1 
ATOM   1994  O  O     . LEU C 3 83  ? -3.544  -7.804  48.967 1.00 49.10  ? 83   LEU C O     1 
ATOM   1995  C  CB    . LEU C 3 83  ? -1.028  -8.527  46.973 1.00 50.26  ? 83   LEU C CB    1 
ATOM   1996  C  CG    . LEU C 3 83  ? -0.101  -7.947  45.895 1.00 56.06  ? 83   LEU C CG    1 
ATOM   1997  C  CD1   . LEU C 3 83  ? 0.239   -9.000  44.842 1.00 60.08  ? 83   LEU C CD1   1 
ATOM   1998  C  CD2   . LEU C 3 83  ? -0.723  -6.759  45.205 1.00 53.01  ? 83   LEU C CD2   1 
ATOM   1999  N  N     . GLN C 3 84  ? -1.972  -9.068  49.914 1.00 48.69  ? 84   GLN C N     1 
ATOM   2000  C  CA    . GLN C 3 84  ? -2.950  -9.703  50.713 1.00 49.78  ? 84   GLN C CA    1 
ATOM   2001  C  C     . GLN C 3 84  ? -3.483  -8.677  51.744 1.00 50.60  ? 84   GLN C C     1 
ATOM   2002  O  O     . GLN C 3 84  ? -4.704  -8.555  51.950 1.00 48.82  ? 84   GLN C O     1 
ATOM   2003  C  CB    . GLN C 3 84  ? -2.328  -10.935 51.351 1.00 48.94  ? 84   GLN C CB    1 
ATOM   2004  C  CG    . GLN C 3 84  ? -3.143  -11.512 52.500 1.00 52.95  ? 84   GLN C CG    1 
ATOM   2005  C  CD    . GLN C 3 84  ? -4.336  -12.373 52.099 1.00 49.87  ? 84   GLN C CD    1 
ATOM   2006  O  OE1   . GLN C 3 84  ? -4.971  -12.231 51.045 1.00 55.15  ? 84   GLN C OE1   1 
ATOM   2007  N  NE2   . GLN C 3 84  ? -4.643  -13.280 52.965 1.00 48.69  ? 84   GLN C NE2   1 
ATOM   2008  N  N     . LEU C 3 85  ? -2.581  -7.943  52.382 1.00 44.07  ? 85   LEU C N     1 
ATOM   2009  C  CA    . LEU C 3 85  ? -3.018  -6.938  53.334 1.00 48.59  ? 85   LEU C CA    1 
ATOM   2010  C  C     . LEU C 3 85  ? -3.952  -5.932  52.676 1.00 51.18  ? 85   LEU C C     1 
ATOM   2011  O  O     . LEU C 3 85  ? -4.938  -5.526  53.268 1.00 49.53  ? 85   LEU C O     1 
ATOM   2012  C  CB    . LEU C 3 85  ? -1.815  -6.190  53.878 1.00 54.07  ? 85   LEU C CB    1 
ATOM   2013  C  CG    . LEU C 3 85  ? -0.986  -6.978  54.870 1.00 56.75  ? 85   LEU C CG    1 
ATOM   2014  C  CD1   . LEU C 3 85  ? 0.236   -6.171  55.191 1.00 57.06  ? 85   LEU C CD1   1 
ATOM   2015  C  CD2   . LEU C 3 85  ? -1.790  -7.286  56.132 1.00 58.34  ? 85   LEU C CD2   1 
ATOM   2016  N  N     . ALA C 3 86  ? -3.619  -5.521  51.453 1.00 48.91  ? 86   ALA C N     1 
ATOM   2017  C  CA    . ALA C 3 86  ? -4.464  -4.626  50.675 1.00 50.67  ? 86   ALA C CA    1 
ATOM   2018  C  C     . ALA C 3 86  ? -5.868  -5.171  50.436 1.00 52.99  ? 86   ALA C C     1 
ATOM   2019  O  O     . ALA C 3 86  ? -6.848  -4.527  50.746 1.00 56.62  ? 86   ALA C O     1 
ATOM   2020  C  CB    . ALA C 3 86  ? -3.802  -4.345  49.336 1.00 56.72  ? 86   ALA C CB    1 
ATOM   2021  N  N     . VAL C 3 87  ? -5.951  -6.354  49.847 1.00 55.02  ? 87   VAL C N     1 
ATOM   2022  C  CA    . VAL C 3 87  ? -7.230  -6.968  49.541 1.00 51.32  ? 87   VAL C CA    1 
ATOM   2023  C  C     . VAL C 3 87  ? -8.064  -7.241  50.810 1.00 50.73  ? 87   VAL C C     1 
ATOM   2024  O  O     . VAL C 3 87  ? -9.251  -6.942  50.865 1.00 49.90  ? 87   VAL C O     1 
ATOM   2025  C  CB    . VAL C 3 87  ? -6.990  -8.288  48.789 1.00 54.30  ? 87   VAL C CB    1 
ATOM   2026  C  CG1   . VAL C 3 87  ? -8.271  -9.072  48.632 1.00 60.76  ? 87   VAL C CG1   1 
ATOM   2027  C  CG2   . VAL C 3 87  ? -6.421  -8.037  47.402 1.00 57.83  ? 87   VAL C CG2   1 
ATOM   2028  N  N     . ARG C 3 88  ? -7.444  -7.824  51.828 1.00 45.23  ? 88   ARG C N     1 
ATOM   2029  C  CA    . ARG C 3 88  ? -8.209  -8.281  52.960 1.00 44.17  ? 88   ARG C CA    1 
ATOM   2030  C  C     . ARG C 3 88  ? -8.595  -7.158  53.835 1.00 44.56  ? 88   ARG C C     1 
ATOM   2031  O  O     . ARG C 3 88  ? -9.517  -7.295  54.600 1.00 51.97  ? 88   ARG C O     1 
ATOM   2032  C  CB    . ARG C 3 88  ? -7.456  -9.356  53.765 1.00 43.29  ? 88   ARG C CB    1 
ATOM   2033  C  CG    . ARG C 3 88  ? -7.117  -10.625 52.950 1.00 41.13  ? 88   ARG C CG    1 
ATOM   2034  C  CD    . ARG C 3 88  ? -8.329  -11.089 52.144 1.00 37.92  ? 88   ARG C CD    1 
ATOM   2035  N  NE    . ARG C 3 88  ? -8.015  -11.934 50.995 1.00 35.82  ? 88   ARG C NE    1 
ATOM   2036  C  CZ    . ARG C 3 88  ? -8.935  -12.332 50.120 1.00 37.95  ? 88   ARG C CZ    1 
ATOM   2037  N  NH1   . ARG C 3 88  ? -10.223 -11.936 50.211 1.00 40.58  ? 88   ARG C NH1   1 
ATOM   2038  N  NH2   . ARG C 3 88  ? -8.587  -13.114 49.129 1.00 36.30  ? 88   ARG C NH2   1 
ATOM   2039  N  N     . ASN C 3 89  ? -7.906  -6.035  53.741 1.00 50.01  ? 89   ASN C N     1 
ATOM   2040  C  CA    . ASN C 3 89  ? -8.268  -4.861  54.560 1.00 50.45  ? 89   ASN C CA    1 
ATOM   2041  C  C     . ASN C 3 89  ? -9.326  -3.969  53.940 1.00 51.60  ? 89   ASN C C     1 
ATOM   2042  O  O     . ASN C 3 89  ? -9.902  -3.156  54.656 1.00 50.30  ? 89   ASN C O     1 
ATOM   2043  C  CB    . ASN C 3 89  ? -7.054  -4.063  54.954 1.00 49.43  ? 89   ASN C CB    1 
ATOM   2044  C  CG    . ASN C 3 89  ? -6.344  -4.675  56.149 1.00 52.79  ? 89   ASN C CG    1 
ATOM   2045  O  OD1   . ASN C 3 89  ? -6.975  -4.940  57.150 1.00 47.16  ? 89   ASN C OD1   1 
ATOM   2046  N  ND2   . ASN C 3 89  ? -5.044  -4.931  56.037 1.00 60.38  ? 89   ASN C ND2   1 
ATOM   2047  N  N     . ASP C 3 90  ? -9.628  -4.200  52.654 1.00 48.85  ? 90   ASP C N     1 
ATOM   2048  C  CA    . ASP C 3 90  ? -10.626 -3.463  51.925 1.00 47.97  ? 90   ASP C CA    1 
ATOM   2049  C  C     . ASP C 3 90  ? -11.885 -4.272  51.680 1.00 57.90  ? 90   ASP C C     1 
ATOM   2050  O  O     . ASP C 3 90  ? -11.907 -5.181  50.856 1.00 65.63  ? 90   ASP C O     1 
ATOM   2051  C  CB    . ASP C 3 90  ? -10.088 -3.087  50.577 1.00 52.25  ? 90   ASP C CB    1 
ATOM   2052  C  CG    . ASP C 3 90  ? -11.072 -2.283  49.791 1.00 61.82  ? 90   ASP C CG    1 
ATOM   2053  O  OD1   . ASP C 3 90  ? -11.193 -1.070  50.065 1.00 69.09  ? 90   ASP C OD1   1 
ATOM   2054  O  OD2   . ASP C 3 90  ? -11.743 -2.868  48.911 1.00 69.50  ? 90   ASP C OD2   1 
ATOM   2055  N  N     . GLU C 3 91  ? -12.957 -3.890  52.350 1.00 61.30  ? 91   GLU C N     1 
ATOM   2056  C  CA    . GLU C 3 91  ? -14.232 -4.570  52.243 1.00 58.39  ? 91   GLU C CA    1 
ATOM   2057  C  C     . GLU C 3 91  ? -14.597 -5.045  50.846 1.00 55.77  ? 91   GLU C C     1 
ATOM   2058  O  O     . GLU C 3 91  ? -15.038 -6.181  50.675 1.00 54.57  ? 91   GLU C O     1 
ATOM   2059  C  CB    . GLU C 3 91  ? -15.323 -3.641  52.730 1.00 67.49  ? 91   GLU C CB    1 
ATOM   2060  C  CG    . GLU C 3 91  ? -16.319 -4.304  53.653 1.00 79.19  ? 91   GLU C CG    1 
ATOM   2061  C  CD    . GLU C 3 91  ? -17.556 -3.459  53.790 1.00 93.65  ? 91   GLU C CD    1 
ATOM   2062  O  OE1   . GLU C 3 91  ? -18.279 -3.287  52.780 1.00 96.53  ? 91   GLU C OE1   1 
ATOM   2063  O  OE2   . GLU C 3 91  ? -17.783 -2.950  54.902 1.00 103.30 ? 91   GLU C OE2   1 
ATOM   2064  N  N     . GLU C 3 92  ? -14.438 -4.177  49.851 1.00 55.88  ? 92   GLU C N     1 
ATOM   2065  C  CA    . GLU C 3 92  ? -14.938 -4.480  48.502 1.00 53.83  ? 92   GLU C CA    1 
ATOM   2066  C  C     . GLU C 3 92  ? -14.008 -5.347  47.681 1.00 52.66  ? 92   GLU C C     1 
ATOM   2067  O  O     . GLU C 3 92  ? -14.463 -6.220  46.977 1.00 51.23  ? 92   GLU C O     1 
ATOM   2068  C  CB    . GLU C 3 92  ? -15.272 -3.209  47.741 1.00 55.31  ? 92   GLU C CB    1 
ATOM   2069  C  CG    . GLU C 3 92  ? -16.568 -2.616  48.238 1.00 62.19  ? 92   GLU C CG    1 
ATOM   2070  C  CD    . GLU C 3 92  ? -17.122 -1.538  47.342 1.00 70.86  ? 92   GLU C CD    1 
ATOM   2071  O  OE1   . GLU C 3 92  ? -16.383 -1.075  46.450 1.00 73.54  ? 92   GLU C OE1   1 
ATOM   2072  O  OE2   . GLU C 3 92  ? -18.301 -1.162  47.538 1.00 74.06  ? 92   GLU C OE2   1 
ATOM   2073  N  N     . LEU C 3 93  ? -12.708 -5.102  47.752 1.00 52.75  ? 93   LEU C N     1 
ATOM   2074  C  CA    . LEU C 3 93  ? -11.757 -6.046  47.171 1.00 55.61  ? 93   LEU C CA    1 
ATOM   2075  C  C     . LEU C 3 93  ? -11.774 -7.414  47.880 1.00 55.91  ? 93   LEU C C     1 
ATOM   2076  O  O     . LEU C 3 93  ? -11.684 -8.445  47.228 1.00 54.87  ? 93   LEU C O     1 
ATOM   2077  C  CB    . LEU C 3 93  ? -10.360 -5.468  47.224 1.00 55.01  ? 93   LEU C CB    1 
ATOM   2078  C  CG    . LEU C 3 93  ? -10.055 -4.370  46.226 1.00 52.72  ? 93   LEU C CG    1 
ATOM   2079  C  CD1   . LEU C 3 93  ? -8.678  -3.829  46.549 1.00 56.43  ? 93   LEU C CD1   1 
ATOM   2080  C  CD2   . LEU C 3 93  ? -10.063 -4.906  44.803 1.00 51.98  ? 93   LEU C CD2   1 
ATOM   2081  N  N     . ASN C 3 94  ? -11.900 -7.418  49.207 1.00 55.46  ? 94   ASN C N     1 
ATOM   2082  C  CA    . ASN C 3 94  ? -12.111 -8.661  49.933 1.00 54.04  ? 94   ASN C CA    1 
ATOM   2083  C  C     . ASN C 3 94  ? -13.306 -9.484  49.460 1.00 48.66  ? 94   ASN C C     1 
ATOM   2084  O  O     . ASN C 3 94  ? -13.262 -10.690 49.467 1.00 55.63  ? 94   ASN C O     1 
ATOM   2085  C  CB    . ASN C 3 94  ? -12.293 -8.429  51.424 1.00 51.32  ? 94   ASN C CB    1 
ATOM   2086  C  CG    . ASN C 3 94  ? -12.320 -9.729  52.174 1.00 45.52  ? 94   ASN C CG    1 
ATOM   2087  O  OD1   . ASN C 3 94  ? -11.455 -10.539 51.971 1.00 47.52  ? 94   ASN C OD1   1 
ATOM   2088  N  ND2   . ASN C 3 94  ? -13.321 -9.956  52.974 1.00 45.83  ? 94   ASN C ND2   1 
ATOM   2089  N  N     . LYS C 3 95  ? -14.387 -8.845  49.096 1.00 47.76  ? 95   LYS C N     1 
ATOM   2090  C  CA    . LYS C 3 95  ? -15.529 -9.597  48.598 1.00 53.40  ? 95   LYS C CA    1 
ATOM   2091  C  C     . LYS C 3 95  ? -15.284 -10.061 47.142 1.00 50.59  ? 95   LYS C C     1 
ATOM   2092  O  O     . LYS C 3 95  ? -15.624 -11.149 46.762 1.00 54.96  ? 95   LYS C O     1 
ATOM   2093  C  CB    . LYS C 3 95  ? -16.779 -8.744  48.709 1.00 51.78  ? 95   LYS C CB    1 
ATOM   2094  C  CG    . LYS C 3 95  ? -18.025 -9.414  48.182 1.00 64.42  ? 95   LYS C CG    1 
ATOM   2095  C  CD    . LYS C 3 95  ? -19.148 -8.377  48.217 1.00 88.52  ? 95   LYS C CD    1 
ATOM   2096  C  CE    . LYS C 3 95  ? -20.553 -8.941  48.037 1.00 101.95 ? 95   LYS C CE    1 
ATOM   2097  N  NZ    . LYS C 3 95  ? -21.561 -8.028  48.671 1.00 111.26 ? 95   LYS C NZ    1 
ATOM   2098  N  N     . LEU C 3 96  ? -14.692 -9.212  46.334 1.00 49.11  ? 96   LEU C N     1 
ATOM   2099  C  CA    . LEU C 3 96  ? -14.508 -9.508  44.947 1.00 48.32  ? 96   LEU C CA    1 
ATOM   2100  C  C     . LEU C 3 96  ? -13.587 -10.674 44.794 1.00 51.33  ? 96   LEU C C     1 
ATOM   2101  O  O     . LEU C 3 96  ? -13.680 -11.402 43.814 1.00 51.70  ? 96   LEU C O     1 
ATOM   2102  C  CB    . LEU C 3 96  ? -13.866 -8.314  44.254 1.00 48.77  ? 96   LEU C CB    1 
ATOM   2103  C  CG    . LEU C 3 96  ? -13.469 -8.569  42.808 1.00 50.46  ? 96   LEU C CG    1 
ATOM   2104  C  CD1   . LEU C 3 96  ? -14.715 -8.797  41.975 1.00 47.83  ? 96   LEU C CD1   1 
ATOM   2105  C  CD2   . LEU C 3 96  ? -12.652 -7.411  42.249 1.00 51.77  ? 96   LEU C CD2   1 
ATOM   2106  N  N     . LEU C 3 97  ? -12.690 -10.818 45.763 1.00 52.14  ? 97   LEU C N     1 
ATOM   2107  C  CA    . LEU C 3 97  ? -11.720 -11.895 45.809 1.00 55.39  ? 97   LEU C CA    1 
ATOM   2108  C  C     . LEU C 3 97  ? -11.939 -12.804 47.045 1.00 58.26  ? 97   LEU C C     1 
ATOM   2109  O  O     . LEU C 3 97  ? -10.979 -13.335 47.684 1.00 48.49  ? 97   LEU C O     1 
ATOM   2110  C  CB    . LEU C 3 97  ? -10.345 -11.266 45.899 1.00 54.61  ? 97   LEU C CB    1 
ATOM   2111  C  CG    . LEU C 3 97  ? -9.875  -10.368 44.760 1.00 56.70  ? 97   LEU C CG    1 
ATOM   2112  C  CD1   . LEU C 3 97  ? -8.455  -9.940  45.065 1.00 57.33  ? 97   LEU C CD1   1 
ATOM   2113  C  CD2   . LEU C 3 97  ? -9.877  -11.105 43.431 1.00 62.44  ? 97   LEU C CD2   1 
ATOM   2114  N  N     . GLY C 3 98  ? -13.202 -12.983 47.388 1.00 51.19  ? 98   GLY C N     1 
ATOM   2115  C  CA    . GLY C 3 98  ? -13.506 -13.717 48.582 1.00 51.44  ? 98   GLY C CA    1 
ATOM   2116  C  C     . GLY C 3 98  ? -13.351 -15.211 48.428 1.00 50.12  ? 98   GLY C C     1 
ATOM   2117  O  O     . GLY C 3 98  ? -13.435 -15.924 49.396 1.00 56.95  ? 98   GLY C O     1 
ATOM   2118  N  N     . ARG C 3 99  ? -13.172 -15.696 47.210 1.00 50.43  ? 99   ARG C N     1 
ATOM   2119  C  CA    . ARG C 3 99  ? -13.042 -17.109 46.988 1.00 47.37  ? 99   ARG C CA    1 
ATOM   2120  C  C     . ARG C 3 99  ? -11.771 -17.331 46.174 1.00 44.23  ? 99   ARG C C     1 
ATOM   2121  O  O     . ARG C 3 99  ? -11.720 -18.171 45.266 1.00 54.01  ? 99   ARG C O     1 
ATOM   2122  C  CB    . ARG C 3 99  ? -14.288 -17.614 46.281 1.00 45.67  ? 99   ARG C CB    1 
ATOM   2123  C  CG    . ARG C 3 99  ? -15.430 -17.876 47.199 1.00 55.01  ? 99   ARG C CG    1 
ATOM   2124  C  CD    . ARG C 3 99  ? -16.469 -18.708 46.421 1.00 87.60  ? 99   ARG C CD    1 
ATOM   2125  N  NE    . ARG C 3 99  ? -17.587 -19.200 47.258 1.00 116.44 ? 99   ARG C NE    1 
ATOM   2126  C  CZ    . ARG C 3 99  ? -18.840 -19.433 46.837 1.00 124.04 ? 99   ARG C CZ    1 
ATOM   2127  N  NH1   . ARG C 3 99  ? -19.207 -19.222 45.566 1.00 134.37 ? 99   ARG C NH1   1 
ATOM   2128  N  NH2   . ARG C 3 99  ? -19.753 -19.867 47.705 1.00 120.69 ? 99   ARG C NH2   1 
ATOM   2129  N  N     . VAL C 3 100 ? -10.757 -16.538 46.485 1.00 41.01  ? 100  VAL C N     1 
ATOM   2130  C  CA    . VAL C 3 100 ? -9.471  -16.574 45.802 1.00 41.02  ? 100  VAL C CA    1 
ATOM   2131  C  C     . VAL C 3 100 ? -8.362  -16.567 46.824 1.00 42.94  ? 100  VAL C C     1 
ATOM   2132  O  O     . VAL C 3 100 ? -8.496  -15.928 47.863 1.00 42.48  ? 100  VAL C O     1 
ATOM   2133  C  CB    . VAL C 3 100 ? -9.287  -15.310 44.994 1.00 43.76  ? 100  VAL C CB    1 
ATOM   2134  C  CG1   . VAL C 3 100 ? -7.860  -15.111 44.533 1.00 45.65  ? 100  VAL C CG1   1 
ATOM   2135  C  CG2   . VAL C 3 100 ? -10.148 -15.412 43.783 1.00 51.16  ? 100  VAL C CG2   1 
ATOM   2136  N  N     . THR C 3 101 ? -7.271  -17.269 46.514 1.00 43.36  ? 101  THR C N     1 
ATOM   2137  C  CA    . THR C 3 101 ? -6.151  -17.408 47.420 1.00 46.34  ? 101  THR C CA    1 
ATOM   2138  C  C     . THR C 3 101 ? -4.888  -16.858 46.791 1.00 51.45  ? 101  THR C C     1 
ATOM   2139  O  O     . THR C 3 101 ? -4.567  -17.181 45.634 1.00 52.73  ? 101  THR C O     1 
ATOM   2140  C  CB    . THR C 3 101 ? -5.982  -18.883 47.832 1.00 49.70  ? 101  THR C CB    1 
ATOM   2141  O  OG1   . THR C 3 101 ? -7.118  -19.269 48.651 1.00 51.63  ? 101  THR C OG1   1 
ATOM   2142  C  CG2   . THR C 3 101 ? -4.669  -19.119 48.612 1.00 43.74  ? 101  THR C CG2   1 
ATOM   2143  N  N     . ILE C 3 102 ? -4.209  -16.007 47.574 1.00 46.79  ? 102  ILE C N     1 
ATOM   2144  C  CA    . ILE C 3 102 ? -3.008  -15.311 47.160 1.00 42.50  ? 102  ILE C CA    1 
ATOM   2145  C  C     . ILE C 3 102 ? -1.869  -16.089 47.762 1.00 46.98  ? 102  ILE C C     1 
ATOM   2146  O  O     . ILE C 3 102 ? -1.598  -16.106 48.998 1.00 44.04  ? 102  ILE C O     1 
ATOM   2147  C  CB    . ILE C 3 102 ? -3.007  -13.842 47.643 1.00 44.11  ? 102  ILE C CB    1 
ATOM   2148  C  CG1   . ILE C 3 102 ? -3.999  -13.022 46.804 1.00 44.48  ? 102  ILE C CG1   1 
ATOM   2149  C  CG2   . ILE C 3 102 ? -1.634  -13.206 47.510 1.00 42.78  ? 102  ILE C CG2   1 
ATOM   2150  C  CD1   . ILE C 3 102 ? -4.405  -11.745 47.475 1.00 45.86  ? 102  ILE C CD1   1 
ATOM   2151  N  N     . ALA C 3 103 ? -1.194  -16.789 46.883 1.00 48.92  ? 103  ALA C N     1 
ATOM   2152  C  CA    . ALA C 3 103 ? -0.064  -17.545 47.322 1.00 49.41  ? 103  ALA C CA    1 
ATOM   2153  C  C     . ALA C 3 103 ? 0.820   -16.600 48.125 1.00 48.77  ? 103  ALA C C     1 
ATOM   2154  O  O     . ALA C 3 103 ? 0.947   -15.458 47.801 1.00 56.18  ? 103  ALA C O     1 
ATOM   2155  C  CB    . ALA C 3 103 ? 0.662   -18.089 46.118 1.00 54.43  ? 103  ALA C CB    1 
ATOM   2156  N  N     . GLN C 3 104 ? 1.396   -17.080 49.205 1.00 52.79  ? 104  GLN C N     1 
ATOM   2157  C  CA    . GLN C 3 104 ? 2.362   -16.326 50.009 1.00 50.22  ? 104  GLN C CA    1 
ATOM   2158  C  C     . GLN C 3 104 ? 1.832   -15.046 50.677 1.00 51.81  ? 104  GLN C C     1 
ATOM   2159  O  O     . GLN C 3 104 ? 2.612   -14.191 51.151 1.00 54.72  ? 104  GLN C O     1 
ATOM   2160  C  CB    . GLN C 3 104 ? 3.647   -16.122 49.221 1.00 51.40  ? 104  GLN C CB    1 
ATOM   2161  C  CG    . GLN C 3 104 ? 4.548   -17.346 49.282 1.00 59.88  ? 104  GLN C CG    1 
ATOM   2162  C  CD    . GLN C 3 104 ? 4.893   -17.754 50.738 1.00 66.39  ? 104  GLN C CD    1 
ATOM   2163  O  OE1   . GLN C 3 104 ? 5.484   -16.950 51.510 1.00 61.76  ? 104  GLN C OE1   1 
ATOM   2164  N  NE2   . GLN C 3 104 ? 4.491   -18.994 51.138 1.00 60.53  ? 104  GLN C NE2   1 
ATOM   2165  N  N     . GLY C 3 105 ? 0.514   -14.960 50.800 1.00 45.44  ? 105  GLY C N     1 
ATOM   2166  C  CA    . GLY C 3 105 ? -0.089  -13.825 51.438 1.00 49.13  ? 105  GLY C CA    1 
ATOM   2167  C  C     . GLY C 3 105 ? -0.278  -13.833 52.942 1.00 49.61  ? 105  GLY C C     1 
ATOM   2168  O  O     . GLY C 3 105 ? -0.486  -12.760 53.551 1.00 48.53  ? 105  GLY C O     1 
ATOM   2169  N  N     . GLY C 3 106 ? -0.240  -15.017 53.554 1.00 46.96  ? 106  GLY C N     1 
ATOM   2170  C  CA    . GLY C 3 106 ? -0.579  -15.121 54.988 1.00 44.95  ? 106  GLY C CA    1 
ATOM   2171  C  C     . GLY C 3 106 ? -2.014  -14.718 55.288 1.00 45.51  ? 106  GLY C C     1 
ATOM   2172  O  O     . GLY C 3 106 ? -2.868  -14.688 54.402 1.00 45.65  ? 106  GLY C O     1 
ATOM   2173  N  N     . VAL C 3 107 ? -2.266  -14.396 56.547 1.00 49.38  ? 107  VAL C N     1 
ATOM   2174  C  CA    . VAL C 3 107 ? -3.608  -13.991 57.015 1.00 46.25  ? 107  VAL C CA    1 
ATOM   2175  C  C     . VAL C 3 107 ? -3.546  -12.655 57.753 1.00 42.41  ? 107  VAL C C     1 
ATOM   2176  O  O     . VAL C 3 107 ? -2.482  -12.182 58.047 1.00 50.48  ? 107  VAL C O     1 
ATOM   2177  C  CB    . VAL C 3 107 ? -4.210  -15.059 57.977 1.00 46.96  ? 107  VAL C CB    1 
ATOM   2178  C  CG1   . VAL C 3 107 ? -4.324  -16.398 57.287 1.00 45.19  ? 107  VAL C CG1   1 
ATOM   2179  C  CG2   . VAL C 3 107 ? -3.405  -15.222 59.246 1.00 47.02  ? 107  VAL C CG2   1 
ATOM   2180  N  N     . LEU C 3 108 ? -4.671  -12.041 58.071 1.00 49.29  ? 108  LEU C N     1 
ATOM   2181  C  CA    . LEU C 3 108 ? -4.650  -10.795 58.897 1.00 50.39  ? 108  LEU C CA    1 
ATOM   2182  C  C     . LEU C 3 108 ? -4.454  -11.110 60.362 1.00 52.71  ? 108  LEU C C     1 
ATOM   2183  O  O     . LEU C 3 108 ? -5.065  -12.049 60.882 1.00 59.58  ? 108  LEU C O     1 
ATOM   2184  C  CB    . LEU C 3 108 ? -5.966  -10.034 58.768 1.00 47.43  ? 108  LEU C CB    1 
ATOM   2185  C  CG    . LEU C 3 108 ? -6.241  -9.408  57.405 1.00 46.84  ? 108  LEU C CG    1 
ATOM   2186  C  CD1   . LEU C 3 108 ? -7.493  -8.570  57.420 1.00 46.75  ? 108  LEU C CD1   1 
ATOM   2187  C  CD2   . LEU C 3 108 ? -5.062  -8.526  57.023 1.00 50.59  ? 108  LEU C CD2   1 
ATOM   2188  N  N     . PRO C 3 109 ? -3.613  -10.334 61.055 1.00 57.66  ? 109  PRO C N     1 
ATOM   2189  C  CA    . PRO C 3 109 ? -3.539  -10.570 62.497 1.00 55.80  ? 109  PRO C CA    1 
ATOM   2190  C  C     . PRO C 3 109 ? -4.911  -10.414 63.104 1.00 55.30  ? 109  PRO C C     1 
ATOM   2191  O  O     . PRO C 3 109 ? -5.562  -9.433  62.862 1.00 59.21  ? 109  PRO C O     1 
ATOM   2192  C  CB    . PRO C 3 109 ? -2.614  -9.473  62.972 1.00 52.23  ? 109  PRO C CB    1 
ATOM   2193  C  CG    . PRO C 3 109 ? -1.665  -9.317  61.836 1.00 55.73  ? 109  PRO C CG    1 
ATOM   2194  C  CD    . PRO C 3 109 ? -2.563  -9.406  60.619 1.00 58.28  ? 109  PRO C CD    1 
ATOM   2195  N  N     . ASN C 3 110 ? -5.375  -11.428 63.806 1.00 55.76  ? 110  ASN C N     1 
ATOM   2196  C  CA    . ASN C 3 110 ? -6.633  -11.355 64.455 1.00 55.98  ? 110  ASN C CA    1 
ATOM   2197  C  C     . ASN C 3 110 ? -6.774  -12.514 65.421 1.00 58.16  ? 110  ASN C C     1 
ATOM   2198  O  O     . ASN C 3 110 ? -6.869  -13.662 65.015 1.00 61.78  ? 110  ASN C O     1 
ATOM   2199  C  CB    . ASN C 3 110 ? -7.765  -11.363 63.442 1.00 63.48  ? 110  ASN C CB    1 
ATOM   2200  C  CG    . ASN C 3 110 ? -9.119  -11.266 64.106 1.00 69.77  ? 110  ASN C CG    1 
ATOM   2201  O  OD1   . ASN C 3 110 ? -9.217  -11.084 65.323 1.00 78.19  ? 110  ASN C OD1   1 
ATOM   2202  N  ND2   . ASN C 3 110 ? -10.171 -11.397 63.323 1.00 71.29  ? 110  ASN C ND2   1 
ATOM   2203  N  N     . ILE C 3 111 ? -6.783  -12.152 66.702 1.00 62.07  ? 111  ILE C N     1 
ATOM   2204  C  CA    . ILE C 3 111 ? -7.005  -13.013 67.860 1.00 57.58  ? 111  ILE C CA    1 
ATOM   2205  C  C     . ILE C 3 111 ? -8.365  -12.724 68.485 1.00 56.31  ? 111  ILE C C     1 
ATOM   2206  O  O     . ILE C 3 111 ? -8.711  -11.593 68.682 1.00 61.61  ? 111  ILE C O     1 
ATOM   2207  C  CB    . ILE C 3 111 ? -5.977  -12.678 68.922 1.00 53.25  ? 111  ILE C CB    1 
ATOM   2208  C  CG1   . ILE C 3 111 ? -4.600  -12.792 68.311 1.00 56.60  ? 111  ILE C CG1   1 
ATOM   2209  C  CG2   . ILE C 3 111 ? -6.158  -13.600 70.107 1.00 61.62  ? 111  ILE C CG2   1 
ATOM   2210  C  CD1   . ILE C 3 111 ? -3.467  -12.639 69.301 1.00 61.79  ? 111  ILE C CD1   1 
ATOM   2211  N  N     . GLN C 3 112 ? -9.140  -13.742 68.796 1.00 64.44  ? 112  GLN C N     1 
ATOM   2212  C  CA    . GLN C 3 112 ? -10.485 -13.513 69.291 1.00 61.86  ? 112  GLN C CA    1 
ATOM   2213  C  C     . GLN C 3 112 ? -10.372 -13.100 70.725 1.00 62.74  ? 112  GLN C C     1 
ATOM   2214  O  O     . GLN C 3 112 ? -9.608  -13.725 71.455 1.00 61.46  ? 112  GLN C O     1 
ATOM   2215  C  CB    . GLN C 3 112 ? -11.273 -14.810 69.241 1.00 63.36  ? 112  GLN C CB    1 
ATOM   2216  C  CG    . GLN C 3 112 ? -11.505 -15.287 67.845 1.00 60.42  ? 112  GLN C CG    1 
ATOM   2217  C  CD    . GLN C 3 112 ? -12.577 -14.488 67.162 1.00 65.02  ? 112  GLN C CD    1 
ATOM   2218  O  OE1   . GLN C 3 112 ? -13.714 -14.372 67.665 1.00 62.88  ? 112  GLN C OE1   1 
ATOM   2219  N  NE2   . GLN C 3 112 ? -12.242 -13.948 65.994 1.00 67.06  ? 112  GLN C NE2   1 
ATOM   2220  N  N     . SER C 3 113 ? -11.158 -12.094 71.127 1.00 64.69  ? 113  SER C N     1 
ATOM   2221  C  CA    . SER C 3 113 ? -11.177 -11.560 72.511 1.00 60.87  ? 113  SER C CA    1 
ATOM   2222  C  C     . SER C 3 113 ? -10.990 -12.567 73.616 1.00 59.26  ? 113  SER C C     1 
ATOM   2223  O  O     . SER C 3 113 ? -10.027 -12.463 74.365 1.00 70.28  ? 113  SER C O     1 
ATOM   2224  C  CB    . SER C 3 113 ? -12.493 -10.856 72.804 1.00 63.76  ? 113  SER C CB    1 
ATOM   2225  O  OG    . SER C 3 113 ? -12.577 -9.687  72.041 1.00 68.98  ? 113  SER C OG    1 
ATOM   2226  N  N     . VAL C 3 114 ? -11.892 -13.539 73.723 1.00 56.02  ? 114  VAL C N     1 
ATOM   2227  C  CA    . VAL C 3 114 ? -11.909 -14.444 74.895 1.00 60.12  ? 114  VAL C CA    1 
ATOM   2228  C  C     . VAL C 3 114 ? -10.600 -15.152 75.115 1.00 62.53  ? 114  VAL C C     1 
ATOM   2229  O  O     . VAL C 3 114 ? -10.370 -15.706 76.187 1.00 71.35  ? 114  VAL C O     1 
ATOM   2230  C  CB    . VAL C 3 114 ? -13.001 -15.549 74.828 1.00 57.93  ? 114  VAL C CB    1 
ATOM   2231  C  CG1   . VAL C 3 114 ? -14.394 -14.945 74.681 1.00 64.91  ? 114  VAL C CG1   1 
ATOM   2232  C  CG2   . VAL C 3 114 ? -12.754 -16.501 73.681 1.00 59.24  ? 114  VAL C CG2   1 
ATOM   2233  N  N     . LEU C 3 115 ? -9.773  -15.176 74.079 1.00 63.04  ? 115  LEU C N     1 
ATOM   2234  C  CA    . LEU C 3 115 ? -8.520  -15.890 74.135 1.00 67.98  ? 115  LEU C CA    1 
ATOM   2235  C  C     . LEU C 3 115 ? -7.436  -15.151 74.863 1.00 67.31  ? 115  LEU C C     1 
ATOM   2236  O  O     . LEU C 3 115 ? -6.460  -15.769 75.270 1.00 66.11  ? 115  LEU C O     1 
ATOM   2237  C  CB    . LEU C 3 115 ? -8.018  -16.187 72.725 1.00 75.23  ? 115  LEU C CB    1 
ATOM   2238  C  CG    . LEU C 3 115 ? -8.893  -17.057 71.822 1.00 71.32  ? 115  LEU C CG    1 
ATOM   2239  C  CD1   . LEU C 3 115 ? -8.074  -17.432 70.597 1.00 64.28  ? 115  LEU C CD1   1 
ATOM   2240  C  CD2   . LEU C 3 115 ? -9.416  -18.289 72.563 1.00 65.99  ? 115  LEU C CD2   1 
ATOM   2241  N  N     . LEU C 3 116 ? -7.590  -13.839 75.012 1.00 71.87  ? 116  LEU C N     1 
ATOM   2242  C  CA    . LEU C 3 116 ? -6.572  -13.022 75.677 1.00 70.79  ? 116  LEU C CA    1 
ATOM   2243  C  C     . LEU C 3 116 ? -6.564  -13.231 77.193 1.00 73.26  ? 116  LEU C C     1 
ATOM   2244  O  O     . LEU C 3 116 ? -7.522  -13.741 77.747 1.00 76.43  ? 116  LEU C O     1 
ATOM   2245  C  CB    . LEU C 3 116 ? -6.790  -11.553 75.361 1.00 65.51  ? 116  LEU C CB    1 
ATOM   2246  C  CG    . LEU C 3 116 ? -6.767  -11.135 73.895 1.00 65.75  ? 116  LEU C CG    1 
ATOM   2247  C  CD1   . LEU C 3 116 ? -7.001  -9.641  73.845 1.00 65.49  ? 116  LEU C CD1   1 
ATOM   2248  C  CD2   . LEU C 3 116 ? -5.479  -11.460 73.173 1.00 66.45  ? 116  LEU C CD2   1 
ATOM   2249  N  N     . PRO C 3 117 ? -5.484  -12.819 77.874 1.00 85.63  ? 117  PRO C N     1 
ATOM   2250  C  CA    . PRO C 3 117 ? -5.347  -13.109 79.315 1.00 86.13  ? 117  PRO C CA    1 
ATOM   2251  C  C     . PRO C 3 117 ? -6.234  -12.292 80.267 1.00 95.80  ? 117  PRO C C     1 
ATOM   2252  O  O     . PRO C 3 117 ? -6.833  -11.287 79.853 1.00 78.70  ? 117  PRO C O     1 
ATOM   2253  C  CB    . PRO C 3 117 ? -3.880  -12.785 79.598 1.00 84.19  ? 117  PRO C CB    1 
ATOM   2254  C  CG    . PRO C 3 117 ? -3.215  -12.649 78.259 1.00 90.41  ? 117  PRO C CG    1 
ATOM   2255  C  CD    . PRO C 3 117 ? -4.283  -12.155 77.341 1.00 86.84  ? 117  PRO C CD    1 
ATOM   2256  N  N     . LYS C 3 118 ? -6.248  -12.742 81.537 1.00 118.77 ? 118  LYS C N     1 
ATOM   2257  C  CA    . LYS C 3 118 ? -7.005  -12.170 82.694 1.00 127.33 ? 118  LYS C CA    1 
ATOM   2258  C  C     . LYS C 3 118 ? -8.527  -12.130 82.468 1.00 151.15 ? 118  LYS C C     1 
ATOM   2259  O  O     . LYS C 3 118 ? -9.122  -13.136 82.071 1.00 146.36 ? 118  LYS C O     1 
ATOM   2260  C  CB    . LYS C 3 118 ? -6.531  -10.763 83.096 1.00 124.74 ? 118  LYS C CB    1 
ATOM   2261  C  CG    . LYS C 3 118 ? -5.049  -10.457 83.078 1.00 127.70 ? 118  LYS C CG    1 
ATOM   2262  C  CD    . LYS C 3 118 ? -4.855  -8.940  83.032 1.00 120.96 ? 118  LYS C CD    1 
ATOM   2263  C  CE    . LYS C 3 118 ? -5.384  -8.357  81.726 1.00 111.84 ? 118  LYS C CE    1 
ATOM   2264  N  NZ    . LYS C 3 118 ? -5.132  -6.902  81.596 1.00 108.22 ? 118  LYS C NZ    1 
ATOM   2265  N  N     . LYS C 3 119 ? -9.147  -10.975 82.756 1.00 174.04 ? 119  LYS C N     1 
ATOM   2266  C  CA    . LYS C 3 119 ? -10.560 -10.714 82.461 1.00 177.49 ? 119  LYS C CA    1 
ATOM   2267  C  C     . LYS C 3 119 ? -10.729 -9.395  81.697 1.00 161.97 ? 119  LYS C C     1 
ATOM   2268  O  O     . LYS C 3 119 ? -9.978  -8.441  81.906 1.00 138.91 ? 119  LYS C O     1 
ATOM   2269  C  CB    . LYS C 3 119 ? -11.393 -10.681 83.754 1.00 182.64 ? 119  LYS C CB    1 
ATOM   2270  C  CG    . LYS C 3 119 ? -10.939 -9.673  84.813 1.00 179.25 ? 119  LYS C CG    1 
ATOM   2271  C  CD    . LYS C 3 119 ? -10.183 -10.319 85.970 1.00 169.32 ? 119  LYS C CD    1 
ATOM   2272  C  CE    . LYS C 3 119 ? -10.325 -9.491  87.239 1.00 162.76 ? 119  LYS C CE    1 
ATOM   2273  N  NZ    . LYS C 3 119 ? -9.985  -10.277 88.452 1.00 159.28 ? 119  LYS C NZ    1 
ATOM   2274  N  N     . LYS D 4 31  ? 11.038  -21.918 22.059 1.00 151.88 ? 28   LYS D N     1 
ATOM   2275  C  CA    . LYS D 4 31  ? 11.182  -20.772 23.020 1.00 139.15 ? 28   LYS D CA    1 
ATOM   2276  C  C     . LYS D 4 31  ? 9.919   -19.927 22.888 1.00 134.36 ? 28   LYS D C     1 
ATOM   2277  O  O     . LYS D 4 31  ? 9.980   -18.734 22.568 1.00 116.73 ? 28   LYS D O     1 
ATOM   2278  C  CB    . LYS D 4 31  ? 12.445  -19.921 22.744 1.00 139.71 ? 28   LYS D CB    1 
ATOM   2279  C  CG    . LYS D 4 31  ? 13.554  -20.570 21.904 1.00 142.91 ? 28   LYS D CG    1 
ATOM   2280  C  CD    . LYS D 4 31  ? 13.500  -20.179 20.415 1.00 134.35 ? 28   LYS D CD    1 
ATOM   2281  C  CE    . LYS D 4 31  ? 13.687  -21.354 19.447 1.00 126.35 ? 28   LYS D CE    1 
ATOM   2282  N  NZ    . LYS D 4 31  ? 14.697  -22.380 19.849 1.00 121.42 ? 28   LYS D NZ    1 
ATOM   2283  N  N     . THR D 4 32  ? 8.771   -20.565 23.124 1.00 129.66 ? 29   THR D N     1 
ATOM   2284  C  CA    . THR D 4 32  ? 7.485   -19.983 22.756 1.00 125.67 ? 29   THR D CA    1 
ATOM   2285  C  C     . THR D 4 32  ? 7.112   -18.816 23.670 1.00 132.70 ? 29   THR D C     1 
ATOM   2286  O  O     . THR D 4 32  ? 7.331   -18.856 24.896 1.00 130.94 ? 29   THR D O     1 
ATOM   2287  C  CB    . THR D 4 32  ? 6.353   -21.030 22.722 1.00 124.37 ? 29   THR D CB    1 
ATOM   2288  O  OG1   . THR D 4 32  ? 5.330   -20.591 21.815 1.00 114.70 ? 29   THR D OG1   1 
ATOM   2289  C  CG2   . THR D 4 32  ? 5.764   -21.287 24.140 1.00 126.50 ? 29   THR D CG2   1 
ATOM   2290  N  N     . ARG D 4 33  ? 6.527   -17.793 23.047 1.00 126.93 ? 30   ARG D N     1 
ATOM   2291  C  CA    . ARG D 4 33  ? 6.361   -16.483 23.669 1.00 118.19 ? 30   ARG D CA    1 
ATOM   2292  C  C     . ARG D 4 33  ? 5.197   -16.451 24.661 1.00 109.66 ? 30   ARG D C     1 
ATOM   2293  O  O     . ARG D 4 33  ? 4.024   -16.540 24.291 1.00 97.42  ? 30   ARG D O     1 
ATOM   2294  C  CB    . ARG D 4 33  ? 6.201   -15.384 22.605 1.00 116.25 ? 30   ARG D CB    1 
ATOM   2295  C  CG    . ARG D 4 33  ? 5.009   -15.541 21.656 1.00 120.44 ? 30   ARG D CG    1 
ATOM   2296  C  CD    . ARG D 4 33  ? 4.542   -14.218 21.047 1.00 125.64 ? 30   ARG D CD    1 
ATOM   2297  N  NE    . ARG D 4 33  ? 5.214   -13.023 21.582 1.00 124.53 ? 30   ARG D NE    1 
ATOM   2298  C  CZ    . ARG D 4 33  ? 4.719   -11.782 21.554 1.00 128.60 ? 30   ARG D CZ    1 
ATOM   2299  N  NH1   . ARG D 4 33  ? 3.526   -11.519 21.022 1.00 135.03 ? 30   ARG D NH1   1 
ATOM   2300  N  NH2   . ARG D 4 33  ? 5.433   -10.782 22.065 1.00 133.00 ? 30   ARG D NH2   1 
ATOM   2301  N  N     . LYS D 4 34  ? 5.529   -16.294 25.931 1.00 96.00  ? 31   LYS D N     1 
ATOM   2302  C  CA    . LYS D 4 34  ? 4.503   -16.272 26.954 1.00 96.35  ? 31   LYS D CA    1 
ATOM   2303  C  C     . LYS D 4 34  ? 4.164   -14.820 27.329 1.00 90.90  ? 31   LYS D C     1 
ATOM   2304  O  O     . LYS D 4 34  ? 4.947   -14.111 27.962 1.00 95.23  ? 31   LYS D O     1 
ATOM   2305  C  CB    . LYS D 4 34  ? 4.893   -17.139 28.159 1.00 102.91 ? 31   LYS D CB    1 
ATOM   2306  C  CG    . LYS D 4 34  ? 6.365   -17.538 28.209 1.00 120.53 ? 31   LYS D CG    1 
ATOM   2307  C  CD    . LYS D 4 34  ? 6.727   -18.275 29.489 1.00 124.87 ? 31   LYS D CD    1 
ATOM   2308  C  CE    . LYS D 4 34  ? 8.203   -18.119 29.838 1.00 115.87 ? 31   LYS D CE    1 
ATOM   2309  N  NZ    . LYS D 4 34  ? 8.365   -18.136 31.316 1.00 112.71 ? 31   LYS D NZ    1 
ATOM   2310  N  N     . GLU D 4 35  ? 2.985   -14.390 26.894 1.00 82.76  ? 32   GLU D N     1 
ATOM   2311  C  CA    . GLU D 4 35  ? 2.444   -13.065 27.175 1.00 81.27  ? 32   GLU D CA    1 
ATOM   2312  C  C     . GLU D 4 35  ? 1.878   -12.868 28.576 1.00 83.60  ? 32   GLU D C     1 
ATOM   2313  O  O     . GLU D 4 35  ? 1.332   -13.801 29.156 1.00 93.39  ? 32   GLU D O     1 
ATOM   2314  C  CB    . GLU D 4 35  ? 1.273   -12.813 26.261 1.00 87.16  ? 32   GLU D CB    1 
ATOM   2315  C  CG    . GLU D 4 35  ? 1.643   -12.526 24.832 1.00 102.63 ? 32   GLU D CG    1 
ATOM   2316  C  CD    . GLU D 4 35  ? 0.417   -12.087 24.076 1.00 107.98 ? 32   GLU D CD    1 
ATOM   2317  O  OE1   . GLU D 4 35  ? -0.682  -12.468 24.555 1.00 93.98  ? 32   GLU D OE1   1 
ATOM   2318  O  OE2   . GLU D 4 35  ? 0.542   -11.363 23.053 1.00 109.78 ? 32   GLU D OE2   1 
ATOM   2319  N  N     . SER D 4 36  ? 1.942   -11.630 29.079 1.00 75.22  ? 33   SER D N     1 
ATOM   2320  C  CA    . SER D 4 36  ? 1.323   -11.255 30.351 1.00 68.86  ? 33   SER D CA    1 
ATOM   2321  C  C     . SER D 4 36  ? 0.961   -9.796  30.372 1.00 63.16  ? 33   SER D C     1 
ATOM   2322  O  O     . SER D 4 36  ? 1.347   -9.060  29.515 1.00 72.09  ? 33   SER D O     1 
ATOM   2323  C  CB    . SER D 4 36  ? 2.228   -11.586 31.563 1.00 68.32  ? 33   SER D CB    1 
ATOM   2324  O  OG    . SER D 4 36  ? 3.246   -10.634 31.800 1.00 67.26  ? 33   SER D OG    1 
ATOM   2325  N  N     . TYR D 4 37  ? 0.234   -9.384  31.389 1.00 58.37  ? 34   TYR D N     1 
ATOM   2326  C  CA    . TYR D 4 37  ? -0.047  -7.993  31.605 1.00 56.38  ? 34   TYR D CA    1 
ATOM   2327  C  C     . TYR D 4 37  ? 1.035   -7.219  32.420 1.00 60.81  ? 34   TYR D C     1 
ATOM   2328  O  O     . TYR D 4 37  ? 0.785   -6.102  32.886 1.00 63.60  ? 34   TYR D O     1 
ATOM   2329  C  CB    . TYR D 4 37  ? -1.371  -7.874  32.312 1.00 56.02  ? 34   TYR D CB    1 
ATOM   2330  C  CG    . TYR D 4 37  ? -2.567  -8.328  31.509 1.00 60.84  ? 34   TYR D CG    1 
ATOM   2331  C  CD1   . TYR D 4 37  ? -3.129  -9.568  31.705 1.00 62.71  ? 34   TYR D CD1   1 
ATOM   2332  C  CD2   . TYR D 4 37  ? -3.185  -7.481  30.612 1.00 65.08  ? 34   TYR D CD2   1 
ATOM   2333  C  CE1   . TYR D 4 37  ? -4.246  -9.972  30.999 1.00 67.11  ? 34   TYR D CE1   1 
ATOM   2334  C  CE2   . TYR D 4 37  ? -4.306  -7.875  29.893 1.00 62.78  ? 34   TYR D CE2   1 
ATOM   2335  C  CZ    . TYR D 4 37  ? -4.834  -9.124  30.092 1.00 66.11  ? 34   TYR D CZ    1 
ATOM   2336  O  OH    . TYR D 4 37  ? -5.959  -9.541  29.391 1.00 74.09  ? 34   TYR D OH    1 
ATOM   2337  N  N     . ALA D 4 38  ? 2.240   -7.765  32.544 1.00 63.76  ? 35   ALA D N     1 
ATOM   2338  C  CA    . ALA D 4 38  ? 3.234   -7.213  33.475 1.00 67.83  ? 35   ALA D CA    1 
ATOM   2339  C  C     . ALA D 4 38  ? 3.722   -5.780  33.200 1.00 71.53  ? 35   ALA D C     1 
ATOM   2340  O  O     . ALA D 4 38  ? 4.045   -5.026  34.137 1.00 74.78  ? 35   ALA D O     1 
ATOM   2341  C  CB    . ALA D 4 38  ? 4.430   -8.155  33.606 1.00 71.27  ? 35   ALA D CB    1 
ATOM   2342  N  N     . ILE D 4 39  ? 3.804   -5.375  31.946 1.00 71.96  ? 36   ILE D N     1 
ATOM   2343  C  CA    . ILE D 4 39  ? 4.397   -4.069  31.699 1.00 70.68  ? 36   ILE D CA    1 
ATOM   2344  C  C     . ILE D 4 39  ? 3.343   -3.038  31.947 1.00 70.79  ? 36   ILE D C     1 
ATOM   2345  O  O     . ILE D 4 39  ? 3.620   -1.928  32.392 1.00 72.39  ? 36   ILE D O     1 
ATOM   2346  C  CB    . ILE D 4 39  ? 5.030   -3.942  30.306 1.00 76.12  ? 36   ILE D CB    1 
ATOM   2347  C  CG1   . ILE D 4 39  ? 4.034   -4.269  29.197 1.00 76.09  ? 36   ILE D CG1   1 
ATOM   2348  C  CG2   . ILE D 4 39  ? 6.271   -4.843  30.221 1.00 79.70  ? 36   ILE D CG2   1 
ATOM   2349  C  CD1   . ILE D 4 39  ? 4.711   -4.384  27.858 1.00 76.45  ? 36   ILE D CD1   1 
ATOM   2350  N  N     . TYR D 4 40  ? 2.114   -3.441  31.701 1.00 68.44  ? 37   TYR D N     1 
ATOM   2351  C  CA    . TYR D 4 40  ? 1.013   -2.554  31.923 1.00 65.89  ? 37   TYR D CA    1 
ATOM   2352  C  C     . TYR D 4 40  ? 0.819   -2.390  33.396 1.00 64.77  ? 37   TYR D C     1 
ATOM   2353  O  O     . TYR D 4 40  ? 0.564   -1.296  33.857 1.00 75.56  ? 37   TYR D O     1 
ATOM   2354  C  CB    . TYR D 4 40  ? -0.229  -3.120  31.277 1.00 67.73  ? 37   TYR D CB    1 
ATOM   2355  C  CG    . TYR D 4 40  ? 0.049   -3.523  29.869 1.00 72.12  ? 37   TYR D CG    1 
ATOM   2356  C  CD1   . TYR D 4 40  ? 0.122   -4.857  29.518 1.00 79.76  ? 37   TYR D CD1   1 
ATOM   2357  C  CD2   . TYR D 4 40  ? 0.312   -2.561  28.896 1.00 74.97  ? 37   TYR D CD2   1 
ATOM   2358  C  CE1   . TYR D 4 40  ? 0.396   -5.234  28.214 1.00 87.91  ? 37   TYR D CE1   1 
ATOM   2359  C  CE2   . TYR D 4 40  ? 0.589   -2.914  27.603 1.00 81.03  ? 37   TYR D CE2   1 
ATOM   2360  C  CZ    . TYR D 4 40  ? 0.633   -4.239  27.260 1.00 91.93  ? 37   TYR D CZ    1 
ATOM   2361  O  OH    . TYR D 4 40  ? 0.912   -4.518  25.949 1.00 109.23 ? 37   TYR D OH    1 
ATOM   2362  N  N     . VAL D 4 41  ? 0.936   -3.476  34.150 1.00 62.36  ? 38   VAL D N     1 
ATOM   2363  C  CA    . VAL D 4 41  ? 0.797   -3.377  35.597 1.00 58.77  ? 38   VAL D CA    1 
ATOM   2364  C  C     . VAL D 4 41  ? 1.890   -2.468  36.109 1.00 53.40  ? 38   VAL D C     1 
ATOM   2365  O  O     . VAL D 4 41  ? 1.654   -1.632  36.958 1.00 49.70  ? 38   VAL D O     1 
ATOM   2366  C  CB    . VAL D 4 41  ? 0.852   -4.748  36.285 1.00 55.82  ? 38   VAL D CB    1 
ATOM   2367  C  CG1   . VAL D 4 41  ? 1.024   -4.583  37.780 1.00 59.75  ? 38   VAL D CG1   1 
ATOM   2368  C  CG2   . VAL D 4 41  ? -0.418  -5.516  35.996 1.00 54.88  ? 38   VAL D CG2   1 
ATOM   2369  N  N     . TYR D 4 42  ? 3.077   -2.608  35.543 1.00 54.43  ? 39   TYR D N     1 
ATOM   2370  C  CA    . TYR D 4 42  ? 4.209   -1.761  35.944 1.00 61.17  ? 39   TYR D CA    1 
ATOM   2371  C  C     . TYR D 4 42  ? 3.966   -0.265  35.629 1.00 60.49  ? 39   TYR D C     1 
ATOM   2372  O  O     . TYR D 4 42  ? 4.218   0.612   36.461 1.00 60.40  ? 39   TYR D O     1 
ATOM   2373  C  CB    . TYR D 4 42  ? 5.503   -2.277  35.293 1.00 66.32  ? 39   TYR D CB    1 
ATOM   2374  C  CG    . TYR D 4 42  ? 6.746   -1.763  35.942 1.00 71.58  ? 39   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D 4 42  ? 7.142   -2.235  37.189 1.00 81.42  ? 39   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D 4 42  ? 7.531   -0.791  35.321 1.00 88.18  ? 39   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D 4 42  ? 8.287   -1.749  37.824 1.00 92.48  ? 39   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D 4 42  ? 8.690   -0.298  35.925 1.00 97.95  ? 39   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D 4 42  ? 9.070   -0.772  37.186 1.00 103.01 ? 39   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D 4 42  ? 10.207  -0.276  37.821 1.00 88.14  ? 39   TYR D OH    1 
ATOM   2381  N  N     . LYS D 4 43  ? 3.444   0.030   34.444 1.00 64.45  ? 40   LYS D N     1 
ATOM   2382  C  CA    . LYS D 4 43  ? 3.119   1.424   34.095 1.00 66.24  ? 40   LYS D CA    1 
ATOM   2383  C  C     . LYS D 4 43  ? 2.209   1.988   35.160 1.00 66.12  ? 40   LYS D C     1 
ATOM   2384  O  O     . LYS D 4 43  ? 2.485   3.018   35.786 1.00 71.66  ? 40   LYS D O     1 
ATOM   2385  C  CB    . LYS D 4 43  ? 2.434   1.535   32.727 1.00 64.36  ? 40   LYS D CB    1 
ATOM   2386  C  CG    . LYS D 4 43  ? 3.390   1.298   31.578 1.00 70.70  ? 40   LYS D CG    1 
ATOM   2387  C  CD    . LYS D 4 43  ? 2.719   1.193   30.208 1.00 79.70  ? 40   LYS D CD    1 
ATOM   2388  C  CE    . LYS D 4 43  ? 3.807   1.150   29.121 1.00 89.49  ? 40   LYS D CE    1 
ATOM   2389  N  NZ    . LYS D 4 43  ? 3.316   0.902   27.732 1.00 95.76  ? 40   LYS D NZ    1 
ATOM   2390  N  N     . VAL D 4 44  ? 1.137   1.260   35.394 1.00 62.31  ? 41   VAL D N     1 
ATOM   2391  C  CA    . VAL D 4 44  ? 0.128   1.725   36.301 1.00 60.84  ? 41   VAL D CA    1 
ATOM   2392  C  C     . VAL D 4 44  ? 0.703   1.849   37.705 1.00 64.58  ? 41   VAL D C     1 
ATOM   2393  O  O     . VAL D 4 44  ? 0.355   2.774   38.472 1.00 63.05  ? 41   VAL D O     1 
ATOM   2394  C  CB    . VAL D 4 44  ? -1.065  0.787   36.302 1.00 58.67  ? 41   VAL D CB    1 
ATOM   2395  C  CG1   . VAL D 4 44  ? -2.116  1.315   37.259 1.00 60.69  ? 41   VAL D CG1   1 
ATOM   2396  C  CG2   . VAL D 4 44  ? -1.670  0.643   34.891 1.00 56.54  ? 41   VAL D CG2   1 
ATOM   2397  N  N     . LEU D 4 45  ? 1.606   0.934   38.036 1.00 63.88  ? 42   LEU D N     1 
ATOM   2398  C  CA    . LEU D 4 45  ? 2.267   0.992   39.332 1.00 63.23  ? 42   LEU D CA    1 
ATOM   2399  C  C     . LEU D 4 45  ? 3.028   2.310   39.462 1.00 64.74  ? 42   LEU D C     1 
ATOM   2400  O  O     . LEU D 4 45  ? 3.025   2.946   40.537 1.00 59.36  ? 42   LEU D O     1 
ATOM   2401  C  CB    . LEU D 4 45  ? 3.205   -0.202  39.505 1.00 58.89  ? 42   LEU D CB    1 
ATOM   2402  C  CG    . LEU D 4 45  ? 4.104   -0.164  40.734 1.00 61.30  ? 42   LEU D CG    1 
ATOM   2403  C  CD1   . LEU D 4 45  ? 3.256   -0.083  41.995 1.00 60.01  ? 42   LEU D CD1   1 
ATOM   2404  C  CD2   . LEU D 4 45  ? 5.069   -1.347  40.796 1.00 62.03  ? 42   LEU D CD2   1 
ATOM   2405  N  N     . LYS D 4 46  ? 3.666   2.718   38.364 1.00 59.89  ? 43   LYS D N     1 
ATOM   2406  C  CA    . LYS D 4 46  ? 4.533   3.886   38.418 1.00 61.87  ? 43   LYS D CA    1 
ATOM   2407  C  C     . LYS D 4 46  ? 3.695   5.102   38.592 1.00 59.24  ? 43   LYS D C     1 
ATOM   2408  O  O     . LYS D 4 46  ? 4.001   5.966   39.418 1.00 59.03  ? 43   LYS D O     1 
ATOM   2409  C  CB    . LYS D 4 46  ? 5.431   3.964   37.183 1.00 65.17  ? 43   LYS D CB    1 
ATOM   2410  C  CG    . LYS D 4 46  ? 6.623   3.006   37.264 1.00 67.59  ? 43   LYS D CG    1 
ATOM   2411  C  CD    . LYS D 4 46  ? 7.054   2.887   38.726 1.00 68.01  ? 43   LYS D CD    1 
ATOM   2412  C  CE    . LYS D 4 46  ? 8.273   2.027   38.946 1.00 68.88  ? 43   LYS D CE    1 
ATOM   2413  N  NZ    . LYS D 4 46  ? 8.717   2.234   40.354 1.00 70.06  ? 43   LYS D NZ    1 
ATOM   2414  N  N     . GLN D 4 47  ? 2.587   5.104   37.868 1.00 53.33  ? 44   GLN D N     1 
ATOM   2415  C  CA    . GLN D 4 47  ? 1.615   6.143   37.992 1.00 52.61  ? 44   GLN D CA    1 
ATOM   2416  C  C     . GLN D 4 47  ? 1.195   6.409   39.433 1.00 51.94  ? 44   GLN D C     1 
ATOM   2417  O  O     . GLN D 4 47  ? 1.019   7.564   39.810 1.00 56.81  ? 44   GLN D O     1 
ATOM   2418  C  CB    . GLN D 4 47  ? 0.397   5.809   37.152 1.00 54.50  ? 44   GLN D CB    1 
ATOM   2419  C  CG    . GLN D 4 47  ? 0.634   5.827   35.655 1.00 53.79  ? 44   GLN D CG    1 
ATOM   2420  C  CD    . GLN D 4 47  ? -0.680  5.838   34.906 1.00 61.69  ? 44   GLN D CD    1 
ATOM   2421  O  OE1   . GLN D 4 47  ? -1.625  5.126   35.291 1.00 69.07  ? 44   GLN D OE1   1 
ATOM   2422  N  NE2   . GLN D 4 47  ? -0.774  6.658   33.859 1.00 61.65  ? 44   GLN D NE2   1 
ATOM   2423  N  N     . VAL D 4 48  ? 1.032   5.365   40.243 1.00 55.64  ? 45   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4 48  ? 0.433   5.557   41.585 1.00 57.34  ? 45   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4 48  ? 1.441   5.607   42.717 1.00 52.32  ? 45   VAL D C     1 
ATOM   2426  O  O     . VAL D 4 48  ? 1.249   6.319   43.719 1.00 64.66  ? 45   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4 48  ? -0.659  4.515   41.902 1.00 56.80  ? 45   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4 48  ? -1.669  4.439   40.762 1.00 58.66  ? 45   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4 48  ? -0.051  3.160   42.180 1.00 60.22  ? 45   VAL D CG2   1 
ATOM   2430  N  N     . HIS D 4 49  ? 2.529   4.896   42.548 1.00 52.65  ? 46   HIS D N     1 
ATOM   2431  C  CA    . HIS D 4 49  ? 3.578   4.891   43.568 1.00 59.96  ? 46   HIS D CA    1 
ATOM   2432  C  C     . HIS D 4 49  ? 4.933   4.892   42.903 1.00 62.84  ? 46   HIS D C     1 
ATOM   2433  O  O     . HIS D 4 49  ? 5.498   3.819   42.670 1.00 62.19  ? 46   HIS D O     1 
ATOM   2434  C  CB    . HIS D 4 49  ? 3.464   3.661   44.398 1.00 52.37  ? 46   HIS D CB    1 
ATOM   2435  C  CG    . HIS D 4 49  ? 2.369   3.718   45.380 1.00 50.96  ? 46   HIS D CG    1 
ATOM   2436  N  ND1   . HIS D 4 49  ? 2.442   4.508   46.501 1.00 57.65  ? 46   HIS D ND1   1 
ATOM   2437  C  CD2   . HIS D 4 49  ? 1.188   3.067   45.447 1.00 55.31  ? 46   HIS D CD2   1 
ATOM   2438  C  CE1   . HIS D 4 49  ? 1.352   4.332   47.228 1.00 58.78  ? 46   HIS D CE1   1 
ATOM   2439  N  NE2   . HIS D 4 49  ? 0.570   3.470   46.608 1.00 57.35  ? 46   HIS D NE2   1 
ATOM   2440  N  N     . PRO D 4 50  ? 5.444   6.096   42.590 1.00 69.47  ? 47   PRO D N     1 
ATOM   2441  C  CA    . PRO D 4 50  ? 6.521   6.204   41.612 1.00 67.56  ? 47   PRO D CA    1 
ATOM   2442  C  C     . PRO D 4 50  ? 7.831   5.669   42.144 1.00 64.08  ? 47   PRO D C     1 
ATOM   2443  O  O     . PRO D 4 50  ? 8.685   5.319   41.366 1.00 61.68  ? 47   PRO D O     1 
ATOM   2444  C  CB    . PRO D 4 50  ? 6.591   7.719   41.312 1.00 72.34  ? 47   PRO D CB    1 
ATOM   2445  C  CG    . PRO D 4 50  ? 5.330   8.315   41.858 1.00 65.57  ? 47   PRO D CG    1 
ATOM   2446  C  CD    . PRO D 4 50  ? 4.978   7.431   43.030 1.00 71.62  ? 47   PRO D CD    1 
ATOM   2447  N  N     . ASP D 4 51  ? 7.972   5.527   43.453 1.00 68.65  ? 48   ASP D N     1 
ATOM   2448  C  CA    . ASP D 4 51  ? 9.222   4.973   43.975 1.00 77.60  ? 48   ASP D CA    1 
ATOM   2449  C  C     . ASP D 4 51  ? 9.098   3.552   44.482 1.00 73.25  ? 48   ASP D C     1 
ATOM   2450  O  O     . ASP D 4 51  ? 9.970   3.077   45.226 1.00 76.56  ? 48   ASP D O     1 
ATOM   2451  C  CB    . ASP D 4 51  ? 9.768   5.866   45.098 1.00 89.56  ? 48   ASP D CB    1 
ATOM   2452  C  CG    . ASP D 4 51  ? 10.088  7.288   44.630 1.00 88.59  ? 48   ASP D CG    1 
ATOM   2453  O  OD1   . ASP D 4 51  ? 10.295  7.519   43.396 1.00 72.05  ? 48   ASP D OD1   1 
ATOM   2454  O  OD2   . ASP D 4 51  ? 10.132  8.157   45.535 1.00 85.39  ? 48   ASP D OD2   1 
ATOM   2455  N  N     . THR D 4 52  ? 8.047   2.861   44.063 1.00 66.02  ? 49   THR D N     1 
ATOM   2456  C  CA    . THR D 4 52  ? 7.784   1.535   44.565 1.00 60.33  ? 49   THR D CA    1 
ATOM   2457  C  C     . THR D 4 52  ? 7.987   0.463   43.494 1.00 59.71  ? 49   THR D C     1 
ATOM   2458  O  O     . THR D 4 52  ? 7.485   0.594   42.383 1.00 55.87  ? 49   THR D O     1 
ATOM   2459  C  CB    . THR D 4 52  ? 6.360   1.475   45.087 1.00 60.56  ? 49   THR D CB    1 
ATOM   2460  O  OG1   . THR D 4 52  ? 6.218   2.427   46.132 1.00 58.41  ? 49   THR D OG1   1 
ATOM   2461  C  CG2   . THR D 4 52  ? 6.027   0.090   45.641 1.00 64.55  ? 49   THR D CG2   1 
ATOM   2462  N  N     . GLY D 4 53  ? 8.709   -0.596  43.853 1.00 55.32  ? 50   GLY D N     1 
ATOM   2463  C  CA    . GLY D 4 53  ? 8.817   -1.766  43.006 1.00 62.30  ? 50   GLY D CA    1 
ATOM   2464  C  C     . GLY D 4 53  ? 7.852   -2.920  43.344 1.00 70.32  ? 50   GLY D C     1 
ATOM   2465  O  O     . GLY D 4 53  ? 7.137   -2.924  44.355 1.00 59.68  ? 50   GLY D O     1 
ATOM   2466  N  N     . ILE D 4 54  ? 7.872   -3.943  42.500 1.00 67.05  ? 51   ILE D N     1 
ATOM   2467  C  CA    . ILE D 4 54  ? 7.048   -5.078  42.720 1.00 59.18  ? 51   ILE D CA    1 
ATOM   2468  C  C     . ILE D 4 54  ? 7.841   -6.334  42.429 1.00 60.29  ? 51   ILE D C     1 
ATOM   2469  O  O     . ILE D 4 54  ? 8.499   -6.408  41.407 1.00 63.32  ? 51   ILE D O     1 
ATOM   2470  C  CB    . ILE D 4 54  ? 5.828   -4.984  41.831 1.00 59.77  ? 51   ILE D CB    1 
ATOM   2471  C  CG1   . ILE D 4 54  ? 4.828   -6.092  42.206 1.00 62.82  ? 51   ILE D CG1   1 
ATOM   2472  C  CG2   . ILE D 4 54  ? 6.214   -5.046  40.368 1.00 54.98  ? 51   ILE D CG2   1 
ATOM   2473  C  CD1   . ILE D 4 54  ? 3.500   -5.944  41.500 1.00 60.26  ? 51   ILE D CD1   1 
ATOM   2474  N  N     . SER D 4 55  ? 7.772   -7.302  43.346 1.00 59.42  ? 52   SER D N     1 
ATOM   2475  C  CA    . SER D 4 55  ? 8.481   -8.578  43.238 1.00 57.10  ? 52   SER D CA    1 
ATOM   2476  C  C     . SER D 4 55  ? 7.835   -9.421  42.147 1.00 56.00  ? 52   SER D C     1 
ATOM   2477  O  O     . SER D 4 55  ? 6.689   -9.211  41.834 1.00 56.57  ? 52   SER D O     1 
ATOM   2478  C  CB    . SER D 4 55  ? 8.377   -9.344  44.540 1.00 62.50  ? 52   SER D CB    1 
ATOM   2479  O  OG    . SER D 4 55  ? 7.143   -10.088 44.558 1.00 66.95  ? 52   SER D OG    1 
ATOM   2480  N  N     . SER D 4 56  ? 8.552   -10.386 41.585 1.00 55.52  ? 53   SER D N     1 
ATOM   2481  C  CA    . SER D 4 56  ? 8.011   -11.092 40.457 1.00 57.78  ? 53   SER D CA    1 
ATOM   2482  C  C     . SER D 4 56  ? 6.858   -11.955 40.893 1.00 61.05  ? 53   SER D C     1 
ATOM   2483  O  O     . SER D 4 56  ? 5.971   -12.213 40.057 1.00 66.77  ? 53   SER D O     1 
ATOM   2484  C  CB    . SER D 4 56  ? 9.049   -11.975 39.796 1.00 61.22  ? 53   SER D CB    1 
ATOM   2485  O  OG    . SER D 4 56  ? 9.470   -12.927 40.733 1.00 66.00  ? 53   SER D OG    1 
ATOM   2486  N  N     . LYS D 4 57  ? 6.876   -12.434 42.153 1.00 55.71  ? 54   LYS D N     1 
ATOM   2487  C  CA    . LYS D 4 57  ? 5.758   -13.250 42.650 1.00 56.56  ? 54   LYS D CA    1 
ATOM   2488  C  C     . LYS D 4 57  ? 4.553   -12.355 42.795 1.00 58.18  ? 54   LYS D C     1 
ATOM   2489  O  O     . LYS D 4 57  ? 3.466   -12.669 42.297 1.00 65.06  ? 54   LYS D O     1 
ATOM   2490  C  CB    . LYS D 4 57  ? 6.046   -13.953 43.965 1.00 65.04  ? 54   LYS D CB    1 
ATOM   2491  C  CG    . LYS D 4 57  ? 6.930   -15.196 43.889 1.00 80.41  ? 54   LYS D CG    1 
ATOM   2492  C  CD    . LYS D 4 57  ? 7.041   -15.875 45.279 1.00 101.48 ? 54   LYS D CD    1 
ATOM   2493  C  CE    . LYS D 4 57  ? 8.106   -16.989 45.412 1.00 100.04 ? 54   LYS D CE    1 
ATOM   2494  N  NZ    . LYS D 4 57  ? 9.328   -16.589 46.188 1.00 98.26  ? 54   LYS D NZ    1 
ATOM   2495  N  N     . ALA D 4 58  ? 4.748   -11.191 43.398 1.00 55.69  ? 55   ALA D N     1 
ATOM   2496  C  CA    . ALA D 4 58  ? 3.670   -10.208 43.415 1.00 48.40  ? 55   ALA D CA    1 
ATOM   2497  C  C     . ALA D 4 58  ? 3.171   -9.913  42.031 1.00 46.71  ? 55   ALA D C     1 
ATOM   2498  O  O     . ALA D 4 58  ? 2.000   -9.810  41.837 1.00 58.34  ? 55   ALA D O     1 
ATOM   2499  C  CB    . ALA D 4 58  ? 4.079   -8.938  44.106 1.00 48.48  ? 55   ALA D CB    1 
ATOM   2500  N  N     . MET D 4 59  ? 4.031   -9.814  41.039 1.00 53.02  ? 56   MET D N     1 
ATOM   2501  C  CA    . MET D 4 59  ? 3.546   -9.537  39.688 1.00 54.37  ? 56   MET D CA    1 
ATOM   2502  C  C     . MET D 4 59  ? 2.801   -10.742 39.191 1.00 52.20  ? 56   MET D C     1 
ATOM   2503  O  O     . MET D 4 59  ? 1.866   -10.627 38.411 1.00 56.10  ? 56   MET D O     1 
ATOM   2504  C  CB    . MET D 4 59  ? 4.698   -9.215  38.734 1.00 58.72  ? 56   MET D CB    1 
ATOM   2505  C  CG    . MET D 4 59  ? 4.303   -8.945  37.280 1.00 57.30  ? 56   MET D CG    1 
ATOM   2506  S  SD    . MET D 4 59  ? 3.309   -7.442  37.152 1.00 64.91  ? 56   MET D SD    1 
ATOM   2507  C  CE    . MET D 4 59  ? 4.516   -6.123  37.327 1.00 62.28  ? 56   MET D CE    1 
ATOM   2508  N  N     . SER D 4 60  ? 3.195   -11.919 39.625 1.00 50.71  ? 57   SER D N     1 
ATOM   2509  C  CA    . SER D 4 60  ? 2.522   -13.067 39.074 1.00 55.57  ? 57   SER D CA    1 
ATOM   2510  C  C     . SER D 4 60  ? 1.052   -13.055 39.483 1.00 55.14  ? 57   SER D C     1 
ATOM   2511  O  O     . SER D 4 60  ? 0.138   -13.241 38.666 1.00 50.63  ? 57   SER D O     1 
ATOM   2512  C  CB    . SER D 4 60  ? 3.186   -14.339 39.515 1.00 52.79  ? 57   SER D CB    1 
ATOM   2513  O  OG    . SER D 4 60  ? 2.518   -15.385 38.838 1.00 65.65  ? 57   SER D OG    1 
ATOM   2514  N  N     . ILE D 4 61  ? 0.862   -12.781 40.764 1.00 53.11  ? 58   ILE D N     1 
ATOM   2515  C  CA    . ILE D 4 61  ? -0.466  -12.632 41.351 1.00 54.82  ? 58   ILE D CA    1 
ATOM   2516  C  C     . ILE D 4 61  ? -1.232  -11.520 40.675 1.00 51.04  ? 58   ILE D C     1 
ATOM   2517  O  O     . ILE D 4 61  ? -2.426  -11.657 40.414 1.00 47.82  ? 58   ILE D O     1 
ATOM   2518  C  CB    . ILE D 4 61  ? -0.350  -12.316 42.845 1.00 54.05  ? 58   ILE D CB    1 
ATOM   2519  C  CG1   . ILE D 4 61  ? 0.164   -13.551 43.567 1.00 55.63  ? 58   ILE D CG1   1 
ATOM   2520  C  CG2   . ILE D 4 61  ? -1.677  -11.890 43.425 1.00 50.61  ? 58   ILE D CG2   1 
ATOM   2521  C  CD1   . ILE D 4 61  ? 0.921   -13.167 44.802 1.00 58.03  ? 58   ILE D CD1   1 
ATOM   2522  N  N     . MET D 4 62  ? -0.550  -10.415 40.406 1.00 51.13  ? 59   MET D N     1 
ATOM   2523  C  CA    . MET D 4 62  ? -1.207  -9.326  39.683 1.00 55.59  ? 59   MET D CA    1 
ATOM   2524  C  C     . MET D 4 62  ? -1.632  -9.816  38.325 1.00 52.86  ? 59   MET D C     1 
ATOM   2525  O  O     . MET D 4 62  ? -2.760  -9.548  37.904 1.00 46.32  ? 59   MET D O     1 
ATOM   2526  C  CB    . MET D 4 62  ? -0.317  -8.103  39.560 1.00 54.51  ? 59   MET D CB    1 
ATOM   2527  C  CG    . MET D 4 62  ? -0.159  -7.319  40.867 1.00 53.90  ? 59   MET D CG    1 
ATOM   2528  S  SD    . MET D 4 62  ? -1.681  -6.861  41.700 1.00 52.85  ? 59   MET D SD    1 
ATOM   2529  C  CE    . MET D 4 62  ? -2.683  -6.221  40.376 1.00 48.59  ? 59   MET D CE    1 
ATOM   2530  N  N     . ASN D 4 63  ? -0.768  -10.591 37.669 1.00 52.65  ? 60   ASN D N     1 
ATOM   2531  C  CA    . ASN D 4 63  ? -1.151  -11.079 36.374 1.00 57.23  ? 60   ASN D CA    1 
ATOM   2532  C  C     . ASN D 4 63  ? -2.365  -12.044 36.417 1.00 60.02  ? 60   ASN D C     1 
ATOM   2533  O  O     . ASN D 4 63  ? -3.248  -12.009 35.527 1.00 48.50  ? 60   ASN D O     1 
ATOM   2534  C  CB    . ASN D 4 63  ? 0.012   -11.707 35.662 1.00 59.16  ? 60   ASN D CB    1 
ATOM   2535  C  CG    . ASN D 4 63  ? -0.288  -11.892 34.190 1.00 61.55  ? 60   ASN D CG    1 
ATOM   2536  O  OD1   . ASN D 4 63  ? -0.697  -10.961 33.543 1.00 59.49  ? 60   ASN D OD1   1 
ATOM   2537  N  ND2   . ASN D 4 63  ? -0.118  -13.093 33.673 1.00 69.38  ? 60   ASN D ND2   1 
ATOM   2538  N  N     . SER D 4 64  ? -2.396  -12.879 37.464 1.00 56.11  ? 61   SER D N     1 
ATOM   2539  C  CA    . SER D 4 64  ? -3.497  -13.790 37.692 1.00 54.05  ? 61   SER D CA    1 
ATOM   2540  C  C     . SER D 4 64  ? -4.792  -13.043 37.925 1.00 58.25  ? 61   SER D C     1 
ATOM   2541  O  O     . SER D 4 64  ? -5.846  -13.392 37.375 1.00 64.37  ? 61   SER D O     1 
ATOM   2542  C  CB    . SER D 4 64  ? -3.233  -14.656 38.910 1.00 59.97  ? 61   SER D CB    1 
ATOM   2543  O  OG    . SER D 4 64  ? -2.235  -15.639 38.665 1.00 72.09  ? 61   SER D OG    1 
ATOM   2544  N  N     . PHE D 4 65  ? -4.702  -12.006 38.742 1.00 58.00  ? 62   PHE D N     1 
ATOM   2545  C  CA    . PHE D 4 65  ? -5.854  -11.187 39.068 1.00 52.63  ? 62   PHE D CA    1 
ATOM   2546  C  C     . PHE D 4 65  ? -6.470  -10.576 37.841 1.00 58.03  ? 62   PHE D C     1 
ATOM   2547  O  O     . PHE D 4 65  ? -7.691  -10.602 37.720 1.00 62.42  ? 62   PHE D O     1 
ATOM   2548  C  CB    . PHE D 4 65  ? -5.444  -10.097 40.020 1.00 50.96  ? 62   PHE D CB    1 
ATOM   2549  C  CG    . PHE D 4 65  ? -6.449  -9.025  40.189 1.00 52.13  ? 62   PHE D CG    1 
ATOM   2550  C  CD1   . PHE D 4 65  ? -7.675  -9.287  40.734 1.00 56.77  ? 62   PHE D CD1   1 
ATOM   2551  C  CD2   . PHE D 4 65  ? -6.143  -7.735  39.841 1.00 57.48  ? 62   PHE D CD2   1 
ATOM   2552  C  CE1   . PHE D 4 65  ? -8.603  -8.287  40.915 1.00 58.01  ? 62   PHE D CE1   1 
ATOM   2553  C  CE2   . PHE D 4 65  ? -7.056  -6.723  40.010 1.00 58.74  ? 62   PHE D CE2   1 
ATOM   2554  C  CZ    . PHE D 4 65  ? -8.291  -7.003  40.546 1.00 61.29  ? 62   PHE D CZ    1 
ATOM   2555  N  N     . VAL D 4 66  ? -5.658  -10.062 36.908 1.00 56.13  ? 63   VAL D N     1 
ATOM   2556  C  CA    . VAL D 4 66  ? -6.244  -9.463  35.679 1.00 56.79  ? 63   VAL D CA    1 
ATOM   2557  C  C     . VAL D 4 66  ? -6.917  -10.507 34.773 1.00 57.70  ? 63   VAL D C     1 
ATOM   2558  O  O     . VAL D 4 66  ? -8.031  -10.299 34.282 1.00 54.24  ? 63   VAL D O     1 
ATOM   2559  C  CB    . VAL D 4 66  ? -5.204  -8.738  34.841 1.00 56.39  ? 63   VAL D CB    1 
ATOM   2560  C  CG1   . VAL D 4 66  ? -5.867  -8.094  33.642 1.00 56.90  ? 63   VAL D CG1   1 
ATOM   2561  C  CG2   . VAL D 4 66  ? -4.504  -7.679  35.671 1.00 57.72  ? 63   VAL D CG2   1 
ATOM   2562  N  N     . ASN D 4 67  ? -6.225  -11.623 34.561 1.00 53.53  ? 64   ASN D N     1 
ATOM   2563  C  CA    . ASN D 4 67  ? -6.791  -12.711 33.819 1.00 50.22  ? 64   ASN D CA    1 
ATOM   2564  C  C     . ASN D 4 67  ? -8.069  -13.186 34.436 1.00 49.78  ? 64   ASN D C     1 
ATOM   2565  O  O     . ASN D 4 67  ? -9.031  -13.457 33.726 1.00 50.66  ? 64   ASN D O     1 
ATOM   2566  C  CB    . ASN D 4 67  ? -5.826  -13.844 33.791 1.00 54.03  ? 64   ASN D CB    1 
ATOM   2567  C  CG    . ASN D 4 67  ? -4.639  -13.538 32.933 1.00 62.25  ? 64   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D 4 67  ? -4.806  -13.186 31.772 1.00 67.63  ? 64   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D 4 67  ? -3.429  -13.612 33.501 1.00 68.85  ? 64   ASN D ND2   1 
ATOM   2570  N  N     . ASP D 4 68  ? -8.095  -13.269 35.754 1.00 46.41  ? 65   ASP D N     1 
ATOM   2571  C  CA    . ASP D 4 68  ? -9.288  -13.712 36.436 1.00 49.02  ? 65   ASP D CA    1 
ATOM   2572  C  C     . ASP D 4 68  ? -10.482 -12.775 36.209 1.00 52.96  ? 65   ASP D C     1 
ATOM   2573  O  O     . ASP D 4 68  ? -11.515 -13.154 35.654 1.00 59.09  ? 65   ASP D O     1 
ATOM   2574  C  CB    . ASP D 4 68  ? -8.978  -13.851 37.923 1.00 56.20  ? 65   ASP D CB    1 
ATOM   2575  C  CG    . ASP D 4 68  ? -10.102 -14.470 38.694 1.00 57.57  ? 65   ASP D CG    1 
ATOM   2576  O  OD1   . ASP D 4 68  ? -10.854 -15.294 38.114 1.00 63.34  ? 65   ASP D OD1   1 
ATOM   2577  O  OD2   . ASP D 4 68  ? -10.237 -14.113 39.882 1.00 59.29  ? 65   ASP D OD2   1 
ATOM   2578  N  N     . VAL D 4 69  ? -10.329 -11.527 36.582 1.00 52.43  ? 66   VAL D N     1 
ATOM   2579  C  CA    . VAL D 4 69  ? -11.393 -10.572 36.376 1.00 52.23  ? 66   VAL D CA    1 
ATOM   2580  C  C     . VAL D 4 69  ? -11.826 -10.470 34.884 1.00 53.04  ? 66   VAL D C     1 
ATOM   2581  O  O     . VAL D 4 69  ? -13.003 -10.284 34.587 1.00 49.66  ? 66   VAL D O     1 
ATOM   2582  C  CB    . VAL D 4 69  ? -10.960 -9.201  36.915 1.00 53.70  ? 66   VAL D CB    1 
ATOM   2583  C  CG1   . VAL D 4 69  ? -12.026 -8.158  36.651 1.00 58.33  ? 66   VAL D CG1   1 
ATOM   2584  C  CG2   . VAL D 4 69  ? -10.675 -9.277  38.414 1.00 54.63  ? 66   VAL D CG2   1 
ATOM   2585  N  N     . PHE D 4 70  ? -10.880 -10.562 33.952 1.00 53.05  ? 67   PHE D N     1 
ATOM   2586  C  CA    . PHE D 4 70  ? -11.211 -10.590 32.520 1.00 53.94  ? 67   PHE D CA    1 
ATOM   2587  C  C     . PHE D 4 70  ? -12.156 -11.746 32.249 1.00 56.29  ? 67   PHE D C     1 
ATOM   2588  O  O     . PHE D 4 70  ? -13.231 -11.578 31.675 1.00 52.67  ? 67   PHE D O     1 
ATOM   2589  C  CB    . PHE D 4 70  ? -9.944  -10.771 31.685 1.00 61.26  ? 67   PHE D CB    1 
ATOM   2590  C  CG    . PHE D 4 70  ? -10.193 -10.897 30.205 1.00 64.52  ? 67   PHE D CG    1 
ATOM   2591  C  CD1   . PHE D 4 70  ? -9.830  -9.883  29.346 1.00 68.18  ? 67   PHE D CD1   1 
ATOM   2592  C  CD2   . PHE D 4 70  ? -10.760 -12.039 29.662 1.00 69.99  ? 67   PHE D CD2   1 
ATOM   2593  C  CE1   . PHE D 4 70  ? -10.050 -9.987  27.988 1.00 68.39  ? 67   PHE D CE1   1 
ATOM   2594  C  CE2   . PHE D 4 70  ? -10.980 -12.153 28.295 1.00 70.12  ? 67   PHE D CE2   1 
ATOM   2595  C  CZ    . PHE D 4 70  ? -10.633 -11.121 27.458 1.00 70.20  ? 67   PHE D CZ    1 
ATOM   2596  N  N     . GLU D 4 71  ? -11.741 -12.934 32.660 1.00 59.70  ? 68   GLU D N     1 
ATOM   2597  C  CA    . GLU D 4 71  ? -12.549 -14.110 32.422 1.00 62.64  ? 68   GLU D CA    1 
ATOM   2598  C  C     . GLU D 4 71  ? -13.906 -13.972 33.048 1.00 56.96  ? 68   GLU D C     1 
ATOM   2599  O  O     . GLU D 4 71  ? -14.906 -14.299 32.431 1.00 56.26  ? 68   GLU D O     1 
ATOM   2600  C  CB    . GLU D 4 71  ? -11.846 -15.355 32.924 1.00 75.44  ? 68   GLU D CB    1 
ATOM   2601  C  CG    . GLU D 4 71  ? -10.883 -15.919 31.876 1.00 93.98  ? 68   GLU D CG    1 
ATOM   2602  C  CD    . GLU D 4 71  ? -9.495  -16.297 32.424 1.00 105.12 ? 68   GLU D CD    1 
ATOM   2603  O  OE1   . GLU D 4 71  ? -9.402  -17.191 33.313 1.00 83.91  ? 68   GLU D OE1   1 
ATOM   2604  O  OE2   . GLU D 4 71  ? -8.483  -15.707 31.941 1.00 109.08 ? 68   GLU D OE2   1 
ATOM   2605  N  N     . ARG D 4 72  ? -13.965 -13.435 34.253 1.00 51.95  ? 69   ARG D N     1 
ATOM   2606  C  CA    . ARG D 4 72  ? -15.255 -13.326 34.920 1.00 52.54  ? 69   ARG D CA    1 
ATOM   2607  C  C     . ARG D 4 72  ? -16.194 -12.300 34.308 1.00 57.58  ? 69   ARG D C     1 
ATOM   2608  O  O     . ARG D 4 72  ? -17.403 -12.503 34.282 1.00 65.59  ? 69   ARG D O     1 
ATOM   2609  C  CB    . ARG D 4 72  ? -15.059 -12.959 36.357 1.00 58.16  ? 69   ARG D CB    1 
ATOM   2610  C  CG    . ARG D 4 72  ? -14.242 -13.947 37.191 1.00 57.87  ? 69   ARG D CG    1 
ATOM   2611  C  CD    . ARG D 4 72  ? -14.691 -13.784 38.636 1.00 57.59  ? 69   ARG D CD    1 
ATOM   2612  N  NE    . ARG D 4 72  ? -13.572 -13.604 39.518 1.00 53.38  ? 69   ARG D NE    1 
ATOM   2613  C  CZ    . ARG D 4 72  ? -13.671 -13.145 40.755 1.00 51.82  ? 69   ARG D CZ    1 
ATOM   2614  N  NH1   . ARG D 4 72  ? -14.829 -12.776 41.262 1.00 46.85  ? 69   ARG D NH1   1 
ATOM   2615  N  NH2   . ARG D 4 72  ? -12.571 -13.024 41.480 1.00 59.40  ? 69   ARG D NH2   1 
ATOM   2616  N  N     . ILE D 4 73  ? -15.655 -11.195 33.809 1.00 62.80  ? 70   ILE D N     1 
ATOM   2617  C  CA    . ILE D 4 73  ? -16.496 -10.192 33.134 1.00 60.95  ? 70   ILE D CA    1 
ATOM   2618  C  C     . ILE D 4 73  ? -16.934 -10.724 31.795 1.00 61.30  ? 70   ILE D C     1 
ATOM   2619  O  O     . ILE D 4 73  ? -18.122 -10.615 31.450 1.00 60.73  ? 70   ILE D O     1 
ATOM   2620  C  CB    . ILE D 4 73  ? -15.782 -8.842  32.953 1.00 60.31  ? 70   ILE D CB    1 
ATOM   2621  C  CG1   . ILE D 4 73  ? -15.735 -8.101  34.296 1.00 60.59  ? 70   ILE D CG1   1 
ATOM   2622  C  CG2   . ILE D 4 73  ? -16.529 -7.984  31.958 1.00 59.83  ? 70   ILE D CG2   1 
ATOM   2623  C  CD1   . ILE D 4 73  ? -14.708 -7.012  34.386 1.00 60.33  ? 70   ILE D CD1   1 
ATOM   2624  N  N     . ALA D 4 74  ? -15.980 -11.310 31.060 1.00 58.88  ? 71   ALA D N     1 
ATOM   2625  C  CA    . ALA D 4 74  ? -16.257 -11.837 29.722 1.00 60.19  ? 71   ALA D CA    1 
ATOM   2626  C  C     . ALA D 4 74  ? -17.300 -12.943 29.799 1.00 56.23  ? 71   ALA D C     1 
ATOM   2627  O  O     . ALA D 4 74  ? -18.156 -13.049 28.950 1.00 61.25  ? 71   ALA D O     1 
ATOM   2628  C  CB    . ALA D 4 74  ? -14.982 -12.336 29.052 1.00 58.92  ? 71   ALA D CB    1 
ATOM   2629  N  N     . GLY D 4 75  ? -17.249 -13.741 30.849 1.00 54.98  ? 72   GLY D N     1 
ATOM   2630  C  CA    . GLY D 4 75  ? -18.241 -14.775 31.023 1.00 55.61  ? 72   GLY D CA    1 
ATOM   2631  C  C     . GLY D 4 75  ? -19.626 -14.201 31.243 1.00 60.50  ? 72   GLY D C     1 
ATOM   2632  O  O     . GLY D 4 75  ? -20.566 -14.567 30.556 1.00 56.38  ? 72   GLY D O     1 
ATOM   2633  N  N     . GLU D 4 76  ? -19.760 -13.298 32.209 1.00 63.47  ? 73   GLU D N     1 
ATOM   2634  C  CA    . GLU D 4 76  ? -21.057 -12.703 32.480 1.00 64.95  ? 73   GLU D CA    1 
ATOM   2635  C  C     . GLU D 4 76  ? -21.572 -12.093 31.195 1.00 67.93  ? 73   GLU D C     1 
ATOM   2636  O  O     . GLU D 4 76  ? -22.754 -12.226 30.875 1.00 70.02  ? 73   GLU D O     1 
ATOM   2637  C  CB    . GLU D 4 76  ? -20.954 -11.611 33.553 1.00 68.50  ? 73   GLU D CB    1 
ATOM   2638  C  CG    . GLU D 4 76  ? -20.705 -12.139 34.945 1.00 75.44  ? 73   GLU D CG    1 
ATOM   2639  C  CD    . GLU D 4 76  ? -21.942 -12.768 35.584 1.00 81.44  ? 73   GLU D CD    1 
ATOM   2640  O  OE1   . GLU D 4 76  ? -23.068 -12.745 34.973 1.00 80.19  ? 73   GLU D OE1   1 
ATOM   2641  O  OE2   . GLU D 4 76  ? -21.758 -13.285 36.721 1.00 73.39  ? 73   GLU D OE2   1 
ATOM   2642  N  N     . ALA D 4 77  ? -20.683 -11.418 30.461 1.00 62.56  ? 74   ALA D N     1 
ATOM   2643  C  CA    . ALA D 4 77  ? -21.067 -10.762 29.222 1.00 64.03  ? 74   ALA D CA    1 
ATOM   2644  C  C     . ALA D 4 77  ? -21.629 -11.778 28.264 1.00 62.44  ? 74   ALA D C     1 
ATOM   2645  O  O     . ALA D 4 77  ? -22.684 -11.594 27.690 1.00 61.60  ? 74   ALA D O     1 
ATOM   2646  C  CB    . ALA D 4 77  ? -19.863 -10.099 28.597 1.00 67.52  ? 74   ALA D CB    1 
ATOM   2647  N  N     . SER D 4 78  ? -20.891 -12.862 28.118 1.00 62.67  ? 75   SER D N     1 
ATOM   2648  C  CA    . SER D 4 78  ? -21.264 -13.934 27.256 1.00 62.75  ? 75   SER D CA    1 
ATOM   2649  C  C     . SER D 4 78  ? -22.690 -14.381 27.521 1.00 66.43  ? 75   SER D C     1 
ATOM   2650  O  O     . SER D 4 78  ? -23.527 -14.350 26.612 1.00 76.32  ? 75   SER D O     1 
ATOM   2651  C  CB    . SER D 4 78  ? -20.298 -15.087 27.456 1.00 66.53  ? 75   SER D CB    1 
ATOM   2652  O  OG    . SER D 4 78  ? -20.512 -16.083 26.483 1.00 75.23  ? 75   SER D OG    1 
ATOM   2653  N  N     . ARG D 4 79  ? -22.950 -14.800 28.757 1.00 64.56  ? 76   ARG D N     1 
ATOM   2654  C  CA    . ARG D 4 79  ? -24.266 -15.280 29.182 1.00 65.40  ? 76   ARG D CA    1 
ATOM   2655  C  C     . ARG D 4 79  ? -25.345 -14.262 28.890 1.00 64.34  ? 76   ARG D C     1 
ATOM   2656  O  O     . ARG D 4 79  ? -26.381 -14.577 28.324 1.00 73.72  ? 76   ARG D O     1 
ATOM   2657  C  CB    . ARG D 4 79  ? -24.278 -15.550 30.691 1.00 65.91  ? 76   ARG D CB    1 
ATOM   2658  C  CG    . ARG D 4 79  ? -23.944 -16.961 31.099 1.00 63.12  ? 76   ARG D CG    1 
ATOM   2659  C  CD    . ARG D 4 79  ? -23.477 -17.046 32.552 1.00 66.07  ? 76   ARG D CD    1 
ATOM   2660  N  NE    . ARG D 4 79  ? -22.028 -17.241 32.556 1.00 70.90  ? 76   ARG D NE    1 
ATOM   2661  C  CZ    . ARG D 4 79  ? -21.176 -16.700 33.418 1.00 67.60  ? 76   ARG D CZ    1 
ATOM   2662  N  NH1   . ARG D 4 79  ? -21.603 -15.918 34.402 1.00 65.72  ? 76   ARG D NH1   1 
ATOM   2663  N  NH2   . ARG D 4 79  ? -19.876 -16.941 33.272 1.00 62.59  ? 76   ARG D NH2   1 
ATOM   2664  N  N     . LEU D 4 80  ? -25.086 -13.039 29.307 1.00 64.91  ? 77   LEU D N     1 
ATOM   2665  C  CA    . LEU D 4 80  ? -26.029 -11.931 29.136 1.00 71.98  ? 77   LEU D CA    1 
ATOM   2666  C  C     . LEU D 4 80  ? -26.518 -11.772 27.680 1.00 65.34  ? 77   LEU D C     1 
ATOM   2667  O  O     . LEU D 4 80  ? -27.717 -11.731 27.409 1.00 63.10  ? 77   LEU D O     1 
ATOM   2668  C  CB    . LEU D 4 80  ? -25.341 -10.653 29.617 1.00 72.69  ? 77   LEU D CB    1 
ATOM   2669  C  CG    . LEU D 4 80  ? -26.170 -9.409  29.875 1.00 80.15  ? 77   LEU D CG    1 
ATOM   2670  C  CD1   . LEU D 4 80  ? -27.130 -9.625  31.025 1.00 78.15  ? 77   LEU D CD1   1 
ATOM   2671  C  CD2   . LEU D 4 80  ? -25.238 -8.246  30.189 1.00 94.69  ? 77   LEU D CD2   1 
ATOM   2672  N  N     . ALA D 4 81  ? -25.569 -11.696 26.757 1.00 62.44  ? 78   ALA D N     1 
ATOM   2673  C  CA    . ALA D 4 81  ? -25.872 -11.735 25.339 1.00 68.94  ? 78   ALA D CA    1 
ATOM   2674  C  C     . ALA D 4 81  ? -26.800 -12.901 25.032 1.00 73.90  ? 78   ALA D C     1 
ATOM   2675  O  O     . ALA D 4 81  ? -27.880 -12.724 24.467 1.00 68.07  ? 78   ALA D O     1 
ATOM   2676  C  CB    . ALA D 4 81  ? -24.596 -11.875 24.528 1.00 73.16  ? 78   ALA D CB    1 
ATOM   2677  N  N     . HIS D 4 82  ? -26.384 -14.100 25.418 1.00 78.25  ? 79   HIS D N     1 
ATOM   2678  C  CA    . HIS D 4 82  ? -27.179 -15.250 25.098 1.00 77.45  ? 79   HIS D CA    1 
ATOM   2679  C  C     . HIS D 4 82  ? -28.569 -15.014 25.632 1.00 70.97  ? 79   HIS D C     1 
ATOM   2680  O  O     . HIS D 4 82  ? -29.498 -14.973 24.871 1.00 71.43  ? 79   HIS D O     1 
ATOM   2681  C  CB    . HIS D 4 82  ? -26.541 -16.543 25.583 1.00 88.37  ? 79   HIS D CB    1 
ATOM   2682  C  CG    . HIS D 4 82  ? -25.427 -17.026 24.693 1.00 114.74 ? 79   HIS D CG    1 
ATOM   2683  N  ND1   . HIS D 4 82  ? -25.635 -17.412 23.382 1.00 127.10 ? 79   HIS D ND1   1 
ATOM   2684  C  CD2   . HIS D 4 82  ? -24.095 -17.173 24.918 1.00 114.71 ? 79   HIS D CD2   1 
ATOM   2685  C  CE1   . HIS D 4 82  ? -24.484 -17.782 22.843 1.00 118.01 ? 79   HIS D CE1   1 
ATOM   2686  N  NE2   . HIS D 4 82  ? -23.536 -17.653 23.755 1.00 112.80 ? 79   HIS D NE2   1 
ATOM   2687  N  N     . TYR D 4 83  ? -28.712 -14.741 26.915 1.00 75.63  ? 80   TYR D N     1 
ATOM   2688  C  CA    . TYR D 4 83  ? -30.045 -14.571 27.487 1.00 75.81  ? 80   TYR D CA    1 
ATOM   2689  C  C     . TYR D 4 83  ? -30.895 -13.633 26.666 1.00 79.73  ? 80   TYR D C     1 
ATOM   2690  O  O     . TYR D 4 83  ? -32.100 -13.823 26.591 1.00 80.31  ? 80   TYR D O     1 
ATOM   2691  C  CB    . TYR D 4 83  ? -29.981 -14.026 28.905 1.00 79.66  ? 80   TYR D CB    1 
ATOM   2692  C  CG    . TYR D 4 83  ? -29.207 -14.877 29.879 1.00 91.34  ? 80   TYR D CG    1 
ATOM   2693  C  CD1   . TYR D 4 83  ? -28.609 -14.302 30.987 1.00 93.89  ? 80   TYR D CD1   1 
ATOM   2694  C  CD2   . TYR D 4 83  ? -29.042 -16.245 29.686 1.00 94.79  ? 80   TYR D CD2   1 
ATOM   2695  C  CE1   . TYR D 4 83  ? -27.891 -15.055 31.890 1.00 94.21  ? 80   TYR D CE1   1 
ATOM   2696  C  CE2   . TYR D 4 83  ? -28.318 -17.002 30.587 1.00 97.59  ? 80   TYR D CE2   1 
ATOM   2697  C  CZ    . TYR D 4 83  ? -27.749 -16.399 31.696 1.00 97.06  ? 80   TYR D CZ    1 
ATOM   2698  O  OH    . TYR D 4 83  ? -27.026 -17.121 32.632 1.00 102.32 ? 80   TYR D OH    1 
ATOM   2699  N  N     . ASN D 4 84  ? -30.275 -12.618 26.067 1.00 82.89  ? 81   ASN D N     1 
ATOM   2700  C  CA    . ASN D 4 84  ? -30.982 -11.671 25.209 1.00 81.43  ? 81   ASN D CA    1 
ATOM   2701  C  C     . ASN D 4 84  ? -30.837 -11.951 23.702 1.00 83.23  ? 81   ASN D C     1 
ATOM   2702  O  O     . ASN D 4 84  ? -30.963 -11.050 22.877 1.00 87.38  ? 81   ASN D O     1 
ATOM   2703  C  CB    . ASN D 4 84  ? -30.495 -10.255 25.516 1.00 85.77  ? 81   ASN D CB    1 
ATOM   2704  C  CG    . ASN D 4 84  ? -30.922 -9.783  26.878 1.00 82.31  ? 81   ASN D CG    1 
ATOM   2705  O  OD1   . ASN D 4 84  ? -32.040 -9.288  27.052 1.00 78.89  ? 81   ASN D OD1   1 
ATOM   2706  N  ND2   . ASN D 4 84  ? -30.028 -9.914  27.857 1.00 82.95  ? 81   ASN D ND2   1 
ATOM   2707  N  N     . LYS D 4 85  ? -30.561 -13.195 23.332 1.00 89.13  ? 82   LYS D N     1 
ATOM   2708  C  CA    . LYS D 4 85  ? -30.496 -13.582 21.913 1.00 91.57  ? 82   LYS D CA    1 
ATOM   2709  C  C     . LYS D 4 85  ? -29.765 -12.515 21.097 1.00 85.74  ? 82   LYS D C     1 
ATOM   2710  O  O     . LYS D 4 85  ? -30.251 -12.046 20.078 1.00 86.68  ? 82   LYS D O     1 
ATOM   2711  C  CB    . LYS D 4 85  ? -31.910 -13.825 21.352 1.00 94.05  ? 82   LYS D CB    1 
ATOM   2712  C  CG    . LYS D 4 85  ? -32.694 -14.943 22.036 1.00 93.48  ? 82   LYS D CG    1 
ATOM   2713  C  CD    . LYS D 4 85  ? -34.050 -14.433 22.529 1.00 108.27 ? 82   LYS D CD    1 
ATOM   2714  C  CE    . LYS D 4 85  ? -34.750 -15.382 23.502 1.00 111.45 ? 82   LYS D CE    1 
ATOM   2715  N  NZ    . LYS D 4 85  ? -35.523 -16.439 22.789 1.00 116.60 ? 82   LYS D NZ    1 
ATOM   2716  N  N     . ARG D 4 86  ? -28.599 -12.135 21.591 1.00 86.61  ? 83   ARG D N     1 
ATOM   2717  C  CA    . ARG D 4 86  ? -27.704 -11.240 20.909 1.00 86.65  ? 83   ARG D CA    1 
ATOM   2718  C  C     . ARG D 4 86  ? -26.504 -12.068 20.520 1.00 82.60  ? 83   ARG D C     1 
ATOM   2719  O  O     . ARG D 4 86  ? -26.079 -12.929 21.292 1.00 91.90  ? 83   ARG D O     1 
ATOM   2720  C  CB    . ARG D 4 86  ? -27.241 -10.142 21.861 1.00 94.86  ? 83   ARG D CB    1 
ATOM   2721  C  CG    . ARG D 4 86  ? -28.340 -9.202  22.322 1.00 102.77 ? 83   ARG D CG    1 
ATOM   2722  C  CD    . ARG D 4 86  ? -28.587 -8.080  21.319 1.00 116.16 ? 83   ARG D CD    1 
ATOM   2723  N  NE    . ARG D 4 86  ? -29.929 -7.503  21.452 1.00 112.47 ? 83   ARG D NE    1 
ATOM   2724  C  CZ    . ARG D 4 86  ? -31.019 -7.926  20.809 1.00 100.22 ? 83   ARG D CZ    1 
ATOM   2725  N  NH1   . ARG D 4 86  ? -30.987 -8.949  19.952 1.00 112.38 ? 83   ARG D NH1   1 
ATOM   2726  N  NH2   . ARG D 4 86  ? -32.162 -7.313  21.029 1.00 94.70  ? 83   ARG D NH2   1 
ATOM   2727  N  N     . SER D 4 87  ? -25.958 -11.802 19.340 1.00 73.56  ? 84   SER D N     1 
ATOM   2728  C  CA    . SER D 4 87  ? -24.731 -12.419 18.913 1.00 70.57  ? 84   SER D CA    1 
ATOM   2729  C  C     . SER D 4 87  ? -23.527 -11.518 19.168 1.00 70.26  ? 84   SER D C     1 
ATOM   2730  O  O     . SER D 4 87  ? -22.384 -11.930 18.956 1.00 75.32  ? 84   SER D O     1 
ATOM   2731  C  CB    . SER D 4 87  ? -24.832 -12.752 17.425 1.00 80.52  ? 84   SER D CB    1 
ATOM   2732  O  OG    . SER D 4 87  ? -25.119 -11.595 16.641 1.00 83.96  ? 84   SER D OG    1 
ATOM   2733  N  N     . THR D 4 88  ? -23.757 -10.287 19.611 1.00 71.89  ? 85   THR D N     1 
ATOM   2734  C  CA    . THR D 4 88  ? -22.648 -9.333  19.719 1.00 83.89  ? 85   THR D CA    1 
ATOM   2735  C  C     . THR D 4 88  ? -22.399 -8.914  21.170 1.00 81.73  ? 85   THR D C     1 
ATOM   2736  O  O     . THR D 4 88  ? -23.347 -8.624  21.907 1.00 90.72  ? 85   THR D O     1 
ATOM   2737  C  CB    . THR D 4 88  ? -22.895 -8.053  18.875 1.00 83.31  ? 85   THR D CB    1 
ATOM   2738  O  OG1   . THR D 4 88  ? -23.487 -8.380  17.613 1.00 80.89  ? 85   THR D OG1   1 
ATOM   2739  C  CG2   . THR D 4 88  ? -21.589 -7.326  18.618 1.00 86.93  ? 85   THR D CG2   1 
ATOM   2740  N  N     . ILE D 4 89  ? -21.130 -8.877  21.572 1.00 72.24  ? 86   ILE D N     1 
ATOM   2741  C  CA    . ILE D 4 89  ? -20.754 -8.329  22.880 1.00 75.69  ? 86   ILE D CA    1 
ATOM   2742  C  C     . ILE D 4 89  ? -20.223 -6.919  22.722 1.00 72.97  ? 86   ILE D C     1 
ATOM   2743  O  O     . ILE D 4 89  ? -19.125 -6.696  22.181 1.00 72.41  ? 86   ILE D O     1 
ATOM   2744  C  CB    . ILE D 4 89  ? -19.685 -9.176  23.603 1.00 72.95  ? 86   ILE D CB    1 
ATOM   2745  C  CG1   . ILE D 4 89  ? -20.334 -10.424 24.181 1.00 76.62  ? 86   ILE D CG1   1 
ATOM   2746  C  CG2   . ILE D 4 89  ? -19.078 -8.388  24.751 1.00 73.22  ? 86   ILE D CG2   1 
ATOM   2747  C  CD1   . ILE D 4 89  ? -19.326 -11.425 24.688 1.00 80.94  ? 86   ILE D CD1   1 
ATOM   2748  N  N     . THR D 4 90  ? -20.999 -5.973  23.220 1.00 67.71  ? 87   THR D N     1 
ATOM   2749  C  CA    . THR D 4 90  ? -20.665 -4.570  23.097 1.00 68.33  ? 87   THR D CA    1 
ATOM   2750  C  C     . THR D 4 90  ? -20.192 -4.026  24.429 1.00 66.84  ? 87   THR D C     1 
ATOM   2751  O  O     . THR D 4 90  ? -20.110 -4.749  25.400 1.00 78.42  ? 87   THR D O     1 
ATOM   2752  C  CB    . THR D 4 90  ? -21.891 -3.773  22.647 1.00 69.40  ? 87   THR D CB    1 
ATOM   2753  O  OG1   . THR D 4 90  ? -22.892 -3.780  23.680 1.00 69.19  ? 87   THR D OG1   1 
ATOM   2754  C  CG2   . THR D 4 90  ? -22.450 -4.363  21.365 1.00 70.14  ? 87   THR D CG2   1 
ATOM   2755  N  N     . SER D 4 91  ? -19.887 -2.744  24.475 1.00 66.09  ? 88   SER D N     1 
ATOM   2756  C  CA    . SER D 4 91  ? -19.489 -2.125  25.706 1.00 68.03  ? 88   SER D CA    1 
ATOM   2757  C  C     . SER D 4 91  ? -20.711 -2.046  26.616 1.00 66.48  ? 88   SER D C     1 
ATOM   2758  O  O     . SER D 4 91  ? -20.572 -1.950  27.813 1.00 70.82  ? 88   SER D O     1 
ATOM   2759  C  CB    . SER D 4 91  ? -18.906 -0.735  25.458 1.00 67.30  ? 88   SER D CB    1 
ATOM   2760  O  OG    . SER D 4 91  ? -19.955 0.213   25.479 1.00 74.14  ? 88   SER D OG    1 
ATOM   2761  N  N     . ARG D 4 92  ? -21.910 -2.088  26.066 1.00 64.75  ? 89   ARG D N     1 
ATOM   2762  C  CA    . ARG D 4 92  ? -23.086 -2.167  26.924 1.00 67.12  ? 89   ARG D CA    1 
ATOM   2763  C  C     . ARG D 4 92  ? -23.169 -3.511  27.700 1.00 66.74  ? 89   ARG D C     1 
ATOM   2764  O  O     . ARG D 4 92  ? -23.587 -3.551  28.842 1.00 64.56  ? 89   ARG D O     1 
ATOM   2765  C  CB    . ARG D 4 92  ? -24.340 -1.936  26.091 1.00 66.00  ? 89   ARG D CB    1 
ATOM   2766  C  CG    . ARG D 4 92  ? -25.573 -1.756  26.938 1.00 73.70  ? 89   ARG D CG    1 
ATOM   2767  C  CD    . ARG D 4 92  ? -26.771 -1.274  26.136 1.00 80.37  ? 89   ARG D CD    1 
ATOM   2768  N  NE    . ARG D 4 92  ? -27.916 -1.074  27.024 1.00 80.44  ? 89   ARG D NE    1 
ATOM   2769  C  CZ    . ARG D 4 92  ? -28.835 -1.995  27.299 1.00 84.39  ? 89   ARG D CZ    1 
ATOM   2770  N  NH1   . ARG D 4 92  ? -28.776 -3.207  26.740 1.00 83.40  ? 89   ARG D NH1   1 
ATOM   2771  N  NH2   . ARG D 4 92  ? -29.831 -1.695  28.131 1.00 88.71  ? 89   ARG D NH2   1 
ATOM   2772  N  N     . GLU D 4 93  ? -22.766 -4.609  27.072 1.00 69.81  ? 90   GLU D N     1 
ATOM   2773  C  CA    . GLU D 4 93  ? -22.757 -5.908  27.749 1.00 70.33  ? 90   GLU D CA    1 
ATOM   2774  C  C     . GLU D 4 93  ? -21.723 -5.933  28.866 1.00 68.05  ? 90   GLU D C     1 
ATOM   2775  O  O     . GLU D 4 93  ? -22.038 -6.316  29.997 1.00 68.34  ? 90   GLU D O     1 
ATOM   2776  C  CB    . GLU D 4 93  ? -22.473 -7.032  26.765 1.00 69.52  ? 90   GLU D CB    1 
ATOM   2777  C  CG    . GLU D 4 93  ? -23.720 -7.557  26.076 1.00 77.34  ? 90   GLU D CG    1 
ATOM   2778  C  CD    . GLU D 4 93  ? -24.453 -6.504  25.284 1.00 77.27  ? 90   GLU D CD    1 
ATOM   2779  O  OE1   . GLU D 4 93  ? -25.691 -6.445  25.389 1.00 78.93  ? 90   GLU D OE1   1 
ATOM   2780  O  OE2   . GLU D 4 93  ? -23.790 -5.734  24.571 1.00 78.72  ? 90   GLU D OE2   1 
ATOM   2781  N  N     . ILE D 4 94  ? -20.512 -5.492  28.545 1.00 56.56  ? 91   ILE D N     1 
ATOM   2782  C  CA    . ILE D 4 94  ? -19.447 -5.411  29.518 1.00 55.45  ? 91   ILE D CA    1 
ATOM   2783  C  C     . ILE D 4 94  ? -19.939 -4.623  30.732 1.00 61.63  ? 91   ILE D C     1 
ATOM   2784  O  O     . ILE D 4 94  ? -19.658 -4.959  31.902 1.00 57.95  ? 91   ILE D O     1 
ATOM   2785  C  CB    . ILE D 4 94  ? -18.246 -4.673  28.923 1.00 55.22  ? 91   ILE D CB    1 
ATOM   2786  C  CG1   . ILE D 4 94  ? -17.686 -5.413  27.698 1.00 61.33  ? 91   ILE D CG1   1 
ATOM   2787  C  CG2   . ILE D 4 94  ? -17.152 -4.498  29.946 1.00 58.05  ? 91   ILE D CG2   1 
ATOM   2788  C  CD1   . ILE D 4 94  ? -16.966 -6.701  27.984 1.00 62.72  ? 91   ILE D CD1   1 
ATOM   2789  N  N     . GLN D 4 95  ? -20.689 -3.569  30.438 1.00 64.83  ? 92   GLN D N     1 
ATOM   2790  C  CA    . GLN D 4 95  ? -21.134 -2.660  31.460 1.00 66.88  ? 92   GLN D CA    1 
ATOM   2791  C  C     . GLN D 4 95  ? -22.014 -3.389  32.442 1.00 60.86  ? 92   GLN D C     1 
ATOM   2792  O  O     . GLN D 4 95  ? -21.756 -3.374  33.631 1.00 67.11  ? 92   GLN D O     1 
ATOM   2793  C  CB    . GLN D 4 95  ? -21.871 -1.451  30.856 1.00 76.04  ? 92   GLN D CB    1 
ATOM   2794  C  CG    . GLN D 4 95  ? -22.665 -0.656  31.880 1.00 77.43  ? 92   GLN D CG    1 
ATOM   2795  C  CD    . GLN D 4 95  ? -22.710 0.819   31.608 1.00 75.21  ? 92   GLN D CD    1 
ATOM   2796  O  OE1   . GLN D 4 95  ? -23.783 1.364   31.492 1.00 88.83  ? 92   GLN D OE1   1 
ATOM   2797  N  NE2   . GLN D 4 95  ? -21.555 1.476   31.544 1.00 73.31  ? 92   GLN D NE2   1 
ATOM   2798  N  N     . THR D 4 96  ? -23.048 -4.041  31.964 1.00 58.29  ? 93   THR D N     1 
ATOM   2799  C  CA    . THR D 4 96  ? -23.867 -4.786  32.879 1.00 63.55  ? 93   THR D CA    1 
ATOM   2800  C  C     . THR D 4 96  ? -23.085 -5.859  33.636 1.00 60.64  ? 93   THR D C     1 
ATOM   2801  O  O     . THR D 4 96  ? -23.316 -6.064  34.809 1.00 58.94  ? 93   THR D O     1 
ATOM   2802  C  CB    . THR D 4 96  ? -24.983 -5.453  32.140 1.00 67.62  ? 93   THR D CB    1 
ATOM   2803  O  OG1   . THR D 4 96  ? -25.599 -4.478  31.314 1.00 70.83  ? 93   THR D OG1   1 
ATOM   2804  C  CG2   . THR D 4 96  ? -26.001 -5.967  33.116 1.00 74.06  ? 93   THR D CG2   1 
ATOM   2805  N  N     . ALA D 4 97  ? -22.147 -6.511  32.966 1.00 58.10  ? 94   ALA D N     1 
ATOM   2806  C  CA    . ALA D 4 97  ? -21.358 -7.559  33.573 1.00 52.72  ? 94   ALA D CA    1 
ATOM   2807  C  C     . ALA D 4 97  ? -20.638 -6.988  34.730 1.00 52.24  ? 94   ALA D C     1 
ATOM   2808  O  O     . ALA D 4 97  ? -20.451 -7.642  35.735 1.00 56.12  ? 94   ALA D O     1 
ATOM   2809  C  CB    . ALA D 4 97  ? -20.351 -8.110  32.574 1.00 57.86  ? 94   ALA D CB    1 
ATOM   2810  N  N     . VAL D 4 98  ? -20.195 -5.759  34.580 1.00 53.48  ? 95   VAL D N     1 
ATOM   2811  C  CA    . VAL D 4 98  ? -19.467 -5.124  35.655 1.00 56.25  ? 95   VAL D CA    1 
ATOM   2812  C  C     . VAL D 4 98  ? -20.343 -4.847  36.873 1.00 56.09  ? 95   VAL D C     1 
ATOM   2813  O  O     . VAL D 4 98  ? -19.912 -4.981  38.010 1.00 54.02  ? 95   VAL D O     1 
ATOM   2814  C  CB    . VAL D 4 98  ? -18.845 -3.836  35.144 1.00 58.76  ? 95   VAL D CB    1 
ATOM   2815  C  CG1   . VAL D 4 98  ? -18.520 -2.926  36.299 1.00 63.52  ? 95   VAL D CG1   1 
ATOM   2816  C  CG2   . VAL D 4 98  ? -17.605 -4.156  34.296 1.00 61.21  ? 95   VAL D CG2   1 
ATOM   2817  N  N     . ARG D 4 99  ? -21.578 -4.455  36.615 1.00 59.52  ? 96   ARG D N     1 
ATOM   2818  C  CA    . ARG D 4 99  ? -22.507 -4.115  37.674 1.00 62.12  ? 96   ARG D CA    1 
ATOM   2819  C  C     . ARG D 4 99  ? -22.942 -5.371  38.349 1.00 61.60  ? 96   ARG D C     1 
ATOM   2820  O  O     . ARG D 4 99  ? -23.230 -5.351  39.542 1.00 66.27  ? 96   ARG D O     1 
ATOM   2821  C  CB    . ARG D 4 99  ? -23.732 -3.362  37.135 1.00 65.62  ? 96   ARG D CB    1 
ATOM   2822  C  CG    . ARG D 4 99  ? -23.442 -1.893  36.895 1.00 75.76  ? 96   ARG D CG    1 
ATOM   2823  C  CD    . ARG D 4 99  ? -24.703 -1.096  36.615 1.00 97.31  ? 96   ARG D CD    1 
ATOM   2824  N  NE    . ARG D 4 99  ? -24.409 0.330   36.378 1.00 109.87 ? 96   ARG D NE    1 
ATOM   2825  C  CZ    . ARG D 4 99  ? -24.789 1.044   35.305 1.00 109.15 ? 96   ARG D CZ    1 
ATOM   2826  N  NH1   . ARG D 4 99  ? -25.519 0.515   34.313 1.00 97.44  ? 96   ARG D NH1   1 
ATOM   2827  N  NH2   . ARG D 4 99  ? -24.443 2.324   35.227 1.00 111.07 ? 96   ARG D NH2   1 
ATOM   2828  N  N     . LEU D 4 100 ? -23.007 -6.455  37.583 1.00 57.47  ? 97   LEU D N     1 
ATOM   2829  C  CA    . LEU D 4 100 ? -23.370 -7.734  38.140 1.00 58.02  ? 97   LEU D CA    1 
ATOM   2830  C  C     . LEU D 4 100 ? -22.222 -8.263  38.970 1.00 64.06  ? 97   LEU D C     1 
ATOM   2831  O  O     . LEU D 4 100 ? -22.435 -8.658  40.106 1.00 74.97  ? 97   LEU D O     1 
ATOM   2832  C  CB    . LEU D 4 100 ? -23.731 -8.731  37.068 1.00 52.53  ? 97   LEU D CB    1 
ATOM   2833  C  CG    . LEU D 4 100 ? -25.139 -8.502  36.512 1.00 53.55  ? 97   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D 4 100 ? -25.267 -9.277  35.211 1.00 52.67  ? 97   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D 4 100 ? -26.250 -8.931  37.465 1.00 56.52  ? 97   LEU D CD2   1 
ATOM   2836  N  N     . LEU D 4 101 ? -21.012 -8.199  38.438 1.00 59.25  ? 98   LEU D N     1 
ATOM   2837  C  CA    . LEU D 4 101 ? -19.872 -8.817  39.073 1.00 60.81  ? 98   LEU D CA    1 
ATOM   2838  C  C     . LEU D 4 101 ? -19.264 -8.047  40.249 1.00 56.35  ? 98   LEU D C     1 
ATOM   2839  O  O     . LEU D 4 101 ? -18.914 -8.636  41.269 1.00 62.94  ? 98   LEU D O     1 
ATOM   2840  C  CB    . LEU D 4 101 ? -18.800 -9.043  38.034 1.00 66.81  ? 98   LEU D CB    1 
ATOM   2841  C  CG    . LEU D 4 101 ? -17.576 -9.755  38.572 1.00 79.53  ? 98   LEU D CG    1 
ATOM   2842  C  CD1   . LEU D 4 101 ? -17.898 -11.234 38.616 1.00 85.81  ? 98   LEU D CD1   1 
ATOM   2843  C  CD2   . LEU D 4 101 ? -16.344 -9.499  37.711 1.00 91.75  ? 98   LEU D CD2   1 
ATOM   2844  N  N     . LEU D 4 102 ? -19.104 -6.748  40.134 1.00 49.96  ? 99   LEU D N     1 
ATOM   2845  C  CA    . LEU D 4 102 ? -18.387 -6.027  41.180 1.00 51.94  ? 99   LEU D CA    1 
ATOM   2846  C  C     . LEU D 4 102 ? -19.293 -5.506  42.288 1.00 52.60  ? 99   LEU D C     1 
ATOM   2847  O  O     . LEU D 4 102 ? -20.480 -5.356  42.093 1.00 62.49  ? 99   LEU D O     1 
ATOM   2848  C  CB    . LEU D 4 102 ? -17.644 -4.843  40.579 1.00 54.77  ? 99   LEU D CB    1 
ATOM   2849  C  CG    . LEU D 4 102 ? -16.736 -5.078  39.381 1.00 52.76  ? 99   LEU D CG    1 
ATOM   2850  C  CD1   . LEU D 4 102 ? -15.848 -3.880  39.129 1.00 57.13  ? 99   LEU D CD1   1 
ATOM   2851  C  CD2   . LEU D 4 102 ? -15.861 -6.241  39.704 1.00 57.99  ? 99   LEU D CD2   1 
ATOM   2852  N  N     . PRO D 4 103 ? -18.725 -5.216  43.458 1.00 52.22  ? 100  PRO D N     1 
ATOM   2853  C  CA    . PRO D 4 103 ? -19.524 -4.688  44.525 1.00 56.13  ? 100  PRO D CA    1 
ATOM   2854  C  C     . PRO D 4 103 ? -19.620 -3.182  44.522 1.00 66.40  ? 100  PRO D C     1 
ATOM   2855  O  O     . PRO D 4 103 ? -18.682 -2.505  44.098 1.00 73.58  ? 100  PRO D O     1 
ATOM   2856  C  CB    . PRO D 4 103 ? -18.800 -5.157  45.787 1.00 54.95  ? 100  PRO D CB    1 
ATOM   2857  C  CG    . PRO D 4 103 ? -17.414 -5.441  45.398 1.00 52.56  ? 100  PRO D CG    1 
ATOM   2858  C  CD    . PRO D 4 103 ? -17.399 -5.656  43.920 1.00 57.57  ? 100  PRO D CD    1 
ATOM   2859  N  N     . GLY D 4 104 ? -20.741 -2.690  45.053 1.00 65.54  ? 101  GLY D N     1 
ATOM   2860  C  CA    . GLY D 4 104 ? -21.085 -1.282  45.096 1.00 61.24  ? 101  GLY D CA    1 
ATOM   2861  C  C     . GLY D 4 104 ? -20.132 -0.272  44.520 1.00 60.85  ? 101  GLY D C     1 
ATOM   2862  O  O     . GLY D 4 104 ? -20.195 0.066   43.339 1.00 68.12  ? 101  GLY D O     1 
ATOM   2863  N  N     . GLU D 4 105 ? -19.255 0.223   45.364 1.00 59.61  ? 102  GLU D N     1 
ATOM   2864  C  CA    . GLU D 4 105 ? -18.466 1.368   45.008 1.00 65.85  ? 102  GLU D CA    1 
ATOM   2865  C  C     . GLU D 4 105 ? -17.427 1.062   43.936 1.00 67.31  ? 102  GLU D C     1 
ATOM   2866  O  O     . GLU D 4 105 ? -17.098 1.935   43.161 1.00 81.22  ? 102  GLU D O     1 
ATOM   2867  C  CB    . GLU D 4 105 ? -17.805 1.964   46.251 1.00 76.74  ? 102  GLU D CB    1 
ATOM   2868  C  CG    . GLU D 4 105 ? -17.621 3.487   46.199 1.00 88.28  ? 102  GLU D CG    1 
ATOM   2869  C  CD    . GLU D 4 105 ? -18.946 4.252   46.165 1.00 92.42  ? 102  GLU D CD    1 
ATOM   2870  O  OE1   . GLU D 4 105 ? -19.924 3.773   46.777 1.00 88.58  ? 102  GLU D OE1   1 
ATOM   2871  O  OE2   . GLU D 4 105 ? -19.011 5.338   45.531 1.00 99.41  ? 102  GLU D OE2   1 
ATOM   2872  N  N     . LEU D 4 106 ? -16.895 -0.155  43.877 1.00 66.87  ? 103  LEU D N     1 
ATOM   2873  C  CA    . LEU D 4 106 ? -15.941 -0.482  42.814 1.00 63.96  ? 103  LEU D CA    1 
ATOM   2874  C  C     . LEU D 4 106 ? -16.661 -0.428  41.488 1.00 67.29  ? 103  LEU D C     1 
ATOM   2875  O  O     . LEU D 4 106 ? -16.104 0.028   40.497 1.00 72.72  ? 103  LEU D O     1 
ATOM   2876  C  CB    . LEU D 4 106 ? -15.323 -1.880  42.986 1.00 63.58  ? 103  LEU D CB    1 
ATOM   2877  C  CG    . LEU D 4 106 ? -14.155 -2.084  43.958 1.00 60.64  ? 103  LEU D CG    1 
ATOM   2878  C  CD1   . LEU D 4 106 ? -13.761 -3.556  44.077 1.00 57.77  ? 103  LEU D CD1   1 
ATOM   2879  C  CD2   . LEU D 4 106 ? -12.964 -1.264  43.523 1.00 57.20  ? 103  LEU D CD2   1 
ATOM   2880  N  N     . ALA D 4 107 ? -17.901 -0.902  41.476 1.00 65.78  ? 104  ALA D N     1 
ATOM   2881  C  CA    . ALA D 4 107 ? -18.687 -0.935  40.268 1.00 64.84  ? 104  ALA D CA    1 
ATOM   2882  C  C     . ALA D 4 107 ? -18.967 0.500   39.755 1.00 72.18  ? 104  ALA D C     1 
ATOM   2883  O  O     . ALA D 4 107 ? -18.734 0.833   38.569 1.00 71.17  ? 104  ALA D O     1 
ATOM   2884  C  CB    . ALA D 4 107 ? -19.966 -1.684  40.549 1.00 67.57  ? 104  ALA D CB    1 
ATOM   2885  N  N     . LYS D 4 108 ? -19.418 1.356   40.672 1.00 72.92  ? 105  LYS D N     1 
ATOM   2886  C  CA    . LYS D 4 108 ? -19.718 2.752   40.357 1.00 69.52  ? 105  LYS D CA    1 
ATOM   2887  C  C     . LYS D 4 108 ? -18.539 3.380   39.661 1.00 64.32  ? 105  LYS D C     1 
ATOM   2888  O  O     . LYS D 4 108 ? -18.688 3.927   38.580 1.00 73.64  ? 105  LYS D O     1 
ATOM   2889  C  CB    . LYS D 4 108 ? -20.052 3.538   41.619 1.00 80.14  ? 105  LYS D CB    1 
ATOM   2890  C  CG    . LYS D 4 108 ? -21.113 4.620   41.427 1.00 100.87 ? 105  LYS D CG    1 
ATOM   2891  C  CD    . LYS D 4 108 ? -21.287 5.503   42.669 1.00 115.15 ? 105  LYS D CD    1 
ATOM   2892  C  CE    . LYS D 4 108 ? -22.001 4.779   43.814 1.00 123.08 ? 105  LYS D CE    1 
ATOM   2893  N  NZ    . LYS D 4 108 ? -21.928 5.515   45.111 1.00 119.89 ? 105  LYS D NZ    1 
ATOM   2894  N  N     . HIS D 4 109 ? -17.361 3.256   40.248 1.00 56.20  ? 106  HIS D N     1 
ATOM   2895  C  CA    . HIS D 4 109 ? -16.187 3.890   39.690 1.00 61.40  ? 106  HIS D CA    1 
ATOM   2896  C  C     . HIS D 4 109 ? -15.663 3.204   38.432 1.00 63.50  ? 106  HIS D C     1 
ATOM   2897  O  O     . HIS D 4 109 ? -15.159 3.869   37.537 1.00 62.70  ? 106  HIS D O     1 
ATOM   2898  C  CB    . HIS D 4 109 ? -15.076 3.946   40.723 1.00 69.11  ? 106  HIS D CB    1 
ATOM   2899  C  CG    . HIS D 4 109 ? -15.306 4.947   41.812 1.00 79.38  ? 106  HIS D CG    1 
ATOM   2900  N  ND1   . HIS D 4 109 ? -16.385 4.893   42.670 1.00 88.80  ? 106  HIS D ND1   1 
ATOM   2901  C  CD2   . HIS D 4 109 ? -14.575 6.015   42.199 1.00 84.77  ? 106  HIS D CD2   1 
ATOM   2902  C  CE1   . HIS D 4 109 ? -16.314 5.890   43.533 1.00 95.18  ? 106  HIS D CE1   1 
ATOM   2903  N  NE2   . HIS D 4 109 ? -15.223 6.585   43.268 1.00 100.79 ? 106  HIS D NE2   1 
ATOM   2904  N  N     . ALA D 4 110 ? -15.751 1.878   38.363 1.00 62.49  ? 107  ALA D N     1 
ATOM   2905  C  CA    . ALA D 4 110 ? -15.281 1.146   37.176 1.00 57.57  ? 107  ALA D CA    1 
ATOM   2906  C  C     . ALA D 4 110 ? -16.152 1.527   36.009 1.00 59.69  ? 107  ALA D C     1 
ATOM   2907  O  O     . ALA D 4 110 ? -15.674 1.698   34.896 1.00 55.06  ? 107  ALA D O     1 
ATOM   2908  C  CB    . ALA D 4 110 ? -15.360 -0.353  37.401 1.00 56.37  ? 107  ALA D CB    1 
ATOM   2909  N  N     . VAL D 4 111 ? -17.447 1.682   36.281 1.00 61.87  ? 108  VAL D N     1 
ATOM   2910  C  CA    . VAL D 4 111 ? -18.366 2.169   35.258 1.00 67.66  ? 108  VAL D CA    1 
ATOM   2911  C  C     . VAL D 4 111 ? -18.039 3.581   34.746 1.00 64.27  ? 108  VAL D C     1 
ATOM   2912  O  O     . VAL D 4 111 ? -18.131 3.832   33.560 1.00 65.71  ? 108  VAL D O     1 
ATOM   2913  C  CB    . VAL D 4 111 ? -19.812 2.102   35.728 1.00 65.88  ? 108  VAL D CB    1 
ATOM   2914  C  CG1   . VAL D 4 111 ? -20.718 2.752   34.705 1.00 64.34  ? 108  VAL D CG1   1 
ATOM   2915  C  CG2   . VAL D 4 111 ? -20.208 0.646   35.911 1.00 70.84  ? 108  VAL D CG2   1 
ATOM   2916  N  N     . SER D 4 112 ? -17.646 4.501   35.613 1.00 67.22  ? 109  SER D N     1 
ATOM   2917  C  CA    . SER D 4 112 ? -17.146 5.790   35.108 1.00 69.90  ? 109  SER D CA    1 
ATOM   2918  C  C     . SER D 4 112 ? -16.039 5.591   34.086 1.00 66.97  ? 109  SER D C     1 
ATOM   2919  O  O     . SER D 4 112 ? -16.116 6.087   32.970 1.00 69.49  ? 109  SER D O     1 
ATOM   2920  C  CB    . SER D 4 112 ? -16.596 6.657   36.224 1.00 64.27  ? 109  SER D CB    1 
ATOM   2921  O  OG    . SER D 4 112 ? -17.595 6.856   37.167 1.00 72.13  ? 109  SER D OG    1 
ATOM   2922  N  N     . GLU D 4 113 ? -15.031 4.830   34.480 1.00 65.86  ? 110  GLU D N     1 
ATOM   2923  C  CA    . GLU D 4 113 ? -13.769 4.839   33.788 1.00 65.89  ? 110  GLU D CA    1 
ATOM   2924  C  C     . GLU D 4 113 ? -13.900 4.175   32.421 1.00 64.08  ? 110  GLU D C     1 
ATOM   2925  O  O     . GLU D 4 113 ? -13.200 4.515   31.466 1.00 62.72  ? 110  GLU D O     1 
ATOM   2926  C  CB    . GLU D 4 113 ? -12.729 4.158   34.666 1.00 65.55  ? 110  GLU D CB    1 
ATOM   2927  C  CG    . GLU D 4 113 ? -12.427 4.936   35.937 1.00 71.58  ? 110  GLU D CG    1 
ATOM   2928  C  CD    . GLU D 4 113 ? -11.061 5.592   35.896 1.00 78.80  ? 110  GLU D CD    1 
ATOM   2929  O  OE1   . GLU D 4 113 ? -10.916 6.633   35.210 1.00 88.84  ? 110  GLU D OE1   1 
ATOM   2930  O  OE2   . GLU D 4 113 ? -10.124 5.053   36.544 1.00 81.02  ? 110  GLU D OE2   1 
ATOM   2931  N  N     . GLY D 4 114 ? -14.829 3.246   32.330 1.00 61.55  ? 111  GLY D N     1 
ATOM   2932  C  CA    . GLY D 4 114 ? -15.075 2.583   31.087 1.00 67.06  ? 111  GLY D CA    1 
ATOM   2933  C  C     . GLY D 4 114 ? -15.885 3.483   30.188 1.00 65.86  ? 111  GLY D C     1 
ATOM   2934  O  O     . GLY D 4 114 ? -15.640 3.554   28.996 1.00 68.49  ? 111  GLY D O     1 
ATOM   2935  N  N     . THR D 4 115 ? -16.875 4.148   30.758 1.00 65.99  ? 112  THR D N     1 
ATOM   2936  C  CA    . THR D 4 115 ? -17.710 5.044   29.989 1.00 71.82  ? 112  THR D CA    1 
ATOM   2937  C  C     . THR D 4 115 ? -16.821 6.142   29.418 1.00 75.05  ? 112  THR D C     1 
ATOM   2938  O  O     . THR D 4 115 ? -16.767 6.392   28.209 1.00 73.49  ? 112  THR D O     1 
ATOM   2939  C  CB    . THR D 4 115 ? -18.802 5.693   30.859 1.00 69.20  ? 112  THR D CB    1 
ATOM   2940  O  OG1   . THR D 4 115 ? -19.475 4.700   31.640 1.00 80.41  ? 112  THR D OG1   1 
ATOM   2941  C  CG2   . THR D 4 115 ? -19.816 6.344   29.993 1.00 71.96  ? 112  THR D CG2   1 
ATOM   2942  N  N     . LYS D 4 116 ? -16.098 6.771   30.321 1.00 74.41  ? 113  LYS D N     1 
ATOM   2943  C  CA    . LYS D 4 116 ? -15.120 7.771   29.970 1.00 73.05  ? 113  LYS D CA    1 
ATOM   2944  C  C     . LYS D 4 116 ? -14.249 7.316   28.825 1.00 65.73  ? 113  LYS D C     1 
ATOM   2945  O  O     . LYS D 4 116 ? -14.036 8.057   27.907 1.00 76.86  ? 113  LYS D O     1 
ATOM   2946  C  CB    . LYS D 4 116 ? -14.270 8.057   31.211 1.00 80.73  ? 113  LYS D CB    1 
ATOM   2947  C  CG    . LYS D 4 116 ? -13.182 9.107   31.106 1.00 75.85  ? 113  LYS D CG    1 
ATOM   2948  C  CD    . LYS D 4 116 ? -12.984 9.708   32.488 1.00 83.82  ? 113  LYS D CD    1 
ATOM   2949  C  CE    . LYS D 4 116 ? -11.597 10.289  32.678 1.00 99.70  ? 113  LYS D CE    1 
ATOM   2950  N  NZ    . LYS D 4 116 ? -10.538 9.248   32.659 1.00 103.51 ? 113  LYS D NZ    1 
ATOM   2951  N  N     . ALA D 4 117 ? -13.749 6.096   28.882 1.00 71.52  ? 114  ALA D N     1 
ATOM   2952  C  CA    . ALA D 4 117 ? -12.798 5.625   27.892 1.00 73.25  ? 114  ALA D CA    1 
ATOM   2953  C  C     . ALA D 4 117 ? -13.434 5.385   26.539 1.00 75.90  ? 114  ALA D C     1 
ATOM   2954  O  O     . ALA D 4 117 ? -12.790 5.563   25.504 1.00 81.97  ? 114  ALA D O     1 
ATOM   2955  C  CB    . ALA D 4 117 ? -12.151 4.354   28.377 1.00 75.98  ? 114  ALA D CB    1 
ATOM   2956  N  N     . VAL D 4 118 ? -14.685 4.958   26.546 1.00 73.80  ? 115  VAL D N     1 
ATOM   2957  C  CA    . VAL D 4 118 ? -15.401 4.729   25.304 1.00 82.41  ? 115  VAL D CA    1 
ATOM   2958  C  C     . VAL D 4 118 ? -15.752 6.064   24.652 1.00 80.42  ? 115  VAL D C     1 
ATOM   2959  O  O     . VAL D 4 118 ? -15.384 6.314   23.513 1.00 89.29  ? 115  VAL D O     1 
ATOM   2960  C  CB    . VAL D 4 118 ? -16.643 3.856   25.544 1.00 82.08  ? 115  VAL D CB    1 
ATOM   2961  C  CG1   . VAL D 4 118 ? -17.534 3.779   24.315 1.00 74.89  ? 115  VAL D CG1   1 
ATOM   2962  C  CG2   . VAL D 4 118 ? -16.186 2.458   25.930 1.00 89.58  ? 115  VAL D CG2   1 
ATOM   2963  N  N     . THR D 4 119 ? -16.446 6.922   25.379 1.00 77.32  ? 116  THR D N     1 
ATOM   2964  C  CA    . THR D 4 119 ? -16.660 8.284   24.932 1.00 73.29  ? 116  THR D CA    1 
ATOM   2965  C  C     . THR D 4 119 ? -15.403 8.880   24.317 1.00 72.35  ? 116  THR D C     1 
ATOM   2966  O  O     . THR D 4 119 ? -15.404 9.336   23.185 1.00 83.36  ? 116  THR D O     1 
ATOM   2967  C  CB    . THR D 4 119 ? -17.062 9.167   26.099 1.00 71.27  ? 116  THR D CB    1 
ATOM   2968  O  OG1   . THR D 4 119 ? -18.179 8.573   26.782 1.00 76.77  ? 116  THR D OG1   1 
ATOM   2969  C  CG2   . THR D 4 119 ? -17.461 10.511  25.584 1.00 80.17  ? 116  THR D CG2   1 
ATOM   2970  N  N     . LYS D 4 120 ? -14.314 8.855   25.055 1.00 69.91  ? 117  LYS D N     1 
ATOM   2971  C  CA    . LYS D 4 120 ? -13.070 9.398   24.538 1.00 72.14  ? 117  LYS D CA    1 
ATOM   2972  C  C     . LYS D 4 120 ? -12.542 8.572   23.367 1.00 73.74  ? 117  LYS D C     1 
ATOM   2973  O  O     . LYS D 4 120 ? -11.724 9.032   22.598 1.00 83.83  ? 117  LYS D O     1 
ATOM   2974  C  CB    . LYS D 4 120 ? -12.005 9.578   25.658 1.00 69.74  ? 117  LYS D CB    1 
ATOM   2975  C  CG    . LYS D 4 120 ? -10.551 9.532   25.177 1.00 71.77  ? 117  LYS D CG    1 
ATOM   2976  C  CD    . LYS D 4 120 ? -9.627  10.528  25.880 1.00 81.57  ? 117  LYS D CD    1 
ATOM   2977  C  CE    . LYS D 4 120 ? -8.178  10.377  25.369 1.00 88.69  ? 117  LYS D CE    1 
ATOM   2978  N  NZ    . LYS D 4 120 ? -7.303  11.594  25.483 1.00 84.99  ? 117  LYS D NZ    1 
ATOM   2979  N  N     . TYR D 4 121 ? -12.979 7.340   23.227 1.00 84.56  ? 118  TYR D N     1 
ATOM   2980  C  CA    . TYR D 4 121 ? -12.508 6.549   22.103 1.00 84.72  ? 118  TYR D CA    1 
ATOM   2981  C  C     . TYR D 4 121 ? -13.261 6.910   20.839 1.00 85.23  ? 118  TYR D C     1 
ATOM   2982  O  O     . TYR D 4 121 ? -12.671 6.991   19.776 1.00 75.80  ? 118  TYR D O     1 
ATOM   2983  C  CB    . TYR D 4 121 ? -12.709 5.086   22.385 1.00 77.53  ? 118  TYR D CB    1 
ATOM   2984  C  CG    . TYR D 4 121 ? -12.211 4.208   21.288 1.00 73.25  ? 118  TYR D CG    1 
ATOM   2985  C  CD1   . TYR D 4 121 ? -10.844 3.996   21.135 1.00 69.06  ? 118  TYR D CD1   1 
ATOM   2986  C  CD2   . TYR D 4 121 ? -13.102 3.555   20.414 1.00 67.97  ? 118  TYR D CD2   1 
ATOM   2987  C  CE1   . TYR D 4 121 ? -10.359 3.155   20.146 1.00 70.67  ? 118  TYR D CE1   1 
ATOM   2988  C  CE2   . TYR D 4 121 ? -12.629 2.708   19.424 1.00 67.08  ? 118  TYR D CE2   1 
ATOM   2989  C  CZ    . TYR D 4 121 ? -11.250 2.523   19.295 1.00 75.23  ? 118  TYR D CZ    1 
ATOM   2990  O  OH    . TYR D 4 121 ? -10.719 1.707   18.330 1.00 90.99  ? 118  TYR D OH    1 
ATOM   2991  N  N     . THR D 4 122 ? -14.570 7.097   20.981 1.00 93.31  ? 119  THR D N     1 
ATOM   2992  C  CA    . THR D 4 122 ? -15.451 7.437   19.880 1.00 96.00  ? 119  THR D CA    1 
ATOM   2993  C  C     . THR D 4 122 ? -15.038 8.766   19.281 1.00 95.65  ? 119  THR D C     1 
ATOM   2994  O  O     . THR D 4 122 ? -14.737 8.850   18.093 1.00 106.21 ? 119  THR D O     1 
ATOM   2995  C  CB    . THR D 4 122 ? -16.903 7.526   20.370 1.00 98.44  ? 119  THR D CB    1 
ATOM   2996  O  OG1   . THR D 4 122 ? -17.149 6.447   21.276 1.00 94.03  ? 119  THR D OG1   1 
ATOM   2997  C  CG2   . THR D 4 122 ? -17.874 7.434   19.206 1.00 104.14 ? 119  THR D CG2   1 
ATOM   2998  N  N     . SER D 4 123 ? -14.981 9.792   20.122 1.00 99.17  ? 120  SER D N     1 
ATOM   2999  C  CA    . SER D 4 123 ? -14.584 11.140  19.687 1.00 108.85 ? 120  SER D CA    1 
ATOM   3000  C  C     . SER D 4 123 ? -13.139 11.252  19.142 1.00 109.23 ? 120  SER D C     1 
ATOM   3001  O  O     . SER D 4 123 ? -12.794 12.266  18.525 1.00 99.82  ? 120  SER D O     1 
ATOM   3002  C  CB    . SER D 4 123 ? -14.730 12.145  20.836 1.00 105.11 ? 120  SER D CB    1 
ATOM   3003  O  OG    . SER D 4 123 ? -13.463 12.357  21.454 1.00 99.36  ? 120  SER D OG    1 
ATOM   3004  N  N     . ALA D 4 124 ? -12.302 10.242  19.377 1.00 104.24 ? 121  ALA D N     1 
ATOM   3005  C  CA    . ALA D 4 124 ? -10.926 10.273  18.891 1.00 114.00 ? 121  ALA D CA    1 
ATOM   3006  C  C     . ALA D 4 124 ? -10.719 9.545   17.538 1.00 127.69 ? 121  ALA D C     1 
ATOM   3007  O  O     . ALA D 4 124 ? -9.951  8.578   17.451 1.00 128.12 ? 121  ALA D O     1 
ATOM   3008  C  CB    . ALA D 4 124 ? -9.979  9.746   19.966 1.00 110.32 ? 121  ALA D CB    1 
ATOM   3009  N  N     . LYS D 4 125 ? -11.424 10.018  16.502 1.00 144.12 ? 122  LYS D N     1 
ATOM   3010  C  CA    . LYS D 4 125 ? -11.068 9.764   15.083 1.00 156.40 ? 122  LYS D CA    1 
ATOM   3011  C  C     . LYS D 4 125 ? -11.892 10.648  14.133 1.00 163.24 ? 122  LYS D C     1 
ATOM   3012  O  O     . LYS D 4 125 ? -11.444 11.038  13.047 1.00 151.85 ? 122  LYS D O     1 
ATOM   3013  C  CB    . LYS D 4 125 ? -11.240 8.290   14.679 1.00 152.52 ? 122  LYS D CB    1 
ATOM   3014  C  CG    . LYS D 4 125 ? -10.498 7.923   13.392 1.00 143.14 ? 122  LYS D CG    1 
ATOM   3015  C  CD    . LYS D 4 125 ? -10.495 6.420   13.157 1.00 137.48 ? 122  LYS D CD    1 
ATOM   3016  C  CE    . LYS D 4 125 ? -9.530  6.013   12.056 1.00 131.73 ? 122  LYS D CE    1 
ATOM   3017  N  NZ    . LYS D 4 125 ? -9.274  4.543   12.092 1.00 133.69 ? 122  LYS D NZ    1 
ATOM   3018  O  OXT   . LYS D 4 125 ? -13.042 10.982  14.429 1.00 169.60 ? 122  LYS D OXT   1 
ATOM   3019  N  N     . PRO E 1 38  ? 15.105  -22.092 87.681 1.00 145.35 ? 38   PRO E N     1 
ATOM   3020  C  CA    . PRO E 1 38  ? 13.966  -22.808 87.110 1.00 131.49 ? 38   PRO E CA    1 
ATOM   3021  C  C     . PRO E 1 38  ? 12.847  -21.832 86.774 1.00 124.55 ? 38   PRO E C     1 
ATOM   3022  O  O     . PRO E 1 38  ? 12.366  -21.139 87.667 1.00 128.97 ? 38   PRO E O     1 
ATOM   3023  C  CB    . PRO E 1 38  ? 13.543  -23.739 88.257 1.00 125.01 ? 38   PRO E CB    1 
ATOM   3024  C  CG    . PRO E 1 38  ? 14.023  -23.069 89.521 1.00 127.95 ? 38   PRO E CG    1 
ATOM   3025  C  CD    . PRO E 1 38  ? 15.002  -21.979 89.151 1.00 135.78 ? 38   PRO E CD    1 
ATOM   3026  N  N     . HIS E 1 39  ? 12.441  -21.757 85.513 1.00 118.18 ? 39   HIS E N     1 
ATOM   3027  C  CA    . HIS E 1 39  ? 11.426  -20.770 85.112 1.00 124.15 ? 39   HIS E CA    1 
ATOM   3028  C  C     . HIS E 1 39  ? 10.427  -21.305 84.069 1.00 121.99 ? 39   HIS E C     1 
ATOM   3029  O  O     . HIS E 1 39  ? 10.768  -22.190 83.257 1.00 103.80 ? 39   HIS E O     1 
ATOM   3030  C  CB    . HIS E 1 39  ? 12.110  -19.502 84.599 1.00 133.13 ? 39   HIS E CB    1 
ATOM   3031  C  CG    . HIS E 1 39  ? 11.170  -18.527 83.966 1.00 133.61 ? 39   HIS E CG    1 
ATOM   3032  N  ND1   . HIS E 1 39  ? 10.825  -18.587 82.631 1.00 132.20 ? 39   HIS E ND1   1 
ATOM   3033  C  CD2   . HIS E 1 39  ? 10.489  -17.481 84.487 1.00 136.68 ? 39   HIS E CD2   1 
ATOM   3034  C  CE1   . HIS E 1 39  ? 9.979   -17.611 82.356 1.00 141.22 ? 39   HIS E CE1   1 
ATOM   3035  N  NE2   . HIS E 1 39  ? 9.757   -16.926 83.464 1.00 141.98 ? 39   HIS E NE2   1 
ATOM   3036  N  N     . ARG E 1 40  ? 9.203   -20.746 84.106 1.00 112.75 ? 40   ARG E N     1 
ATOM   3037  C  CA    . ARG E 1 40  ? 8.056   -21.229 83.309 1.00 96.94  ? 40   ARG E CA    1 
ATOM   3038  C  C     . ARG E 1 40  ? 7.035   -20.169 82.892 1.00 91.89  ? 40   ARG E C     1 
ATOM   3039  O  O     . ARG E 1 40  ? 6.598   -19.345 83.702 1.00 91.97  ? 40   ARG E O     1 
ATOM   3040  C  CB    . ARG E 1 40  ? 7.291   -22.305 84.090 1.00 87.85  ? 40   ARG E CB    1 
ATOM   3041  C  CG    . ARG E 1 40  ? 7.864   -23.683 83.896 1.00 84.84  ? 40   ARG E CG    1 
ATOM   3042  C  CD    . ARG E 1 40  ? 6.874   -24.812 84.095 1.00 80.37  ? 40   ARG E CD    1 
ATOM   3043  N  NE    . ARG E 1 40  ? 7.577   -25.989 83.602 1.00 85.53  ? 40   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E 1 40  ? 7.153   -26.795 82.647 1.00 80.21  ? 40   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E 1 40  ? 5.967   -26.623 82.122 1.00 75.09  ? 40   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E 1 40  ? 7.906   -27.822 82.266 1.00 91.80  ? 40   ARG E NH2   1 
ATOM   3047  N  N     . TYR E 1 41  ? 6.608   -20.239 81.632 1.00 81.37  ? 41   TYR E N     1 
ATOM   3048  C  CA    . TYR E 1 41  ? 5.415   -19.511 81.227 1.00 74.83  ? 41   TYR E CA    1 
ATOM   3049  C  C     . TYR E 1 41  ? 4.167   -20.302 81.577 1.00 69.14  ? 41   TYR E C     1 
ATOM   3050  O  O     . TYR E 1 41  ? 4.175   -21.531 81.530 1.00 66.24  ? 41   TYR E O     1 
ATOM   3051  C  CB    . TYR E 1 41  ? 5.466   -19.202 79.740 1.00 72.35  ? 41   TYR E CB    1 
ATOM   3052  C  CG    . TYR E 1 41  ? 6.525   -18.194 79.426 1.00 65.75  ? 41   TYR E CG    1 
ATOM   3053  C  CD1   . TYR E 1 41  ? 7.652   -18.541 78.725 1.00 66.42  ? 41   TYR E CD1   1 
ATOM   3054  C  CD2   . TYR E 1 41  ? 6.415   -16.897 79.889 1.00 69.07  ? 41   TYR E CD2   1 
ATOM   3055  C  CE1   . TYR E 1 41  ? 8.643   -17.616 78.477 1.00 71.50  ? 41   TYR E CE1   1 
ATOM   3056  C  CE2   . TYR E 1 41  ? 7.389   -15.960 79.636 1.00 70.11  ? 41   TYR E CE2   1 
ATOM   3057  C  CZ    . TYR E 1 41  ? 8.498   -16.321 78.927 1.00 71.13  ? 41   TYR E CZ    1 
ATOM   3058  O  OH    . TYR E 1 41  ? 9.461   -15.371 78.678 1.00 82.15  ? 41   TYR E OH    1 
ATOM   3059  N  N     . ARG E 1 42  ? 3.102   -19.594 81.931 1.00 65.76  ? 42   ARG E N     1 
ATOM   3060  C  CA    . ARG E 1 42  ? 1.832   -20.246 82.208 1.00 67.60  ? 42   ARG E CA    1 
ATOM   3061  C  C     . ARG E 1 42  ? 1.219   -20.769 80.907 1.00 68.96  ? 42   ARG E C     1 
ATOM   3062  O  O     . ARG E 1 42  ? 1.357   -20.144 79.861 1.00 73.88  ? 42   ARG E O     1 
ATOM   3063  C  CB    . ARG E 1 42  ? 0.874   -19.274 82.868 1.00 76.41  ? 42   ARG E CB    1 
ATOM   3064  C  CG    . ARG E 1 42  ? 1.349   -18.761 84.218 1.00 85.88  ? 42   ARG E CG    1 
ATOM   3065  C  CD    . ARG E 1 42  ? 0.797   -17.377 84.524 1.00 95.48  ? 42   ARG E CD    1 
ATOM   3066  N  NE    . ARG E 1 42  ? -0.257  -17.400 85.536 1.00 102.65 ? 42   ARG E NE    1 
ATOM   3067  C  CZ    . ARG E 1 42  ? -0.045  -17.455 86.854 1.00 113.94 ? 42   ARG E CZ    1 
ATOM   3068  N  NH1   . ARG E 1 42  ? 1.190   -17.513 87.361 1.00 104.72 ? 42   ARG E NH1   1 
ATOM   3069  N  NH2   . ARG E 1 42  ? -1.087  -17.456 87.680 1.00 124.98 ? 42   ARG E NH2   1 
ATOM   3070  N  N     . PRO E 1 43  ? 0.542   -21.924 80.955 1.00 68.77  ? 43   PRO E N     1 
ATOM   3071  C  CA    . PRO E 1 43  ? -0.082  -22.388 79.755 1.00 68.91  ? 43   PRO E CA    1 
ATOM   3072  C  C     . PRO E 1 43  ? -0.952  -21.334 79.114 1.00 65.22  ? 43   PRO E C     1 
ATOM   3073  O  O     . PRO E 1 43  ? -1.809  -20.735 79.768 1.00 58.59  ? 43   PRO E O     1 
ATOM   3074  C  CB    . PRO E 1 43  ? -0.936  -23.561 80.239 1.00 72.29  ? 43   PRO E CB    1 
ATOM   3075  C  CG    . PRO E 1 43  ? -0.997  -23.440 81.699 1.00 67.48  ? 43   PRO E CG    1 
ATOM   3076  C  CD    . PRO E 1 43  ? 0.331   -22.889 82.036 1.00 72.57  ? 43   PRO E CD    1 
ATOM   3077  N  N     . GLY E 1 44  ? -0.711  -21.124 77.829 1.00 65.86  ? 44   GLY E N     1 
ATOM   3078  C  CA    . GLY E 1 44  ? -1.487  -20.172 77.070 1.00 67.77  ? 44   GLY E CA    1 
ATOM   3079  C  C     . GLY E 1 44  ? -0.645  -19.020 76.618 1.00 66.13  ? 44   GLY E C     1 
ATOM   3080  O  O     . GLY E 1 44  ? -1.016  -18.284 75.697 1.00 69.33  ? 44   GLY E O     1 
ATOM   3081  N  N     . THR E 1 45  ? 0.491   -18.844 77.269 1.00 63.69  ? 45   THR E N     1 
ATOM   3082  C  CA    . THR E 1 45  ? 1.265   -17.654 77.030 1.00 61.90  ? 45   THR E CA    1 
ATOM   3083  C  C     . THR E 1 45  ? 2.140   -17.906 75.816 1.00 56.97  ? 45   THR E C     1 
ATOM   3084  O  O     . THR E 1 45  ? 2.231   -17.051 74.940 1.00 60.20  ? 45   THR E O     1 
ATOM   3085  C  CB    . THR E 1 45  ? 2.034   -17.218 78.306 1.00 66.19  ? 45   THR E CB    1 
ATOM   3086  O  OG1   . THR E 1 45  ? 1.096   -16.879 79.330 1.00 65.21  ? 45   THR E OG1   1 
ATOM   3087  C  CG2   . THR E 1 45  ? 2.869   -15.996 78.069 1.00 63.42  ? 45   THR E CG2   1 
ATOM   3088  N  N     . VAL E 1 46  ? 2.753   -19.077 75.725 1.00 55.30  ? 46   VAL E N     1 
ATOM   3089  C  CA    . VAL E 1 46  ? 3.506   -19.371 74.513 1.00 57.17  ? 46   VAL E CA    1 
ATOM   3090  C  C     . VAL E 1 46  ? 2.506   -19.474 73.368 1.00 59.06  ? 46   VAL E C     1 
ATOM   3091  O  O     . VAL E 1 46  ? 2.797   -19.025 72.250 1.00 60.97  ? 46   VAL E O     1 
ATOM   3092  C  CB    . VAL E 1 46  ? 4.348   -20.666 74.591 1.00 55.39  ? 46   VAL E CB    1 
ATOM   3093  C  CG1   . VAL E 1 46  ? 5.377   -20.719 73.453 1.00 47.71  ? 46   VAL E CG1   1 
ATOM   3094  C  CG2   . VAL E 1 46  ? 5.072   -20.751 75.919 1.00 59.29  ? 46   VAL E CG2   1 
ATOM   3095  N  N     . ALA E 1 47  ? 1.325   -20.036 73.641 1.00 57.43  ? 47   ALA E N     1 
ATOM   3096  C  CA    . ALA E 1 47  ? 0.351   -20.253 72.573 1.00 58.36  ? 47   ALA E CA    1 
ATOM   3097  C  C     . ALA E 1 47  ? 0.012   -18.932 71.881 1.00 57.31  ? 47   ALA E C     1 
ATOM   3098  O  O     . ALA E 1 47  ? 0.105   -18.838 70.659 1.00 63.96  ? 47   ALA E O     1 
ATOM   3099  C  CB    . ALA E 1 47  ? -0.902  -20.959 73.076 1.00 53.26  ? 47   ALA E CB    1 
ATOM   3100  N  N     . LEU E 1 48  ? -0.332  -17.912 72.654 1.00 53.02  ? 48   LEU E N     1 
ATOM   3101  C  CA    . LEU E 1 48  ? -0.587  -16.588 72.084 1.00 53.21  ? 48   LEU E CA    1 
ATOM   3102  C  C     . LEU E 1 48  ? 0.671   -16.015 71.431 1.00 55.73  ? 48   LEU E C     1 
ATOM   3103  O  O     . LEU E 1 48  ? 0.605   -15.322 70.426 1.00 59.23  ? 48   LEU E O     1 
ATOM   3104  C  CB    . LEU E 1 48  ? -1.046  -15.638 73.154 1.00 49.74  ? 48   LEU E CB    1 
ATOM   3105  C  CG    . LEU E 1 48  ? -2.405  -15.922 73.715 1.00 56.09  ? 48   LEU E CG    1 
ATOM   3106  C  CD1   . LEU E 1 48  ? -2.579  -15.169 75.005 1.00 59.80  ? 48   LEU E CD1   1 
ATOM   3107  C  CD2   . LEU E 1 48  ? -3.470  -15.436 72.756 1.00 66.63  ? 48   LEU E CD2   1 
ATOM   3108  N  N     . ARG E 1 49  ? 1.827   -16.291 72.009 1.00 55.70  ? 49   ARG E N     1 
ATOM   3109  C  CA    . ARG E 1 49  ? 3.048   -15.829 71.406 1.00 60.69  ? 49   ARG E CA    1 
ATOM   3110  C  C     . ARG E 1 49  ? 3.099   -16.374 69.956 1.00 61.79  ? 49   ARG E C     1 
ATOM   3111  O  O     . ARG E 1 49  ? 3.421   -15.670 68.991 1.00 57.91  ? 49   ARG E O     1 
ATOM   3112  C  CB    . ARG E 1 49  ? 4.249   -16.290 72.250 1.00 63.63  ? 49   ARG E CB    1 
ATOM   3113  C  CG    . ARG E 1 49  ? 5.517   -15.453 72.071 1.00 67.34  ? 49   ARG E CG    1 
ATOM   3114  C  CD    . ARG E 1 49  ? 6.853   -16.226 72.176 1.00 78.54  ? 49   ARG E CD    1 
ATOM   3115  N  NE    . ARG E 1 49  ? 7.339   -16.734 73.483 1.00 73.83  ? 49   ARG E NE    1 
ATOM   3116  C  CZ    . ARG E 1 49  ? 6.894   -16.379 74.687 1.00 77.34  ? 49   ARG E CZ    1 
ATOM   3117  N  NH1   . ARG E 1 49  ? 5.918   -15.483 74.878 1.00 82.59  ? 49   ARG E NH1   1 
ATOM   3118  N  NH2   . ARG E 1 49  ? 7.453   -16.931 75.742 1.00 78.55  ? 49   ARG E NH2   1 
ATOM   3119  N  N     . GLU E 1 50  ? 2.742   -17.641 69.814 1.00 62.85  ? 50   GLU E N     1 
ATOM   3120  C  CA    . GLU E 1 50  ? 2.859   -18.312 68.521 1.00 64.08  ? 50   GLU E CA    1 
ATOM   3121  C  C     . GLU E 1 50  ? 1.842   -17.780 67.524 1.00 60.71  ? 50   GLU E C     1 
ATOM   3122  O  O     . GLU E 1 50  ? 2.153   -17.579 66.343 1.00 57.95  ? 50   GLU E O     1 
ATOM   3123  C  CB    . GLU E 1 50  ? 2.730   -19.826 68.702 1.00 67.03  ? 50   GLU E CB    1 
ATOM   3124  C  CG    . GLU E 1 50  ? 3.988   -20.449 69.285 1.00 65.68  ? 50   GLU E CG    1 
ATOM   3125  C  CD    . GLU E 1 50  ? 3.812   -21.873 69.764 1.00 78.46  ? 50   GLU E CD    1 
ATOM   3126  O  OE1   . GLU E 1 50  ? 4.776   -22.369 70.376 1.00 90.81  ? 50   GLU E OE1   1 
ATOM   3127  O  OE2   . GLU E 1 50  ? 2.744   -22.503 69.548 1.00 88.75  ? 50   GLU E OE2   1 
ATOM   3128  N  N     . ILE E 1 51  ? 0.632   -17.531 68.009 1.00 55.57  ? 51   ILE E N     1 
ATOM   3129  C  CA    . ILE E 1 51  ? -0.407  -16.965 67.177 1.00 51.74  ? 51   ILE E CA    1 
ATOM   3130  C  C     . ILE E 1 51  ? 0.106   -15.655 66.566 1.00 53.27  ? 51   ILE E C     1 
ATOM   3131  O  O     . ILE E 1 51  ? 0.005   -15.448 65.362 1.00 54.04  ? 51   ILE E O     1 
ATOM   3132  C  CB    . ILE E 1 51  ? -1.677  -16.690 67.985 1.00 48.60  ? 51   ILE E CB    1 
ATOM   3133  C  CG1   . ILE E 1 51  ? -2.223  -17.983 68.549 1.00 47.42  ? 51   ILE E CG1   1 
ATOM   3134  C  CG2   . ILE E 1 51  ? -2.731  -16.031 67.110 1.00 52.85  ? 51   ILE E CG2   1 
ATOM   3135  C  CD1   . ILE E 1 51  ? -3.640  -17.904 69.088 1.00 50.13  ? 51   ILE E CD1   1 
ATOM   3136  N  N     . ARG E 1 52  ? 0.679   -14.780 67.385 1.00 51.66  ? 52   ARG E N     1 
ATOM   3137  C  CA    . ARG E 1 52  ? 1.165   -13.490 66.865 1.00 52.76  ? 52   ARG E CA    1 
ATOM   3138  C  C     . ARG E 1 52  ? 2.280   -13.717 65.857 1.00 52.61  ? 52   ARG E C     1 
ATOM   3139  O  O     . ARG E 1 52  ? 2.372   -13.043 64.860 1.00 52.79  ? 52   ARG E O     1 
ATOM   3140  C  CB    . ARG E 1 52  ? 1.633   -12.577 68.005 1.00 50.35  ? 52   ARG E CB    1 
ATOM   3141  C  CG    . ARG E 1 52  ? 0.507   -12.214 68.992 1.00 55.50  ? 52   ARG E CG    1 
ATOM   3142  C  CD    . ARG E 1 52  ? 0.893   -11.225 70.077 1.00 57.55  ? 52   ARG E CD    1 
ATOM   3143  N  NE    . ARG E 1 52  ? 0.547   -11.737 71.413 1.00 65.68  ? 52   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E 1 52  ? -0.605  -11.514 72.064 1.00 67.39  ? 52   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E 1 52  ? -1.584  -10.777 71.553 1.00 61.41  ? 52   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E 1 52  ? -0.782  -12.042 73.260 1.00 73.82  ? 52   ARG E NH2   1 
ATOM   3147  N  N     . ARG E 1 53  ? 3.119   -14.697 66.131 1.00 56.77  ? 53   ARG E N     1 
ATOM   3148  C  CA    . ARG E 1 53  ? 4.230   -14.984 65.277 1.00 55.40  ? 53   ARG E CA    1 
ATOM   3149  C  C     . ARG E 1 53  ? 3.746   -15.469 63.936 1.00 56.65  ? 53   ARG E C     1 
ATOM   3150  O  O     . ARG E 1 53  ? 4.132   -14.942 62.899 1.00 57.57  ? 53   ARG E O     1 
ATOM   3151  C  CB    . ARG E 1 53  ? 5.120   -16.048 65.923 1.00 54.80  ? 53   ARG E CB    1 
ATOM   3152  C  CG    . ARG E 1 53  ? 6.301   -16.421 65.037 1.00 58.83  ? 53   ARG E CG    1 
ATOM   3153  C  CD    . ARG E 1 53  ? 7.092   -17.617 65.562 1.00 70.72  ? 53   ARG E CD    1 
ATOM   3154  N  NE    . ARG E 1 53  ? 8.001   -18.071 64.498 1.00 81.02  ? 53   ARG E NE    1 
ATOM   3155  C  CZ    . ARG E 1 53  ? 8.869   -19.077 64.598 1.00 79.36  ? 53   ARG E CZ    1 
ATOM   3156  N  NH1   . ARG E 1 53  ? 8.969   -19.785 65.725 1.00 75.98  ? 53   ARG E NH1   1 
ATOM   3157  N  NH2   . ARG E 1 53  ? 9.639   -19.365 63.552 1.00 74.53  ? 53   ARG E NH2   1 
ATOM   3158  N  N     . TYR E 1 54  ? 2.910   -16.494 63.960 1.00 52.82  ? 54   TYR E N     1 
ATOM   3159  C  CA    . TYR E 1 54  ? 2.522   -17.128 62.718 1.00 54.15  ? 54   TYR E CA    1 
ATOM   3160  C  C     . TYR E 1 54  ? 1.557   -16.286 61.866 1.00 52.24  ? 54   TYR E C     1 
ATOM   3161  O  O     . TYR E 1 54  ? 1.590   -16.391 60.621 1.00 48.70  ? 54   TYR E O     1 
ATOM   3162  C  CB    . TYR E 1 54  ? 2.024   -18.559 62.984 1.00 55.24  ? 54   TYR E CB    1 
ATOM   3163  C  CG    . TYR E 1 54  ? 3.191   -19.435 63.359 1.00 53.72  ? 54   TYR E CG    1 
ATOM   3164  C  CD1   . TYR E 1 54  ? 3.289   -20.049 64.607 1.00 54.99  ? 54   TYR E CD1   1 
ATOM   3165  C  CD2   . TYR E 1 54  ? 4.224   -19.601 62.482 1.00 51.20  ? 54   TYR E CD2   1 
ATOM   3166  C  CE1   . TYR E 1 54  ? 4.386   -20.826 64.937 1.00 49.93  ? 54   TYR E CE1   1 
ATOM   3167  C  CE2   . TYR E 1 54  ? 5.326   -20.343 62.819 1.00 56.59  ? 54   TYR E CE2   1 
ATOM   3168  C  CZ    . TYR E 1 54  ? 5.395   -20.959 64.043 1.00 50.76  ? 54   TYR E CZ    1 
ATOM   3169  O  OH    . TYR E 1 54  ? 6.518   -21.684 64.305 1.00 53.65  ? 54   TYR E OH    1 
ATOM   3170  N  N     . GLN E 1 55  ? 0.744   -15.444 62.529 1.00 47.54  ? 55   GLN E N     1 
ATOM   3171  C  CA    . GLN E 1 55  ? -0.161  -14.531 61.827 1.00 48.02  ? 55   GLN E CA    1 
ATOM   3172  C  C     . GLN E 1 55  ? 0.581   -13.375 61.151 1.00 53.42  ? 55   GLN E C     1 
ATOM   3173  O  O     . GLN E 1 55  ? 0.101   -12.771 60.193 1.00 58.64  ? 55   GLN E O     1 
ATOM   3174  C  CB    . GLN E 1 55  ? -1.223  -14.009 62.751 1.00 45.57  ? 55   GLN E CB    1 
ATOM   3175  C  CG    . GLN E 1 55  ? -2.352  -14.982 62.917 1.00 48.82  ? 55   GLN E CG    1 
ATOM   3176  C  CD    . GLN E 1 55  ? -3.463  -14.438 63.777 1.00 53.09  ? 55   GLN E CD    1 
ATOM   3177  O  OE1   . GLN E 1 55  ? -3.344  -13.380 64.414 1.00 56.64  ? 55   GLN E OE1   1 
ATOM   3178  N  NE2   . GLN E 1 55  ? -4.551  -15.172 63.825 1.00 56.18  ? 55   GLN E NE2   1 
ATOM   3179  N  N     . LYS E 1 56  ? 1.791   -13.129 61.622 1.00 56.24  ? 56   LYS E N     1 
ATOM   3180  C  CA    . LYS E 1 56  ? 2.653   -12.103 61.102 1.00 54.61  ? 56   LYS E CA    1 
ATOM   3181  C  C     . LYS E 1 56  ? 3.424   -12.599 59.890 1.00 55.30  ? 56   LYS E C     1 
ATOM   3182  O  O     . LYS E 1 56  ? 3.744   -11.804 59.019 1.00 57.87  ? 56   LYS E O     1 
ATOM   3183  C  CB    . LYS E 1 56  ? 3.622   -11.747 62.203 1.00 63.82  ? 56   LYS E CB    1 
ATOM   3184  C  CG    . LYS E 1 56  ? 4.458   -10.501 62.053 1.00 69.20  ? 56   LYS E CG    1 
ATOM   3185  C  CD    . LYS E 1 56  ? 4.933   -10.164 63.466 1.00 79.30  ? 56   LYS E CD    1 
ATOM   3186  C  CE    . LYS E 1 56  ? 6.117   -9.219  63.571 1.00 85.75  ? 56   LYS E CE    1 
ATOM   3187  N  NZ    . LYS E 1 56  ? 6.148   -8.796  65.007 1.00 97.04  ? 56   LYS E NZ    1 
ATOM   3188  N  N     . SER E 1 57  ? 3.727   -13.894 59.807 1.00 52.16  ? 57   SER E N     1 
ATOM   3189  C  CA    . SER E 1 57  ? 4.485   -14.376 58.652 1.00 57.18  ? 57   SER E CA    1 
ATOM   3190  C  C     . SER E 1 57  ? 3.612   -15.044 57.587 1.00 61.09  ? 57   SER E C     1 
ATOM   3191  O  O     . SER E 1 57  ? 2.372   -15.249 57.781 1.00 64.09  ? 57   SER E O     1 
ATOM   3192  C  CB    . SER E 1 57  ? 5.540   -15.360 59.111 1.00 59.35  ? 57   SER E CB    1 
ATOM   3193  O  OG    . SER E 1 57  ? 4.902   -16.327 59.922 1.00 59.75  ? 57   SER E OG    1 
ATOM   3194  N  N     . THR E 1 58  ? 4.286   -15.392 56.486 1.00 51.01  ? 58   THR E N     1 
ATOM   3195  C  CA    . THR E 1 58  ? 3.670   -16.091 55.393 1.00 49.29  ? 58   THR E CA    1 
ATOM   3196  C  C     . THR E 1 58  ? 4.344   -17.405 54.909 1.00 53.81  ? 58   THR E C     1 
ATOM   3197  O  O     . THR E 1 58  ? 3.950   -17.929 53.859 1.00 49.78  ? 58   THR E O     1 
ATOM   3198  C  CB    . THR E 1 58  ? 3.622   -15.166 54.173 1.00 52.76  ? 58   THR E CB    1 
ATOM   3199  O  OG1   . THR E 1 58  ? 4.913   -15.049 53.617 1.00 50.10  ? 58   THR E OG1   1 
ATOM   3200  C  CG2   . THR E 1 58  ? 3.138   -13.793 54.534 1.00 54.81  ? 58   THR E CG2   1 
ATOM   3201  N  N     . GLU E 1 59  ? 5.320   -17.960 55.641 1.00 53.87  ? 59   GLU E N     1 
ATOM   3202  C  CA    . GLU E 1 59  ? 5.998   -19.146 55.129 1.00 52.41  ? 59   GLU E CA    1 
ATOM   3203  C  C     . GLU E 1 59  ? 5.083   -20.303 55.281 1.00 60.73  ? 59   GLU E C     1 
ATOM   3204  O  O     . GLU E 1 59  ? 4.265   -20.312 56.217 1.00 56.92  ? 59   GLU E O     1 
ATOM   3205  C  CB    . GLU E 1 59  ? 7.293   -19.533 55.805 1.00 53.26  ? 59   GLU E CB    1 
ATOM   3206  C  CG    . GLU E 1 59  ? 7.777   -18.727 56.956 1.00 63.98  ? 59   GLU E CG    1 
ATOM   3207  C  CD    . GLU E 1 59  ? 7.106   -19.052 58.250 1.00 69.67  ? 59   GLU E CD    1 
ATOM   3208  O  OE1   . GLU E 1 59  ? 7.591   -19.968 58.936 1.00 71.04  ? 59   GLU E OE1   1 
ATOM   3209  O  OE2   . GLU E 1 59  ? 6.141   -18.337 58.605 1.00 79.05  ? 59   GLU E OE2   1 
ATOM   3210  N  N     . LEU E 1 60  ? 5.238   -21.291 54.382 1.00 56.95  ? 60   LEU E N     1 
ATOM   3211  C  CA    . LEU E 1 60  ? 4.538   -22.557 54.548 1.00 56.25  ? 60   LEU E CA    1 
ATOM   3212  C  C     . LEU E 1 60  ? 4.930   -23.202 55.893 1.00 54.73  ? 60   LEU E C     1 
ATOM   3213  O  O     . LEU E 1 60  ? 6.047   -23.033 56.367 1.00 55.93  ? 60   LEU E O     1 
ATOM   3214  C  CB    . LEU E 1 60  ? 4.784   -23.496 53.382 1.00 56.30  ? 60   LEU E CB    1 
ATOM   3215  C  CG    . LEU E 1 60  ? 4.257   -22.885 52.084 1.00 59.78  ? 60   LEU E CG    1 
ATOM   3216  C  CD1   . LEU E 1 60  ? 4.714   -23.721 50.912 1.00 60.28  ? 60   LEU E CD1   1 
ATOM   3217  C  CD2   . LEU E 1 60  ? 2.734   -22.716 52.079 1.00 59.50  ? 60   LEU E CD2   1 
ATOM   3218  N  N     . LEU E 1 61  ? 3.975   -23.869 56.528 1.00 47.43  ? 61   LEU E N     1 
ATOM   3219  C  CA    . LEU E 1 61  ? 4.167   -24.383 57.853 1.00 52.29  ? 61   LEU E CA    1 
ATOM   3220  C  C     . LEU E 1 61  ? 4.305   -25.932 57.853 1.00 57.01  ? 61   LEU E C     1 
ATOM   3221  O  O     . LEU E 1 61  ? 4.677   -26.551 58.852 1.00 55.49  ? 61   LEU E O     1 
ATOM   3222  C  CB    . LEU E 1 61  ? 3.010   -23.885 58.709 1.00 56.31  ? 61   LEU E CB    1 
ATOM   3223  C  CG    . LEU E 1 61  ? 2.860   -22.338 58.794 1.00 56.65  ? 61   LEU E CG    1 
ATOM   3224  C  CD1   . LEU E 1 61  ? 1.556   -21.927 59.464 1.00 55.09  ? 61   LEU E CD1   1 
ATOM   3225  C  CD2   . LEU E 1 61  ? 4.015   -21.723 59.574 1.00 54.58  ? 61   LEU E CD2   1 
ATOM   3226  N  N     . ILE E 1 62  ? 4.017   -26.563 56.722 1.00 53.63  ? 62   ILE E N     1 
ATOM   3227  C  CA    . ILE E 1 62  ? 4.249   -27.967 56.583 1.00 53.32  ? 62   ILE E CA    1 
ATOM   3228  C  C     . ILE E 1 62  ? 5.583   -28.141 55.860 1.00 54.82  ? 62   ILE E C     1 
ATOM   3229  O  O     . ILE E 1 62  ? 5.826   -27.457 54.900 1.00 53.27  ? 62   ILE E O     1 
ATOM   3230  C  CB    . ILE E 1 62  ? 3.127   -28.631 55.787 1.00 54.57  ? 62   ILE E CB    1 
ATOM   3231  C  CG1   . ILE E 1 62  ? 1.793   -28.504 56.535 1.00 51.73  ? 62   ILE E CG1   1 
ATOM   3232  C  CG2   . ILE E 1 62  ? 3.465   -30.101 55.537 1.00 58.40  ? 62   ILE E CG2   1 
ATOM   3233  C  CD1   . ILE E 1 62  ? 0.623   -29.107 55.787 1.00 50.58  ? 62   ILE E CD1   1 
ATOM   3234  N  N     . ARG E 1 63  ? 6.427   -29.064 56.340 1.00 56.21  ? 63   ARG E N     1 
ATOM   3235  C  CA    . ARG E 1 63  ? 7.733   -29.354 55.764 1.00 49.40  ? 63   ARG E CA    1 
ATOM   3236  C  C     . ARG E 1 63  ? 7.560   -29.825 54.305 1.00 48.91  ? 63   ARG E C     1 
ATOM   3237  O  O     . ARG E 1 63  ? 6.647   -30.552 53.998 1.00 48.01  ? 63   ARG E O     1 
ATOM   3238  C  CB    . ARG E 1 63  ? 8.429   -30.481 56.542 1.00 55.77  ? 63   ARG E CB    1 
ATOM   3239  C  CG    . ARG E 1 63  ? 8.769   -30.282 58.018 1.00 60.34  ? 63   ARG E CG    1 
ATOM   3240  C  CD    . ARG E 1 63  ? 10.015  -29.459 58.291 1.00 72.03  ? 63   ARG E CD    1 
ATOM   3241  N  NE    . ARG E 1 63  ? 9.635   -28.102 58.742 1.00 89.80  ? 63   ARG E NE    1 
ATOM   3242  C  CZ    . ARG E 1 63  ? 9.896   -26.958 58.090 1.00 88.00  ? 63   ARG E CZ    1 
ATOM   3243  N  NH1   . ARG E 1 63  ? 10.573  -26.987 56.938 1.00 92.36  ? 63   ARG E NH1   1 
ATOM   3244  N  NH2   . ARG E 1 63  ? 9.479   -25.776 58.589 1.00 74.95  ? 63   ARG E NH2   1 
ATOM   3245  N  N     . LYS E 1 64  ? 8.474   -29.447 53.424 1.00 48.43  ? 64   LYS E N     1 
ATOM   3246  C  CA    . LYS E 1 64  ? 8.284   -29.634 52.002 1.00 56.44  ? 64   LYS E CA    1 
ATOM   3247  C  C     . LYS E 1 64  ? 8.193   -31.075 51.569 1.00 54.40  ? 64   LYS E C     1 
ATOM   3248  O  O     . LYS E 1 64  ? 7.254   -31.459 50.888 1.00 58.39  ? 64   LYS E O     1 
ATOM   3249  C  CB    . LYS E 1 64  ? 9.403   -28.972 51.205 1.00 60.83  ? 64   LYS E CB    1 
ATOM   3250  C  CG    . LYS E 1 64  ? 9.163   -27.508 50.958 1.00 75.12  ? 64   LYS E CG    1 
ATOM   3251  C  CD    . LYS E 1 64  ? 10.195  -26.927 49.987 1.00 90.04  ? 64   LYS E CD    1 
ATOM   3252  C  CE    . LYS E 1 64  ? 10.276  -25.389 50.092 1.00 98.36  ? 64   LYS E CE    1 
ATOM   3253  N  NZ    . LYS E 1 64  ? 8.959   -24.695 50.331 1.00 91.75  ? 64   LYS E NZ    1 
ATOM   3254  N  N     . LEU E 1 65  ? 9.187   -31.848 51.962 1.00 54.07  ? 65   LEU E N     1 
ATOM   3255  C  CA    . LEU E 1 65  ? 9.336   -33.192 51.496 1.00 55.25  ? 65   LEU E CA    1 
ATOM   3256  C  C     . LEU E 1 65  ? 8.240   -34.111 51.978 1.00 51.79  ? 65   LEU E C     1 
ATOM   3257  O  O     . LEU E 1 65  ? 7.642   -34.826 51.169 1.00 57.58  ? 65   LEU E O     1 
ATOM   3258  C  CB    . LEU E 1 65  ? 10.702  -33.757 51.906 1.00 59.33  ? 65   LEU E CB    1 
ATOM   3259  C  CG    . LEU E 1 65  ? 11.023  -35.186 51.407 1.00 57.76  ? 65   LEU E CG    1 
ATOM   3260  C  CD1   . LEU E 1 65  ? 11.044  -35.299 49.880 1.00 53.69  ? 65   LEU E CD1   1 
ATOM   3261  C  CD2   . LEU E 1 65  ? 12.358  -35.534 52.003 1.00 59.45  ? 65   LEU E CD2   1 
ATOM   3262  N  N     . PRO E 1 66  ? 7.988   -34.136 53.280 1.00 47.53  ? 66   PRO E N     1 
ATOM   3263  C  CA    . PRO E 1 66  ? 6.850   -34.929 53.715 1.00 49.22  ? 66   PRO E CA    1 
ATOM   3264  C  C     . PRO E 1 66  ? 5.624   -34.634 52.865 1.00 48.03  ? 66   PRO E C     1 
ATOM   3265  O  O     . PRO E 1 66  ? 4.974   -35.545 52.360 1.00 51.68  ? 66   PRO E O     1 
ATOM   3266  C  CB    . PRO E 1 66  ? 6.617   -34.478 55.159 1.00 51.93  ? 66   PRO E CB    1 
ATOM   3267  C  CG    . PRO E 1 66  ? 7.931   -33.941 55.588 1.00 55.98  ? 66   PRO E CG    1 
ATOM   3268  C  CD    . PRO E 1 66  ? 8.540   -33.323 54.363 1.00 53.03  ? 66   PRO E CD    1 
ATOM   3269  N  N     . PHE E 1 67  ? 5.322   -33.361 52.672 1.00 53.80  ? 67   PHE E N     1 
ATOM   3270  C  CA    . PHE E 1 67  ? 4.114   -33.013 51.936 1.00 54.96  ? 67   PHE E CA    1 
ATOM   3271  C  C     . PHE E 1 67  ? 4.227   -33.537 50.489 1.00 51.28  ? 67   PHE E C     1 
ATOM   3272  O  O     . PHE E 1 67  ? 3.258   -34.001 49.906 1.00 51.34  ? 67   PHE E O     1 
ATOM   3273  C  CB    . PHE E 1 67  ? 3.833   -31.517 51.997 1.00 50.46  ? 67   PHE E CB    1 
ATOM   3274  C  CG    . PHE E 1 67  ? 2.622   -31.100 51.212 1.00 49.14  ? 67   PHE E CG    1 
ATOM   3275  C  CD1   . PHE E 1 67  ? 1.445   -30.933 51.823 1.00 50.55  ? 67   PHE E CD1   1 
ATOM   3276  C  CD2   . PHE E 1 67  ? 2.683   -30.875 49.853 1.00 50.17  ? 67   PHE E CD2   1 
ATOM   3277  C  CE1   . PHE E 1 67  ? 0.311   -30.566 51.102 1.00 49.82  ? 67   PHE E CE1   1 
ATOM   3278  C  CE2   . PHE E 1 67  ? 1.570   -30.512 49.143 1.00 47.62  ? 67   PHE E CE2   1 
ATOM   3279  C  CZ    . PHE E 1 67  ? 0.378   -30.338 49.778 1.00 45.41  ? 67   PHE E CZ    1 
ATOM   3280  N  N     . GLN E 1 68  ? 5.416   -33.475 49.931 1.00 51.01  ? 68   GLN E N     1 
ATOM   3281  C  CA    . GLN E 1 68  ? 5.637   -33.961 48.579 1.00 54.88  ? 68   GLN E CA    1 
ATOM   3282  C  C     . GLN E 1 68  ? 5.337   -35.446 48.467 1.00 55.50  ? 68   GLN E C     1 
ATOM   3283  O  O     . GLN E 1 68  ? 4.760   -35.904 47.475 1.00 55.14  ? 68   GLN E O     1 
ATOM   3284  C  CB    . GLN E 1 68  ? 7.069   -33.705 48.144 1.00 57.23  ? 68   GLN E CB    1 
ATOM   3285  C  CG    . GLN E 1 68  ? 7.174   -33.574 46.645 1.00 72.27  ? 68   GLN E CG    1 
ATOM   3286  C  CD    . GLN E 1 68  ? 8.593   -33.318 46.163 1.00 84.89  ? 68   GLN E CD    1 
ATOM   3287  O  OE1   . GLN E 1 68  ? 9.575   -33.618 46.863 1.00 94.83  ? 68   GLN E OE1   1 
ATOM   3288  N  NE2   . GLN E 1 68  ? 8.709   -32.766 44.957 1.00 81.61  ? 68   GLN E NE2   1 
ATOM   3289  N  N     . ARG E 1 69  ? 5.733   -36.206 49.480 1.00 53.06  ? 69   ARG E N     1 
ATOM   3290  C  CA    . ARG E 1 69  ? 5.550   -37.628 49.414 1.00 52.57  ? 69   ARG E CA    1 
ATOM   3291  C  C     . ARG E 1 69  ? 4.091   -37.934 49.457 1.00 50.45  ? 69   ARG E C     1 
ATOM   3292  O  O     . ARG E 1 69  ? 3.592   -38.754 48.703 1.00 56.99  ? 69   ARG E O     1 
ATOM   3293  C  CB    . ARG E 1 69  ? 6.156   -38.279 50.602 1.00 58.81  ? 69   ARG E CB    1 
ATOM   3294  C  CG    . ARG E 1 69  ? 7.627   -38.551 50.543 1.00 55.30  ? 69   ARG E CG    1 
ATOM   3295  C  CD    . ARG E 1 69  ? 7.951   -39.236 51.874 1.00 54.66  ? 69   ARG E CD    1 
ATOM   3296  N  NE    . ARG E 1 69  ? 9.156   -38.669 52.453 1.00 57.18  ? 69   ARG E NE    1 
ATOM   3297  C  CZ    . ARG E 1 69  ? 9.293   -38.325 53.722 1.00 58.82  ? 69   ARG E CZ    1 
ATOM   3298  N  NH1   . ARG E 1 69  ? 8.297   -38.467 54.595 1.00 53.43  ? 69   ARG E NH1   1 
ATOM   3299  N  NH2   . ARG E 1 69  ? 10.452  -37.815 54.111 1.00 69.54  ? 69   ARG E NH2   1 
ATOM   3300  N  N     . LEU E 1 70  ? 3.416   -37.255 50.368 1.00 51.00  ? 70   LEU E N     1 
ATOM   3301  C  CA    . LEU E 1 70  ? 1.973   -37.388 50.516 1.00 49.88  ? 70   LEU E CA    1 
ATOM   3302  C  C     . LEU E 1 70  ? 1.239   -37.142 49.201 1.00 47.96  ? 70   LEU E C     1 
ATOM   3303  O  O     . LEU E 1 70  ? 0.317   -37.865 48.887 1.00 46.65  ? 70   LEU E O     1 
ATOM   3304  C  CB    . LEU E 1 70  ? 1.447   -36.440 51.601 1.00 46.40  ? 70   LEU E CB    1 
ATOM   3305  C  CG    . LEU E 1 70  ? -0.064  -36.582 51.874 1.00 52.55  ? 70   LEU E CG    1 
ATOM   3306  C  CD1   . LEU E 1 70  ? -0.482  -38.020 52.200 1.00 52.39  ? 70   LEU E CD1   1 
ATOM   3307  C  CD2   . LEU E 1 70  ? -0.495  -35.622 52.989 1.00 54.76  ? 70   LEU E CD2   1 
ATOM   3308  N  N     . VAL E 1 71  ? 1.655   -36.128 48.450 1.00 45.34  ? 71   VAL E N     1 
ATOM   3309  C  CA    . VAL E 1 71  ? 1.038   -35.818 47.194 1.00 47.81  ? 71   VAL E CA    1 
ATOM   3310  C  C     . VAL E 1 71  ? 1.286   -36.999 46.292 1.00 48.78  ? 71   VAL E C     1 
ATOM   3311  O  O     . VAL E 1 71  ? 0.356   -37.603 45.748 1.00 46.87  ? 71   VAL E O     1 
ATOM   3312  C  CB    . VAL E 1 71  ? 1.629   -34.519 46.590 1.00 52.17  ? 71   VAL E CB    1 
ATOM   3313  C  CG1   . VAL E 1 71  ? 1.201   -34.314 45.153 1.00 54.56  ? 71   VAL E CG1   1 
ATOM   3314  C  CG2   . VAL E 1 71  ? 1.184   -33.302 47.407 1.00 56.58  ? 71   VAL E CG2   1 
ATOM   3315  N  N     . ARG E 1 72  ? 2.548   -37.362 46.173 1.00 51.28  ? 72   ARG E N     1 
ATOM   3316  C  CA    . ARG E 1 72  ? 2.924   -38.406 45.218 1.00 58.09  ? 72   ARG E CA    1 
ATOM   3317  C  C     . ARG E 1 72  ? 2.214   -39.744 45.465 1.00 53.24  ? 72   ARG E C     1 
ATOM   3318  O  O     . ARG E 1 72  ? 1.813   -40.442 44.523 1.00 52.77  ? 72   ARG E O     1 
ATOM   3319  C  CB    . ARG E 1 72  ? 4.426   -38.571 45.211 1.00 57.61  ? 72   ARG E CB    1 
ATOM   3320  C  CG    . ARG E 1 72  ? 5.152   -37.426 44.504 1.00 58.75  ? 72   ARG E CG    1 
ATOM   3321  C  CD    . ARG E 1 72  ? 6.638   -37.660 44.599 1.00 56.88  ? 72   ARG E CD    1 
ATOM   3322  N  NE    . ARG E 1 72  ? 7.406   -36.506 44.209 1.00 65.45  ? 72   ARG E NE    1 
ATOM   3323  C  CZ    . ARG E 1 72  ? 7.510   -36.091 42.959 1.00 70.88  ? 72   ARG E CZ    1 
ATOM   3324  N  NH1   . ARG E 1 72  ? 6.865   -36.708 41.977 1.00 70.08  ? 72   ARG E NH1   1 
ATOM   3325  N  NH2   . ARG E 1 72  ? 8.266   -35.051 42.690 1.00 81.67  ? 72   ARG E NH2   1 
ATOM   3326  N  N     . GLU E 1 73  ? 2.042   -40.045 46.737 1.00 46.20  ? 73   GLU E N     1 
ATOM   3327  C  CA    . GLU E 1 73  ? 1.328   -41.223 47.182 1.00 49.61  ? 73   GLU E CA    1 
ATOM   3328  C  C     . GLU E 1 73  ? -0.124  -41.210 46.726 1.00 49.98  ? 73   GLU E C     1 
ATOM   3329  O  O     . GLU E 1 73  ? -0.598  -42.134 46.087 1.00 58.79  ? 73   GLU E O     1 
ATOM   3330  C  CB    . GLU E 1 73  ? 1.420   -41.339 48.720 1.00 46.11  ? 73   GLU E CB    1 
ATOM   3331  C  CG    . GLU E 1 73  ? 0.546   -42.429 49.322 1.00 46.54  ? 73   GLU E CG    1 
ATOM   3332  C  CD    . GLU E 1 73  ? 0.647   -42.619 50.870 1.00 50.29  ? 73   GLU E CD    1 
ATOM   3333  O  OE1   . GLU E 1 73  ? 1.759   -42.600 51.451 1.00 51.31  ? 73   GLU E OE1   1 
ATOM   3334  O  OE2   . GLU E 1 73  ? -0.398  -42.872 51.536 1.00 52.34  ? 73   GLU E OE2   1 
ATOM   3335  N  N     . ILE E 1 74  ? -0.834  -40.162 47.074 1.00 52.87  ? 74   ILE E N     1 
ATOM   3336  C  CA    . ILE E 1 74  ? -2.235  -40.054 46.720 1.00 50.92  ? 74   ILE E CA    1 
ATOM   3337  C  C     . ILE E 1 74  ? -2.385  -40.110 45.196 1.00 50.21  ? 74   ILE E C     1 
ATOM   3338  O  O     . ILE E 1 74  ? -3.237  -40.793 44.666 1.00 52.56  ? 74   ILE E O     1 
ATOM   3339  C  CB    . ILE E 1 74  ? -2.818  -38.775 47.319 1.00 47.87  ? 74   ILE E CB    1 
ATOM   3340  C  CG1   . ILE E 1 74  ? -2.993  -38.936 48.825 1.00 49.36  ? 74   ILE E CG1   1 
ATOM   3341  C  CG2   . ILE E 1 74  ? -4.155  -38.470 46.728 1.00 52.60  ? 74   ILE E CG2   1 
ATOM   3342  C  CD1   . ILE E 1 74  ? -3.148  -37.623 49.566 1.00 54.40  ? 74   ILE E CD1   1 
ATOM   3343  N  N     . ALA E 1 75  ? -1.522  -39.429 44.485 1.00 52.78  ? 75   ALA E N     1 
ATOM   3344  C  CA    . ALA E 1 75  ? -1.629  -39.404 43.027 1.00 58.07  ? 75   ALA E CA    1 
ATOM   3345  C  C     . ALA E 1 75  ? -1.430  -40.776 42.441 1.00 58.69  ? 75   ALA E C     1 
ATOM   3346  O  O     . ALA E 1 75  ? -2.099  -41.176 41.491 1.00 50.43  ? 75   ALA E O     1 
ATOM   3347  C  CB    . ALA E 1 75  ? -0.578  -38.483 42.448 1.00 60.00  ? 75   ALA E CB    1 
ATOM   3348  N  N     . GLN E 1 76  ? -0.463  -41.477 43.003 1.00 61.87  ? 76   GLN E N     1 
ATOM   3349  C  CA    . GLN E 1 76  ? -0.081  -42.770 42.499 1.00 59.13  ? 76   GLN E CA    1 
ATOM   3350  C  C     . GLN E 1 76  ? -1.258  -43.661 42.650 1.00 57.97  ? 76   GLN E C     1 
ATOM   3351  O  O     . GLN E 1 76  ? -1.600  -44.384 41.715 1.00 63.84  ? 76   GLN E O     1 
ATOM   3352  C  CB    . GLN E 1 76  ? 1.063   -43.322 43.304 1.00 66.63  ? 76   GLN E CB    1 
ATOM   3353  C  CG    . GLN E 1 76  ? 1.839   -44.403 42.608 1.00 69.96  ? 76   GLN E CG    1 
ATOM   3354  C  CD    . GLN E 1 76  ? 3.001   -44.801 43.458 1.00 72.64  ? 76   GLN E CD    1 
ATOM   3355  O  OE1   . GLN E 1 76  ? 2.851   -44.984 44.684 1.00 67.94  ? 76   GLN E OE1   1 
ATOM   3356  N  NE2   . GLN E 1 76  ? 4.182   -44.872 42.845 1.00 82.98  ? 76   GLN E NE2   1 
ATOM   3357  N  N     . ASP E 1 77  ? -1.916  -43.583 43.805 1.00 53.22  ? 77   ASP E N     1 
ATOM   3358  C  CA    . ASP E 1 77  ? -3.154  -44.334 43.997 1.00 54.92  ? 77   ASP E CA    1 
ATOM   3359  C  C     . ASP E 1 77  ? -4.250  -44.013 42.929 1.00 55.84  ? 77   ASP E C     1 
ATOM   3360  O  O     . ASP E 1 77  ? -5.074  -44.829 42.672 1.00 64.05  ? 77   ASP E O     1 
ATOM   3361  C  CB    . ASP E 1 77  ? -3.668  -44.179 45.430 1.00 54.26  ? 77   ASP E CB    1 
ATOM   3362  C  CG    . ASP E 1 77  ? -2.807  -44.916 46.478 1.00 59.76  ? 77   ASP E CG    1 
ATOM   3363  O  OD1   . ASP E 1 77  ? -1.965  -45.789 46.173 1.00 75.26  ? 77   ASP E OD1   1 
ATOM   3364  O  OD2   . ASP E 1 77  ? -2.980  -44.623 47.662 1.00 63.05  ? 77   ASP E OD2   1 
ATOM   3365  N  N     . PHE E 1 78  ? -4.243  -42.851 42.295 1.00 59.75  ? 78   PHE E N     1 
ATOM   3366  C  CA    . PHE E 1 78  ? -5.134  -42.595 41.169 1.00 59.78  ? 78   PHE E CA    1 
ATOM   3367  C  C     . PHE E 1 78  ? -4.523  -43.011 39.844 1.00 60.65  ? 78   PHE E C     1 
ATOM   3368  O  O     . PHE E 1 78  ? -5.245  -43.266 38.897 1.00 60.73  ? 78   PHE E O     1 
ATOM   3369  C  CB    . PHE E 1 78  ? -5.449  -41.098 41.035 1.00 65.52  ? 78   PHE E CB    1 
ATOM   3370  C  CG    . PHE E 1 78  ? -6.385  -40.575 42.077 1.00 74.53  ? 78   PHE E CG    1 
ATOM   3371  C  CD1   . PHE E 1 78  ? -5.952  -39.661 43.033 1.00 81.42  ? 78   PHE E CD1   1 
ATOM   3372  C  CD2   . PHE E 1 78  ? -7.710  -40.977 42.108 1.00 82.56  ? 78   PHE E CD2   1 
ATOM   3373  C  CE1   . PHE E 1 78  ? -6.822  -39.170 44.007 1.00 79.09  ? 78   PHE E CE1   1 
ATOM   3374  C  CE2   . PHE E 1 78  ? -8.585  -40.484 43.086 1.00 86.86  ? 78   PHE E CE2   1 
ATOM   3375  C  CZ    . PHE E 1 78  ? -8.140  -39.568 44.028 1.00 77.87  ? 78   PHE E CZ    1 
ATOM   3376  N  N     . LYS E 1 79  ? -3.199  -42.993 39.739 1.00 62.23  ? 79   LYS E N     1 
ATOM   3377  C  CA    . LYS E 1 79  ? -2.539  -43.213 38.460 1.00 64.94  ? 79   LYS E CA    1 
ATOM   3378  C  C     . LYS E 1 79  ? -1.028  -43.365 38.630 1.00 72.25  ? 79   LYS E C     1 
ATOM   3379  O  O     . LYS E 1 79  ? -0.345  -42.521 39.229 1.00 79.30  ? 79   LYS E O     1 
ATOM   3380  C  CB    . LYS E 1 79  ? -2.822  -42.035 37.543 1.00 66.30  ? 79   LYS E CB    1 
ATOM   3381  C  CG    . LYS E 1 79  ? -3.165  -42.413 36.121 1.00 74.76  ? 79   LYS E CG    1 
ATOM   3382  C  CD    . LYS E 1 79  ? -1.913  -42.515 35.273 1.00 75.36  ? 79   LYS E CD    1 
ATOM   3383  C  CE    . LYS E 1 79  ? -2.194  -43.189 33.942 1.00 74.48  ? 79   LYS E CE    1 
ATOM   3384  N  NZ    . LYS E 1 79  ? -1.039  -44.090 33.637 1.00 78.62  ? 79   LYS E NZ    1 
ATOM   3385  N  N     . THR E 1 80  ? -0.491  -44.434 38.082 1.00 76.33  ? 80   THR E N     1 
ATOM   3386  C  CA    . THR E 1 80  ? 0.924   -44.712 38.250 1.00 79.60  ? 80   THR E CA    1 
ATOM   3387  C  C     . THR E 1 80  ? 1.781   -44.046 37.205 1.00 76.95  ? 80   THR E C     1 
ATOM   3388  O  O     . THR E 1 80  ? 1.278   -43.617 36.163 1.00 70.11  ? 80   THR E O     1 
ATOM   3389  C  CB    . THR E 1 80  ? 1.145   -46.179 38.073 1.00 83.10  ? 80   THR E CB    1 
ATOM   3390  O  OG1   . THR E 1 80  ? 0.527   -46.557 36.827 1.00 93.57  ? 80   THR E OG1   1 
ATOM   3391  C  CG2   . THR E 1 80  ? 0.516   -46.909 39.234 1.00 77.53  ? 80   THR E CG2   1 
ATOM   3392  N  N     . ASP E 1 81  ? 3.085   -44.002 37.497 1.00 80.37  ? 81   ASP E N     1 
ATOM   3393  C  CA    . ASP E 1 81  ? 4.101   -43.423 36.604 1.00 81.72  ? 81   ASP E CA    1 
ATOM   3394  C  C     . ASP E 1 81  ? 3.745   -42.003 36.238 1.00 74.36  ? 81   ASP E C     1 
ATOM   3395  O  O     . ASP E 1 81  ? 3.640   -41.665 35.070 1.00 73.08  ? 81   ASP E O     1 
ATOM   3396  C  CB    . ASP E 1 81  ? 4.239   -44.251 35.322 1.00 91.68  ? 81   ASP E CB    1 
ATOM   3397  C  CG    . ASP E 1 81  ? 4.210   -45.727 35.585 1.00 101.17 ? 81   ASP E CG    1 
ATOM   3398  O  OD1   . ASP E 1 81  ? 3.209   -46.358 35.159 1.00 99.87  ? 81   ASP E OD1   1 
ATOM   3399  O  OD2   . ASP E 1 81  ? 5.166   -46.237 36.231 1.00 97.58  ? 81   ASP E OD2   1 
ATOM   3400  N  N     . LEU E 1 82  ? 3.506   -41.191 37.260 1.00 80.41  ? 82   LEU E N     1 
ATOM   3401  C  CA    . LEU E 1 82  ? 3.200   -39.773 37.084 1.00 75.27  ? 82   LEU E CA    1 
ATOM   3402  C  C     . LEU E 1 82  ? 4.376   -38.950 37.594 1.00 71.51  ? 82   LEU E C     1 
ATOM   3403  O  O     . LEU E 1 82  ? 5.035   -39.312 38.556 1.00 66.15  ? 82   LEU E O     1 
ATOM   3404  C  CB    . LEU E 1 82  ? 1.928   -39.382 37.855 1.00 73.24  ? 82   LEU E CB    1 
ATOM   3405  C  CG    . LEU E 1 82  ? 0.533   -39.662 37.279 1.00 75.57  ? 82   LEU E CG    1 
ATOM   3406  C  CD1   . LEU E 1 82  ? -0.573  -39.331 38.283 1.00 67.79  ? 82   LEU E CD1   1 
ATOM   3407  C  CD2   . LEU E 1 82  ? 0.360   -38.853 36.000 1.00 76.75  ? 82   LEU E CD2   1 
ATOM   3408  N  N     . ARG E 1 83  ? 4.619   -37.824 36.965 1.00 70.06  ? 83   ARG E N     1 
ATOM   3409  C  CA    . ARG E 1 83  ? 5.608   -36.918 37.468 1.00 75.92  ? 83   ARG E CA    1 
ATOM   3410  C  C     . ARG E 1 83  ? 4.896   -35.626 37.848 1.00 68.97  ? 83   ARG E C     1 
ATOM   3411  O  O     . ARG E 1 83  ? 3.808   -35.357 37.365 1.00 62.41  ? 83   ARG E O     1 
ATOM   3412  C  CB    . ARG E 1 83  ? 6.625   -36.640 36.359 1.00 89.73  ? 83   ARG E CB    1 
ATOM   3413  C  CG    . ARG E 1 83  ? 7.358   -37.857 35.821 1.00 90.00  ? 83   ARG E CG    1 
ATOM   3414  C  CD    . ARG E 1 83  ? 7.934   -37.580 34.441 1.00 96.39  ? 83   ARG E CD    1 
ATOM   3415  N  NE    . ARG E 1 83  ? 9.192   -38.299 34.200 1.00 107.91 ? 83   ARG E NE    1 
ATOM   3416  C  CZ    . ARG E 1 83  ? 10.425  -37.810 34.398 1.00 113.21 ? 83   ARG E CZ    1 
ATOM   3417  N  NH1   . ARG E 1 83  ? 10.631  -36.579 34.838 1.00 108.48 ? 83   ARG E NH1   1 
ATOM   3418  N  NH2   . ARG E 1 83  ? 11.482  -38.567 34.141 1.00 127.29 ? 83   ARG E NH2   1 
ATOM   3419  N  N     . PHE E 1 84  ? 5.548   -34.803 38.656 1.00 66.41  ? 84   PHE E N     1 
ATOM   3420  C  CA    . PHE E 1 84  ? 5.020   -33.497 39.029 1.00 66.25  ? 84   PHE E CA    1 
ATOM   3421  C  C     . PHE E 1 84  ? 5.991   -32.368 38.835 1.00 62.05  ? 84   PHE E C     1 
ATOM   3422  O  O     . PHE E 1 84  ? 7.083   -32.396 39.414 1.00 68.60  ? 84   PHE E O     1 
ATOM   3423  C  CB    . PHE E 1 84  ? 4.719   -33.492 40.509 1.00 67.99  ? 84   PHE E CB    1 
ATOM   3424  C  CG    . PHE E 1 84  ? 3.477   -34.214 40.872 1.00 70.65  ? 84   PHE E CG    1 
ATOM   3425  C  CD1   . PHE E 1 84  ? 3.459   -35.585 40.951 1.00 69.73  ? 84   PHE E CD1   1 
ATOM   3426  C  CD2   . PHE E 1 84  ? 2.321   -33.507 41.169 1.00 68.49  ? 84   PHE E CD2   1 
ATOM   3427  C  CE1   . PHE E 1 84  ? 2.293   -36.246 41.320 1.00 73.53  ? 84   PHE E CE1   1 
ATOM   3428  C  CE2   . PHE E 1 84  ? 1.167   -34.155 41.534 1.00 64.75  ? 84   PHE E CE2   1 
ATOM   3429  C  CZ    . PHE E 1 84  ? 1.147   -35.532 41.609 1.00 65.64  ? 84   PHE E CZ    1 
ATOM   3430  N  N     . GLN E 1 85  ? 5.578   -31.333 38.105 1.00 58.40  ? 85   GLN E N     1 
ATOM   3431  C  CA    . GLN E 1 85  ? 6.341   -30.086 38.087 1.00 54.92  ? 85   GLN E CA    1 
ATOM   3432  C  C     . GLN E 1 85  ? 6.468   -29.634 39.516 1.00 50.38  ? 85   GLN E C     1 
ATOM   3433  O  O     . GLN E 1 85  ? 5.555   -29.810 40.301 1.00 57.04  ? 85   GLN E O     1 
ATOM   3434  C  CB    . GLN E 1 85  ? 5.645   -29.021 37.252 1.00 58.71  ? 85   GLN E CB    1 
ATOM   3435  C  CG    . GLN E 1 85  ? 5.683   -29.305 35.755 1.00 65.52  ? 85   GLN E CG    1 
ATOM   3436  C  CD    . GLN E 1 85  ? 5.022   -28.219 34.901 1.00 75.32  ? 85   GLN E CD    1 
ATOM   3437  O  OE1   . GLN E 1 85  ? 4.310   -27.335 35.396 1.00 74.88  ? 85   GLN E OE1   1 
ATOM   3438  N  NE2   . GLN E 1 85  ? 5.237   -28.306 33.595 1.00 78.84  ? 85   GLN E NE2   1 
ATOM   3439  N  N     . SER E 1 86  ? 7.590   -29.086 39.905 1.00 53.05  ? 86   SER E N     1 
ATOM   3440  C  CA    . SER E 1 86  ? 7.741   -28.803 41.330 1.00 59.02  ? 86   SER E CA    1 
ATOM   3441  C  C     . SER E 1 86  ? 6.792   -27.707 41.725 1.00 59.16  ? 86   SER E C     1 
ATOM   3442  O  O     . SER E 1 86  ? 6.329   -27.706 42.837 1.00 66.33  ? 86   SER E O     1 
ATOM   3443  C  CB    . SER E 1 86  ? 9.150   -28.401 41.697 1.00 59.10  ? 86   SER E CB    1 
ATOM   3444  O  OG    . SER E 1 86  ? 9.461   -27.252 40.951 1.00 74.01  ? 86   SER E OG    1 
ATOM   3445  N  N     . SER E 1 87  ? 6.472   -26.791 40.821 1.00 58.43  ? 87   SER E N     1 
ATOM   3446  C  CA    . SER E 1 87  ? 5.521   -25.755 41.161 1.00 55.21  ? 87   SER E CA    1 
ATOM   3447  C  C     . SER E 1 87  ? 4.136   -26.352 41.348 1.00 56.70  ? 87   SER E C     1 
ATOM   3448  O  O     . SER E 1 87  ? 3.336   -25.820 42.102 1.00 66.88  ? 87   SER E O     1 
ATOM   3449  C  CB    . SER E 1 87  ? 5.468   -24.686 40.101 1.00 55.83  ? 87   SER E CB    1 
ATOM   3450  O  OG    . SER E 1 87  ? 5.200   -25.285 38.841 1.00 64.15  ? 87   SER E OG    1 
ATOM   3451  N  N     . ALA E 1 88  ? 3.835   -27.457 40.696 1.00 53.28  ? 88   ALA E N     1 
ATOM   3452  C  CA    . ALA E 1 88  ? 2.545   -28.080 40.946 1.00 55.37  ? 88   ALA E CA    1 
ATOM   3453  C  C     . ALA E 1 88  ? 2.421   -28.568 42.368 1.00 53.57  ? 88   ALA E C     1 
ATOM   3454  O  O     . ALA E 1 88  ? 1.371   -28.487 42.986 1.00 60.44  ? 88   ALA E O     1 
ATOM   3455  C  CB    . ALA E 1 88  ? 2.287   -29.216 40.004 1.00 55.44  ? 88   ALA E CB    1 
ATOM   3456  N  N     . VAL E 1 89  ? 3.502   -29.043 42.924 1.00 53.86  ? 89   VAL E N     1 
ATOM   3457  C  CA    . VAL E 1 89  ? 3.447   -29.462 44.324 1.00 51.53  ? 89   VAL E CA    1 
ATOM   3458  C  C     . VAL E 1 89  ? 3.316   -28.243 45.203 1.00 53.00  ? 89   VAL E C     1 
ATOM   3459  O  O     . VAL E 1 89  ? 2.631   -28.278 46.207 1.00 56.13  ? 89   VAL E O     1 
ATOM   3460  C  CB    . VAL E 1 89  ? 4.715   -30.225 44.750 1.00 51.29  ? 89   VAL E CB    1 
ATOM   3461  C  CG1   . VAL E 1 89  ? 4.614   -30.676 46.190 1.00 56.44  ? 89   VAL E CG1   1 
ATOM   3462  C  CG2   . VAL E 1 89  ? 4.928   -31.447 43.886 1.00 53.16  ? 89   VAL E CG2   1 
ATOM   3463  N  N     . MET E 1 90  ? 4.009   -27.173 44.830 1.00 57.14  ? 90   MET E N     1 
ATOM   3464  C  CA    . MET E 1 90  ? 3.933   -25.942 45.570 1.00 58.15  ? 90   MET E CA    1 
ATOM   3465  C  C     . MET E 1 90  ? 2.532   -25.365 45.515 1.00 58.88  ? 90   MET E C     1 
ATOM   3466  O  O     . MET E 1 90  ? 2.028   -24.859 46.537 1.00 55.29  ? 90   MET E O     1 
ATOM   3467  C  CB    . MET E 1 90  ? 4.938   -24.952 45.036 1.00 61.50  ? 90   MET E CB    1 
ATOM   3468  C  CG    . MET E 1 90  ? 6.351   -25.329 45.398 1.00 68.69  ? 90   MET E CG    1 
ATOM   3469  S  SD    . MET E 1 90  ? 6.479   -25.858 47.121 1.00 76.28  ? 90   MET E SD    1 
ATOM   3470  C  CE    . MET E 1 90  ? 6.404   -24.252 47.913 1.00 84.80  ? 90   MET E CE    1 
ATOM   3471  N  N     . ALA E 1 91  ? 1.889   -25.471 44.349 1.00 53.35  ? 91   ALA E N     1 
ATOM   3472  C  CA    . ALA E 1 91  ? 0.547   -24.933 44.213 1.00 53.31  ? 91   ALA E CA    1 
ATOM   3473  C  C     . ALA E 1 91  ? -0.349  -25.657 45.186 1.00 50.84  ? 91   ALA E C     1 
ATOM   3474  O  O     . ALA E 1 91  ? -1.131  -25.041 45.901 1.00 53.97  ? 91   ALA E O     1 
ATOM   3475  C  CB    . ALA E 1 91  ? 0.030   -25.097 42.814 1.00 52.22  ? 91   ALA E CB    1 
ATOM   3476  N  N     . LEU E 1 92  ? -0.216  -26.970 45.223 1.00 48.95  ? 92   LEU E N     1 
ATOM   3477  C  CA    . LEU E 1 92  ? -1.030  -27.782 46.138 1.00 50.01  ? 92   LEU E CA    1 
ATOM   3478  C  C     . LEU E 1 92  ? -0.762  -27.409 47.573 1.00 49.34  ? 92   LEU E C     1 
ATOM   3479  O  O     . LEU E 1 92  ? -1.675  -27.303 48.380 1.00 53.03  ? 92   LEU E O     1 
ATOM   3480  C  CB    . LEU E 1 92  ? -0.755  -29.273 45.943 1.00 51.65  ? 92   LEU E CB    1 
ATOM   3481  C  CG    . LEU E 1 92  ? -1.393  -29.870 44.669 1.00 56.54  ? 92   LEU E CG    1 
ATOM   3482  C  CD1   . LEU E 1 92  ? -0.766  -31.175 44.220 1.00 57.84  ? 92   LEU E CD1   1 
ATOM   3483  C  CD2   . LEU E 1 92  ? -2.864  -30.113 44.894 1.00 58.64  ? 92   LEU E CD2   1 
ATOM   3484  N  N     . GLN E 1 93  ? 0.493   -27.174 47.898 1.00 47.07  ? 93   GLN E N     1 
ATOM   3485  C  CA    . GLN E 1 93  ? 0.819   -26.872 49.275 1.00 48.34  ? 93   GLN E CA    1 
ATOM   3486  C  C     . GLN E 1 93  ? 0.254   -25.540 49.717 1.00 46.67  ? 93   GLN E C     1 
ATOM   3487  O  O     . GLN E 1 93  ? -0.319  -25.451 50.788 1.00 48.48  ? 93   GLN E O     1 
ATOM   3488  C  CB    . GLN E 1 93  ? 2.336   -26.923 49.544 1.00 50.43  ? 93   GLN E CB    1 
ATOM   3489  C  CG    . GLN E 1 93  ? 2.608   -27.085 51.044 1.00 50.86  ? 93   GLN E CG    1 
ATOM   3490  C  CD    . GLN E 1 93  ? 4.048   -27.345 51.435 1.00 50.02  ? 93   GLN E CD    1 
ATOM   3491  O  OE1   . GLN E 1 93  ? 4.909   -27.609 50.623 1.00 53.28  ? 93   GLN E OE1   1 
ATOM   3492  N  NE2   . GLN E 1 93  ? 4.306   -27.269 52.712 1.00 52.93  ? 93   GLN E NE2   1 
ATOM   3493  N  N     . GLU E 1 94  ? 0.432   -24.512 48.893 1.00 47.61  ? 94   GLU E N     1 
ATOM   3494  C  CA    . GLU E 1 94  ? -0.181  -23.195 49.114 1.00 45.65  ? 94   GLU E CA    1 
ATOM   3495  C  C     . GLU E 1 94  ? -1.695  -23.314 49.246 1.00 46.96  ? 94   GLU E C     1 
ATOM   3496  O  O     . GLU E 1 94  ? -2.294  -22.692 50.099 1.00 53.01  ? 94   GLU E O     1 
ATOM   3497  C  CB    . GLU E 1 94  ? 0.120   -22.240 47.954 1.00 49.70  ? 94   GLU E CB    1 
ATOM   3498  C  CG    . GLU E 1 94  ? 1.537   -21.675 47.911 1.00 53.14  ? 94   GLU E CG    1 
ATOM   3499  C  CD    . GLU E 1 94  ? 1.866   -20.728 49.065 1.00 58.65  ? 94   GLU E CD    1 
ATOM   3500  O  OE1   . GLU E 1 94  ? 0.952   -20.230 49.780 1.00 59.20  ? 94   GLU E OE1   1 
ATOM   3501  O  OE2   . GLU E 1 94  ? 3.071   -20.478 49.263 1.00 61.52  ? 94   GLU E OE2   1 
ATOM   3502  N  N     . ALA E 1 95  ? -2.329  -24.110 48.402 1.00 43.83  ? 95   ALA E N     1 
ATOM   3503  C  CA    . ALA E 1 95  ? -3.766  -24.245 48.487 1.00 41.11  ? 95   ALA E CA    1 
ATOM   3504  C  C     . ALA E 1 95  ? -4.140  -24.936 49.763 1.00 43.87  ? 95   ALA E C     1 
ATOM   3505  O  O     . ALA E 1 95  ? -5.044  -24.502 50.424 1.00 47.97  ? 95   ALA E O     1 
ATOM   3506  C  CB    . ALA E 1 95  ? -4.304  -25.029 47.293 1.00 39.17  ? 95   ALA E CB    1 
ATOM   3507  N  N     . SER E 1 96  ? -3.446  -26.029 50.080 1.00 45.79  ? 96   SER E N     1 
ATOM   3508  C  CA    . SER E 1 96  ? -3.756  -26.888 51.233 1.00 44.79  ? 96   SER E CA    1 
ATOM   3509  C  C     . SER E 1 96  ? -3.634  -26.176 52.577 1.00 44.26  ? 96   SER E C     1 
ATOM   3510  O  O     . SER E 1 96  ? -4.557  -26.208 53.420 1.00 41.82  ? 96   SER E O     1 
ATOM   3511  C  CB    . SER E 1 96  ? -2.796  -28.084 51.241 1.00 47.57  ? 96   SER E CB    1 
ATOM   3512  O  OG    . SER E 1 96  ? -3.081  -29.014 50.193 1.00 50.63  ? 96   SER E OG    1 
ATOM   3513  N  N     . GLU E 1 97  ? -2.501  -25.508 52.766 1.00 47.32  ? 97   GLU E N     1 
ATOM   3514  C  CA    . GLU E 1 97  ? -2.296  -24.701 53.964 1.00 47.60  ? 97   GLU E CA    1 
ATOM   3515  C  C     . GLU E 1 97  ? -3.321  -23.558 54.070 1.00 43.38  ? 97   GLU E C     1 
ATOM   3516  O  O     . GLU E 1 97  ? -3.861  -23.264 55.141 1.00 41.45  ? 97   GLU E O     1 
ATOM   3517  C  CB    . GLU E 1 97  ? -0.872  -24.196 54.015 1.00 52.89  ? 97   GLU E CB    1 
ATOM   3518  C  CG    . GLU E 1 97  ? 0.176   -25.326 54.086 1.00 60.01  ? 97   GLU E CG    1 
ATOM   3519  C  CD    . GLU E 1 97  ? 1.527   -24.894 54.687 1.00 65.62  ? 97   GLU E CD    1 
ATOM   3520  O  OE1   . GLU E 1 97  ? 1.684   -23.731 55.122 1.00 68.74  ? 97   GLU E OE1   1 
ATOM   3521  O  OE2   . GLU E 1 97  ? 2.461   -25.711 54.734 1.00 69.48  ? 97   GLU E OE2   1 
ATOM   3522  N  N     . ALA E 1 98  ? -3.660  -22.947 52.951 1.00 40.92  ? 98   ALA E N     1 
ATOM   3523  C  CA    . ALA E 1 98  ? -4.650  -21.877 53.001 1.00 37.55  ? 98   ALA E CA    1 
ATOM   3524  C  C     . ALA E 1 98  ? -5.967  -22.445 53.412 1.00 39.89  ? 98   ALA E C     1 
ATOM   3525  O  O     . ALA E 1 98  ? -6.678  -21.869 54.214 1.00 50.28  ? 98   ALA E O     1 
ATOM   3526  C  CB    . ALA E 1 98  ? -4.789  -21.206 51.665 1.00 35.31  ? 98   ALA E CB    1 
ATOM   3527  N  N     . TYR E 1 99  ? -6.294  -23.588 52.858 1.00 40.72  ? 99   TYR E N     1 
ATOM   3528  C  CA    . TYR E 1 99  ? -7.544  -24.234 53.185 1.00 43.25  ? 99   TYR E CA    1 
ATOM   3529  C  C     . TYR E 1 99  ? -7.555  -24.583 54.653 1.00 44.20  ? 99   TYR E C     1 
ATOM   3530  O  O     . TYR E 1 99  ? -8.548  -24.315 55.345 1.00 46.21  ? 99   TYR E O     1 
ATOM   3531  C  CB    . TYR E 1 99  ? -7.813  -25.462 52.302 1.00 40.58  ? 99   TYR E CB    1 
ATOM   3532  C  CG    . TYR E 1 99  ? -8.919  -26.339 52.791 1.00 39.70  ? 99   TYR E CG    1 
ATOM   3533  C  CD1   . TYR E 1 99  ? -10.210 -26.104 52.445 1.00 43.57  ? 99   TYR E CD1   1 
ATOM   3534  C  CD2   . TYR E 1 99  ? -8.656  -27.432 53.599 1.00 43.13  ? 99   TYR E CD2   1 
ATOM   3535  C  CE1   . TYR E 1 99  ? -11.235 -26.944 52.890 1.00 44.09  ? 99   TYR E CE1   1 
ATOM   3536  C  CE2   . TYR E 1 99  ? -9.650  -28.265 54.057 1.00 39.24  ? 99   TYR E CE2   1 
ATOM   3537  C  CZ    . TYR E 1 99  ? -10.946 -28.018 53.712 1.00 45.12  ? 99   TYR E CZ    1 
ATOM   3538  O  OH    . TYR E 1 99  ? -11.971 -28.842 54.213 1.00 50.49  ? 99   TYR E OH    1 
ATOM   3539  N  N     . LEU E 1 100 ? -6.459  -25.146 55.139 1.00 43.19  ? 100  LEU E N     1 
ATOM   3540  C  CA    . LEU E 1 100 ? -6.499  -25.626 56.513 1.00 46.23  ? 100  LEU E CA    1 
ATOM   3541  C  C     . LEU E 1 100 ? -6.517  -24.488 57.545 1.00 45.16  ? 100  LEU E C     1 
ATOM   3542  O  O     . LEU E 1 100 ? -7.212  -24.567 58.539 1.00 48.16  ? 100  LEU E O     1 
ATOM   3543  C  CB    . LEU E 1 100 ? -5.370  -26.616 56.778 1.00 46.31  ? 100  LEU E CB    1 
ATOM   3544  C  CG    . LEU E 1 100 ? -5.475  -28.022 56.148 1.00 45.30  ? 100  LEU E CG    1 
ATOM   3545  C  CD1   . LEU E 1 100 ? -4.178  -28.767 56.422 1.00 44.86  ? 100  LEU E CD1   1 
ATOM   3546  C  CD2   . LEU E 1 100 ? -6.597  -28.878 56.711 1.00 45.61  ? 100  LEU E CD2   1 
ATOM   3547  N  N     . VAL E 1 101 ? -5.786  -23.414 57.282 1.00 47.05  ? 101  VAL E N     1 
ATOM   3548  C  CA    . VAL E 1 101 ? -5.763  -22.266 58.183 1.00 44.82  ? 101  VAL E CA    1 
ATOM   3549  C  C     . VAL E 1 101 ? -7.150  -21.631 58.308 1.00 45.41  ? 101  VAL E C     1 
ATOM   3550  O  O     . VAL E 1 101 ? -7.567  -21.247 59.397 1.00 43.08  ? 101  VAL E O     1 
ATOM   3551  C  CB    . VAL E 1 101 ? -4.745  -21.219 57.691 1.00 47.20  ? 101  VAL E CB    1 
ATOM   3552  C  CG1   . VAL E 1 101 ? -4.893  -19.921 58.467 1.00 48.39  ? 101  VAL E CG1   1 
ATOM   3553  C  CG2   . VAL E 1 101 ? -3.307  -21.730 57.864 1.00 46.08  ? 101  VAL E CG2   1 
ATOM   3554  N  N     . ALA E 1 102 ? -7.877  -21.541 57.196 1.00 45.51  ? 102  ALA E N     1 
ATOM   3555  C  CA    . ALA E 1 102 ? -9.226  -20.983 57.221 1.00 41.49  ? 102  ALA E CA    1 
ATOM   3556  C  C     . ALA E 1 102 ? -10.187 -21.907 57.958 1.00 46.83  ? 102  ALA E C     1 
ATOM   3557  O  O     . ALA E 1 102 ? -11.095 -21.465 58.671 1.00 56.45  ? 102  ALA E O     1 
ATOM   3558  C  CB    . ALA E 1 102 ? -9.694  -20.800 55.834 1.00 40.55  ? 102  ALA E CB    1 
ATOM   3559  N  N     . LEU E 1 103 ? -9.995  -23.200 57.791 1.00 45.46  ? 103  LEU E N     1 
ATOM   3560  C  CA    . LEU E 1 103 ? -10.843 -24.173 58.462 1.00 41.80  ? 103  LEU E CA    1 
ATOM   3561  C  C     . LEU E 1 103 ? -10.684 -24.051 59.979 1.00 51.30  ? 103  LEU E C     1 
ATOM   3562  O  O     . LEU E 1 103 ? -11.672 -24.157 60.732 1.00 51.54  ? 103  LEU E O     1 
ATOM   3563  C  CB    . LEU E 1 103 ? -10.457 -25.566 58.008 1.00 39.06  ? 103  LEU E CB    1 
ATOM   3564  C  CG    . LEU E 1 103 ? -11.304 -26.620 58.637 1.00 43.16  ? 103  LEU E CG    1 
ATOM   3565  C  CD1   . LEU E 1 103 ? -12.763 -26.351 58.379 1.00 44.69  ? 103  LEU E CD1   1 
ATOM   3566  C  CD2   . LEU E 1 103 ? -10.921 -27.987 58.121 1.00 45.19  ? 103  LEU E CD2   1 
ATOM   3567  N  N     . PHE E 1 104 ? -9.447  -23.821 60.440 1.00 50.78  ? 104  PHE E N     1 
ATOM   3568  C  CA    . PHE E 1 104 ? -9.215  -23.628 61.861 1.00 47.91  ? 104  PHE E CA    1 
ATOM   3569  C  C     . PHE E 1 104 ? -9.798  -22.323 62.409 1.00 48.43  ? 104  PHE E C     1 
ATOM   3570  O  O     . PHE E 1 104 ? -10.207 -22.270 63.543 1.00 47.44  ? 104  PHE E O     1 
ATOM   3571  C  CB    . PHE E 1 104 ? -7.752  -23.642 62.162 1.00 48.99  ? 104  PHE E CB    1 
ATOM   3572  C  CG    . PHE E 1 104 ? -7.135  -25.001 62.170 1.00 50.45  ? 104  PHE E CG    1 
ATOM   3573  C  CD1   . PHE E 1 104 ? -6.005  -25.269 61.427 1.00 50.89  ? 104  PHE E CD1   1 
ATOM   3574  C  CD2   . PHE E 1 104 ? -7.604  -25.978 63.012 1.00 53.51  ? 104  PHE E CD2   1 
ATOM   3575  C  CE1   . PHE E 1 104 ? -5.401  -26.506 61.475 1.00 49.41  ? 104  PHE E CE1   1 
ATOM   3576  C  CE2   . PHE E 1 104 ? -6.996  -27.224 63.067 1.00 49.67  ? 104  PHE E CE2   1 
ATOM   3577  C  CZ    . PHE E 1 104 ? -5.901  -27.489 62.288 1.00 49.29  ? 104  PHE E CZ    1 
ATOM   3578  N  N     . GLU E 1 105 ? -9.852  -21.250 61.640 1.00 49.95  ? 105  GLU E N     1 
ATOM   3579  C  CA    . GLU E 1 105 ? -10.579 -20.082 62.168 1.00 49.61  ? 105  GLU E CA    1 
ATOM   3580  C  C     . GLU E 1 105 ? -12.002 -20.518 62.408 1.00 52.63  ? 105  GLU E C     1 
ATOM   3581  O  O     . GLU E 1 105 ? -12.557 -20.304 63.486 1.00 56.23  ? 105  GLU E O     1 
ATOM   3582  C  CB    . GLU E 1 105 ? -10.590 -18.909 61.213 1.00 48.43  ? 105  GLU E CB    1 
ATOM   3583  C  CG    . GLU E 1 105 ? -9.204  -18.411 60.843 1.00 59.80  ? 105  GLU E CG    1 
ATOM   3584  C  CD    . GLU E 1 105 ? -9.138  -17.705 59.491 1.00 67.41  ? 105  GLU E CD    1 
ATOM   3585  O  OE1   . GLU E 1 105 ? -10.221 -17.357 58.926 1.00 69.62  ? 105  GLU E OE1   1 
ATOM   3586  O  OE2   . GLU E 1 105 ? -7.984  -17.506 59.009 1.00 66.60  ? 105  GLU E OE2   1 
ATOM   3587  N  N     . ASP E 1 106 ? -12.605 -21.150 61.399 1.00 52.23  ? 106  ASP E N     1 
ATOM   3588  C  CA    . ASP E 1 106 ? -14.032 -21.488 61.496 1.00 51.32  ? 106  ASP E CA    1 
ATOM   3589  C  C     . ASP E 1 106 ? -14.238 -22.438 62.664 1.00 52.00  ? 106  ASP E C     1 
ATOM   3590  O  O     . ASP E 1 106 ? -15.209 -22.315 63.423 1.00 48.92  ? 106  ASP E O     1 
ATOM   3591  C  CB    . ASP E 1 106 ? -14.530 -22.125 60.213 1.00 51.06  ? 106  ASP E CB    1 
ATOM   3592  C  CG    . ASP E 1 106 ? -14.679 -21.137 59.066 1.00 54.90  ? 106  ASP E CG    1 
ATOM   3593  O  OD1   . ASP E 1 106 ? -14.487 -19.920 59.314 1.00 57.97  ? 106  ASP E OD1   1 
ATOM   3594  O  OD2   . ASP E 1 106 ? -15.001 -21.590 57.908 1.00 57.16  ? 106  ASP E OD2   1 
ATOM   3595  N  N     . THR E 1 107 ? -13.282 -23.360 62.815 1.00 50.42  ? 107  THR E N     1 
ATOM   3596  C  CA    . THR E 1 107 ? -13.308 -24.341 63.886 1.00 47.21  ? 107  THR E CA    1 
ATOM   3597  C  C     . THR E 1 107 ? -13.245 -23.657 65.219 1.00 48.71  ? 107  THR E C     1 
ATOM   3598  O  O     . THR E 1 107 ? -14.059 -23.896 66.084 1.00 53.70  ? 107  THR E O     1 
ATOM   3599  C  CB    . THR E 1 107 ? -12.142 -25.266 63.732 1.00 44.15  ? 107  THR E CB    1 
ATOM   3600  O  OG1   . THR E 1 107 ? -12.345 -26.016 62.544 1.00 45.21  ? 107  THR E OG1   1 
ATOM   3601  C  CG2   . THR E 1 107 ? -12.074 -26.206 64.836 1.00 48.12  ? 107  THR E CG2   1 
ATOM   3602  N  N     . ASN E 1 108 ? -12.296 -22.749 65.340 1.00 54.00  ? 108  ASN E N     1 
ATOM   3603  C  CA    . ASN E 1 108 ? -12.106 -21.961 66.543 1.00 52.96  ? 108  ASN E CA    1 
ATOM   3604  C  C     . ASN E 1 108 ? -13.349 -21.225 66.946 1.00 54.23  ? 108  ASN E C     1 
ATOM   3605  O  O     . ASN E 1 108 ? -13.647 -21.134 68.129 1.00 56.27  ? 108  ASN E O     1 
ATOM   3606  C  CB    . ASN E 1 108 ? -11.021 -20.941 66.307 1.00 53.39  ? 108  ASN E CB    1 
ATOM   3607  C  CG    . ASN E 1 108 ? -10.383 -20.480 67.572 1.00 52.78  ? 108  ASN E CG    1 
ATOM   3608  O  OD1   . ASN E 1 108 ? -10.295 -21.212 68.540 1.00 58.34  ? 108  ASN E OD1   1 
ATOM   3609  N  ND2   . ASN E 1 108 ? -9.865  -19.287 67.546 1.00 52.14  ? 108  ASN E ND2   1 
ATOM   3610  N  N     . LEU E 1 109 ? -14.066 -20.694 65.955 1.00 55.47  ? 109  LEU E N     1 
ATOM   3611  C  CA    . LEU E 1 109 ? -15.319 -19.976 66.215 1.00 51.76  ? 109  LEU E CA    1 
ATOM   3612  C  C     . LEU E 1 109 ? -16.353 -20.939 66.750 1.00 54.12  ? 109  LEU E C     1 
ATOM   3613  O  O     . LEU E 1 109 ? -17.091 -20.599 67.658 1.00 58.70  ? 109  LEU E O     1 
ATOM   3614  C  CB    . LEU E 1 109 ? -15.852 -19.331 64.949 1.00 46.92  ? 109  LEU E CB    1 
ATOM   3615  C  CG    . LEU E 1 109 ? -15.106 -18.116 64.412 1.00 42.61  ? 109  LEU E CG    1 
ATOM   3616  C  CD1   . LEU E 1 109 ? -15.832 -17.619 63.156 1.00 41.27  ? 109  LEU E CD1   1 
ATOM   3617  C  CD2   . LEU E 1 109 ? -15.046 -17.007 65.421 1.00 37.11  ? 109  LEU E CD2   1 
ATOM   3618  N  N     . CYS E 1 110 ? -16.399 -22.144 66.195 1.00 51.71  ? 110  CYS E N     1 
ATOM   3619  C  CA    . CYS E 1 110 ? -17.292 -23.155 66.735 1.00 55.72  ? 110  CYS E CA    1 
ATOM   3620  C  C     . CYS E 1 110 ? -17.004 -23.509 68.230 1.00 56.45  ? 110  CYS E C     1 
ATOM   3621  O  O     . CYS E 1 110 ? -17.913 -23.506 69.054 1.00 52.65  ? 110  CYS E O     1 
ATOM   3622  C  CB    . CYS E 1 110 ? -17.292 -24.383 65.827 1.00 53.45  ? 110  CYS E CB    1 
ATOM   3623  S  SG    . CYS E 1 110 ? -18.045 -24.047 64.192 1.00 54.82  ? 110  CYS E SG    1 
ATOM   3624  N  N     . ALA E 1 111 ? -15.755 -23.779 68.594 1.00 51.99  ? 111  ALA E N     1 
ATOM   3625  C  CA    . ALA E 1 111 ? -15.439 -23.941 70.008 1.00 52.60  ? 111  ALA E CA    1 
ATOM   3626  C  C     . ALA E 1 111 ? -15.929 -22.738 70.821 1.00 53.14  ? 111  ALA E C     1 
ATOM   3627  O  O     . ALA E 1 111 ? -16.616 -22.857 71.835 1.00 54.82  ? 111  ALA E O     1 
ATOM   3628  C  CB    . ALA E 1 111 ? -13.958 -24.120 70.200 1.00 55.17  ? 111  ALA E CB    1 
ATOM   3629  N  N     . ILE E 1 112 ? -15.594 -21.551 70.385 1.00 54.29  ? 112  ILE E N     1 
ATOM   3630  C  CA    . ILE E 1 112 ? -15.960 -20.386 71.191 1.00 52.35  ? 112  ILE E CA    1 
ATOM   3631  C  C     . ILE E 1 112 ? -17.470 -20.285 71.330 1.00 50.45  ? 112  ILE E C     1 
ATOM   3632  O  O     . ILE E 1 112 ? -17.984 -19.921 72.365 1.00 54.02  ? 112  ILE E O     1 
ATOM   3633  C  CB    . ILE E 1 112 ? -15.377 -19.096 70.604 1.00 47.14  ? 112  ILE E CB    1 
ATOM   3634  C  CG1   . ILE E 1 112 ? -13.875 -19.089 70.779 1.00 49.88  ? 112  ILE E CG1   1 
ATOM   3635  C  CG2   . ILE E 1 112 ? -15.928 -17.900 71.308 1.00 46.22  ? 112  ILE E CG2   1 
ATOM   3636  C  CD1   . ILE E 1 112 ? -13.168 -18.169 69.815 1.00 57.66  ? 112  ILE E CD1   1 
ATOM   3637  N  N     . HIS E 1 113 ? -18.190 -20.652 70.293 1.00 51.62  ? 113  HIS E N     1 
ATOM   3638  C  CA    . HIS E 1 113 ? -19.645 -20.660 70.366 1.00 51.15  ? 113  HIS E CA    1 
ATOM   3639  C  C     . HIS E 1 113 ? -20.150 -21.563 71.479 1.00 57.78  ? 113  HIS E C     1 
ATOM   3640  O  O     . HIS E 1 113 ? -21.221 -21.328 72.058 1.00 57.20  ? 113  HIS E O     1 
ATOM   3641  C  CB    . HIS E 1 113 ? -20.183 -21.189 69.059 1.00 54.85  ? 113  HIS E CB    1 
ATOM   3642  C  CG    . HIS E 1 113 ? -21.659 -21.160 68.971 1.00 53.50  ? 113  HIS E CG    1 
ATOM   3643  N  ND1   . HIS E 1 113 ? -22.361 -19.981 68.866 1.00 54.77  ? 113  HIS E ND1   1 
ATOM   3644  C  CD2   . HIS E 1 113 ? -22.571 -22.157 68.947 1.00 56.23  ? 113  HIS E CD2   1 
ATOM   3645  C  CE1   . HIS E 1 113 ? -23.651 -20.247 68.800 1.00 57.35  ? 113  HIS E CE1   1 
ATOM   3646  N  NE2   . HIS E 1 113 ? -23.807 -21.562 68.845 1.00 63.04  ? 113  HIS E NE2   1 
ATOM   3647  N  N     . ALA E 1 114 ? -19.369 -22.617 71.745 1.00 59.19  ? 114  ALA E N     1 
ATOM   3648  C  CA    . ALA E 1 114 ? -19.670 -23.619 72.752 1.00 54.79  ? 114  ALA E CA    1 
ATOM   3649  C  C     . ALA E 1 114 ? -19.123 -23.232 74.108 1.00 62.88  ? 114  ALA E C     1 
ATOM   3650  O  O     . ALA E 1 114 ? -18.986 -24.076 75.007 1.00 59.61  ? 114  ALA E O     1 
ATOM   3651  C  CB    . ALA E 1 114 ? -19.044 -24.931 72.329 1.00 57.37  ? 114  ALA E CB    1 
ATOM   3652  N  N     . LYS E 1 115 ? -18.731 -21.971 74.243 1.00 68.45  ? 115  LYS E N     1 
ATOM   3653  C  CA    . LYS E 1 115 ? -18.106 -21.496 75.467 1.00 66.05  ? 115  LYS E CA    1 
ATOM   3654  C  C     . LYS E 1 115 ? -16.878 -22.316 75.854 1.00 62.14  ? 115  LYS E C     1 
ATOM   3655  O  O     . LYS E 1 115 ? -16.591 -22.459 77.003 1.00 61.49  ? 115  LYS E O     1 
ATOM   3656  C  CB    . LYS E 1 115 ? -19.141 -21.469 76.583 1.00 66.82  ? 115  LYS E CB    1 
ATOM   3657  C  CG    . LYS E 1 115 ? -20.388 -20.741 76.111 1.00 73.24  ? 115  LYS E CG    1 
ATOM   3658  C  CD    . LYS E 1 115 ? -21.423 -20.494 77.190 1.00 79.13  ? 115  LYS E CD    1 
ATOM   3659  C  CE    . LYS E 1 115 ? -22.292 -19.319 76.769 1.00 84.16  ? 115  LYS E CE    1 
ATOM   3660  N  NZ    . LYS E 1 115 ? -23.284 -18.998 77.825 1.00 103.37 ? 115  LYS E NZ    1 
ATOM   3661  N  N     . ARG E 1 116 ? -16.136 -22.817 74.873 1.00 58.60  ? 116  ARG E N     1 
ATOM   3662  C  CA    . ARG E 1 116 ? -14.797 -23.342 75.118 1.00 53.67  ? 116  ARG E CA    1 
ATOM   3663  C  C     . ARG E 1 116 ? -13.713 -22.486 74.432 1.00 51.37  ? 116  ARG E C     1 
ATOM   3664  O  O     . ARG E 1 116 ? -13.987 -21.603 73.610 1.00 52.43  ? 116  ARG E O     1 
ATOM   3665  C  CB    . ARG E 1 116 ? -14.703 -24.760 74.571 1.00 58.57  ? 116  ARG E CB    1 
ATOM   3666  C  CG    . ARG E 1 116 ? -15.706 -25.722 75.149 1.00 55.87  ? 116  ARG E CG    1 
ATOM   3667  C  CD    . ARG E 1 116 ? -15.556 -27.093 74.529 1.00 57.21  ? 116  ARG E CD    1 
ATOM   3668  N  NE    . ARG E 1 116 ? -16.469 -27.303 73.395 1.00 59.67  ? 116  ARG E NE    1 
ATOM   3669  C  CZ    . ARG E 1 116 ? -16.124 -27.374 72.108 1.00 55.48  ? 116  ARG E CZ    1 
ATOM   3670  N  NH1   . ARG E 1 116 ? -14.879 -27.226 71.694 1.00 57.70  ? 116  ARG E NH1   1 
ATOM   3671  N  NH2   . ARG E 1 116 ? -17.054 -27.598 71.219 1.00 56.64  ? 116  ARG E NH2   1 
ATOM   3672  N  N     . VAL E 1 117 ? -12.472 -22.773 74.778 1.00 51.34  ? 117  VAL E N     1 
ATOM   3673  C  CA    . VAL E 1 117 ? -11.317 -22.218 74.074 1.00 52.74  ? 117  VAL E CA    1 
ATOM   3674  C  C     . VAL E 1 117 ? -10.451 -23.323 73.439 1.00 52.30  ? 117  VAL E C     1 
ATOM   3675  O  O     . VAL E 1 117 ? -9.410  -23.046 72.809 1.00 57.02  ? 117  VAL E O     1 
ATOM   3676  C  CB    . VAL E 1 117 ? -10.464 -21.336 75.009 1.00 50.73  ? 117  VAL E CB    1 
ATOM   3677  C  CG1   . VAL E 1 117 ? -11.340 -20.287 75.637 1.00 50.69  ? 117  VAL E CG1   1 
ATOM   3678  C  CG2   . VAL E 1 117 ? -9.795  -22.163 76.096 1.00 58.03  ? 117  VAL E CG2   1 
ATOM   3679  N  N     . THR E 1 118 ? -10.901 -24.557 73.579 1.00 51.40  ? 118  THR E N     1 
ATOM   3680  C  CA    . THR E 1 118 ? -10.197 -25.697 73.036 1.00 58.11  ? 118  THR E CA    1 
ATOM   3681  C  C     . THR E 1 118 ? -10.902 -26.275 71.815 1.00 52.33  ? 118  THR E C     1 
ATOM   3682  O  O     . THR E 1 118 ? -11.983 -26.807 71.935 1.00 54.58  ? 118  THR E O     1 
ATOM   3683  C  CB    . THR E 1 118 ? -10.130 -26.814 74.099 1.00 58.02  ? 118  THR E CB    1 
ATOM   3684  O  OG1   . THR E 1 118 ? -9.736  -26.240 75.342 1.00 55.40  ? 118  THR E OG1   1 
ATOM   3685  C  CG2   . THR E 1 118 ? -9.146  -27.905 73.681 1.00 57.81  ? 118  THR E CG2   1 
ATOM   3686  N  N     . ILE E 1 119 ? -10.274 -26.243 70.659 1.00 47.04  ? 119  ILE E N     1 
ATOM   3687  C  CA    . ILE E 1 119 ? -10.882 -26.899 69.490 1.00 50.04  ? 119  ILE E CA    1 
ATOM   3688  C  C     . ILE E 1 119 ? -10.920 -28.438 69.609 1.00 49.43  ? 119  ILE E C     1 
ATOM   3689  O  O     . ILE E 1 119 ? -9.988  -29.065 70.078 1.00 48.45  ? 119  ILE E O     1 
ATOM   3690  C  CB    . ILE E 1 119 ? -10.238 -26.462 68.157 1.00 46.46  ? 119  ILE E CB    1 
ATOM   3691  C  CG1   . ILE E 1 119 ? -8.758  -26.792 68.089 1.00 46.37  ? 119  ILE E CG1   1 
ATOM   3692  C  CG2   . ILE E 1 119 ? -10.369 -24.971 68.023 1.00 51.10  ? 119  ILE E CG2   1 
ATOM   3693  C  CD1   . ILE E 1 119 ? -8.248  -26.837 66.681 1.00 48.56  ? 119  ILE E CD1   1 
ATOM   3694  N  N     . MET E 1 120 ? -12.021 -29.039 69.183 1.00 52.00  ? 120  MET E N     1 
ATOM   3695  C  CA    . MET E 1 120 ? -12.172 -30.494 69.230 1.00 52.10  ? 120  MET E CA    1 
ATOM   3696  C  C     . MET E 1 120 ? -12.728 -30.976 67.887 1.00 48.71  ? 120  MET E C     1 
ATOM   3697  O  O     . MET E 1 120 ? -13.206 -30.177 67.074 1.00 51.01  ? 120  MET E O     1 
ATOM   3698  C  CB    . MET E 1 120 ? -13.116 -30.873 70.369 1.00 53.72  ? 120  MET E CB    1 
ATOM   3699  C  CG    . MET E 1 120 ? -12.874 -30.131 71.663 1.00 59.03  ? 120  MET E CG    1 
ATOM   3700  S  SD    . MET E 1 120 ? -13.766 -30.749 73.124 1.00 67.39  ? 120  MET E SD    1 
ATOM   3701  C  CE    . MET E 1 120 ? -15.457 -30.782 72.601 1.00 83.49  ? 120  MET E CE    1 
ATOM   3702  N  N     . PRO E 1 121 ? -12.699 -32.280 67.644 1.00 50.81  ? 121  PRO E N     1 
ATOM   3703  C  CA    . PRO E 1 121 ? -13.138 -32.721 66.337 1.00 54.16  ? 121  PRO E CA    1 
ATOM   3704  C  C     . PRO E 1 121 ? -14.586 -32.350 66.031 1.00 55.23  ? 121  PRO E C     1 
ATOM   3705  O  O     . PRO E 1 121 ? -14.937 -32.061 64.868 1.00 53.60  ? 121  PRO E O     1 
ATOM   3706  C  CB    . PRO E 1 121 ? -12.923 -34.227 66.407 1.00 51.41  ? 121  PRO E CB    1 
ATOM   3707  C  CG    . PRO E 1 121 ? -11.709 -34.362 67.257 1.00 52.26  ? 121  PRO E CG    1 
ATOM   3708  C  CD    . PRO E 1 121 ? -12.090 -33.402 68.374 1.00 57.62  ? 121  PRO E CD    1 
ATOM   3709  N  N     . LYS E 1 122 ? -15.410 -32.292 67.064 1.00 51.37  ? 122  LYS E N     1 
ATOM   3710  C  CA    . LYS E 1 122 ? -16.772 -31.894 66.828 1.00 49.31  ? 122  LYS E CA    1 
ATOM   3711  C  C     . LYS E 1 122 ? -16.832 -30.479 66.239 1.00 49.19  ? 122  LYS E C     1 
ATOM   3712  O  O     . LYS E 1 122 ? -17.708 -30.184 65.429 1.00 47.83  ? 122  LYS E O     1 
ATOM   3713  C  CB    . LYS E 1 122 ? -17.638 -32.062 68.086 1.00 49.32  ? 122  LYS E CB    1 
ATOM   3714  C  CG    . LYS E 1 122 ? -17.395 -31.074 69.194 1.00 54.49  ? 122  LYS E CG    1 
ATOM   3715  C  CD    . LYS E 1 122 ? -17.725 -31.647 70.566 1.00 57.51  ? 122  LYS E CD    1 
ATOM   3716  C  CE    . LYS E 1 122 ? -19.166 -31.463 70.956 1.00 70.34  ? 122  LYS E CE    1 
ATOM   3717  N  NZ    . LYS E 1 122 ? -19.529 -32.439 72.032 1.00 83.38  ? 122  LYS E NZ    1 
ATOM   3718  N  N     . ASP E 1 123 ? -15.891 -29.622 66.595 1.00 47.39  ? 123  ASP E N     1 
ATOM   3719  C  CA    . ASP E 1 123 ? -15.888 -28.275 66.032 1.00 49.30  ? 123  ASP E CA    1 
ATOM   3720  C  C     . ASP E 1 123 ? -15.540 -28.319 64.555 1.00 50.22  ? 123  ASP E C     1 
ATOM   3721  O  O     . ASP E 1 123 ? -16.173 -27.693 63.733 1.00 50.93  ? 123  ASP E O     1 
ATOM   3722  C  CB    . ASP E 1 123 ? -14.907 -27.358 66.749 1.00 48.62  ? 123  ASP E CB    1 
ATOM   3723  C  CG    . ASP E 1 123 ? -15.212 -27.220 68.225 1.00 51.61  ? 123  ASP E CG    1 
ATOM   3724  O  OD1   . ASP E 1 123 ? -16.377 -27.028 68.562 1.00 56.12  ? 123  ASP E OD1   1 
ATOM   3725  O  OD2   . ASP E 1 123 ? -14.299 -27.322 69.064 1.00 51.66  ? 123  ASP E OD2   1 
ATOM   3726  N  N     . ILE E 1 124 ? -14.547 -29.103 64.200 1.00 52.97  ? 124  ILE E N     1 
ATOM   3727  C  CA    . ILE E 1 124 ? -14.192 -29.220 62.797 1.00 49.15  ? 124  ILE E CA    1 
ATOM   3728  C  C     . ILE E 1 124 ? -15.376 -29.738 62.042 1.00 48.03  ? 124  ILE E C     1 
ATOM   3729  O  O     . ILE E 1 124 ? -15.766 -29.192 61.030 1.00 49.80  ? 124  ILE E O     1 
ATOM   3730  C  CB    . ILE E 1 124 ? -13.027 -30.177 62.611 1.00 49.83  ? 124  ILE E CB    1 
ATOM   3731  C  CG1   . ILE E 1 124 ? -11.777 -29.584 63.248 1.00 53.65  ? 124  ILE E CG1   1 
ATOM   3732  C  CG2   . ILE E 1 124 ? -12.736 -30.370 61.153 1.00 52.45  ? 124  ILE E CG2   1 
ATOM   3733  C  CD1   . ILE E 1 124 ? -10.528 -30.398 62.960 1.00 55.12  ? 124  ILE E CD1   1 
ATOM   3734  N  N     . GLN E 1 125 ? -15.965 -30.801 62.552 1.00 53.52  ? 125  GLN E N     1 
ATOM   3735  C  CA    . GLN E 1 125 ? -17.142 -31.353 61.909 1.00 50.96  ? 125  GLN E CA    1 
ATOM   3736  C  C     . GLN E 1 125 ? -18.290 -30.348 61.763 1.00 49.11  ? 125  GLN E C     1 
ATOM   3737  O  O     . GLN E 1 125 ? -18.967 -30.337 60.768 1.00 53.52  ? 125  GLN E O     1 
ATOM   3738  C  CB    . GLN E 1 125 ? -17.596 -32.577 62.655 1.00 51.23  ? 125  GLN E CB    1 
ATOM   3739  C  CG    . GLN E 1 125 ? -16.656 -33.743 62.416 1.00 54.72  ? 125  GLN E CG    1 
ATOM   3740  C  CD    . GLN E 1 125 ? -16.551 -34.723 63.598 1.00 62.50  ? 125  GLN E CD    1 
ATOM   3741  O  OE1   . GLN E 1 125 ? -17.461 -34.865 64.444 1.00 58.61  ? 125  GLN E OE1   1 
ATOM   3742  N  NE2   . GLN E 1 125 ? -15.412 -35.409 63.662 1.00 68.28  ? 125  GLN E NE2   1 
ATOM   3743  N  N     . LEU E 1 126 ? -18.531 -29.494 62.732 1.00 49.55  ? 126  LEU E N     1 
ATOM   3744  C  CA    . LEU E 1 126 ? -19.681 -28.616 62.598 1.00 45.46  ? 126  LEU E CA    1 
ATOM   3745  C  C     . LEU E 1 126 ? -19.332 -27.645 61.499 1.00 46.52  ? 126  LEU E C     1 
ATOM   3746  O  O     . LEU E 1 126 ? -20.165 -27.345 60.673 1.00 45.56  ? 126  LEU E O     1 
ATOM   3747  C  CB    . LEU E 1 126 ? -19.995 -27.894 63.913 1.00 44.25  ? 126  LEU E CB    1 
ATOM   3748  C  CG    . LEU E 1 126 ? -21.106 -26.891 63.820 1.00 46.04  ? 126  LEU E CG    1 
ATOM   3749  C  CD1   . LEU E 1 126 ? -22.346 -27.574 63.379 1.00 49.41  ? 126  LEU E CD1   1 
ATOM   3750  C  CD2   . LEU E 1 126 ? -21.380 -26.246 65.166 1.00 51.60  ? 126  LEU E CD2   1 
ATOM   3751  N  N     . ALA E 1 127 ? -18.080 -27.179 61.479 1.00 47.59  ? 127  ALA E N     1 
ATOM   3752  C  CA    . ALA E 1 127 ? -17.618 -26.224 60.451 1.00 47.92  ? 127  ALA E CA    1 
ATOM   3753  C  C     . ALA E 1 127 ? -17.806 -26.763 59.057 1.00 49.37  ? 127  ALA E C     1 
ATOM   3754  O  O     . ALA E 1 127 ? -18.307 -26.077 58.169 1.00 49.72  ? 127  ALA E O     1 
ATOM   3755  C  CB    . ALA E 1 127 ? -16.162 -25.878 60.652 1.00 47.14  ? 127  ALA E CB    1 
ATOM   3756  N  N     . ARG E 1 128 ? -17.397 -28.007 58.868 1.00 50.42  ? 128  ARG E N     1 
ATOM   3757  C  CA    . ARG E 1 128 ? -17.468 -28.599 57.563 1.00 46.31  ? 128  ARG E CA    1 
ATOM   3758  C  C     . ARG E 1 128 ? -18.905 -28.886 57.163 1.00 48.25  ? 128  ARG E C     1 
ATOM   3759  O  O     . ARG E 1 128 ? -19.207 -28.840 55.988 1.00 53.93  ? 128  ARG E O     1 
ATOM   3760  C  CB    . ARG E 1 128 ? -16.635 -29.837 57.529 1.00 44.04  ? 128  ARG E CB    1 
ATOM   3761  C  CG    . ARG E 1 128 ? -15.172 -29.580 57.833 1.00 46.39  ? 128  ARG E CG    1 
ATOM   3762  C  CD    . ARG E 1 128 ? -14.261 -30.363 56.908 1.00 51.10  ? 128  ARG E CD    1 
ATOM   3763  N  NE    . ARG E 1 128 ? -14.686 -31.752 56.848 1.00 57.82  ? 128  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E 1 128 ? -14.711 -32.504 55.765 1.00 60.88  ? 128  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E 1 128 ? -14.299 -32.048 54.580 1.00 67.74  ? 128  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E 1 128 ? -15.139 -33.744 55.892 1.00 75.14  ? 128  ARG E NH2   1 
ATOM   3767  N  N     . ARG E 1 129 ? -19.800 -29.172 58.111 1.00 48.62  ? 129  ARG E N     1 
ATOM   3768  C  CA    . ARG E 1 129 ? -21.186 -29.432 57.730 1.00 52.60  ? 129  ARG E CA    1 
ATOM   3769  C  C     . ARG E 1 129 ? -21.772 -28.128 57.257 1.00 50.09  ? 129  ARG E C     1 
ATOM   3770  O  O     . ARG E 1 129 ? -22.265 -28.030 56.168 1.00 51.24  ? 129  ARG E O     1 
ATOM   3771  C  CB    . ARG E 1 129 ? -22.045 -30.001 58.861 1.00 53.38  ? 129  ARG E CB    1 
ATOM   3772  C  CG    . ARG E 1 129 ? -23.522 -30.217 58.468 1.00 62.33  ? 129  ARG E CG    1 
ATOM   3773  C  CD    . ARG E 1 129 ? -24.096 -31.405 59.235 1.00 73.81  ? 129  ARG E CD    1 
ATOM   3774  N  NE    . ARG E 1 129 ? -25.516 -31.729 58.985 1.00 90.35  ? 129  ARG E NE    1 
ATOM   3775  C  CZ    . ARG E 1 129 ? -26.275 -32.541 59.759 1.00 96.06  ? 129  ARG E CZ    1 
ATOM   3776  N  NH1   . ARG E 1 129 ? -25.792 -33.127 60.861 1.00 85.40  ? 129  ARG E NH1   1 
ATOM   3777  N  NH2   . ARG E 1 129 ? -27.558 -32.750 59.451 1.00 102.30 ? 129  ARG E NH2   1 
ATOM   3778  N  N     . ILE E 1 130 ? -21.651 -27.108 58.069 1.00 50.57  ? 130  ILE E N     1 
ATOM   3779  C  CA    . ILE E 1 130 ? -22.188 -25.836 57.714 1.00 51.51  ? 130  ILE E CA    1 
ATOM   3780  C  C     . ILE E 1 130 ? -21.587 -25.319 56.443 1.00 49.44  ? 130  ILE E C     1 
ATOM   3781  O  O     . ILE E 1 130 ? -22.316 -24.832 55.594 1.00 58.52  ? 130  ILE E O     1 
ATOM   3782  C  CB    . ILE E 1 130 ? -22.015 -24.829 58.818 1.00 56.60  ? 130  ILE E CB    1 
ATOM   3783  C  CG1   . ILE E 1 130 ? -22.858 -25.276 60.020 1.00 66.48  ? 130  ILE E CG1   1 
ATOM   3784  C  CG2   . ILE E 1 130 ? -22.480 -23.469 58.343 1.00 56.72  ? 130  ILE E CG2   1 
ATOM   3785  C  CD1   . ILE E 1 130 ? -22.420 -24.636 61.316 1.00 72.28  ? 130  ILE E CD1   1 
ATOM   3786  N  N     . ARG E 1 131 ? -20.285 -25.452 56.267 1.00 54.38  ? 131  ARG E N     1 
ATOM   3787  C  CA    . ARG E 1 131 ? -19.635 -25.039 54.979 1.00 58.52  ? 131  ARG E CA    1 
ATOM   3788  C  C     . ARG E 1 131 ? -20.182 -25.764 53.711 1.00 56.97  ? 131  ARG E C     1 
ATOM   3789  O  O     . ARG E 1 131 ? -19.825 -25.414 52.604 1.00 63.26  ? 131  ARG E O     1 
ATOM   3790  C  CB    . ARG E 1 131 ? -18.133 -25.309 55.039 1.00 51.29  ? 131  ARG E CB    1 
ATOM   3791  C  CG    . ARG E 1 131 ? -17.317 -24.255 55.726 1.00 49.87  ? 131  ARG E CG    1 
ATOM   3792  C  CD    . ARG E 1 131 ? -15.890 -24.804 55.822 1.00 48.41  ? 131  ARG E CD    1 
ATOM   3793  N  NE    . ARG E 1 131 ? -14.846 -23.813 56.117 1.00 44.91  ? 131  ARG E NE    1 
ATOM   3794  C  CZ    . ARG E 1 131 ? -13.613 -23.912 55.619 1.00 53.31  ? 131  ARG E CZ    1 
ATOM   3795  N  NH1   . ARG E 1 131 ? -13.303 -24.933 54.829 1.00 53.67  ? 131  ARG E NH1   1 
ATOM   3796  N  NH2   . ARG E 1 131 ? -12.657 -23.020 55.886 1.00 55.97  ? 131  ARG E NH2   1 
ATOM   3797  N  N     . GLY E 1 132 ? -20.990 -26.797 53.880 1.00 51.29  ? 132  GLY E N     1 
ATOM   3798  C  CA    . GLY E 1 132 ? -21.429 -27.586 52.756 1.00 54.68  ? 132  GLY E CA    1 
ATOM   3799  C  C     . GLY E 1 132 ? -20.415 -28.567 52.256 1.00 58.49  ? 132  GLY E C     1 
ATOM   3800  O  O     . GLY E 1 132 ? -20.532 -29.047 51.168 1.00 75.54  ? 132  GLY E O     1 
ATOM   3801  N  N     . GLU E 1 133 ? -19.418 -28.899 53.053 1.00 71.22  ? 133  GLU E N     1 
ATOM   3802  C  CA    . GLU E 1 133 ? -18.477 -29.967 52.697 1.00 71.29  ? 133  GLU E CA    1 
ATOM   3803  C  C     . GLU E 1 133 ? -19.092 -31.321 53.035 1.00 82.31  ? 133  GLU E C     1 
ATOM   3804  O  O     . GLU E 1 133 ? -18.544 -32.367 52.707 1.00 94.25  ? 133  GLU E O     1 
ATOM   3805  C  CB    . GLU E 1 133 ? -17.108 -29.727 53.374 1.00 65.51  ? 133  GLU E CB    1 
ATOM   3806  C  CG    . GLU E 1 133 ? -16.347 -28.592 52.682 1.00 65.36  ? 133  GLU E CG    1 
ATOM   3807  C  CD    . GLU E 1 133 ? -15.117 -28.039 53.408 1.00 69.62  ? 133  GLU E CD    1 
ATOM   3808  O  OE1   . GLU E 1 133 ? -14.303 -28.837 53.975 1.00 65.40  ? 133  GLU E OE1   1 
ATOM   3809  O  OE2   . GLU E 1 133 ? -14.951 -26.784 53.358 1.00 63.59  ? 133  GLU E OE2   1 
ATOM   3810  N  N     . ARG E 1 134 ? -20.244 -31.293 53.697 1.00 103.92 ? 134  ARG E N     1 
ATOM   3811  C  CA    . ARG E 1 134 ? -21.145 -32.447 53.742 1.00 114.83 ? 134  ARG E CA    1 
ATOM   3812  C  C     . ARG E 1 134 ? -22.630 -32.045 53.695 1.00 105.97 ? 134  ARG E C     1 
ATOM   3813  O  O     . ARG E 1 134 ? -23.046 -31.036 54.270 1.00 83.09  ? 134  ARG E O     1 
ATOM   3814  C  CB    . ARG E 1 134 ? -20.873 -33.269 54.989 1.00 122.61 ? 134  ARG E CB    1 
ATOM   3815  C  CG    . ARG E 1 134 ? -19.601 -34.107 54.911 1.00 129.61 ? 134  ARG E CG    1 
ATOM   3816  C  CD    . ARG E 1 134 ? -19.195 -34.515 56.303 1.00 131.16 ? 134  ARG E CD    1 
ATOM   3817  N  NE    . ARG E 1 134 ? -19.227 -33.326 57.147 1.00 131.62 ? 134  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E 1 134 ? -19.349 -33.328 58.471 1.00 124.84 ? 134  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E 1 134 ? -19.428 -34.465 59.164 1.00 119.44 ? 134  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E 1 134 ? -19.375 -32.168 59.108 1.00 116.07 ? 134  ARG E NH2   1 
ATOM   3821  N  N     . LYS F 2 16  ? 14.254  -47.510 33.938 1.00 158.63 ? 16   LYS F N     1 
ATOM   3822  C  CA    . LYS F 2 16  ? 14.413  -47.324 35.415 1.00 166.63 ? 16   LYS F CA    1 
ATOM   3823  C  C     . LYS F 2 16  ? 14.467  -48.672 36.132 1.00 166.09 ? 16   LYS F C     1 
ATOM   3824  O  O     . LYS F 2 16  ? 13.731  -49.603 35.780 1.00 165.84 ? 16   LYS F O     1 
ATOM   3825  C  CB    . LYS F 2 16  ? 13.284  -46.451 36.000 1.00 167.57 ? 16   LYS F CB    1 
ATOM   3826  C  CG    . LYS F 2 16  ? 11.876  -47.011 35.819 1.00 167.69 ? 16   LYS F CG    1 
ATOM   3827  C  CD    . LYS F 2 16  ? 10.879  -46.359 36.758 1.00 163.59 ? 16   LYS F CD    1 
ATOM   3828  C  CE    . LYS F 2 16  ? 9.555   -47.103 36.742 1.00 158.76 ? 16   LYS F CE    1 
ATOM   3829  N  NZ    . LYS F 2 16  ? 8.472   -46.308 37.382 1.00 155.05 ? 16   LYS F NZ    1 
ATOM   3830  N  N     . ARG F 2 17  ? 15.358  -48.774 37.117 1.00 163.97 ? 17   ARG F N     1 
ATOM   3831  C  CA    . ARG F 2 17  ? 15.420  -49.942 37.985 1.00 155.83 ? 17   ARG F CA    1 
ATOM   3832  C  C     . ARG F 2 17  ? 14.928  -49.630 39.400 1.00 159.55 ? 17   ARG F C     1 
ATOM   3833  O  O     . ARG F 2 17  ? 15.542  -48.839 40.122 1.00 166.14 ? 17   ARG F O     1 
ATOM   3834  C  CB    . ARG F 2 17  ? 16.832  -50.526 38.027 1.00 148.28 ? 17   ARG F CB    1 
ATOM   3835  C  CG    . ARG F 2 17  ? 16.948  -51.848 37.290 1.00 154.51 ? 17   ARG F CG    1 
ATOM   3836  C  CD    . ARG F 2 17  ? 17.918  -52.785 37.985 1.00 156.85 ? 17   ARG F CD    1 
ATOM   3837  N  NE    . ARG F 2 17  ? 18.460  -53.757 37.048 1.00 156.54 ? 17   ARG F NE    1 
ATOM   3838  C  CZ    . ARG F 2 17  ? 19.500  -54.546 37.294 1.00 149.97 ? 17   ARG F CZ    1 
ATOM   3839  N  NH1   . ARG F 2 17  ? 20.128  -54.497 38.464 1.00 145.78 ? 17   ARG F NH1   1 
ATOM   3840  N  NH2   . ARG F 2 17  ? 19.916  -55.390 36.354 1.00 146.15 ? 17   ARG F NH2   1 
ATOM   3841  N  N     . HIS F 2 18  ? 13.808  -50.266 39.764 1.00 156.05 ? 18   HIS F N     1 
ATOM   3842  C  CA    . HIS F 2 18  ? 13.224  -50.251 41.116 1.00 149.95 ? 18   HIS F CA    1 
ATOM   3843  C  C     . HIS F 2 18  ? 12.554  -48.923 41.360 1.00 133.40 ? 18   HIS F C     1 
ATOM   3844  O  O     . HIS F 2 18  ? 12.893  -47.927 40.724 1.00 133.94 ? 18   HIS F O     1 
ATOM   3845  C  CB    . HIS F 2 18  ? 14.260  -50.602 42.203 1.00 161.54 ? 18   HIS F CB    1 
ATOM   3846  C  CG    . HIS F 2 18  ? 15.133  -51.769 41.839 1.00 174.70 ? 18   HIS F CG    1 
ATOM   3847  N  ND1   . HIS F 2 18  ? 14.683  -53.075 41.853 1.00 180.49 ? 18   HIS F ND1   1 
ATOM   3848  C  CD2   . HIS F 2 18  ? 16.418  -51.821 41.410 1.00 174.58 ? 18   HIS F CD2   1 
ATOM   3849  C  CE1   . HIS F 2 18  ? 15.657  -53.880 41.463 1.00 173.93 ? 18   HIS F CE1   1 
ATOM   3850  N  NE2   . HIS F 2 18  ? 16.719  -53.144 41.187 1.00 173.74 ? 18   HIS F NE2   1 
ATOM   3851  N  N     . ARG F 2 19  ? 11.573  -48.920 42.255 1.00 125.14 ? 19   ARG F N     1 
ATOM   3852  C  CA    . ARG F 2 19  ? 10.717  -47.753 42.431 1.00 119.67 ? 19   ARG F CA    1 
ATOM   3853  C  C     . ARG F 2 19  ? 10.109  -47.759 43.834 1.00 110.28 ? 19   ARG F C     1 
ATOM   3854  O  O     . ARG F 2 19  ? 9.053   -48.341 44.057 1.00 114.43 ? 19   ARG F O     1 
ATOM   3855  C  CB    . ARG F 2 19  ? 9.637   -47.725 41.327 1.00 122.16 ? 19   ARG F CB    1 
ATOM   3856  C  CG    . ARG F 2 19  ? 9.196   -46.331 40.883 1.00 136.59 ? 19   ARG F CG    1 
ATOM   3857  C  CD    . ARG F 2 19  ? 8.185   -45.702 41.835 1.00 144.58 ? 19   ARG F CD    1 
ATOM   3858  N  NE    . ARG F 2 19  ? 8.448   -44.278 42.102 1.00 151.18 ? 19   ARG F NE    1 
ATOM   3859  C  CZ    . ARG F 2 19  ? 7.983   -43.601 43.159 1.00 156.24 ? 19   ARG F CZ    1 
ATOM   3860  N  NH1   . ARG F 2 19  ? 7.229   -44.205 44.078 1.00 156.80 ? 19   ARG F NH1   1 
ATOM   3861  N  NH2   . ARG F 2 19  ? 8.276   -42.309 43.312 1.00 146.04 ? 19   ARG F NH2   1 
ATOM   3862  N  N     . LYS F 2 20  ? 10.787  -47.097 44.768 1.00 103.23 ? 20   LYS F N     1 
ATOM   3863  C  CA    . LYS F 2 20  ? 10.404  -47.086 46.188 1.00 101.79 ? 20   LYS F CA    1 
ATOM   3864  C  C     . LYS F 2 20  ? 8.887   -46.997 46.520 1.00 87.94  ? 20   LYS F C     1 
ATOM   3865  O  O     . LYS F 2 20  ? 8.167   -46.194 45.946 1.00 96.23  ? 20   LYS F O     1 
ATOM   3866  C  CB    . LYS F 2 20  ? 11.133  -45.939 46.897 1.00 105.74 ? 20   LYS F CB    1 
ATOM   3867  C  CG    . LYS F 2 20  ? 10.944  -45.943 48.411 1.00 120.25 ? 20   LYS F CG    1 
ATOM   3868  C  CD    . LYS F 2 20  ? 11.235  -47.303 49.062 1.00 119.36 ? 20   LYS F CD    1 
ATOM   3869  C  CE    . LYS F 2 20  ? 10.835  -47.293 50.529 1.00 129.98 ? 20   LYS F CE    1 
ATOM   3870  N  NZ    . LYS F 2 20  ? 11.812  -48.024 51.380 1.00 142.96 ? 20   LYS F NZ    1 
ATOM   3871  N  N     . VAL F 2 21  ? 8.438   -47.809 47.474 1.00 71.41  ? 21   VAL F N     1 
ATOM   3872  C  CA    . VAL F 2 21  ? 7.031   -47.937 47.846 1.00 63.81  ? 21   VAL F CA    1 
ATOM   3873  C  C     . VAL F 2 21  ? 6.631   -46.848 48.810 1.00 64.57  ? 21   VAL F C     1 
ATOM   3874  O  O     . VAL F 2 21  ? 7.236   -46.729 49.870 1.00 73.31  ? 21   VAL F O     1 
ATOM   3875  C  CB    . VAL F 2 21  ? 6.768   -49.303 48.559 1.00 60.09  ? 21   VAL F CB    1 
ATOM   3876  C  CG1   . VAL F 2 21  ? 5.386   -49.402 49.160 1.00 58.08  ? 21   VAL F CG1   1 
ATOM   3877  C  CG2   . VAL F 2 21  ? 6.930   -50.433 47.587 1.00 68.23  ? 21   VAL F CG2   1 
ATOM   3878  N  N     . LEU F 2 22  ? 5.563   -46.121 48.469 1.00 59.45  ? 22   LEU F N     1 
ATOM   3879  C  CA    . LEU F 2 22  ? 5.058   -45.031 49.273 1.00 53.51  ? 22   LEU F CA    1 
ATOM   3880  C  C     . LEU F 2 22  ? 3.968   -45.542 50.159 1.00 55.68  ? 22   LEU F C     1 
ATOM   3881  O  O     . LEU F 2 22  ? 2.957   -46.024 49.665 1.00 57.86  ? 22   LEU F O     1 
ATOM   3882  C  CB    . LEU F 2 22  ? 4.483   -43.925 48.393 1.00 54.64  ? 22   LEU F CB    1 
ATOM   3883  C  CG    . LEU F 2 22  ? 5.502   -43.239 47.463 1.00 62.40  ? 22   LEU F CG    1 
ATOM   3884  C  CD1   . LEU F 2 22  ? 4.855   -42.430 46.343 1.00 67.66  ? 22   LEU F CD1   1 
ATOM   3885  C  CD2   . LEU F 2 22  ? 6.456   -42.362 48.233 1.00 67.61  ? 22   LEU F CD2   1 
ATOM   3886  N  N     . ARG F 2 23  ? 4.137   -45.406 51.473 1.00 57.64  ? 23   ARG F N     1 
ATOM   3887  C  CA    . ARG F 2 23  ? 3.044   -45.719 52.385 1.00 59.23  ? 23   ARG F CA    1 
ATOM   3888  C  C     . ARG F 2 23  ? 3.080   -44.909 53.656 1.00 58.00  ? 23   ARG F C     1 
ATOM   3889  O  O     . ARG F 2 23  ? 4.127   -44.572 54.123 1.00 61.78  ? 23   ARG F O     1 
ATOM   3890  C  CB    . ARG F 2 23  ? 3.042   -47.207 52.723 1.00 61.16  ? 23   ARG F CB    1 
ATOM   3891  C  CG    . ARG F 2 23  ? 4.411   -47.746 53.049 1.00 67.82  ? 23   ARG F CG    1 
ATOM   3892  C  CD    . ARG F 2 23  ? 4.438   -49.257 52.937 1.00 64.33  ? 23   ARG F CD    1 
ATOM   3893  N  NE    . ARG F 2 23  ? 4.114   -49.830 54.229 1.00 64.58  ? 23   ARG F NE    1 
ATOM   3894  C  CZ    . ARG F 2 23  ? 5.013   -50.219 55.137 1.00 60.77  ? 23   ARG F CZ    1 
ATOM   3895  N  NH1   . ARG F 2 23  ? 6.342   -50.122 54.916 1.00 49.33  ? 23   ARG F NH1   1 
ATOM   3896  N  NH2   . ARG F 2 23  ? 4.559   -50.726 56.279 1.00 60.75  ? 23   ARG F NH2   1 
ATOM   3897  N  N     . ASP F 2 24  ? 1.901   -44.585 54.184 1.00 66.98  ? 24   ASP F N     1 
ATOM   3898  C  CA    . ASP F 2 24  ? 1.746   -43.882 55.464 1.00 58.85  ? 24   ASP F CA    1 
ATOM   3899  C  C     . ASP F 2 24  ? 2.295   -42.446 55.532 1.00 59.24  ? 24   ASP F C     1 
ATOM   3900  O  O     . ASP F 2 24  ? 2.419   -41.858 56.610 1.00 51.82  ? 24   ASP F O     1 
ATOM   3901  C  CB    . ASP F 2 24  ? 2.372   -44.699 56.557 1.00 58.69  ? 24   ASP F CB    1 
ATOM   3902  C  CG    . ASP F 2 24  ? 1.743   -44.434 57.878 1.00 67.37  ? 24   ASP F CG    1 
ATOM   3903  O  OD1   . ASP F 2 24  ? 0.518   -44.212 57.884 1.00 72.09  ? 24   ASP F OD1   1 
ATOM   3904  O  OD2   . ASP F 2 24  ? 2.445   -44.461 58.911 1.00 70.81  ? 24   ASP F OD2   1 
ATOM   3905  N  N     . ASN F 2 25  ? 2.591   -41.870 54.378 1.00 56.94  ? 25   ASN F N     1 
ATOM   3906  C  CA    . ASN F 2 25  ? 3.067   -40.524 54.339 1.00 56.12  ? 25   ASN F CA    1 
ATOM   3907  C  C     . ASN F 2 25  ? 2.197   -39.452 55.008 1.00 57.33  ? 25   ASN F C     1 
ATOM   3908  O  O     . ASN F 2 25  ? 2.728   -38.439 55.416 1.00 63.64  ? 25   ASN F O     1 
ATOM   3909  C  CB    . ASN F 2 25  ? 3.313   -40.150 52.922 1.00 57.11  ? 25   ASN F CB    1 
ATOM   3910  C  CG    . ASN F 2 25  ? 4.513   -40.824 52.388 1.00 62.04  ? 25   ASN F CG    1 
ATOM   3911  O  OD1   . ASN F 2 25  ? 5.622   -40.514 52.810 1.00 74.20  ? 25   ASN F OD1   1 
ATOM   3912  N  ND2   . ASN F 2 25  ? 4.324   -41.763 51.480 1.00 65.79  ? 25   ASN F ND2   1 
ATOM   3913  N  N     . ILE F 2 26  ? 0.898   -39.679 55.142 1.00 59.38  ? 26   ILE F N     1 
ATOM   3914  C  CA    . ILE F 2 26  ? 0.032   -38.805 55.912 1.00 57.38  ? 26   ILE F CA    1 
ATOM   3915  C  C     . ILE F 2 26  ? 0.679   -38.464 57.238 1.00 57.67  ? 26   ILE F C     1 
ATOM   3916  O  O     . ILE F 2 26  ? 0.335   -37.465 57.856 1.00 61.73  ? 26   ILE F O     1 
ATOM   3917  C  CB    . ILE F 2 26  ? -1.326  -39.480 56.252 1.00 59.28  ? 26   ILE F CB    1 
ATOM   3918  C  CG1   . ILE F 2 26  ? -2.435  -38.486 56.608 1.00 63.13  ? 26   ILE F CG1   1 
ATOM   3919  C  CG2   . ILE F 2 26  ? -1.192  -40.369 57.464 1.00 59.02  ? 26   ILE F CG2   1 
ATOM   3920  C  CD1   . ILE F 2 26  ? -2.589  -37.326 55.645 1.00 69.60  ? 26   ILE F CD1   1 
ATOM   3921  N  N     . GLN F 2 27  ? 1.603   -39.282 57.706 1.00 53.98  ? 27   GLN F N     1 
ATOM   3922  C  CA    . GLN F 2 27  ? 2.150   -39.041 59.040 1.00 57.26  ? 27   GLN F CA    1 
ATOM   3923  C  C     . GLN F 2 27  ? 3.309   -38.085 59.030 1.00 57.80  ? 27   GLN F C     1 
ATOM   3924  O  O     . GLN F 2 27  ? 3.890   -37.790 60.087 1.00 60.74  ? 27   GLN F O     1 
ATOM   3925  C  CB    . GLN F 2 27  ? 2.564   -40.348 59.701 1.00 56.74  ? 27   GLN F CB    1 
ATOM   3926  C  CG    . GLN F 2 27  ? 1.376   -41.201 60.072 1.00 53.72  ? 27   GLN F CG    1 
ATOM   3927  C  CD    . GLN F 2 27  ? 0.640   -40.629 61.253 1.00 58.14  ? 27   GLN F CD    1 
ATOM   3928  O  OE1   . GLN F 2 27  ? 1.241   -39.966 62.089 1.00 69.42  ? 27   GLN F OE1   1 
ATOM   3929  N  NE2   . GLN F 2 27  ? -0.668  -40.878 61.339 1.00 59.29  ? 27   GLN F NE2   1 
ATOM   3930  N  N     . GLY F 2 28  ? 3.639   -37.587 57.845 1.00 56.57  ? 28   GLY F N     1 
ATOM   3931  C  CA    . GLY F 2 28  ? 4.628   -36.529 57.723 1.00 63.42  ? 28   GLY F CA    1 
ATOM   3932  C  C     . GLY F 2 28  ? 4.049   -35.175 58.051 1.00 63.38  ? 28   GLY F C     1 
ATOM   3933  O  O     . GLY F 2 28  ? 4.779   -34.205 58.162 1.00 73.55  ? 28   GLY F O     1 
ATOM   3934  N  N     . ILE F 2 29  ? 2.721   -35.127 58.132 1.00 58.17  ? 29   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2 29  ? 1.971   -33.973 58.562 1.00 51.50  ? 29   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2 29  ? 1.999   -34.101 60.068 1.00 51.62  ? 29   ILE F C     1 
ATOM   3937  O  O     . ILE F 2 29  ? 1.081   -34.650 60.734 1.00 51.34  ? 29   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2 29  ? 0.527   -34.065 58.063 1.00 53.82  ? 29   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2 29  ? 0.458   -34.295 56.562 1.00 54.67  ? 29   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2 29  ? -0.251  -32.839 58.417 1.00 54.57  ? 29   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2 29  ? 1.406   -33.449 55.801 1.00 60.00  ? 29   ILE F CD1   1 
ATOM   3942  N  N     . THR F 2 30  ? 3.086   -33.608 60.620 1.00 51.86  ? 30   THR F N     1 
ATOM   3943  C  CA    . THR F 2 30  ? 3.370   -33.838 62.033 1.00 55.29  ? 30   THR F CA    1 
ATOM   3944  C  C     . THR F 2 30  ? 2.508   -33.036 62.955 1.00 47.89  ? 30   THR F C     1 
ATOM   3945  O  O     . THR F 2 30  ? 1.969   -32.035 62.579 1.00 53.28  ? 30   THR F O     1 
ATOM   3946  C  CB    . THR F 2 30  ? 4.832   -33.536 62.340 1.00 54.14  ? 30   THR F CB    1 
ATOM   3947  O  OG1   . THR F 2 30  ? 5.115   -32.168 62.046 1.00 65.25  ? 30   THR F OG1   1 
ATOM   3948  C  CG2   . THR F 2 30  ? 5.709   -34.380 61.468 1.00 51.89  ? 30   THR F CG2   1 
ATOM   3949  N  N     . LYS F 2 31  ? 2.411   -33.484 64.184 1.00 52.69  ? 31   LYS F N     1 
ATOM   3950  C  CA    . LYS F 2 31  ? 1.750   -32.707 65.251 1.00 54.63  ? 31   LYS F CA    1 
ATOM   3951  C  C     . LYS F 2 31  ? 2.176   -31.233 65.308 1.00 54.46  ? 31   LYS F C     1 
ATOM   3952  O  O     . LYS F 2 31  ? 1.341   -30.361 65.256 1.00 60.52  ? 31   LYS F O     1 
ATOM   3953  C  CB    . LYS F 2 31  ? 2.018   -33.351 66.598 1.00 53.55  ? 31   LYS F CB    1 
ATOM   3954  C  CG    . LYS F 2 31  ? 1.097   -32.916 67.704 1.00 63.64  ? 31   LYS F CG    1 
ATOM   3955  C  CD    . LYS F 2 31  ? 1.669   -33.320 69.060 1.00 69.07  ? 31   LYS F CD    1 
ATOM   3956  C  CE    . LYS F 2 31  ? 1.050   -32.506 70.171 1.00 69.09  ? 31   LYS F CE    1 
ATOM   3957  N  NZ    . LYS F 2 31  ? 1.683   -32.879 71.461 1.00 82.85  ? 31   LYS F NZ    1 
ATOM   3958  N  N     . PRO F 2 32  ? 3.474   -30.952 65.399 1.00 53.77  ? 32   PRO F N     1 
ATOM   3959  C  CA    . PRO F 2 32  ? 3.886   -29.547 65.378 1.00 54.82  ? 32   PRO F CA    1 
ATOM   3960  C  C     . PRO F 2 32  ? 3.474   -28.761 64.141 1.00 56.67  ? 32   PRO F C     1 
ATOM   3961  O  O     . PRO F 2 32  ? 3.196   -27.584 64.268 1.00 61.35  ? 32   PRO F O     1 
ATOM   3962  C  CB    . PRO F 2 32  ? 5.416   -29.634 65.398 1.00 59.57  ? 32   PRO F CB    1 
ATOM   3963  C  CG    . PRO F 2 32  ? 5.695   -30.975 65.977 1.00 60.57  ? 32   PRO F CG    1 
ATOM   3964  C  CD    . PRO F 2 32  ? 4.630   -31.853 65.432 1.00 53.76  ? 32   PRO F CD    1 
ATOM   3965  N  N     . ALA F 2 33  ? 3.479   -29.370 62.952 1.00 54.50  ? 33   ALA F N     1 
ATOM   3966  C  CA    . ALA F 2 33  ? 3.147   -28.602 61.764 1.00 50.38  ? 33   ALA F CA    1 
ATOM   3967  C  C     . ALA F 2 33  ? 1.652   -28.241 61.821 1.00 55.76  ? 33   ALA F C     1 
ATOM   3968  O  O     . ALA F 2 33  ? 1.247   -27.152 61.416 1.00 54.14  ? 33   ALA F O     1 
ATOM   3969  C  CB    . ALA F 2 33  ? 3.480   -29.361 60.515 1.00 43.86  ? 33   ALA F CB    1 
ATOM   3970  N  N     . ILE F 2 34  ? 0.846   -29.144 62.368 1.00 53.50  ? 34   ILE F N     1 
ATOM   3971  C  CA    . ILE F 2 34  ? -0.588  -28.930 62.452 1.00 52.18  ? 34   ILE F CA    1 
ATOM   3972  C  C     . ILE F 2 34  ? -0.854  -27.893 63.498 1.00 52.72  ? 34   ILE F C     1 
ATOM   3973  O  O     . ILE F 2 34  ? -1.764  -27.118 63.395 1.00 64.55  ? 34   ILE F O     1 
ATOM   3974  C  CB    . ILE F 2 34  ? -1.325  -30.214 62.852 1.00 52.68  ? 34   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F 2 34  ? -1.226  -31.245 61.720 1.00 52.50  ? 34   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F 2 34  ? -2.792  -29.940 63.149 1.00 52.21  ? 34   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F 2 34  ? -1.720  -32.616 62.131 1.00 52.65  ? 34   ILE F CD1   1 
ATOM   3978  N  N     . ARG F 2 35  ? -0.038  -27.864 64.515 1.00 54.38  ? 35   ARG F N     1 
ATOM   3979  C  CA    . ARG F 2 35  ? -0.203  -26.874 65.543 1.00 51.77  ? 35   ARG F CA    1 
ATOM   3980  C  C     . ARG F 2 35  ? 0.157   -25.505 64.964 1.00 46.34  ? 35   ARG F C     1 
ATOM   3981  O  O     . ARG F 2 35  ? -0.579  -24.551 65.125 1.00 48.06  ? 35   ARG F O     1 
ATOM   3982  C  CB    . ARG F 2 35  ? 0.616   -27.299 66.743 1.00 55.12  ? 35   ARG F CB    1 
ATOM   3983  C  CG    . ARG F 2 35  ? 0.746   -26.276 67.838 1.00 74.02  ? 35   ARG F CG    1 
ATOM   3984  C  CD    . ARG F 2 35  ? 1.683   -26.845 68.876 1.00 79.72  ? 35   ARG F CD    1 
ATOM   3985  N  NE    . ARG F 2 35  ? 1.051   -28.083 69.252 1.00 70.59  ? 35   ARG F NE    1 
ATOM   3986  C  CZ    . ARG F 2 35  ? 0.396   -28.259 70.385 1.00 82.27  ? 35   ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F 2 35  ? 0.346   -27.330 71.333 1.00 73.50  ? 35   ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F 2 35  ? -0.168  -29.426 70.600 1.00 111.93 ? 35   ARG F NH2   1 
ATOM   3989  N  N     . ARG F 2 36  ? 1.220   -25.409 64.202 1.00 44.31  ? 36   ARG F N     1 
ATOM   3990  C  CA    . ARG F 2 36  ? 1.484   -24.144 63.565 1.00 49.98  ? 36   ARG F CA    1 
ATOM   3991  C  C     . ARG F 2 36  ? 0.269   -23.630 62.750 1.00 50.80  ? 36   ARG F C     1 
ATOM   3992  O  O     . ARG F 2 36  ? -0.133  -22.486 62.917 1.00 54.05  ? 36   ARG F O     1 
ATOM   3993  C  CB    . ARG F 2 36  ? 2.729   -24.218 62.694 1.00 54.24  ? 36   ARG F CB    1 
ATOM   3994  C  CG    . ARG F 2 36  ? 4.000   -24.400 63.490 1.00 54.18  ? 36   ARG F CG    1 
ATOM   3995  C  CD    . ARG F 2 36  ? 5.225   -24.205 62.618 1.00 56.69  ? 36   ARG F CD    1 
ATOM   3996  N  NE    . ARG F 2 36  ? 5.548   -25.282 61.666 1.00 56.48  ? 36   ARG F NE    1 
ATOM   3997  C  CZ    . ARG F 2 36  ? 6.230   -26.409 61.963 1.00 59.96  ? 36   ARG F CZ    1 
ATOM   3998  N  NH1   . ARG F 2 36  ? 6.622   -26.672 63.207 1.00 59.63  ? 36   ARG F NH1   1 
ATOM   3999  N  NH2   . ARG F 2 36  ? 6.509   -27.310 61.009 1.00 58.14  ? 36   ARG F NH2   1 
ATOM   4000  N  N     . LEU F 2 37  ? -0.336  -24.467 61.906 1.00 50.18  ? 37   LEU F N     1 
ATOM   4001  C  CA    . LEU F 2 37  ? -1.468  -24.010 61.081 1.00 47.27  ? 37   LEU F CA    1 
ATOM   4002  C  C     . LEU F 2 37  ? -2.640  -23.551 61.959 1.00 45.18  ? 37   LEU F C     1 
ATOM   4003  O  O     . LEU F 2 37  ? -3.244  -22.537 61.694 1.00 46.05  ? 37   LEU F O     1 
ATOM   4004  C  CB    . LEU F 2 37  ? -1.953  -25.081 60.132 1.00 43.89  ? 37   LEU F CB    1 
ATOM   4005  C  CG    . LEU F 2 37  ? -0.996  -25.565 59.083 1.00 46.35  ? 37   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F 2 37  ? -1.298  -27.006 58.733 1.00 49.49  ? 37   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F 2 37  ? -1.094  -24.724 57.846 1.00 49.49  ? 37   LEU F CD2   1 
ATOM   4008  N  N     . ALA F 2 38  ? -2.972  -24.286 62.996 1.00 41.32  ? 38   ALA F N     1 
ATOM   4009  C  CA    . ALA F 2 38  ? -3.945  -23.770 63.944 1.00 48.32  ? 38   ALA F CA    1 
ATOM   4010  C  C     . ALA F 2 38  ? -3.602  -22.361 64.462 1.00 49.05  ? 38   ALA F C     1 
ATOM   4011  O  O     . ALA F 2 38  ? -4.483  -21.509 64.638 1.00 43.63  ? 38   ALA F O     1 
ATOM   4012  C  CB    . ALA F 2 38  ? -4.065  -24.702 65.127 1.00 50.36  ? 38   ALA F CB    1 
ATOM   4013  N  N     . ARG F 2 39  ? -2.322  -22.137 64.733 1.00 50.99  ? 39   ARG F N     1 
ATOM   4014  C  CA    . ARG F 2 39  ? -1.871  -20.849 65.253 1.00 51.74  ? 39   ARG F CA    1 
ATOM   4015  C  C     . ARG F 2 39  ? -2.100  -19.740 64.243 1.00 49.49  ? 39   ARG F C     1 
ATOM   4016  O  O     . ARG F 2 39  ? -2.674  -18.704 64.544 1.00 49.77  ? 39   ARG F O     1 
ATOM   4017  C  CB    . ARG F 2 39  ? -0.387  -20.904 65.577 1.00 50.77  ? 39   ARG F CB    1 
ATOM   4018  C  CG    . ARG F 2 39  ? -0.088  -21.829 66.713 1.00 49.34  ? 39   ARG F CG    1 
ATOM   4019  C  CD    . ARG F 2 39  ? -0.662  -21.376 68.034 1.00 49.69  ? 39   ARG F CD    1 
ATOM   4020  N  NE    . ARG F 2 39  ? -0.046  -22.186 69.071 1.00 54.48  ? 39   ARG F NE    1 
ATOM   4021  C  CZ    . ARG F 2 39  ? -0.684  -22.973 69.918 1.00 53.60  ? 39   ARG F CZ    1 
ATOM   4022  N  NH1   . ARG F 2 39  ? -1.991  -23.021 69.982 1.00 58.69  ? 39   ARG F NH1   1 
ATOM   4023  N  NH2   . ARG F 2 39  ? 0.012   -23.676 70.755 1.00 57.48  ? 39   ARG F NH2   1 
ATOM   4024  N  N     . ARG F 2 40  ? -1.645  -19.963 63.032 1.00 44.81  ? 40   ARG F N     1 
ATOM   4025  C  CA    . ARG F 2 40  ? -1.923  -19.016 62.017 1.00 48.21  ? 40   ARG F CA    1 
ATOM   4026  C  C     . ARG F 2 40  ? -3.403  -18.794 61.990 1.00 46.10  ? 40   ARG F C     1 
ATOM   4027  O  O     . ARG F 2 40  ? -3.847  -17.712 61.670 1.00 52.79  ? 40   ARG F O     1 
ATOM   4028  C  CB    . ARG F 2 40  ? -1.446  -19.512 60.663 1.00 49.55  ? 40   ARG F CB    1 
ATOM   4029  C  CG    . ARG F 2 40  ? -1.600  -18.470 59.565 1.00 46.91  ? 40   ARG F CG    1 
ATOM   4030  C  CD    . ARG F 2 40  ? -0.568  -18.724 58.481 1.00 43.06  ? 40   ARG F CD    1 
ATOM   4031  N  NE    . ARG F 2 40  ? 0.760   -18.309 58.861 1.00 41.49  ? 40   ARG F NE    1 
ATOM   4032  C  CZ    . ARG F 2 40  ? 1.854   -18.590 58.157 1.00 50.35  ? 40   ARG F CZ    1 
ATOM   4033  N  NH1   . ARG F 2 40  ? 1.787   -19.366 57.075 1.00 49.49  ? 40   ARG F NH1   1 
ATOM   4034  N  NH2   . ARG F 2 40  ? 3.051   -18.121 58.553 1.00 51.28  ? 40   ARG F NH2   1 
ATOM   4035  N  N     . GLY F 2 41  ? -4.161  -19.826 62.328 1.00 43.98  ? 41   GLY F N     1 
ATOM   4036  C  CA    . GLY F 2 41  ? -5.629  -19.759 62.303 1.00 45.67  ? 41   GLY F CA    1 
ATOM   4037  C  C     . GLY F 2 41  ? -6.216  -19.235 63.591 1.00 46.27  ? 41   GLY F C     1 
ATOM   4038  O  O     . GLY F 2 41  ? -7.423  -19.221 63.783 1.00 44.09  ? 41   GLY F O     1 
ATOM   4039  N  N     . GLY F 2 42  ? -5.349  -18.836 64.505 1.00 48.24  ? 42   GLY F N     1 
ATOM   4040  C  CA    . GLY F 2 42  ? -5.782  -18.137 65.707 1.00 51.46  ? 42   GLY F CA    1 
ATOM   4041  C  C     . GLY F 2 42  ? -6.259  -19.016 66.832 1.00 52.18  ? 42   GLY F C     1 
ATOM   4042  O  O     . GLY F 2 42  ? -7.032  -18.582 67.676 1.00 55.95  ? 42   GLY F O     1 
ATOM   4043  N  N     . VAL F 2 43  ? -5.769  -20.240 66.852 1.00 51.30  ? 43   VAL F N     1 
ATOM   4044  C  CA    . VAL F 2 43  ? -6.218  -21.221 67.801 1.00 51.10  ? 43   VAL F CA    1 
ATOM   4045  C  C     . VAL F 2 43  ? -5.273  -21.245 68.975 1.00 47.89  ? 43   VAL F C     1 
ATOM   4046  O  O     . VAL F 2 43  ? -4.080  -21.349 68.795 1.00 46.78  ? 43   VAL F O     1 
ATOM   4047  C  CB    . VAL F 2 43  ? -6.259  -22.588 67.135 1.00 46.34  ? 43   VAL F CB    1 
ATOM   4048  C  CG1   . VAL F 2 43  ? -6.439  -23.677 68.159 1.00 49.36  ? 43   VAL F CG1   1 
ATOM   4049  C  CG2   . VAL F 2 43  ? -7.404  -22.591 66.162 1.00 49.95  ? 43   VAL F CG2   1 
ATOM   4050  N  N     . LYS F 2 44  ? -5.823  -21.190 70.180 1.00 55.96  ? 44   LYS F N     1 
ATOM   4051  C  CA    . LYS F 2 44  ? -5.012  -21.193 71.413 1.00 55.49  ? 44   LYS F CA    1 
ATOM   4052  C  C     . LYS F 2 44  ? -4.812  -22.541 72.025 1.00 51.50  ? 44   LYS F C     1 
ATOM   4053  O  O     . LYS F 2 44  ? -3.718  -22.817 72.492 1.00 63.93  ? 44   LYS F O     1 
ATOM   4054  C  CB    . LYS F 2 44  ? -5.647  -20.312 72.466 1.00 59.47  ? 44   LYS F CB    1 
ATOM   4055  C  CG    . LYS F 2 44  ? -4.699  -19.808 73.535 1.00 61.63  ? 44   LYS F CG    1 
ATOM   4056  C  CD    . LYS F 2 44  ? -5.484  -18.891 74.463 1.00 65.65  ? 44   LYS F CD    1 
ATOM   4057  C  CE    . LYS F 2 44  ? -4.700  -18.454 75.671 1.00 65.90  ? 44   LYS F CE    1 
ATOM   4058  N  NZ    . LYS F 2 44  ? -5.698  -18.243 76.762 1.00 75.63  ? 44   LYS F NZ    1 
ATOM   4059  N  N     . ARG F 2 45  ? -5.858  -23.361 72.058 1.00 49.35  ? 45   ARG F N     1 
ATOM   4060  C  CA    . ARG F 2 45  ? -5.798  -24.647 72.726 1.00 50.23  ? 45   ARG F CA    1 
ATOM   4061  C  C     . ARG F 2 45  ? -6.321  -25.778 71.823 1.00 50.77  ? 45   ARG F C     1 
ATOM   4062  O  O     . ARG F 2 45  ? -7.372  -25.653 71.221 1.00 48.38  ? 45   ARG F O     1 
ATOM   4063  C  CB    . ARG F 2 45  ? -6.589  -24.560 74.027 1.00 53.44  ? 45   ARG F CB    1 
ATOM   4064  C  CG    . ARG F 2 45  ? -6.109  -25.450 75.160 1.00 54.92  ? 45   ARG F CG    1 
ATOM   4065  C  CD    . ARG F 2 45  ? -6.795  -25.107 76.505 1.00 58.36  ? 45   ARG F CD    1 
ATOM   4066  N  NE    . ARG F 2 45  ? -6.366  -26.072 77.507 1.00 62.63  ? 45   ARG F NE    1 
ATOM   4067  C  CZ    . ARG F 2 45  ? -6.929  -27.268 77.703 1.00 69.75  ? 45   ARG F CZ    1 
ATOM   4068  N  NH1   . ARG F 2 45  ? -8.020  -27.616 77.037 1.00 65.04  ? 45   ARG F NH1   1 
ATOM   4069  N  NH2   . ARG F 2 45  ? -6.422  -28.122 78.602 1.00 74.19  ? 45   ARG F NH2   1 
ATOM   4070  N  N     . ILE F 2 46  ? -5.576  -26.885 71.763 1.00 52.53  ? 46   ILE F N     1 
ATOM   4071  C  CA    . ILE F 2 46  ? -5.848  -27.965 70.844 1.00 52.37  ? 46   ILE F CA    1 
ATOM   4072  C  C     . ILE F 2 46  ? -5.950  -29.322 71.547 1.00 56.99  ? 46   ILE F C     1 
ATOM   4073  O  O     . ILE F 2 46  ? -4.957  -29.866 72.070 1.00 63.76  ? 46   ILE F O     1 
ATOM   4074  C  CB    . ILE F 2 46  ? -4.731  -28.051 69.813 1.00 52.89  ? 46   ILE F CB    1 
ATOM   4075  C  CG1   . ILE F 2 46  ? -4.660  -26.777 69.010 1.00 52.99  ? 46   ILE F CG1   1 
ATOM   4076  C  CG2   . ILE F 2 46  ? -4.969  -29.224 68.881 1.00 56.21  ? 46   ILE F CG2   1 
ATOM   4077  C  CD1   . ILE F 2 46  ? -3.351  -26.621 68.291 1.00 56.58  ? 46   ILE F CD1   1 
ATOM   4078  N  N     . SER F 2 47  ? -7.153  -29.877 71.509 1.00 55.83  ? 47   SER F N     1 
ATOM   4079  C  CA    . SER F 2 47  ? -7.429  -31.220 71.995 1.00 54.98  ? 47   SER F CA    1 
ATOM   4080  C  C     . SER F 2 47  ? -6.610  -32.235 71.225 1.00 53.56  ? 47   SER F C     1 
ATOM   4081  O  O     . SER F 2 47  ? -6.350  -32.052 70.052 1.00 54.80  ? 47   SER F O     1 
ATOM   4082  C  CB    . SER F 2 47  ? -8.924  -31.533 71.841 1.00 58.65  ? 47   SER F CB    1 
ATOM   4083  O  OG    . SER F 2 47  ? -9.126  -32.848 71.366 1.00 66.32  ? 47   SER F OG    1 
ATOM   4084  N  N     . GLY F 2 48  ? -6.211  -33.315 71.882 1.00 52.92  ? 48   GLY F N     1 
ATOM   4085  C  CA    . GLY F 2 48  ? -5.269  -34.277 71.268 1.00 54.23  ? 48   GLY F CA    1 
ATOM   4086  C  C     . GLY F 2 48  ? -5.811  -35.031 70.067 1.00 55.93  ? 48   GLY F C     1 
ATOM   4087  O  O     . GLY F 2 48  ? -5.055  -35.546 69.219 1.00 58.64  ? 48   GLY F O     1 
ATOM   4088  N  N     . LEU F 2 49  ? -7.130  -35.095 69.984 1.00 51.32  ? 49   LEU F N     1 
ATOM   4089  C  CA    . LEU F 2 49  ? -7.767  -35.743 68.871 1.00 55.26  ? 49   LEU F CA    1 
ATOM   4090  C  C     . LEU F 2 49  ? -7.780  -34.911 67.551 1.00 57.55  ? 49   LEU F C     1 
ATOM   4091  O  O     . LEU F 2 49  ? -8.142  -35.416 66.479 1.00 54.12  ? 49   LEU F O     1 
ATOM   4092  C  CB    . LEU F 2 49  ? -9.183  -36.102 69.281 1.00 55.55  ? 49   LEU F CB    1 
ATOM   4093  C  CG    . LEU F 2 49  ? -9.240  -37.229 70.306 1.00 56.83  ? 49   LEU F CG    1 
ATOM   4094  C  CD1   . LEU F 2 49  ? -10.657 -37.278 70.866 1.00 64.35  ? 49   LEU F CD1   1 
ATOM   4095  C  CD2   . LEU F 2 49  ? -8.828  -38.568 69.694 1.00 55.25  ? 49   LEU F CD2   1 
ATOM   4096  N  N     . ILE F 2 50  ? -7.389  -33.647 67.623 1.00 50.46  ? 50   ILE F N     1 
ATOM   4097  C  CA    . ILE F 2 50  ? -7.445  -32.798 66.455 1.00 49.74  ? 50   ILE F CA    1 
ATOM   4098  C  C     . ILE F 2 50  ? -6.519  -33.333 65.352 1.00 51.69  ? 50   ILE F C     1 
ATOM   4099  O  O     . ILE F 2 50  ? -6.882  -33.360 64.163 1.00 54.62  ? 50   ILE F O     1 
ATOM   4100  C  CB    . ILE F 2 50  ? -7.117  -31.341 66.855 1.00 49.04  ? 50   ILE F CB    1 
ATOM   4101  C  CG1   . ILE F 2 50  ? -8.306  -30.669 67.541 1.00 52.42  ? 50   ILE F CG1   1 
ATOM   4102  C  CG2   . ILE F 2 50  ? -6.745  -30.500 65.679 1.00 48.43  ? 50   ILE F CG2   1 
ATOM   4103  C  CD1   . ILE F 2 50  ? -9.479  -30.352 66.647 1.00 54.26  ? 50   ILE F CD1   1 
ATOM   4104  N  N     . TYR F 2 51  ? -5.332  -33.784 65.735 1.00 48.50  ? 51   TYR F N     1 
ATOM   4105  C  CA    . TYR F 2 51  ? -4.329  -34.146 64.717 1.00 47.61  ? 51   TYR F CA    1 
ATOM   4106  C  C     . TYR F 2 51  ? -4.777  -35.257 63.809 1.00 49.01  ? 51   TYR F C     1 
ATOM   4107  O  O     . TYR F 2 51  ? -4.563  -35.150 62.614 1.00 55.23  ? 51   TYR F O     1 
ATOM   4108  C  CB    . TYR F 2 51  ? -2.986  -34.450 65.325 1.00 43.80  ? 51   TYR F CB    1 
ATOM   4109  C  CG    . TYR F 2 51  ? -2.642  -33.435 66.370 1.00 45.29  ? 51   TYR F CG    1 
ATOM   4110  C  CD1   . TYR F 2 51  ? -2.832  -33.700 67.721 1.00 52.21  ? 51   TYR F CD1   1 
ATOM   4111  C  CD2   . TYR F 2 51  ? -2.149  -32.204 66.013 1.00 50.12  ? 51   TYR F CD2   1 
ATOM   4112  C  CE1   . TYR F 2 51  ? -2.529  -32.760 68.686 1.00 57.79  ? 51   TYR F CE1   1 
ATOM   4113  C  CE2   . TYR F 2 51  ? -1.836  -31.252 66.971 1.00 53.21  ? 51   TYR F CE2   1 
ATOM   4114  C  CZ    . TYR F 2 51  ? -2.034  -31.547 68.293 1.00 55.33  ? 51   TYR F CZ    1 
ATOM   4115  O  OH    . TYR F 2 51  ? -1.755  -30.645 69.245 1.00 68.70  ? 51   TYR F OH    1 
ATOM   4116  N  N     . GLU F 2 52  ? -5.423  -36.302 64.328 1.00 53.16  ? 52   GLU F N     1 
ATOM   4117  C  CA    . GLU F 2 52  ? -5.881  -37.345 63.398 1.00 57.93  ? 52   GLU F CA    1 
ATOM   4118  C  C     . GLU F 2 52  ? -6.971  -36.787 62.508 1.00 51.04  ? 52   GLU F C     1 
ATOM   4119  O  O     . GLU F 2 52  ? -6.971  -37.012 61.310 1.00 47.71  ? 52   GLU F O     1 
ATOM   4120  C  CB    . GLU F 2 52  ? -6.335  -38.638 64.090 1.00 58.62  ? 52   GLU F CB    1 
ATOM   4121  C  CG    . GLU F 2 52  ? -5.205  -39.645 64.277 1.00 69.78  ? 52   GLU F CG    1 
ATOM   4122  C  CD    . GLU F 2 52  ? -4.346  -39.868 63.013 1.00 80.91  ? 52   GLU F CD    1 
ATOM   4123  O  OE1   . GLU F 2 52  ? -4.917  -40.166 61.924 1.00 87.54  ? 52   GLU F OE1   1 
ATOM   4124  O  OE2   . GLU F 2 52  ? -3.091  -39.746 63.106 1.00 71.99  ? 52   GLU F OE2   1 
ATOM   4125  N  N     . GLU F 2 53  ? -7.863  -36.016 63.102 1.00 47.54  ? 53   GLU F N     1 
ATOM   4126  C  CA    . GLU F 2 53  ? -8.997  -35.496 62.378 1.00 47.37  ? 53   GLU F CA    1 
ATOM   4127  C  C     . GLU F 2 53  ? -8.499  -34.628 61.258 1.00 50.66  ? 53   GLU F C     1 
ATOM   4128  O  O     . GLU F 2 53  ? -9.003  -34.717 60.139 1.00 52.72  ? 53   GLU F O     1 
ATOM   4129  C  CB    . GLU F 2 53  ? -9.872  -34.679 63.294 1.00 46.35  ? 53   GLU F CB    1 
ATOM   4130  C  CG    . GLU F 2 53  ? -11.200 -34.331 62.680 1.00 54.37  ? 53   GLU F CG    1 
ATOM   4131  C  CD    . GLU F 2 53  ? -12.257 -35.411 62.821 1.00 58.64  ? 53   GLU F CD    1 
ATOM   4132  O  OE1   . GLU F 2 53  ? -12.047 -36.419 63.534 1.00 62.52  ? 53   GLU F OE1   1 
ATOM   4133  O  OE2   . GLU F 2 53  ? -13.334 -35.230 62.215 1.00 60.14  ? 53   GLU F OE2   1 
ATOM   4134  N  N     . THR F 2 54  ? -7.487  -33.814 61.552 1.00 50.36  ? 54   THR F N     1 
ATOM   4135  C  CA    . THR F 2 54  ? -6.947  -32.922 60.557 1.00 48.63  ? 54   THR F CA    1 
ATOM   4136  C  C     . THR F 2 54  ? -6.288  -33.681 59.433 1.00 48.98  ? 54   THR F C     1 
ATOM   4137  O  O     . THR F 2 54  ? -6.444  -33.345 58.270 1.00 53.84  ? 54   THR F O     1 
ATOM   4138  C  CB    . THR F 2 54  ? -5.929  -31.947 61.140 1.00 51.13  ? 54   THR F CB    1 
ATOM   4139  O  OG1   . THR F 2 54  ? -6.509  -31.222 62.233 1.00 45.97  ? 54   THR F OG1   1 
ATOM   4140  C  CG2   . THR F 2 54  ? -5.544  -30.955 60.064 1.00 52.39  ? 54   THR F CG2   1 
ATOM   4141  N  N     . ARG F 2 55  ? -5.552  -34.716 59.769 1.00 47.30  ? 55   ARG F N     1 
ATOM   4142  C  CA    . ARG F 2 55  ? -4.967  -35.540 58.733 1.00 48.34  ? 55   ARG F CA    1 
ATOM   4143  C  C     . ARG F 2 55  ? -6.057  -36.074 57.787 1.00 49.61  ? 55   ARG F C     1 
ATOM   4144  O  O     . ARG F 2 55  ? -5.901  -36.088 56.584 1.00 51.99  ? 55   ARG F O     1 
ATOM   4145  C  CB    . ARG F 2 55  ? -4.160  -36.652 59.390 1.00 49.03  ? 55   ARG F CB    1 
ATOM   4146  C  CG    . ARG F 2 55  ? -2.883  -36.102 59.994 1.00 52.39  ? 55   ARG F CG    1 
ATOM   4147  C  CD    . ARG F 2 55  ? -1.900  -37.175 60.449 1.00 58.94  ? 55   ARG F CD    1 
ATOM   4148  N  NE    . ARG F 2 55  ? -0.870  -36.600 61.322 1.00 51.32  ? 55   ARG F NE    1 
ATOM   4149  C  CZ    . ARG F 2 55  ? -0.897  -36.668 62.645 1.00 53.31  ? 55   ARG F CZ    1 
ATOM   4150  N  NH1   . ARG F 2 55  ? -1.873  -37.295 63.320 1.00 54.89  ? 55   ARG F NH1   1 
ATOM   4151  N  NH2   . ARG F 2 55  ? 0.045   -36.064 63.309 1.00 54.61  ? 55   ARG F NH2   1 
ATOM   4152  N  N     . GLY F 2 56  ? -7.191  -36.473 58.333 1.00 51.17  ? 56   GLY F N     1 
ATOM   4153  C  CA    . GLY F 2 56  ? -8.263  -36.991 57.507 1.00 51.74  ? 56   GLY F CA    1 
ATOM   4154  C  C     . GLY F 2 56  ? -8.744  -35.951 56.537 1.00 52.80  ? 56   GLY F C     1 
ATOM   4155  O  O     . GLY F 2 56  ? -8.722  -36.185 55.314 1.00 50.54  ? 56   GLY F O     1 
ATOM   4156  N  N     . VAL F 2 57  ? -9.113  -34.793 57.100 1.00 44.92  ? 57   VAL F N     1 
ATOM   4157  C  CA    . VAL F 2 57  ? -9.627  -33.677 56.342 1.00 40.71  ? 57   VAL F CA    1 
ATOM   4158  C  C     . VAL F 2 57  ? -8.653  -33.289 55.247 1.00 42.54  ? 57   VAL F C     1 
ATOM   4159  O  O     . VAL F 2 57  ? -9.043  -33.023 54.125 1.00 43.29  ? 57   VAL F O     1 
ATOM   4160  C  CB    . VAL F 2 57  ? -9.862  -32.468 57.244 1.00 44.29  ? 57   VAL F CB    1 
ATOM   4161  C  CG1   . VAL F 2 57  ? -10.089 -31.221 56.422 1.00 50.42  ? 57   VAL F CG1   1 
ATOM   4162  C  CG2   . VAL F 2 57  ? -11.068 -32.663 58.152 1.00 45.96  ? 57   VAL F CG2   1 
ATOM   4163  N  N     . LEU F 2 58  ? -7.371  -33.256 55.558 1.00 43.35  ? 58   LEU F N     1 
ATOM   4164  C  CA    . LEU F 2 58  ? -6.390  -32.902 54.544 1.00 44.80  ? 58   LEU F CA    1 
ATOM   4165  C  C     . LEU F 2 58  ? -6.371  -33.952 53.453 1.00 45.29  ? 58   LEU F C     1 
ATOM   4166  O  O     . LEU F 2 58  ? -6.297  -33.633 52.279 1.00 52.07  ? 58   LEU F O     1 
ATOM   4167  C  CB    . LEU F 2 58  ? -5.004  -32.736 55.173 1.00 46.34  ? 58   LEU F CB    1 
ATOM   4168  C  CG    . LEU F 2 58  ? -3.787  -32.575 54.261 1.00 46.74  ? 58   LEU F CG    1 
ATOM   4169  C  CD1   . LEU F 2 58  ? -3.933  -31.405 53.322 1.00 49.18  ? 58   LEU F CD1   1 
ATOM   4170  C  CD2   . LEU F 2 58  ? -2.525  -32.427 55.111 1.00 46.85  ? 58   LEU F CD2   1 
ATOM   4171  N  N     . LYS F 2 59  ? -6.479  -35.212 53.832 1.00 49.45  ? 59   LYS F N     1 
ATOM   4172  C  CA    . LYS F 2 59  ? -6.421  -36.295 52.847 1.00 52.39  ? 59   LYS F CA    1 
ATOM   4173  C  C     . LYS F 2 59  ? -7.575  -36.194 51.845 1.00 49.96  ? 59   LYS F C     1 
ATOM   4174  O  O     . LYS F 2 59  ? -7.377  -36.344 50.651 1.00 45.80  ? 59   LYS F O     1 
ATOM   4175  C  CB    . LYS F 2 59  ? -6.423  -37.634 53.560 1.00 55.88  ? 59   LYS F CB    1 
ATOM   4176  C  CG    . LYS F 2 59  ? -6.187  -38.805 52.634 1.00 66.70  ? 59   LYS F CG    1 
ATOM   4177  C  CD    . LYS F 2 59  ? -5.796  -40.078 53.391 1.00 71.72  ? 59   LYS F CD    1 
ATOM   4178  C  CE    . LYS F 2 59  ? -6.392  -41.350 52.761 1.00 75.50  ? 59   LYS F CE    1 
ATOM   4179  N  NZ    . LYS F 2 59  ? -7.885  -41.456 52.858 1.00 72.02  ? 59   LYS F NZ    1 
ATOM   4180  N  N     . VAL F 2 60  ? -8.759  -35.862 52.344 1.00 46.12  ? 60   VAL F N     1 
ATOM   4181  C  CA    . VAL F 2 60  ? -9.899  -35.648 51.493 1.00 44.36  ? 60   VAL F CA    1 
ATOM   4182  C  C     . VAL F 2 60  ? -9.677  -34.427 50.611 1.00 44.05  ? 60   VAL F C     1 
ATOM   4183  O  O     . VAL F 2 60  ? -10.092 -34.384 49.478 1.00 48.98  ? 60   VAL F O     1 
ATOM   4184  C  CB    . VAL F 2 60  ? -11.156 -35.363 52.318 1.00 44.46  ? 60   VAL F CB    1 
ATOM   4185  C  CG1   . VAL F 2 60  ? -12.260 -34.910 51.417 1.00 48.54  ? 60   VAL F CG1   1 
ATOM   4186  C  CG2   . VAL F 2 60  ? -11.638 -36.587 53.040 1.00 52.23  ? 60   VAL F CG2   1 
ATOM   4187  N  N     . PHE F 2 61  ? -9.071  -33.401 51.144 1.00 40.99  ? 61   PHE F N     1 
ATOM   4188  C  CA    . PHE F 2 61  ? -8.943  -32.222 50.370 1.00 42.17  ? 61   PHE F CA    1 
ATOM   4189  C  C     . PHE F 2 61  ? -8.035  -32.519 49.220 1.00 45.98  ? 61   PHE F C     1 
ATOM   4190  O  O     . PHE F 2 61  ? -8.377  -32.241 48.077 1.00 52.72  ? 61   PHE F O     1 
ATOM   4191  C  CB    . PHE F 2 61  ? -8.404  -31.088 51.214 1.00 44.16  ? 61   PHE F CB    1 
ATOM   4192  C  CG    . PHE F 2 61  ? -8.072  -29.859 50.431 1.00 45.00  ? 61   PHE F CG    1 
ATOM   4193  C  CD1   . PHE F 2 61  ? -8.961  -28.814 50.316 1.00 42.62  ? 61   PHE F CD1   1 
ATOM   4194  C  CD2   . PHE F 2 61  ? -6.837  -29.737 49.828 1.00 49.92  ? 61   PHE F CD2   1 
ATOM   4195  C  CE1   . PHE F 2 61  ? -8.629  -27.691 49.562 1.00 42.76  ? 61   PHE F CE1   1 
ATOM   4196  C  CE2   . PHE F 2 61  ? -6.487  -28.593 49.118 1.00 47.27  ? 61   PHE F CE2   1 
ATOM   4197  C  CZ    . PHE F 2 61  ? -7.392  -27.583 48.973 1.00 42.48  ? 61   PHE F CZ    1 
ATOM   4198  N  N     . LEU F 2 62  ? -6.896  -33.134 49.504 1.00 47.86  ? 62   LEU F N     1 
ATOM   4199  C  CA    . LEU F 2 62  ? -5.938  -33.488 48.439 1.00 48.64  ? 62   LEU F CA    1 
ATOM   4200  C  C     . LEU F 2 62  ? -6.473  -34.463 47.378 1.00 50.55  ? 62   LEU F C     1 
ATOM   4201  O  O     . LEU F 2 62  ? -6.217  -34.305 46.187 1.00 51.93  ? 62   LEU F O     1 
ATOM   4202  C  CB    . LEU F 2 62  ? -4.656  -34.055 49.044 1.00 46.73  ? 62   LEU F CB    1 
ATOM   4203  C  CG    . LEU F 2 62  ? -3.692  -33.003 49.575 1.00 49.08  ? 62   LEU F CG    1 
ATOM   4204  C  CD1   . LEU F 2 62  ? -2.485  -33.614 50.296 1.00 50.29  ? 62   LEU F CD1   1 
ATOM   4205  C  CD2   . LEU F 2 62  ? -3.200  -32.118 48.425 1.00 50.62  ? 62   LEU F CD2   1 
ATOM   4206  N  N     . GLU F 2 63  ? -7.195  -35.485 47.808 1.00 49.71  ? 63   GLU F N     1 
ATOM   4207  C  CA    . GLU F 2 63  ? -7.717  -36.449 46.871 1.00 49.00  ? 63   GLU F CA    1 
ATOM   4208  C  C     . GLU F 2 63  ? -8.574  -35.745 45.846 1.00 51.31  ? 63   GLU F C     1 
ATOM   4209  O  O     . GLU F 2 63  ? -8.506  -36.038 44.660 1.00 51.47  ? 63   GLU F O     1 
ATOM   4210  C  CB    . GLU F 2 63  ? -8.579  -37.451 47.593 1.00 56.69  ? 63   GLU F CB    1 
ATOM   4211  C  CG    . GLU F 2 63  ? -7.823  -38.571 48.283 1.00 64.00  ? 63   GLU F CG    1 
ATOM   4212  C  CD    . GLU F 2 63  ? -8.671  -39.314 49.333 1.00 70.97  ? 63   GLU F CD    1 
ATOM   4213  O  OE1   . GLU F 2 63  ? -9.905  -39.053 49.403 1.00 66.48  ? 63   GLU F OE1   1 
ATOM   4214  O  OE2   . GLU F 2 63  ? -8.087  -40.150 50.092 1.00 66.46  ? 63   GLU F OE2   1 
ATOM   4215  N  N     . ASN F 2 64  ? -9.412  -34.822 46.311 1.00 53.56  ? 64   ASN F N     1 
ATOM   4216  C  CA    . ASN F 2 64  ? -10.340 -34.155 45.411 1.00 49.70  ? 64   ASN F CA    1 
ATOM   4217  C  C     . ASN F 2 64  ? -9.600  -33.299 44.437 1.00 51.35  ? 64   ASN F C     1 
ATOM   4218  O  O     . ASN F 2 64  ? -9.889  -33.302 43.227 1.00 50.00  ? 64   ASN F O     1 
ATOM   4219  C  CB    . ASN F 2 64  ? -11.371 -33.372 46.178 1.00 47.17  ? 64   ASN F CB    1 
ATOM   4220  C  CG    . ASN F 2 64  ? -12.384 -34.279 46.839 1.00 51.43  ? 64   ASN F CG    1 
ATOM   4221  O  OD1   . ASN F 2 64  ? -12.622 -35.348 46.354 1.00 66.49  ? 64   ASN F OD1   1 
ATOM   4222  N  ND2   . ASN F 2 64  ? -12.971 -33.865 47.950 1.00 60.71  ? 64   ASN F ND2   1 
ATOM   4223  N  N     . VAL F 2 65  ? -8.597  -32.608 44.938 1.00 49.27  ? 65   VAL F N     1 
ATOM   4224  C  CA    . VAL F 2 65  ? -7.883  -31.735 44.052 1.00 52.70  ? 65   VAL F CA    1 
ATOM   4225  C  C     . VAL F 2 65  ? -6.999  -32.543 43.130 1.00 53.64  ? 65   VAL F C     1 
ATOM   4226  O  O     . VAL F 2 65  ? -6.962  -32.273 41.944 1.00 55.61  ? 65   VAL F O     1 
ATOM   4227  C  CB    . VAL F 2 65  ? -7.074  -30.684 44.801 1.00 54.50  ? 65   VAL F CB    1 
ATOM   4228  C  CG1   . VAL F 2 65  ? -6.348  -29.784 43.811 1.00 57.17  ? 65   VAL F CG1   1 
ATOM   4229  C  CG2   . VAL F 2 65  ? -8.017  -29.830 45.626 1.00 55.22  ? 65   VAL F CG2   1 
ATOM   4230  N  N     . ILE F 2 66  ? -6.306  -33.543 43.649 1.00 52.23  ? 66   ILE F N     1 
ATOM   4231  C  CA    . ILE F 2 66  ? -5.407  -34.305 42.790 1.00 51.51  ? 66   ILE F CA    1 
ATOM   4232  C  C     . ILE F 2 66  ? -6.191  -35.078 41.717 1.00 51.90  ? 66   ILE F C     1 
ATOM   4233  O  O     . ILE F 2 66  ? -5.761  -35.137 40.590 1.00 52.40  ? 66   ILE F O     1 
ATOM   4234  C  CB    . ILE F 2 66  ? -4.499  -35.230 43.601 1.00 53.06  ? 66   ILE F CB    1 
ATOM   4235  C  CG1   . ILE F 2 66  ? -3.375  -34.421 44.236 1.00 52.81  ? 66   ILE F CG1   1 
ATOM   4236  C  CG2   . ILE F 2 66  ? -3.844  -36.233 42.693 1.00 58.13  ? 66   ILE F CG2   1 
ATOM   4237  C  CD1   . ILE F 2 66  ? -2.931  -34.910 45.581 1.00 56.71  ? 66   ILE F CD1   1 
ATOM   4238  N  N     . ARG F 2 67  ? -7.350  -35.636 42.039 1.00 49.65  ? 67   ARG F N     1 
ATOM   4239  C  CA    . ARG F 2 67  ? -8.112  -36.386 41.043 1.00 51.26  ? 67   ARG F CA    1 
ATOM   4240  C  C     . ARG F 2 67  ? -8.339  -35.477 39.833 1.00 52.91  ? 67   ARG F C     1 
ATOM   4241  O  O     . ARG F 2 67  ? -7.984  -35.806 38.715 1.00 53.63  ? 67   ARG F O     1 
ATOM   4242  C  CB    . ARG F 2 67  ? -9.439  -36.876 41.638 1.00 55.07  ? 67   ARG F CB    1 
ATOM   4243  C  CG    . ARG F 2 67  ? -10.394 -37.620 40.691 1.00 63.52  ? 67   ARG F CG    1 
ATOM   4244  C  CD    . ARG F 2 67  ? -11.795 -37.931 41.317 1.00 76.83  ? 67   ARG F CD    1 
ATOM   4245  N  NE    . ARG F 2 67  ? -11.688 -38.675 42.602 1.00 93.25  ? 67   ARG F NE    1 
ATOM   4246  C  CZ    . ARG F 2 67  ? -12.012 -38.226 43.831 1.00 95.10  ? 67   ARG F CZ    1 
ATOM   4247  N  NH1   . ARG F 2 67  ? -12.543 -37.011 44.031 1.00 89.93  ? 67   ARG F NH1   1 
ATOM   4248  N  NH2   . ARG F 2 67  ? -11.823 -39.026 44.882 1.00 93.02  ? 67   ARG F NH2   1 
ATOM   4249  N  N     . ASP F 2 68  ? -8.902  -34.306 40.073 1.00 59.27  ? 68   ASP F N     1 
ATOM   4250  C  CA    . ASP F 2 68  ? -9.187  -33.351 38.994 1.00 56.40  ? 68   ASP F CA    1 
ATOM   4251  C  C     . ASP F 2 68  ? -7.893  -32.940 38.307 1.00 51.94  ? 68   ASP F C     1 
ATOM   4252  O  O     . ASP F 2 68  ? -7.835  -32.823 37.101 1.00 48.87  ? 68   ASP F O     1 
ATOM   4253  C  CB    . ASP F 2 68  ? -9.882  -32.099 39.537 1.00 52.80  ? 68   ASP F CB    1 
ATOM   4254  C  CG    . ASP F 2 68  ? -11.337 -32.341 39.903 1.00 57.82  ? 68   ASP F CG    1 
ATOM   4255  O  OD1   . ASP F 2 68  ? -11.856 -33.484 39.773 1.00 62.57  ? 68   ASP F OD1   1 
ATOM   4256  O  OD2   . ASP F 2 68  ? -11.971 -31.354 40.314 1.00 60.53  ? 68   ASP F OD2   1 
ATOM   4257  N  N     . ALA F 2 69  ? -6.839  -32.745 39.071 1.00 49.43  ? 69   ALA F N     1 
ATOM   4258  C  CA    . ALA F 2 69  ? -5.607  -32.285 38.449 1.00 53.48  ? 69   ALA F CA    1 
ATOM   4259  C  C     . ALA F 2 69  ? -5.130  -33.338 37.491 1.00 51.65  ? 69   ALA F C     1 
ATOM   4260  O  O     . ALA F 2 69  ? -4.849  -33.055 36.341 1.00 53.13  ? 69   ALA F O     1 
ATOM   4261  C  CB    . ALA F 2 69  ? -4.537  -31.983 39.485 1.00 54.46  ? 69   ALA F CB    1 
ATOM   4262  N  N     . VAL F 2 70  ? -5.083  -34.565 37.972 1.00 52.73  ? 70   VAL F N     1 
ATOM   4263  C  CA    . VAL F 2 70  ? -4.649  -35.689 37.159 1.00 52.56  ? 70   VAL F CA    1 
ATOM   4264  C  C     . VAL F 2 70  ? -5.606  -35.939 35.976 1.00 51.96  ? 70   VAL F C     1 
ATOM   4265  O  O     . VAL F 2 70  ? -5.164  -36.259 34.886 1.00 49.05  ? 70   VAL F O     1 
ATOM   4266  C  CB    . VAL F 2 70  ? -4.530  -36.956 38.005 1.00 49.85  ? 70   VAL F CB    1 
ATOM   4267  C  CG1   . VAL F 2 70  ? -4.346  -38.130 37.092 1.00 51.68  ? 70   VAL F CG1   1 
ATOM   4268  C  CG2   . VAL F 2 70  ? -3.360  -36.841 38.980 1.00 48.07  ? 70   VAL F CG2   1 
ATOM   4269  N  N     . THR F 2 71  ? -6.898  -35.743 36.170 1.00 45.57  ? 71   THR F N     1 
ATOM   4270  C  CA    . THR F 2 71  ? -7.810  -35.838 35.054 1.00 49.29  ? 71   THR F CA    1 
ATOM   4271  C  C     . THR F 2 71  ? -7.429  -34.898 33.904 1.00 55.02  ? 71   THR F C     1 
ATOM   4272  O  O     . THR F 2 71  ? -7.426  -35.285 32.729 1.00 61.14  ? 71   THR F O     1 
ATOM   4273  C  CB    . THR F 2 71  ? -9.236  -35.582 35.529 1.00 49.26  ? 71   THR F CB    1 
ATOM   4274  O  OG1   . THR F 2 71  ? -9.549  -36.517 36.583 1.00 47.67  ? 71   THR F OG1   1 
ATOM   4275  C  CG2   . THR F 2 71  ? -10.217 -35.716 34.398 1.00 45.79  ? 71   THR F CG2   1 
ATOM   4276  N  N     . TYR F 2 72  ? -7.097  -33.666 34.244 1.00 58.52  ? 72   TYR F N     1 
ATOM   4277  C  CA    . TYR F 2 72  ? -6.584  -32.716 33.249 1.00 61.83  ? 72   TYR F CA    1 
ATOM   4278  C  C     . TYR F 2 72  ? -5.275  -33.248 32.615 1.00 61.86  ? 72   TYR F C     1 
ATOM   4279  O  O     . TYR F 2 72  ? -5.095  -33.254 31.415 1.00 61.43  ? 72   TYR F O     1 
ATOM   4280  C  CB    . TYR F 2 72  ? -6.369  -31.319 33.888 1.00 59.84  ? 72   TYR F CB    1 
ATOM   4281  C  CG    . TYR F 2 72  ? -7.649  -30.505 34.116 1.00 56.94  ? 72   TYR F CG    1 
ATOM   4282  C  CD1   . TYR F 2 72  ? -8.010  -30.030 35.378 1.00 58.17  ? 72   TYR F CD1   1 
ATOM   4283  C  CD2   . TYR F 2 72  ? -8.472  -30.183 33.063 1.00 58.56  ? 72   TYR F CD2   1 
ATOM   4284  C  CE1   . TYR F 2 72  ? -9.163  -29.260 35.560 1.00 59.76  ? 72   TYR F CE1   1 
ATOM   4285  C  CE2   . TYR F 2 72  ? -9.617  -29.426 33.234 1.00 60.52  ? 72   TYR F CE2   1 
ATOM   4286  C  CZ    . TYR F 2 72  ? -9.972  -28.966 34.477 1.00 60.19  ? 72   TYR F CZ    1 
ATOM   4287  O  OH    . TYR F 2 72  ? -11.144 -28.227 34.592 1.00 55.03  ? 72   TYR F OH    1 
ATOM   4288  N  N     . THR F 2 73  ? -4.359  -33.707 33.438 1.00 63.11  ? 73   THR F N     1 
ATOM   4289  C  CA    . THR F 2 73  ? -3.130  -34.243 32.922 1.00 63.63  ? 73   THR F CA    1 
ATOM   4290  C  C     . THR F 2 73  ? -3.408  -35.290 31.857 1.00 65.73  ? 73   THR F C     1 
ATOM   4291  O  O     . THR F 2 73  ? -2.891  -35.196 30.771 1.00 61.61  ? 73   THR F O     1 
ATOM   4292  C  CB    . THR F 2 73  ? -2.374  -34.904 34.049 1.00 61.36  ? 73   THR F CB    1 
ATOM   4293  O  OG1   . THR F 2 73  ? -2.255  -33.958 35.122 1.00 58.97  ? 73   THR F OG1   1 
ATOM   4294  C  CG2   . THR F 2 73  ? -1.025  -35.348 33.555 1.00 63.83  ? 73   THR F CG2   1 
ATOM   4295  N  N     . GLU F 2 74  ? -4.241  -36.272 32.181 1.00 65.69  ? 74   GLU F N     1 
ATOM   4296  C  CA    . GLU F 2 74  ? -4.511  -37.378 31.277 1.00 65.25  ? 74   GLU F CA    1 
ATOM   4297  C  C     . GLU F 2 74  ? -5.218  -36.865 30.063 1.00 67.93  ? 74   GLU F C     1 
ATOM   4298  O  O     . GLU F 2 74  ? -4.946  -37.303 28.955 1.00 68.72  ? 74   GLU F O     1 
ATOM   4299  C  CB    . GLU F 2 74  ? -5.404  -38.450 31.899 1.00 70.20  ? 74   GLU F CB    1 
ATOM   4300  C  CG    . GLU F 2 74  ? -4.835  -39.183 33.122 1.00 85.23  ? 74   GLU F CG    1 
ATOM   4301  C  CD    . GLU F 2 74  ? -5.775  -40.296 33.634 1.00 99.75  ? 74   GLU F CD    1 
ATOM   4302  O  OE1   . GLU F 2 74  ? -6.459  -40.907 32.786 1.00 111.58 ? 74   GLU F OE1   1 
ATOM   4303  O  OE2   . GLU F 2 74  ? -5.849  -40.584 34.860 1.00 92.16  ? 74   GLU F OE2   1 
ATOM   4304  N  N     . HIS F 2 75  ? -6.142  -35.933 30.228 1.00 71.77  ? 75   HIS F N     1 
ATOM   4305  C  CA    . HIS F 2 75  ? -6.873  -35.505 29.038 1.00 70.34  ? 75   HIS F CA    1 
ATOM   4306  C  C     . HIS F 2 75  ? -5.921  -34.880 28.020 1.00 72.05  ? 75   HIS F C     1 
ATOM   4307  O  O     . HIS F 2 75  ? -6.140  -34.959 26.816 1.00 70.63  ? 75   HIS F O     1 
ATOM   4308  C  CB    . HIS F 2 75  ? -7.963  -34.526 29.361 1.00 65.19  ? 75   HIS F CB    1 
ATOM   4309  C  CG    . HIS F 2 75  ? -8.689  -34.054 28.155 1.00 65.68  ? 75   HIS F CG    1 
ATOM   4310  N  ND1   . HIS F 2 75  ? -9.943  -34.520 27.822 1.00 71.22  ? 75   HIS F ND1   1 
ATOM   4311  C  CD2   . HIS F 2 75  ? -8.339  -33.172 27.189 1.00 65.46  ? 75   HIS F CD2   1 
ATOM   4312  C  CE1   . HIS F 2 75  ? -10.343 -33.936 26.705 1.00 79.06  ? 75   HIS F CE1   1 
ATOM   4313  N  NE2   . HIS F 2 75  ? -9.392  -33.108 26.304 1.00 78.96  ? 75   HIS F NE2   1 
ATOM   4314  N  N     . ALA F 2 76  ? -4.860  -34.265 28.526 1.00 68.01  ? 76   ALA F N     1 
ATOM   4315  C  CA    . ALA F 2 76  ? -3.859  -33.666 27.693 1.00 61.45  ? 76   ALA F CA    1 
ATOM   4316  C  C     . ALA F 2 76  ? -2.883  -34.706 27.187 1.00 65.53  ? 76   ALA F C     1 
ATOM   4317  O  O     . ALA F 2 76  ? -1.956  -34.346 26.495 1.00 75.13  ? 76   ALA F O     1 
ATOM   4318  C  CB    . ALA F 2 76  ? -3.113  -32.612 28.482 1.00 64.07  ? 76   ALA F CB    1 
ATOM   4319  N  N     . LYS F 2 77  ? -3.054  -35.978 27.549 1.00 67.91  ? 77   LYS F N     1 
ATOM   4320  C  CA    . LYS F 2 77  ? -2.097  -37.053 27.175 1.00 74.48  ? 77   LYS F CA    1 
ATOM   4321  C  C     . LYS F 2 77  ? -0.671  -36.788 27.653 1.00 69.60  ? 77   LYS F C     1 
ATOM   4322  O  O     . LYS F 2 77  ? 0.280   -36.994 26.896 1.00 71.78  ? 77   LYS F O     1 
ATOM   4323  C  CB    . LYS F 2 77  ? -2.089  -37.288 25.645 1.00 78.13  ? 77   LYS F CB    1 
ATOM   4324  C  CG    . LYS F 2 77  ? -3.402  -37.805 25.064 1.00 81.59  ? 77   LYS F CG    1 
ATOM   4325  C  CD    . LYS F 2 77  ? -3.509  -37.513 23.570 1.00 93.57  ? 77   LYS F CD    1 
ATOM   4326  C  CE    . LYS F 2 77  ? -4.814  -38.059 22.981 1.00 103.42 ? 77   LYS F CE    1 
ATOM   4327  N  NZ    . LYS F 2 77  ? -4.985  -37.751 21.525 1.00 104.24 ? 77   LYS F NZ    1 
ATOM   4328  N  N     . ARG F 2 78  ? -0.535  -36.309 28.890 1.00 64.16  ? 78   ARG F N     1 
ATOM   4329  C  CA    . ARG F 2 78  ? 0.771   -36.061 29.503 1.00 60.74  ? 78   ARG F CA    1 
ATOM   4330  C  C     . ARG F 2 78  ? 0.987   -37.035 30.646 1.00 60.10  ? 78   ARG F C     1 
ATOM   4331  O  O     . ARG F 2 78  ? 0.068   -37.711 31.053 1.00 60.06  ? 78   ARG F O     1 
ATOM   4332  C  CB    . ARG F 2 78  ? 0.865   -34.627 30.010 1.00 62.10  ? 78   ARG F CB    1 
ATOM   4333  C  CG    . ARG F 2 78  ? 1.249   -33.641 28.941 1.00 63.16  ? 78   ARG F CG    1 
ATOM   4334  C  CD    . ARG F 2 78  ? 1.439   -32.236 29.477 1.00 67.27  ? 78   ARG F CD    1 
ATOM   4335  N  NE    . ARG F 2 78  ? 0.143   -31.588 29.732 1.00 74.88  ? 78   ARG F NE    1 
ATOM   4336  C  CZ    . ARG F 2 78  ? -0.428  -31.442 30.930 1.00 68.24  ? 78   ARG F CZ    1 
ATOM   4337  N  NH1   . ARG F 2 78  ? 0.143   -31.876 32.055 1.00 66.11  ? 78   ARG F NH1   1 
ATOM   4338  N  NH2   . ARG F 2 78  ? -1.585  -30.839 30.993 1.00 65.11  ? 78   ARG F NH2   1 
ATOM   4339  N  N     . LYS F 2 79  ? 2.222   -37.127 31.123 1.00 69.32  ? 79   LYS F N     1 
ATOM   4340  C  CA    . LYS F 2 79  ? 2.593   -37.967 32.274 1.00 72.37  ? 79   LYS F CA    1 
ATOM   4341  C  C     . LYS F 2 79  ? 3.013   -37.105 33.439 1.00 72.26  ? 79   LYS F C     1 
ATOM   4342  O  O     . LYS F 2 79  ? 3.218   -37.601 34.559 1.00 70.10  ? 79   LYS F O     1 
ATOM   4343  C  CB    . LYS F 2 79  ? 3.771   -38.885 31.928 1.00 80.39  ? 79   LYS F CB    1 
ATOM   4344  C  CG    . LYS F 2 79  ? 3.505   -39.859 30.785 1.00 93.77  ? 79   LYS F CG    1 
ATOM   4345  C  CD    . LYS F 2 79  ? 4.107   -41.224 31.091 1.00 109.96 ? 79   LYS F CD    1 
ATOM   4346  C  CE    . LYS F 2 79  ? 4.710   -41.887 29.863 1.00 121.65 ? 79   LYS F CE    1 
ATOM   4347  N  NZ    . LYS F 2 79  ? 5.797   -42.818 30.279 1.00 123.26 ? 79   LYS F NZ    1 
ATOM   4348  N  N     . THR F 2 80  ? 3.171   -35.816 33.163 1.00 70.36  ? 80   THR F N     1 
ATOM   4349  C  CA    . THR F 2 80  ? 3.532   -34.866 34.172 1.00 72.35  ? 80   THR F CA    1 
ATOM   4350  C  C     . THR F 2 80  ? 2.344   -33.964 34.490 1.00 70.16  ? 80   THR F C     1 
ATOM   4351  O  O     . THR F 2 80  ? 1.693   -33.405 33.604 1.00 71.93  ? 80   THR F O     1 
ATOM   4352  C  CB    . THR F 2 80  ? 4.717   -34.041 33.703 1.00 74.32  ? 80   THR F CB    1 
ATOM   4353  O  OG1   . THR F 2 80  ? 5.693   -34.934 33.156 1.00 78.41  ? 80   THR F OG1   1 
ATOM   4354  C  CG2   . THR F 2 80  ? 5.314   -33.290 34.872 1.00 80.37  ? 80   THR F CG2   1 
ATOM   4355  N  N     . VAL F 2 81  ? 2.088   -33.837 35.780 1.00 67.76  ? 81   VAL F N     1 
ATOM   4356  C  CA    . VAL F 2 81  ? 1.083   -32.943 36.323 1.00 63.00  ? 81   VAL F CA    1 
ATOM   4357  C  C     . VAL F 2 81  ? 1.654   -31.529 36.430 1.00 59.15  ? 81   VAL F C     1 
ATOM   4358  O  O     . VAL F 2 81  ? 2.661   -31.309 37.090 1.00 60.06  ? 81   VAL F O     1 
ATOM   4359  C  CB    . VAL F 2 81  ? 0.712   -33.399 37.733 1.00 62.38  ? 81   VAL F CB    1 
ATOM   4360  C  CG1   . VAL F 2 81  ? -0.332  -32.466 38.303 1.00 66.28  ? 81   VAL F CG1   1 
ATOM   4361  C  CG2   . VAL F 2 81  ? 0.206   -34.843 37.714 1.00 59.46  ? 81   VAL F CG2   1 
ATOM   4362  N  N     . THR F 2 82  ? 1.019   -30.568 35.784 1.00 60.70  ? 82   THR F N     1 
ATOM   4363  C  CA    . THR F 2 82  ? 1.582   -29.229 35.696 1.00 62.01  ? 82   THR F CA    1 
ATOM   4364  C  C     . THR F 2 82  ? 0.973   -28.407 36.783 1.00 59.60  ? 82   THR F C     1 
ATOM   4365  O  O     . THR F 2 82  ? -0.141  -28.668 37.200 1.00 60.89  ? 82   THR F O     1 
ATOM   4366  C  CB    . THR F 2 82  ? 1.255   -28.548 34.342 1.00 64.56  ? 82   THR F CB    1 
ATOM   4367  O  OG1   . THR F 2 82  ? -0.157  -28.633 34.082 1.00 56.95  ? 82   THR F OG1   1 
ATOM   4368  C  CG2   . THR F 2 82  ? 2.007   -29.219 33.187 1.00 63.78  ? 82   THR F CG2   1 
ATOM   4369  N  N     . ALA F 2 83  ? 1.699   -27.396 37.222 1.00 58.04  ? 83   ALA F N     1 
ATOM   4370  C  CA    . ALA F 2 83  ? 1.114   -26.323 37.987 1.00 54.45  ? 83   ALA F CA    1 
ATOM   4371  C  C     . ALA F 2 83  ? -0.248  -25.905 37.390 1.00 56.84  ? 83   ALA F C     1 
ATOM   4372  O  O     . ALA F 2 83  ? -1.197  -25.688 38.132 1.00 59.72  ? 83   ALA F O     1 
ATOM   4373  C  CB    . ALA F 2 83  ? 2.056   -25.163 37.991 1.00 57.37  ? 83   ALA F CB    1 
ATOM   4374  N  N     . MET F 2 84  ? -0.365  -25.825 36.066 1.00 53.67  ? 84   MET F N     1 
ATOM   4375  C  CA    . MET F 2 84  ? -1.646  -25.465 35.461 1.00 53.53  ? 84   MET F CA    1 
ATOM   4376  C  C     . MET F 2 84  ? -2.707  -26.510 35.676 1.00 51.08  ? 84   MET F C     1 
ATOM   4377  O  O     . MET F 2 84  ? -3.873  -26.194 35.767 1.00 57.19  ? 84   MET F O     1 
ATOM   4378  C  CB    . MET F 2 84  ? -1.532  -25.153 33.954 1.00 55.91  ? 84   MET F CB    1 
ATOM   4379  C  CG    . MET F 2 84  ? -0.809  -23.844 33.644 1.00 65.07  ? 84   MET F CG    1 
ATOM   4380  S  SD    . MET F 2 84  ? -1.183  -22.480 34.797 1.00 75.04  ? 84   MET F SD    1 
ATOM   4381  C  CE    . MET F 2 84  ? -2.845  -22.081 34.205 1.00 72.55  ? 84   MET F CE    1 
ATOM   4382  N  N     . ASP F 2 85  ? -2.353  -27.765 35.753 1.00 51.89  ? 85   ASP F N     1 
ATOM   4383  C  CA    . ASP F 2 85  ? -3.425  -28.757 35.986 1.00 56.66  ? 85   ASP F CA    1 
ATOM   4384  C  C     . ASP F 2 85  ? -4.047  -28.513 37.364 1.00 54.50  ? 85   ASP F C     1 
ATOM   4385  O  O     . ASP F 2 85  ? -5.258  -28.537 37.528 1.00 51.83  ? 85   ASP F O     1 
ATOM   4386  C  CB    . ASP F 2 85  ? -2.882  -30.201 35.912 1.00 61.31  ? 85   ASP F CB    1 
ATOM   4387  C  CG    . ASP F 2 85  ? -2.408  -30.598 34.506 1.00 60.94  ? 85   ASP F CG    1 
ATOM   4388  O  OD1   . ASP F 2 85  ? -3.086  -30.219 33.524 1.00 59.38  ? 85   ASP F OD1   1 
ATOM   4389  O  OD2   . ASP F 2 85  ? -1.370  -31.290 34.406 1.00 55.48  ? 85   ASP F OD2   1 
ATOM   4390  N  N     . VAL F 2 86  ? -3.183  -28.280 38.351 1.00 51.63  ? 86   VAL F N     1 
ATOM   4391  C  CA    . VAL F 2 86  ? -3.578  -28.002 39.721 1.00 48.20  ? 86   VAL F CA    1 
ATOM   4392  C  C     . VAL F 2 86  ? -4.352  -26.696 39.822 1.00 49.82  ? 86   VAL F C     1 
ATOM   4393  O  O     . VAL F 2 86  ? -5.336  -26.599 40.545 1.00 47.45  ? 86   VAL F O     1 
ATOM   4394  C  CB    . VAL F 2 86  ? -2.326  -27.860 40.586 1.00 50.35  ? 86   VAL F CB    1 
ATOM   4395  C  CG1   . VAL F 2 86  ? -2.691  -27.509 42.003 1.00 52.67  ? 86   VAL F CG1   1 
ATOM   4396  C  CG2   . VAL F 2 86  ? -1.566  -29.166 40.603 1.00 54.82  ? 86   VAL F CG2   1 
ATOM   4397  N  N     . VAL F 2 87  ? -3.889  -25.671 39.112 1.00 49.76  ? 87   VAL F N     1 
ATOM   4398  C  CA    . VAL F 2 87  ? -4.591  -24.411 39.129 1.00 47.71  ? 87   VAL F CA    1 
ATOM   4399  C  C     . VAL F 2 87  ? -5.994  -24.565 38.562 1.00 48.47  ? 87   VAL F C     1 
ATOM   4400  O  O     . VAL F 2 87  ? -6.946  -24.147 39.178 1.00 58.00  ? 87   VAL F O     1 
ATOM   4401  C  CB    . VAL F 2 87  ? -3.810  -23.318 38.428 1.00 48.52  ? 87   VAL F CB    1 
ATOM   4402  C  CG1   . VAL F 2 87  ? -4.626  -22.055 38.394 1.00 48.10  ? 87   VAL F CG1   1 
ATOM   4403  C  CG2   . VAL F 2 87  ? -2.529  -23.031 39.197 1.00 51.25  ? 87   VAL F CG2   1 
ATOM   4404  N  N     . TYR F 2 88  ? -6.135  -25.204 37.423 1.00 53.65  ? 88   TYR F N     1 
ATOM   4405  C  CA    . TYR F 2 88  ? -7.474  -25.483 36.880 1.00 57.93  ? 88   TYR F CA    1 
ATOM   4406  C  C     . TYR F 2 88  ? -8.313  -26.359 37.765 1.00 52.38  ? 88   TYR F C     1 
ATOM   4407  O  O     . TYR F 2 88  ? -9.532  -26.249 37.745 1.00 56.46  ? 88   TYR F O     1 
ATOM   4408  C  CB    . TYR F 2 88  ? -7.421  -26.145 35.490 1.00 60.69  ? 88   TYR F CB    1 
ATOM   4409  C  CG    . TYR F 2 88  ? -6.731  -25.299 34.466 1.00 66.59  ? 88   TYR F CG    1 
ATOM   4410  C  CD1   . TYR F 2 88  ? -5.714  -25.806 33.688 1.00 74.74  ? 88   TYR F CD1   1 
ATOM   4411  C  CD2   . TYR F 2 88  ? -7.062  -23.977 34.308 1.00 78.69  ? 88   TYR F CD2   1 
ATOM   4412  C  CE1   . TYR F 2 88  ? -5.066  -25.031 32.757 1.00 78.05  ? 88   TYR F CE1   1 
ATOM   4413  C  CE2   . TYR F 2 88  ? -6.421  -23.191 33.381 1.00 86.16  ? 88   TYR F CE2   1 
ATOM   4414  C  CZ    . TYR F 2 88  ? -5.426  -23.734 32.611 1.00 84.38  ? 88   TYR F CZ    1 
ATOM   4415  O  OH    . TYR F 2 88  ? -4.791  -22.948 31.708 1.00 94.59  ? 88   TYR F OH    1 
ATOM   4416  N  N     . ALA F 2 89  ? -7.685  -27.259 38.498 1.00 50.71  ? 89   ALA F N     1 
ATOM   4417  C  CA    . ALA F 2 89  ? -8.468  -28.132 39.350 1.00 52.97  ? 89   ALA F CA    1 
ATOM   4418  C  C     . ALA F 2 89  ? -8.979  -27.296 40.474 1.00 51.67  ? 89   ALA F C     1 
ATOM   4419  O  O     . ALA F 2 89  ? -10.153 -27.366 40.789 1.00 57.59  ? 89   ALA F O     1 
ATOM   4420  C  CB    . ALA F 2 89  ? -7.645  -29.275 39.877 1.00 55.09  ? 89   ALA F CB    1 
ATOM   4421  N  N     . LEU F 2 90  ? -8.094  -26.478 41.046 1.00 48.57  ? 90   LEU F N     1 
ATOM   4422  C  CA    . LEU F 2 90  ? -8.445  -25.630 42.159 1.00 45.04  ? 90   LEU F CA    1 
ATOM   4423  C  C     . LEU F 2 90  ? -9.583  -24.689 41.782 1.00 47.97  ? 90   LEU F C     1 
ATOM   4424  O  O     . LEU F 2 90  ? -10.482 -24.439 42.592 1.00 49.38  ? 90   LEU F O     1 
ATOM   4425  C  CB    . LEU F 2 90  ? -7.227  -24.873 42.637 1.00 44.95  ? 90   LEU F CB    1 
ATOM   4426  C  CG    . LEU F 2 90  ? -6.225  -25.605 43.536 1.00 48.61  ? 90   LEU F CG    1 
ATOM   4427  C  CD1   . LEU F 2 90  ? -4.948  -24.782 43.750 1.00 45.04  ? 90   LEU F CD1   1 
ATOM   4428  C  CD2   . LEU F 2 90  ? -6.847  -26.003 44.874 1.00 45.84  ? 90   LEU F CD2   1 
ATOM   4429  N  N     . LYS F 2 91  ? -9.584  -24.194 40.554 1.00 46.26  ? 91   LYS F N     1 
ATOM   4430  C  CA    . LYS F 2 91  ? -10.637 -23.295 40.159 1.00 50.70  ? 91   LYS F CA    1 
ATOM   4431  C  C     . LYS F 2 91  ? -11.974 -24.037 40.103 1.00 53.78  ? 91   LYS F C     1 
ATOM   4432  O  O     . LYS F 2 91  ? -12.953 -23.587 40.687 1.00 57.01  ? 91   LYS F O     1 
ATOM   4433  C  CB    . LYS F 2 91  ? -10.291 -22.613 38.858 1.00 59.51  ? 91   LYS F CB    1 
ATOM   4434  C  CG    . LYS F 2 91  ? -11.352 -21.716 38.217 1.00 67.00  ? 91   LYS F CG    1 
ATOM   4435  C  CD    . LYS F 2 91  ? -10.743 -20.861 37.076 1.00 70.25  ? 91   LYS F CD    1 
ATOM   4436  C  CE    . LYS F 2 91  ? -10.663 -19.385 37.448 1.00 87.46  ? 91   LYS F CE    1 
ATOM   4437  N  NZ    . LYS F 2 91  ? -9.328  -18.756 37.227 1.00 94.59  ? 91   LYS F NZ    1 
ATOM   4438  N  N     . ARG F 2 92  ? -12.038 -25.186 39.453 1.00 54.49  ? 92   ARG F N     1 
ATOM   4439  C  CA    . ARG F 2 92  ? -13.307 -25.962 39.422 1.00 55.02  ? 92   ARG F CA    1 
ATOM   4440  C  C     . ARG F 2 92  ? -13.892 -26.142 40.794 1.00 54.26  ? 92   ARG F C     1 
ATOM   4441  O  O     . ARG F 2 92  ? -15.078 -26.222 40.968 1.00 59.09  ? 92   ARG F O     1 
ATOM   4442  C  CB    . ARG F 2 92  ? -13.086 -27.399 38.974 1.00 60.87  ? 92   ARG F CB    1 
ATOM   4443  C  CG    . ARG F 2 92  ? -13.052 -27.615 37.501 1.00 67.28  ? 92   ARG F CG    1 
ATOM   4444  C  CD    . ARG F 2 92  ? -13.224 -29.083 37.189 1.00 66.28  ? 92   ARG F CD    1 
ATOM   4445  N  NE    . ARG F 2 92  ? -14.612 -29.418 37.405 1.00 62.89  ? 92   ARG F NE    1 
ATOM   4446  C  CZ    . ARG F 2 92  ? -15.056 -29.972 38.507 1.00 64.47  ? 92   ARG F CZ    1 
ATOM   4447  N  NH1   . ARG F 2 92  ? -14.205 -30.284 39.456 1.00 67.15  ? 92   ARG F NH1   1 
ATOM   4448  N  NH2   . ARG F 2 92  ? -16.343 -30.250 38.649 1.00 71.25  ? 92   ARG F NH2   1 
ATOM   4449  N  N     . GLN F 2 93  ? -13.040 -26.322 41.777 1.00 57.38  ? 93   GLN F N     1 
ATOM   4450  C  CA    . GLN F 2 93  ? -13.523 -26.626 43.082 1.00 57.80  ? 93   GLN F CA    1 
ATOM   4451  C  C     . GLN F 2 93  ? -13.793 -25.430 43.937 1.00 50.94  ? 93   GLN F C     1 
ATOM   4452  O  O     . GLN F 2 93  ? -13.954 -25.568 45.109 1.00 45.48  ? 93   GLN F O     1 
ATOM   4453  C  CB    . GLN F 2 93  ? -12.534 -27.552 43.748 1.00 71.59  ? 93   GLN F CB    1 
ATOM   4454  C  CG    . GLN F 2 93  ? -13.061 -28.975 43.660 1.00 86.36  ? 93   GLN F CG    1 
ATOM   4455  C  CD    . GLN F 2 93  ? -11.959 -29.938 43.707 1.00 88.09  ? 93   GLN F CD    1 
ATOM   4456  O  OE1   . GLN F 2 93  ? -11.036 -29.782 44.519 1.00 98.98  ? 93   GLN F OE1   1 
ATOM   4457  N  NE2   . GLN F 2 93  ? -11.996 -30.920 42.813 1.00 85.16  ? 93   GLN F NE2   1 
ATOM   4458  N  N     . GLY F 2 94  ? -13.854 -24.250 43.336 1.00 51.16  ? 94   GLY F N     1 
ATOM   4459  C  CA    . GLY F 2 94  ? -14.138 -23.049 44.067 1.00 48.31  ? 94   GLY F CA    1 
ATOM   4460  C  C     . GLY F 2 94  ? -13.043 -22.644 45.032 1.00 56.81  ? 94   GLY F C     1 
ATOM   4461  O  O     . GLY F 2 94  ? -13.338 -21.967 46.017 1.00 62.24  ? 94   GLY F O     1 
ATOM   4462  N  N     . ARG F 2 95  ? -11.793 -23.027 44.749 1.00 54.12  ? 95   ARG F N     1 
ATOM   4463  C  CA    . ARG F 2 95  ? -10.660 -22.596 45.532 1.00 46.20  ? 95   ARG F CA    1 
ATOM   4464  C  C     . ARG F 2 95  ? -9.560  -21.990 44.603 1.00 48.38  ? 95   ARG F C     1 
ATOM   4465  O  O     . ARG F 2 95  ? -8.355  -22.306 44.735 1.00 53.25  ? 95   ARG F O     1 
ATOM   4466  C  CB    . ARG F 2 95  ? -10.066 -23.765 46.322 1.00 47.25  ? 95   ARG F CB    1 
ATOM   4467  C  CG    . ARG F 2 95  ? -10.996 -24.763 46.959 1.00 53.54  ? 95   ARG F CG    1 
ATOM   4468  C  CD    . ARG F 2 95  ? -11.152 -24.734 48.477 1.00 64.07  ? 95   ARG F CD    1 
ATOM   4469  N  NE    . ARG F 2 95  ? -10.123 -23.925 49.147 1.00 71.74  ? 95   ARG F NE    1 
ATOM   4470  C  CZ    . ARG F 2 95  ? -10.361 -23.112 50.177 1.00 59.86  ? 95   ARG F CZ    1 
ATOM   4471  N  NH1   . ARG F 2 95  ? -11.568 -23.037 50.705 1.00 62.99  ? 95   ARG F NH1   1 
ATOM   4472  N  NH2   . ARG F 2 95  ? -9.377  -22.413 50.710 1.00 58.86  ? 95   ARG F NH2   1 
ATOM   4473  N  N     . THR F 2 96  ? -9.949  -21.099 43.696 1.00 48.41  ? 96   THR F N     1 
ATOM   4474  C  CA    . THR F 2 96  ? -8.967  -20.341 42.865 1.00 46.96  ? 96   THR F CA    1 
ATOM   4475  C  C     . THR F 2 96  ? -7.706  -19.836 43.520 1.00 41.36  ? 96   THR F C     1 
ATOM   4476  O  O     . THR F 2 96  ? -7.745  -19.178 44.548 1.00 48.03  ? 96   THR F O     1 
ATOM   4477  C  CB    . THR F 2 96  ? -9.586  -19.056 42.361 1.00 47.19  ? 96   THR F CB    1 
ATOM   4478  O  OG1   . THR F 2 96  ? -10.802 -19.355 41.685 1.00 51.29  ? 96   THR F OG1   1 
ATOM   4479  C  CG2   . THR F 2 96  ? -8.659  -18.409 41.418 1.00 47.49  ? 96   THR F CG2   1 
ATOM   4480  N  N     . LEU F 2 97  ? -6.587  -20.087 42.877 1.00 45.09  ? 97   LEU F N     1 
ATOM   4481  C  CA    . LEU F 2 97  ? -5.257  -19.744 43.430 1.00 46.83  ? 97   LEU F CA    1 
ATOM   4482  C  C     . LEU F 2 97  ? -4.562  -18.780 42.500 1.00 49.68  ? 97   LEU F C     1 
ATOM   4483  O  O     . LEU F 2 97  ? -4.526  -19.012 41.301 1.00 51.96  ? 97   LEU F O     1 
ATOM   4484  C  CB    . LEU F 2 97  ? -4.385  -20.994 43.522 1.00 41.39  ? 97   LEU F CB    1 
ATOM   4485  C  CG    . LEU F 2 97  ? -2.941  -20.858 43.967 1.00 41.57  ? 97   LEU F CG    1 
ATOM   4486  C  CD1   . LEU F 2 97  ? -2.796  -20.433 45.395 1.00 45.81  ? 97   LEU F CD1   1 
ATOM   4487  C  CD2   . LEU F 2 97  ? -2.255  -22.189 43.858 1.00 48.16  ? 97   LEU F CD2   1 
ATOM   4488  N  N     . TYR F 2 98  ? -3.991  -17.718 43.049 1.00 50.16  ? 98   TYR F N     1 
ATOM   4489  C  CA    . TYR F 2 98  ? -3.155  -16.843 42.282 1.00 46.20  ? 98   TYR F CA    1 
ATOM   4490  C  C     . TYR F 2 98  ? -1.728  -17.116 42.653 1.00 47.09  ? 98   TYR F C     1 
ATOM   4491  O  O     . TYR F 2 98  ? -1.430  -17.465 43.790 1.00 48.59  ? 98   TYR F O     1 
ATOM   4492  C  CB    . TYR F 2 98  ? -3.472  -15.428 42.660 1.00 52.88  ? 98   TYR F CB    1 
ATOM   4493  C  CG    . TYR F 2 98  ? -4.811  -14.874 42.223 1.00 51.89  ? 98   TYR F CG    1 
ATOM   4494  C  CD1   . TYR F 2 98  ? -5.657  -15.561 41.386 1.00 48.44  ? 98   TYR F CD1   1 
ATOM   4495  C  CD2   . TYR F 2 98  ? -5.166  -13.579 42.581 1.00 51.17  ? 98   TYR F CD2   1 
ATOM   4496  C  CE1   . TYR F 2 98  ? -6.848  -14.978 40.962 1.00 53.03  ? 98   TYR F CE1   1 
ATOM   4497  C  CE2   . TYR F 2 98  ? -6.360  -13.015 42.186 1.00 50.68  ? 98   TYR F CE2   1 
ATOM   4498  C  CZ    . TYR F 2 98  ? -7.184  -13.714 41.371 1.00 52.40  ? 98   TYR F CZ    1 
ATOM   4499  O  OH    . TYR F 2 98  ? -8.358  -13.130 41.001 1.00 61.68  ? 98   TYR F OH    1 
ATOM   4500  N  N     . GLY F 2 99  ? -0.833  -16.963 41.692 1.00 53.12  ? 99   GLY F N     1 
ATOM   4501  C  CA    . GLY F 2 99  ? 0.611   -17.022 41.959 1.00 50.59  ? 99   GLY F CA    1 
ATOM   4502  C  C     . GLY F 2 99  ? 1.380   -18.040 41.143 1.00 52.55  ? 99   GLY F C     1 
ATOM   4503  O  O     . GLY F 2 99  ? 2.613   -18.097 41.250 1.00 58.93  ? 99   GLY F O     1 
ATOM   4504  N  N     . PHE F 2 100 ? 0.661   -18.876 40.379 1.00 55.92  ? 100  PHE F N     1 
ATOM   4505  C  CA    . PHE F 2 100 ? 1.248   -20.050 39.683 1.00 52.57  ? 100  PHE F CA    1 
ATOM   4506  C  C     . PHE F 2 100 ? 0.826   -20.170 38.233 1.00 49.96  ? 100  PHE F C     1 
ATOM   4507  O  O     . PHE F 2 100 ? 0.982   -21.215 37.667 1.00 58.35  ? 100  PHE F O     1 
ATOM   4508  C  CB    . PHE F 2 100 ? 0.917   -21.370 40.423 1.00 48.75  ? 100  PHE F CB    1 
ATOM   4509  C  CG    . PHE F 2 100 ? 1.583   -21.496 41.770 1.00 47.72  ? 100  PHE F CG    1 
ATOM   4510  C  CD1   . PHE F 2 100 ? 0.969   -21.030 42.924 1.00 51.98  ? 100  PHE F CD1   1 
ATOM   4511  C  CD2   . PHE F 2 100 ? 2.822   -22.074 41.882 1.00 52.11  ? 100  PHE F CD2   1 
ATOM   4512  C  CE1   . PHE F 2 100 ? 1.593   -21.122 44.173 1.00 57.16  ? 100  PHE F CE1   1 
ATOM   4513  C  CE2   . PHE F 2 100 ? 3.465   -22.177 43.126 1.00 58.07  ? 100  PHE F CE2   1 
ATOM   4514  C  CZ    . PHE F 2 100 ? 2.853   -21.692 44.277 1.00 58.58  ? 100  PHE F CZ    1 
ATOM   4515  N  N     . GLY F 2 101 ? 0.313   -19.103 37.628 1.00 51.57  ? 101  GLY F N     1 
ATOM   4516  C  CA    . GLY F 2 101 ? 0.020   -19.070 36.201 1.00 51.19  ? 101  GLY F CA    1 
ATOM   4517  C  C     . GLY F 2 101 ? -1.451  -18.981 35.878 1.00 59.70  ? 101  GLY F C     1 
ATOM   4518  O  O     . GLY F 2 101 ? -1.871  -19.088 34.719 1.00 61.53  ? 101  GLY F O     1 
ATOM   4519  N  N     . GLY F 2 102 ? -2.269  -18.753 36.885 1.00 71.67  ? 102  GLY F N     1 
ATOM   4520  C  CA    . GLY F 2 102 ? -3.712  -18.614 36.614 1.00 97.97  ? 102  GLY F CA    1 
ATOM   4521  C  C     . GLY F 2 102 ? -4.493  -17.590 37.445 1.00 105.77 ? 102  GLY F C     1 
ATOM   4522  O  O     . GLY F 2 102 ? -4.930  -16.546 36.889 1.00 103.83 ? 102  GLY F O     1 
ATOM   4523  O  OXT   . GLY F 2 102 ? -4.732  -17.814 38.657 1.00 86.92  ? 102  GLY F OXT   1 
ATOM   4524  N  N     . ALA G 3 14  ? -34.878 -40.797 5.002  1.00 144.70 ? 14   ALA G N     1 
ATOM   4525  C  CA    . ALA G 3 14  ? -34.330 -40.038 6.178  1.00 146.24 ? 14   ALA G CA    1 
ATOM   4526  C  C     . ALA G 3 14  ? -34.505 -40.820 7.493  1.00 147.34 ? 14   ALA G C     1 
ATOM   4527  O  O     . ALA G 3 14  ? -35.580 -41.367 7.753  1.00 140.53 ? 14   ALA G O     1 
ATOM   4528  C  CB    . ALA G 3 14  ? -34.996 -38.668 6.279  1.00 136.83 ? 14   ALA G CB    1 
ATOM   4529  N  N     . LYS G 3 15  ? -33.448 -40.878 8.310  1.00 154.16 ? 15   LYS G N     1 
ATOM   4530  C  CA    . LYS G 3 15  ? -33.520 -41.512 9.642  1.00 152.59 ? 15   LYS G CA    1 
ATOM   4531  C  C     . LYS G 3 15  ? -32.737 -40.743 10.713 1.00 139.60 ? 15   LYS G C     1 
ATOM   4532  O  O     . LYS G 3 15  ? -31.514 -40.555 10.600 1.00 138.12 ? 15   LYS G O     1 
ATOM   4533  C  CB    . LYS G 3 15  ? -33.041 -42.971 9.594  1.00 149.88 ? 15   LYS G CB    1 
ATOM   4534  C  CG    . LYS G 3 15  ? -33.702 -43.847 10.648 1.00 144.96 ? 15   LYS G CG    1 
ATOM   4535  C  CD    . LYS G 3 15  ? -35.170 -44.103 10.306 1.00 143.66 ? 15   LYS G CD    1 
ATOM   4536  C  CE    . LYS G 3 15  ? -36.009 -44.423 11.536 1.00 134.42 ? 15   LYS G CE    1 
ATOM   4537  N  NZ    . LYS G 3 15  ? -35.570 -45.687 12.187 1.00 136.97 ? 15   LYS G NZ    1 
ATOM   4538  N  N     . THR G 3 16  ? -33.449 -40.334 11.765 1.00 113.98 ? 16   THR G N     1 
ATOM   4539  C  CA    . THR G 3 16  ? -32.878 -39.453 12.792 1.00 108.83 ? 16   THR G CA    1 
ATOM   4540  C  C     . THR G 3 16  ? -31.621 -40.023 13.436 1.00 113.50 ? 16   THR G C     1 
ATOM   4541  O  O     . THR G 3 16  ? -31.530 -41.234 13.715 1.00 109.66 ? 16   THR G O     1 
ATOM   4542  C  CB    . THR G 3 16  ? -33.854 -39.136 13.950 1.00 100.18 ? 16   THR G CB    1 
ATOM   4543  O  OG1   . THR G 3 16  ? -34.175 -40.334 14.679 1.00 95.53  ? 16   THR G OG1   1 
ATOM   4544  C  CG2   . THR G 3 16  ? -35.119 -38.450 13.447 1.00 99.14  ? 16   THR G CG2   1 
ATOM   4545  N  N     . ARG G 3 17  ? -30.674 -39.123 13.697 1.00 103.33 ? 17   ARG G N     1 
ATOM   4546  C  CA    . ARG G 3 17  ? -29.437 -39.477 14.374 1.00 99.73  ? 17   ARG G CA    1 
ATOM   4547  C  C     . ARG G 3 17  ? -29.671 -40.075 15.770 1.00 99.79  ? 17   ARG G C     1 
ATOM   4548  O  O     . ARG G 3 17  ? -28.870 -40.898 16.254 1.00 90.61  ? 17   ARG G O     1 
ATOM   4549  C  CB    . ARG G 3 17  ? -28.542 -38.259 14.466 1.00 92.89  ? 17   ARG G CB    1 
ATOM   4550  C  CG    . ARG G 3 17  ? -28.108 -37.753 13.108 1.00 94.62  ? 17   ARG G CG    1 
ATOM   4551  C  CD    . ARG G 3 17  ? -26.798 -36.989 13.194 1.00 93.62  ? 17   ARG G CD    1 
ATOM   4552  N  NE    . ARG G 3 17  ? -27.026 -35.562 13.396 1.00 97.52  ? 17   ARG G NE    1 
ATOM   4553  C  CZ    . ARG G 3 17  ? -26.101 -34.694 13.807 1.00 98.53  ? 17   ARG G CZ    1 
ATOM   4554  N  NH1   . ARG G 3 17  ? -24.860 -35.112 14.096 1.00 87.67  ? 17   ARG G NH1   1 
ATOM   4555  N  NH2   . ARG G 3 17  ? -26.448 -33.409 13.946 1.00 98.47  ? 17   ARG G NH2   1 
ATOM   4556  N  N     . SER G 3 18  ? -30.766 -39.676 16.410 1.00 91.80  ? 18   SER G N     1 
ATOM   4557  C  CA    . SER G 3 18  ? -31.142 -40.279 17.674 1.00 90.12  ? 18   SER G CA    1 
ATOM   4558  C  C     . SER G 3 18  ? -31.433 -41.761 17.491 1.00 94.70  ? 18   SER G C     1 
ATOM   4559  O  O     . SER G 3 18  ? -30.817 -42.587 18.157 1.00 107.28 ? 18   SER G O     1 
ATOM   4560  C  CB    . SER G 3 18  ? -32.331 -39.544 18.281 1.00 90.84  ? 18   SER G CB    1 
ATOM   4561  O  OG    . SER G 3 18  ? -32.035 -38.162 18.399 1.00 88.10  ? 18   SER G OG    1 
ATOM   4562  N  N     . SER G 3 19  ? -32.324 -42.107 16.564 1.00 98.10  ? 19   SER G N     1 
ATOM   4563  C  CA    . SER G 3 19  ? -32.660 -43.515 16.304 1.00 92.95  ? 19   SER G CA    1 
ATOM   4564  C  C     . SER G 3 19  ? -31.440 -44.325 15.872 1.00 85.51  ? 19   SER G C     1 
ATOM   4565  O  O     . SER G 3 19  ? -31.332 -45.484 16.233 1.00 81.02  ? 19   SER G O     1 
ATOM   4566  C  CB    . SER G 3 19  ? -33.719 -43.600 15.234 1.00 92.49  ? 19   SER G CB    1 
ATOM   4567  O  OG    . SER G 3 19  ? -33.310 -42.809 14.134 1.00 102.14 ? 19   SER G OG    1 
ATOM   4568  N  N     . ARG G 3 20  ? -30.528 -43.714 15.115 1.00 83.13  ? 20   ARG G N     1 
ATOM   4569  C  CA    . ARG G 3 20  ? -29.253 -44.364 14.764 1.00 90.41  ? 20   ARG G CA    1 
ATOM   4570  C  C     . ARG G 3 20  ? -28.444 -44.704 16.006 1.00 91.52  ? 20   ARG G C     1 
ATOM   4571  O  O     . ARG G 3 20  ? -27.727 -45.705 16.036 1.00 95.46  ? 20   ARG G O     1 
ATOM   4572  C  CB    . ARG G 3 20  ? -28.349 -43.461 13.889 1.00 99.49  ? 20   ARG G CB    1 
ATOM   4573  C  CG    . ARG G 3 20  ? -28.857 -43.072 12.507 1.00 101.64 ? 20   ARG G CG    1 
ATOM   4574  C  CD    . ARG G 3 20  ? -27.703 -42.628 11.610 1.00 104.15 ? 20   ARG G CD    1 
ATOM   4575  N  NE    . ARG G 3 20  ? -28.169 -41.897 10.427 1.00 118.52 ? 20   ARG G NE    1 
ATOM   4576  C  CZ    . ARG G 3 20  ? -28.738 -42.454 9.352  1.00 124.92 ? 20   ARG G CZ    1 
ATOM   4577  N  NH1   . ARG G 3 20  ? -28.939 -43.768 9.275  1.00 128.67 ? 20   ARG G NH1   1 
ATOM   4578  N  NH2   . ARG G 3 20  ? -29.115 -41.690 8.336  1.00 119.54 ? 20   ARG G NH2   1 
ATOM   4579  N  N     . ALA G 3 21  ? -28.504 -43.818 17.002 1.00 98.32  ? 21   ALA G N     1 
ATOM   4580  C  CA    . ALA G 3 21  ? -27.726 -43.971 18.241 1.00 96.00  ? 21   ALA G CA    1 
ATOM   4581  C  C     . ALA G 3 21  ? -28.544 -44.649 19.345 1.00 86.54  ? 21   ALA G C     1 
ATOM   4582  O  O     . ALA G 3 21  ? -28.032 -44.976 20.406 1.00 81.13  ? 21   ALA G O     1 
ATOM   4583  C  CB    . ALA G 3 21  ? -27.210 -42.616 18.700 1.00 98.42  ? 21   ALA G CB    1 
ATOM   4584  N  N     . GLY G 3 22  ? -29.822 -44.869 19.080 1.00 90.13  ? 22   GLY G N     1 
ATOM   4585  C  CA    . GLY G 3 22  ? -30.648 -45.727 19.922 1.00 90.00  ? 22   GLY G CA    1 
ATOM   4586  C  C     . GLY G 3 22  ? -31.205 -44.927 21.048 1.00 91.47  ? 22   GLY G C     1 
ATOM   4587  O  O     . GLY G 3 22  ? -31.540 -45.471 22.098 1.00 98.47  ? 22   GLY G O     1 
ATOM   4588  N  N     . LEU G 3 23  ? -31.340 -43.628 20.806 1.00 89.00  ? 23   LEU G N     1 
ATOM   4589  C  CA    . LEU G 3 23  ? -31.604 -42.679 21.862 1.00 83.58  ? 23   LEU G CA    1 
ATOM   4590  C  C     . LEU G 3 23  ? -32.932 -41.992 21.673 1.00 82.51  ? 23   LEU G C     1 
ATOM   4591  O  O     . LEU G 3 23  ? -33.293 -41.615 20.559 1.00 87.26  ? 23   LEU G O     1 
ATOM   4592  C  CB    . LEU G 3 23  ? -30.495 -41.634 21.905 1.00 80.22  ? 23   LEU G CB    1 
ATOM   4593  C  CG    . LEU G 3 23  ? -29.119 -42.123 22.359 1.00 82.98  ? 23   LEU G CG    1 
ATOM   4594  C  CD1   . LEU G 3 23  ? -28.059 -41.049 22.096 1.00 79.46  ? 23   LEU G CD1   1 
ATOM   4595  C  CD2   . LEU G 3 23  ? -29.131 -42.536 23.837 1.00 83.80  ? 23   LEU G CD2   1 
ATOM   4596  N  N     . GLN G 3 24  ? -33.634 -41.819 22.787 1.00 81.56  ? 24   GLN G N     1 
ATOM   4597  C  CA    . GLN G 3 24  ? -34.827 -41.008 22.846 1.00 82.74  ? 24   GLN G CA    1 
ATOM   4598  C  C     . GLN G 3 24  ? -34.559 -39.505 22.877 1.00 81.73  ? 24   GLN G C     1 
ATOM   4599  O  O     . GLN G 3 24  ? -35.487 -38.729 22.819 1.00 86.47  ? 24   GLN G O     1 
ATOM   4600  C  CB    . GLN G 3 24  ? -35.606 -41.379 24.088 1.00 91.84  ? 24   GLN G CB    1 
ATOM   4601  C  CG    . GLN G 3 24  ? -36.045 -42.833 24.113 1.00 97.91  ? 24   GLN G CG    1 
ATOM   4602  C  CD    . GLN G 3 24  ? -36.977 -43.147 22.970 1.00 98.64  ? 24   GLN G CD    1 
ATOM   4603  O  OE1   . GLN G 3 24  ? -37.958 -42.440 22.748 1.00 96.97  ? 24   GLN G OE1   1 
ATOM   4604  N  NE2   . GLN G 3 24  ? -36.672 -44.201 22.227 1.00 103.94 ? 24   GLN G NE2   1 
ATOM   4605  N  N     . PHE G 3 25  ? -33.303 -39.089 22.963 1.00 81.92  ? 25   PHE G N     1 
ATOM   4606  C  CA    . PHE G 3 25  ? -32.976 -37.682 23.204 1.00 82.29  ? 25   PHE G CA    1 
ATOM   4607  C  C     . PHE G 3 25  ? -32.345 -37.116 21.948 1.00 81.35  ? 25   PHE G C     1 
ATOM   4608  O  O     . PHE G 3 25  ? -31.521 -37.771 21.316 1.00 82.75  ? 25   PHE G O     1 
ATOM   4609  C  CB    . PHE G 3 25  ? -32.000 -37.532 24.400 1.00 88.85  ? 25   PHE G CB    1 
ATOM   4610  C  CG    . PHE G 3 25  ? -32.656 -37.145 25.715 1.00 73.84  ? 25   PHE G CG    1 
ATOM   4611  C  CD1   . PHE G 3 25  ? -33.666 -37.908 26.265 1.00 75.13  ? 25   PHE G CD1   1 
ATOM   4612  C  CD2   . PHE G 3 25  ? -32.232 -36.024 26.398 1.00 73.48  ? 25   PHE G CD2   1 
ATOM   4613  C  CE1   . PHE G 3 25  ? -34.254 -37.557 27.460 1.00 75.98  ? 25   PHE G CE1   1 
ATOM   4614  C  CE2   . PHE G 3 25  ? -32.824 -35.660 27.588 1.00 79.04  ? 25   PHE G CE2   1 
ATOM   4615  C  CZ    . PHE G 3 25  ? -33.832 -36.435 28.128 1.00 78.76  ? 25   PHE G CZ    1 
ATOM   4616  N  N     . PRO G 3 26  ? -32.705 -35.875 21.602 1.00 85.41  ? 26   PRO G N     1 
ATOM   4617  C  CA    . PRO G 3 26  ? -32.450 -35.327 20.276 1.00 78.87  ? 26   PRO G CA    1 
ATOM   4618  C  C     . PRO G 3 26  ? -31.005 -34.950 20.022 1.00 70.63  ? 26   PRO G C     1 
ATOM   4619  O  O     . PRO G 3 26  ? -30.555 -33.834 20.308 1.00 72.70  ? 26   PRO G O     1 
ATOM   4620  C  CB    . PRO G 3 26  ? -33.370 -34.103 20.222 1.00 81.06  ? 26   PRO G CB    1 
ATOM   4621  C  CG    . PRO G 3 26  ? -33.444 -33.652 21.631 1.00 83.92  ? 26   PRO G CG    1 
ATOM   4622  C  CD    . PRO G 3 26  ? -33.413 -34.909 22.459 1.00 88.26  ? 26   PRO G CD    1 
ATOM   4623  N  N     . VAL G 3 27  ? -30.301 -35.890 19.433 1.00 63.32  ? 27   VAL G N     1 
ATOM   4624  C  CA    . VAL G 3 27  ? -28.965 -35.643 18.949 1.00 59.57  ? 27   VAL G CA    1 
ATOM   4625  C  C     . VAL G 3 27  ? -28.912 -34.412 18.059 1.00 67.67  ? 27   VAL G C     1 
ATOM   4626  O  O     . VAL G 3 27  ? -27.975 -33.639 18.139 1.00 84.76  ? 27   VAL G O     1 
ATOM   4627  C  CB    . VAL G 3 27  ? -28.492 -36.843 18.162 1.00 56.91  ? 27   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G 3 27  ? -27.018 -36.726 17.818 1.00 57.61  ? 27   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G 3 27  ? -28.788 -38.102 18.981 1.00 60.21  ? 27   VAL G CG2   1 
ATOM   4630  N  N     . GLY G 3 28  ? -29.910 -34.218 17.207 1.00 73.27  ? 28   GLY G N     1 
ATOM   4631  C  CA    . GLY G 3 28  ? -29.902 -33.070 16.329 1.00 72.30  ? 28   GLY G CA    1 
ATOM   4632  C  C     . GLY G 3 28  ? -29.886 -31.789 17.133 1.00 72.86  ? 28   GLY G C     1 
ATOM   4633  O  O     . GLY G 3 28  ? -29.031 -30.912 16.950 1.00 75.71  ? 28   GLY G O     1 
ATOM   4634  N  N     . ARG G 3 29  ? -30.835 -31.687 18.044 1.00 69.12  ? 29   ARG G N     1 
ATOM   4635  C  CA    . ARG G 3 29  ? -31.000 -30.468 18.813 1.00 67.03  ? 29   ARG G CA    1 
ATOM   4636  C  C     . ARG G 3 29  ? -29.767 -30.203 19.638 1.00 69.30  ? 29   ARG G C     1 
ATOM   4637  O  O     . ARG G 3 29  ? -29.267 -29.070 19.696 1.00 66.89  ? 29   ARG G O     1 
ATOM   4638  C  CB    . ARG G 3 29  ? -32.201 -30.584 19.724 1.00 63.76  ? 29   ARG G CB    1 
ATOM   4639  C  CG    . ARG G 3 29  ? -32.618 -29.275 20.335 1.00 67.22  ? 29   ARG G CG    1 
ATOM   4640  C  CD    . ARG G 3 29  ? -33.897 -29.474 21.128 1.00 74.16  ? 29   ARG G CD    1 
ATOM   4641  N  NE    . ARG G 3 29  ? -35.113 -29.440 20.328 1.00 73.13  ? 29   ARG G NE    1 
ATOM   4642  C  CZ    . ARG G 3 29  ? -36.346 -29.460 20.835 1.00 80.60  ? 29   ARG G CZ    1 
ATOM   4643  N  NH1   . ARG G 3 29  ? -36.541 -29.548 22.145 1.00 84.21  ? 29   ARG G NH1   1 
ATOM   4644  N  NH2   . ARG G 3 29  ? -37.401 -29.399 20.026 1.00 89.53  ? 29   ARG G NH2   1 
ATOM   4645  N  N     . VAL G 3 30  ? -29.274 -31.263 20.263 1.00 66.78  ? 30   VAL G N     1 
ATOM   4646  C  CA    . VAL G 3 30  ? -28.101 -31.149 21.092 1.00 64.22  ? 30   VAL G CA    1 
ATOM   4647  C  C     . VAL G 3 30  ? -26.962 -30.604 20.264 1.00 67.46  ? 30   VAL G C     1 
ATOM   4648  O  O     . VAL G 3 30  ? -26.221 -29.724 20.720 1.00 72.75  ? 30   VAL G O     1 
ATOM   4649  C  CB    . VAL G 3 30  ? -27.729 -32.498 21.730 1.00 65.54  ? 30   VAL G CB    1 
ATOM   4650  C  CG1   . VAL G 3 30  ? -26.296 -32.495 22.232 1.00 67.83  ? 30   VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G 3 30  ? -28.680 -32.800 22.871 1.00 67.75  ? 30   VAL G CG2   1 
ATOM   4652  N  N     . HIS G 3 31  ? -26.826 -31.108 19.042 1.00 70.57  ? 31   HIS G N     1 
ATOM   4653  C  CA    . HIS G 3 31  ? -25.739 -30.664 18.180 1.00 70.21  ? 31   HIS G CA    1 
ATOM   4654  C  C     . HIS G 3 31  ? -25.858 -29.171 17.962 1.00 70.15  ? 31   HIS G C     1 
ATOM   4655  O  O     . HIS G 3 31  ? -24.878 -28.432 18.035 1.00 65.05  ? 31   HIS G O     1 
ATOM   4656  C  CB    . HIS G 3 31  ? -25.788 -31.360 16.830 1.00 75.97  ? 31   HIS G CB    1 
ATOM   4657  C  CG    . HIS G 3 31  ? -24.498 -31.287 16.080 1.00 87.45  ? 31   HIS G CG    1 
ATOM   4658  N  ND1   . HIS G 3 31  ? -23.594 -30.260 16.244 1.00 87.75  ? 31   HIS G ND1   1 
ATOM   4659  C  CD2   . HIS G 3 31  ? -23.953 -32.119 15.163 1.00 90.72  ? 31   HIS G CD2   1 
ATOM   4660  C  CE1   . HIS G 3 31  ? -22.542 -30.475 15.473 1.00 91.54  ? 31   HIS G CE1   1 
ATOM   4661  N  NE2   . HIS G 3 31  ? -22.740 -31.590 14.798 1.00 87.60  ? 31   HIS G NE2   1 
ATOM   4662  N  N     . ARG G 3 32  ? -27.079 -28.741 17.681 1.00 68.28  ? 32   ARG G N     1 
ATOM   4663  C  CA    . ARG G 3 32  ? -27.322 -27.370 17.311 1.00 72.20  ? 32   ARG G CA    1 
ATOM   4664  C  C     . ARG G 3 32  ? -26.959 -26.479 18.472 1.00 73.71  ? 32   ARG G C     1 
ATOM   4665  O  O     . ARG G 3 32  ? -26.075 -25.611 18.346 1.00 71.86  ? 32   ARG G O     1 
ATOM   4666  C  CB    . ARG G 3 32  ? -28.792 -27.208 16.919 1.00 72.96  ? 32   ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3 32  ? -29.204 -25.835 16.446 1.00 65.82  ? 32   ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3 32  ? -30.716 -25.772 16.555 1.00 77.92  ? 32   ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3 32  ? -31.190 -25.372 17.884 1.00 80.62  ? 32   ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3 32  ? -32.324 -25.774 18.475 1.00 83.48  ? 32   ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3 32  ? -33.149 -26.653 17.914 1.00 84.02  ? 32   ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3 32  ? -32.621 -25.307 19.681 1.00 89.13  ? 32   ARG G NH2   1 
ATOM   4673  N  N     . LEU G 3 33  ? -27.626 -26.738 19.601 1.00 70.17  ? 33   LEU G N     1 
ATOM   4674  C  CA    . LEU G 3 33  ? -27.425 -25.998 20.835 1.00 66.28  ? 33   LEU G CA    1 
ATOM   4675  C  C     . LEU G 3 33  ? -25.940 -25.845 21.189 1.00 71.39  ? 33   LEU G C     1 
ATOM   4676  O  O     . LEU G 3 33  ? -25.517 -24.787 21.638 1.00 86.03  ? 33   LEU G O     1 
ATOM   4677  C  CB    . LEU G 3 33  ? -28.176 -26.678 21.964 1.00 65.94  ? 33   LEU G CB    1 
ATOM   4678  C  CG    . LEU G 3 33  ? -29.720 -26.562 21.922 1.00 65.85  ? 33   LEU G CG    1 
ATOM   4679  C  CD1   . LEU G 3 33  ? -30.354 -27.421 22.996 1.00 65.84  ? 33   LEU G CD1   1 
ATOM   4680  C  CD2   . LEU G 3 33  ? -30.263 -25.153 22.099 1.00 63.91  ? 33   LEU G CD2   1 
ATOM   4681  N  N     . LEU G 3 34  ? -25.149 -26.877 20.948 1.00 68.87  ? 34   LEU G N     1 
ATOM   4682  C  CA    . LEU G 3 34  ? -23.708 -26.773 21.110 1.00 72.78  ? 34   LEU G CA    1 
ATOM   4683  C  C     . LEU G 3 34  ? -23.042 -25.758 20.201 1.00 81.06  ? 34   LEU G C     1 
ATOM   4684  O  O     . LEU G 3 34  ? -22.089 -25.115 20.627 1.00 93.90  ? 34   LEU G O     1 
ATOM   4685  C  CB    . LEU G 3 34  ? -23.015 -28.136 20.898 1.00 77.21  ? 34   LEU G CB    1 
ATOM   4686  C  CG    . LEU G 3 34  ? -23.051 -29.162 22.052 1.00 80.30  ? 34   LEU G CG    1 
ATOM   4687  C  CD1   . LEU G 3 34  ? -22.533 -30.502 21.570 1.00 76.02  ? 34   LEU G CD1   1 
ATOM   4688  C  CD2   . LEU G 3 34  ? -22.261 -28.725 23.285 1.00 80.22  ? 34   LEU G CD2   1 
ATOM   4689  N  N     . ARG G 3 35  ? -23.482 -25.640 18.946 1.00 91.78  ? 35   ARG G N     1 
ATOM   4690  C  CA    . ARG G 3 35  ? -22.860 -24.676 18.014 1.00 88.29  ? 35   ARG G CA    1 
ATOM   4691  C  C     . ARG G 3 35  ? -23.234 -23.274 18.442 1.00 89.24  ? 35   ARG G C     1 
ATOM   4692  O  O     . ARG G 3 35  ? -22.391 -22.379 18.558 1.00 86.37  ? 35   ARG G O     1 
ATOM   4693  C  CB    . ARG G 3 35  ? -23.351 -24.836 16.588 1.00 95.15  ? 35   ARG G CB    1 
ATOM   4694  C  CG    . ARG G 3 35  ? -23.564 -26.250 16.120 1.00 106.80 ? 35   ARG G CG    1 
ATOM   4695  C  CD    . ARG G 3 35  ? -23.788 -26.269 14.616 1.00 111.38 ? 35   ARG G CD    1 
ATOM   4696  N  NE    . ARG G 3 35  ? -23.126 -27.419 14.022 1.00 114.91 ? 35   ARG G NE    1 
ATOM   4697  C  CZ    . ARG G 3 35  ? -21.802 -27.580 13.960 1.00 123.04 ? 35   ARG G CZ    1 
ATOM   4698  N  NH1   . ARG G 3 35  ? -20.965 -26.667 14.471 1.00 124.77 ? 35   ARG G NH1   1 
ATOM   4699  N  NH2   . ARG G 3 35  ? -21.306 -28.673 13.387 1.00 127.30 ? 35   ARG G NH2   1 
ATOM   4700  N  N     . LYS G 3 36  ? -24.520 -23.086 18.712 1.00 90.30  ? 36   LYS G N     1 
ATOM   4701  C  CA    . LYS G 3 36  ? -25.014 -21.761 19.019 1.00 97.85  ? 36   LYS G CA    1 
ATOM   4702  C  C     . LYS G 3 36  ? -24.886 -21.537 20.517 1.00 90.71  ? 36   LYS G C     1 
ATOM   4703  O  O     . LYS G 3 36  ? -25.761 -20.944 21.144 1.00 96.46  ? 36   LYS G O     1 
ATOM   4704  C  CB    . LYS G 3 36  ? -26.446 -21.570 18.464 1.00 112.78 ? 36   LYS G CB    1 
ATOM   4705  C  CG    . LYS G 3 36  ? -26.607 -22.160 17.052 1.00 120.97 ? 36   LYS G CG    1 
ATOM   4706  C  CD    . LYS G 3 36  ? -27.206 -21.249 15.977 1.00 124.06 ? 36   LYS G CD    1 
ATOM   4707  C  CE    . LYS G 3 36  ? -26.800 -21.748 14.577 1.00 129.57 ? 36   LYS G CE    1 
ATOM   4708  N  NZ    . LYS G 3 36  ? -27.837 -21.622 13.510 1.00 128.84 ? 36   LYS G NZ    1 
ATOM   4709  N  N     . GLY G 3 37  ? -23.780 -22.041 21.073 1.00 85.28  ? 37   GLY G N     1 
ATOM   4710  C  CA    . GLY G 3 37  ? -23.418 -21.870 22.474 1.00 77.38  ? 37   GLY G CA    1 
ATOM   4711  C  C     . GLY G 3 37  ? -22.030 -21.282 22.637 1.00 73.52  ? 37   GLY G C     1 
ATOM   4712  O  O     . GLY G 3 37  ? -21.584 -21.029 23.739 1.00 72.36  ? 37   GLY G O     1 
ATOM   4713  N  N     . ASN G 3 38  ? -21.332 -21.036 21.543 1.00 78.97  ? 38   ASN G N     1 
ATOM   4714  C  CA    . ASN G 3 38  ? -19.988 -20.486 21.648 1.00 87.81  ? 38   ASN G CA    1 
ATOM   4715  C  C     . ASN G 3 38  ? -19.211 -21.271 22.668 1.00 73.38  ? 38   ASN G C     1 
ATOM   4716  O  O     . ASN G 3 38  ? -18.540 -20.706 23.511 1.00 85.66  ? 38   ASN G O     1 
ATOM   4717  C  CB    . ASN G 3 38  ? -20.002 -19.017 22.108 1.00 98.07  ? 38   ASN G CB    1 
ATOM   4718  C  CG    . ASN G 3 38  ? -20.696 -18.088 21.136 1.00 96.74  ? 38   ASN G CG    1 
ATOM   4719  O  OD1   . ASN G 3 38  ? -21.817 -17.649 21.378 1.00 93.15  ? 38   ASN G OD1   1 
ATOM   4720  N  ND2   . ASN G 3 38  ? -20.022 -17.762 20.046 1.00 102.48 ? 38   ASN G ND2   1 
ATOM   4721  N  N     . TYR G 3 39  ? -19.319 -22.580 22.614 1.00 73.51  ? 39   TYR G N     1 
ATOM   4722  C  CA    . TYR G 3 39  ? -18.536 -23.418 23.498 1.00 68.51  ? 39   TYR G CA    1 
ATOM   4723  C  C     . TYR G 3 39  ? -17.188 -23.653 22.828 1.00 76.98  ? 39   TYR G C     1 
ATOM   4724  O  O     . TYR G 3 39  ? -16.149 -23.587 23.503 1.00 83.36  ? 39   TYR G O     1 
ATOM   4725  C  CB    . TYR G 3 39  ? -19.292 -24.707 23.801 1.00 65.10  ? 39   TYR G CB    1 
ATOM   4726  C  CG    . TYR G 3 39  ? -20.553 -24.493 24.628 1.00 58.67  ? 39   TYR G CG    1 
ATOM   4727  C  CD1   . TYR G 3 39  ? -21.801 -24.687 24.111 1.00 56.11  ? 39   TYR G CD1   1 
ATOM   4728  C  CD2   . TYR G 3 39  ? -20.464 -24.099 25.935 1.00 66.70  ? 39   TYR G CD2   1 
ATOM   4729  C  CE1   . TYR G 3 39  ? -22.940 -24.502 24.891 1.00 60.83  ? 39   TYR G CE1   1 
ATOM   4730  C  CE2   . TYR G 3 39  ? -21.578 -23.912 26.729 1.00 66.47  ? 39   TYR G CE2   1 
ATOM   4731  C  CZ    . TYR G 3 39  ? -22.821 -24.119 26.216 1.00 66.23  ? 39   TYR G CZ    1 
ATOM   4732  O  OH    . TYR G 3 39  ? -23.910 -23.926 27.066 1.00 65.75  ? 39   TYR G OH    1 
ATOM   4733  N  N     . ALA G 3 40  ? -17.189 -23.881 21.504 1.00 81.29  ? 40   ALA G N     1 
ATOM   4734  C  CA    . ALA G 3 40  ? -15.939 -23.809 20.713 1.00 89.62  ? 40   ALA G CA    1 
ATOM   4735  C  C     . ALA G 3 40  ? -16.157 -23.452 19.245 1.00 89.97  ? 40   ALA G C     1 
ATOM   4736  O  O     . ALA G 3 40  ? -17.297 -23.419 18.787 1.00 88.93  ? 40   ALA G O     1 
ATOM   4737  C  CB    . ALA G 3 40  ? -15.176 -25.107 20.824 1.00 88.03  ? 40   ALA G CB    1 
ATOM   4738  N  N     . GLU G 3 41  ? -15.066 -23.184 18.517 1.00 91.37  ? 41   GLU G N     1 
ATOM   4739  C  CA    . GLU G 3 41  ? -15.153 -22.905 17.060 1.00 96.66  ? 41   GLU G CA    1 
ATOM   4740  C  C     . GLU G 3 41  ? -15.928 -24.022 16.352 1.00 87.61  ? 41   GLU G C     1 
ATOM   4741  O  O     . GLU G 3 41  ? -16.761 -23.763 15.509 1.00 86.02  ? 41   GLU G O     1 
ATOM   4742  C  CB    . GLU G 3 41  ? -13.761 -22.803 16.382 1.00 103.43 ? 41   GLU G CB    1 
ATOM   4743  C  CG    . GLU G 3 41  ? -12.773 -21.759 16.910 1.00 115.45 ? 41   GLU G CG    1 
ATOM   4744  C  CD    . GLU G 3 41  ? -12.944 -20.358 16.327 1.00 122.46 ? 41   GLU G CD    1 
ATOM   4745  O  OE1   . GLU G 3 41  ? -13.610 -20.195 15.278 1.00 130.41 ? 41   GLU G OE1   1 
ATOM   4746  O  OE2   . GLU G 3 41  ? -12.381 -19.407 16.922 1.00 135.87 ? 41   GLU G OE2   1 
ATOM   4747  N  N     . ARG G 3 42  ? -15.647 -25.263 16.731 1.00 92.09  ? 42   ARG G N     1 
ATOM   4748  C  CA    . ARG G 3 42  ? -16.021 -26.440 15.962 1.00 96.83  ? 42   ARG G CA    1 
ATOM   4749  C  C     . ARG G 3 42  ? -16.573 -27.520 16.866 1.00 91.19  ? 42   ARG G C     1 
ATOM   4750  O  O     . ARG G 3 42  ? -16.341 -27.485 18.045 1.00 94.18  ? 42   ARG G O     1 
ATOM   4751  C  CB    . ARG G 3 42  ? -14.780 -27.017 15.301 1.00 103.40 ? 42   ARG G CB    1 
ATOM   4752  C  CG    . ARG G 3 42  ? -14.100 -26.125 14.271 1.00 105.01 ? 42   ARG G CG    1 
ATOM   4753  C  CD    . ARG G 3 42  ? -13.182 -26.985 13.417 1.00 114.55 ? 42   ARG G CD    1 
ATOM   4754  N  NE    . ARG G 3 42  ? -13.160 -26.579 12.013 1.00 122.06 ? 42   ARG G NE    1 
ATOM   4755  C  CZ    . ARG G 3 42  ? -13.148 -27.422 10.981 1.00 132.97 ? 42   ARG G CZ    1 
ATOM   4756  N  NH1   . ARG G 3 42  ? -13.186 -28.744 11.166 1.00 125.12 ? 42   ARG G NH1   1 
ATOM   4757  N  NH2   . ARG G 3 42  ? -13.124 -26.939 9.744  1.00 149.03 ? 42   ARG G NH2   1 
ATOM   4758  N  N     . VAL G 3 43  ? -17.254 -28.506 16.303 1.00 82.58  ? 43   VAL G N     1 
ATOM   4759  C  CA    . VAL G 3 43  ? -17.950 -29.498 17.090 1.00 79.53  ? 43   VAL G CA    1 
ATOM   4760  C  C     . VAL G 3 43  ? -17.974 -30.808 16.360 1.00 83.84  ? 43   VAL G C     1 
ATOM   4761  O  O     . VAL G 3 43  ? -18.713 -30.964 15.377 1.00 90.75  ? 43   VAL G O     1 
ATOM   4762  C  CB    . VAL G 3 43  ? -19.429 -29.115 17.290 1.00 86.46  ? 43   VAL G CB    1 
ATOM   4763  C  CG1   . VAL G 3 43  ? -20.220 -30.257 17.946 1.00 87.37  ? 43   VAL G CG1   1 
ATOM   4764  C  CG2   . VAL G 3 43  ? -19.553 -27.831 18.098 1.00 86.06  ? 43   VAL G CG2   1 
ATOM   4765  N  N     . GLY G 3 44  ? -17.221 -31.769 16.878 1.00 86.54  ? 44   GLY G N     1 
ATOM   4766  C  CA    . GLY G 3 44  ? -17.181 -33.130 16.320 1.00 86.88  ? 44   GLY G CA    1 
ATOM   4767  C  C     . GLY G 3 44  ? -18.539 -33.807 16.236 1.00 77.92  ? 44   GLY G C     1 
ATOM   4768  O  O     . GLY G 3 44  ? -19.502 -33.374 16.843 1.00 76.97  ? 44   GLY G O     1 
ATOM   4769  N  N     . ALA G 3 45  ? -18.606 -34.885 15.474 1.00 81.47  ? 45   ALA G N     1 
ATOM   4770  C  CA    . ALA G 3 45  ? -19.878 -35.498 15.144 1.00 75.78  ? 45   ALA G CA    1 
ATOM   4771  C  C     . ALA G 3 45  ? -20.424 -36.325 16.285 1.00 75.80  ? 45   ALA G C     1 
ATOM   4772  O  O     . ALA G 3 45  ? -21.631 -36.497 16.360 1.00 78.92  ? 45   ALA G O     1 
ATOM   4773  C  CB    . ALA G 3 45  ? -19.733 -36.351 13.902 1.00 74.77  ? 45   ALA G CB    1 
ATOM   4774  N  N     . GLY G 3 46  ? -19.550 -36.844 17.153 1.00 77.42  ? 46   GLY G N     1 
ATOM   4775  C  CA    . GLY G 3 46  ? -19.965 -37.760 18.239 1.00 82.63  ? 46   GLY G CA    1 
ATOM   4776  C  C     . GLY G 3 46  ? -20.385 -37.066 19.525 1.00 87.97  ? 46   GLY G C     1 
ATOM   4777  O  O     . GLY G 3 46  ? -21.305 -37.515 20.244 1.00 80.59  ? 46   GLY G O     1 
ATOM   4778  N  N     . ALA G 3 47  ? -19.708 -35.955 19.804 1.00 82.53  ? 47   ALA G N     1 
ATOM   4779  C  CA    . ALA G 3 47  ? -20.009 -35.137 20.959 1.00 74.02  ? 47   ALA G CA    1 
ATOM   4780  C  C     . ALA G 3 47  ? -21.518 -35.005 21.242 1.00 76.32  ? 47   ALA G C     1 
ATOM   4781  O  O     . ALA G 3 47  ? -21.941 -35.234 22.367 1.00 78.82  ? 47   ALA G O     1 
ATOM   4782  C  CB    . ALA G 3 47  ? -19.354 -33.773 20.817 1.00 71.61  ? 47   ALA G CB    1 
ATOM   4783  N  N     . PRO G 3 48  ? -22.343 -34.655 20.237 1.00 80.59  ? 48   PRO G N     1 
ATOM   4784  C  CA    . PRO G 3 48  ? -23.767 -34.515 20.631 1.00 79.48  ? 48   PRO G CA    1 
ATOM   4785  C  C     . PRO G 3 48  ? -24.394 -35.854 20.951 1.00 81.60  ? 48   PRO G C     1 
ATOM   4786  O  O     . PRO G 3 48  ? -25.357 -35.944 21.726 1.00 81.35  ? 48   PRO G O     1 
ATOM   4787  C  CB    . PRO G 3 48  ? -24.436 -33.888 19.406 1.00 78.97  ? 48   PRO G CB    1 
ATOM   4788  C  CG    . PRO G 3 48  ? -23.469 -34.094 18.286 1.00 87.26  ? 48   PRO G CG    1 
ATOM   4789  C  CD    . PRO G 3 48  ? -22.088 -34.169 18.872 1.00 79.30  ? 48   PRO G CD    1 
ATOM   4790  N  N     . VAL G 3 49  ? -23.852 -36.902 20.362 1.00 82.04  ? 49   VAL G N     1 
ATOM   4791  C  CA    . VAL G 3 49  ? -24.394 -38.225 20.614 1.00 87.90  ? 49   VAL G CA    1 
ATOM   4792  C  C     . VAL G 3 49  ? -24.091 -38.585 22.067 1.00 79.96  ? 49   VAL G C     1 
ATOM   4793  O  O     . VAL G 3 49  ? -24.993 -38.933 22.876 1.00 69.16  ? 49   VAL G O     1 
ATOM   4794  C  CB    . VAL G 3 49  ? -23.798 -39.266 19.645 1.00 87.38  ? 49   VAL G CB    1 
ATOM   4795  C  CG1   . VAL G 3 49  ? -24.336 -40.650 19.963 1.00 93.96  ? 49   VAL G CG1   1 
ATOM   4796  C  CG2   . VAL G 3 49  ? -24.153 -38.899 18.218 1.00 85.81  ? 49   VAL G CG2   1 
ATOM   4797  N  N     . TYR G 3 50  ? -22.806 -38.470 22.381 1.00 70.52  ? 50   TYR G N     1 
ATOM   4798  C  CA    . TYR G 3 50  ? -22.313 -38.707 23.735 1.00 73.40  ? 50   TYR G CA    1 
ATOM   4799  C  C     . TYR G 3 50  ? -23.126 -37.874 24.755 1.00 73.24  ? 50   TYR G C     1 
ATOM   4800  O  O     . TYR G 3 50  ? -23.734 -38.384 25.711 1.00 66.45  ? 50   TYR G O     1 
ATOM   4801  C  CB    . TYR G 3 50  ? -20.822 -38.333 23.774 1.00 73.47  ? 50   TYR G CB    1 
ATOM   4802  C  CG    . TYR G 3 50  ? -20.049 -38.991 24.891 1.00 74.59  ? 50   TYR G CG    1 
ATOM   4803  C  CD1   . TYR G 3 50  ? -18.897 -39.712 24.631 1.00 68.11  ? 50   TYR G CD1   1 
ATOM   4804  C  CD2   . TYR G 3 50  ? -20.476 -38.881 26.210 1.00 76.65  ? 50   TYR G CD2   1 
ATOM   4805  C  CE1   . TYR G 3 50  ? -18.204 -40.316 25.651 1.00 74.10  ? 50   TYR G CE1   1 
ATOM   4806  C  CE2   . TYR G 3 50  ? -19.787 -39.471 27.240 1.00 78.15  ? 50   TYR G CE2   1 
ATOM   4807  C  CZ    . TYR G 3 50  ? -18.650 -40.194 26.965 1.00 82.78  ? 50   TYR G CZ    1 
ATOM   4808  O  OH    . TYR G 3 50  ? -17.955 -40.787 28.020 1.00 84.59  ? 50   TYR G OH    1 
ATOM   4809  N  N     . LEU G 3 51  ? -23.154 -36.576 24.505 1.00 70.57  ? 51   LEU G N     1 
ATOM   4810  C  CA    . LEU G 3 51  ? -23.808 -35.672 25.384 1.00 68.98  ? 51   LEU G CA    1 
ATOM   4811  C  C     . LEU G 3 51  ? -25.251 -36.088 25.567 1.00 69.29  ? 51   LEU G C     1 
ATOM   4812  O  O     . LEU G 3 51  ? -25.742 -36.145 26.695 1.00 82.21  ? 51   LEU G O     1 
ATOM   4813  C  CB    . LEU G 3 51  ? -23.705 -34.255 24.834 1.00 72.28  ? 51   LEU G CB    1 
ATOM   4814  C  CG    . LEU G 3 51  ? -24.335 -33.137 25.673 1.00 74.75  ? 51   LEU G CG    1 
ATOM   4815  C  CD1   . LEU G 3 51  ? -24.103 -33.327 27.165 1.00 76.44  ? 51   LEU G CD1   1 
ATOM   4816  C  CD2   . LEU G 3 51  ? -23.777 -31.801 25.214 1.00 78.02  ? 51   LEU G CD2   1 
ATOM   4817  N  N     . ALA G 3 52  ? -25.921 -36.423 24.476 1.00 63.11  ? 52   ALA G N     1 
ATOM   4818  C  CA    . ALA G 3 52  ? -27.353 -36.704 24.545 1.00 65.35  ? 52   ALA G CA    1 
ATOM   4819  C  C     . ALA G 3 52  ? -27.669 -37.991 25.310 1.00 65.76  ? 52   ALA G C     1 
ATOM   4820  O  O     . ALA G 3 52  ? -28.707 -38.124 25.980 1.00 59.41  ? 52   ALA G O     1 
ATOM   4821  C  CB    . ALA G 3 52  ? -27.911 -36.774 23.157 1.00 71.46  ? 52   ALA G CB    1 
ATOM   4822  N  N     . ALA G 3 53  ? -26.749 -38.935 25.209 1.00 67.66  ? 53   ALA G N     1 
ATOM   4823  C  CA    . ALA G 3 53  ? -26.849 -40.189 25.931 1.00 66.29  ? 53   ALA G CA    1 
ATOM   4824  C  C     . ALA G 3 53  ? -26.839 -39.925 27.411 1.00 68.15  ? 53   ALA G C     1 
ATOM   4825  O  O     . ALA G 3 53  ? -27.687 -40.423 28.160 1.00 64.24  ? 53   ALA G O     1 
ATOM   4826  C  CB    . ALA G 3 53  ? -25.645 -41.055 25.574 1.00 71.45  ? 53   ALA G CB    1 
ATOM   4827  N  N     . VAL G 3 54  ? -25.833 -39.142 27.803 1.00 66.50  ? 54   VAL G N     1 
ATOM   4828  C  CA    . VAL G 3 54  ? -25.585 -38.793 29.184 1.00 65.52  ? 54   VAL G CA    1 
ATOM   4829  C  C     . VAL G 3 54  ? -26.814 -38.089 29.795 1.00 63.00  ? 54   VAL G C     1 
ATOM   4830  O  O     . VAL G 3 54  ? -27.279 -38.417 30.893 1.00 64.16  ? 54   VAL G O     1 
ATOM   4831  C  CB    . VAL G 3 54  ? -24.350 -37.892 29.249 1.00 67.25  ? 54   VAL G CB    1 
ATOM   4832  C  CG1   . VAL G 3 54  ? -24.113 -37.373 30.659 1.00 68.36  ? 54   VAL G CG1   1 
ATOM   4833  C  CG2   . VAL G 3 54  ? -23.127 -38.653 28.761 1.00 68.54  ? 54   VAL G CG2   1 
ATOM   4834  N  N     . LEU G 3 55  ? -27.377 -37.151 29.068 1.00 52.91  ? 55   LEU G N     1 
ATOM   4835  C  CA    . LEU G 3 55  ? -28.571 -36.518 29.563 1.00 58.74  ? 55   LEU G CA    1 
ATOM   4836  C  C     . LEU G 3 55  ? -29.729 -37.524 29.707 1.00 62.93  ? 55   LEU G C     1 
ATOM   4837  O  O     . LEU G 3 55  ? -30.551 -37.447 30.639 1.00 56.34  ? 55   LEU G O     1 
ATOM   4838  C  CB    . LEU G 3 55  ? -28.954 -35.353 28.645 1.00 58.68  ? 55   LEU G CB    1 
ATOM   4839  C  CG    . LEU G 3 55  ? -27.948 -34.187 28.531 1.00 60.91  ? 55   LEU G CG    1 
ATOM   4840  C  CD1   . LEU G 3 55  ? -28.270 -33.226 27.402 1.00 59.90  ? 55   LEU G CD1   1 
ATOM   4841  C  CD2   . LEU G 3 55  ? -27.862 -33.378 29.810 1.00 65.14  ? 55   LEU G CD2   1 
ATOM   4842  N  N     . GLU G 3 56  ? -29.802 -38.466 28.768 1.00 71.90  ? 56   GLU G N     1 
ATOM   4843  C  CA    . GLU G 3 56  ? -30.908 -39.413 28.757 1.00 70.67  ? 56   GLU G CA    1 
ATOM   4844  C  C     . GLU G 3 56  ? -30.750 -40.254 29.975 1.00 59.79  ? 56   GLU G C     1 
ATOM   4845  O  O     . GLU G 3 56  ? -31.654 -40.376 30.815 1.00 56.53  ? 56   GLU G O     1 
ATOM   4846  C  CB    . GLU G 3 56  ? -30.883 -40.297 27.514 1.00 77.34  ? 56   GLU G CB    1 
ATOM   4847  C  CG    . GLU G 3 56  ? -32.186 -41.063 27.302 1.00 84.61  ? 56   GLU G CG    1 
ATOM   4848  C  CD    . GLU G 3 56  ? -32.210 -41.890 26.023 1.00 91.27  ? 56   GLU G CD    1 
ATOM   4849  O  OE1   . GLU G 3 56  ? -31.581 -41.488 25.010 1.00 78.34  ? 56   GLU G OE1   1 
ATOM   4850  O  OE2   . GLU G 3 56  ? -32.892 -42.942 26.032 1.00 99.03  ? 56   GLU G OE2   1 
ATOM   4851  N  N     . TYR G 3 57  ? -29.555 -40.799 30.081 1.00 59.26  ? 57   TYR G N     1 
ATOM   4852  C  CA    . TYR G 3 57  ? -29.190 -41.599 31.233 1.00 65.35  ? 57   TYR G CA    1 
ATOM   4853  C  C     . TYR G 3 57  ? -29.622 -40.946 32.573 1.00 68.48  ? 57   TYR G C     1 
ATOM   4854  O  O     . TYR G 3 57  ? -30.398 -41.538 33.355 1.00 63.76  ? 57   TYR G O     1 
ATOM   4855  C  CB    . TYR G 3 57  ? -27.684 -41.847 31.227 1.00 64.97  ? 57   TYR G CB    1 
ATOM   4856  C  CG    . TYR G 3 57  ? -27.253 -42.424 32.534 1.00 70.60  ? 57   TYR G CG    1 
ATOM   4857  C  CD1   . TYR G 3 57  ? -27.789 -43.626 32.984 1.00 73.88  ? 57   TYR G CD1   1 
ATOM   4858  C  CD2   . TYR G 3 57  ? -26.364 -41.753 33.354 1.00 72.16  ? 57   TYR G CD2   1 
ATOM   4859  C  CE1   . TYR G 3 57  ? -27.419 -44.159 34.201 1.00 80.07  ? 57   TYR G CE1   1 
ATOM   4860  C  CE2   . TYR G 3 57  ? -25.972 -42.285 34.567 1.00 77.05  ? 57   TYR G CE2   1 
ATOM   4861  C  CZ    . TYR G 3 57  ? -26.506 -43.479 34.982 1.00 81.75  ? 57   TYR G CZ    1 
ATOM   4862  O  OH    . TYR G 3 57  ? -26.138 -43.969 36.194 1.00 90.65  ? 57   TYR G OH    1 
ATOM   4863  N  N     . LEU G 3 58  ? -29.141 -39.722 32.808 1.00 59.99  ? 58   LEU G N     1 
ATOM   4864  C  CA    . LEU G 3 58  ? -29.397 -39.059 34.061 1.00 58.84  ? 58   LEU G CA    1 
ATOM   4865  C  C     . LEU G 3 58  ? -30.879 -38.844 34.250 1.00 63.31  ? 58   LEU G C     1 
ATOM   4866  O  O     . LEU G 3 58  ? -31.395 -38.895 35.381 1.00 66.82  ? 58   LEU G O     1 
ATOM   4867  C  CB    . LEU G 3 58  ? -28.631 -37.735 34.150 1.00 58.96  ? 58   LEU G CB    1 
ATOM   4868  C  CG    . LEU G 3 58  ? -27.092 -37.871 34.234 1.00 62.00  ? 58   LEU G CG    1 
ATOM   4869  C  CD1   . LEU G 3 58  ? -26.348 -36.606 33.850 1.00 61.16  ? 58   LEU G CD1   1 
ATOM   4870  C  CD2   . LEU G 3 58  ? -26.656 -38.314 35.618 1.00 58.27  ? 58   LEU G CD2   1 
ATOM   4871  N  N     . THR G 3 59  ? -31.576 -38.612 33.148 1.00 63.74  ? 59   THR G N     1 
ATOM   4872  C  CA    . THR G 3 59  ? -33.009 -38.379 33.230 1.00 69.02  ? 59   THR G CA    1 
ATOM   4873  C  C     . THR G 3 59  ? -33.733 -39.631 33.686 1.00 69.97  ? 59   THR G C     1 
ATOM   4874  O  O     . THR G 3 59  ? -34.658 -39.592 34.504 1.00 66.98  ? 59   THR G O     1 
ATOM   4875  C  CB    . THR G 3 59  ? -33.537 -37.936 31.872 1.00 68.33  ? 59   THR G CB    1 
ATOM   4876  O  OG1   . THR G 3 59  ? -33.017 -36.639 31.608 1.00 65.50  ? 59   THR G OG1   1 
ATOM   4877  C  CG2   . THR G 3 59  ? -35.048 -37.868 31.869 1.00 67.20  ? 59   THR G CG2   1 
ATOM   4878  N  N     . ALA G 3 60  ? -33.291 -40.747 33.141 1.00 69.94  ? 60   ALA G N     1 
ATOM   4879  C  CA    . ALA G 3 60  ? -33.848 -42.019 33.522 1.00 73.40  ? 60   ALA G CA    1 
ATOM   4880  C  C     . ALA G 3 60  ? -33.682 -42.257 35.027 1.00 72.20  ? 60   ALA G C     1 
ATOM   4881  O  O     . ALA G 3 60  ? -34.656 -42.547 35.757 1.00 69.74  ? 60   ALA G O     1 
ATOM   4882  C  CB    . ALA G 3 60  ? -33.186 -43.130 32.721 1.00 70.52  ? 60   ALA G CB    1 
ATOM   4883  N  N     . GLU G 3 61  ? -32.448 -42.120 35.494 1.00 70.72  ? 61   GLU G N     1 
ATOM   4884  C  CA    . GLU G 3 61  ? -32.157 -42.401 36.898 1.00 75.53  ? 61   GLU G CA    1 
ATOM   4885  C  C     . GLU G 3 61  ? -33.126 -41.662 37.836 1.00 65.91  ? 61   GLU G C     1 
ATOM   4886  O  O     . GLU G 3 61  ? -33.701 -42.251 38.752 1.00 70.44  ? 61   GLU G O     1 
ATOM   4887  C  CB    . GLU G 3 61  ? -30.712 -42.032 37.217 1.00 84.42  ? 61   GLU G CB    1 
ATOM   4888  C  CG    . GLU G 3 61  ? -30.078 -42.848 38.331 1.00 92.13  ? 61   GLU G CG    1 
ATOM   4889  C  CD    . GLU G 3 61  ? -29.657 -44.207 37.849 1.00 105.61 ? 61   GLU G CD    1 
ATOM   4890  O  OE1   . GLU G 3 61  ? -28.485 -44.384 37.429 1.00 101.47 ? 61   GLU G OE1   1 
ATOM   4891  O  OE2   . GLU G 3 61  ? -30.528 -45.096 37.868 1.00 134.40 ? 61   GLU G OE2   1 
ATOM   4892  N  N     . ILE G 3 62  ? -33.323 -40.381 37.579 1.00 57.66  ? 62   ILE G N     1 
ATOM   4893  C  CA    . ILE G 3 62  ? -34.148 -39.563 38.429 1.00 58.03  ? 62   ILE G CA    1 
ATOM   4894  C  C     . ILE G 3 62  ? -35.593 -39.960 38.275 1.00 66.78  ? 62   ILE G C     1 
ATOM   4895  O  O     . ILE G 3 62  ? -36.338 -40.077 39.269 1.00 70.62  ? 62   ILE G O     1 
ATOM   4896  C  CB    . ILE G 3 62  ? -34.003 -38.083 38.072 1.00 63.81  ? 62   ILE G CB    1 
ATOM   4897  C  CG1   . ILE G 3 62  ? -32.661 -37.567 38.548 1.00 68.10  ? 62   ILE G CG1   1 
ATOM   4898  C  CG2   . ILE G 3 62  ? -35.068 -37.234 38.745 1.00 62.78  ? 62   ILE G CG2   1 
ATOM   4899  C  CD1   . ILE G 3 62  ? -32.307 -36.226 37.948 1.00 77.41  ? 62   ILE G CD1   1 
ATOM   4900  N  N     . LEU G 3 63  ? -36.007 -40.163 37.028 1.00 66.49  ? 63   LEU G N     1 
ATOM   4901  C  CA    . LEU G 3 63  ? -37.373 -40.581 36.793 1.00 63.27  ? 63   LEU G CA    1 
ATOM   4902  C  C     . LEU G 3 63  ? -37.636 -41.925 37.458 1.00 62.03  ? 63   LEU G C     1 
ATOM   4903  O  O     . LEU G 3 63  ? -38.691 -42.103 38.086 1.00 62.07  ? 63   LEU G O     1 
ATOM   4904  C  CB    . LEU G 3 63  ? -37.663 -40.647 35.321 1.00 65.46  ? 63   LEU G CB    1 
ATOM   4905  C  CG    . LEU G 3 63  ? -37.712 -39.289 34.646 1.00 68.17  ? 63   LEU G CG    1 
ATOM   4906  C  CD1   . LEU G 3 63  ? -37.781 -39.520 33.157 1.00 73.04  ? 63   LEU G CD1   1 
ATOM   4907  C  CD2   . LEU G 3 63  ? -38.885 -38.439 35.122 1.00 65.73  ? 63   LEU G CD2   1 
ATOM   4908  N  N     . GLU G 3 64  ? -36.680 -42.852 37.371 1.00 57.53  ? 64   GLU G N     1 
ATOM   4909  C  CA    . GLU G 3 64  ? -36.842 -44.111 38.083 1.00 72.17  ? 64   GLU G CA    1 
ATOM   4910  C  C     . GLU G 3 64  ? -37.154 -43.843 39.548 1.00 75.65  ? 64   GLU G C     1 
ATOM   4911  O  O     . GLU G 3 64  ? -38.205 -44.236 40.058 1.00 82.68  ? 64   GLU G O     1 
ATOM   4912  C  CB    . GLU G 3 64  ? -35.612 -45.000 37.975 1.00 79.21  ? 64   GLU G CB    1 
ATOM   4913  C  CG    . GLU G 3 64  ? -35.831 -46.375 38.608 1.00 95.53  ? 64   GLU G CG    1 
ATOM   4914  C  CD    . GLU G 3 64  ? -34.588 -47.277 38.584 1.00 120.25 ? 64   GLU G CD    1 
ATOM   4915  O  OE1   . GLU G 3 64  ? -33.638 -47.014 37.799 1.00 119.02 ? 64   GLU G OE1   1 
ATOM   4916  O  OE2   . GLU G 3 64  ? -34.557 -48.263 39.365 1.00 133.44 ? 64   GLU G OE2   1 
ATOM   4917  N  N     . LEU G 3 65  ? -36.268 -43.112 40.208 1.00 72.50  ? 65   LEU G N     1 
ATOM   4918  C  CA    . LEU G 3 65  ? -36.340 -43.012 41.650 1.00 70.59  ? 65   LEU G CA    1 
ATOM   4919  C  C     . LEU G 3 65  ? -37.534 -42.185 42.063 1.00 69.22  ? 65   LEU G C     1 
ATOM   4920  O  O     . LEU G 3 65  ? -38.145 -42.426 43.118 1.00 66.83  ? 65   LEU G O     1 
ATOM   4921  C  CB    . LEU G 3 65  ? -35.027 -42.464 42.210 1.00 70.89  ? 65   LEU G CB    1 
ATOM   4922  C  CG    . LEU G 3 65  ? -33.792 -43.340 41.870 1.00 71.33  ? 65   LEU G CG    1 
ATOM   4923  C  CD1   . LEU G 3 65  ? -32.502 -42.539 41.848 1.00 77.55  ? 65   LEU G CD1   1 
ATOM   4924  C  CD2   . LEU G 3 65  ? -33.606 -44.514 42.806 1.00 66.02  ? 65   LEU G CD2   1 
ATOM   4925  N  N     . ALA G 3 66  ? -37.884 -41.223 41.215 1.00 68.59  ? 66   ALA G N     1 
ATOM   4926  C  CA    . ALA G 3 66  ? -39.003 -40.349 41.517 1.00 73.10  ? 66   ALA G CA    1 
ATOM   4927  C  C     . ALA G 3 66  ? -40.291 -41.133 41.360 1.00 79.72  ? 66   ALA G C     1 
ATOM   4928  O  O     . ALA G 3 66  ? -41.258 -40.893 42.086 1.00 82.29  ? 66   ALA G O     1 
ATOM   4929  C  CB    . ALA G 3 66  ? -38.987 -39.127 40.623 1.00 71.27  ? 66   ALA G CB    1 
ATOM   4930  N  N     . GLY G 3 67  ? -40.295 -42.075 40.417 1.00 83.78  ? 67   GLY G N     1 
ATOM   4931  C  CA    . GLY G 3 67  ? -41.416 -42.982 40.258 1.00 84.34  ? 67   GLY G CA    1 
ATOM   4932  C  C     . GLY G 3 67  ? -41.539 -43.826 41.509 1.00 80.65  ? 67   GLY G C     1 
ATOM   4933  O  O     . GLY G 3 67  ? -42.608 -43.926 42.124 1.00 84.49  ? 67   GLY G O     1 
ATOM   4934  N  N     . ASN G 3 68  ? -40.431 -44.412 41.922 1.00 71.68  ? 68   ASN G N     1 
ATOM   4935  C  CA    . ASN G 3 68  ? -40.463 -45.229 43.115 1.00 72.35  ? 68   ASN G CA    1 
ATOM   4936  C  C     . ASN G 3 68  ? -41.002 -44.429 44.273 1.00 73.27  ? 68   ASN G C     1 
ATOM   4937  O  O     . ASN G 3 68  ? -41.710 -44.945 45.115 1.00 75.22  ? 68   ASN G O     1 
ATOM   4938  C  CB    . ASN G 3 68  ? -39.078 -45.728 43.456 1.00 75.49  ? 68   ASN G CB    1 
ATOM   4939  C  CG    . ASN G 3 68  ? -38.476 -46.584 42.348 1.00 83.08  ? 68   ASN G CG    1 
ATOM   4940  O  OD1   . ASN G 3 68  ? -39.186 -47.043 41.425 1.00 84.56  ? 68   ASN G OD1   1 
ATOM   4941  N  ND2   . ASN G 3 68  ? -37.154 -46.818 42.433 1.00 73.14  ? 68   ASN G ND2   1 
ATOM   4942  N  N     . ALA G 3 69  ? -40.654 -43.154 44.300 1.00 76.06  ? 69   ALA G N     1 
ATOM   4943  C  CA    . ALA G 3 69  ? -41.118 -42.277 45.339 1.00 79.96  ? 69   ALA G CA    1 
ATOM   4944  C  C     . ALA G 3 69  ? -42.598 -42.063 45.246 1.00 76.58  ? 69   ALA G C     1 
ATOM   4945  O  O     . ALA G 3 69  ? -43.271 -42.021 46.264 1.00 77.43  ? 69   ALA G O     1 
ATOM   4946  C  CB    . ALA G 3 69  ? -40.399 -40.958 45.249 1.00 88.60  ? 69   ALA G CB    1 
ATOM   4947  N  N     . ALA G 3 70  ? -43.092 -41.906 44.023 1.00 86.88  ? 70   ALA G N     1 
ATOM   4948  C  CA    . ALA G 3 70  ? -44.540 -41.816 43.758 1.00 89.35  ? 70   ALA G CA    1 
ATOM   4949  C  C     . ALA G 3 70  ? -45.249 -43.051 44.284 1.00 86.55  ? 70   ALA G C     1 
ATOM   4950  O  O     . ALA G 3 70  ? -46.208 -42.953 45.062 1.00 90.33  ? 70   ALA G O     1 
ATOM   4951  C  CB    . ALA G 3 70  ? -44.809 -41.656 42.269 1.00 82.33  ? 70   ALA G CB    1 
ATOM   4952  N  N     . ARG G 3 71  ? -44.738 -44.208 43.880 1.00 80.93  ? 71   ARG G N     1 
ATOM   4953  C  CA    . ARG G 3 71  ? -45.263 -45.480 44.336 1.00 84.73  ? 71   ARG G CA    1 
ATOM   4954  C  C     . ARG G 3 71  ? -45.423 -45.464 45.864 1.00 85.28  ? 71   ARG G C     1 
ATOM   4955  O  O     . ARG G 3 71  ? -46.523 -45.570 46.388 1.00 91.93  ? 71   ARG G O     1 
ATOM   4956  C  CB    . ARG G 3 71  ? -44.345 -46.607 43.875 1.00 88.17  ? 71   ARG G CB    1 
ATOM   4957  C  CG    . ARG G 3 71  ? -44.998 -47.963 43.881 1.00 105.54 ? 71   ARG G CG    1 
ATOM   4958  C  CD    . ARG G 3 71  ? -43.979 -49.085 44.002 1.00 113.69 ? 71   ARG G CD    1 
ATOM   4959  N  NE    . ARG G 3 71  ? -44.632 -50.370 44.287 1.00 124.72 ? 71   ARG G NE    1 
ATOM   4960  C  CZ    . ARG G 3 71  ? -43.988 -51.510 44.541 1.00 136.82 ? 71   ARG G CZ    1 
ATOM   4961  N  NH1   . ARG G 3 71  ? -42.655 -51.542 44.548 1.00 144.92 ? 71   ARG G NH1   1 
ATOM   4962  N  NH2   . ARG G 3 71  ? -44.675 -52.627 44.792 1.00 130.13 ? 71   ARG G NH2   1 
ATOM   4963  N  N     . ASP G 3 72  ? -44.333 -45.252 46.577 1.00 91.25  ? 72   ASP G N     1 
ATOM   4964  C  CA    . ASP G 3 72  ? -44.365 -45.262 48.032 1.00 89.30  ? 72   ASP G CA    1 
ATOM   4965  C  C     . ASP G 3 72  ? -45.492 -44.433 48.569 1.00 90.15  ? 72   ASP G C     1 
ATOM   4966  O  O     . ASP G 3 72  ? -46.101 -44.798 49.560 1.00 98.21  ? 72   ASP G O     1 
ATOM   4967  C  CB    . ASP G 3 72  ? -43.093 -44.676 48.620 1.00 98.69  ? 72   ASP G CB    1 
ATOM   4968  C  CG    . ASP G 3 72  ? -41.854 -45.309 48.068 1.00 104.21 ? 72   ASP G CG    1 
ATOM   4969  O  OD1   . ASP G 3 72  ? -41.894 -46.516 47.735 1.00 111.01 ? 72   ASP G OD1   1 
ATOM   4970  O  OD2   . ASP G 3 72  ? -40.845 -44.581 47.955 1.00 107.60 ? 72   ASP G OD2   1 
ATOM   4971  N  N     . ASN G 3 73  ? -45.757 -43.293 47.950 1.00 93.23  ? 73   ASN G N     1 
ATOM   4972  C  CA    . ASN G 3 73  ? -46.791 -42.417 48.487 1.00 108.17 ? 73   ASN G CA    1 
ATOM   4973  C  C     . ASN G 3 73  ? -48.156 -42.693 47.880 1.00 103.16 ? 73   ASN G C     1 
ATOM   4974  O  O     . ASN G 3 73  ? -49.079 -41.916 48.070 1.00 98.96  ? 73   ASN G O     1 
ATOM   4975  C  CB    . ASN G 3 73  ? -46.372 -40.953 48.379 1.00 113.38 ? 73   ASN G CB    1 
ATOM   4976  C  CG    . ASN G 3 73  ? -45.103 -40.672 49.173 1.00 126.62 ? 73   ASN G CG    1 
ATOM   4977  O  OD1   . ASN G 3 73  ? -45.171 -40.345 50.355 1.00 141.03 ? 73   ASN G OD1   1 
ATOM   4978  N  ND2   . ASN G 3 73  ? -43.938 -40.859 48.545 1.00 118.08 ? 73   ASN G ND2   1 
ATOM   4979  N  N     . LYS G 3 74  ? -48.283 -43.838 47.209 1.00 95.00  ? 74   LYS G N     1 
ATOM   4980  C  CA    . LYS G 3 74  ? -49.555 -44.320 46.695 1.00 102.85 ? 74   LYS G CA    1 
ATOM   4981  C  C     . LYS G 3 74  ? -50.032 -43.392 45.605 1.00 97.60  ? 74   LYS G C     1 
ATOM   4982  O  O     . LYS G 3 74  ? -51.174 -42.947 45.631 1.00 104.34 ? 74   LYS G O     1 
ATOM   4983  C  CB    . LYS G 3 74  ? -50.625 -44.409 47.807 1.00 114.89 ? 74   LYS G CB    1 
ATOM   4984  C  CG    . LYS G 3 74  ? -50.387 -45.467 48.884 1.00 119.91 ? 74   LYS G CG    1 
ATOM   4985  C  CD    . LYS G 3 74  ? -50.981 -46.824 48.491 1.00 126.64 ? 74   LYS G CD    1 
ATOM   4986  C  CE    . LYS G 3 74  ? -51.072 -47.792 49.668 1.00 123.55 ? 74   LYS G CE    1 
ATOM   4987  N  NZ    . LYS G 3 74  ? -49.729 -48.190 50.183 1.00 117.20 ? 74   LYS G NZ    1 
ATOM   4988  N  N     . LYS G 3 75  ? -49.148 -43.090 44.660 1.00 92.10  ? 75   LYS G N     1 
ATOM   4989  C  CA    . LYS G 3 75  ? -49.457 -42.176 43.557 1.00 84.85  ? 75   LYS G CA    1 
ATOM   4990  C  C     . LYS G 3 75  ? -48.876 -42.657 42.229 1.00 91.55  ? 75   LYS G C     1 
ATOM   4991  O  O     . LYS G 3 75  ? -47.897 -43.438 42.175 1.00 85.04  ? 75   LYS G O     1 
ATOM   4992  C  CB    . LYS G 3 75  ? -48.906 -40.789 43.863 1.00 85.16  ? 75   LYS G CB    1 
ATOM   4993  C  CG    . LYS G 3 75  ? -49.916 -39.831 44.487 1.00 95.31  ? 75   LYS G CG    1 
ATOM   4994  C  CD    . LYS G 3 75  ? -49.713 -39.592 45.975 1.00 92.72  ? 75   LYS G CD    1 
ATOM   4995  C  CE    . LYS G 3 75  ? -51.035 -39.419 46.727 1.00 97.80  ? 75   LYS G CE    1 
ATOM   4996  N  NZ    . LYS G 3 75  ? -51.802 -38.194 46.368 1.00 99.58  ? 75   LYS G NZ    1 
ATOM   4997  N  N     . THR G 3 76  ? -49.482 -42.188 41.147 1.00 93.38  ? 76   THR G N     1 
ATOM   4998  C  CA    . THR G 3 76  ? -48.994 -42.530 39.803 1.00 102.72 ? 76   THR G CA    1 
ATOM   4999  C  C     . THR G 3 76  ? -48.511 -41.318 39.006 1.00 98.20  ? 76   THR G C     1 
ATOM   5000  O  O     . THR G 3 76  ? -47.770 -41.468 38.031 1.00 86.81  ? 76   THR G O     1 
ATOM   5001  C  CB    . THR G 3 76  ? -50.091 -43.239 38.999 1.00 112.62 ? 76   THR G CB    1 
ATOM   5002  O  OG1   . THR G 3 76  ? -51.331 -42.520 39.170 1.00 105.14 ? 76   THR G OG1   1 
ATOM   5003  C  CG2   . THR G 3 76  ? -50.211 -44.727 39.460 1.00 109.12 ? 76   THR G CG2   1 
ATOM   5004  N  N     . ARG G 3 77  ? -48.940 -40.125 39.414 1.00 90.77  ? 77   ARG G N     1 
ATOM   5005  C  CA    . ARG G 3 77  ? -48.454 -38.890 38.829 1.00 86.96  ? 77   ARG G CA    1 
ATOM   5006  C  C     . ARG G 3 77  ? -47.302 -38.350 39.672 1.00 86.92  ? 77   ARG G C     1 
ATOM   5007  O  O     . ARG G 3 77  ? -47.510 -38.038 40.857 1.00 81.80  ? 77   ARG G O     1 
ATOM   5008  C  CB    . ARG G 3 77  ? -49.589 -37.881 38.823 1.00 96.02  ? 77   ARG G CB    1 
ATOM   5009  C  CG    . ARG G 3 77  ? -49.185 -36.438 38.572 1.00 100.85 ? 77   ARG G CG    1 
ATOM   5010  C  CD    . ARG G 3 77  ? -50.370 -35.619 38.091 1.00 97.55  ? 77   ARG G CD    1 
ATOM   5011  N  NE    . ARG G 3 77  ? -50.981 -36.318 36.967 1.00 96.14  ? 77   ARG G NE    1 
ATOM   5012  C  CZ    . ARG G 3 77  ? -52.279 -36.569 36.817 1.00 95.25  ? 77   ARG G CZ    1 
ATOM   5013  N  NH1   . ARG G 3 77  ? -53.201 -36.128 37.687 1.00 90.78  ? 77   ARG G NH1   1 
ATOM   5014  N  NH2   . ARG G 3 77  ? -52.654 -37.257 35.747 1.00 98.72  ? 77   ARG G NH2   1 
ATOM   5015  N  N     . ILE G 3 78  ? -46.115 -38.249 39.057 1.00 73.92  ? 78   ILE G N     1 
ATOM   5016  C  CA    . ILE G 3 78  ? -44.933 -37.630 39.663 1.00 66.79  ? 78   ILE G CA    1 
ATOM   5017  C  C     . ILE G 3 78  ? -45.099 -36.119 39.858 1.00 67.04  ? 78   ILE G C     1 
ATOM   5018  O  O     . ILE G 3 78  ? -45.369 -35.395 38.896 1.00 70.42  ? 78   ILE G O     1 
ATOM   5019  C  CB    . ILE G 3 78  ? -43.666 -37.858 38.807 1.00 62.56  ? 78   ILE G CB    1 
ATOM   5020  C  CG1   . ILE G 3 78  ? -43.188 -39.312 38.975 1.00 67.00  ? 78   ILE G CG1   1 
ATOM   5021  C  CG2   . ILE G 3 78  ? -42.578 -36.872 39.221 1.00 64.64  ? 78   ILE G CG2   1 
ATOM   5022  C  CD1   . ILE G 3 78  ? -42.128 -39.822 38.009 1.00 61.69  ? 78   ILE G CD1   1 
ATOM   5023  N  N     . ILE G 3 79  ? -44.907 -35.650 41.090 1.00 63.43  ? 79   ILE G N     1 
ATOM   5024  C  CA    . ILE G 3 79  ? -44.872 -34.224 41.385 1.00 69.15  ? 79   ILE G CA    1 
ATOM   5025  C  C     . ILE G 3 79  ? -43.502 -33.785 41.920 1.00 70.55  ? 79   ILE G C     1 
ATOM   5026  O  O     . ILE G 3 79  ? -42.619 -34.621 42.140 1.00 73.22  ? 79   ILE G O     1 
ATOM   5027  C  CB    . ILE G 3 79  ? -45.999 -33.804 42.349 1.00 64.16  ? 79   ILE G CB    1 
ATOM   5028  C  CG1   . ILE G 3 79  ? -46.020 -34.670 43.610 1.00 65.16  ? 79   ILE G CG1   1 
ATOM   5029  C  CG2   . ILE G 3 79  ? -47.317 -33.868 41.616 1.00 65.89  ? 79   ILE G CG2   1 
ATOM   5030  C  CD1   . ILE G 3 79  ? -46.826 -34.043 44.742 1.00 63.66  ? 79   ILE G CD1   1 
ATOM   5031  N  N     . PRO G 3 80  ? -43.307 -32.468 42.088 1.00 67.55  ? 80   PRO G N     1 
ATOM   5032  C  CA    . PRO G 3 80  ? -42.045 -31.999 42.592 1.00 71.06  ? 80   PRO G CA    1 
ATOM   5033  C  C     . PRO G 3 80  ? -41.578 -32.722 43.835 1.00 66.30  ? 80   PRO G C     1 
ATOM   5034  O  O     . PRO G 3 80  ? -40.435 -33.172 43.903 1.00 68.24  ? 80   PRO G O     1 
ATOM   5035  C  CB    . PRO G 3 80  ? -42.339 -30.529 42.848 1.00 73.85  ? 80   PRO G CB    1 
ATOM   5036  C  CG    . PRO G 3 80  ? -43.124 -30.171 41.630 1.00 70.78  ? 80   PRO G CG    1 
ATOM   5037  C  CD    . PRO G 3 80  ? -44.037 -31.362 41.444 1.00 72.75  ? 80   PRO G CD    1 
ATOM   5038  N  N     . ARG G 3 81  ? -42.464 -32.890 44.792 1.00 62.94  ? 81   ARG G N     1 
ATOM   5039  C  CA    . ARG G 3 81  ? -42.085 -33.588 46.008 1.00 59.81  ? 81   ARG G CA    1 
ATOM   5040  C  C     . ARG G 3 81  ? -41.469 -34.908 45.700 1.00 60.78  ? 81   ARG G C     1 
ATOM   5041  O  O     . ARG G 3 81  ? -40.618 -35.355 46.421 1.00 62.75  ? 81   ARG G O     1 
ATOM   5042  C  CB    . ARG G 3 81  ? -43.293 -33.843 46.876 1.00 62.23  ? 81   ARG G CB    1 
ATOM   5043  C  CG    . ARG G 3 81  ? -43.026 -34.632 48.123 1.00 63.02  ? 81   ARG G CG    1 
ATOM   5044  C  CD    . ARG G 3 81  ? -41.979 -33.976 48.959 1.00 62.86  ? 81   ARG G CD    1 
ATOM   5045  N  NE    . ARG G 3 81  ? -42.057 -34.401 50.347 1.00 66.15  ? 81   ARG G NE    1 
ATOM   5046  C  CZ    . ARG G 3 81  ? -41.288 -33.900 51.310 1.00 67.99  ? 81   ARG G CZ    1 
ATOM   5047  N  NH1   . ARG G 3 81  ? -40.370 -32.976 51.018 1.00 68.55  ? 81   ARG G NH1   1 
ATOM   5048  N  NH2   . ARG G 3 81  ? -41.434 -34.308 52.566 1.00 63.70  ? 81   ARG G NH2   1 
ATOM   5049  N  N     . HIS G 3 82  ? -41.897 -35.567 44.640 1.00 64.27  ? 82   HIS G N     1 
ATOM   5050  C  CA    . HIS G 3 82  ? -41.309 -36.871 44.363 1.00 67.77  ? 82   HIS G CA    1 
ATOM   5051  C  C     . HIS G 3 82  ? -39.906 -36.722 43.800 1.00 70.16  ? 82   HIS G C     1 
ATOM   5052  O  O     . HIS G 3 82  ? -39.059 -37.588 44.023 1.00 70.87  ? 82   HIS G O     1 
ATOM   5053  C  CB    . HIS G 3 82  ? -42.204 -37.764 43.480 1.00 68.88  ? 82   HIS G CB    1 
ATOM   5054  C  CG    . HIS G 3 82  ? -43.596 -37.914 44.008 1.00 70.20  ? 82   HIS G CG    1 
ATOM   5055  N  ND1   . HIS G 3 82  ? -44.704 -37.812 43.204 1.00 70.86  ? 82   HIS G ND1   1 
ATOM   5056  C  CD2   . HIS G 3 82  ? -44.063 -38.073 45.267 1.00 72.29  ? 82   HIS G CD2   1 
ATOM   5057  C  CE1   . HIS G 3 82  ? -45.794 -37.932 43.932 1.00 68.85  ? 82   HIS G CE1   1 
ATOM   5058  N  NE2   . HIS G 3 82  ? -45.435 -38.085 45.191 1.00 73.37  ? 82   HIS G NE2   1 
ATOM   5059  N  N     . LEU G 3 83  ? -39.638 -35.623 43.096 1.00 74.87  ? 83   LEU G N     1 
ATOM   5060  C  CA    . LEU G 3 83  ? -38.277 -35.378 42.571 1.00 68.01  ? 83   LEU G CA    1 
ATOM   5061  C  C     . LEU G 3 83  ? -37.304 -35.039 43.689 1.00 62.56  ? 83   LEU G C     1 
ATOM   5062  O  O     . LEU G 3 83  ? -36.183 -35.554 43.711 1.00 55.75  ? 83   LEU G O     1 
ATOM   5063  C  CB    . LEU G 3 83  ? -38.292 -34.263 41.568 1.00 63.15  ? 83   LEU G CB    1 
ATOM   5064  C  CG    . LEU G 3 83  ? -39.036 -34.635 40.293 1.00 65.57  ? 83   LEU G CG    1 
ATOM   5065  C  CD1   . LEU G 3 83  ? -39.465 -33.362 39.585 1.00 71.50  ? 83   LEU G CD1   1 
ATOM   5066  C  CD2   . LEU G 3 83  ? -38.134 -35.439 39.384 1.00 64.32  ? 83   LEU G CD2   1 
ATOM   5067  N  N     . GLN G 3 84  ? -37.765 -34.211 44.626 1.00 57.10  ? 84   GLN G N     1 
ATOM   5068  C  CA    . GLN G 3 84  ? -37.006 -33.881 45.822 1.00 58.01  ? 84   GLN G CA    1 
ATOM   5069  C  C     . GLN G 3 84  ? -36.693 -35.096 46.676 1.00 62.59  ? 84   GLN G C     1 
ATOM   5070  O  O     . GLN G 3 84  ? -35.546 -35.303 47.024 1.00 75.75  ? 84   GLN G O     1 
ATOM   5071  C  CB    . GLN G 3 84  ? -37.778 -32.901 46.674 1.00 58.82  ? 84   GLN G CB    1 
ATOM   5072  C  CG    . GLN G 3 84  ? -37.132 -32.595 48.007 1.00 57.88  ? 84   GLN G CG    1 
ATOM   5073  C  CD    . GLN G 3 84  ? -35.959 -31.653 47.870 1.00 59.25  ? 84   GLN G CD    1 
ATOM   5074  O  OE1   . GLN G 3 84  ? -35.296 -31.588 46.818 1.00 58.84  ? 84   GLN G OE1   1 
ATOM   5075  N  NE2   . GLN G 3 84  ? -35.673 -30.930 48.941 1.00 54.80  ? 84   GLN G NE2   1 
ATOM   5076  N  N     . LEU G 3 85  ? -37.683 -35.903 47.024 1.00 60.51  ? 85   LEU G N     1 
ATOM   5077  C  CA    . LEU G 3 85  ? -37.383 -37.103 47.805 1.00 62.50  ? 85   LEU G CA    1 
ATOM   5078  C  C     . LEU G 3 85  ? -36.423 -38.008 47.040 1.00 61.21  ? 85   LEU G C     1 
ATOM   5079  O  O     . LEU G 3 85  ? -35.594 -38.691 47.635 1.00 60.81  ? 85   LEU G O     1 
ATOM   5080  C  CB    . LEU G 3 85  ? -38.638 -37.897 48.142 1.00 66.99  ? 85   LEU G CB    1 
ATOM   5081  C  CG    . LEU G 3 85  ? -39.746 -37.201 48.943 1.00 70.37  ? 85   LEU G CG    1 
ATOM   5082  C  CD1   . LEU G 3 85  ? -40.816 -38.205 49.280 1.00 74.61  ? 85   LEU G CD1   1 
ATOM   5083  C  CD2   . LEU G 3 85  ? -39.240 -36.562 50.212 1.00 72.82  ? 85   LEU G CD2   1 
ATOM   5084  N  N     . ALA G 3 86  ? -36.520 -38.031 45.722 1.00 58.95  ? 86   ALA G N     1 
ATOM   5085  C  CA    . ALA G 3 86  ? -35.648 -38.948 44.973 1.00 65.24  ? 86   ALA G CA    1 
ATOM   5086  C  C     . ALA G 3 86  ? -34.224 -38.488 45.082 1.00 65.86  ? 86   ALA G C     1 
ATOM   5087  O  O     . ALA G 3 86  ? -33.326 -39.253 45.402 1.00 61.77  ? 86   ALA G O     1 
ATOM   5088  C  CB    . ALA G 3 86  ? -36.047 -39.034 43.513 1.00 65.00  ? 86   ALA G CB    1 
ATOM   5089  N  N     . VAL G 3 87  ? -34.052 -37.203 44.822 1.00 68.43  ? 87   VAL G N     1 
ATOM   5090  C  CA    . VAL G 3 87  ? -32.739 -36.600 44.736 1.00 64.57  ? 87   VAL G CA    1 
ATOM   5091  C  C     . VAL G 3 87  ? -32.019 -36.569 46.100 1.00 57.52  ? 87   VAL G C     1 
ATOM   5092  O  O     . VAL G 3 87  ? -30.833 -36.900 46.186 1.00 55.06  ? 87   VAL G O     1 
ATOM   5093  C  CB    . VAL G 3 87  ? -32.851 -35.207 44.053 1.00 58.46  ? 87   VAL G CB    1 
ATOM   5094  C  CG1   . VAL G 3 87  ? -31.694 -34.291 44.396 1.00 67.07  ? 87   VAL G CG1   1 
ATOM   5095  C  CG2   . VAL G 3 87  ? -32.902 -35.372 42.551 1.00 57.42  ? 87   VAL G CG2   1 
ATOM   5096  N  N     . ARG G 3 88  ? -32.721 -36.221 47.163 1.00 52.18  ? 88   ARG G N     1 
ATOM   5097  C  CA    . ARG G 3 88  ? -32.009 -36.037 48.424 1.00 62.89  ? 88   ARG G CA    1 
ATOM   5098  C  C     . ARG G 3 88  ? -31.891 -37.344 49.212 1.00 60.54  ? 88   ARG G C     1 
ATOM   5099  O  O     . ARG G 3 88  ? -31.225 -37.400 50.221 1.00 66.78  ? 88   ARG G O     1 
ATOM   5100  C  CB    . ARG G 3 88  ? -32.618 -34.933 49.307 1.00 61.74  ? 88   ARG G CB    1 
ATOM   5101  C  CG    . ARG G 3 88  ? -33.447 -33.906 48.575 1.00 62.50  ? 88   ARG G CG    1 
ATOM   5102  C  CD    . ARG G 3 88  ? -32.783 -32.570 48.226 1.00 63.45  ? 88   ARG G CD    1 
ATOM   5103  N  NE    . ARG G 3 88  ? -31.446 -32.551 47.634 1.00 57.07  ? 88   ARG G NE    1 
ATOM   5104  C  CZ    . ARG G 3 88  ? -31.026 -31.661 46.717 1.00 52.88  ? 88   ARG G CZ    1 
ATOM   5105  N  NH1   . ARG G 3 88  ? -31.813 -30.718 46.197 1.00 43.47  ? 88   ARG G NH1   1 
ATOM   5106  N  NH2   . ARG G 3 88  ? -29.779 -31.731 46.294 1.00 62.06  ? 88   ARG G NH2   1 
ATOM   5107  N  N     . ASN G 3 89  ? -32.529 -38.401 48.767 1.00 61.10  ? 89   ASN G N     1 
ATOM   5108  C  CA    . ASN G 3 89  ? -32.287 -39.690 49.397 1.00 59.59  ? 89   ASN G CA    1 
ATOM   5109  C  C     . ASN G 3 89  ? -31.224 -40.489 48.698 1.00 60.49  ? 89   ASN G C     1 
ATOM   5110  O  O     . ASN G 3 89  ? -30.937 -41.576 49.154 1.00 66.05  ? 89   ASN G O     1 
ATOM   5111  C  CB    . ASN G 3 89  ? -33.554 -40.514 49.499 1.00 54.15  ? 89   ASN G CB    1 
ATOM   5112  C  CG    . ASN G 3 89  ? -34.429 -40.056 50.636 1.00 64.11  ? 89   ASN G CG    1 
ATOM   5113  O  OD1   . ASN G 3 89  ? -34.002 -40.048 51.788 1.00 64.35  ? 89   ASN G OD1   1 
ATOM   5114  N  ND2   . ASN G 3 89  ? -35.657 -39.649 50.328 1.00 69.67  ? 89   ASN G ND2   1 
ATOM   5115  N  N     . ASP G 3 90  ? -30.662 -39.970 47.601 1.00 58.69  ? 90   ASP G N     1 
ATOM   5116  C  CA    . ASP G 3 90  ? -29.542 -40.606 46.927 1.00 56.14  ? 90   ASP G CA    1 
ATOM   5117  C  C     . ASP G 3 90  ? -28.302 -39.729 47.033 1.00 60.71  ? 90   ASP G C     1 
ATOM   5118  O  O     . ASP G 3 90  ? -28.217 -38.629 46.471 1.00 62.24  ? 90   ASP G O     1 
ATOM   5119  C  CB    . ASP G 3 90  ? -29.809 -40.905 45.464 1.00 61.20  ? 90   ASP G CB    1 
ATOM   5120  C  CG    . ASP G 3 90  ? -28.551 -41.469 44.746 1.00 73.83  ? 90   ASP G CG    1 
ATOM   5121  O  OD1   . ASP G 3 90  ? -28.427 -42.699 44.592 1.00 88.53  ? 90   ASP G OD1   1 
ATOM   5122  O  OD2   . ASP G 3 90  ? -27.651 -40.701 44.362 1.00 74.51  ? 90   ASP G OD2   1 
ATOM   5123  N  N     . GLU G 3 91  ? -27.321 -40.270 47.735 1.00 65.23  ? 91   GLU G N     1 
ATOM   5124  C  CA    . GLU G 3 91  ? -26.058 -39.628 47.953 1.00 65.03  ? 91   GLU G CA    1 
ATOM   5125  C  C     . GLU G 3 91  ? -25.526 -38.936 46.705 1.00 63.15  ? 91   GLU G C     1 
ATOM   5126  O  O     . GLU G 3 91  ? -25.197 -37.757 46.769 1.00 71.58  ? 91   GLU G O     1 
ATOM   5127  C  CB    . GLU G 3 91  ? -25.044 -40.651 48.476 1.00 72.66  ? 91   GLU G CB    1 
ATOM   5128  C  CG    . GLU G 3 91  ? -23.975 -40.023 49.345 1.00 82.91  ? 91   GLU G CG    1 
ATOM   5129  C  CD    . GLU G 3 91  ? -22.729 -40.865 49.469 1.00 92.94  ? 91   GLU G CD    1 
ATOM   5130  O  OE1   . GLU G 3 91  ? -21.770 -40.626 48.698 1.00 110.92 ? 91   GLU G OE1   1 
ATOM   5131  O  OE2   . GLU G 3 91  ? -22.709 -41.764 50.334 1.00 102.48 ? 91   GLU G OE2   1 
ATOM   5132  N  N     . GLU G 3 92  ? -25.475 -39.643 45.576 1.00 63.70  ? 92   GLU G N     1 
ATOM   5133  C  CA    . GLU G 3 92  ? -24.846 -39.106 44.356 1.00 63.52  ? 92   GLU G CA    1 
ATOM   5134  C  C     . GLU G 3 92  ? -25.646 -38.018 43.610 1.00 60.45  ? 92   GLU G C     1 
ATOM   5135  O  O     . GLU G 3 92  ? -25.116 -36.987 43.224 1.00 59.86  ? 92   GLU G O     1 
ATOM   5136  C  CB    . GLU G 3 92  ? -24.463 -40.230 43.416 1.00 66.34  ? 92   GLU G CB    1 
ATOM   5137  C  CG    . GLU G 3 92  ? -23.311 -41.082 43.931 1.00 74.36  ? 92   GLU G CG    1 
ATOM   5138  C  CD    . GLU G 3 92  ? -22.484 -41.724 42.820 1.00 83.09  ? 92   GLU G CD    1 
ATOM   5139  O  OE1   . GLU G 3 92  ? -23.054 -42.081 41.750 1.00 87.19  ? 92   GLU G OE1   1 
ATOM   5140  O  OE2   . GLU G 3 92  ? -21.258 -41.892 43.021 1.00 85.36  ? 92   GLU G OE2   1 
ATOM   5141  N  N     . LEU G 3 93  ? -26.931 -38.231 43.435 1.00 61.44  ? 93   LEU G N     1 
ATOM   5142  C  CA    . LEU G 3 93  ? -27.788 -37.172 42.904 1.00 64.17  ? 93   LEU G CA    1 
ATOM   5143  C  C     . LEU G 3 93  ? -27.779 -35.951 43.797 1.00 66.64  ? 93   LEU G C     1 
ATOM   5144  O  O     . LEU G 3 93  ? -27.757 -34.819 43.300 1.00 67.14  ? 93   LEU G O     1 
ATOM   5145  C  CB    . LEU G 3 93  ? -29.235 -37.663 42.737 1.00 60.42  ? 93   LEU G CB    1 
ATOM   5146  C  CG    . LEU G 3 93  ? -29.385 -38.610 41.542 1.00 57.60  ? 93   LEU G CG    1 
ATOM   5147  C  CD1   . LEU G 3 93  ? -30.781 -39.180 41.450 1.00 60.09  ? 93   LEU G CD1   1 
ATOM   5148  C  CD2   . LEU G 3 93  ? -29.030 -37.916 40.243 1.00 57.53  ? 93   LEU G CD2   1 
ATOM   5149  N  N     . ASN G 3 94  ? -27.813 -36.185 45.109 1.00 61.78  ? 94   ASN G N     1 
ATOM   5150  C  CA    . ASN G 3 94  ? -27.820 -35.093 46.054 1.00 57.35  ? 94   ASN G CA    1 
ATOM   5151  C  C     . ASN G 3 94  ? -26.605 -34.227 45.927 1.00 56.70  ? 94   ASN G C     1 
ATOM   5152  O  O     . ASN G 3 94  ? -26.670 -33.017 46.166 1.00 55.98  ? 94   ASN G O     1 
ATOM   5153  C  CB    . ASN G 3 94  ? -27.864 -35.610 47.471 1.00 57.09  ? 94   ASN G CB    1 
ATOM   5154  C  CG    . ASN G 3 94  ? -27.994 -34.501 48.478 1.00 54.82  ? 94   ASN G CG    1 
ATOM   5155  O  OD1   . ASN G 3 94  ? -28.813 -33.607 48.333 1.00 64.87  ? 94   ASN G OD1   1 
ATOM   5156  N  ND2   . ASN G 3 94  ? -27.203 -34.554 49.497 1.00 54.98  ? 94   ASN G ND2   1 
ATOM   5157  N  N     . LYS G 3 95  ? -25.483 -34.846 45.573 1.00 60.23  ? 95   LYS G N     1 
ATOM   5158  C  CA    . LYS G 3 95  ? -24.227 -34.105 45.533 1.00 60.39  ? 95   LYS G CA    1 
ATOM   5159  C  C     . LYS G 3 95  ? -24.172 -33.306 44.260 1.00 56.85  ? 95   LYS G C     1 
ATOM   5160  O  O     . LYS G 3 95  ? -23.854 -32.138 44.269 1.00 54.77  ? 95   LYS G O     1 
ATOM   5161  C  CB    . LYS G 3 95  ? -23.040 -35.025 45.681 1.00 61.49  ? 95   LYS G CB    1 
ATOM   5162  C  CG    . LYS G 3 95  ? -21.703 -34.305 45.735 1.00 78.25  ? 95   LYS G CG    1 
ATOM   5163  C  CD    . LYS G 3 95  ? -20.572 -35.286 46.058 1.00 97.23  ? 95   LYS G CD    1 
ATOM   5164  C  CE    . LYS G 3 95  ? -19.296 -35.038 45.252 1.00 101.32 ? 95   LYS G CE    1 
ATOM   5165  N  NZ    . LYS G 3 95  ? -18.207 -35.932 45.743 1.00 104.01 ? 95   LYS G NZ    1 
ATOM   5166  N  N     . LEU G 3 96  ? -24.544 -33.934 43.167 1.00 62.34  ? 96   LEU G N     1 
ATOM   5167  C  CA    . LEU G 3 96  ? -24.692 -33.232 41.888 1.00 60.80  ? 96   LEU G CA    1 
ATOM   5168  C  C     . LEU G 3 96  ? -25.658 -32.077 41.941 1.00 59.64  ? 96   LEU G C     1 
ATOM   5169  O  O     . LEU G 3 96  ? -25.485 -31.114 41.221 1.00 71.31  ? 96   LEU G O     1 
ATOM   5170  C  CB    . LEU G 3 96  ? -25.214 -34.193 40.829 1.00 57.82  ? 96   LEU G CB    1 
ATOM   5171  C  CG    . LEU G 3 96  ? -25.218 -33.704 39.393 1.00 58.53  ? 96   LEU G CG    1 
ATOM   5172  C  CD1   . LEU G 3 96  ? -23.813 -33.532 38.846 1.00 57.00  ? 96   LEU G CD1   1 
ATOM   5173  C  CD2   . LEU G 3 96  ? -25.981 -34.705 38.554 1.00 58.24  ? 96   LEU G CD2   1 
ATOM   5174  N  N     . LEU G 3 97  ? -26.689 -32.181 42.767 1.00 57.72  ? 97   LEU G N     1 
ATOM   5175  C  CA    . LEU G 3 97  ? -27.712 -31.144 42.830 1.00 59.29  ? 97   LEU G CA    1 
ATOM   5176  C  C     . LEU G 3 97  ? -27.652 -30.416 44.141 1.00 55.14  ? 97   LEU G C     1 
ATOM   5177  O  O     . LEU G 3 97  ? -28.656 -29.845 44.606 1.00 57.15  ? 97   LEU G O     1 
ATOM   5178  C  CB    . LEU G 3 97  ? -29.123 -31.752 42.632 1.00 59.22  ? 97   LEU G CB    1 
ATOM   5179  C  CG    . LEU G 3 97  ? -29.361 -32.323 41.233 1.00 58.83  ? 97   LEU G CG    1 
ATOM   5180  C  CD1   . LEU G 3 97  ? -30.829 -32.497 40.960 1.00 59.33  ? 97   LEU G CD1   1 
ATOM   5181  C  CD2   . LEU G 3 97  ? -28.786 -31.404 40.179 1.00 60.54  ? 97   LEU G CD2   1 
ATOM   5182  N  N     . GLY G 3 98  ? -26.486 -30.432 44.747 1.00 50.22  ? 98   GLY G N     1 
ATOM   5183  C  CA    . GLY G 3 98  ? -26.359 -29.882 46.083 1.00 54.71  ? 98   GLY G CA    1 
ATOM   5184  C  C     . GLY G 3 98  ? -26.391 -28.370 46.217 1.00 51.83  ? 98   GLY G C     1 
ATOM   5185  O  O     . GLY G 3 98  ? -26.466 -27.862 47.303 1.00 52.91  ? 98   GLY G O     1 
ATOM   5186  N  N     . ARG G 3 99  ? -26.303 -27.647 45.114 1.00 63.12  ? 99   ARG G N     1 
ATOM   5187  C  CA    . ARG G 3 99  ? -26.535 -26.212 45.151 1.00 59.63  ? 99   ARG G CA    1 
ATOM   5188  C  C     . ARG G 3 99  ? -27.703 -25.859 44.240 1.00 53.87  ? 99   ARG G C     1 
ATOM   5189  O  O     . ARG G 3 99  ? -27.707 -24.803 43.636 1.00 56.95  ? 99   ARG G O     1 
ATOM   5190  C  CB    . ARG G 3 99  ? -25.262 -25.450 44.780 1.00 58.87  ? 99   ARG G CB    1 
ATOM   5191  C  CG    . ARG G 3 99  ? -24.139 -25.564 45.805 1.00 65.60  ? 99   ARG G CG    1 
ATOM   5192  C  CD    . ARG G 3 99  ? -22.887 -24.853 45.270 1.00 94.51  ? 99   ARG G CD    1 
ATOM   5193  N  NE    . ARG G 3 99  ? -21.616 -25.380 45.810 1.00 123.42 ? 99   ARG G NE    1 
ATOM   5194  C  CZ    . ARG G 3 99  ? -20.413 -25.343 45.207 1.00 128.18 ? 99   ARG G CZ    1 
ATOM   5195  N  NH1   . ARG G 3 99  ? -20.225 -24.811 43.998 1.00 125.42 ? 99   ARG G NH1   1 
ATOM   5196  N  NH2   . ARG G 3 99  ? -19.364 -25.861 45.834 1.00 129.04 ? 99   ARG G NH2   1 
ATOM   5197  N  N     . VAL G 3 100 ? -28.700 -26.748 44.195 1.00 50.57  ? 100  VAL G N     1 
ATOM   5198  C  CA    . VAL G 3 100 ? -29.924 -26.554 43.433 1.00 46.78  ? 100  VAL G CA    1 
ATOM   5199  C  C     . VAL G 3 100 ? -31.171 -26.658 44.297 1.00 47.58  ? 100  VAL G C     1 
ATOM   5200  O  O     . VAL G 3 100 ? -31.242 -27.492 45.200 1.00 51.04  ? 100  VAL G O     1 
ATOM   5201  C  CB    . VAL G 3 100 ? -30.049 -27.632 42.369 1.00 47.89  ? 100  VAL G CB    1 
ATOM   5202  C  CG1   . VAL G 3 100 ? -31.473 -27.758 41.843 1.00 53.43  ? 100  VAL G CG1   1 
ATOM   5203  C  CG2   . VAL G 3 100 ? -29.158 -27.313 41.220 1.00 49.77  ? 100  VAL G CG2   1 
ATOM   5204  N  N     . THR G 3 101 ? -32.169 -25.843 43.979 1.00 48.93  ? 101  THR G N     1 
ATOM   5205  C  CA    . THR G 3 101 ? -33.417 -25.868 44.702 1.00 55.00  ? 101  THR G CA    1 
ATOM   5206  C  C     . THR G 3 101 ? -34.507 -26.298 43.774 1.00 61.29  ? 101  THR G C     1 
ATOM   5207  O  O     . THR G 3 101 ? -34.654 -25.739 42.700 1.00 67.07  ? 101  THR G O     1 
ATOM   5208  C  CB    . THR G 3 101 ? -33.733 -24.509 45.346 1.00 54.12  ? 101  THR G CB    1 
ATOM   5209  O  OG1   . THR G 3 101 ? -32.900 -24.358 46.507 1.00 59.12  ? 101  THR G OG1   1 
ATOM   5210  C  CG2   . THR G 3 101 ? -35.143 -24.461 45.822 1.00 54.06  ? 101  THR G CG2   1 
ATOM   5211  N  N     . ILE G 3 102 ? -35.243 -27.326 44.190 1.00 64.50  ? 102  ILE G N     1 
ATOM   5212  C  CA    . ILE G 3 102 ? -36.363 -27.846 43.417 1.00 61.82  ? 102  ILE G CA    1 
ATOM   5213  C  C     . ILE G 3 102 ? -37.585 -27.153 43.926 1.00 61.14  ? 102  ILE G C     1 
ATOM   5214  O  O     . ILE G 3 102 ? -37.999 -27.364 45.056 1.00 62.90  ? 102  ILE G O     1 
ATOM   5215  C  CB    . ILE G 3 102 ? -36.554 -29.363 43.622 1.00 58.51  ? 102  ILE G CB    1 
ATOM   5216  C  CG1   . ILE G 3 102 ? -35.443 -30.126 42.934 1.00 61.93  ? 102  ILE G CG1   1 
ATOM   5217  C  CG2   . ILE G 3 102 ? -37.834 -29.841 42.989 1.00 58.44  ? 102  ILE G CG2   1 
ATOM   5218  C  CD1   . ILE G 3 102 ? -35.234 -31.494 43.518 1.00 64.82  ? 102  ILE G CD1   1 
ATOM   5219  N  N     . ALA G 3 103 ? -38.185 -26.325 43.093 1.00 66.56  ? 103  ALA G N     1 
ATOM   5220  C  CA    . ALA G 3 103 ? -39.365 -25.605 43.535 1.00 63.30  ? 103  ALA G CA    1 
ATOM   5221  C  C     . ALA G 3 103 ? -40.449 -26.586 43.967 1.00 63.87  ? 103  ALA G C     1 
ATOM   5222  O  O     . ALA G 3 103 ? -40.697 -27.589 43.300 1.00 65.55  ? 103  ALA G O     1 
ATOM   5223  C  CB    . ALA G 3 103 ? -39.855 -24.713 42.438 1.00 64.40  ? 103  ALA G CB    1 
ATOM   5224  N  N     . GLN G 3 104 ? -41.076 -26.303 45.100 1.00 62.71  ? 104  GLN G N     1 
ATOM   5225  C  CA    . GLN G 3 104 ? -42.189 -27.114 45.604 1.00 63.32  ? 104  GLN G CA    1 
ATOM   5226  C  C     . GLN G 3 104 ? -41.774 -28.515 46.035 1.00 62.81  ? 104  GLN G C     1 
ATOM   5227  O  O     . GLN G 3 104 ? -42.572 -29.438 45.994 1.00 70.44  ? 104  GLN G O     1 
ATOM   5228  C  CB    . GLN G 3 104 ? -43.358 -27.154 44.596 1.00 64.64  ? 104  GLN G CB    1 
ATOM   5229  C  CG    . GLN G 3 104 ? -44.314 -25.969 44.720 1.00 71.95  ? 104  GLN G CG    1 
ATOM   5230  C  CD    . GLN G 3 104 ? -44.878 -25.774 46.143 1.00 85.15  ? 104  GLN G CD    1 
ATOM   5231  O  OE1   . GLN G 3 104 ? -45.755 -26.541 46.621 1.00 86.24  ? 104  GLN G OE1   1 
ATOM   5232  N  NE2   . GLN G 3 104 ? -44.367 -24.742 46.836 1.00 82.78  ? 104  GLN G NE2   1 
ATOM   5233  N  N     . GLY G 3 105 ? -40.537 -28.663 46.499 1.00 61.09  ? 105  GLY G N     1 
ATOM   5234  C  CA    . GLY G 3 105 ? -40.033 -29.971 46.938 1.00 59.97  ? 105  GLY G CA    1 
ATOM   5235  C  C     . GLY G 3 105 ? -40.078 -30.260 48.431 1.00 56.74  ? 105  GLY G C     1 
ATOM   5236  O  O     . GLY G 3 105 ? -39.982 -31.414 48.839 1.00 56.84  ? 105  GLY G O     1 
ATOM   5237  N  N     . GLY G 3 106 ? -40.218 -29.224 49.259 1.00 55.34  ? 106  GLY G N     1 
ATOM   5238  C  CA    . GLY G 3 106 ? -40.051 -29.375 50.714 1.00 51.45  ? 106  GLY G CA    1 
ATOM   5239  C  C     . GLY G 3 106 ? -38.716 -30.016 51.095 1.00 57.07  ? 106  GLY G C     1 
ATOM   5240  O  O     . GLY G 3 106 ? -37.732 -29.953 50.365 1.00 53.54  ? 106  GLY G O     1 
ATOM   5241  N  N     . VAL G 3 107 ? -38.698 -30.659 52.248 1.00 60.92  ? 107  VAL G N     1 
ATOM   5242  C  CA    . VAL G 3 107 ? -37.489 -31.245 52.783 1.00 54.02  ? 107  VAL G CA    1 
ATOM   5243  C  C     . VAL G 3 107 ? -37.744 -32.652 53.282 1.00 56.15  ? 107  VAL G C     1 
ATOM   5244  O  O     . VAL G 3 107 ? -38.879 -32.992 53.542 1.00 67.74  ? 107  VAL G O     1 
ATOM   5245  C  CB    . VAL G 3 107 ? -37.007 -30.417 53.959 1.00 54.83  ? 107  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G 3 107 ? -36.676 -29.027 53.486 1.00 50.80  ? 107  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G 3 107 ? -38.050 -30.353 55.072 1.00 57.75  ? 107  VAL G CG2   1 
ATOM   5248  N  N     . LEU G 3 108 ? -36.695 -33.460 53.412 1.00 59.93  ? 108  LEU G N     1 
ATOM   5249  C  CA    . LEU G 3 108 ? -36.781 -34.788 54.040 1.00 58.66  ? 108  LEU G CA    1 
ATOM   5250  C  C     . LEU G 3 108 ? -37.188 -34.696 55.485 1.00 62.25  ? 108  LEU G C     1 
ATOM   5251  O  O     . LEU G 3 108 ? -36.629 -33.908 56.216 1.00 72.32  ? 108  LEU G O     1 
ATOM   5252  C  CB    . LEU G 3 108 ? -35.424 -35.451 54.062 1.00 56.28  ? 108  LEU G CB    1 
ATOM   5253  C  CG    . LEU G 3 108 ? -34.796 -35.672 52.707 1.00 56.53  ? 108  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G 3 108 ? -33.682 -36.690 52.864 1.00 56.31  ? 108  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G 3 108 ? -35.840 -36.115 51.709 1.00 56.96  ? 108  LEU G CD2   1 
ATOM   5256  N  N     . PRO G 3 109 ? -38.153 -35.516 55.918 1.00 79.01  ? 109  PRO G N     1 
ATOM   5257  C  CA    . PRO G 3 109 ? -38.433 -35.593 57.339 1.00 76.37  ? 109  PRO G CA    1 
ATOM   5258  C  C     . PRO G 3 109 ? -37.168 -35.943 58.072 1.00 69.09  ? 109  PRO G C     1 
ATOM   5259  O  O     . PRO G 3 109 ? -36.518 -36.909 57.719 1.00 71.12  ? 109  PRO G O     1 
ATOM   5260  C  CB    . PRO G 3 109 ? -39.430 -36.747 57.428 1.00 78.83  ? 109  PRO G CB    1 
ATOM   5261  C  CG    . PRO G 3 109 ? -40.174 -36.651 56.146 1.00 84.66  ? 109  PRO G CG    1 
ATOM   5262  C  CD    . PRO G 3 109 ? -39.063 -36.388 55.159 1.00 87.82  ? 109  PRO G CD    1 
ATOM   5263  N  N     . ASN G 3 110 ? -36.814 -35.135 59.052 1.00 64.39  ? 110  ASN G N     1 
ATOM   5264  C  CA    . ASN G 3 110 ? -35.622 -35.340 59.824 1.00 66.61  ? 110  ASN G CA    1 
ATOM   5265  C  C     . ASN G 3 110 ? -35.676 -34.442 61.061 1.00 70.55  ? 110  ASN G C     1 
ATOM   5266  O  O     . ASN G 3 110 ? -35.860 -33.224 60.954 1.00 62.66  ? 110  ASN G O     1 
ATOM   5267  C  CB    . ASN G 3 110 ? -34.383 -35.038 58.981 1.00 71.22  ? 110  ASN G CB    1 
ATOM   5268  C  CG    . ASN G 3 110 ? -33.087 -35.194 59.758 1.00 78.10  ? 110  ASN G CG    1 
ATOM   5269  O  OD1   . ASN G 3 110 ? -33.070 -35.667 60.902 1.00 89.34  ? 110  ASN G OD1   1 
ATOM   5270  N  ND2   . ASN G 3 110 ? -31.992 -34.799 59.139 1.00 80.46  ? 110  ASN G ND2   1 
ATOM   5271  N  N     . ILE G 3 111 ? -35.534 -35.073 62.229 1.00 68.59  ? 111  ILE G N     1 
ATOM   5272  C  CA    . ILE G 3 111 ? -35.522 -34.376 63.501 1.00 63.40  ? 111  ILE G CA    1 
ATOM   5273  C  C     . ILE G 3 111 ? -34.320 -34.785 64.309 1.00 64.36  ? 111  ILE G C     1 
ATOM   5274  O  O     . ILE G 3 111 ? -34.081 -35.957 64.498 1.00 66.14  ? 111  ILE G O     1 
ATOM   5275  C  CB    . ILE G 3 111 ? -36.745 -34.718 64.342 1.00 65.05  ? 111  ILE G CB    1 
ATOM   5276  C  CG1   . ILE G 3 111 ? -38.037 -34.408 63.559 1.00 69.17  ? 111  ILE G CG1   1 
ATOM   5277  C  CG2   . ILE G 3 111 ? -36.664 -33.952 65.659 1.00 67.69  ? 111  ILE G CG2   1 
ATOM   5278  C  CD1   . ILE G 3 111 ? -39.332 -34.824 64.242 1.00 71.67  ? 111  ILE G CD1   1 
ATOM   5279  N  N     . GLN G 3 112 ? -33.583 -33.809 64.820 1.00 75.15  ? 112  GLN G N     1 
ATOM   5280  C  CA    . GLN G 3 112 ? -32.415 -34.096 65.653 1.00 73.76  ? 112  GLN G CA    1 
ATOM   5281  C  C     . GLN G 3 112 ? -32.847 -34.794 66.920 1.00 73.15  ? 112  GLN G C     1 
ATOM   5282  O  O     . GLN G 3 112 ? -33.777 -34.349 67.602 1.00 69.81  ? 112  GLN G O     1 
ATOM   5283  C  CB    . GLN G 3 112 ? -31.696 -32.816 66.051 1.00 75.04  ? 112  GLN G CB    1 
ATOM   5284  C  CG    . GLN G 3 112 ? -31.152 -32.038 64.890 1.00 70.44  ? 112  GLN G CG    1 
ATOM   5285  C  CD    . GLN G 3 112 ? -30.215 -32.865 64.079 1.00 69.19  ? 112  GLN G CD    1 
ATOM   5286  O  OE1   . GLN G 3 112 ? -29.089 -33.157 64.502 1.00 76.91  ? 112  GLN G OE1   1 
ATOM   5287  N  NE2   . GLN G 3 112 ? -30.674 -33.284 62.922 1.00 73.97  ? 112  GLN G NE2   1 
ATOM   5288  N  N     . SER G 3 113 ? -32.135 -35.860 67.256 1.00 74.72  ? 113  SER G N     1 
ATOM   5289  C  CA    . SER G 3 113 ? -32.611 -36.796 68.257 1.00 76.22  ? 113  SER G CA    1 
ATOM   5290  C  C     . SER G 3 113 ? -32.692 -36.218 69.643 1.00 72.75  ? 113  SER G C     1 
ATOM   5291  O  O     . SER G 3 113 ? -33.622 -36.539 70.370 1.00 80.85  ? 113  SER G O     1 
ATOM   5292  C  CB    . SER G 3 113 ? -31.748 -38.032 68.278 1.00 79.04  ? 113  SER G CB    1 
ATOM   5293  O  OG    . SER G 3 113 ? -30.402 -37.660 68.385 1.00 82.08  ? 113  SER G OG    1 
ATOM   5294  N  N     . VAL G 3 114 ? -31.763 -35.337 69.993 1.00 73.67  ? 114  VAL G N     1 
ATOM   5295  C  CA    . VAL G 3 114 ? -31.853 -34.612 71.269 1.00 75.14  ? 114  VAL G CA    1 
ATOM   5296  C  C     . VAL G 3 114 ? -33.135 -33.787 71.424 1.00 74.06  ? 114  VAL G C     1 
ATOM   5297  O  O     . VAL G 3 114 ? -33.440 -33.343 72.521 1.00 71.96  ? 114  VAL G O     1 
ATOM   5298  C  CB    . VAL G 3 114 ? -30.657 -33.662 71.468 1.00 76.55  ? 114  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3 114 ? -30.775 -32.466 70.541 1.00 81.12  ? 114  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3 114 ? -30.561 -33.209 72.921 1.00 73.77  ? 114  VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3 115 ? -33.867 -33.559 70.331 1.00 79.73  ? 115  LEU G N     1 
ATOM   5302  C  CA    . LEU G 3 115 ? -35.138 -32.827 70.395 1.00 77.79  ? 115  LEU G CA    1 
ATOM   5303  C  C     . LEU G 3 115 ? -36.341 -33.710 70.668 1.00 76.38  ? 115  LEU G C     1 
ATOM   5304  O  O     . LEU G 3 115 ? -37.417 -33.193 70.940 1.00 75.60  ? 115  LEU G O     1 
ATOM   5305  C  CB    . LEU G 3 115 ? -35.364 -32.012 69.115 1.00 75.49  ? 115  LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3 115 ? -34.244 -30.989 68.852 1.00 76.58  ? 115  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3 115 ? -34.465 -30.303 67.516 1.00 81.86  ? 115  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3 115 ? -34.123 -29.928 69.943 1.00 74.28  ? 115  LEU G CD2   1 
ATOM   5309  N  N     . LEU G 3 116 ? -36.161 -35.032 70.602 1.00 83.34  ? 116  LEU G N     1 
ATOM   5310  C  CA    . LEU G 3 116 ? -37.214 -35.986 70.974 1.00 76.72  ? 116  LEU G CA    1 
ATOM   5311  C  C     . LEU G 3 116 ? -37.463 -36.011 72.494 1.00 86.11  ? 116  LEU G C     1 
ATOM   5312  O  O     . LEU G 3 116 ? -36.517 -35.948 73.300 1.00 78.09  ? 116  LEU G O     1 
ATOM   5313  C  CB    . LEU G 3 116 ? -36.834 -37.389 70.521 1.00 70.09  ? 116  LEU G CB    1 
ATOM   5314  C  CG    . LEU G 3 116 ? -36.665 -37.554 69.017 1.00 75.71  ? 116  LEU G CG    1 
ATOM   5315  C  CD1   . LEU G 3 116 ? -36.028 -38.904 68.657 1.00 72.10  ? 116  LEU G CD1   1 
ATOM   5316  C  CD2   . LEU G 3 116 ? -37.998 -37.351 68.307 1.00 78.24  ? 116  LEU G CD2   1 
ATOM   5317  N  N     . PRO G 3 117 ? -38.739 -36.150 72.893 1.00 98.36  ? 117  PRO G N     1 
ATOM   5318  C  CA    . PRO G 3 117 ? -39.124 -36.252 74.304 1.00 97.44  ? 117  PRO G CA    1 
ATOM   5319  C  C     . PRO G 3 117 ? -38.563 -37.505 74.916 1.00 98.31  ? 117  PRO G C     1 
ATOM   5320  O  O     . PRO G 3 117 ? -38.323 -38.460 74.171 1.00 106.39 ? 117  PRO G O     1 
ATOM   5321  C  CB    . PRO G 3 117 ? -40.646 -36.372 74.238 1.00 100.41 ? 117  PRO G CB    1 
ATOM   5322  C  CG    . PRO G 3 117 ? -40.921 -36.997 72.916 1.00 101.71 ? 117  PRO G CG    1 
ATOM   5323  C  CD    . PRO G 3 117 ? -39.878 -36.428 71.997 1.00 108.30 ? 117  PRO G CD    1 
ATOM   5324  N  N     . LYS G 3 118 ? -38.385 -37.526 76.244 1.00 104.98 ? 118  LYS G N     1 
ATOM   5325  C  CA    . LYS G 3 118 ? -37.768 -38.696 76.925 1.00 122.05 ? 118  LYS G CA    1 
ATOM   5326  C  C     . LYS G 3 118 ? -38.703 -39.912 77.203 1.00 123.36 ? 118  LYS G C     1 
ATOM   5327  O  O     . LYS G 3 118 ? -39.897 -39.755 77.448 1.00 131.89 ? 118  LYS G O     1 
ATOM   5328  C  CB    . LYS G 3 118 ? -37.025 -38.241 78.191 1.00 124.52 ? 118  LYS G CB    1 
ATOM   5329  C  CG    . LYS G 3 118 ? -35.617 -37.741 77.873 1.00 134.15 ? 118  LYS G CG    1 
ATOM   5330  C  CD    . LYS G 3 118 ? -35.371 -36.306 78.321 1.00 143.90 ? 118  LYS G CD    1 
ATOM   5331  C  CE    . LYS G 3 118 ? -34.292 -35.626 77.474 1.00 140.46 ? 118  LYS G CE    1 
ATOM   5332  N  NZ    . LYS G 3 118 ? -33.983 -34.235 77.932 1.00 135.32 ? 118  LYS G NZ    1 
ATOM   5333  N  N     . LYS G 3 119 ? -38.130 -41.120 77.149 1.00 130.28 ? 119  LYS G N     1 
ATOM   5334  C  CA    . LYS G 3 119 ? -38.881 -42.386 77.313 1.00 128.92 ? 119  LYS G CA    1 
ATOM   5335  C  C     . LYS G 3 119 ? -39.037 -42.712 78.805 1.00 122.73 ? 119  LYS G C     1 
ATOM   5336  O  O     . LYS G 3 119 ? -40.110 -42.581 79.387 1.00 108.52 ? 119  LYS G O     1 
ATOM   5337  C  CB    . LYS G 3 119 ? -38.185 -43.591 76.622 1.00 129.61 ? 119  LYS G CB    1 
ATOM   5338  C  CG    . LYS G 3 119 ? -37.256 -43.293 75.441 1.00 126.01 ? 119  LYS G CG    1 
ATOM   5339  C  CD    . LYS G 3 119 ? -37.582 -44.129 74.205 1.00 123.95 ? 119  LYS G CD    1 
ATOM   5340  C  CE    . LYS G 3 119 ? -38.735 -43.489 73.434 1.00 124.15 ? 119  LYS G CE    1 
ATOM   5341  N  NZ    . LYS G 3 119 ? -39.036 -44.146 72.135 1.00 115.47 ? 119  LYS G NZ    1 
ATOM   5342  N  N     . LYS H 4 31  ? -46.666 -16.635 20.214 1.00 120.62 ? 28   LYS H N     1 
ATOM   5343  C  CA    . LYS H 4 31  ? -46.560 -17.112 18.799 1.00 124.69 ? 28   LYS H CA    1 
ATOM   5344  C  C     . LYS H 4 31  ? -45.250 -17.845 18.566 1.00 115.70 ? 28   LYS H C     1 
ATOM   5345  O  O     . LYS H 4 31  ? -45.252 -18.953 18.022 1.00 110.64 ? 28   LYS H O     1 
ATOM   5346  C  CB    . LYS H 4 31  ? -46.693 -15.941 17.811 1.00 129.06 ? 28   LYS H CB    1 
ATOM   5347  C  CG    . LYS H 4 31  ? -46.674 -16.314 16.327 1.00 129.40 ? 28   LYS H CG    1 
ATOM   5348  C  CD    . LYS H 4 31  ? -47.143 -15.157 15.441 1.00 132.94 ? 28   LYS H CD    1 
ATOM   5349  C  CE    . LYS H 4 31  ? -48.652 -14.886 15.554 1.00 125.72 ? 28   LYS H CE    1 
ATOM   5350  N  NZ    . LYS H 4 31  ? -49.084 -13.610 14.920 1.00 110.23 ? 28   LYS H NZ    1 
ATOM   5351  N  N     . THR H 4 32  ? -44.138 -17.236 18.979 1.00 104.32 ? 29   THR H N     1 
ATOM   5352  C  CA    . THR H 4 32  ? -42.834 -17.830 18.717 1.00 115.75 ? 29   THR H CA    1 
ATOM   5353  C  C     . THR H 4 32  ? -42.747 -19.191 19.427 1.00 120.38 ? 29   THR H C     1 
ATOM   5354  O  O     . THR H 4 32  ? -43.148 -19.326 20.583 1.00 117.25 ? 29   THR H O     1 
ATOM   5355  C  CB    . THR H 4 32  ? -41.654 -16.879 19.061 1.00 111.81 ? 29   THR H CB    1 
ATOM   5356  O  OG1   . THR H 4 32  ? -40.541 -17.173 18.205 1.00 102.60 ? 29   THR H OG1   1 
ATOM   5357  C  CG2   . THR H 4 32  ? -41.219 -16.998 20.522 1.00 111.99 ? 29   THR H CG2   1 
ATOM   5358  N  N     . ARG H 4 33  ? -42.268 -20.193 18.693 1.00 126.90 ? 30   ARG H N     1 
ATOM   5359  C  CA    . ARG H 4 33  ? -42.187 -21.573 19.173 1.00 126.89 ? 30   ARG H CA    1 
ATOM   5360  C  C     . ARG H 4 33  ? -41.259 -21.682 20.376 1.00 124.15 ? 30   ARG H C     1 
ATOM   5361  O  O     . ARG H 4 33  ? -40.079 -21.326 20.284 1.00 126.05 ? 30   ARG H O     1 
ATOM   5362  C  CB    . ARG H 4 33  ? -41.674 -22.488 18.053 1.00 129.84 ? 30   ARG H CB    1 
ATOM   5363  C  CG    . ARG H 4 33  ? -42.755 -22.964 17.093 1.00 138.97 ? 30   ARG H CG    1 
ATOM   5364  C  CD    . ARG H 4 33  ? -42.179 -23.562 15.813 1.00 147.72 ? 30   ARG H CD    1 
ATOM   5365  N  NE    . ARG H 4 33  ? -40.901 -24.256 16.026 1.00 160.49 ? 30   ARG H NE    1 
ATOM   5366  C  CZ    . ARG H 4 33  ? -40.754 -25.526 16.421 1.00 162.32 ? 30   ARG H CZ    1 
ATOM   5367  N  NH1   . ARG H 4 33  ? -41.802 -26.310 16.677 1.00 168.75 ? 30   ARG H NH1   1 
ATOM   5368  N  NH2   . ARG H 4 33  ? -39.530 -26.023 16.572 1.00 154.14 ? 30   ARG H NH2   1 
ATOM   5369  N  N     . LYS H 4 34  ? -41.783 -22.175 21.498 1.00 109.05 ? 31   LYS H N     1 
ATOM   5370  C  CA    . LYS H 4 34  ? -40.977 -22.311 22.701 1.00 110.56 ? 31   LYS H CA    1 
ATOM   5371  C  C     . LYS H 4 34  ? -40.545 -23.778 22.904 1.00 100.39 ? 31   LYS H C     1 
ATOM   5372  O  O     . LYS H 4 34  ? -41.311 -24.593 23.405 1.00 100.51 ? 31   LYS H O     1 
ATOM   5373  C  CB    . LYS H 4 34  ? -41.733 -21.743 23.916 1.00 116.21 ? 31   LYS H CB    1 
ATOM   5374  C  CG    . LYS H 4 34  ? -40.847 -20.948 24.883 1.00 136.99 ? 31   LYS H CG    1 
ATOM   5375  C  CD    . LYS H 4 34  ? -39.903 -21.833 25.710 1.00 152.20 ? 31   LYS H CD    1 
ATOM   5376  C  CE    . LYS H 4 34  ? -38.963 -21.037 26.623 1.00 153.54 ? 31   LYS H CE    1 
ATOM   5377  N  NZ    . LYS H 4 34  ? -37.711 -20.566 25.957 1.00 148.32 ? 31   LYS H NZ    1 
ATOM   5378  N  N     . GLU H 4 35  ? -39.317 -24.098 22.496 1.00 90.31  ? 32   GLU H N     1 
ATOM   5379  C  CA    . GLU H 4 35  ? -38.722 -25.426 22.684 1.00 89.84  ? 32   GLU H CA    1 
ATOM   5380  C  C     . GLU H 4 35  ? -38.546 -25.892 24.139 1.00 91.51  ? 32   GLU H C     1 
ATOM   5381  O  O     . GLU H 4 35  ? -38.547 -25.091 25.074 1.00 101.98 ? 32   GLU H O     1 
ATOM   5382  C  CB    . GLU H 4 35  ? -37.343 -25.456 22.068 1.00 92.38  ? 32   GLU H CB    1 
ATOM   5383  C  CG    . GLU H 4 35  ? -37.289 -25.807 20.607 1.00 94.20  ? 32   GLU H CG    1 
ATOM   5384  C  CD    . GLU H 4 35  ? -35.842 -25.990 20.207 1.00 106.85 ? 32   GLU H CD    1 
ATOM   5385  O  OE1   . GLU H 4 35  ? -35.543 -26.642 19.182 1.00 97.48  ? 32   GLU H OE1   1 
ATOM   5386  O  OE2   . GLU H 4 35  ? -34.979 -25.480 20.964 1.00 108.33 ? 32   GLU H OE2   1 
ATOM   5387  N  N     . SER H 4 36  ? -38.323 -27.200 24.285 1.00 83.61  ? 33   SER H N     1 
ATOM   5388  C  CA    . SER H 4 36  ? -38.356 -27.896 25.557 1.00 75.76  ? 33   SER H CA    1 
ATOM   5389  C  C     . SER H 4 36  ? -37.864 -29.311 25.361 1.00 74.43  ? 33   SER H C     1 
ATOM   5390  O  O     . SER H 4 36  ? -38.051 -29.863 24.297 1.00 84.63  ? 33   SER H O     1 
ATOM   5391  C  CB    . SER H 4 36  ? -39.794 -27.971 26.062 1.00 73.34  ? 33   SER H CB    1 
ATOM   5392  O  OG    . SER H 4 36  ? -39.849 -28.724 27.253 1.00 74.41  ? 33   SER H OG    1 
ATOM   5393  N  N     . TYR H 4 37  ? -37.267 -29.908 26.391 1.00 76.65  ? 34   TYR H N     1 
ATOM   5394  C  CA    . TYR H 4 37  ? -36.941 -31.355 26.389 1.00 70.23  ? 34   TYR H CA    1 
ATOM   5395  C  C     . TYR H 4 37  ? -38.137 -32.206 26.815 1.00 66.02  ? 34   TYR H C     1 
ATOM   5396  O  O     . TYR H 4 37  ? -38.046 -33.430 26.817 1.00 65.96  ? 34   TYR H O     1 
ATOM   5397  C  CB    . TYR H 4 37  ? -35.748 -31.683 27.311 1.00 68.26  ? 34   TYR H CB    1 
ATOM   5398  C  CG    . TYR H 4 37  ? -34.405 -31.140 26.852 1.00 70.52  ? 34   TYR H CG    1 
ATOM   5399  C  CD1   . TYR H 4 37  ? -33.899 -29.949 27.339 1.00 66.47  ? 34   TYR H CD1   1 
ATOM   5400  C  CD2   . TYR H 4 37  ? -33.631 -31.843 25.937 1.00 72.30  ? 34   TYR H CD2   1 
ATOM   5401  C  CE1   . TYR H 4 37  ? -32.671 -29.468 26.905 1.00 69.65  ? 34   TYR H CE1   1 
ATOM   5402  C  CE2   . TYR H 4 37  ? -32.414 -31.359 25.483 1.00 62.63  ? 34   TYR H CE2   1 
ATOM   5403  C  CZ    . TYR H 4 37  ? -31.943 -30.179 25.963 1.00 66.83  ? 34   TYR H CZ    1 
ATOM   5404  O  OH    . TYR H 4 37  ? -30.718 -29.735 25.520 1.00 73.84  ? 34   TYR H OH    1 
ATOM   5405  N  N     . ALA H 4 38  ? -39.268 -31.570 27.133 1.00 71.43  ? 35   ALA H N     1 
ATOM   5406  C  CA    . ALA H 4 38  ? -40.435 -32.269 27.749 1.00 80.60  ? 35   ALA H CA    1 
ATOM   5407  C  C     . ALA H 4 38  ? -40.874 -33.608 27.106 1.00 83.12  ? 35   ALA H C     1 
ATOM   5408  O  O     . ALA H 4 38  ? -41.152 -34.575 27.810 1.00 83.39  ? 35   ALA H O     1 
ATOM   5409  C  CB    . ALA H 4 38  ? -41.639 -31.324 27.864 1.00 71.77  ? 35   ALA H CB    1 
ATOM   5410  N  N     . ILE H 4 39  ? -40.947 -33.668 25.787 1.00 84.38  ? 36   ILE H N     1 
ATOM   5411  C  CA    . ILE H 4 39  ? -41.407 -34.907 25.140 1.00 95.75  ? 36   ILE H CA    1 
ATOM   5412  C  C     . ILE H 4 39  ? -40.381 -36.025 25.236 1.00 91.73  ? 36   ILE H C     1 
ATOM   5413  O  O     . ILE H 4 39  ? -40.756 -37.202 25.332 1.00 89.73  ? 36   ILE H O     1 
ATOM   5414  C  CB    . ILE H 4 39  ? -41.833 -34.735 23.650 1.00 96.52  ? 36   ILE H CB    1 
ATOM   5415  C  CG1   . ILE H 4 39  ? -41.001 -33.669 22.944 1.00 87.03  ? 36   ILE H CG1   1 
ATOM   5416  C  CG2   . ILE H 4 39  ? -43.319 -34.400 23.555 1.00 100.19 ? 36   ILE H CG2   1 
ATOM   5417  C  CD1   . ILE H 4 39  ? -40.742 -34.018 21.511 1.00 88.71  ? 36   ILE H CD1   1 
ATOM   5418  N  N     . TYR H 4 40  ? -39.102 -35.668 25.223 1.00 80.53  ? 37   TYR H N     1 
ATOM   5419  C  CA    . TYR H 4 40  ? -38.066 -36.684 25.333 1.00 84.39  ? 37   TYR H CA    1 
ATOM   5420  C  C     . TYR H 4 40  ? -38.038 -37.184 26.771 1.00 80.70  ? 37   TYR H C     1 
ATOM   5421  O  O     . TYR H 4 40  ? -37.981 -38.380 27.044 1.00 76.57  ? 37   TYR H O     1 
ATOM   5422  C  CB    . TYR H 4 40  ? -36.723 -36.129 24.952 1.00 80.89  ? 37   TYR H CB    1 
ATOM   5423  C  CG    . TYR H 4 40  ? -36.780 -35.366 23.686 1.00 88.29  ? 37   TYR H CG    1 
ATOM   5424  C  CD1   . TYR H 4 40  ? -36.817 -33.990 23.698 1.00 101.98 ? 37   TYR H CD1   1 
ATOM   5425  C  CD2   . TYR H 4 40  ? -36.805 -36.011 22.466 1.00 99.32  ? 37   TYR H CD2   1 
ATOM   5426  C  CE1   . TYR H 4 40  ? -36.873 -33.265 22.523 1.00 105.83 ? 37   TYR H CE1   1 
ATOM   5427  C  CE2   . TYR H 4 40  ? -36.844 -35.301 21.285 1.00 101.40 ? 37   TYR H CE2   1 
ATOM   5428  C  CZ    . TYR H 4 40  ? -36.889 -33.929 21.324 1.00 100.03 ? 37   TYR H CZ    1 
ATOM   5429  O  OH    . TYR H 4 40  ? -36.944 -33.216 20.159 1.00 115.46 ? 37   TYR H OH    1 
ATOM   5430  N  N     . VAL H 4 41  ? -38.126 -36.258 27.702 1.00 71.97  ? 38   VAL H N     1 
ATOM   5431  C  CA    . VAL H 4 41  ? -38.307 -36.647 29.086 1.00 75.49  ? 38   VAL H CA    1 
ATOM   5432  C  C     . VAL H 4 41  ? -39.475 -37.628 29.187 1.00 78.51  ? 38   VAL H C     1 
ATOM   5433  O  O     . VAL H 4 41  ? -39.379 -38.649 29.863 1.00 71.12  ? 38   VAL H O     1 
ATOM   5434  C  CB    . VAL H 4 41  ? -38.578 -35.412 29.963 1.00 72.89  ? 38   VAL H CB    1 
ATOM   5435  C  CG1   . VAL H 4 41  ? -39.108 -35.808 31.321 1.00 68.05  ? 38   VAL H CG1   1 
ATOM   5436  C  CG2   . VAL H 4 41  ? -37.304 -34.599 30.108 1.00 79.10  ? 38   VAL H CG2   1 
ATOM   5437  N  N     . TYR H 4 42  ? -40.573 -37.299 28.508 1.00 81.36  ? 39   TYR H N     1 
ATOM   5438  C  CA    . TYR H 4 42  ? -41.790 -38.090 28.592 1.00 84.19  ? 39   TYR H CA    1 
ATOM   5439  C  C     . TYR H 4 42  ? -41.602 -39.458 27.936 1.00 80.20  ? 39   TYR H C     1 
ATOM   5440  O  O     . TYR H 4 42  ? -42.075 -40.477 28.437 1.00 76.30  ? 39   TYR H O     1 
ATOM   5441  C  CB    . TYR H 4 42  ? -42.976 -37.338 27.979 1.00 88.45  ? 39   TYR H CB    1 
ATOM   5442  C  CG    . TYR H 4 42  ? -44.320 -37.891 28.410 1.00 98.31  ? 39   TYR H CG    1 
ATOM   5443  C  CD1   . TYR H 4 42  ? -44.917 -37.487 29.617 1.00 99.29  ? 39   TYR H CD1   1 
ATOM   5444  C  CD2   . TYR H 4 42  ? -45.000 -38.822 27.616 1.00 111.59 ? 39   TYR H CD2   1 
ATOM   5445  C  CE1   . TYR H 4 42  ? -46.145 -38.003 30.028 1.00 106.82 ? 39   TYR H CE1   1 
ATOM   5446  C  CE2   . TYR H 4 42  ? -46.230 -39.340 28.011 1.00 115.97 ? 39   TYR H CE2   1 
ATOM   5447  C  CZ    . TYR H 4 42  ? -46.798 -38.932 29.217 1.00 118.77 ? 39   TYR H CZ    1 
ATOM   5448  O  OH    . TYR H 4 42  ? -48.015 -39.451 29.607 1.00 119.73 ? 39   TYR H OH    1 
ATOM   5449  N  N     . LYS H 4 43  ? -40.881 -39.501 26.834 1.00 75.42  ? 40   LYS H N     1 
ATOM   5450  C  CA    . LYS H 4 43  ? -40.629 -40.788 26.233 1.00 80.90  ? 40   LYS H CA    1 
ATOM   5451  C  C     . LYS H 4 43  ? -39.918 -41.661 27.232 1.00 78.78  ? 40   LYS H C     1 
ATOM   5452  O  O     . LYS H 4 43  ? -40.345 -42.785 27.508 1.00 86.77  ? 40   LYS H O     1 
ATOM   5453  C  CB    . LYS H 4 43  ? -39.827 -40.653 24.947 1.00 86.25  ? 40   LYS H CB    1 
ATOM   5454  C  CG    . LYS H 4 43  ? -40.662 -40.103 23.791 1.00 87.88  ? 40   LYS H CG    1 
ATOM   5455  C  CD    . LYS H 4 43  ? -39.810 -39.978 22.537 1.00 93.65  ? 40   LYS H CD    1 
ATOM   5456  C  CE    . LYS H 4 43  ? -40.525 -39.277 21.397 1.00 94.15  ? 40   LYS H CE    1 
ATOM   5457  N  NZ    . LYS H 4 43  ? -39.504 -38.654 20.499 1.00 95.04  ? 40   LYS H NZ    1 
ATOM   5458  N  N     . VAL H 4 44  ? -38.864 -41.111 27.820 1.00 87.78  ? 41   VAL H N     1 
ATOM   5459  C  CA    . VAL H 4 44  ? -38.021 -41.862 28.760 1.00 81.30  ? 41   VAL H CA    1 
ATOM   5460  C  C     . VAL H 4 44  ? -38.802 -42.281 30.018 1.00 78.11  ? 41   VAL H C     1 
ATOM   5461  O  O     . VAL H 4 44  ? -38.602 -43.372 30.550 1.00 73.49  ? 41   VAL H O     1 
ATOM   5462  C  CB    . VAL H 4 44  ? -36.768 -41.066 29.161 1.00 75.83  ? 41   VAL H CB    1 
ATOM   5463  C  CG1   . VAL H 4 44  ? -35.788 -41.965 29.884 1.00 82.12  ? 41   VAL H CG1   1 
ATOM   5464  C  CG2   . VAL H 4 44  ? -36.062 -40.491 27.945 1.00 73.07  ? 41   VAL H CG2   1 
ATOM   5465  N  N     . LEU H 4 45  ? -39.708 -41.425 30.475 1.00 78.70  ? 42   LEU H N     1 
ATOM   5466  C  CA    . LEU H 4 45  ? -40.569 -41.757 31.603 1.00 79.08  ? 42   LEU H CA    1 
ATOM   5467  C  C     . LEU H 4 45  ? -41.279 -43.086 31.350 1.00 89.56  ? 42   LEU H C     1 
ATOM   5468  O  O     . LEU H 4 45  ? -41.279 -43.987 32.189 1.00 97.03  ? 42   LEU H O     1 
ATOM   5469  C  CB    . LEU H 4 45  ? -41.587 -40.636 31.832 1.00 75.96  ? 42   LEU H CB    1 
ATOM   5470  C  CG    . LEU H 4 45  ? -42.658 -40.846 32.913 1.00 82.03  ? 42   LEU H CG    1 
ATOM   5471  C  CD1   . LEU H 4 45  ? -42.094 -41.365 34.233 1.00 75.64  ? 42   LEU H CD1   1 
ATOM   5472  C  CD2   . LEU H 4 45  ? -43.487 -39.583 33.170 1.00 83.84  ? 42   LEU H CD2   1 
ATOM   5473  N  N     . LYS H 4 46  ? -41.863 -43.216 30.170 1.00 97.42  ? 43   LYS H N     1 
ATOM   5474  C  CA    . LYS H 4 46  ? -42.648 -44.397 29.858 1.00 91.93  ? 43   LYS H CA    1 
ATOM   5475  C  C     . LYS H 4 46  ? -41.808 -45.680 29.845 1.00 88.42  ? 43   LYS H C     1 
ATOM   5476  O  O     . LYS H 4 46  ? -42.203 -46.660 30.468 1.00 80.53  ? 43   LYS H O     1 
ATOM   5477  C  CB    . LYS H 4 46  ? -43.396 -44.177 28.551 1.00 90.76  ? 43   LYS H CB    1 
ATOM   5478  C  CG    . LYS H 4 46  ? -44.475 -43.105 28.675 1.00 84.96  ? 43   LYS H CG    1 
ATOM   5479  C  CD    . LYS H 4 46  ? -45.582 -43.589 29.585 1.00 87.17  ? 43   LYS H CD    1 
ATOM   5480  C  CE    . LYS H 4 46  ? -46.072 -42.503 30.516 1.00 94.78  ? 43   LYS H CE    1 
ATOM   5481  N  NZ    . LYS H 4 46  ? -46.988 -43.056 31.553 1.00 95.32  ? 43   LYS H NZ    1 
ATOM   5482  N  N     . GLN H 4 47  ? -40.642 -45.666 29.189 1.00 86.38  ? 44   GLN H N     1 
ATOM   5483  C  CA    . GLN H 4 47  ? -39.713 -46.811 29.252 1.00 88.34  ? 44   GLN H CA    1 
ATOM   5484  C  C     . GLN H 4 47  ? -39.443 -47.236 30.693 1.00 90.07  ? 44   GLN H C     1 
ATOM   5485  O  O     . GLN H 4 47  ? -39.333 -48.404 31.019 1.00 94.17  ? 44   GLN H O     1 
ATOM   5486  C  CB    . GLN H 4 47  ? -38.365 -46.466 28.645 1.00 91.99  ? 44   GLN H CB    1 
ATOM   5487  C  CG    . GLN H 4 47  ? -38.327 -46.342 27.135 1.00 105.85 ? 44   GLN H CG    1 
ATOM   5488  C  CD    . GLN H 4 47  ? -36.887 -46.308 26.594 1.00 123.84 ? 44   GLN H CD    1 
ATOM   5489  O  OE1   . GLN H 4 47  ? -35.959 -46.889 27.187 1.00 114.77 ? 44   GLN H OE1   1 
ATOM   5490  N  NE2   . GLN H 4 47  ? -36.699 -45.637 25.453 1.00 127.67 ? 44   GLN H NE2   1 
ATOM   5491  N  N     . VAL H 4 48  ? -39.324 -46.255 31.562 1.00 93.01  ? 45   VAL H N     1 
ATOM   5492  C  CA    . VAL H 4 48  ? -38.908 -46.492 32.929 1.00 84.67  ? 45   VAL H CA    1 
ATOM   5493  C  C     . VAL H 4 48  ? -40.090 -46.823 33.828 1.00 76.71  ? 45   VAL H C     1 
ATOM   5494  O  O     . VAL H 4 48  ? -39.974 -47.640 34.707 1.00 82.11  ? 45   VAL H O     1 
ATOM   5495  C  CB    . VAL H 4 48  ? -38.142 -45.249 33.446 1.00 86.36  ? 45   VAL H CB    1 
ATOM   5496  C  CG1   . VAL H 4 48  ? -37.878 -45.329 34.922 1.00 90.06  ? 45   VAL H CG1   1 
ATOM   5497  C  CG2   . VAL H 4 48  ? -36.818 -45.120 32.722 1.00 85.36  ? 45   VAL H CG2   1 
ATOM   5498  N  N     . HIS H 4 49  ? -41.217 -46.166 33.622 1.00 79.81  ? 46   HIS H N     1 
ATOM   5499  C  CA    . HIS H 4 49  ? -42.395 -46.389 34.441 1.00 92.70  ? 46   HIS H CA    1 
ATOM   5500  C  C     . HIS H 4 49  ? -43.605 -46.177 33.529 1.00 98.79  ? 46   HIS H C     1 
ATOM   5501  O  O     . HIS H 4 49  ? -44.152 -45.062 33.477 1.00 105.46 ? 46   HIS H O     1 
ATOM   5502  C  CB    . HIS H 4 49  ? -42.448 -45.371 35.592 1.00 99.53  ? 46   HIS H CB    1 
ATOM   5503  C  CG    . HIS H 4 49  ? -41.657 -45.747 36.815 1.00 100.14 ? 46   HIS H CG    1 
ATOM   5504  N  ND1   . HIS H 4 49  ? -42.246 -46.254 37.956 1.00 99.19  ? 46   HIS H ND1   1 
ATOM   5505  C  CD2   . HIS H 4 49  ? -40.342 -45.613 37.106 1.00 94.83  ? 46   HIS H CD2   1 
ATOM   5506  C  CE1   . HIS H 4 49  ? -41.319 -46.458 38.877 1.00 95.84  ? 46   HIS H CE1   1 
ATOM   5507  N  NE2   . HIS H 4 49  ? -40.154 -46.075 38.385 1.00 94.66  ? 46   HIS H NE2   1 
ATOM   5508  N  N     . PRO H 4 50  ? -44.021 -47.224 32.788 1.00 96.88  ? 47   PRO H N     1 
ATOM   5509  C  CA    . PRO H 4 50  ? -45.031 -46.979 31.739 1.00 93.66  ? 47   PRO H CA    1 
ATOM   5510  C  C     . PRO H 4 50  ? -46.420 -46.615 32.288 1.00 91.40  ? 47   PRO H C     1 
ATOM   5511  O  O     . PRO H 4 50  ? -47.179 -45.954 31.597 1.00 83.00  ? 47   PRO H O     1 
ATOM   5512  C  CB    . PRO H 4 50  ? -45.057 -48.285 30.943 1.00 92.83  ? 47   PRO H CB    1 
ATOM   5513  C  CG    . PRO H 4 50  ? -43.893 -49.103 31.446 1.00 93.67  ? 47   PRO H CG    1 
ATOM   5514  C  CD    . PRO H 4 50  ? -43.608 -48.635 32.835 1.00 91.31  ? 47   PRO H CD    1 
ATOM   5515  N  N     . ASP H 4 51  ? -46.724 -47.003 33.527 1.00 92.96  ? 48   ASP H N     1 
ATOM   5516  C  CA    . ASP H 4 51  ? -47.982 -46.609 34.181 1.00 109.75 ? 48   ASP H CA    1 
ATOM   5517  C  C     . ASP H 4 51  ? -47.891 -45.305 35.014 1.00 107.03 ? 48   ASP H C     1 
ATOM   5518  O  O     . ASP H 4 51  ? -48.804 -45.020 35.808 1.00 96.55  ? 48   ASP H O     1 
ATOM   5519  C  CB    . ASP H 4 51  ? -48.482 -47.721 35.136 1.00 122.93 ? 48   ASP H CB    1 
ATOM   5520  C  CG    . ASP H 4 51  ? -48.657 -49.073 34.459 1.00 126.63 ? 48   ASP H CG    1 
ATOM   5521  O  OD1   . ASP H 4 51  ? -49.284 -49.144 33.374 1.00 125.27 ? 48   ASP H OD1   1 
ATOM   5522  O  OD2   . ASP H 4 51  ? -48.202 -50.079 35.054 1.00 133.33 ? 48   ASP H OD2   1 
ATOM   5523  N  N     . THR H 4 52  ? -46.805 -44.536 34.888 1.00 103.75 ? 49   THR H N     1 
ATOM   5524  C  CA    . THR H 4 52  ? -46.613 -43.355 35.755 1.00 94.62  ? 49   THR H CA    1 
ATOM   5525  C  C     . THR H 4 52  ? -46.573 -42.078 34.937 1.00 88.86  ? 49   THR H C     1 
ATOM   5526  O  O     . THR H 4 52  ? -45.986 -42.068 33.857 1.00 85.91  ? 49   THR H O     1 
ATOM   5527  C  CB    . THR H 4 52  ? -45.315 -43.443 36.566 1.00 97.55  ? 49   THR H CB    1 
ATOM   5528  O  OG1   . THR H 4 52  ? -45.229 -44.713 37.217 1.00 101.78 ? 49   THR H OG1   1 
ATOM   5529  C  CG2   . THR H 4 52  ? -45.270 -42.374 37.625 1.00 101.30 ? 49   THR H CG2   1 
ATOM   5530  N  N     . GLY H 4 53  ? -47.197 -41.019 35.469 1.00 87.54  ? 50   GLY H N     1 
ATOM   5531  C  CA    . GLY H 4 53  ? -47.365 -39.723 34.787 1.00 87.39  ? 50   GLY H CA    1 
ATOM   5532  C  C     . GLY H 4 53  ? -46.587 -38.639 35.497 1.00 81.83  ? 50   GLY H C     1 
ATOM   5533  O  O     . GLY H 4 53  ? -45.841 -38.919 36.411 1.00 89.29  ? 50   GLY H O     1 
ATOM   5534  N  N     . ILE H 4 54  ? -46.769 -37.398 35.096 1.00 74.93  ? 51   ILE H N     1 
ATOM   5535  C  CA    . ILE H 4 54  ? -45.932 -36.346 35.601 1.00 77.98  ? 51   ILE H CA    1 
ATOM   5536  C  C     . ILE H 4 54  ? -46.592 -34.992 35.526 1.00 72.55  ? 51   ILE H C     1 
ATOM   5537  O  O     . ILE H 4 54  ? -47.061 -34.582 34.469 1.00 73.74  ? 51   ILE H O     1 
ATOM   5538  C  CB    . ILE H 4 54  ? -44.588 -36.304 34.832 1.00 87.13  ? 51   ILE H CB    1 
ATOM   5539  C  CG1   . ILE H 4 54  ? -43.637 -35.269 35.462 1.00 83.91  ? 51   ILE H CG1   1 
ATOM   5540  C  CG2   . ILE H 4 54  ? -44.799 -36.033 33.344 1.00 89.16  ? 51   ILE H CG2   1 
ATOM   5541  C  CD1   . ILE H 4 54  ? -42.196 -35.478 35.064 1.00 82.59  ? 51   ILE H CD1   1 
ATOM   5542  N  N     . SER H 4 55  ? -46.564 -34.275 36.641 1.00 69.47  ? 52   SER H N     1 
ATOM   5543  C  CA    . SER H 4 55  ? -47.201 -32.971 36.713 1.00 70.95  ? 52   SER H CA    1 
ATOM   5544  C  C     . SER H 4 55  ? -46.455 -31.962 35.849 1.00 69.27  ? 52   SER H C     1 
ATOM   5545  O  O     . SER H 4 55  ? -45.309 -32.198 35.435 1.00 64.50  ? 52   SER H O     1 
ATOM   5546  C  CB    . SER H 4 55  ? -47.286 -32.475 38.157 1.00 73.38  ? 52   SER H CB    1 
ATOM   5547  O  OG    . SER H 4 55  ? -46.152 -31.707 38.503 1.00 78.60  ? 52   SER H OG    1 
ATOM   5548  N  N     . SER H 4 56  ? -47.126 -30.856 35.551 1.00 68.07  ? 53   SER H N     1 
ATOM   5549  C  CA    . SER H 4 56  ? -46.511 -29.809 34.765 1.00 74.90  ? 53   SER H CA    1 
ATOM   5550  C  C     . SER H 4 56  ? -45.306 -29.318 35.495 1.00 77.51  ? 53   SER H C     1 
ATOM   5551  O  O     . SER H 4 56  ? -44.211 -29.269 34.927 1.00 77.85  ? 53   SER H O     1 
ATOM   5552  C  CB    . SER H 4 56  ? -47.450 -28.631 34.543 1.00 79.14  ? 53   SER H CB    1 
ATOM   5553  O  OG    . SER H 4 56  ? -47.725 -28.529 33.171 1.00 97.01  ? 53   SER H OG    1 
ATOM   5554  N  N     . LYS H 4 57  ? -45.513 -28.962 36.760 1.00 68.41  ? 54   LYS H N     1 
ATOM   5555  C  CA    . LYS H 4 57  ? -44.436 -28.443 37.547 1.00 73.83  ? 54   LYS H CA    1 
ATOM   5556  C  C     . LYS H 4 57  ? -43.278 -29.443 37.534 1.00 78.03  ? 54   LYS H C     1 
ATOM   5557  O  O     . LYS H 4 57  ? -42.130 -29.092 37.232 1.00 88.94  ? 54   LYS H O     1 
ATOM   5558  C  CB    . LYS H 4 57  ? -44.923 -28.072 38.948 1.00 89.46  ? 54   LYS H CB    1 
ATOM   5559  C  CG    . LYS H 4 57  ? -45.590 -26.686 38.975 1.00 106.47 ? 54   LYS H CG    1 
ATOM   5560  C  CD    . LYS H 4 57  ? -46.775 -26.537 39.946 1.00 116.03 ? 54   LYS H CD    1 
ATOM   5561  C  CE    . LYS H 4 57  ? -47.450 -25.166 39.791 1.00 116.19 ? 54   LYS H CE    1 
ATOM   5562  N  NZ    . LYS H 4 57  ? -48.921 -25.200 40.017 1.00 118.74 ? 54   LYS H NZ    1 
ATOM   5563  N  N     . ALA H 4 58  ? -43.565 -30.709 37.774 1.00 67.34  ? 55   ALA H N     1 
ATOM   5564  C  CA    . ALA H 4 58  ? -42.494 -31.674 37.740 1.00 62.81  ? 55   ALA H CA    1 
ATOM   5565  C  C     . ALA H 4 58  ? -41.766 -31.677 36.405 1.00 58.66  ? 55   ALA H C     1 
ATOM   5566  O  O     . ALA H 4 58  ? -40.581 -31.895 36.328 1.00 62.41  ? 55   ALA H O     1 
ATOM   5567  C  CB    . ALA H 4 58  ? -43.021 -33.047 38.061 1.00 65.67  ? 55   ALA H CB    1 
ATOM   5568  N  N     . MET H 4 59  ? -42.472 -31.455 35.326 1.00 65.93  ? 56   MET H N     1 
ATOM   5569  C  CA    . MET H 4 59  ? -41.810 -31.544 34.031 1.00 68.30  ? 56   MET H CA    1 
ATOM   5570  C  C     . MET H 4 59  ? -40.874 -30.358 33.825 1.00 64.43  ? 56   MET H C     1 
ATOM   5571  O  O     . MET H 4 59  ? -39.777 -30.475 33.266 1.00 56.68  ? 56   MET H O     1 
ATOM   5572  C  CB    . MET H 4 59  ? -42.844 -31.609 32.922 1.00 62.55  ? 56   MET H CB    1 
ATOM   5573  C  CG    . MET H 4 59  ? -42.235 -31.564 31.542 1.00 64.02  ? 56   MET H CG    1 
ATOM   5574  S  SD    . MET H 4 59  ? -41.217 -32.995 31.191 1.00 72.60  ? 56   MET H SD    1 
ATOM   5575  C  CE    . MET H 4 59  ? -42.497 -34.226 30.932 1.00 78.11  ? 56   MET H CE    1 
ATOM   5576  N  N     . SER H 4 60  ? -41.340 -29.211 34.287 1.00 66.16  ? 57   SER H N     1 
ATOM   5577  C  CA    . SER H 4 60  ? -40.583 -27.974 34.218 1.00 64.18  ? 57   SER H CA    1 
ATOM   5578  C  C     . SER H 4 60  ? -39.239 -28.176 34.938 1.00 64.46  ? 57   SER H C     1 
ATOM   5579  O  O     . SER H 4 60  ? -38.184 -27.842 34.426 1.00 63.39  ? 57   SER H O     1 
ATOM   5580  C  CB    . SER H 4 60  ? -41.415 -26.863 34.871 1.00 60.71  ? 57   SER H CB    1 
ATOM   5581  O  OG    . SER H 4 60  ? -41.118 -25.606 34.334 1.00 75.45  ? 57   SER H OG    1 
ATOM   5582  N  N     . ILE H 4 61  ? -39.291 -28.775 36.124 1.00 65.77  ? 58   ILE H N     1 
ATOM   5583  C  CA    . ILE H 4 61  ? -38.093 -29.094 36.881 1.00 59.07  ? 58   ILE H CA    1 
ATOM   5584  C  C     . ILE H 4 61  ? -37.148 -30.004 36.126 1.00 59.83  ? 58   ILE H C     1 
ATOM   5585  O  O     . ILE H 4 61  ? -35.941 -29.798 36.098 1.00 64.81  ? 58   ILE H O     1 
ATOM   5586  C  CB    . ILE H 4 61  ? -38.481 -29.756 38.178 1.00 60.54  ? 58   ILE H CB    1 
ATOM   5587  C  CG1   . ILE H 4 61  ? -38.961 -28.677 39.151 1.00 67.62  ? 58   ILE H CG1   1 
ATOM   5588  C  CG2   . ILE H 4 61  ? -37.284 -30.452 38.770 1.00 66.25  ? 58   ILE H CG2   1 
ATOM   5589  C  CD1   . ILE H 4 61  ? -39.935 -29.181 40.185 1.00 71.50  ? 58   ILE H CD1   1 
ATOM   5590  N  N     . MET H 4 62  ? -37.702 -31.022 35.499 1.00 67.75  ? 59   MET H N     1 
ATOM   5591  C  CA    . MET H 4 62  ? -36.893 -31.944 34.727 1.00 64.08  ? 59   MET H CA    1 
ATOM   5592  C  C     . MET H 4 62  ? -36.256 -31.212 33.577 1.00 64.78  ? 59   MET H C     1 
ATOM   5593  O  O     . MET H 4 62  ? -35.152 -31.503 33.142 1.00 66.87  ? 59   MET H O     1 
ATOM   5594  C  CB    . MET H 4 62  ? -37.757 -33.068 34.220 1.00 64.72  ? 59   MET H CB    1 
ATOM   5595  C  CG    . MET H 4 62  ? -38.203 -34.019 35.322 1.00 69.99  ? 59   MET H CG    1 
ATOM   5596  S  SD    . MET H 4 62  ? -36.846 -34.865 36.149 1.00 66.99  ? 59   MET H SD    1 
ATOM   5597  C  CE    . MET H 4 62  ? -35.991 -35.552 34.751 1.00 63.39  ? 59   MET H CE    1 
ATOM   5598  N  N     . ASN H 4 63  ? -36.958 -30.235 33.070 1.00 65.18  ? 60   ASN H N     1 
ATOM   5599  C  CA    . ASN H 4 63  ? -36.445 -29.557 31.939 1.00 65.65  ? 60   ASN H CA    1 
ATOM   5600  C  C     . ASN H 4 63  ? -35.274 -28.668 32.387 1.00 64.04  ? 60   ASN H C     1 
ATOM   5601  O  O     . ASN H 4 63  ? -34.229 -28.640 31.730 1.00 66.21  ? 60   ASN H O     1 
ATOM   5602  C  CB    . ASN H 4 63  ? -37.577 -28.774 31.270 1.00 68.22  ? 60   ASN H CB    1 
ATOM   5603  C  CG    . ASN H 4 63  ? -37.186 -28.293 29.910 1.00 68.21  ? 60   ASN H CG    1 
ATOM   5604  O  OD1   . ASN H 4 63  ? -36.496 -29.005 29.176 1.00 66.00  ? 60   ASN H OD1   1 
ATOM   5605  N  ND2   . ASN H 4 63  ? -37.560 -27.065 29.581 1.00 64.10  ? 60   ASN H ND2   1 
ATOM   5606  N  N     . SER H 4 64  ? -35.437 -27.968 33.512 1.00 59.49  ? 61   SER H N     1 
ATOM   5607  C  CA    . SER H 4 64  ? -34.339 -27.171 34.081 1.00 63.23  ? 61   SER H CA    1 
ATOM   5608  C  C     . SER H 4 64  ? -33.143 -28.094 34.246 1.00 63.22  ? 61   SER H C     1 
ATOM   5609  O  O     . SER H 4 64  ? -32.053 -27.829 33.728 1.00 60.87  ? 61   SER H O     1 
ATOM   5610  C  CB    . SER H 4 64  ? -34.696 -26.581 35.447 1.00 63.75  ? 61   SER H CB    1 
ATOM   5611  O  OG    . SER H 4 64  ? -35.811 -25.738 35.365 1.00 71.96  ? 61   SER H OG    1 
ATOM   5612  N  N     . PHE H 4 65  ? -33.379 -29.207 34.928 1.00 58.04  ? 62   PHE H N     1 
ATOM   5613  C  CA    . PHE H 4 65  ? -32.335 -30.162 35.136 1.00 60.95  ? 62   PHE H CA    1 
ATOM   5614  C  C     . PHE H 4 65  ? -31.513 -30.476 33.889 1.00 66.05  ? 62   PHE H C     1 
ATOM   5615  O  O     . PHE H 4 65  ? -30.263 -30.394 33.913 1.00 63.56  ? 62   PHE H O     1 
ATOM   5616  C  CB    . PHE H 4 65  ? -32.918 -31.430 35.625 1.00 59.11  ? 62   PHE H CB    1 
ATOM   5617  C  CG    . PHE H 4 65  ? -31.909 -32.489 35.809 1.00 62.95  ? 62   PHE H CG    1 
ATOM   5618  C  CD1   . PHE H 4 65  ? -31.013 -32.416 36.850 1.00 67.68  ? 62   PHE H CD1   1 
ATOM   5619  C  CD2   . PHE H 4 65  ? -31.857 -33.546 34.951 1.00 62.25  ? 62   PHE H CD2   1 
ATOM   5620  C  CE1   . PHE H 4 65  ? -30.088 -33.409 37.047 1.00 70.37  ? 62   PHE H CE1   1 
ATOM   5621  C  CE2   . PHE H 4 65  ? -30.943 -34.541 35.135 1.00 65.66  ? 62   PHE H CE2   1 
ATOM   5622  C  CZ    . PHE H 4 65  ? -30.049 -34.472 36.175 1.00 71.17  ? 62   PHE H CZ    1 
ATOM   5623  N  N     . VAL H 4 66  ? -32.204 -30.823 32.805 1.00 59.43  ? 63   VAL H N     1 
ATOM   5624  C  CA    . VAL H 4 66  ? -31.498 -31.171 31.584 1.00 59.17  ? 63   VAL H CA    1 
ATOM   5625  C  C     . VAL H 4 66  ? -30.682 -29.985 31.072 1.00 62.83  ? 63   VAL H C     1 
ATOM   5626  O  O     . VAL H 4 66  ? -29.470 -30.134 30.736 1.00 57.19  ? 63   VAL H O     1 
ATOM   5627  C  CB    . VAL H 4 66  ? -32.437 -31.673 30.489 1.00 56.07  ? 63   VAL H CB    1 
ATOM   5628  C  CG1   . VAL H 4 66  ? -31.641 -32.003 29.248 1.00 52.63  ? 63   VAL H CG1   1 
ATOM   5629  C  CG2   . VAL H 4 66  ? -33.168 -32.921 30.951 1.00 58.19  ? 63   VAL H CG2   1 
ATOM   5630  N  N     . ASN H 4 67  ? -31.317 -28.810 31.046 1.00 59.30  ? 64   ASN H N     1 
ATOM   5631  C  CA    . ASN H 4 67  ? -30.585 -27.595 30.639 1.00 66.20  ? 64   ASN H CA    1 
ATOM   5632  C  C     . ASN H 4 67  ? -29.380 -27.250 31.492 1.00 61.35  ? 64   ASN H C     1 
ATOM   5633  O  O     . ASN H 4 67  ? -28.353 -26.785 30.966 1.00 60.76  ? 64   ASN H O     1 
ATOM   5634  C  CB    . ASN H 4 67  ? -31.484 -26.382 30.601 1.00 67.91  ? 64   ASN H CB    1 
ATOM   5635  C  CG    . ASN H 4 67  ? -32.363 -26.385 29.396 1.00 68.05  ? 64   ASN H CG    1 
ATOM   5636  O  OD1   . ASN H 4 67  ? -31.894 -26.609 28.276 1.00 68.94  ? 64   ASN H OD1   1 
ATOM   5637  N  ND2   . ASN H 4 67  ? -33.656 -26.205 29.616 1.00 73.26  ? 64   ASN H ND2   1 
ATOM   5638  N  N     . ASP H 4 68  ? -29.522 -27.470 32.789 1.00 51.76  ? 65   ASP H N     1 
ATOM   5639  C  CA    . ASP H 4 68  ? -28.452 -27.246 33.716 1.00 53.37  ? 65   ASP H CA    1 
ATOM   5640  C  C     . ASP H 4 68  ? -27.331 -28.174 33.357 1.00 54.10  ? 65   ASP H C     1 
ATOM   5641  O  O     . ASP H 4 68  ? -26.215 -27.763 32.986 1.00 59.59  ? 65   ASP H O     1 
ATOM   5642  C  CB    . ASP H 4 68  ? -28.959 -27.526 35.129 1.00 63.46  ? 65   ASP H CB    1 
ATOM   5643  C  CG    . ASP H 4 68  ? -27.997 -27.108 36.200 1.00 60.58  ? 65   ASP H CG    1 
ATOM   5644  O  OD1   . ASP H 4 68  ? -26.977 -26.488 35.868 1.00 58.06  ? 65   ASP H OD1   1 
ATOM   5645  O  OD2   . ASP H 4 68  ? -28.272 -27.412 37.388 1.00 66.82  ? 65   ASP H OD2   1 
ATOM   5646  N  N     . VAL H 4 69  ? -27.604 -29.455 33.418 1.00 56.62  ? 66   VAL H N     1 
ATOM   5647  C  CA    . VAL H 4 69  ? -26.502 -30.381 33.204 1.00 56.81  ? 66   VAL H CA    1 
ATOM   5648  C  C     . VAL H 4 69  ? -25.903 -30.152 31.841 1.00 55.80  ? 66   VAL H C     1 
ATOM   5649  O  O     . VAL H 4 69  ? -24.697 -30.212 31.675 1.00 54.84  ? 66   VAL H O     1 
ATOM   5650  C  CB    . VAL H 4 69  ? -26.925 -31.842 33.340 1.00 55.83  ? 66   VAL H CB    1 
ATOM   5651  C  CG1   . VAL H 4 69  ? -25.825 -32.735 32.843 1.00 55.51  ? 66   VAL H CG1   1 
ATOM   5652  C  CG2   . VAL H 4 69  ? -27.210 -32.176 34.799 1.00 59.27  ? 66   VAL H CG2   1 
ATOM   5653  N  N     . PHE H 4 70  ? -26.742 -29.871 30.855 1.00 59.69  ? 67   PHE H N     1 
ATOM   5654  C  CA    . PHE H 4 70  ? -26.212 -29.530 29.538 1.00 59.95  ? 67   PHE H CA    1 
ATOM   5655  C  C     . PHE H 4 70  ? -25.106 -28.459 29.637 1.00 60.88  ? 67   PHE H C     1 
ATOM   5656  O  O     . PHE H 4 70  ? -23.976 -28.627 29.132 1.00 52.57  ? 67   PHE H O     1 
ATOM   5657  C  CB    . PHE H 4 70  ? -27.325 -29.032 28.615 1.00 56.57  ? 67   PHE H CB    1 
ATOM   5658  C  CG    . PHE H 4 70  ? -26.834 -28.737 27.225 1.00 59.21  ? 67   PHE H CG    1 
ATOM   5659  C  CD1   . PHE H 4 70  ? -26.951 -29.683 26.218 1.00 64.58  ? 67   PHE H CD1   1 
ATOM   5660  C  CD2   . PHE H 4 70  ? -26.201 -27.533 26.941 1.00 58.24  ? 67   PHE H CD2   1 
ATOM   5661  C  CE1   . PHE H 4 70  ? -26.457 -29.440 24.946 1.00 67.07  ? 67   PHE H CE1   1 
ATOM   5662  C  CE2   . PHE H 4 70  ? -25.715 -27.273 25.677 1.00 64.69  ? 67   PHE H CE2   1 
ATOM   5663  C  CZ    . PHE H 4 70  ? -25.833 -28.236 24.674 1.00 70.57  ? 67   PHE H CZ    1 
ATOM   5664  N  N     . GLU H 4 71  ? -25.461 -27.358 30.294 1.00 60.49  ? 68   GLU H N     1 
ATOM   5665  C  CA    . GLU H 4 71  ? -24.583 -26.204 30.384 1.00 62.62  ? 68   GLU H CA    1 
ATOM   5666  C  C     . GLU H 4 71  ? -23.339 -26.561 31.163 1.00 60.07  ? 68   GLU H C     1 
ATOM   5667  O  O     . GLU H 4 71  ? -22.217 -26.186 30.763 1.00 55.98  ? 68   GLU H O     1 
ATOM   5668  C  CB    . GLU H 4 71  ? -25.300 -24.982 30.990 1.00 66.45  ? 68   GLU H CB    1 
ATOM   5669  C  CG    . GLU H 4 71  ? -25.982 -24.100 29.926 1.00 80.13  ? 68   GLU H CG    1 
ATOM   5670  C  CD    . GLU H 4 71  ? -27.239 -23.332 30.406 1.00 92.02  ? 68   GLU H CD    1 
ATOM   5671  O  OE1   . GLU H 4 71  ? -27.576 -23.335 31.616 1.00 91.04  ? 68   GLU H OE1   1 
ATOM   5672  O  OE2   . GLU H 4 71  ? -27.900 -22.681 29.565 1.00 91.54  ? 68   GLU H OE2   1 
ATOM   5673  N  N     . ARG H 4 72  ? -23.515 -27.306 32.252 1.00 53.79  ? 69   ARG H N     1 
ATOM   5674  C  CA    . ARG H 4 72  ? -22.359 -27.640 33.055 1.00 53.55  ? 69   ARG H CA    1 
ATOM   5675  C  C     . ARG H 4 72  ? -21.372 -28.452 32.236 1.00 52.56  ? 69   ARG H C     1 
ATOM   5676  O  O     . ARG H 4 72  ? -20.175 -28.161 32.162 1.00 53.20  ? 69   ARG H O     1 
ATOM   5677  C  CB    . ARG H 4 72  ? -22.772 -28.380 34.308 1.00 57.53  ? 69   ARG H CB    1 
ATOM   5678  C  CG    . ARG H 4 72  ? -23.633 -27.579 35.294 1.00 57.84  ? 69   ARG H CG    1 
ATOM   5679  C  CD    . ARG H 4 72  ? -23.481 -28.205 36.672 1.00 55.46  ? 69   ARG H CD    1 
ATOM   5680  N  NE    . ARG H 4 72  ? -24.728 -28.322 37.378 1.00 54.83  ? 69   ARG H NE    1 
ATOM   5681  C  CZ    . ARG H 4 72  ? -24.887 -29.014 38.494 1.00 59.15  ? 69   ARG H CZ    1 
ATOM   5682  N  NH1   . ARG H 4 72  ? -23.883 -29.661 39.048 1.00 57.11  ? 69   ARG H NH1   1 
ATOM   5683  N  NH2   . ARG H 4 72  ? -26.074 -29.051 39.068 1.00 71.46  ? 69   ARG H NH2   1 
ATOM   5684  N  N     . ILE H 4 73  ? -21.889 -29.456 31.566 1.00 57.12  ? 70   ILE H N     1 
ATOM   5685  C  CA    . ILE H 4 73  ? -21.020 -30.304 30.799 1.00 62.03  ? 70   ILE H CA    1 
ATOM   5686  C  C     . ILE H 4 73  ? -20.400 -29.532 29.637 1.00 59.51  ? 70   ILE H C     1 
ATOM   5687  O  O     . ILE H 4 73  ? -19.200 -29.521 29.521 1.00 62.95  ? 70   ILE H O     1 
ATOM   5688  C  CB    . ILE H 4 73  ? -21.740 -31.568 30.323 1.00 59.22  ? 70   ILE H CB    1 
ATOM   5689  C  CG1   . ILE H 4 73  ? -22.092 -32.420 31.517 1.00 55.47  ? 70   ILE H CG1   1 
ATOM   5690  C  CG2   . ILE H 4 73  ? -20.829 -32.373 29.432 1.00 60.52  ? 70   ILE H CG2   1 
ATOM   5691  C  CD1   . ILE H 4 73  ? -22.803 -33.683 31.133 1.00 57.52  ? 70   ILE H CD1   1 
ATOM   5692  N  N     . ALA H 4 74  ? -21.201 -28.895 28.794 1.00 56.19  ? 71   ALA H N     1 
ATOM   5693  C  CA    . ALA H 4 74  ? -20.635 -28.113 27.692 1.00 61.86  ? 71   ALA H CA    1 
ATOM   5694  C  C     . ALA H 4 74  ? -19.619 -27.105 28.217 1.00 61.90  ? 71   ALA H C     1 
ATOM   5695  O  O     . ALA H 4 74  ? -18.542 -26.907 27.640 1.00 62.08  ? 71   ALA H O     1 
ATOM   5696  C  CB    . ALA H 4 74  ? -21.726 -27.379 26.929 1.00 62.46  ? 71   ALA H CB    1 
ATOM   5697  N  N     . GLY H 4 75  ? -19.963 -26.464 29.324 1.00 61.40  ? 72   GLY H N     1 
ATOM   5698  C  CA    . GLY H 4 75  ? -19.091 -25.450 29.883 1.00 65.96  ? 72   GLY H CA    1 
ATOM   5699  C  C     . GLY H 4 75  ? -17.709 -25.983 30.221 1.00 64.05  ? 72   GLY H C     1 
ATOM   5700  O  O     . GLY H 4 75  ? -16.673 -25.420 29.829 1.00 60.05  ? 72   GLY H O     1 
ATOM   5701  N  N     . GLU H 4 76  ? -17.690 -27.073 30.966 1.00 62.97  ? 73   GLU H N     1 
ATOM   5702  C  CA    . GLU H 4 76  ? -16.433 -27.713 31.250 1.00 62.74  ? 73   GLU H CA    1 
ATOM   5703  C  C     . GLU H 4 76  ? -15.686 -28.126 29.969 1.00 62.55  ? 73   GLU H C     1 
ATOM   5704  O  O     . GLU H 4 76  ? -14.470 -27.950 29.886 1.00 75.10  ? 73   GLU H O     1 
ATOM   5705  C  CB    . GLU H 4 76  ? -16.670 -28.925 32.120 1.00 65.44  ? 73   GLU H CB    1 
ATOM   5706  C  CG    . GLU H 4 76  ? -15.368 -29.507 32.623 1.00 73.01  ? 73   GLU H CG    1 
ATOM   5707  C  CD    . GLU H 4 76  ? -14.674 -28.597 33.623 1.00 85.44  ? 73   GLU H CD    1 
ATOM   5708  O  OE1   . GLU H 4 76  ? -13.592 -28.024 33.228 1.00 78.72  ? 73   GLU H OE1   1 
ATOM   5709  O  OE2   . GLU H 4 76  ? -15.246 -28.466 34.775 1.00 74.61  ? 73   GLU H OE2   1 
ATOM   5710  N  N     . ALA H 4 77  ? -16.407 -28.655 28.980 1.00 54.57  ? 74   ALA H N     1 
ATOM   5711  C  CA    . ALA H 4 77  ? -15.797 -29.156 27.764 1.00 57.24  ? 74   ALA H CA    1 
ATOM   5712  C  C     . ALA H 4 77  ? -15.139 -28.043 27.046 1.00 57.44  ? 74   ALA H C     1 
ATOM   5713  O  O     . ALA H 4 77  ? -13.997 -28.183 26.616 1.00 58.44  ? 74   ALA H O     1 
ATOM   5714  C  CB    . ALA H 4 77  ? -16.831 -29.795 26.864 1.00 62.53  ? 74   ALA H CB    1 
ATOM   5715  N  N     . SER H 4 78  ? -15.863 -26.935 26.920 1.00 57.98  ? 75   SER H N     1 
ATOM   5716  C  CA    . SER H 4 78  ? -15.292 -25.713 26.343 1.00 65.18  ? 75   SER H CA    1 
ATOM   5717  C  C     . SER H 4 78  ? -13.947 -25.423 27.001 1.00 69.10  ? 75   SER H C     1 
ATOM   5718  O  O     . SER H 4 78  ? -12.902 -25.363 26.350 1.00 73.37  ? 75   SER H O     1 
ATOM   5719  C  CB    . SER H 4 78  ? -16.233 -24.513 26.548 1.00 67.28  ? 75   SER H CB    1 
ATOM   5720  O  OG    . SER H 4 78  ? -15.549 -23.293 26.273 1.00 70.57  ? 75   SER H OG    1 
ATOM   5721  N  N     . ARG H 4 79  ? -13.991 -25.276 28.316 1.00 63.93  ? 76   ARG H N     1 
ATOM   5722  C  CA    . ARG H 4 79  ? -12.819 -24.976 29.073 1.00 60.32  ? 76   ARG H CA    1 
ATOM   5723  C  C     . ARG H 4 79  ? -11.692 -25.963 28.745 1.00 55.78  ? 76   ARG H C     1 
ATOM   5724  O  O     . ARG H 4 79  ? -10.577 -25.553 28.451 1.00 57.43  ? 76   ARG H O     1 
ATOM   5725  C  CB    . ARG H 4 79  ? -13.173 -24.988 30.550 1.00 66.87  ? 76   ARG H CB    1 
ATOM   5726  C  CG    . ARG H 4 79  ? -13.305 -23.624 31.203 1.00 62.53  ? 76   ARG H CG    1 
ATOM   5727  C  CD    . ARG H 4 79  ? -14.058 -23.742 32.544 1.00 65.55  ? 76   ARG H CD    1 
ATOM   5728  N  NE    . ARG H 4 79  ? -15.446 -23.264 32.423 1.00 67.40  ? 76   ARG H NE    1 
ATOM   5729  C  CZ    . ARG H 4 79  ? -16.544 -23.904 32.840 1.00 77.15  ? 76   ARG H CZ    1 
ATOM   5730  N  NH1   . ARG H 4 79  ? -16.474 -25.094 33.458 1.00 76.72  ? 76   ARG H NH1   1 
ATOM   5731  N  NH2   . ARG H 4 79  ? -17.741 -23.328 32.644 1.00 75.57  ? 76   ARG H NH2   1 
ATOM   5732  N  N     . LEU H 4 80  ? -11.974 -27.253 28.774 1.00 55.61  ? 77   LEU H N     1 
ATOM   5733  C  CA    . LEU H 4 80  ? -10.961 -28.226 28.364 1.00 62.46  ? 77   LEU H CA    1 
ATOM   5734  C  C     . LEU H 4 80  ? -10.319 -27.953 26.989 1.00 59.68  ? 77   LEU H C     1 
ATOM   5735  O  O     . LEU H 4 80  ? -9.098  -27.968 26.835 1.00 59.24  ? 77   LEU H O     1 
ATOM   5736  C  CB    . LEU H 4 80  ? -11.579 -29.598 28.290 1.00 68.14  ? 77   LEU H CB    1 
ATOM   5737  C  CG    . LEU H 4 80  ? -11.595 -30.379 29.587 1.00 74.80  ? 77   LEU H CG    1 
ATOM   5738  C  CD1   . LEU H 4 80  ? -12.468 -31.626 29.429 1.00 72.59  ? 77   LEU H CD1   1 
ATOM   5739  C  CD2   . LEU H 4 80  ? -10.173 -30.760 29.952 1.00 81.62  ? 77   LEU H CD2   1 
ATOM   5740  N  N     . ALA H 4 81  ? -11.145 -27.726 25.982 1.00 55.27  ? 78   ALA H N     1 
ATOM   5741  C  CA    . ALA H 4 81  ? -10.614 -27.473 24.662 1.00 57.80  ? 78   ALA H CA    1 
ATOM   5742  C  C     . ALA H 4 81  ? -9.646  -26.290 24.736 1.00 64.58  ? 78   ALA H C     1 
ATOM   5743  O  O     . ALA H 4 81  ? -8.466  -26.395 24.373 1.00 62.18  ? 78   ALA H O     1 
ATOM   5744  C  CB    . ALA H 4 81  ? -11.732 -27.190 23.696 1.00 57.60  ? 78   ALA H CB    1 
ATOM   5745  N  N     . HIS H 4 82  ? -10.141 -25.180 25.266 1.00 67.84  ? 79   HIS H N     1 
ATOM   5746  C  CA    . HIS H 4 82  ? -9.319  -23.995 25.429 1.00 70.74  ? 79   HIS H CA    1 
ATOM   5747  C  C     . HIS H 4 82  ? -8.013  -24.322 26.163 1.00 70.11  ? 79   HIS H C     1 
ATOM   5748  O  O     . HIS H 4 82  ? -6.947  -23.963 25.685 1.00 74.53  ? 79   HIS H O     1 
ATOM   5749  C  CB    . HIS H 4 82  ? -10.101 -22.852 26.108 1.00 73.90  ? 79   HIS H CB    1 
ATOM   5750  C  CG    . HIS H 4 82  ? -11.206 -22.270 25.255 1.00 93.01  ? 79   HIS H CG    1 
ATOM   5751  N  ND1   . HIS H 4 82  ? -10.986 -21.741 23.996 1.00 94.53  ? 79   HIS H ND1   1 
ATOM   5752  C  CD2   . HIS H 4 82  ? -12.537 -22.118 25.493 1.00 98.88  ? 79   HIS H CD2   1 
ATOM   5753  C  CE1   . HIS H 4 82  ? -12.129 -21.303 23.492 1.00 96.13  ? 79   HIS H CE1   1 
ATOM   5754  N  NE2   . HIS H 4 82  ? -13.086 -21.518 24.380 1.00 99.39  ? 79   HIS H NE2   1 
ATOM   5755  N  N     . TYR H 4 83  ? -8.060  -25.028 27.292 1.00 71.92  ? 80   TYR H N     1 
ATOM   5756  C  CA    . TYR H 4 83  ? -6.803  -25.295 28.010 1.00 72.96  ? 80   TYR H CA    1 
ATOM   5757  C  C     . TYR H 4 83  ? -5.847  -25.950 27.071 1.00 74.49  ? 80   TYR H C     1 
ATOM   5758  O  O     . TYR H 4 83  ? -4.686  -25.592 27.029 1.00 68.06  ? 80   TYR H O     1 
ATOM   5759  C  CB    . TYR H 4 83  ? -6.987  -26.189 29.230 1.00 74.67  ? 80   TYR H CB    1 
ATOM   5760  C  CG    . TYR H 4 83  ? -7.874  -25.594 30.281 1.00 87.68  ? 80   TYR H CG    1 
ATOM   5761  C  CD1   . TYR H 4 83  ? -8.057  -24.216 30.372 1.00 85.32  ? 80   TYR H CD1   1 
ATOM   5762  C  CD2   . TYR H 4 83  ? -8.535  -26.400 31.194 1.00 87.75  ? 80   TYR H CD2   1 
ATOM   5763  C  CE1   . TYR H 4 83  ? -8.880  -23.678 31.317 1.00 76.63  ? 80   TYR H CE1   1 
ATOM   5764  C  CE2   . TYR H 4 83  ? -9.347  -25.847 32.152 1.00 82.27  ? 80   TYR H CE2   1 
ATOM   5765  C  CZ    . TYR H 4 83  ? -9.508  -24.487 32.191 1.00 74.42  ? 80   TYR H CZ    1 
ATOM   5766  O  OH    . TYR H 4 83  ? -10.316 -23.923 33.123 1.00 91.66  ? 80   TYR H OH    1 
ATOM   5767  N  N     . ASN H 4 84  ? -6.363  -26.876 26.275 1.00 75.95  ? 81   ASN H N     1 
ATOM   5768  C  CA    . ASN H 4 84  ? -5.529  -27.603 25.355 1.00 83.36  ? 81   ASN H CA    1 
ATOM   5769  C  C     . ASN H 4 84  ? -5.380  -27.047 23.924 1.00 85.37  ? 81   ASN H C     1 
ATOM   5770  O  O     . ASN H 4 84  ? -5.035  -27.800 23.004 1.00 84.21  ? 81   ASN H O     1 
ATOM   5771  C  CB    . ASN H 4 84  ? -6.014  -29.037 25.339 1.00 84.31  ? 81   ASN H CB    1 
ATOM   5772  C  CG    . ASN H 4 84  ? -5.827  -29.694 26.676 1.00 82.21  ? 81   ASN H CG    1 
ATOM   5773  O  OD1   . ASN H 4 84  ? -4.704  -30.050 27.055 1.00 78.39  ? 81   ASN H OD1   1 
ATOM   5774  N  ND2   . ASN H 4 84  ? -6.917  -29.840 27.417 1.00 89.19  ? 81   ASN H ND2   1 
ATOM   5775  N  N     . LYS H 4 85  ? -5.593  -25.742 23.747 1.00 82.07  ? 82   LYS H N     1 
ATOM   5776  C  CA    . LYS H 4 85  ? -5.440  -25.105 22.445 1.00 81.65  ? 82   LYS H CA    1 
ATOM   5777  C  C     . LYS H 4 85  ? -6.027  -25.972 21.319 1.00 82.51  ? 82   LYS H C     1 
ATOM   5778  O  O     . LYS H 4 85  ? -5.323  -26.395 20.404 1.00 82.07  ? 82   LYS H O     1 
ATOM   5779  C  CB    . LYS H 4 85  ? -3.965  -24.841 22.184 1.00 87.66  ? 82   LYS H CB    1 
ATOM   5780  C  CG    . LYS H 4 85  ? -3.362  -23.840 23.140 1.00 96.25  ? 82   LYS H CG    1 
ATOM   5781  C  CD    . LYS H 4 85  ? -1.859  -23.677 22.929 1.00 109.35 ? 82   LYS H CD    1 
ATOM   5782  C  CE    . LYS H 4 85  ? -1.027  -24.381 23.999 1.00 109.97 ? 82   LYS H CE    1 
ATOM   5783  N  NZ    . LYS H 4 85  ? 0.427   -24.105 23.809 1.00 109.59 ? 82   LYS H NZ    1 
ATOM   5784  N  N     . ARG H 4 86  ? -7.314  -26.261 21.423 1.00 76.83  ? 83   ARG H N     1 
ATOM   5785  C  CA    . ARG H 4 86  ? -8.021  -27.016 20.413 1.00 77.50  ? 83   ARG H CA    1 
ATOM   5786  C  C     . ARG H 4 86  ? -9.297  -26.288 20.008 1.00 79.03  ? 83   ARG H C     1 
ATOM   5787  O  O     . ARG H 4 86  ? -9.961  -25.650 20.829 1.00 79.57  ? 83   ARG H O     1 
ATOM   5788  C  CB    . ARG H 4 86  ? -8.377  -28.386 20.948 1.00 81.32  ? 83   ARG H CB    1 
ATOM   5789  C  CG    . ARG H 4 86  ? -7.173  -29.216 21.306 1.00 90.35  ? 83   ARG H CG    1 
ATOM   5790  C  CD    . ARG H 4 86  ? -6.660  -30.033 20.142 1.00 97.48  ? 83   ARG H CD    1 
ATOM   5791  N  NE    . ARG H 4 86  ? -5.611  -30.951 20.597 1.00 112.15 ? 83   ARG H NE    1 
ATOM   5792  C  CZ    . ARG H 4 86  ? -4.322  -30.631 20.761 1.00 114.51 ? 83   ARG H CZ    1 
ATOM   5793  N  NH1   . ARG H 4 86  ? -3.864  -29.405 20.500 1.00 124.63 ? 83   ARG H NH1   1 
ATOM   5794  N  NH2   . ARG H 4 86  ? -3.469  -31.554 21.182 1.00 109.74 ? 83   ARG H NH2   1 
ATOM   5795  N  N     . SER H 4 87  ? -9.653  -26.398 18.736 1.00 82.05  ? 84   SER H N     1 
ATOM   5796  C  CA    . SER H 4 87  ? -10.779 -25.650 18.225 1.00 82.52  ? 84   SER H CA    1 
ATOM   5797  C  C     . SER H 4 87  ? -12.059 -26.452 18.296 1.00 82.01  ? 84   SER H C     1 
ATOM   5798  O  O     . SER H 4 87  ? -13.125 -25.918 18.009 1.00 82.81  ? 84   SER H O     1 
ATOM   5799  C  CB    . SER H 4 87  ? -10.483 -25.211 16.801 1.00 88.78  ? 84   SER H CB    1 
ATOM   5800  O  OG    . SER H 4 87  ? -9.323  -24.383 16.771 1.00 94.90  ? 84   SER H OG    1 
ATOM   5801  N  N     . THR H 4 88  ? -11.961 -27.714 18.718 1.00 77.51  ? 85   THR H N     1 
ATOM   5802  C  CA    . THR H 4 88  ? -13.078 -28.624 18.625 1.00 81.65  ? 85   THR H CA    1 
ATOM   5803  C  C     . THR H 4 88  ? -13.468 -29.266 19.981 1.00 84.58  ? 85   THR H C     1 
ATOM   5804  O  O     . THR H 4 88  ? -12.617 -29.631 20.782 1.00 89.13  ? 85   THR H O     1 
ATOM   5805  C  CB    . THR H 4 88  ? -12.749 -29.729 17.600 1.00 82.59  ? 85   THR H CB    1 
ATOM   5806  O  OG1   . THR H 4 88  ? -11.910 -29.188 16.578 1.00 93.44  ? 85   THR H OG1   1 
ATOM   5807  C  CG2   . THR H 4 88  ? -14.012 -30.290 16.962 1.00 84.98  ? 85   THR H CG2   1 
ATOM   5808  N  N     . ILE H 4 89  ? -14.778 -29.397 20.200 1.00 86.34  ? 86   ILE H N     1 
ATOM   5809  C  CA    . ILE H 4 89  ? -15.369 -30.216 21.254 1.00 77.67  ? 86   ILE H CA    1 
ATOM   5810  C  C     . ILE H 4 89  ? -15.802 -31.591 20.703 1.00 79.71  ? 86   ILE H C     1 
ATOM   5811  O  O     . ILE H 4 89  ? -16.825 -31.732 20.018 1.00 76.53  ? 86   ILE H O     1 
ATOM   5812  C  CB    . ILE H 4 89  ? -16.570 -29.490 21.893 1.00 78.25  ? 86   ILE H CB    1 
ATOM   5813  C  CG1   . ILE H 4 89  ? -16.052 -28.295 22.685 1.00 87.19  ? 86   ILE H CG1   1 
ATOM   5814  C  CG2   . ILE H 4 89  ? -17.338 -30.409 22.827 1.00 78.50  ? 86   ILE H CG2   1 
ATOM   5815  C  CD1   . ILE H 4 89  ? -17.123 -27.373 23.233 1.00 86.99  ? 86   ILE H CD1   1 
ATOM   5816  N  N     . THR H 4 90  ? -15.005 -32.599 21.038 1.00 82.08  ? 87   THR H N     1 
ATOM   5817  C  CA    . THR H 4 90  ? -15.197 -33.962 20.591 1.00 73.15  ? 87   THR H CA    1 
ATOM   5818  C  C     . THR H 4 90  ? -15.677 -34.709 21.797 1.00 70.51  ? 87   THR H C     1 
ATOM   5819  O  O     . THR H 4 90  ? -15.593 -34.218 22.905 1.00 81.29  ? 87   THR H O     1 
ATOM   5820  C  CB    . THR H 4 90  ? -13.867 -34.624 20.215 1.00 74.06  ? 87   THR H CB    1 
ATOM   5821  O  OG1   . THR H 4 90  ? -13.241 -35.106 21.405 1.00 71.41  ? 87   THR H OG1   1 
ATOM   5822  C  CG2   . THR H 4 90  ? -12.919 -33.646 19.513 1.00 79.06  ? 87   THR H CG2   1 
ATOM   5823  N  N     . SER H 4 91  ? -16.116 -35.929 21.589 1.00 69.41  ? 88   SER H N     1 
ATOM   5824  C  CA    . SER H 4 91  ? -16.641 -36.754 22.646 1.00 74.83  ? 88   SER H CA    1 
ATOM   5825  C  C     . SER H 4 91  ? -15.608 -36.929 23.775 1.00 74.98  ? 88   SER H C     1 
ATOM   5826  O  O     . SER H 4 91  ? -15.940 -37.045 24.949 1.00 80.77  ? 88   SER H O     1 
ATOM   5827  C  CB    . SER H 4 91  ? -16.990 -38.096 22.033 1.00 81.99  ? 88   SER H CB    1 
ATOM   5828  O  OG    . SER H 4 91  ? -15.858 -38.528 21.288 1.00 82.42  ? 88   SER H OG    1 
ATOM   5829  N  N     . ARG H 4 92  ? -14.340 -36.938 23.426 1.00 71.17  ? 89   ARG H N     1 
ATOM   5830  C  CA    . ARG H 4 92  ? -13.304 -37.002 24.432 1.00 70.18  ? 89   ARG H CA    1 
ATOM   5831  C  C     . ARG H 4 92  ? -13.452 -35.863 25.444 1.00 71.78  ? 89   ARG H C     1 
ATOM   5832  O  O     . ARG H 4 92  ? -13.294 -36.049 26.655 1.00 78.71  ? 89   ARG H O     1 
ATOM   5833  C  CB    . ARG H 4 92  ? -11.937 -36.915 23.757 1.00 77.61  ? 89   ARG H CB    1 
ATOM   5834  C  CG    . ARG H 4 92  ? -10.901 -37.787 24.408 1.00 82.69  ? 89   ARG H CG    1 
ATOM   5835  C  CD    . ARG H 4 92  ? -9.560  -37.587 23.760 1.00 88.81  ? 89   ARG H CD    1 
ATOM   5836  N  NE    . ARG H 4 92  ? -8.514  -38.035 24.673 1.00 94.35  ? 89   ARG H NE    1 
ATOM   5837  C  CZ    . ARG H 4 92  ? -7.759  -37.237 25.417 1.00 99.08  ? 89   ARG H CZ    1 
ATOM   5838  N  NH1   . ARG H 4 92  ? -7.919  -35.922 25.366 1.00 105.89 ? 89   ARG H NH1   1 
ATOM   5839  N  NH2   . ARG H 4 92  ? -6.829  -37.757 26.217 1.00 105.66 ? 89   ARG H NH2   1 
ATOM   5840  N  N     . GLU H 4 93  ? -13.752 -34.675 24.945 1.00 69.81  ? 90   GLU H N     1 
ATOM   5841  C  CA    . GLU H 4 93  ? -13.982 -33.556 25.831 1.00 66.88  ? 90   GLU H CA    1 
ATOM   5842  C  C     . GLU H 4 93  ? -15.212 -33.777 26.668 1.00 62.93  ? 90   GLU H C     1 
ATOM   5843  O  O     . GLU H 4 93  ? -15.147 -33.626 27.873 1.00 68.58  ? 90   GLU H O     1 
ATOM   5844  C  CB    . GLU H 4 93  ? -14.067 -32.241 25.070 1.00 73.63  ? 90   GLU H CB    1 
ATOM   5845  C  CG    . GLU H 4 93  ? -12.696 -31.675 24.675 1.00 76.15  ? 90   GLU H CG    1 
ATOM   5846  C  CD    . GLU H 4 93  ? -12.005 -32.468 23.584 1.00 80.33  ? 90   GLU H CD    1 
ATOM   5847  O  OE1   . GLU H 4 93  ? -12.696 -32.863 22.602 1.00 76.02  ? 90   GLU H OE1   1 
ATOM   5848  O  OE2   . GLU H 4 93  ? -10.773 -32.691 23.727 1.00 76.88  ? 90   GLU H OE2   1 
ATOM   5849  N  N     . ILE H 4 94  ? -16.319 -34.178 26.053 1.00 63.83  ? 91   ILE H N     1 
ATOM   5850  C  CA    . ILE H 4 94  ? -17.552 -34.441 26.819 1.00 67.02  ? 91   ILE H CA    1 
ATOM   5851  C  C     . ILE H 4 94  ? -17.285 -35.495 27.865 1.00 68.64  ? 91   ILE H C     1 
ATOM   5852  O  O     . ILE H 4 94  ? -17.812 -35.425 28.966 1.00 70.60  ? 91   ILE H O     1 
ATOM   5853  C  CB    . ILE H 4 94  ? -18.727 -34.952 25.947 1.00 66.36  ? 91   ILE H CB    1 
ATOM   5854  C  CG1   . ILE H 4 94  ? -19.142 -33.921 24.894 1.00 68.68  ? 91   ILE H CG1   1 
ATOM   5855  C  CG2   . ILE H 4 94  ? -19.934 -35.319 26.793 1.00 56.80  ? 91   ILE H CG2   1 
ATOM   5856  C  CD1   . ILE H 4 94  ? -19.581 -32.581 25.428 1.00 70.96  ? 91   ILE H CD1   1 
ATOM   5857  N  N     . GLN H 4 95  ? -16.457 -36.469 27.520 1.00 70.16  ? 92   GLN H N     1 
ATOM   5858  C  CA    . GLN H 4 95  ? -16.154 -37.557 28.441 1.00 71.70  ? 92   GLN H CA    1 
ATOM   5859  C  C     . GLN H 4 95  ? -15.407 -37.068 29.671 1.00 62.18  ? 92   GLN H C     1 
ATOM   5860  O  O     . GLN H 4 95  ? -15.856 -37.280 30.797 1.00 58.74  ? 92   GLN H O     1 
ATOM   5861  C  CB    . GLN H 4 95  ? -15.330 -38.624 27.745 1.00 76.30  ? 92   GLN H CB    1 
ATOM   5862  C  CG    . GLN H 4 95  ? -14.936 -39.747 28.670 1.00 79.49  ? 92   GLN H CG    1 
ATOM   5863  C  CD    . GLN H 4 95  ? -14.681 -41.033 27.932 1.00 73.94  ? 92   GLN H CD    1 
ATOM   5864  O  OE1   . GLN H 4 95  ? -13.531 -41.395 27.674 1.00 69.25  ? 92   GLN H OE1   1 
ATOM   5865  N  NE2   . GLN H 4 95  ? -15.751 -41.726 27.581 1.00 65.43  ? 92   GLN H NE2   1 
ATOM   5866  N  N     . THR H 4 96  ? -14.285 -36.403 29.446 1.00 55.42  ? 93   THR H N     1 
ATOM   5867  C  CA    . THR H 4 96  ? -13.520 -35.852 30.533 1.00 56.82  ? 93   THR H CA    1 
ATOM   5868  C  C     . THR H 4 96  ? -14.372 -34.888 31.354 1.00 63.23  ? 93   THR H C     1 
ATOM   5869  O  O     . THR H 4 96  ? -14.325 -34.923 32.590 1.00 63.62  ? 93   THR H O     1 
ATOM   5870  C  CB    . THR H 4 96  ? -12.361 -35.066 29.998 1.00 57.22  ? 93   THR H CB    1 
ATOM   5871  O  OG1   . THR H 4 96  ? -11.622 -35.877 29.094 1.00 62.61  ? 93   THR H OG1   1 
ATOM   5872  C  CG2   . THR H 4 96  ? -11.491 -34.642 31.110 1.00 61.78  ? 93   THR H CG2   1 
ATOM   5873  N  N     . ALA H 4 97  ? -15.128 -34.027 30.666 1.00 57.38  ? 94   ALA H N     1 
ATOM   5874  C  CA    . ALA H 4 97  ? -16.110 -33.172 31.320 1.00 59.48  ? 94   ALA H CA    1 
ATOM   5875  C  C     . ALA H 4 97  ? -17.000 -33.973 32.267 1.00 65.57  ? 94   ALA H C     1 
ATOM   5876  O  O     . ALA H 4 97  ? -17.214 -33.584 33.430 1.00 66.40  ? 94   ALA H O     1 
ATOM   5877  C  CB    . ALA H 4 97  ? -16.979 -32.453 30.297 1.00 61.47  ? 94   ALA H CB    1 
ATOM   5878  N  N     . VAL H 4 98  ? -17.531 -35.090 31.780 1.00 64.76  ? 95   VAL H N     1 
ATOM   5879  C  CA    . VAL H 4 98  ? -18.458 -35.865 32.600 1.00 61.60  ? 95   VAL H CA    1 
ATOM   5880  C  C     . VAL H 4 98  ? -17.747 -36.396 33.818 1.00 58.60  ? 95   VAL H C     1 
ATOM   5881  O  O     . VAL H 4 98  ? -18.306 -36.432 34.919 1.00 54.65  ? 95   VAL H O     1 
ATOM   5882  C  CB    . VAL H 4 98  ? -19.136 -36.996 31.802 1.00 61.15  ? 95   VAL H CB    1 
ATOM   5883  C  CG1   . VAL H 4 98  ? -19.679 -38.086 32.714 1.00 62.32  ? 95   VAL H CG1   1 
ATOM   5884  C  CG2   . VAL H 4 98  ? -20.289 -36.422 30.969 1.00 62.67  ? 95   VAL H CG2   1 
ATOM   5885  N  N     . ARG H 4 99  ? -16.506 -36.798 33.627 1.00 56.70  ? 96   ARG H N     1 
ATOM   5886  C  CA    . ARG H 4 99  ? -15.784 -37.355 34.735 1.00 62.30  ? 96   ARG H CA    1 
ATOM   5887  C  C     . ARG H 4 99  ? -15.622 -36.301 35.813 1.00 60.81  ? 96   ARG H C     1 
ATOM   5888  O  O     . ARG H 4 99  ? -15.914 -36.570 36.972 1.00 69.44  ? 96   ARG H O     1 
ATOM   5889  C  CB    . ARG H 4 99  ? -14.436 -37.927 34.305 1.00 62.05  ? 96   ARG H CB    1 
ATOM   5890  C  CG    . ARG H 4 99  ? -14.557 -39.276 33.618 1.00 65.09  ? 96   ARG H CG    1 
ATOM   5891  C  CD    . ARG H 4 99  ? -13.320 -40.156 33.773 1.00 73.46  ? 96   ARG H CD    1 
ATOM   5892  N  NE    . ARG H 4 99  ? -13.501 -41.389 33.009 1.00 83.82  ? 96   ARG H NE    1 
ATOM   5893  C  CZ    . ARG H 4 99  ? -12.930 -41.652 31.826 1.00 98.21  ? 96   ARG H CZ    1 
ATOM   5894  N  NH1   . ARG H 4 99  ? -12.070 -40.795 31.262 1.00 101.61 ? 96   ARG H NH1   1 
ATOM   5895  N  NH2   . ARG H 4 99  ? -13.206 -42.799 31.205 1.00 91.55  ? 96   ARG H NH2   1 
ATOM   5896  N  N     . LEU H 4 100 ? -15.192 -35.116 35.408 1.00 55.60  ? 97   LEU H N     1 
ATOM   5897  C  CA    . LEU H 4 100 ? -14.945 -34.000 36.312 1.00 54.76  ? 97   LEU H CA    1 
ATOM   5898  C  C     . LEU H 4 100 ? -16.201 -33.495 37.043 1.00 53.11  ? 97   LEU H C     1 
ATOM   5899  O  O     . LEU H 4 100 ? -16.112 -33.010 38.126 1.00 56.08  ? 97   LEU H O     1 
ATOM   5900  C  CB    . LEU H 4 100 ? -14.360 -32.833 35.516 1.00 52.02  ? 97   LEU H CB    1 
ATOM   5901  C  CG    . LEU H 4 100 ? -12.952 -32.944 34.942 1.00 53.00  ? 97   LEU H CG    1 
ATOM   5902  C  CD1   . LEU H 4 100 ? -12.706 -31.711 34.098 1.00 56.27  ? 97   LEU H CD1   1 
ATOM   5903  C  CD2   . LEU H 4 100 ? -11.860 -33.056 35.994 1.00 52.23  ? 97   LEU H CD2   1 
ATOM   5904  N  N     . LEU H 4 101 ? -17.357 -33.608 36.431 1.00 58.06  ? 98   LEU H N     1 
ATOM   5905  C  CA    . LEU H 4 101 ? -18.575 -33.068 36.996 1.00 65.16  ? 98   LEU H CA    1 
ATOM   5906  C  C     . LEU H 4 101 ? -19.396 -34.036 37.779 1.00 62.80  ? 98   LEU H C     1 
ATOM   5907  O  O     . LEU H 4 101 ? -20.083 -33.629 38.702 1.00 68.46  ? 98   LEU H O     1 
ATOM   5908  C  CB    . LEU H 4 101 ? -19.500 -32.572 35.896 1.00 71.41  ? 98   LEU H CB    1 
ATOM   5909  C  CG    . LEU H 4 101 ? -19.124 -31.237 35.309 1.00 77.89  ? 98   LEU H CG    1 
ATOM   5910  C  CD1   . LEU H 4 101 ? -20.001 -31.065 34.089 1.00 87.87  ? 98   LEU H CD1   1 
ATOM   5911  C  CD2   . LEU H 4 101 ? -19.371 -30.113 36.301 1.00 84.63  ? 98   LEU H CD2   1 
ATOM   5912  N  N     . LEU H 4 102 ? -19.421 -35.292 37.357 1.00 65.34  ? 99   LEU H N     1 
ATOM   5913  C  CA    . LEU H 4 102 ? -20.307 -36.281 37.985 1.00 59.19  ? 99   LEU H CA    1 
ATOM   5914  C  C     . LEU H 4 102 ? -19.602 -37.059 39.123 1.00 58.33  ? 99   LEU H C     1 
ATOM   5915  O  O     . LEU H 4 102 ? -18.379 -37.334 39.089 1.00 61.86  ? 99   LEU H O     1 
ATOM   5916  C  CB    . LEU H 4 102 ? -20.889 -37.251 36.948 1.00 57.27  ? 99   LEU H CB    1 
ATOM   5917  C  CG    . LEU H 4 102 ? -21.740 -36.759 35.760 1.00 57.59  ? 99   LEU H CG    1 
ATOM   5918  C  CD1   . LEU H 4 102 ? -22.855 -37.741 35.487 1.00 66.19  ? 99   LEU H CD1   1 
ATOM   5919  C  CD2   . LEU H 4 102 ? -22.400 -35.440 36.004 1.00 60.60  ? 99   LEU H CD2   1 
ATOM   5920  N  N     . PRO H 4 103 ? -20.371 -37.383 40.149 1.00 55.16  ? 100  PRO H N     1 
ATOM   5921  C  CA    . PRO H 4 103 ? -19.894 -38.200 41.219 1.00 60.73  ? 100  PRO H CA    1 
ATOM   5922  C  C     . PRO H 4 103 ? -19.600 -39.651 40.792 1.00 68.01  ? 100  PRO H C     1 
ATOM   5923  O  O     . PRO H 4 103 ? -20.384 -40.253 40.056 1.00 65.40  ? 100  PRO H O     1 
ATOM   5924  C  CB    . PRO H 4 103 ? -21.049 -38.171 42.239 1.00 64.11  ? 100  PRO H CB    1 
ATOM   5925  C  CG    . PRO H 4 103 ? -21.962 -37.076 41.857 1.00 61.24  ? 100  PRO H CG    1 
ATOM   5926  C  CD    . PRO H 4 103 ? -21.698 -36.792 40.419 1.00 66.68  ? 100  PRO H CD    1 
ATOM   5927  N  N     . GLY H 4 104 ? -18.481 -40.189 41.292 1.00 71.26  ? 101  GLY H N     1 
ATOM   5928  C  CA    . GLY H 4 104 ? -18.077 -41.584 41.100 1.00 69.24  ? 101  GLY H CA    1 
ATOM   5929  C  C     . GLY H 4 104 ? -18.975 -42.511 40.287 1.00 70.26  ? 101  GLY H C     1 
ATOM   5930  O  O     . GLY H 4 104 ? -18.713 -42.732 39.119 1.00 65.44  ? 101  GLY H O     1 
ATOM   5931  N  N     . GLU H 4 105 ? -19.999 -43.099 40.902 1.00 69.37  ? 102  GLU H N     1 
ATOM   5932  C  CA    . GLU H 4 105 ? -20.765 -44.145 40.219 1.00 76.27  ? 102  GLU H CA    1 
ATOM   5933  C  C     . GLU H 4 105 ? -21.573 -43.582 39.061 1.00 80.75  ? 102  GLU H C     1 
ATOM   5934  O  O     . GLU H 4 105 ? -21.621 -44.167 37.984 1.00 83.52  ? 102  GLU H O     1 
ATOM   5935  C  CB    . GLU H 4 105 ? -21.678 -44.916 41.178 1.00 89.19  ? 102  GLU H CB    1 
ATOM   5936  C  CG    . GLU H 4 105 ? -20.956 -45.931 42.070 1.00 105.31 ? 102  GLU H CG    1 
ATOM   5937  C  CD    . GLU H 4 105 ? -20.571 -47.214 41.351 1.00 110.26 ? 102  GLU H CD    1 
ATOM   5938  O  OE1   . GLU H 4 105 ? -21.463 -48.079 41.171 1.00 110.95 ? 102  GLU H OE1   1 
ATOM   5939  O  OE2   . GLU H 4 105 ? -19.372 -47.354 40.988 1.00 97.34  ? 102  GLU H OE2   1 
ATOM   5940  N  N     . LEU H 4 106 ? -22.202 -42.439 39.282 1.00 78.07  ? 103  LEU H N     1 
ATOM   5941  C  CA    . LEU H 4 106 ? -22.962 -41.774 38.235 1.00 72.22  ? 103  LEU H CA    1 
ATOM   5942  C  C     . LEU H 4 106 ? -22.043 -41.544 37.031 1.00 69.53  ? 103  LEU H C     1 
ATOM   5943  O  O     . LEU H 4 106 ? -22.430 -41.779 35.888 1.00 68.00  ? 103  LEU H O     1 
ATOM   5944  C  CB    . LEU H 4 106 ? -23.495 -40.427 38.753 1.00 69.11  ? 103  LEU H CB    1 
ATOM   5945  C  CG    . LEU H 4 106 ? -24.960 -40.011 38.598 1.00 70.88  ? 103  LEU H CG    1 
ATOM   5946  C  CD1   . LEU H 4 106 ? -25.954 -41.154 38.634 1.00 71.64  ? 103  LEU H CD1   1 
ATOM   5947  C  CD2   . LEU H 4 106 ? -25.329 -39.037 39.702 1.00 73.56  ? 103  LEU H CD2   1 
ATOM   5948  N  N     . ALA H 4 107 ? -20.822 -41.090 37.292 1.00 63.72  ? 104  ALA H N     1 
ATOM   5949  C  CA    . ALA H 4 107 ? -19.907 -40.767 36.207 1.00 66.43  ? 104  ALA H CA    1 
ATOM   5950  C  C     . ALA H 4 107 ? -19.637 -42.018 35.406 1.00 71.22  ? 104  ALA H C     1 
ATOM   5951  O  O     . ALA H 4 107 ? -19.670 -41.991 34.184 1.00 80.02  ? 104  ALA H O     1 
ATOM   5952  C  CB    . ALA H 4 107 ? -18.604 -40.180 36.731 1.00 63.57  ? 104  ALA H CB    1 
ATOM   5953  N  N     . LYS H 4 108 ? -19.407 -43.127 36.096 1.00 72.81  ? 105  LYS H N     1 
ATOM   5954  C  CA    . LYS H 4 108 ? -19.046 -44.336 35.404 1.00 74.18  ? 105  LYS H CA    1 
ATOM   5955  C  C     . LYS H 4 108 ? -20.176 -44.750 34.472 1.00 74.93  ? 105  LYS H C     1 
ATOM   5956  O  O     . LYS H 4 108 ? -19.972 -44.897 33.271 1.00 66.00  ? 105  LYS H O     1 
ATOM   5957  C  CB    . LYS H 4 108 ? -18.627 -45.426 36.380 1.00 81.67  ? 105  LYS H CB    1 
ATOM   5958  C  CG    . LYS H 4 108 ? -17.170 -45.200 36.835 1.00 102.99 ? 105  LYS H CG    1 
ATOM   5959  C  CD    . LYS H 4 108 ? -16.773 -45.987 38.085 1.00 118.84 ? 105  LYS H CD    1 
ATOM   5960  C  CE    . LYS H 4 108 ? -15.466 -45.492 38.701 1.00 119.70 ? 105  LYS H CE    1 
ATOM   5961  N  NZ    . LYS H 4 108 ? -15.114 -46.220 39.963 1.00 122.74 ? 105  LYS H NZ    1 
ATOM   5962  N  N     . HIS H 4 109 ? -21.383 -44.870 34.994 1.00 78.38  ? 106  HIS H N     1 
ATOM   5963  C  CA    . HIS H 4 109 ? -22.480 -45.321 34.157 1.00 81.80  ? 106  HIS H CA    1 
ATOM   5964  C  C     . HIS H 4 109 ? -22.686 -44.394 32.963 1.00 89.50  ? 106  HIS H C     1 
ATOM   5965  O  O     . HIS H 4 109 ? -22.782 -44.849 31.811 1.00 93.12  ? 106  HIS H O     1 
ATOM   5966  C  CB    . HIS H 4 109 ? -23.740 -45.464 34.981 1.00 86.90  ? 106  HIS H CB    1 
ATOM   5967  C  CG    . HIS H 4 109 ? -23.746 -46.701 35.816 1.00 95.13  ? 106  HIS H CG    1 
ATOM   5968  N  ND1   . HIS H 4 109 ? -24.565 -47.775 35.548 1.00 106.76 ? 106  HIS H ND1   1 
ATOM   5969  C  CD2   . HIS H 4 109 ? -23.004 -47.050 36.890 1.00 102.40 ? 106  HIS H CD2   1 
ATOM   5970  C  CE1   . HIS H 4 109 ? -24.336 -48.728 36.431 1.00 118.55 ? 106  HIS H CE1   1 
ATOM   5971  N  NE2   . HIS H 4 109 ? -23.390 -48.313 37.254 1.00 113.49 ? 106  HIS H NE2   1 
ATOM   5972  N  N     . ALA H 4 110 ? -22.698 -43.092 33.235 1.00 86.86  ? 107  ALA H N     1 
ATOM   5973  C  CA    . ALA H 4 110 ? -22.875 -42.084 32.196 1.00 70.39  ? 107  ALA H CA    1 
ATOM   5974  C  C     . ALA H 4 110 ? -21.829 -42.229 31.129 1.00 67.80  ? 107  ALA H C     1 
ATOM   5975  O  O     . ALA H 4 110 ? -22.124 -42.101 29.945 1.00 70.34  ? 107  ALA H O     1 
ATOM   5976  C  CB    . ALA H 4 110 ? -22.784 -40.702 32.794 1.00 72.13  ? 107  ALA H CB    1 
ATOM   5977  N  N     . VAL H 4 111 ? -20.595 -42.488 31.540 1.00 65.33  ? 108  VAL H N     1 
ATOM   5978  C  CA    . VAL H 4 111 ? -19.510 -42.696 30.563 1.00 68.03  ? 108  VAL H CA    1 
ATOM   5979  C  C     . VAL H 4 111 ? -19.726 -43.927 29.698 1.00 68.19  ? 108  VAL H C     1 
ATOM   5980  O  O     . VAL H 4 111 ? -19.414 -43.936 28.508 1.00 69.20  ? 108  VAL H O     1 
ATOM   5981  C  CB    . VAL H 4 111 ? -18.156 -42.820 31.249 1.00 59.20  ? 108  VAL H CB    1 
ATOM   5982  C  CG1   . VAL H 4 111 ? -17.145 -43.399 30.318 1.00 56.06  ? 108  VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H 4 111 ? -17.712 -41.451 31.692 1.00 61.76  ? 108  VAL H CG2   1 
ATOM   5984  N  N     . SER H 4 112 ? -20.267 -44.967 30.300 1.00 70.30  ? 109  SER H N     1 
ATOM   5985  C  CA    . SER H 4 112 ? -20.504 -46.151 29.549 1.00 71.58  ? 109  SER H CA    1 
ATOM   5986  C  C     . SER H 4 112 ? -21.668 -45.837 28.625 1.00 70.89  ? 109  SER H C     1 
ATOM   5987  O  O     . SER H 4 112 ? -21.529 -45.970 27.419 1.00 76.67  ? 109  SER H O     1 
ATOM   5988  C  CB    . SER H 4 112 ? -20.730 -47.356 30.454 1.00 76.24  ? 109  SER H CB    1 
ATOM   5989  O  OG    . SER H 4 112 ? -22.103 -47.554 30.723 1.00 85.18  ? 109  SER H OG    1 
ATOM   5990  N  N     . GLU H 4 113 ? -22.772 -45.312 29.140 1.00 70.41  ? 110  GLU H N     1 
ATOM   5991  C  CA    . GLU H 4 113 ? -23.897 -45.004 28.228 1.00 77.16  ? 110  GLU H CA    1 
ATOM   5992  C  C     . GLU H 4 113 ? -23.471 -44.120 27.068 1.00 73.06  ? 110  GLU H C     1 
ATOM   5993  O  O     . GLU H 4 113 ? -24.051 -44.158 25.997 1.00 70.57  ? 110  GLU H O     1 
ATOM   5994  C  CB    . GLU H 4 113 ? -25.056 -44.326 28.947 1.00 80.26  ? 110  GLU H CB    1 
ATOM   5995  C  CG    . GLU H 4 113 ? -25.755 -45.203 29.982 1.00 91.43  ? 110  GLU H CG    1 
ATOM   5996  C  CD    . GLU H 4 113 ? -26.561 -46.358 29.392 1.00 93.46  ? 110  GLU H CD    1 
ATOM   5997  O  OE1   . GLU H 4 113 ? -26.787 -46.358 28.167 1.00 104.12 ? 110  GLU H OE1   1 
ATOM   5998  O  OE2   . GLU H 4 113 ? -26.983 -47.266 30.156 1.00 105.43 ? 110  GLU H OE2   1 
ATOM   5999  N  N     . GLY H 4 114 ? -22.455 -43.318 27.311 1.00 76.96  ? 111  GLY H N     1 
ATOM   6000  C  CA    . GLY H 4 114 ? -22.000 -42.359 26.350 1.00 80.84  ? 111  GLY H CA    1 
ATOM   6001  C  C     . GLY H 4 114 ? -21.174 -43.020 25.304 1.00 73.26  ? 111  GLY H C     1 
ATOM   6002  O  O     . GLY H 4 114 ? -21.435 -42.836 24.147 1.00 78.40  ? 111  GLY H O     1 
ATOM   6003  N  N     . THR H 4 115 ? -20.171 -43.778 25.714 1.00 77.89  ? 112  THR H N     1 
ATOM   6004  C  CA    . THR H 4 115 ? -19.345 -44.518 24.761 1.00 86.45  ? 112  THR H CA    1 
ATOM   6005  C  C     . THR H 4 115 ? -20.195 -45.511 23.967 1.00 89.10  ? 112  THR H C     1 
ATOM   6006  O  O     . THR H 4 115 ? -19.942 -45.766 22.786 1.00 72.92  ? 112  THR H O     1 
ATOM   6007  C  CB    . THR H 4 115 ? -18.228 -45.279 25.474 1.00 81.56  ? 112  THR H CB    1 
ATOM   6008  O  OG1   . THR H 4 115 ? -17.353 -44.340 26.105 1.00 82.77  ? 112  THR H OG1   1 
ATOM   6009  C  CG2   . THR H 4 115 ? -17.432 -46.076 24.492 1.00 89.45  ? 112  THR H CG2   1 
ATOM   6010  N  N     . LYS H 4 116 ? -21.213 -46.051 24.631 1.00 95.24  ? 113  LYS H N     1 
ATOM   6011  C  CA    . LYS H 4 116 ? -22.123 -46.985 23.994 1.00 95.48  ? 113  LYS H CA    1 
ATOM   6012  C  C     . LYS H 4 116 ? -22.741 -46.295 22.809 1.00 99.04  ? 113  LYS H C     1 
ATOM   6013  O  O     . LYS H 4 116 ? -22.467 -46.633 21.661 1.00 119.10 ? 113  LYS H O     1 
ATOM   6014  C  CB    . LYS H 4 116 ? -23.225 -47.411 24.949 1.00 88.43  ? 113  LYS H CB    1 
ATOM   6015  C  CG    . LYS H 4 116 ? -23.566 -48.864 24.860 1.00 87.70  ? 113  LYS H CG    1 
ATOM   6016  C  CD    . LYS H 4 116 ? -24.621 -49.206 25.891 1.00 87.87  ? 113  LYS H CD    1 
ATOM   6017  C  CE    . LYS H 4 116 ? -25.999 -49.056 25.292 1.00 83.99  ? 113  LYS H CE    1 
ATOM   6018  N  NZ    . LYS H 4 116 ? -27.034 -49.307 26.328 1.00 94.97  ? 113  LYS H NZ    1 
ATOM   6019  N  N     . ALA H 4 117 ? -23.527 -45.276 23.100 1.00 93.79  ? 114  ALA H N     1 
ATOM   6020  C  CA    . ALA H 4 117 ? -24.309 -44.616 22.085 1.00 90.01  ? 114  ALA H CA    1 
ATOM   6021  C  C     . ALA H 4 117 ? -23.482 -44.205 20.872 1.00 86.08  ? 114  ALA H C     1 
ATOM   6022  O  O     . ALA H 4 117 ? -24.031 -44.139 19.768 1.00 85.19  ? 114  ALA H O     1 
ATOM   6023  C  CB    . ALA H 4 117 ? -25.008 -43.410 22.678 1.00 92.14  ? 114  ALA H CB    1 
ATOM   6024  N  N     . VAL H 4 118 ? -22.188 -43.933 21.064 1.00 82.64  ? 115  VAL H N     1 
ATOM   6025  C  CA    . VAL H 4 118 ? -21.331 -43.476 19.961 1.00 87.38  ? 115  VAL H CA    1 
ATOM   6026  C  C     . VAL H 4 118 ? -20.899 -44.645 19.091 1.00 92.48  ? 115  VAL H C     1 
ATOM   6027  O  O     . VAL H 4 118 ? -20.920 -44.558 17.862 1.00 102.86 ? 115  VAL H O     1 
ATOM   6028  C  CB    . VAL H 4 118 ? -20.120 -42.664 20.471 1.00 86.58  ? 115  VAL H CB    1 
ATOM   6029  C  CG1   . VAL H 4 118 ? -18.974 -42.654 19.468 1.00 93.36  ? 115  VAL H CG1   1 
ATOM   6030  C  CG2   . VAL H 4 118 ? -20.555 -41.240 20.757 1.00 86.20  ? 115  VAL H CG2   1 
ATOM   6031  N  N     . THR H 4 119 ? -20.507 -45.733 19.732 1.00 95.66  ? 116  THR H N     1 
ATOM   6032  C  CA    . THR H 4 119 ? -20.281 -46.977 19.038 1.00 94.32  ? 116  THR H CA    1 
ATOM   6033  C  C     . THR H 4 119 ? -21.492 -47.283 18.134 1.00 96.51  ? 116  THR H C     1 
ATOM   6034  O  O     . THR H 4 119 ? -21.403 -47.198 16.902 1.00 95.67  ? 116  THR H O     1 
ATOM   6035  C  CB    . THR H 4 119 ? -20.003 -48.075 20.074 1.00 97.29  ? 116  THR H CB    1 
ATOM   6036  O  OG1   . THR H 4 119 ? -18.651 -47.925 20.513 1.00 95.83  ? 116  THR H OG1   1 
ATOM   6037  C  CG2   . THR H 4 119 ? -20.192 -49.474 19.504 1.00 114.65 ? 116  THR H CG2   1 
ATOM   6038  N  N     . LYS H 4 120 ? -22.629 -47.572 18.760 1.00 90.81  ? 117  LYS H N     1 
ATOM   6039  C  CA    . LYS H 4 120 ? -23.866 -47.892 18.054 1.00 90.39  ? 117  LYS H CA    1 
ATOM   6040  C  C     . LYS H 4 120 ? -24.124 -46.959 16.880 1.00 91.42  ? 117  LYS H C     1 
ATOM   6041  O  O     . LYS H 4 120 ? -24.522 -47.395 15.815 1.00 114.66 ? 117  LYS H O     1 
ATOM   6042  C  CB    . LYS H 4 120 ? -25.056 -47.846 19.024 1.00 93.02  ? 117  LYS H CB    1 
ATOM   6043  C  CG    . LYS H 4 120 ? -26.359 -48.405 18.470 1.00 99.05  ? 117  LYS H CG    1 
ATOM   6044  C  CD    . LYS H 4 120 ? -27.227 -49.070 19.545 1.00 106.06 ? 117  LYS H CD    1 
ATOM   6045  C  CE    . LYS H 4 120 ? -28.228 -50.071 18.958 1.00 115.72 ? 117  LYS H CE    1 
ATOM   6046  N  NZ    . LYS H 4 120 ? -29.021 -49.539 17.805 1.00 118.03 ? 117  LYS H NZ    1 
ATOM   6047  N  N     . TYR H 4 121 ? -23.890 -45.677 17.080 1.00 93.16  ? 118  TYR H N     1 
ATOM   6048  C  CA    . TYR H 4 121 ? -24.116 -44.683 16.046 1.00 97.23  ? 118  TYR H CA    1 
ATOM   6049  C  C     . TYR H 4 121 ? -23.115 -44.819 14.887 1.00 105.47 ? 118  TYR H C     1 
ATOM   6050  O  O     . TYR H 4 121 ? -23.513 -44.696 13.725 1.00 124.23 ? 118  TYR H O     1 
ATOM   6051  C  CB    . TYR H 4 121 ? -24.049 -43.269 16.666 1.00 92.10  ? 118  TYR H CB    1 
ATOM   6052  C  CG    . TYR H 4 121 ? -24.127 -42.099 15.681 1.00 80.89  ? 118  TYR H CG    1 
ATOM   6053  C  CD1   . TYR H 4 121 ? -25.361 -41.587 15.268 1.00 79.45  ? 118  TYR H CD1   1 
ATOM   6054  C  CD2   . TYR H 4 121 ? -22.958 -41.499 15.175 1.00 75.02  ? 118  TYR H CD2   1 
ATOM   6055  C  CE1   . TYR H 4 121 ? -25.434 -40.522 14.371 1.00 79.47  ? 118  TYR H CE1   1 
ATOM   6056  C  CE2   . TYR H 4 121 ? -23.016 -40.431 14.281 1.00 74.37  ? 118  TYR H CE2   1 
ATOM   6057  C  CZ    . TYR H 4 121 ? -24.254 -39.949 13.875 1.00 79.82  ? 118  TYR H CZ    1 
ATOM   6058  O  OH    . TYR H 4 121 ? -24.334 -38.889 12.990 1.00 85.43  ? 118  TYR H OH    1 
ATOM   6059  N  N     . THR H 4 122 ? -21.834 -45.054 15.183 1.00 94.95  ? 119  THR H N     1 
ATOM   6060  C  CA    . THR H 4 122 ? -20.818 -45.180 14.123 1.00 105.28 ? 119  THR H CA    1 
ATOM   6061  C  C     . THR H 4 122 ? -21.129 -46.352 13.187 1.00 116.00 ? 119  THR H C     1 
ATOM   6062  O  O     . THR H 4 122 ? -21.224 -46.189 11.969 1.00 111.23 ? 119  THR H O     1 
ATOM   6063  C  CB    . THR H 4 122 ? -19.406 -45.401 14.705 1.00 107.44 ? 119  THR H CB    1 
ATOM   6064  O  OG1   . THR H 4 122 ? -19.081 -44.319 15.576 1.00 113.56 ? 119  THR H OG1   1 
ATOM   6065  C  CG2   . THR H 4 122 ? -18.348 -45.468 13.608 1.00 103.67 ? 119  THR H CG2   1 
ATOM   6066  N  N     . SER H 4 123 ? -21.281 -47.531 13.781 1.00 122.76 ? 120  SER H N     1 
ATOM   6067  C  CA    . SER H 4 123 ? -21.545 -48.755 13.042 1.00 122.81 ? 120  SER H CA    1 
ATOM   6068  C  C     . SER H 4 123 ? -22.837 -48.676 12.217 1.00 130.21 ? 120  SER H C     1 
ATOM   6069  O  O     . SER H 4 123 ? -22.869 -49.110 11.057 1.00 137.89 ? 120  SER H O     1 
ATOM   6070  C  CB    . SER H 4 123 ? -21.575 -49.935 14.012 1.00 122.41 ? 120  SER H CB    1 
ATOM   6071  O  OG    . SER H 4 123 ? -20.396 -49.927 14.798 1.00 119.29 ? 120  SER H OG    1 
ATOM   6072  N  N     . ALA H 4 124 ? -23.895 -48.115 12.794 1.00 126.79 ? 121  ALA H N     1 
ATOM   6073  C  CA    . ALA H 4 124 ? -25.110 -47.872 12.019 1.00 131.75 ? 121  ALA H CA    1 
ATOM   6074  C  C     . ALA H 4 124 ? -24.761 -47.020 10.796 1.00 136.63 ? 121  ALA H C     1 
ATOM   6075  O  O     . ALA H 4 124 ? -23.970 -46.079 10.883 1.00 116.05 ? 121  ALA H O     1 
ATOM   6076  C  CB    . ALA H 4 124 ? -26.190 -47.209 12.859 1.00 127.38 ? 121  ALA H CB    1 
ATOM   6077  N  N     . LYS H 4 125 ? -25.347 -47.393 9.661  1.00 155.58 ? 122  LYS H N     1 
ATOM   6078  C  CA    . LYS H 4 125 ? -24.993 -46.840 8.344  1.00 157.09 ? 122  LYS H CA    1 
ATOM   6079  C  C     . LYS H 4 125 ? -25.506 -45.402 8.146  1.00 153.19 ? 122  LYS H C     1 
ATOM   6080  O  O     . LYS H 4 125 ? -25.831 -44.684 9.103  1.00 138.34 ? 122  LYS H O     1 
ATOM   6081  C  CB    . LYS H 4 125 ? -25.462 -47.786 7.206  1.00 153.65 ? 122  LYS H CB    1 
ATOM   6082  C  CG    . LYS H 4 125 ? -26.907 -48.294 7.296  1.00 153.81 ? 122  LYS H CG    1 
ATOM   6083  C  CD    . LYS H 4 125 ? -27.123 -49.599 6.529  1.00 159.06 ? 122  LYS H CD    1 
ATOM   6084  C  CE    . LYS H 4 125 ? -28.496 -50.205 6.823  1.00 154.85 ? 122  LYS H CE    1 
ATOM   6085  N  NZ    . LYS H 4 125 ? -28.719 -51.544 6.200  1.00 144.95 ? 122  LYS H NZ    1 
ATOM   6086  O  OXT   . LYS H 4 125 ? -25.586 -44.912 7.018  1.00 142.30 ? 122  LYS H OXT   1 
ATOM   6087  O  "O5'" . DA  I 5 1   ? 3.438   0.074   91.008 1.00 139.55 ? -72  DA  I "O5'" 1 
ATOM   6088  C  "C5'" . DA  I 5 1   ? 4.554   -0.801  91.268 1.00 148.85 ? -72  DA  I "C5'" 1 
ATOM   6089  C  "C4'" . DA  I 5 1   ? 4.798   -0.980  92.761 1.00 155.23 ? -72  DA  I "C4'" 1 
ATOM   6090  O  "O4'" . DA  I 5 1   ? 3.720   -1.507  93.578 1.00 165.17 ? -72  DA  I "O4'" 1 
ATOM   6091  C  "C3'" . DA  I 5 1   ? 6.112   -1.589  93.245 1.00 153.46 ? -72  DA  I "C3'" 1 
ATOM   6092  O  "O3'" . DA  I 5 1   ? 7.103   -0.574  93.372 1.00 143.05 ? -72  DA  I "O3'" 1 
ATOM   6093  C  "C2'" . DA  I 5 1   ? 5.723   -2.313  94.543 1.00 154.01 ? -72  DA  I "C2'" 1 
ATOM   6094  C  "C1'" . DA  I 5 1   ? 4.221   -2.576  94.362 1.00 162.44 ? -72  DA  I "C1'" 1 
ATOM   6095  N  N9    . DA  I 5 1   ? 3.848   -3.846  93.715 1.00 171.93 ? -72  DA  I N9    1 
ATOM   6096  C  C8    . DA  I 5 1   ? 2.848   -4.022  92.788 1.00 176.18 ? -72  DA  I C8    1 
ATOM   6097  N  N7    . DA  I 5 1   ? 2.716   -5.261  92.382 1.00 169.46 ? -72  DA  I N7    1 
ATOM   6098  C  C5    . DA  I 5 1   ? 3.682   -5.951  93.097 1.00 161.61 ? -72  DA  I C5    1 
ATOM   6099  C  C6    . DA  I 5 1   ? 4.044   -7.306  93.124 1.00 154.97 ? -72  DA  I C6    1 
ATOM   6100  N  N6    . DA  I 5 1   ? 3.448   -8.240  92.378 1.00 144.82 ? -72  DA  I N6    1 
ATOM   6101  N  N1    . DA  I 5 1   ? 5.050   -7.673  93.948 1.00 154.12 ? -72  DA  I N1    1 
ATOM   6102  C  C2    . DA  I 5 1   ? 5.641   -6.730  94.696 1.00 161.43 ? -72  DA  I C2    1 
ATOM   6103  N  N3    . DA  I 5 1   ? 5.383   -5.424  94.764 1.00 164.64 ? -72  DA  I N3    1 
ATOM   6104  C  C4    . DA  I 5 1   ? 4.385   -5.094  93.927 1.00 163.96 ? -72  DA  I C4    1 
ATOM   6105  P  P     . DT  I 5 2   ? 8.650   -0.981  93.404 1.00 161.80 ? -71  DT  I P     1 
ATOM   6106  O  OP1   . DT  I 5 2   ? 9.429   0.209   93.819 1.00 167.93 ? -71  DT  I OP1   1 
ATOM   6107  O  OP2   . DT  I 5 2   ? 8.984   -1.641  92.114 1.00 150.26 ? -71  DT  I OP2   1 
ATOM   6108  O  "O5'" . DT  I 5 2   ? 8.687   -2.038  94.597 1.00 157.16 ? -71  DT  I "O5'" 1 
ATOM   6109  C  "C5'" . DT  I 5 2   ? 9.849   -2.208  95.422 1.00 159.48 ? -71  DT  I "C5'" 1 
ATOM   6110  C  "C4'" . DT  I 5 2   ? 10.474  -3.554  95.142 1.00 165.60 ? -71  DT  I "C4'" 1 
ATOM   6111  O  "O4'" . DT  I 5 2   ? 9.467   -4.476  94.653 1.00 172.92 ? -71  DT  I "O4'" 1 
ATOM   6112  C  "C3'" . DT  I 5 2   ? 11.597  -3.543  94.096 1.00 161.23 ? -71  DT  I "C3'" 1 
ATOM   6113  O  "O3'" . DT  I 5 2   ? 12.754  -4.186  94.648 1.00 160.17 ? -71  DT  I "O3'" 1 
ATOM   6114  C  "C2'" . DT  I 5 2   ? 11.019  -4.330  92.931 1.00 166.79 ? -71  DT  I "C2'" 1 
ATOM   6115  C  "C1'" . DT  I 5 2   ? 10.053  -5.265  93.632 1.00 175.61 ? -71  DT  I "C1'" 1 
ATOM   6116  N  N1    . DT  I 5 2   ? 8.970   -5.818  92.782 1.00 172.47 ? -71  DT  I N1    1 
ATOM   6117  C  C2    . DT  I 5 2   ? 8.946   -7.177  92.558 1.00 166.28 ? -71  DT  I C2    1 
ATOM   6118  O  O2    . DT  I 5 2   ? 9.765   -7.946  93.032 1.00 164.71 ? -71  DT  I O2    1 
ATOM   6119  N  N3    . DT  I 5 2   ? 7.920   -7.606  91.751 1.00 158.56 ? -71  DT  I N3    1 
ATOM   6120  C  C4    . DT  I 5 2   ? 6.943   -6.829  91.159 1.00 150.03 ? -71  DT  I C4    1 
ATOM   6121  O  O4    . DT  I 5 2   ? 6.086   -7.355  90.457 1.00 147.57 ? -71  DT  I O4    1 
ATOM   6122  C  C5    . DT  I 5 2   ? 7.031   -5.413  91.432 1.00 153.25 ? -71  DT  I C5    1 
ATOM   6123  C  C7    . DT  I 5 2   ? 6.018   -4.493  90.828 1.00 139.63 ? -71  DT  I C7    1 
ATOM   6124  C  C6    . DT  I 5 2   ? 8.029   -4.984  92.216 1.00 168.46 ? -71  DT  I C6    1 
ATOM   6125  P  P     . DC  I 5 3   ? 14.124  -4.266  93.818 1.00 164.67 ? -70  DC  I P     1 
ATOM   6126  O  OP1   . DC  I 5 3   ? 15.253  -4.220  94.783 1.00 155.74 ? -70  DC  I OP1   1 
ATOM   6127  O  OP2   . DC  I 5 3   ? 14.048  -3.279  92.708 1.00 158.20 ? -70  DC  I OP2   1 
ATOM   6128  O  "O5'" . DC  I 5 3   ? 14.095  -5.734  93.198 1.00 175.44 ? -70  DC  I "O5'" 1 
ATOM   6129  C  "C5'" . DC  I 5 3   ? 14.572  -6.882  93.932 1.00 169.03 ? -70  DC  I "C5'" 1 
ATOM   6130  C  "C4'" . DC  I 5 3   ? 14.552  -8.107  93.046 1.00 168.07 ? -70  DC  I "C4'" 1 
ATOM   6131  O  "O4'" . DC  I 5 3   ? 13.226  -8.269  92.460 1.00 179.85 ? -70  DC  I "O4'" 1 
ATOM   6132  C  "C3'" . DC  I 5 3   ? 15.526  -8.081  91.869 1.00 158.59 ? -70  DC  I "C3'" 1 
ATOM   6133  O  "O3'" . DC  I 5 3   ? 16.093  -9.373  91.692 1.00 146.14 ? -70  DC  I "O3'" 1 
ATOM   6134  C  "C2'" . DC  I 5 3   ? 14.631  -7.685  90.698 1.00 162.18 ? -70  DC  I "C2'" 1 
ATOM   6135  C  "C1'" . DC  I 5 3   ? 13.348  -8.427  91.058 1.00 171.13 ? -70  DC  I "C1'" 1 
ATOM   6136  N  N1    . DC  I 5 3   ? 12.123  -7.915  90.413 1.00 159.68 ? -70  DC  I N1    1 
ATOM   6137  C  C2    . DC  I 5 3   ? 11.239  -8.825  89.827 1.00 144.90 ? -70  DC  I C2    1 
ATOM   6138  O  O2    . DC  I 5 3   ? 11.515  -10.034 89.863 1.00 137.28 ? -70  DC  I O2    1 
ATOM   6139  N  N3    . DC  I 5 3   ? 10.107  -8.366  89.242 1.00 139.77 ? -70  DC  I N3    1 
ATOM   6140  C  C4    . DC  I 5 3   ? 9.850   -7.055  89.225 1.00 132.66 ? -70  DC  I C4    1 
ATOM   6141  N  N4    . DC  I 5 3   ? 8.725   -6.643  88.637 1.00 117.75 ? -70  DC  I N4    1 
ATOM   6142  C  C5    . DC  I 5 3   ? 10.734  -6.107  89.814 1.00 146.67 ? -70  DC  I C5    1 
ATOM   6143  C  C6    . DC  I 5 3   ? 11.849  -6.576  90.391 1.00 156.29 ? -70  DC  I C6    1 
ATOM   6144  P  P     . DA  I 5 4   ? 17.340  -9.574  90.712 1.00 151.50 ? -69  DA  I P     1 
ATOM   6145  O  OP1   . DA  I 5 4   ? 18.574  -9.363  91.504 1.00 164.22 ? -69  DA  I OP1   1 
ATOM   6146  O  OP2   . DA  I 5 4   ? 17.109  -8.772  89.476 1.00 141.07 ? -69  DA  I OP2   1 
ATOM   6147  O  "O5'" . DA  I 5 4   ? 17.293  -11.124 90.338 1.00 150.43 ? -69  DA  I "O5'" 1 
ATOM   6148  C  "C5'" . DA  I 5 4   ? 16.064  -11.880 90.304 1.00 135.95 ? -69  DA  I "C5'" 1 
ATOM   6149  C  "C4'" . DA  I 5 4   ? 15.663  -12.199 88.880 1.00 120.73 ? -69  DA  I "C4'" 1 
ATOM   6150  O  "O4'" . DA  I 5 4   ? 14.528  -11.369 88.500 1.00 127.02 ? -69  DA  I "O4'" 1 
ATOM   6151  C  "C3'" . DA  I 5 4   ? 16.720  -11.982 87.788 1.00 113.62 ? -69  DA  I "C3'" 1 
ATOM   6152  O  "O3'" . DA  I 5 4   ? 16.650  -13.043 86.850 1.00 116.53 ? -69  DA  I "O3'" 1 
ATOM   6153  C  "C2'" . DA  I 5 4   ? 16.235  -10.720 87.079 1.00 112.28 ? -69  DA  I "C2'" 1 
ATOM   6154  C  "C1'" . DA  I 5 4   ? 14.725  -10.915 87.178 1.00 117.35 ? -69  DA  I "C1'" 1 
ATOM   6155  N  N9    . DA  I 5 4   ? 13.887  -9.739  86.951 1.00 108.72 ? -69  DA  I N9    1 
ATOM   6156  C  C8    . DA  I 5 4   ? 14.163  -8.410  87.159 1.00 114.41 ? -69  DA  I C8    1 
ATOM   6157  N  N7    . DA  I 5 4   ? 13.171  -7.610  86.849 1.00 114.92 ? -69  DA  I N7    1 
ATOM   6158  C  C5    . DA  I 5 4   ? 12.177  -8.470  86.404 1.00 114.61 ? -69  DA  I C5    1 
ATOM   6159  C  C6    . DA  I 5 4   ? 10.873  -8.245  85.928 1.00 110.31 ? -69  DA  I C6    1 
ATOM   6160  N  N6    . DA  I 5 4   ? 10.323  -7.034  85.817 1.00 108.60 ? -69  DA  I N6    1 
ATOM   6161  N  N1    . DA  I 5 4   ? 10.138  -9.322  85.577 1.00 113.86 ? -69  DA  I N1    1 
ATOM   6162  C  C2    . DA  I 5 4   ? 10.689  -10.539 85.693 1.00 116.15 ? -69  DA  I C2    1 
ATOM   6163  N  N3    . DA  I 5 4   ? 11.905  -10.877 86.116 1.00 103.76 ? -69  DA  I N3    1 
ATOM   6164  C  C4    . DA  I 5 4   ? 12.605  -9.784  86.463 1.00 107.24 ? -69  DA  I C4    1 
ATOM   6165  P  P     . DA  I 5 5   ? 17.602  -14.311 86.985 1.00 120.30 ? -68  DA  I P     1 
ATOM   6166  O  OP1   . DA  I 5 5   ? 17.448  -14.876 88.353 1.00 109.53 ? -68  DA  I OP1   1 
ATOM   6167  O  OP2   . DA  I 5 5   ? 18.933  -13.934 86.456 1.00 107.57 ? -68  DA  I OP2   1 
ATOM   6168  O  "O5'" . DA  I 5 5   ? 16.998  -15.337 85.925 1.00 135.80 ? -68  DA  I "O5'" 1 
ATOM   6169  C  "C5'" . DA  I 5 5   ? 15.734  -16.004 86.146 1.00 132.19 ? -68  DA  I "C5'" 1 
ATOM   6170  C  "C4'" . DA  I 5 5   ? 14.888  -15.993 84.887 1.00 117.09 ? -68  DA  I "C4'" 1 
ATOM   6171  O  "O4'" . DA  I 5 5   ? 14.212  -14.712 84.757 1.00 103.71 ? -68  DA  I "O4'" 1 
ATOM   6172  C  "C3'" . DA  I 5 5   ? 15.627  -16.229 83.565 1.00 103.13 ? -68  DA  I "C3'" 1 
ATOM   6173  O  "O3'" . DA  I 5 5   ? 14.854  -17.123 82.786 1.00 113.39 ? -68  DA  I "O3'" 1 
ATOM   6174  C  "C2'" . DA  I 5 5   ? 15.663  -14.849 82.920 1.00 92.17  ? -68  DA  I "C2'" 1 
ATOM   6175  C  "C1'" . DA  I 5 5   ? 14.359  -14.247 83.437 1.00 104.81 ? -68  DA  I "C1'" 1 
ATOM   6176  N  N9    . DA  I 5 5   ? 14.345  -12.787 83.458 1.00 116.34 ? -68  DA  I N9    1 
ATOM   6177  C  C8    . DA  I 5 5   ? 15.366  -11.934 83.795 1.00 126.98 ? -68  DA  I C8    1 
ATOM   6178  N  N7    . DA  I 5 5   ? 15.049  -10.666 83.693 1.00 140.58 ? -68  DA  I N7    1 
ATOM   6179  C  C5    . DA  I 5 5   ? 13.732  -10.685 83.254 1.00 123.24 ? -68  DA  I C5    1 
ATOM   6180  C  C6    . DA  I 5 5   ? 12.818  -9.658  82.954 1.00 113.69 ? -68  DA  I C6    1 
ATOM   6181  N  N6    . DA  I 5 5   ? 13.102  -8.359  83.052 1.00 98.49  ? -68  DA  I N6    1 
ATOM   6182  N  N1    . DA  I 5 5   ? 11.584  -10.018 82.543 1.00 125.80 ? -68  DA  I N1    1 
ATOM   6183  C  C2    . DA  I 5 5   ? 11.296  -11.323 82.442 1.00 120.37 ? -68  DA  I C2    1 
ATOM   6184  N  N3    . DA  I 5 5   ? 12.070  -12.377 82.691 1.00 112.42 ? -68  DA  I N3    1 
ATOM   6185  C  C4    . DA  I 5 5   ? 13.287  -11.985 83.105 1.00 118.62 ? -68  DA  I C4    1 
ATOM   6186  P  P     . DT  I 5 6   ? 15.523  -17.967 81.604 1.00 120.80 ? -67  DT  I P     1 
ATOM   6187  O  OP1   . DT  I 5 6   ? 15.396  -19.407 81.962 1.00 99.84  ? -67  DT  I OP1   1 
ATOM   6188  O  OP2   . DT  I 5 6   ? 16.855  -17.368 81.290 1.00 100.87 ? -67  DT  I OP2   1 
ATOM   6189  O  "O5'" . DT  I 5 6   ? 14.580  -17.668 80.350 1.00 112.31 ? -67  DT  I "O5'" 1 
ATOM   6190  C  "C5'" . DT  I 5 6   ? 13.203  -17.258 80.496 1.00 100.09 ? -67  DT  I "C5'" 1 
ATOM   6191  C  "C4'" . DT  I 5 6   ? 12.831  -16.212 79.469 1.00 95.97  ? -67  DT  I "C4'" 1 
ATOM   6192  O  "O4'" . DT  I 5 6   ? 13.081  -14.871 79.952 1.00 91.79  ? -67  DT  I "O4'" 1 
ATOM   6193  C  "C3'" . DT  I 5 6   ? 13.550  -16.319 78.120 1.00 95.39  ? -67  DT  I "C3'" 1 
ATOM   6194  O  "O3'" . DT  I 5 6   ? 12.609  -16.859 77.183 1.00 102.68 ? -67  DT  I "O3'" 1 
ATOM   6195  C  "C2'" . DT  I 5 6   ? 14.015  -14.898 77.818 1.00 87.65  ? -67  DT  I "C2'" 1 
ATOM   6196  C  "C1'" . DT  I 5 6   ? 13.264  -14.041 78.823 1.00 91.27  ? -67  DT  I "C1'" 1 
ATOM   6197  N  N1    . DT  I 5 6   ? 13.937  -12.794 79.266 1.00 102.39 ? -67  DT  I N1    1 
ATOM   6198  C  C2    . DT  I 5 6   ? 13.236  -11.611 79.156 1.00 105.11 ? -67  DT  I C2    1 
ATOM   6199  O  O2    . DT  I 5 6   ? 12.104  -11.545 78.710 1.00 101.83 ? -67  DT  I O2    1 
ATOM   6200  N  N3    . DT  I 5 6   ? 13.912  -10.500 79.594 1.00 107.69 ? -67  DT  I N3    1 
ATOM   6201  C  C4    . DT  I 5 6   ? 15.187  -10.454 80.122 1.00 105.12 ? -67  DT  I C4    1 
ATOM   6202  O  O4    . DT  I 5 6   ? 15.661  -9.380  80.471 1.00 102.00 ? -67  DT  I O4    1 
ATOM   6203  C  C5    . DT  I 5 6   ? 15.870  -11.728 80.203 1.00 103.94 ? -67  DT  I C5    1 
ATOM   6204  C  C7    . DT  I 5 6   ? 17.264  -11.773 80.743 1.00 103.00 ? -67  DT  I C7    1 
ATOM   6205  C  C6    . DT  I 5 6   ? 15.217  -12.820 79.781 1.00 105.55 ? -67  DT  I C6    1 
ATOM   6206  P  P     . DA  I 5 7   ? 12.937  -16.881 75.623 1.00 103.89 ? -66  DA  I P     1 
ATOM   6207  O  OP1   . DA  I 5 7   ? 12.386  -18.138 75.075 1.00 93.35  ? -66  DA  I OP1   1 
ATOM   6208  O  OP2   . DA  I 5 7   ? 14.373  -16.558 75.443 1.00 107.36 ? -66  DA  I OP2   1 
ATOM   6209  O  "O5'" . DA  I 5 7   ? 12.078  -15.663 75.071 1.00 96.62  ? -66  DA  I "O5'" 1 
ATOM   6210  C  "C5'" . DA  I 5 7   ? 10.698  -15.583 75.450 1.00 97.44  ? -66  DA  I "C5'" 1 
ATOM   6211  C  "C4'" . DA  I 5 7   ? 10.110  -14.268 75.020 1.00 93.03  ? -66  DA  I "C4'" 1 
ATOM   6212  O  "O4'" . DA  I 5 7   ? 10.785  -13.188 75.713 1.00 90.28  ? -66  DA  I "O4'" 1 
ATOM   6213  C  "C3'" . DA  I 5 7   ? 10.226  -13.959 73.529 1.00 96.75  ? -66  DA  I "C3'" 1 
ATOM   6214  O  "O3'" . DA  I 5 7   ? 9.052   -13.276 73.116 1.00 97.86  ? -66  DA  I "O3'" 1 
ATOM   6215  C  "C2'" . DA  I 5 7   ? 11.449  -13.057 73.469 1.00 102.32 ? -66  DA  I "C2'" 1 
ATOM   6216  C  "C1'" . DA  I 5 7   ? 11.303  -12.274 74.771 1.00 100.60 ? -66  DA  I "C1'" 1 
ATOM   6217  N  N9    . DA  I 5 7   ? 12.589  -11.780 75.259 1.00 105.28 ? -66  DA  I N9    1 
ATOM   6218  C  C8    . DA  I 5 7   ? 13.739  -12.508 75.428 1.00 101.72 ? -66  DA  I C8    1 
ATOM   6219  N  N7    . DA  I 5 7   ? 14.755  -11.799 75.855 1.00 107.99 ? -66  DA  I N7    1 
ATOM   6220  C  C5    . DA  I 5 7   ? 14.246  -10.511 75.951 1.00 104.09 ? -66  DA  I C5    1 
ATOM   6221  C  C6    . DA  I 5 7   ? 14.827  -9.290  76.337 1.00 109.86 ? -66  DA  I C6    1 
ATOM   6222  N  N6    . DA  I 5 7   ? 16.098  -9.164  76.722 1.00 103.91 ? -66  DA  I N6    1 
ATOM   6223  N  N1    . DA  I 5 7   ? 14.044  -8.189  76.320 1.00 113.62 ? -66  DA  I N1    1 
ATOM   6224  C  C2    . DA  I 5 7   ? 12.768  -8.315  75.933 1.00 102.25 ? -66  DA  I C2    1 
ATOM   6225  N  N3    . DA  I 5 7   ? 12.108  -9.407  75.549 1.00 98.97  ? -66  DA  I N3    1 
ATOM   6226  C  C4    . DA  I 5 7   ? 12.914  -10.483 75.580 1.00 103.28 ? -66  DA  I C4    1 
ATOM   6227  P  P     . DT  I 5 8   ? 8.769   -13.043 71.582 1.00 94.30  ? -65  DT  I P     1 
ATOM   6228  O  OP1   . DT  I 5 8   ? 7.315   -13.140 71.380 1.00 108.31 ? -65  DT  I OP1   1 
ATOM   6229  O  OP2   . DT  I 5 8   ? 9.701   -13.916 70.807 1.00 87.06  ? -65  DT  I OP2   1 
ATOM   6230  O  "O5'" . DT  I 5 8   ? 9.061   -11.493 71.402 1.00 90.78  ? -65  DT  I "O5'" 1 
ATOM   6231  C  "C5'" . DT  I 5 8   ? 8.462   -10.555 72.316 1.00 100.83 ? -65  DT  I "C5'" 1 
ATOM   6232  C  "C4'" . DT  I 5 8   ? 8.971   -9.163  72.028 1.00 107.85 ? -65  DT  I "C4'" 1 
ATOM   6233  O  "O4'" . DT  I 5 8   ? 10.276  -8.985  72.623 1.00 107.95 ? -65  DT  I "O4'" 1 
ATOM   6234  C  "C3'" . DT  I 5 8   ? 9.138   -8.856  70.539 1.00 113.62 ? -65  DT  I "C3'" 1 
ATOM   6235  O  "O3'" . DT  I 5 8   ? 8.443   -7.633  70.280 1.00 110.67 ? -65  DT  I "O3'" 1 
ATOM   6236  C  "C2'" . DT  I 5 8   ? 10.647  -8.813  70.342 1.00 110.55 ? -65  DT  I "C2'" 1 
ATOM   6237  C  "C1'" . DT  I 5 8   ? 11.117  -8.333  71.696 1.00 105.35 ? -65  DT  I "C1'" 1 
ATOM   6238  N  N1    . DT  I 5 8   ? 12.498  -8.651  72.061 1.00 101.74 ? -65  DT  I N1    1 
ATOM   6239  C  C2    . DT  I 5 8   ? 13.250  -7.664  72.657 1.00 104.85 ? -65  DT  I C2    1 
ATOM   6240  O  O2    . DT  I 5 8   ? 12.838  -6.526  72.839 1.00 93.53  ? -65  DT  I O2    1 
ATOM   6241  N  N3    . DT  I 5 8   ? 14.516  -8.053  73.019 1.00 106.60 ? -65  DT  I N3    1 
ATOM   6242  C  C4    . DT  I 5 8   ? 15.086  -9.305  72.856 1.00 102.75 ? -65  DT  I C4    1 
ATOM   6243  O  O4    . DT  I 5 8   ? 16.237  -9.508  73.232 1.00 102.84 ? -65  DT  I O4    1 
ATOM   6244  C  C5    . DT  I 5 8   ? 14.234  -10.293 72.236 1.00 104.59 ? -65  DT  I C5    1 
ATOM   6245  C  C7    . DT  I 5 8   ? 14.758  -11.681 72.031 1.00 99.29  ? -65  DT  I C7    1 
ATOM   6246  C  C6    . DT  I 5 8   ? 12.994  -9.925  71.887 1.00 96.87  ? -65  DT  I C6    1 
ATOM   6247  P  P     . DC  I 5 9   ? 8.218   -7.126  68.785 1.00 108.83 ? -64  DC  I P     1 
ATOM   6248  O  OP1   . DC  I 5 9   ? 6.818   -6.648  68.673 1.00 110.22 ? -64  DC  I OP1   1 
ATOM   6249  O  OP2   . DC  I 5 9   ? 8.739   -8.163  67.848 1.00 100.20 ? -64  DC  I OP2   1 
ATOM   6250  O  "O5'" . DC  I 5 9   ? 9.137   -5.830  68.719 1.00 121.68 ? -64  DC  I "O5'" 1 
ATOM   6251  C  "C5'" . DC  I 5 9   ? 9.063   -4.826  69.752 1.00 125.77 ? -64  DC  I "C5'" 1 
ATOM   6252  C  "C4'" . DC  I 5 9   ? 10.299  -3.966  69.712 1.00 129.66 ? -64  DC  I "C4'" 1 
ATOM   6253  O  "O4'" . DC  I 5 9   ? 11.434  -4.719  70.220 1.00 119.20 ? -64  DC  I "O4'" 1 
ATOM   6254  C  "C3'" . DC  I 5 9   ? 10.689  -3.479  68.315 1.00 134.80 ? -64  DC  I "C3'" 1 
ATOM   6255  O  "O3'" . DC  I 5 9   ? 10.746  -2.054  68.225 1.00 144.00 ? -64  DC  I "O3'" 1 
ATOM   6256  C  "C2'" . DC  I 5 9   ? 12.032  -4.163  68.046 1.00 132.44 ? -64  DC  I "C2'" 1 
ATOM   6257  C  "C1'" . DC  I 5 9   ? 12.565  -4.394  69.458 1.00 121.55 ? -64  DC  I "C1'" 1 
ATOM   6258  N  N1    . DC  I 5 9   ? 13.511  -5.513  69.532 1.00 122.49 ? -64  DC  I N1    1 
ATOM   6259  C  C2    . DC  I 5 9   ? 14.753  -5.317  70.147 1.00 131.75 ? -64  DC  I C2    1 
ATOM   6260  O  O2    . DC  I 5 9   ? 15.013  -4.207  70.635 1.00 138.15 ? -64  DC  I O2    1 
ATOM   6261  N  N3    . DC  I 5 9   ? 15.634  -6.342  70.197 1.00 124.68 ? -64  DC  I N3    1 
ATOM   6262  C  C4    . DC  I 5 9   ? 15.316  -7.521  69.657 1.00 113.76 ? -64  DC  I C4    1 
ATOM   6263  N  N4    . DC  I 5 9   ? 16.211  -8.508  69.737 1.00 110.85 ? -64  DC  I N4    1 
ATOM   6264  C  C5    . DC  I 5 9   ? 14.061  -7.744  69.017 1.00 112.40 ? -64  DC  I C5    1 
ATOM   6265  C  C6    . DC  I 5 9   ? 13.200  -6.721  68.974 1.00 112.85 ? -64  DC  I C6    1 
ATOM   6266  P  P     . DC  I 5 10  ? 9.968   -1.271  67.048 1.00 141.61 ? -63  DC  I P     1 
ATOM   6267  O  OP1   . DC  I 5 10  ? 9.029   -0.297  67.680 1.00 124.74 ? -63  DC  I OP1   1 
ATOM   6268  O  OP2   . DC  I 5 10  ? 9.444   -2.277  66.078 1.00 124.70 ? -63  DC  I OP2   1 
ATOM   6269  O  "O5'" . DC  I 5 10  ? 11.132  -0.432  66.353 1.00 128.53 ? -63  DC  I "O5'" 1 
ATOM   6270  C  "C5'" . DC  I 5 10  ? 12.324  -1.058  65.845 1.00 121.26 ? -63  DC  I "C5'" 1 
ATOM   6271  C  "C4'" . DC  I 5 10  ? 13.540  -0.492  66.539 1.00 130.38 ? -63  DC  I "C4'" 1 
ATOM   6272  O  "O4'" . DC  I 5 10  ? 14.005  -1.439  67.528 1.00 126.18 ? -63  DC  I "O4'" 1 
ATOM   6273  C  "C3'" . DC  I 5 10  ? 14.727  -0.181  65.634 1.00 146.74 ? -63  DC  I "C3'" 1 
ATOM   6274  O  "O3'" . DC  I 5 10  ? 14.693  1.219   65.322 1.00 162.21 ? -63  DC  I "O3'" 1 
ATOM   6275  C  "C2'" . DC  I 5 10  ? 15.949  -0.503  66.496 1.00 145.06 ? -63  DC  I "C2'" 1 
ATOM   6276  C  "C1'" . DC  I 5 10  ? 15.413  -1.508  67.513 1.00 132.07 ? -63  DC  I "C1'" 1 
ATOM   6277  N  N1    . DC  I 5 10  ? 15.818  -2.901  67.256 1.00 140.00 ? -63  DC  I N1    1 
ATOM   6278  C  C2    . DC  I 5 10  ? 17.046  -3.354  67.762 1.00 141.76 ? -63  DC  I C2    1 
ATOM   6279  O  O2    . DC  I 5 10  ? 17.768  -2.563  68.388 1.00 133.90 ? -63  DC  I O2    1 
ATOM   6280  N  N3    . DC  I 5 10  ? 17.414  -4.639  67.549 1.00 135.85 ? -63  DC  I N3    1 
ATOM   6281  C  C4    . DC  I 5 10  ? 16.608  -5.459  66.867 1.00 125.93 ? -63  DC  I C4    1 
ATOM   6282  N  N4    . DC  I 5 10  ? 17.009  -6.717  66.678 1.00 116.05 ? -63  DC  I N4    1 
ATOM   6283  C  C5    . DC  I 5 10  ? 15.353  -5.025  66.348 1.00 120.45 ? -63  DC  I C5    1 
ATOM   6284  C  C6    . DC  I 5 10  ? 15.003  -3.750  66.559 1.00 127.32 ? -63  DC  I C6    1 
ATOM   6285  P  P     . DA  I 5 11  ? 15.512  1.838   64.068 1.00 139.25 ? -62  DA  I P     1 
ATOM   6286  O  OP1   . DA  I 5 11  ? 14.563  2.681   63.297 1.00 136.32 ? -62  DA  I OP1   1 
ATOM   6287  O  OP2   . DA  I 5 11  ? 16.249  0.748   63.388 1.00 116.64 ? -62  DA  I OP2   1 
ATOM   6288  O  "O5'" . DA  I 5 11  ? 16.613  2.771   64.748 1.00 137.42 ? -62  DA  I "O5'" 1 
ATOM   6289  C  "C5'" . DA  I 5 11  ? 17.325  2.397   65.955 1.00 147.98 ? -62  DA  I "C5'" 1 
ATOM   6290  C  "C4'" . DA  I 5 11  ? 18.706  1.840   65.656 1.00 149.84 ? -62  DA  I "C4'" 1 
ATOM   6291  O  "O4'" . DA  I 5 11  ? 18.725  0.393   65.819 1.00 151.19 ? -62  DA  I "O4'" 1 
ATOM   6292  C  "C3'" . DA  I 5 11  ? 19.270  2.120   64.257 1.00 155.61 ? -62  DA  I "C3'" 1 
ATOM   6293  O  "O3'" . DA  I 5 11  ? 20.566  2.706   64.319 1.00 166.18 ? -62  DA  I "O3'" 1 
ATOM   6294  C  "C2'" . DA  I 5 11  ? 19.328  0.741   63.602 1.00 150.39 ? -62  DA  I "C2'" 1 
ATOM   6295  C  "C1'" . DA  I 5 11  ? 19.532  -0.171  64.809 1.00 147.55 ? -62  DA  I "C1'" 1 
ATOM   6296  N  N9    . DA  I 5 11  ? 19.084  -1.540  64.553 1.00 138.05 ? -62  DA  I N9    1 
ATOM   6297  C  C8    . DA  I 5 11  ? 17.830  -1.920  64.141 1.00 123.11 ? -62  DA  I C8    1 
ATOM   6298  N  N7    . DA  I 5 11  ? 17.701  -3.211  63.964 1.00 120.45 ? -62  DA  I N7    1 
ATOM   6299  C  C5    . DA  I 5 11  ? 18.960  -3.716  64.259 1.00 140.80 ? -62  DA  I C5    1 
ATOM   6300  C  C6    . DA  I 5 11  ? 19.479  -5.023  64.256 1.00 148.29 ? -62  DA  I C6    1 
ATOM   6301  N  N6    . DA  I 5 11  ? 18.763  -6.102  63.930 1.00 142.05 ? -62  DA  I N6    1 
ATOM   6302  N  N1    . DA  I 5 11  ? 20.775  -5.187  64.606 1.00 146.65 ? -62  DA  I N1    1 
ATOM   6303  C  C2    . DA  I 5 11  ? 21.491  -4.103  64.933 1.00 139.52 ? -62  DA  I C2    1 
ATOM   6304  N  N3    . DA  I 5 11  ? 21.116  -2.825  64.972 1.00 148.54 ? -62  DA  I N3    1 
ATOM   6305  C  C4    . DA  I 5 11  ? 19.824  -2.697  64.617 1.00 141.92 ? -62  DA  I C4    1 
ATOM   6306  P  P     . DC  I 5 12  ? 21.234  3.329   63.001 1.00 171.45 ? -61  DC  I P     1 
ATOM   6307  O  OP1   . DC  I 5 12  ? 21.969  4.559   63.402 1.00 167.23 ? -61  DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I 5 12  ? 20.193  3.390   61.928 1.00 148.85 ? -61  DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I 5 12  ? 22.329  2.240   62.618 1.00 157.53 ? -61  DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I 5 12  ? 23.347  1.854   63.562 1.00 162.15 ? -61  DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I 5 12  ? 24.203  0.764   62.967 1.00 169.90 ? -61  DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I 5 12  ? 23.477  -0.499  63.010 1.00 166.45 ? -61  DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I 5 12  ? 24.593  0.978   61.505 1.00 173.17 ? -61  DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I 5 12  ? 25.942  0.593   61.268 1.00 170.91 ? -61  DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I 5 12  ? 23.598  0.101   60.754 1.00 164.22 ? -61  DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I 5 12  ? 23.455  -1.071  61.720 1.00 158.83 ? -61  DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I 5 12  ? 22.193  -1.801  61.541 1.00 145.42 ? -61  DC  I N1    1 
ATOM   6318  C  C2    . DC  I 5 12  ? 22.154  -3.174  61.806 1.00 134.95 ? -61  DC  I C2    1 
ATOM   6319  O  O2    . DC  I 5 12  ? 23.179  -3.735  62.220 1.00 139.33 ? -61  DC  I O2    1 
ATOM   6320  N  N3    . DC  I 5 12  ? 21.001  -3.852  61.611 1.00 135.56 ? -61  DC  I N3    1 
ATOM   6321  C  C4    . DC  I 5 12  ? 19.919  -3.212  61.161 1.00 127.68 ? -61  DC  I C4    1 
ATOM   6322  N  N4    . DC  I 5 12  ? 18.802  -3.919  60.986 1.00 117.03 ? -61  DC  I N4    1 
ATOM   6323  C  C5    . DC  I 5 12  ? 19.934  -1.817  60.874 1.00 135.88 ? -61  DC  I C5    1 
ATOM   6324  C  C6    . DC  I 5 12  ? 21.083  -1.158  61.067 1.00 145.20 ? -61  DC  I C6    1 
ATOM   6325  P  P     . DC  I 5 13  ? 26.537  0.649   59.791 1.00 151.58 ? -60  DC  I P     1 
ATOM   6326  O  OP1   . DC  I 5 13  ? 27.948  1.090   59.885 1.00 169.65 ? -60  DC  I OP1   1 
ATOM   6327  O  OP2   . DC  I 5 13  ? 25.586  1.425   58.954 1.00 138.11 ? -60  DC  I OP2   1 
ATOM   6328  O  "O5'" . DC  I 5 13  ? 26.613  -0.891  59.393 1.00 150.45 ? -60  DC  I "O5'" 1 
ATOM   6329  C  "C5'" . DC  I 5 13  ? 27.221  -1.834  60.303 1.00 160.81 ? -60  DC  I "C5'" 1 
ATOM   6330  C  "C4'" . DC  I 5 13  ? 27.458  -3.160  59.622 1.00 166.31 ? -60  DC  I "C4'" 1 
ATOM   6331  O  "O4'" . DC  I 5 13  ? 26.226  -3.936  59.627 1.00 169.17 ? -60  DC  I "O4'" 1 
ATOM   6332  C  "C3'" . DC  I 5 13  ? 27.902  -3.080  58.167 1.00 165.82 ? -60  DC  I "C3'" 1 
ATOM   6333  O  "O3'" . DC  I 5 13  ? 28.859  -4.093  57.883 1.00 155.67 ? -60  DC  I "O3'" 1 
ATOM   6334  C  "C2'" . DC  I 5 13  ? 26.590  -3.226  57.399 1.00 168.15 ? -60  DC  I "C2'" 1 
ATOM   6335  C  "C1'" . DC  I 5 13  ? 25.804  -4.183  58.298 1.00 159.89 ? -60  DC  I "C1'" 1 
ATOM   6336  N  N1    . DC  I 5 13  ? 24.340  -3.993  58.234 1.00 143.32 ? -60  DC  I N1    1 
ATOM   6337  C  C2    . DC  I 5 13  ? 23.502  -5.108  58.352 1.00 128.62 ? -60  DC  I C2    1 
ATOM   6338  O  O2    . DC  I 5 13  ? 24.010  -6.229  58.493 1.00 108.61 ? -60  DC  I O2    1 
ATOM   6339  N  N3    . DC  I 5 13  ? 22.160  -4.935  58.302 1.00 125.69 ? -60  DC  I N3    1 
ATOM   6340  C  C4    . DC  I 5 13  ? 21.650  -3.711  58.143 1.00 119.39 ? -60  DC  I C4    1 
ATOM   6341  N  N4    . DC  I 5 13  ? 20.323  -3.586  58.096 1.00 102.15 ? -60  DC  I N4    1 
ATOM   6342  C  C5    . DC  I 5 13  ? 22.481  -2.559  58.023 1.00 134.12 ? -60  DC  I C5    1 
ATOM   6343  C  C6    . DC  I 5 13  ? 23.807  -2.744  58.076 1.00 138.80 ? -60  DC  I C6    1 
ATOM   6344  P  P     . DT  I 5 14  ? 29.773  -4.001  56.566 1.00 164.40 ? -59  DT  I P     1 
ATOM   6345  O  OP1   . DT  I 5 14  ? 31.027  -3.291  56.924 1.00 164.08 ? -59  DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I 5 14  ? 28.940  -3.486  55.448 1.00 144.03 ? -59  DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I 5 14  ? 30.113  -5.528  56.262 1.00 165.32 ? -59  DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I 5 14  ? 29.324  -6.604  56.818 1.00 171.21 ? -59  DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I 5 14  ? 28.661  -7.408  55.722 1.00 174.65 ? -59  DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I 5 14  ? 27.236  -7.140  55.697 1.00 179.67 ? -59  DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I 5 14  ? 29.172  -7.130  54.306 1.00 181.92 ? -59  DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I 5 14  ? 29.320  -8.370  53.616 1.00 178.75 ? -59  DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I 5 14  ? 28.076  -6.277  53.693 1.00 186.91 ? -59  DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I 5 14  ? 26.835  -6.835  54.369 1.00 181.83 ? -59  DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I 5 14  ? 25.646  -5.945  54.434 1.00 170.67 ? -59  DT  I N1    1 
ATOM   6356  C  C2    . DT  I 5 14  ? 24.444  -6.520  54.779 1.00 160.66 ? -59  DT  I C2    1 
ATOM   6357  O  O2    . DT  I 5 14  ? 24.324  -7.706  55.041 1.00 166.30 ? -59  DT  I O2    1 
ATOM   6358  N  N3    . DT  I 5 14  ? 23.381  -5.652  54.811 1.00 149.37 ? -59  DT  I N3    1 
ATOM   6359  C  C4    . DT  I 5 14  ? 23.399  -4.298  54.534 1.00 150.59 ? -59  DT  I C4    1 
ATOM   6360  O  O4    . DT  I 5 14  ? 22.360  -3.647  54.606 1.00 131.43 ? -59  DT  I O4    1 
ATOM   6361  C  C5    . DT  I 5 14  ? 24.694  -3.760  54.173 1.00 153.32 ? -59  DT  I C5    1 
ATOM   6362  C  C7    . DT  I 5 14  ? 24.816  -2.303  53.856 1.00 146.05 ? -59  DT  I C7    1 
ATOM   6363  C  C6    . DT  I 5 14  ? 25.737  -4.600  54.138 1.00 156.93 ? -59  DT  I C6    1 
ATOM   6364  P  P     . DG  I 5 15  ? 30.349  -8.500  52.403 1.00 170.17 ? -58  DG  I P     1 
ATOM   6365  O  OP1   . DG  I 5 15  ? 31.684  -8.820  52.968 1.00 156.98 ? -58  DG  I OP1   1 
ATOM   6366  O  OP2   . DG  I 5 15  ? 30.182  -7.312  51.513 1.00 150.40 ? -58  DG  I OP2   1 
ATOM   6367  O  "O5'" . DG  I 5 15  ? 29.831  -9.810  51.660 1.00 161.19 ? -58  DG  I "O5'" 1 
ATOM   6368  C  "C5'" . DG  I 5 15  ? 29.541  -11.011 52.401 1.00 143.81 ? -58  DG  I "C5'" 1 
ATOM   6369  C  "C4'" . DG  I 5 15  ? 28.336  -11.702 51.814 1.00 141.25 ? -58  DG  I "C4'" 1 
ATOM   6370  O  "O4'" . DG  I 5 15  ? 27.163  -10.850 51.941 1.00 148.70 ? -58  DG  I "O4'" 1 
ATOM   6371  C  "C3'" . DG  I 5 15  ? 28.434  -12.047 50.335 1.00 138.00 ? -58  DG  I "C3'" 1 
ATOM   6372  O  "O3'" . DG  I 5 15  ? 27.746  -13.272 50.145 1.00 142.69 ? -58  DG  I "O3'" 1 
ATOM   6373  C  "C2'" . DG  I 5 15  ? 27.755  -10.858 49.663 1.00 139.39 ? -58  DG  I "C2'" 1 
ATOM   6374  C  "C1'" . DG  I 5 15  ? 26.635  -10.559 50.657 1.00 154.15 ? -58  DG  I "C1'" 1 
ATOM   6375  N  N9    . DG  I 5 15  ? 26.198  -9.167  50.658 1.00 156.17 ? -58  DG  I N9    1 
ATOM   6376  C  C8    . DG  I 5 15  ? 26.999  -8.058  50.532 1.00 154.97 ? -58  DG  I C8    1 
ATOM   6377  N  N7    . DG  I 5 15  ? 26.336  -6.936  50.604 1.00 142.28 ? -58  DG  I N7    1 
ATOM   6378  C  C5    . DG  I 5 15  ? 25.018  -7.326  50.795 1.00 135.19 ? -58  DG  I C5    1 
ATOM   6379  C  C6    . DG  I 5 15  ? 23.842  -6.548  50.946 1.00 125.16 ? -58  DG  I C6    1 
ATOM   6380  O  O6    . DG  I 5 15  ? 23.725  -5.317  50.946 1.00 105.85 ? -58  DG  I O6    1 
ATOM   6381  N  N1    . DG  I 5 15  ? 22.718  -7.347  51.119 1.00 132.34 ? -58  DG  I N1    1 
ATOM   6382  C  C2    . DG  I 5 15  ? 22.722  -8.719  51.143 1.00 138.40 ? -58  DG  I C2    1 
ATOM   6383  N  N2    . DG  I 5 15  ? 21.532  -9.310  51.322 1.00 140.12 ? -58  DG  I N2    1 
ATOM   6384  N  N3    . DG  I 5 15  ? 23.811  -9.458  51.004 1.00 149.72 ? -58  DG  I N3    1 
ATOM   6385  C  C4    . DG  I 5 15  ? 24.916  -8.701  50.835 1.00 148.33 ? -58  DG  I C4    1 
ATOM   6386  P  P     . DC  I 5 16  ? 27.960  -14.086 48.801 1.00 152.47 ? -57  DC  I P     1 
ATOM   6387  O  OP1   . DC  I 5 16  ? 28.762  -15.295 49.119 1.00 140.39 ? -57  DC  I OP1   1 
ATOM   6388  O  OP2   . DC  I 5 16  ? 28.436  -13.118 47.768 1.00 116.42 ? -57  DC  I OP2   1 
ATOM   6389  O  "O5'" . DC  I 5 16  ? 26.501  -14.630 48.448 1.00 159.72 ? -57  DC  I "O5'" 1 
ATOM   6390  C  "C5'" . DC  I 5 16  ? 25.296  -14.122 49.065 1.00 148.92 ? -57  DC  I "C5'" 1 
ATOM   6391  C  "C4'" . DC  I 5 16  ? 24.307  -13.650 48.018 1.00 138.62 ? -57  DC  I "C4'" 1 
ATOM   6392  O  "O4'" . DC  I 5 16  ? 24.079  -12.221 48.183 1.00 146.02 ? -57  DC  I "O4'" 1 
ATOM   6393  C  "C3'" . DC  I 5 16  ? 24.701  -13.847 46.548 1.00 125.95 ? -57  DC  I "C3'" 1 
ATOM   6394  O  "O3'" . DC  I 5 16  ? 23.603  -14.264 45.749 1.00 123.92 ? -57  DC  I "O3'" 1 
ATOM   6395  C  "C2'" . DC  I 5 16  ? 25.098  -12.440 46.104 1.00 130.57 ? -57  DC  I "C2'" 1 
ATOM   6396  C  "C1'" . DC  I 5 16  ? 24.114  -11.601 46.914 1.00 139.14 ? -57  DC  I "C1'" 1 
ATOM   6397  N  N1    . DC  I 5 16  ? 24.439  -10.173 47.095 1.00 137.01 ? -57  DC  I N1    1 
ATOM   6398  C  C2    . DC  I 5 16  ? 23.404  -9.313  47.459 1.00 127.93 ? -57  DC  I C2    1 
ATOM   6399  O  O2    . DC  I 5 16  ? 22.268  -9.779  47.606 1.00 127.32 ? -57  DC  I O2    1 
ATOM   6400  N  N3    . DC  I 5 16  ? 23.664  -7.999  47.636 1.00 127.52 ? -57  DC  I N3    1 
ATOM   6401  C  C4    . DC  I 5 16  ? 24.902  -7.536  47.459 1.00 133.37 ? -57  DC  I C4    1 
ATOM   6402  N  N4    . DC  I 5 16  ? 25.113  -6.232  47.641 1.00 139.25 ? -57  DC  I N4    1 
ATOM   6403  C  C5    . DC  I 5 16  ? 25.982  -8.393  47.096 1.00 132.78 ? -57  DC  I C5    1 
ATOM   6404  C  C6    . DC  I 5 16  ? 25.708  -9.693  46.924 1.00 136.97 ? -57  DC  I C6    1 
ATOM   6405  P  P     . DA  I 5 17  ? 23.094  -15.777 45.795 1.00 129.84 ? -56  DA  I P     1 
ATOM   6406  O  OP1   . DA  I 5 17  ? 23.369  -16.321 47.148 1.00 116.46 ? -56  DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I 5 17  ? 23.568  -16.469 44.567 1.00 128.13 ? -56  DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I 5 17  ? 21.517  -15.652 45.642 1.00 134.07 ? -56  DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I 5 17  ? 20.670  -15.529 46.795 1.00 138.59 ? -56  DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I 5 17  ? 19.491  -14.660 46.450 1.00 137.70 ? -56  DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I 5 17  ? 19.952  -13.302 46.198 1.00 137.93 ? -56  DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I 5 17  ? 18.720  -15.070 45.199 1.00 129.82 ? -56  DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I 5 17  ? 17.359  -14.739 45.442 1.00 126.73 ? -56  DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I 5 17  ? 19.401  -14.250 44.103 1.00 129.98 ? -56  DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I 5 17  ? 19.715  -12.950 44.845 1.00 133.55 ? -56  DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I 5 17  ? 20.893  -12.230 44.361 1.00 130.98 ? -56  DA  I N9    1 
ATOM   6417  C  C8    . DA  I 5 17  ? 22.004  -12.748 43.744 1.00 136.80 ? -56  DA  I C8    1 
ATOM   6418  N  N7    . DA  I 5 17  ? 22.922  -11.852 43.472 1.00 141.97 ? -56  DA  I N7    1 
ATOM   6419  C  C5    . DA  I 5 17  ? 22.384  -10.667 43.953 1.00 128.21 ? -56  DA  I C5    1 
ATOM   6420  C  C6    . DA  I 5 17  ? 22.867  -9.349  43.970 1.00 126.16 ? -56  DA  I C6    1 
ATOM   6421  N  N6    . DA  I 5 17  ? 24.046  -8.989  43.465 1.00 130.83 ? -56  DA  I N6    1 
ATOM   6422  N  N1    . DA  I 5 17  ? 22.079  -8.398  44.518 1.00 120.58 ? -56  DA  I N1    1 
ATOM   6423  C  C2    . DA  I 5 17  ? 20.889  -8.758  45.010 1.00 105.09 ? -56  DA  I C2    1 
ATOM   6424  N  N3    . DA  I 5 17  ? 20.329  -9.964  45.058 1.00 117.62 ? -56  DA  I N3    1 
ATOM   6425  C  C4    . DA  I 5 17  ? 21.137  -10.885 44.507 1.00 126.73 ? -56  DA  I C4    1 
ATOM   6426  P  P     . DG  I 5 18  ? 16.194  -15.333 44.532 1.00 130.73 ? -55  DG  I P     1 
ATOM   6427  O  OP1   . DG  I 5 18  ? 15.565  -16.450 45.279 1.00 130.83 ? -55  DG  I OP1   1 
ATOM   6428  O  OP2   . DG  I 5 18  ? 16.735  -15.563 43.164 1.00 118.72 ? -55  DG  I OP2   1 
ATOM   6429  O  "O5'" . DG  I 5 18  ? 15.134  -14.143 44.463 1.00 118.75 ? -55  DG  I "O5'" 1 
ATOM   6430  C  "C5'" . DG  I 5 18  ? 15.418  -12.831 44.994 1.00 118.99 ? -55  DG  I "C5'" 1 
ATOM   6431  C  "C4'" . DG  I 5 18  ? 15.414  -11.788 43.897 1.00 120.43 ? -55  DG  I "C4'" 1 
ATOM   6432  O  "O4'" . DG  I 5 18  ? 16.788  -11.391 43.576 1.00 131.51 ? -55  DG  I "O4'" 1 
ATOM   6433  C  "C3'" . DG  I 5 18  ? 14.782  -12.196 42.559 1.00 118.06 ? -55  DG  I "C3'" 1 
ATOM   6434  O  "O3'" . DG  I 5 18  ? 14.135  -11.117 41.879 1.00 115.50 ? -55  DG  I "O3'" 1 
ATOM   6435  C  "C2'" . DG  I 5 18  ? 16.011  -12.398 41.671 1.00 128.25 ? -55  DG  I "C2'" 1 
ATOM   6436  C  "C1'" . DG  I 5 18  ? 16.887  -11.255 42.174 1.00 133.37 ? -55  DG  I "C1'" 1 
ATOM   6437  N  N9    . DG  I 5 18  ? 18.289  -11.223 41.758 1.00 132.14 ? -55  DG  I N9    1 
ATOM   6438  C  C8    . DG  I 5 18  ? 19.049  -12.259 41.271 1.00 128.21 ? -55  DG  I C8    1 
ATOM   6439  N  N7    . DG  I 5 18  ? 20.261  -11.896 40.948 1.00 132.14 ? -55  DG  I N7    1 
ATOM   6440  C  C5    . DG  I 5 18  ? 20.293  -10.533 41.207 1.00 141.18 ? -55  DG  I C5    1 
ATOM   6441  C  C6    . DG  I 5 18  ? 21.341  -9.590  41.045 1.00 144.95 ? -55  DG  I C6    1 
ATOM   6442  O  O6    . DG  I 5 18  ? 22.490  -9.779  40.630 1.00 150.87 ? -55  DG  I O6    1 
ATOM   6443  N  N1    . DG  I 5 18  ? 20.946  -8.313  41.432 1.00 136.25 ? -55  DG  I N1    1 
ATOM   6444  C  C2    . DG  I 5 18  ? 19.705  -7.984  41.914 1.00 129.33 ? -55  DG  I C2    1 
ATOM   6445  N  N2    . DG  I 5 18  ? 19.518  -6.696  42.234 1.00 130.40 ? -55  DG  I N2    1 
ATOM   6446  N  N3    . DG  I 5 18  ? 18.718  -8.852  42.066 1.00 140.77 ? -55  DG  I N3    1 
ATOM   6447  C  C4    . DG  I 5 18  ? 19.081  -10.100 41.697 1.00 138.97 ? -55  DG  I C4    1 
ATOM   6448  P  P     . DA  I 5 19  ? 12.602  -10.665 42.142 1.00 101.19 ? -54  DA  I P     1 
ATOM   6449  O  OP1   . DA  I 5 19  ? 12.287  -10.768 43.592 1.00 83.36  ? -54  DA  I OP1   1 
ATOM   6450  O  OP2   . DA  I 5 19  ? 11.749  -11.380 41.170 1.00 92.13  ? -54  DA  I OP2   1 
ATOM   6451  O  "O5'" . DA  I 5 19  ? 12.671  -9.126  41.725 1.00 90.50  ? -54  DA  I "O5'" 1 
ATOM   6452  C  "C5'" . DA  I 5 19  ? 13.385  -8.169  42.544 1.00 98.83  ? -54  DA  I "C5'" 1 
ATOM   6453  C  "C4'" . DA  I 5 19  ? 14.050  -7.066  41.734 1.00 102.20 ? -54  DA  I "C4'" 1 
ATOM   6454  O  "O4'" . DA  I 5 19  ? 15.399  -7.467  41.373 1.00 110.49 ? -54  DA  I "O4'" 1 
ATOM   6455  C  "C3'" . DA  I 5 19  ? 13.372  -6.610  40.434 1.00 103.35 ? -54  DA  I "C3'" 1 
ATOM   6456  O  "O3'" . DA  I 5 19  ? 13.274  -5.190  40.392 1.00 96.05  ? -54  DA  I "O3'" 1 
ATOM   6457  C  "C2'" . DA  I 5 19  ? 14.313  -7.114  39.340 1.00 109.17 ? -54  DA  I "C2'" 1 
ATOM   6458  C  "C1'" . DA  I 5 19  ? 15.663  -7.054  40.051 1.00 118.38 ? -54  DA  I "C1'" 1 
ATOM   6459  N  N9    . DA  I 5 19  ? 16.682  -7.937  39.488 1.00 125.72 ? -54  DA  I N9    1 
ATOM   6460  C  C8    . DA  I 5 19  ? 16.579  -9.282  39.228 1.00 136.16 ? -54  DA  I C8    1 
ATOM   6461  N  N7    . DA  I 5 19  ? 17.670  -9.809  38.729 1.00 135.18 ? -54  DA  I N7    1 
ATOM   6462  C  C5    . DA  I 5 19  ? 18.550  -8.739  38.650 1.00 143.55 ? -54  DA  I C5    1 
ATOM   6463  C  C6    . DA  I 5 19  ? 19.875  -8.638  38.198 1.00 153.75 ? -54  DA  I C6    1 
ATOM   6464  N  N6    . DA  I 5 19  ? 20.573  -9.671  37.722 1.00 156.92 ? -54  DA  I N6    1 
ATOM   6465  N  N1    . DA  I 5 19  ? 20.469  -7.426  38.258 1.00 162.34 ? -54  DA  I N1    1 
ATOM   6466  C  C2    . DA  I 5 19  ? 19.768  -6.391  38.742 1.00 150.19 ? -54  DA  I C2    1 
ATOM   6467  N  N3    . DA  I 5 19  ? 18.516  -6.361  39.193 1.00 137.99 ? -54  DA  I N3    1 
ATOM   6468  C  C4    . DA  I 5 19  ? 17.956  -7.581  39.119 1.00 135.92 ? -54  DA  I C4    1 
ATOM   6469  P  P     . DT  I 5 20  ? 12.075  -4.480  39.601 1.00 110.90 ? -53  DT  I P     1 
ATOM   6470  O  OP1   . DT  I 5 20  ? 11.079  -3.997  40.600 1.00 123.82 ? -53  DT  I OP1   1 
ATOM   6471  O  OP2   . DT  I 5 20  ? 11.654  -5.377  38.497 1.00 96.33  ? -53  DT  I OP2   1 
ATOM   6472  O  "O5'" . DT  I 5 20  ? 12.754  -3.195  38.944 1.00 118.80 ? -53  DT  I "O5'" 1 
ATOM   6473  C  "C5'" . DT  I 5 20  ? 13.862  -2.511  39.554 1.00 117.85 ? -53  DT  I "C5'" 1 
ATOM   6474  C  "C4'" . DT  I 5 20  ? 14.989  -2.305  38.563 1.00 129.31 ? -53  DT  I "C4'" 1 
ATOM   6475  O  "O4'" . DT  I 5 20  ? 15.699  -3.541  38.297 1.00 117.44 ? -53  DT  I "O4'" 1 
ATOM   6476  C  "C3'" . DT  I 5 20  ? 14.619  -1.724  37.182 1.00 132.44 ? -53  DT  I "C3'" 1 
ATOM   6477  O  "O3'" . DT  I 5 20  ? 15.389  -0.526  36.963 1.00 142.48 ? -53  DT  I "O3'" 1 
ATOM   6478  C  "C2'" . DT  I 5 20  ? 15.023  -2.827  36.214 1.00 128.44 ? -53  DT  I "C2'" 1 
ATOM   6479  C  "C1'" . DT  I 5 20  ? 16.184  -3.418  36.977 1.00 128.64 ? -53  DT  I "C1'" 1 
ATOM   6480  N  N1    . DT  I 5 20  ? 16.700  -4.725  36.540 1.00 136.04 ? -53  DT  I N1    1 
ATOM   6481  C  C2    . DT  I 5 20  ? 18.047  -4.799  36.270 1.00 138.20 ? -53  DT  I C2    1 
ATOM   6482  O  O2    . DT  I 5 20  ? 18.801  -3.844  36.371 1.00 133.42 ? -53  DT  I O2    1 
ATOM   6483  N  N3    . DT  I 5 20  ? 18.483  -6.037  35.872 1.00 134.95 ? -53  DT  I N3    1 
ATOM   6484  C  C4    . DT  I 5 20  ? 17.722  -7.180  35.716 1.00 129.18 ? -53  DT  I C4    1 
ATOM   6485  O  O4    . DT  I 5 20  ? 18.254  -8.223  35.349 1.00 121.65 ? -53  DT  I O4    1 
ATOM   6486  C  C5    . DT  I 5 20  ? 16.316  -7.032  36.018 1.00 135.20 ? -53  DT  I C5    1 
ATOM   6487  C  C7    . DT  I 5 20  ? 15.416  -8.221  35.892 1.00 131.96 ? -53  DT  I C7    1 
ATOM   6488  C  C6    . DT  I 5 20  ? 15.880  -5.826  36.407 1.00 135.61 ? -53  DT  I C6    1 
ATOM   6489  P  P     . DA  I 5 21  ? 15.410  0.223   35.531 1.00 143.14 ? -52  DA  I P     1 
ATOM   6490  O  OP1   . DA  I 5 21  ? 15.916  1.602   35.744 1.00 144.56 ? -52  DA  I OP1   1 
ATOM   6491  O  OP2   . DA  I 5 21  ? 14.099  0.008   34.866 1.00 148.66 ? -52  DA  I OP2   1 
ATOM   6492  O  "O5'" . DA  I 5 21  ? 16.545  -0.545  34.723 1.00 144.21 ? -52  DA  I "O5'" 1 
ATOM   6493  C  "C5'" . DA  I 5 21  ? 17.924  -0.415  35.107 1.00 152.41 ? -52  DA  I "C5'" 1 
ATOM   6494  C  "C4'" . DA  I 5 21  ? 18.828  -0.707  33.936 1.00 158.30 ? -52  DA  I "C4'" 1 
ATOM   6495  O  "O4'" . DA  I 5 21  ? 19.052  -2.143  33.842 1.00 159.75 ? -52  DA  I "O4'" 1 
ATOM   6496  C  "C3'" . DA  I 5 21  ? 18.331  -0.269  32.550 1.00 162.54 ? -52  DA  I "C3'" 1 
ATOM   6497  O  "O3'" . DA  I 5 21  ? 19.443  0.315   31.863 1.00 164.30 ? -52  DA  I "O3'" 1 
ATOM   6498  C  "C2'" . DA  I 5 21  ? 17.899  -1.592  31.919 1.00 158.04 ? -52  DA  I "C2'" 1 
ATOM   6499  C  "C1'" . DA  I 5 21  ? 18.962  -2.524  32.489 1.00 162.52 ? -52  DA  I "C1'" 1 
ATOM   6500  N  N9    . DA  I 5 21  ? 18.671  -3.956  32.410 1.00 163.51 ? -52  DA  I N9    1 
ATOM   6501  C  C8    . DA  I 5 21  ? 17.557  -4.640  32.834 1.00 153.95 ? -52  DA  I C8    1 
ATOM   6502  N  N7    . DA  I 5 21  ? 17.612  -5.931  32.606 1.00 147.54 ? -52  DA  I N7    1 
ATOM   6503  C  C5    . DA  I 5 21  ? 18.844  -6.109  31.990 1.00 159.52 ? -52  DA  I C5    1 
ATOM   6504  C  C6    . DA  I 5 21  ? 19.504  -7.253  31.498 1.00 155.08 ? -52  DA  I C6    1 
ATOM   6505  N  N6    . DA  I 5 21  ? 18.994  -8.486  31.553 1.00 147.78 ? -52  DA  I N6    1 
ATOM   6506  N  N1    . DA  I 5 21  ? 20.721  -7.084  30.938 1.00 157.36 ? -52  DA  I N1    1 
ATOM   6507  C  C2    . DA  I 5 21  ? 21.235  -5.848  30.878 1.00 159.39 ? -52  DA  I C2    1 
ATOM   6508  N  N3    . DA  I 5 21  ? 20.716  -4.699  31.310 1.00 162.47 ? -52  DA  I N3    1 
ATOM   6509  C  C4    . DA  I 5 21  ? 19.506  -4.901  31.862 1.00 164.58 ? -52  DA  I C4    1 
ATOM   6510  P  P     . DC  I 5 22  ? 19.253  1.206   30.530 1.00 143.75 ? -51  DC  I P     1 
ATOM   6511  O  OP1   . DC  I 5 22  ? 19.064  2.621   30.941 1.00 117.21 ? -51  DC  I OP1   1 
ATOM   6512  O  OP2   . DC  I 5 22  ? 18.249  0.544   29.654 1.00 140.24 ? -51  DC  I OP2   1 
ATOM   6513  O  "O5'" . DC  I 5 22  ? 20.683  1.107   29.830 1.00 144.25 ? -51  DC  I "O5'" 1 
ATOM   6514  C  "C5'" . DC  I 5 22  ? 21.434  -0.128  29.787 1.00 144.27 ? -51  DC  I "C5'" 1 
ATOM   6515  C  "C4'" . DC  I 5 22  ? 21.404  -0.747  28.404 1.00 153.09 ? -51  DC  I "C4'" 1 
ATOM   6516  O  "O4'" . DC  I 5 22  ? 21.014  -2.132  28.538 1.00 158.09 ? -51  DC  I "O4'" 1 
ATOM   6517  C  "C3'" . DC  I 5 22  ? 20.463  -0.107  27.374 1.00 159.12 ? -51  DC  I "C3'" 1 
ATOM   6518  O  "O3'" . DC  I 5 22  ? 21.167  0.685   26.399 1.00 172.44 ? -51  DC  I "O3'" 1 
ATOM   6519  C  "C2'" . DC  I 5 22  ? 19.538  -1.244  26.913 1.00 158.54 ? -51  DC  I "C2'" 1 
ATOM   6520  C  "C1'" . DC  I 5 22  ? 20.226  -2.507  27.436 1.00 165.36 ? -51  DC  I "C1'" 1 
ATOM   6521  N  N1    . DC  I 5 22  ? 19.263  -3.526  27.893 1.00 174.39 ? -51  DC  I N1    1 
ATOM   6522  C  C2    . DC  I 5 22  ? 19.664  -4.868  27.968 1.00 174.45 ? -51  DC  I C2    1 
ATOM   6523  O  O2    . DC  I 5 22  ? 20.823  -5.170  27.647 1.00 151.86 ? -51  DC  I O2    1 
ATOM   6524  N  N3    . DC  I 5 22  ? 18.777  -5.799  28.393 1.00 180.91 ? -51  DC  I N3    1 
ATOM   6525  C  C4    . DC  I 5 22  ? 17.540  -5.433  28.740 1.00 180.46 ? -51  DC  I C4    1 
ATOM   6526  N  N4    . DC  I 5 22  ? 16.701  -6.382  29.159 1.00 180.40 ? -51  DC  I N4    1 
ATOM   6527  C  C5    . DC  I 5 22  ? 17.108  -4.075  28.672 1.00 171.89 ? -51  DC  I C5    1 
ATOM   6528  C  C6    . DC  I 5 22  ? 17.993  -3.163  28.251 1.00 167.64 ? -51  DC  I C6    1 
ATOM   6529  P  P     . DT  I 5 23  ? 21.432  0.193   24.875 1.00 176.60 ? -50  DT  I P     1 
ATOM   6530  O  OP1   . DT  I 5 23  ? 22.438  1.111   24.286 1.00 171.02 ? -50  DT  I OP1   1 
ATOM   6531  O  OP2   . DT  I 5 23  ? 20.117  0.039   24.192 1.00 164.96 ? -50  DT  I OP2   1 
ATOM   6532  O  "O5'" . DT  I 5 23  ? 22.146  -1.224  25.048 1.00 177.49 ? -50  DT  I "O5'" 1 
ATOM   6533  C  "C5'" . DT  I 5 23  ? 23.442  -1.505  24.462 1.00 175.27 ? -50  DT  I "C5'" 1 
ATOM   6534  C  "C4'" . DT  I 5 23  ? 23.317  -2.552  23.379 1.00 178.60 ? -50  DT  I "C4'" 1 
ATOM   6535  O  "O4'" . DT  I 5 23  ? 22.375  -3.568  23.801 1.00 182.74 ? -50  DT  I "O4'" 1 
ATOM   6536  C  "C3'" . DT  I 5 23  ? 22.812  -2.038  22.027 1.00 187.64 ? -50  DT  I "C3'" 1 
ATOM   6537  O  "O3'" . DT  I 5 23  ? 23.540  -2.661  20.960 1.00 203.94 ? -50  DT  I "O3'" 1 
ATOM   6538  C  "C2'" . DT  I 5 23  ? 21.345  -2.422  22.037 1.00 187.05 ? -50  DT  I "C2'" 1 
ATOM   6539  C  "C1'" . DT  I 5 23  ? 21.361  -3.724  22.820 1.00 188.77 ? -50  DT  I "C1'" 1 
ATOM   6540  N  N1    . DT  I 5 23  ? 20.098  -4.054  23.515 1.00 188.44 ? -50  DT  I N1    1 
ATOM   6541  C  C2    . DT  I 5 23  ? 19.945  -5.318  24.044 1.00 179.28 ? -50  DT  I C2    1 
ATOM   6542  O  O2    . DT  I 5 23  ? 20.806  -6.181  23.975 1.00 171.56 ? -50  DT  I O2    1 
ATOM   6543  N  N3    . DT  I 5 23  ? 18.740  -5.535  24.667 1.00 177.03 ? -50  DT  I N3    1 
ATOM   6544  C  C4    . DT  I 5 23  ? 17.700  -4.635  24.810 1.00 172.33 ? -50  DT  I C4    1 
ATOM   6545  O  O4    . DT  I 5 23  ? 16.676  -4.974  25.397 1.00 144.19 ? -50  DT  I O4    1 
ATOM   6546  C  C5    . DT  I 5 23  ? 17.927  -3.330  24.225 1.00 180.48 ? -50  DT  I C5    1 
ATOM   6547  C  C7    . DT  I 5 23  ? 16.859  -2.288  24.327 1.00 173.06 ? -50  DT  I C7    1 
ATOM   6548  C  C6    . DT  I 5 23  ? 19.098  -3.110  23.615 1.00 186.32 ? -50  DT  I C6    1 
ATOM   6549  P  P     . DA  I 5 24  ? 23.083  -2.484  19.425 1.00 207.79 ? -49  DA  I P     1 
ATOM   6550  O  OP1   . DA  I 5 24  ? 24.308  -2.270  18.614 1.00 210.38 ? -49  DA  I OP1   1 
ATOM   6551  O  OP2   . DA  I 5 24  ? 21.992  -1.472  19.373 1.00 198.43 ? -49  DA  I OP2   1 
ATOM   6552  O  "O5'" . DA  I 5 24  ? 22.499  -3.924  19.055 1.00 195.33 ? -49  DA  I "O5'" 1 
ATOM   6553  C  "C5'" . DA  I 5 24  ? 23.292  -5.120  19.241 1.00 186.88 ? -49  DA  I "C5'" 1 
ATOM   6554  C  "C4'" . DA  I 5 24  ? 22.524  -6.364  18.842 1.00 190.54 ? -49  DA  I "C4'" 1 
ATOM   6555  O  "O4'" . DA  I 5 24  ? 21.548  -6.694  19.869 1.00 188.76 ? -49  DA  I "O4'" 1 
ATOM   6556  C  "C3'" . DA  I 5 24  ? 21.751  -6.281  17.523 1.00 202.19 ? -49  DA  I "C3'" 1 
ATOM   6557  O  "O3'" . DA  I 5 24  ? 21.934  -7.447  16.721 1.00 209.76 ? -49  DA  I "O3'" 1 
ATOM   6558  C  "C2'" . DA  I 5 24  ? 20.302  -6.121  17.975 1.00 198.79 ? -49  DA  I "C2'" 1 
ATOM   6559  C  "C1'" . DA  I 5 24  ? 20.294  -6.933  19.267 1.00 192.83 ? -49  DA  I "C1'" 1 
ATOM   6560  N  N9    . DA  I 5 24  ? 19.244  -6.502  20.187 1.00 191.19 ? -49  DA  I N9    1 
ATOM   6561  C  C8    . DA  I 5 24  ? 18.974  -5.216  20.588 1.00 187.54 ? -49  DA  I C8    1 
ATOM   6562  N  N7    . DA  I 5 24  ? 17.953  -5.120  21.404 1.00 184.32 ? -49  DA  I N7    1 
ATOM   6563  C  C5    . DA  I 5 24  ? 17.515  -6.429  21.546 1.00 185.02 ? -49  DA  I C5    1 
ATOM   6564  C  C6    . DA  I 5 24  ? 16.463  -7.000  22.283 1.00 179.57 ? -49  DA  I C6    1 
ATOM   6565  N  N6    . DA  I 5 24  ? 15.628  -6.295  23.051 1.00 162.50 ? -49  DA  I N6    1 
ATOM   6566  N  N1    . DA  I 5 24  ? 16.293  -8.338  22.202 1.00 187.07 ? -49  DA  I N1    1 
ATOM   6567  C  C2    . DA  I 5 24  ? 17.130  -9.046  21.430 1.00 184.83 ? -49  DA  I C2    1 
ATOM   6568  N  N3    . DA  I 5 24  ? 18.155  -8.623  20.692 1.00 182.71 ? -49  DA  I N3    1 
ATOM   6569  C  C4    . DA  I 5 24  ? 18.295  -7.290  20.794 1.00 186.12 ? -49  DA  I C4    1 
ATOM   6570  P  P     . DC  I 5 25  ? 21.506  -7.440  15.171 1.00 200.41 ? -48  DC  I P     1 
ATOM   6571  O  OP1   . DC  I 5 25  ? 22.348  -8.432  14.454 1.00 178.65 ? -48  DC  I OP1   1 
ATOM   6572  O  OP2   . DC  I 5 25  ? 21.451  -6.029  14.707 1.00 198.24 ? -48  DC  I OP2   1 
ATOM   6573  O  "O5'" . DC  I 5 25  ? 20.031  -8.032  15.204 1.00 184.98 ? -48  DC  I "O5'" 1 
ATOM   6574  C  "C5'" . DC  I 5 25  ? 19.833  -9.362  15.693 1.00 177.31 ? -48  DC  I "C5'" 1 
ATOM   6575  C  "C4'" . DC  I 5 25  ? 18.375  -9.616  15.967 1.00 173.71 ? -48  DC  I "C4'" 1 
ATOM   6576  O  "O4'" . DC  I 5 25  ? 17.894  -8.776  17.049 1.00 177.89 ? -48  DC  I "O4'" 1 
ATOM   6577  C  "C3'" . DC  I 5 25  ? 17.407  -9.376  14.804 1.00 171.02 ? -48  DC  I "C3'" 1 
ATOM   6578  O  "O3'" . DC  I 5 25  ? 16.741  -10.610 14.558 1.00 177.92 ? -48  DC  I "O3'" 1 
ATOM   6579  C  "C2'" . DC  I 5 25  ? 16.452  -8.303  15.341 1.00 175.26 ? -48  DC  I "C2'" 1 
ATOM   6580  C  "C1'" . DC  I 5 25  ? 16.519  -8.582  16.840 1.00 181.67 ? -48  DC  I "C1'" 1 
ATOM   6581  N  N1    . DC  I 5 25  ? 16.007  -7.537  17.751 1.00 172.63 ? -48  DC  I N1    1 
ATOM   6582  C  C2    . DC  I 5 25  ? 15.128  -7.918  18.772 1.00 160.04 ? -48  DC  I C2    1 
ATOM   6583  O  O2    . DC  I 5 25  ? 14.832  -9.117  18.894 1.00 142.03 ? -48  DC  I O2    1 
ATOM   6584  N  N3    . DC  I 5 25  ? 14.630  -6.975  19.604 1.00 163.32 ? -48  DC  I N3    1 
ATOM   6585  C  C4    . DC  I 5 25  ? 14.975  -5.695  19.444 1.00 163.95 ? -48  DC  I C4    1 
ATOM   6586  N  N4    . DC  I 5 25  ? 14.464  -4.800  20.293 1.00 155.03 ? -48  DC  I N4    1 
ATOM   6587  C  C5    . DC  I 5 25  ? 15.863  -5.278  18.409 1.00 174.61 ? -48  DC  I C5    1 
ATOM   6588  C  C6    . DC  I 5 25  ? 16.346  -6.222  17.588 1.00 174.96 ? -48  DC  I C6    1 
ATOM   6589  P  P     . DC  I 5 26  ? 16.080  -10.904 13.134 1.00 177.36 ? -47  DC  I P     1 
ATOM   6590  O  OP1   . DC  I 5 26  ? 17.174  -11.219 12.188 1.00 171.57 ? -47  DC  I OP1   1 
ATOM   6591  O  OP2   . DC  I 5 26  ? 15.153  -9.787  12.823 1.00 174.57 ? -47  DC  I OP2   1 
ATOM   6592  O  "O5'" . DC  I 5 26  ? 15.238  -12.245 13.361 1.00 173.09 ? -47  DC  I "O5'" 1 
ATOM   6593  C  "C5'" . DC  I 5 26  ? 14.784  -12.697 14.661 1.00 160.68 ? -47  DC  I "C5'" 1 
ATOM   6594  C  "C4'" . DC  I 5 26  ? 13.289  -12.507 14.830 1.00 156.94 ? -47  DC  I "C4'" 1 
ATOM   6595  O  "O4'" . DC  I 5 26  ? 13.039  -11.387 15.726 1.00 156.78 ? -47  DC  I "O4'" 1 
ATOM   6596  C  "C3'" . DC  I 5 26  ? 12.475  -12.227 13.564 1.00 156.96 ? -47  DC  I "C3'" 1 
ATOM   6597  O  "O3'" . DC  I 5 26  ? 11.313  -13.044 13.482 1.00 157.10 ? -47  DC  I "O3'" 1 
ATOM   6598  C  "C2'" . DC  I 5 26  ? 12.092  -10.755 13.698 1.00 153.63 ? -47  DC  I "C2'" 1 
ATOM   6599  C  "C1'" . DC  I 5 26  ? 11.980  -10.608 15.211 1.00 157.77 ? -47  DC  I "C1'" 1 
ATOM   6600  N  N1    . DC  I 5 26  ? 12.138  -9.228  15.697 1.00 154.78 ? -47  DC  I N1    1 
ATOM   6601  C  C2    . DC  I 5 26  ? 12.033  -8.984  17.070 1.00 153.92 ? -47  DC  I C2    1 
ATOM   6602  O  O2    . DC  I 5 26  ? 11.805  -9.935  17.832 1.00 153.78 ? -47  DC  I O2    1 
ATOM   6603  N  N3    . DC  I 5 26  ? 12.184  -7.720  17.531 1.00 144.06 ? -47  DC  I N3    1 
ATOM   6604  C  C4    . DC  I 5 26  ? 12.436  -6.726  16.679 1.00 136.17 ? -47  DC  I C4    1 
ATOM   6605  N  N4    . DC  I 5 26  ? 12.576  -5.497  17.179 1.00 129.31 ? -47  DC  I N4    1 
ATOM   6606  C  C5    . DC  I 5 26  ? 12.550  -6.947  15.275 1.00 147.85 ? -47  DC  I C5    1 
ATOM   6607  C  C6    . DC  I 5 26  ? 12.394  -8.202  14.831 1.00 148.86 ? -47  DC  I C6    1 
ATOM   6608  P  P     . DA  I 5 27  ? 11.310  -14.311 12.510 1.00 153.99 ? -46  DA  I P     1 
ATOM   6609  O  OP1   . DA  I 5 27  ? 12.632  -14.971 12.636 1.00 149.36 ? -46  DA  I OP1   1 
ATOM   6610  O  OP2   . DA  I 5 27  ? 10.797  -13.876 11.182 1.00 133.82 ? -46  DA  I OP2   1 
ATOM   6611  O  "O5'" . DA  I 5 27  ? 10.220  -15.281 13.146 1.00 163.55 ? -46  DA  I "O5'" 1 
ATOM   6612  C  "C5'" . DA  I 5 27  ? 10.142  -15.506 14.568 1.00 151.93 ? -46  DA  I "C5'" 1 
ATOM   6613  C  "C4'" . DA  I 5 27  ? 8.821   -15.001 15.093 1.00 131.54 ? -46  DA  I "C4'" 1 
ATOM   6614  O  "O4'" . DA  I 5 27  ? 8.899   -13.563 15.308 1.00 121.35 ? -46  DA  I "O4'" 1 
ATOM   6615  C  "C3'" . DA  I 5 27  ? 7.620   -15.221 14.174 1.00 128.18 ? -46  DA  I "C3'" 1 
ATOM   6616  O  "O3'" . DA  I 5 27  ? 6.552   -15.501 15.050 1.00 138.90 ? -46  DA  I "O3'" 1 
ATOM   6617  C  "C2'" . DA  I 5 27  ? 7.438   -13.859 13.514 1.00 128.49 ? -46  DA  I "C2'" 1 
ATOM   6618  C  "C1'" . DA  I 5 27  ? 7.805   -12.934 14.671 1.00 128.42 ? -46  DA  I "C1'" 1 
ATOM   6619  N  N9    . DA  I 5 27  ? 8.196   -11.576 14.287 1.00 138.36 ? -46  DA  I N9    1 
ATOM   6620  C  C8    . DA  I 5 27  ? 8.499   -11.106 13.033 1.00 144.84 ? -46  DA  I C8    1 
ATOM   6621  N  N7    . DA  I 5 27  ? 8.804   -9.831  13.007 1.00 142.48 ? -46  DA  I N7    1 
ATOM   6622  C  C5    . DA  I 5 27  ? 8.689   -9.433  14.331 1.00 132.02 ? -46  DA  I C5    1 
ATOM   6623  C  C6    . DA  I 5 27  ? 8.882   -8.196  14.964 1.00 132.48 ? -46  DA  I C6    1 
ATOM   6624  N  N6    . DA  I 5 27  ? 9.244   -7.087  14.320 1.00 134.92 ? -46  DA  I N6    1 
ATOM   6625  N  N1    . DA  I 5 27  ? 8.673   -8.133  16.297 1.00 145.36 ? -46  DA  I N1    1 
ATOM   6626  C  C2    . DA  I 5 27  ? 8.304   -9.246  16.941 1.00 142.90 ? -46  DA  I C2    1 
ATOM   6627  N  N3    . DA  I 5 27  ? 8.094   -10.468 16.457 1.00 141.56 ? -46  DA  I N3    1 
ATOM   6628  C  C4    . DA  I 5 27  ? 8.304   -10.494 15.129 1.00 139.98 ? -46  DA  I C4    1 
ATOM   6629  P  P     . DA  I 5 28  ? 5.323   -16.401 14.600 1.00 149.52 ? -45  DA  I P     1 
ATOM   6630  O  OP1   . DA  I 5 28  ? 5.743   -17.821 14.697 1.00 147.48 ? -45  DA  I OP1   1 
ATOM   6631  O  OP2   . DA  I 5 28  ? 4.794   -15.863 13.317 1.00 143.41 ? -45  DA  I OP2   1 
ATOM   6632  O  "O5'" . DA  I 5 28  ? 4.279   -16.114 15.767 1.00 149.17 ? -45  DA  I "O5'" 1 
ATOM   6633  C  "C5'" . DA  I 5 28  ? 4.717   -15.452 16.977 1.00 147.80 ? -45  DA  I "C5'" 1 
ATOM   6634  C  "C4'" . DA  I 5 28  ? 4.131   -14.061 17.082 1.00 141.36 ? -45  DA  I "C4'" 1 
ATOM   6635  O  "O4'" . DA  I 5 28  ? 4.812   -13.106 16.218 1.00 142.08 ? -45  DA  I "O4'" 1 
ATOM   6636  C  "C3'" . DA  I 5 28  ? 2.647   -13.938 16.724 1.00 138.43 ? -45  DA  I "C3'" 1 
ATOM   6637  O  "O3'" . DA  I 5 28  ? 1.954   -13.319 17.788 1.00 133.60 ? -45  DA  I "O3'" 1 
ATOM   6638  C  "C2'" . DA  I 5 28  ? 2.633   -12.970 15.543 1.00 141.55 ? -45  DA  I "C2'" 1 
ATOM   6639  C  "C1'" . DA  I 5 28  ? 3.869   -12.131 15.840 1.00 140.37 ? -45  DA  I "C1'" 1 
ATOM   6640  N  N9    . DA  I 5 28  ? 4.357   -11.353 14.700 1.00 140.28 ? -45  DA  I N9    1 
ATOM   6641  C  C8    . DA  I 5 28  ? 4.309   -11.685 13.368 1.00 136.94 ? -45  DA  I C8    1 
ATOM   6642  N  N7    . DA  I 5 28  ? 4.765   -10.747 12.574 1.00 141.61 ? -45  DA  I N7    1 
ATOM   6643  C  C5    . DA  I 5 28  ? 5.111   -9.717  13.437 1.00 142.01 ? -45  DA  I C5    1 
ATOM   6644  C  C6    . DA  I 5 28  ? 5.653   -8.437  13.216 1.00 138.54 ? -45  DA  I C6    1 
ATOM   6645  N  N6    . DA  I 5 28  ? 5.957   -7.960  12.008 1.00 129.54 ? -45  DA  I N6    1 
ATOM   6646  N  N1    . DA  I 5 28  ? 5.879   -7.655  14.295 1.00 138.25 ? -45  DA  I N1    1 
ATOM   6647  C  C2    . DA  I 5 28  ? 5.573   -8.133  15.507 1.00 139.63 ? -45  DA  I C2    1 
ATOM   6648  N  N3    . DA  I 5 28  ? 5.059   -9.316  15.842 1.00 146.61 ? -45  DA  I N3    1 
ATOM   6649  C  C4    . DA  I 5 28  ? 4.847   -10.069 14.748 1.00 143.02 ? -45  DA  I C4    1 
ATOM   6650  P  P     . DA  I 5 29  ? 0.460   -13.705 18.068 1.00 121.33 ? -44  DA  I P     1 
ATOM   6651  O  OP1   . DA  I 5 29  ? 0.473   -14.932 18.899 1.00 129.68 ? -44  DA  I OP1   1 
ATOM   6652  O  OP2   . DA  I 5 29  ? -0.272  -13.680 16.776 1.00 117.34 ? -44  DA  I OP2   1 
ATOM   6653  O  "O5'" . DA  I 5 29  ? -0.053  -12.482 18.935 1.00 108.84 ? -44  DA  I "O5'" 1 
ATOM   6654  C  "C5'" . DA  I 5 29  ? -0.720  -11.398 18.294 1.00 118.65 ? -44  DA  I "C5'" 1 
ATOM   6655  C  "C4'" . DA  I 5 29  ? 0.193   -10.210 18.241 1.00 117.22 ? -44  DA  I "C4'" 1 
ATOM   6656  O  "O4'" . DA  I 5 29  ? 1.109   -10.359 17.139 1.00 137.28 ? -44  DA  I "O4'" 1 
ATOM   6657  C  "C3'" . DA  I 5 29  ? -0.521  -8.901  17.949 1.00 123.58 ? -44  DA  I "C3'" 1 
ATOM   6658  O  "O3'" . DA  I 5 29  ? -0.971  -8.398  19.196 1.00 121.06 ? -44  DA  I "O3'" 1 
ATOM   6659  C  "C2'" . DA  I 5 29  ? 0.560   -8.039  17.296 1.00 134.68 ? -44  DA  I "C2'" 1 
ATOM   6660  C  "C1'" . DA  I 5 29  ? 1.517   -9.078  16.704 1.00 136.68 ? -44  DA  I "C1'" 1 
ATOM   6661  N  N9    . DA  I 5 29  ? 1.579   -9.071  15.241 1.00 138.15 ? -44  DA  I N9    1 
ATOM   6662  C  C8    . DA  I 5 29  ? 1.215   -10.059 14.358 1.00 135.61 ? -44  DA  I C8    1 
ATOM   6663  N  N7    . DA  I 5 29  ? 1.433   -9.752  13.103 1.00 132.06 ? -44  DA  I N7    1 
ATOM   6664  C  C5    . DA  I 5 29  ? 1.982   -8.479  13.163 1.00 132.63 ? -44  DA  I C5    1 
ATOM   6665  C  C6    . DA  I 5 29  ? 2.435   -7.598  12.168 1.00 133.01 ? -44  DA  I C6    1 
ATOM   6666  N  N6    . DA  I 5 29  ? 2.393   -7.872  10.863 1.00 142.26 ? -44  DA  I N6    1 
ATOM   6667  N  N1    . DA  I 5 29  ? 2.924   -6.403  12.563 1.00 133.98 ? -44  DA  I N1    1 
ATOM   6668  C  C2    . DA  I 5 29  ? 2.961   -6.126  13.872 1.00 128.65 ? -44  DA  I C2    1 
ATOM   6669  N  N3    . DA  I 5 29  ? 2.571   -6.873  14.901 1.00 120.01 ? -44  DA  I N3    1 
ATOM   6670  C  C4    . DA  I 5 29  ? 2.081   -8.050  14.473 1.00 130.16 ? -44  DA  I C4    1 
ATOM   6671  P  P     . DA  I 5 30  ? -2.522  -8.154  19.460 1.00 128.75 ? -43  DA  I P     1 
ATOM   6672  O  OP1   . DA  I 5 30  ? -2.748  -8.323  20.915 1.00 125.18 ? -43  DA  I OP1   1 
ATOM   6673  O  OP2   . DA  I 5 30  ? -3.298  -8.971  18.486 1.00 105.19 ? -43  DA  I OP2   1 
ATOM   6674  O  "O5'" . DA  I 5 30  ? -2.700  -6.604  19.131 1.00 111.89 ? -43  DA  I "O5'" 1 
ATOM   6675  C  "C5'" . DA  I 5 30  ? -1.688  -5.657  19.527 1.00 109.82 ? -43  DA  I "C5'" 1 
ATOM   6676  C  "C4'" . DA  I 5 30  ? -1.541  -4.558  18.492 1.00 111.30 ? -43  DA  I "C4'" 1 
ATOM   6677  O  "O4'" . DA  I 5 30  ? -0.915  -5.076  17.283 1.00 109.46 ? -43  DA  I "O4'" 1 
ATOM   6678  C  "C3'" . DA  I 5 30  ? -2.844  -3.884  18.048 1.00 100.59 ? -43  DA  I "C3'" 1 
ATOM   6679  O  "O3'" . DA  I 5 30  ? -2.760  -2.468  18.153 1.00 92.24  ? -43  DA  I "O3'" 1 
ATOM   6680  C  "C2'" . DA  I 5 30  ? -3.016  -4.358  16.610 1.00 104.33 ? -43  DA  I "C2'" 1 
ATOM   6681  C  "C1'" . DA  I 5 30  ? -1.566  -4.522  16.165 1.00 110.32 ? -43  DA  I "C1'" 1 
ATOM   6682  N  N9    . DA  I 5 30  ? -1.416  -5.416  15.012 1.00 116.94 ? -43  DA  I N9    1 
ATOM   6683  C  C8    . DA  I 5 30  ? -1.934  -6.677  14.846 1.00 110.39 ? -43  DA  I C8    1 
ATOM   6684  N  N7    . DA  I 5 30  ? -1.661  -7.209  13.680 1.00 116.18 ? -43  DA  I N7    1 
ATOM   6685  C  C5    . DA  I 5 30  ? -0.947  -6.220  13.019 1.00 117.33 ? -43  DA  I C5    1 
ATOM   6686  C  C6    . DA  I 5 30  ? -0.379  -6.160  11.736 1.00 111.71 ? -43  DA  I C6    1 
ATOM   6687  N  N6    . DA  I 5 30  ? -0.442  -7.158  10.853 1.00 112.84 ? -43  DA  I N6    1 
ATOM   6688  N  N1    . DA  I 5 30  ? 0.274   -5.030  11.390 1.00 115.27 ? -43  DA  I N1    1 
ATOM   6689  C  C2    . DA  I 5 30  ? 0.342   -4.030  12.278 1.00 115.44 ? -43  DA  I C2    1 
ATOM   6690  N  N3    . DA  I 5 30  ? -0.155  -3.965  13.510 1.00 117.58 ? -43  DA  I N3    1 
ATOM   6691  C  C4    . DA  I 5 30  ? -0.794  -5.107  13.825 1.00 121.02 ? -43  DA  I C4    1 
ATOM   6692  P  P     . DG  I 5 31  ? -4.020  -1.551  17.773 1.00 101.36 ? -42  DG  I P     1 
ATOM   6693  O  OP1   . DG  I 5 31  ? -4.115  -0.440  18.754 1.00 104.31 ? -42  DG  I OP1   1 
ATOM   6694  O  OP2   . DG  I 5 31  ? -5.201  -2.427  17.533 1.00 96.63  ? -42  DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  I 5 31  ? -3.553  -0.895  16.403 1.00 125.81 ? -42  DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  I 5 31  ? -2.183  -0.471  16.216 1.00 135.33 ? -42  DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  I 5 31  ? -1.987  0.079   14.819 1.00 131.19 ? -42  DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  I 5 31  ? -1.676  -1.005  13.898 1.00 117.86 ? -42  DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  I 5 31  ? -3.189  0.823   14.243 1.00 123.78 ? -42  DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  I 5 31  ? -2.773  2.051   13.664 1.00 128.66 ? -42  DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  I 5 31  ? -3.802  -0.178  13.264 1.00 117.34 ? -42  DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  I 5 31  ? -2.586  -0.992  12.820 1.00 112.33 ? -42  DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  I 5 31  ? -2.939  -2.371  12.508 1.00 113.25 ? -42  DG  I N9    1 
ATOM   6704  C  C8    . DG  I 5 31  ? -3.580  -3.261  13.334 1.00 121.29 ? -42  DG  I C8    1 
ATOM   6705  N  N7    . DG  I 5 31  ? -3.778  -4.425  12.779 1.00 122.69 ? -42  DG  I N7    1 
ATOM   6706  C  C5    . DG  I 5 31  ? -3.256  -4.289  11.501 1.00 127.48 ? -42  DG  I C5    1 
ATOM   6707  C  C6    . DG  I 5 31  ? -3.194  -5.217  10.430 1.00 126.45 ? -42  DG  I C6    1 
ATOM   6708  O  O6    . DG  I 5 31  ? -3.596  -6.385  10.398 1.00 117.86 ? -42  DG  I O6    1 
ATOM   6709  N  N1    . DG  I 5 31  ? -2.585  -4.662  9.308  1.00 138.98 ? -42  DG  I N1    1 
ATOM   6710  C  C2    . DG  I 5 31  ? -2.098  -3.381  9.226  1.00 142.44 ? -42  DG  I C2    1 
ATOM   6711  N  N2    . DG  I 5 31  ? -1.540  -3.032  8.057  1.00 152.17 ? -42  DG  I N2    1 
ATOM   6712  N  N3    . DG  I 5 31  ? -2.151  -2.507  10.217 1.00 134.90 ? -42  DG  I N3    1 
ATOM   6713  C  C4    . DG  I 5 31  ? -2.738  -3.025  11.316 1.00 127.67 ? -42  DG  I C4    1 
ATOM   6714  P  P     . DT  I 5 32  ? -3.853  3.102   13.151 1.00 119.18 ? -41  DT  I P     1 
ATOM   6715  O  OP1   . DT  I 5 32  ? -3.325  4.464   13.430 1.00 108.53 ? -41  DT  I OP1   1 
ATOM   6716  O  OP2   . DT  I 5 32  ? -5.188  2.690   13.649 1.00 112.02 ? -41  DT  I OP2   1 
ATOM   6717  O  "O5'" . DT  I 5 32  ? -3.869  2.850   11.581 1.00 134.46 ? -41  DT  I "O5'" 1 
ATOM   6718  C  "C5'" . DT  I 5 32  ? -2.652  2.611   10.843 1.00 138.46 ? -41  DT  I "C5'" 1 
ATOM   6719  C  "C4'" . DT  I 5 32  ? -2.954  2.436   9.371  1.00 144.63 ? -41  DT  I "C4'" 1 
ATOM   6720  O  "O4'" . DT  I 5 32  ? -3.151  1.035   9.061  1.00 139.90 ? -41  DT  I "O4'" 1 
ATOM   6721  C  "C3'" . DT  I 5 32  ? -4.202  3.170   8.867  1.00 147.68 ? -41  DT  I "C3'" 1 
ATOM   6722  O  "O3'" . DT  I 5 32  ? -3.900  3.860   7.652  1.00 148.18 ? -41  DT  I "O3'" 1 
ATOM   6723  C  "C2'" . DT  I 5 32  ? -5.224  2.064   8.662  1.00 137.33 ? -41  DT  I "C2'" 1 
ATOM   6724  C  "C1'" . DT  I 5 32  ? -4.359  0.861   8.334  1.00 135.52 ? -41  DT  I "C1'" 1 
ATOM   6725  N  N1    . DT  I 5 32  ? -4.926  -0.449  8.709  1.00 130.51 ? -41  DT  I N1    1 
ATOM   6726  C  C2    . DT  I 5 32  ? -4.788  -1.490  7.820  1.00 131.28 ? -41  DT  I C2    1 
ATOM   6727  O  O2    . DT  I 5 32  ? -4.252  -1.371  6.733  1.00 137.83 ? -41  DT  I O2    1 
ATOM   6728  N  N3    . DT  I 5 32  ? -5.325  -2.679  8.243  1.00 141.44 ? -41  DT  I N3    1 
ATOM   6729  C  C4    . DT  I 5 32  ? -5.958  -2.928  9.444  1.00 141.23 ? -41  DT  I C4    1 
ATOM   6730  O  O4    . DT  I 5 32  ? -6.391  -4.050  9.685  1.00 152.96 ? -41  DT  I O4    1 
ATOM   6731  C  C5    . DT  I 5 32  ? -6.063  -1.794  10.333 1.00 133.03 ? -41  DT  I C5    1 
ATOM   6732  C  C7    . DT  I 5 32  ? -6.737  -1.969  11.657 1.00 128.49 ? -41  DT  I C7    1 
ATOM   6733  C  C6    . DT  I 5 32  ? -5.545  -0.627  9.928  1.00 133.13 ? -41  DT  I C6    1 
ATOM   6734  P  P     . DG  I 5 33  ? -4.936  4.908   7.044  1.00 150.13 ? -40  DG  I P     1 
ATOM   6735  O  OP1   . DG  I 5 33  ? -4.150  6.052   6.519  1.00 136.99 ? -40  DG  I OP1   1 
ATOM   6736  O  OP2   . DG  I 5 33  ? -6.005  5.155   8.048  1.00 139.22 ? -40  DG  I OP2   1 
ATOM   6737  O  "O5'" . DG  I 5 33  ? -5.614  4.080   5.862  1.00 156.22 ? -40  DG  I "O5'" 1 
ATOM   6738  C  "C5'" . DG  I 5 33  ? -4.813  3.404   4.872  1.00 152.76 ? -40  DG  I "C5'" 1 
ATOM   6739  C  "C4'" . DG  I 5 33  ? -5.677  2.554   3.968  1.00 151.70 ? -40  DG  I "C4'" 1 
ATOM   6740  O  "O4'" . DG  I 5 33  ? -5.853  1.236   4.562  1.00 151.86 ? -40  DG  I "O4'" 1 
ATOM   6741  C  "C3'" . DG  I 5 33  ? -7.092  3.070   3.677  1.00 155.94 ? -40  DG  I "C3'" 1 
ATOM   6742  O  "O3'" . DG  I 5 33  ? -7.356  2.890   2.284  1.00 162.39 ? -40  DG  I "O3'" 1 
ATOM   6743  C  "C2'" . DG  I 5 33  ? -7.959  2.169   4.553  1.00 153.58 ? -40  DG  I "C2'" 1 
ATOM   6744  C  "C1'" . DG  I 5 33  ? -7.202  0.856   4.411  1.00 158.61 ? -40  DG  I "C1'" 1 
ATOM   6745  N  N9    . DG  I 5 33  ? -7.528  -0.194  5.372  1.00 161.40 ? -40  DG  I N9    1 
ATOM   6746  C  C8    . DG  I 5 33  ? -7.590  -0.103  6.742  1.00 150.66 ? -40  DG  I C8    1 
ATOM   6747  N  N7    . DG  I 5 33  ? -7.924  -1.227  7.315  1.00 143.14 ? -40  DG  I N7    1 
ATOM   6748  C  C5    . DG  I 5 33  ? -8.095  -2.113  6.260  1.00 159.98 ? -40  DG  I C5    1 
ATOM   6749  C  C6    . DG  I 5 33  ? -8.462  -3.485  6.259  1.00 163.69 ? -40  DG  I C6    1 
ATOM   6750  O  O6    . DG  I 5 33  ? -8.714  -4.215  7.224  1.00 158.20 ? -40  DG  I O6    1 
ATOM   6751  N  N1    . DG  I 5 33  ? -8.520  -3.999  4.968  1.00 168.77 ? -40  DG  I N1    1 
ATOM   6752  C  C2    . DG  I 5 33  ? -8.264  -3.287  3.822  1.00 170.31 ? -40  DG  I C2    1 
ATOM   6753  N  N2    . DG  I 5 33  ? -8.378  -3.959  2.667  1.00 173.73 ? -40  DG  I N2    1 
ATOM   6754  N  N3    . DG  I 5 33  ? -7.925  -2.009  3.809  1.00 167.85 ? -40  DG  I N3    1 
ATOM   6755  C  C4    . DG  I 5 33  ? -7.858  -1.490  5.054  1.00 165.64 ? -40  DG  I C4    1 
ATOM   6756  P  P     . DT  I 5 34  ? -8.697  3.475   1.610  1.00 166.64 ? -39  DT  I P     1 
ATOM   6757  O  OP1   . DT  I 5 34  ? -8.430  4.879   1.202  1.00 158.96 ? -39  DT  I OP1   1 
ATOM   6758  O  OP2   . DT  I 5 34  ? -9.846  3.184   2.505  1.00 168.89 ? -39  DT  I OP2   1 
ATOM   6759  O  "O5'" . DT  I 5 34  ? -8.874  2.591   0.291  1.00 160.22 ? -39  DT  I "O5'" 1 
ATOM   6760  C  "C5'" . DT  I 5 34  ? -8.240  1.305   0.121  1.00 151.57 ? -39  DT  I "C5'" 1 
ATOM   6761  C  "C4'" . DT  I 5 34  ? -9.258  0.219   -0.150 1.00 154.77 ? -39  DT  I "C4'" 1 
ATOM   6762  O  "O4'" . DT  I 5 34  ? -9.432  -0.579  1.045  1.00 162.01 ? -39  DT  I "O4'" 1 
ATOM   6763  C  "C3'" . DT  I 5 34  ? -10.666 0.668   -0.574 1.00 159.60 ? -39  DT  I "C3'" 1 
ATOM   6764  O  "O3'" . DT  I 5 34  ? -11.057 -0.071  -1.745 1.00 166.12 ? -39  DT  I "O3'" 1 
ATOM   6765  C  "C2'" . DT  I 5 34  ? -11.523 0.354   0.641  1.00 156.61 ? -39  DT  I "C2'" 1 
ATOM   6766  C  "C1'" . DT  I 5 34  ? -10.809 -0.854  1.214  1.00 165.88 ? -39  DT  I "C1'" 1 
ATOM   6767  N  N1    . DT  I 5 34  ? -11.052 -1.118  2.647  1.00 173.15 ? -39  DT  I N1    1 
ATOM   6768  C  C2    . DT  I 5 34  ? -11.347 -2.407  3.036  1.00 174.78 ? -39  DT  I C2    1 
ATOM   6769  O  O2    . DT  I 5 34  ? -11.418 -3.341  2.254  1.00 185.29 ? -39  DT  I O2    1 
ATOM   6770  N  N3    . DT  I 5 34  ? -11.559 -2.562  4.383  1.00 170.39 ? -39  DT  I N3    1 
ATOM   6771  C  C4    . DT  I 5 34  ? -11.505 -1.582  5.356  1.00 173.63 ? -39  DT  I C4    1 
ATOM   6772  O  O4    . DT  I 5 34  ? -11.714 -1.873  6.530  1.00 177.62 ? -39  DT  I O4    1 
ATOM   6773  C  C5    . DT  I 5 34  ? -11.189 -0.254  4.878  1.00 172.95 ? -39  DT  I C5    1 
ATOM   6774  C  C7    . DT  I 5 34  ? -11.106 0.872   5.859  1.00 166.14 ? -39  DT  I C7    1 
ATOM   6775  C  C6    . DT  I 5 34  ? -10.981 -0.092  3.565  1.00 174.79 ? -39  DT  I C6    1 
ATOM   6776  P  P     . DA  I 5 35  ? -12.580 -0.061  -2.289 1.00 162.29 ? -38  DA  I P     1 
ATOM   6777  O  OP1   . DA  I 5 35  ? -12.529 -0.116  -3.772 1.00 144.02 ? -38  DA  I OP1   1 
ATOM   6778  O  OP2   . DA  I 5 35  ? -13.323 1.049   -1.622 1.00 134.70 ? -38  DA  I OP2   1 
ATOM   6779  O  "O5'" . DA  I 5 35  ? -13.136 -1.474  -1.802 1.00 158.17 ? -38  DA  I "O5'" 1 
ATOM   6780  C  "C5'" . DA  I 5 35  ? -12.400 -2.692  -2.067 1.00 155.83 ? -38  DA  I "C5'" 1 
ATOM   6781  C  "C4'" . DA  I 5 35  ? -13.249 -3.906  -1.760 1.00 158.34 ? -38  DA  I "C4'" 1 
ATOM   6782  O  "O4'" . DA  I 5 35  ? -13.246 -4.153  -0.320 1.00 150.33 ? -38  DA  I "O4'" 1 
ATOM   6783  C  "C3'" . DA  I 5 35  ? -14.725 -3.797  -2.168 1.00 164.01 ? -38  DA  I "C3'" 1 
ATOM   6784  O  "O3'" . DA  I 5 35  ? -15.232 -5.007  -2.737 1.00 163.05 ? -38  DA  I "O3'" 1 
ATOM   6785  C  "C2'" . DA  I 5 35  ? -15.406 -3.470  -0.845 1.00 163.79 ? -38  DA  I "C2'" 1 
ATOM   6786  C  "C1'" . DA  I 5 35  ? -14.579 -4.314  0.119  1.00 156.60 ? -38  DA  I "C1'" 1 
ATOM   6787  N  N9    . DA  I 5 35  ? -14.699 -3.855  1.501  1.00 149.33 ? -38  DA  I N9    1 
ATOM   6788  C  C8    . DA  I 5 35  ? -14.487 -2.587  1.984  1.00 155.50 ? -38  DA  I C8    1 
ATOM   6789  N  N7    . DA  I 5 35  ? -14.730 -2.464  3.266  1.00 151.38 ? -38  DA  I N7    1 
ATOM   6790  C  C5    . DA  I 5 35  ? -15.159 -3.728  3.646  1.00 146.57 ? -38  DA  I C5    1 
ATOM   6791  C  C6    . DA  I 5 35  ? -15.573 -4.250  4.880  1.00 144.42 ? -38  DA  I C6    1 
ATOM   6792  N  N6    . DA  I 5 35  ? -15.623 -3.530  6.002  1.00 147.59 ? -38  DA  I N6    1 
ATOM   6793  N  N1    . DA  I 5 35  ? -15.935 -5.551  4.923  1.00 160.02 ? -38  DA  I N1    1 
ATOM   6794  C  C2    . DA  I 5 35  ? -15.885 -6.268  3.792  1.00 158.69 ? -38  DA  I C2    1 
ATOM   6795  N  N3    . DA  I 5 35  ? -15.518 -5.887  2.570  1.00 151.65 ? -38  DA  I N3    1 
ATOM   6796  C  C4    . DA  I 5 35  ? -15.160 -4.590  2.566  1.00 147.22 ? -38  DA  I C4    1 
ATOM   6797  P  P     . DT  I 5 36  ? -16.811 -5.170  -3.059 1.00 158.91 ? -37  DT  I P     1 
ATOM   6798  O  OP1   . DT  I 5 36  ? -16.957 -6.122  -4.190 1.00 150.84 ? -37  DT  I OP1   1 
ATOM   6799  O  OP2   . DT  I 5 36  ? -17.427 -3.813  -3.131 1.00 138.99 ? -37  DT  I OP2   1 
ATOM   6800  O  "O5'" . DT  I 5 36  ? -17.377 -5.915  -1.770 1.00 159.11 ? -37  DT  I "O5'" 1 
ATOM   6801  C  "C5'" . DT  I 5 36  ? -16.981 -7.265  -1.471 1.00 161.27 ? -37  DT  I "C5'" 1 
ATOM   6802  C  "C4'" . DT  I 5 36  ? -17.781 -7.800  -0.306 1.00 160.39 ? -37  DT  I "C4'" 1 
ATOM   6803  O  "O4'" . DT  I 5 36  ? -17.551 -6.979  0.865  1.00 165.30 ? -37  DT  I "O4'" 1 
ATOM   6804  C  "C3'" . DT  I 5 36  ? -19.299 -7.839  -0.520 1.00 157.08 ? -37  DT  I "C3'" 1 
ATOM   6805  O  "O3'" . DT  I 5 36  ? -19.758 -9.152  -0.162 1.00 149.51 ? -37  DT  I "O3'" 1 
ATOM   6806  C  "C2'" . DT  I 5 36  ? -19.813 -6.710  0.359  1.00 163.54 ? -37  DT  I "C2'" 1 
ATOM   6807  C  "C1'" . DT  I 5 36  ? -18.794 -6.697  1.484  1.00 173.64 ? -37  DT  I "C1'" 1 
ATOM   6808  N  N1    . DT  I 5 36  ? -18.668 -5.411  2.207  1.00 171.77 ? -37  DT  I N1    1 
ATOM   6809  C  C2    . DT  I 5 36  ? -18.858 -5.408  3.571  1.00 158.96 ? -37  DT  I C2    1 
ATOM   6810  O  O2    . DT  I 5 36  ? -19.110 -6.415  4.212  1.00 154.15 ? -37  DT  I O2    1 
ATOM   6811  N  N3    . DT  I 5 36  ? -18.728 -4.176  4.163  1.00 156.47 ? -37  DT  I N3    1 
ATOM   6812  C  C4    . DT  I 5 36  ? -18.440 -2.975  3.539  1.00 160.82 ? -37  DT  I C4    1 
ATOM   6813  O  O4    . DT  I 5 36  ? -18.351 -1.947  4.202  1.00 154.90 ? -37  DT  I O4    1 
ATOM   6814  C  C5    . DT  I 5 36  ? -18.262 -3.052  2.107  1.00 164.09 ? -37  DT  I C5    1 
ATOM   6815  C  C7    . DT  I 5 36  ? -17.954 -1.802  1.345  1.00 160.02 ? -37  DT  I C7    1 
ATOM   6816  C  C6    . DT  I 5 36  ? -18.385 -4.249  1.521  1.00 172.05 ? -37  DT  I C6    1 
ATOM   6817  P  P     . DT  I 5 37  ? -21.316 -9.453  0.123  1.00 152.37 ? -36  DT  I P     1 
ATOM   6818  O  OP1   . DT  I 5 37  ? -21.605 -10.835 -0.333 1.00 132.63 ? -36  DT  I OP1   1 
ATOM   6819  O  OP2   . DT  I 5 37  ? -22.127 -8.313  -0.386 1.00 134.80 ? -36  DT  I OP2   1 
ATOM   6820  O  "O5'" . DT  I 5 37  ? -21.403 -9.448  1.716  1.00 165.49 ? -36  DT  I "O5'" 1 
ATOM   6821  C  "C5'" . DT  I 5 37  ? -20.679 -10.409 2.517  1.00 148.26 ? -36  DT  I "C5'" 1 
ATOM   6822  C  "C4'" . DT  I 5 37  ? -21.243 -10.464 3.919  1.00 134.18 ? -36  DT  I "C4'" 1 
ATOM   6823  O  "O4'" . DT  I 5 37  ? -21.035 -9.193  4.578  1.00 134.58 ? -36  DT  I "O4'" 1 
ATOM   6824  C  "C3'" . DT  I 5 37  ? -22.745 -10.743 4.013  1.00 122.52 ? -36  DT  I "C3'" 1 
ATOM   6825  O  "O3'" . DT  I 5 37  ? -22.985 -11.592 5.139  1.00 113.43 ? -36  DT  I "O3'" 1 
ATOM   6826  C  "C2'" . DT  I 5 37  ? -23.347 -9.365  4.208  1.00 119.42 ? -36  DT  I "C2'" 1 
ATOM   6827  C  "C1'" . DT  I 5 37  ? -22.277 -8.677  5.039  1.00 135.28 ? -36  DT  I "C1'" 1 
ATOM   6828  N  N1    . DT  I 5 37  ? -22.218 -7.208  4.922  1.00 140.66 ? -36  DT  I N1    1 
ATOM   6829  C  C2    . DT  I 5 37  ? -22.072 -6.460  6.070  1.00 149.96 ? -36  DT  I C2    1 
ATOM   6830  O  O2    . DT  I 5 37  ? -22.025 -6.950  7.187  1.00 160.84 ? -36  DT  I O2    1 
ATOM   6831  N  N3    . DT  I 5 37  ? -21.994 -5.105  5.861  1.00 146.82 ? -36  DT  I N3    1 
ATOM   6832  C  C4    . DT  I 5 37  ? -22.036 -4.444  4.649  1.00 136.54 ? -36  DT  I C4    1 
ATOM   6833  O  O4    . DT  I 5 37  ? -21.957 -3.220  4.618  1.00 128.58 ? -36  DT  I O4    1 
ATOM   6834  C  C5    . DT  I 5 37  ? -22.184 -5.290  3.489  1.00 137.94 ? -36  DT  I C5    1 
ATOM   6835  C  C7    . DT  I 5 37  ? -22.249 -4.660  2.134  1.00 139.72 ? -36  DT  I C7    1 
ATOM   6836  C  C6    . DT  I 5 37  ? -22.252 -6.613  3.680  1.00 138.98 ? -36  DT  I C6    1 
ATOM   6837  P  P     . DT  I 5 38  ? -24.470 -12.076 5.497  1.00 127.12 ? -35  DT  I P     1 
ATOM   6838  O  OP1   . DT  I 5 38  ? -24.379 -13.464 6.003  1.00 127.92 ? -35  DT  I OP1   1 
ATOM   6839  O  OP2   . DT  I 5 38  ? -25.363 -11.767 4.352  1.00 138.22 ? -35  DT  I OP2   1 
ATOM   6840  O  "O5'" . DT  I 5 38  ? -24.901 -11.099 6.681  1.00 134.97 ? -35  DT  I "O5'" 1 
ATOM   6841  C  "C5'" . DT  I 5 38  ? -24.114 -10.975 7.888  1.00 124.04 ? -35  DT  I "C5'" 1 
ATOM   6842  C  "C4'" . DT  I 5 38  ? -24.759 -9.994  8.843  1.00 117.00 ? -35  DT  I "C4'" 1 
ATOM   6843  O  "O4'" . DT  I 5 38  ? -24.570 -8.630  8.388  1.00 107.58 ? -35  DT  I "O4'" 1 
ATOM   6844  C  "C3'" . DT  I 5 38  ? -26.270 -10.169 9.039  1.00 113.07 ? -35  DT  I "C3'" 1 
ATOM   6845  O  "O3'" . DT  I 5 38  ? -26.621 -10.106 10.423 1.00 111.67 ? -35  DT  I "O3'" 1 
ATOM   6846  C  "C2'" . DT  I 5 38  ? -26.875 -8.970  8.336  1.00 111.03 ? -35  DT  I "C2'" 1 
ATOM   6847  C  "C1'" . DT  I 5 38  ? -25.796 -7.924  8.512  1.00 110.05 ? -35  DT  I "C1'" 1 
ATOM   6848  N  N1    . DT  I 5 38  ? -25.807 -6.849  7.502  1.00 117.00 ? -35  DT  I N1    1 
ATOM   6849  C  C2    . DT  I 5 38  ? -25.886 -5.546  7.934  1.00 117.14 ? -35  DT  I C2    1 
ATOM   6850  O  O2    . DT  I 5 38  ? -25.965 -5.239  9.111  1.00 117.04 ? -35  DT  I O2    1 
ATOM   6851  N  N3    . DT  I 5 38  ? -25.872 -4.609  6.932  1.00 120.40 ? -35  DT  I N3    1 
ATOM   6852  C  C4    . DT  I 5 38  ? -25.794 -4.843  5.571  1.00 124.40 ? -35  DT  I C4    1 
ATOM   6853  O  O4    . DT  I 5 38  ? -25.793 -3.898  4.788  1.00 124.31 ? -35  DT  I O4    1 
ATOM   6854  C  C5    . DT  I 5 38  ? -25.713 -6.235  5.189  1.00 127.17 ? -35  DT  I C5    1 
ATOM   6855  C  C7    . DT  I 5 38  ? -25.640 -6.587  3.736  1.00 126.15 ? -35  DT  I C7    1 
ATOM   6856  C  C6    . DT  I 5 38  ? -25.724 -7.155  6.161  1.00 129.83 ? -35  DT  I C6    1 
ATOM   6857  P  P     . DG  I 5 39  ? -26.589 -11.427 11.314 1.00 102.19 ? -34  DG  I P     1 
ATOM   6858  O  OP1   . DG  I 5 39  ? -25.337 -12.175 11.000 1.00 89.09  ? -34  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I 5 39  ? -27.909 -12.091 11.186 1.00 86.88  ? -34  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I 5 39  ? -26.440 -10.835 12.779 1.00 97.49  ? -34  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I 5 39  ? -25.226 -10.180 13.154 1.00 103.89 ? -34  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I 5 39  ? -25.544 -8.911  13.900 1.00 105.88 ? -34  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I 5 39  ? -25.989 -7.907  12.953 1.00 110.40 ? -34  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I 5 39  ? -26.632 -9.037  14.961 1.00 100.81 ? -34  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I 5 39  ? -26.217 -8.371  16.146 1.00 92.27  ? -34  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I 5 39  ? -27.861 -8.424  14.293 1.00 107.68 ? -34  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I 5 39  ? -27.239 -7.392  13.354 1.00 115.98 ? -34  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I 5 39  ? -28.041 -7.170  12.155 1.00 129.78 ? -34  DG  I N9    1 
ATOM   6869  C  C8    . DG  I 5 39  ? -28.809 -8.101  11.498 1.00 129.27 ? -34  DG  I C8    1 
ATOM   6870  N  N7    . DG  I 5 39  ? -29.424 -7.613  10.455 1.00 126.84 ? -34  DG  I N7    1 
ATOM   6871  C  C5    . DG  I 5 39  ? -29.030 -6.283  10.413 1.00 133.14 ? -34  DG  I C5    1 
ATOM   6872  C  C6    . DG  I 5 39  ? -29.375 -5.253  9.504  1.00 132.69 ? -34  DG  I C6    1 
ATOM   6873  O  O6    . DG  I 5 39  ? -30.123 -5.311  8.521  1.00 136.23 ? -34  DG  I O6    1 
ATOM   6874  N  N1    . DG  I 5 39  ? -28.759 -4.051  9.836  1.00 136.99 ? -34  DG  I N1    1 
ATOM   6875  C  C2    . DG  I 5 39  ? -27.918 -3.864  10.905 1.00 129.35 ? -34  DG  I C2    1 
ATOM   6876  N  N2    . DG  I 5 39  ? -27.418 -2.628  11.054 1.00 139.46 ? -34  DG  I N2    1 
ATOM   6877  N  N3    . DG  I 5 39  ? -27.588 -4.816  11.761 1.00 125.63 ? -34  DG  I N3    1 
ATOM   6878  C  C4    . DG  I 5 39  ? -28.179 -5.992  11.458 1.00 134.20 ? -34  DG  I C4    1 
ATOM   6879  P  P     . DG  I 5 40  ? -26.966 -8.636  17.546 1.00 96.80  ? -33  DG  I P     1 
ATOM   6880  O  OP1   . DG  I 5 40  ? -25.925 -8.689  18.599 1.00 106.53 ? -33  DG  I OP1   1 
ATOM   6881  O  OP2   . DG  I 5 40  ? -27.910 -9.778  17.397 1.00 89.97  ? -33  DG  I OP2   1 
ATOM   6882  O  "O5'" . DG  I 5 40  ? -27.820 -7.307  17.732 1.00 91.03  ? -33  DG  I "O5'" 1 
ATOM   6883  C  "C5'" . DG  I 5 40  ? -27.195 -6.025  17.553 1.00 91.51  ? -33  DG  I "C5'" 1 
ATOM   6884  C  "C4'" . DG  I 5 40  ? -28.235 -4.975  17.272 1.00 94.91  ? -33  DG  I "C4'" 1 
ATOM   6885  O  "O4'" . DG  I 5 40  ? -28.785 -5.180  15.945 1.00 105.16 ? -33  DG  I "O4'" 1 
ATOM   6886  C  "C3'" . DG  I 5 40  ? -29.427 -4.956  18.227 1.00 101.73 ? -33  DG  I "C3'" 1 
ATOM   6887  O  "O3'" . DG  I 5 40  ? -29.634 -3.609  18.619 1.00 108.05 ? -33  DG  I "O3'" 1 
ATOM   6888  C  "C2'" . DG  I 5 40  ? -30.571 -5.508  17.379 1.00 103.75 ? -33  DG  I "C2'" 1 
ATOM   6889  C  "C1'" . DG  I 5 40  ? -30.178 -4.993  15.999 1.00 112.18 ? -33  DG  I "C1'" 1 
ATOM   6890  N  N9    . DG  I 5 40  ? -30.790 -5.674  14.861 1.00 119.20 ? -33  DG  I N9    1 
ATOM   6891  C  C8    . DG  I 5 40  ? -31.239 -6.972  14.789 1.00 117.98 ? -33  DG  I C8    1 
ATOM   6892  N  N7    . DG  I 5 40  ? -31.748 -7.273  13.625 1.00 116.06 ? -33  DG  I N7    1 
ATOM   6893  C  C5    . DG  I 5 40  ? -31.635 -6.103  12.886 1.00 126.12 ? -33  DG  I C5    1 
ATOM   6894  C  C6    . DG  I 5 40  ? -32.017 -5.817  11.548 1.00 127.02 ? -33  DG  I C6    1 
ATOM   6895  O  O6    . DG  I 5 40  ? -32.545 -6.567  10.719 1.00 129.30 ? -33  DG  I O6    1 
ATOM   6896  N  N1    . DG  I 5 40  ? -31.716 -4.504  11.200 1.00 127.54 ? -33  DG  I N1    1 
ATOM   6897  C  C2    . DG  I 5 40  ? -31.125 -3.582  12.032 1.00 119.79 ? -33  DG  I C2    1 
ATOM   6898  N  N2    . DG  I 5 40  ? -30.919 -2.365  11.515 1.00 123.55 ? -33  DG  I N2    1 
ATOM   6899  N  N3    . DG  I 5 40  ? -30.766 -3.835  13.278 1.00 113.43 ? -33  DG  I N3    1 
ATOM   6900  C  C4    . DG  I 5 40  ? -31.047 -5.106  13.637 1.00 123.96 ? -33  DG  I C4    1 
ATOM   6901  P  P     . DA  I 5 41  ? -30.314 -3.250  20.028 1.00 112.05 ? -32  DA  I P     1 
ATOM   6902  O  OP1   . DA  I 5 41  ? -29.367 -3.621  21.108 1.00 108.67 ? -32  DA  I OP1   1 
ATOM   6903  O  OP2   . DA  I 5 41  ? -31.698 -3.795  20.034 1.00 104.23 ? -32  DA  I OP2   1 
ATOM   6904  O  "O5'" . DA  I 5 41  ? -30.390 -1.660  19.969 1.00 127.35 ? -32  DA  I "O5'" 1 
ATOM   6905  C  "C5'" . DA  I 5 41  ? -29.569 -0.893  19.045 1.00 125.50 ? -32  DA  I "C5'" 1 
ATOM   6906  C  "C4'" . DA  I 5 41  ? -30.417 0.050   18.213 1.00 116.50 ? -32  DA  I "C4'" 1 
ATOM   6907  O  "O4'" . DA  I 5 41  ? -30.931 -0.654  17.050 1.00 110.16 ? -32  DA  I "O4'" 1 
ATOM   6908  C  "C3'" . DA  I 5 41  ? -31.617 0.684   18.929 1.00 124.09 ? -32  DA  I "C3'" 1 
ATOM   6909  O  "O3'" . DA  I 5 41  ? -31.477 2.116   18.924 1.00 116.60 ? -32  DA  I "O3'" 1 
ATOM   6910  C  "C2'" . DA  I 5 41  ? -32.837 -0.003  18.296 1.00 121.18 ? -32  DA  I "C2'" 1 
ATOM   6911  C  "C1'" . DA  I 5 41  ? -32.320 -0.420  16.918 1.00 116.69 ? -32  DA  I "C1'" 1 
ATOM   6912  N  N9    . DA  I 5 41  ? -32.935 -1.654  16.422 1.00 117.88 ? -32  DA  I N9    1 
ATOM   6913  C  C8    . DA  I 5 41  ? -33.172 -2.797  17.145 1.00 119.06 ? -32  DA  I C8    1 
ATOM   6914  N  N7    . DA  I 5 41  ? -33.709 -3.765  16.443 1.00 119.68 ? -32  DA  I N7    1 
ATOM   6915  C  C5    . DA  I 5 41  ? -33.834 -3.224  15.171 1.00 116.60 ? -32  DA  I C5    1 
ATOM   6916  C  C6    . DA  I 5 41  ? -34.332 -3.749  13.970 1.00 108.30 ? -32  DA  I C6    1 
ATOM   6917  N  N6    . DA  I 5 41  ? -34.819 -4.986  13.854 1.00 111.30 ? -32  DA  I N6    1 
ATOM   6918  N  N1    . DA  I 5 41  ? -34.312 -2.952  12.878 1.00 101.01 ? -32  DA  I N1    1 
ATOM   6919  C  C2    . DA  I 5 41  ? -33.817 -1.713  12.999 1.00 107.61 ? -32  DA  I C2    1 
ATOM   6920  N  N3    . DA  I 5 41  ? -33.322 -1.105  14.077 1.00 119.84 ? -32  DA  I N3    1 
ATOM   6921  C  C4    . DA  I 5 41  ? -33.359 -1.925  15.142 1.00 122.45 ? -32  DA  I C4    1 
ATOM   6922  P  P     . DA  I 5 42  ? -32.711 3.087   18.601 1.00 113.97 ? -31  DA  I P     1 
ATOM   6923  O  OP1   . DA  I 5 42  ? -32.191 4.471   18.571 1.00 106.93 ? -31  DA  I OP1   1 
ATOM   6924  O  OP2   . DA  I 5 42  ? -33.829 2.745   19.524 1.00 116.72 ? -31  DA  I OP2   1 
ATOM   6925  O  "O5'" . DA  I 5 42  ? -33.121 2.645   17.124 1.00 134.31 ? -31  DA  I "O5'" 1 
ATOM   6926  C  "C5'" . DA  I 5 42  ? -33.333 3.585   16.057 1.00 133.78 ? -31  DA  I "C5'" 1 
ATOM   6927  C  "C4'" . DA  I 5 42  ? -34.713 3.397   15.479 1.00 126.18 ? -31  DA  I "C4'" 1 
ATOM   6928  O  "O4'" . DA  I 5 42  ? -34.962 1.986   15.205 1.00 118.01 ? -31  DA  I "O4'" 1 
ATOM   6929  C  "C3'" . DA  I 5 42  ? -35.866 3.857   16.376 1.00 128.48 ? -31  DA  I "C3'" 1 
ATOM   6930  O  "O3'" . DA  I 5 42  ? -36.783 4.544   15.530 1.00 147.40 ? -31  DA  I "O3'" 1 
ATOM   6931  C  "C2'" . DA  I 5 42  ? -36.437 2.538   16.888 1.00 128.25 ? -31  DA  I "C2'" 1 
ATOM   6932  C  "C1'" . DA  I 5 42  ? -36.261 1.669   15.649 1.00 126.07 ? -31  DA  I "C1'" 1 
ATOM   6933  N  N9    . DA  I 5 42  ? -36.362 0.229   15.874 1.00 129.98 ? -31  DA  I N9    1 
ATOM   6934  C  C8    . DA  I 5 42  ? -36.057 -0.491  17.003 1.00 135.51 ? -31  DA  I C8    1 
ATOM   6935  N  N7    . DA  I 5 42  ? -36.284 -1.776  16.885 1.00 139.60 ? -31  DA  I N7    1 
ATOM   6936  C  C5    . DA  I 5 42  ? -36.789 -1.909  15.599 1.00 130.69 ? -31  DA  I C5    1 
ATOM   6937  C  C6    . DA  I 5 42  ? -37.228 -3.025  14.865 1.00 123.99 ? -31  DA  I C6    1 
ATOM   6938  N  N6    . DA  I 5 42  ? -37.231 -4.270  15.345 1.00 118.56 ? -31  DA  I N6    1 
ATOM   6939  N  N1    . DA  I 5 42  ? -37.668 -2.816  13.605 1.00 128.99 ? -31  DA  I N1    1 
ATOM   6940  C  C2    . DA  I 5 42  ? -37.669 -1.566  13.127 1.00 138.56 ? -31  DA  I C2    1 
ATOM   6941  N  N3    . DA  I 5 42  ? -37.284 -0.437  13.720 1.00 139.04 ? -31  DA  I N3    1 
ATOM   6942  C  C4    . DA  I 5 42  ? -36.848 -0.681  14.968 1.00 129.30 ? -31  DA  I C4    1 
ATOM   6943  P  P     . DA  I 5 43  ? -37.921 5.505   16.127 1.00 145.83 ? -30  DA  I P     1 
ATOM   6944  O  OP1   . DA  I 5 43  ? -37.340 6.858   16.270 1.00 142.32 ? -30  DA  I OP1   1 
ATOM   6945  O  OP2   . DA  I 5 43  ? -38.547 4.836   17.298 1.00 141.56 ? -30  DA  I OP2   1 
ATOM   6946  O  "O5'" . DA  I 5 43  ? -38.996 5.552   14.951 1.00 142.27 ? -30  DA  I "O5'" 1 
ATOM   6947  C  "C5'" . DA  I 5 43  ? -38.920 4.647   13.829 1.00 139.15 ? -30  DA  I "C5'" 1 
ATOM   6948  C  "C4'" . DA  I 5 43  ? -40.216 3.888   13.669 1.00 144.15 ? -30  DA  I "C4'" 1 
ATOM   6949  O  "O4'" . DA  I 5 43  ? -39.994 2.480   13.946 1.00 149.10 ? -30  DA  I "O4'" 1 
ATOM   6950  C  "C3'" . DA  I 5 43  ? -41.386 4.314   14.564 1.00 142.94 ? -30  DA  I "C3'" 1 
ATOM   6951  O  "O3'" . DA  I 5 43  ? -42.566 4.305   13.772 1.00 146.91 ? -30  DA  I "O3'" 1 
ATOM   6952  C  "C2'" . DA  I 5 43  ? -41.446 3.204   15.609 1.00 136.93 ? -30  DA  I "C2'" 1 
ATOM   6953  C  "C1'" . DA  I 5 43  ? -41.040 2.001   14.765 1.00 147.38 ? -30  DA  I "C1'" 1 
ATOM   6954  N  N9    . DA  I 5 43  ? -40.545 0.860   15.532 1.00 154.30 ? -30  DA  I N9    1 
ATOM   6955  C  C8    . DA  I 5 43  ? -39.712 0.878   16.623 1.00 153.48 ? -30  DA  I C8    1 
ATOM   6956  N  N7    . DA  I 5 43  ? -39.440 -0.313  17.100 1.00 152.26 ? -30  DA  I N7    1 
ATOM   6957  C  C5    . DA  I 5 43  ? -40.140 -1.174  16.266 1.00 154.95 ? -30  DA  I C5    1 
ATOM   6958  C  C6    . DA  I 5 43  ? -40.265 -2.574  16.242 1.00 157.88 ? -30  DA  I C6    1 
ATOM   6959  N  N6    . DA  I 5 43  ? -39.662 -3.385  17.114 1.00 159.20 ? -30  DA  I N6    1 
ATOM   6960  N  N1    . DA  I 5 43  ? -41.040 -3.120  15.278 1.00 150.93 ? -30  DA  I N1    1 
ATOM   6961  C  C2    . DA  I 5 43  ? -41.645 -2.305  14.405 1.00 145.60 ? -30  DA  I C2    1 
ATOM   6962  N  N3    . DA  I 5 43  ? -41.604 -0.975  14.325 1.00 151.24 ? -30  DA  I N3    1 
ATOM   6963  C  C4    . DA  I 5 43  ? -40.825 -0.465  15.296 1.00 155.39 ? -30  DA  I C4    1 
ATOM   6964  P  P     . DC  I 5 44  ? -43.844 5.146   14.211 1.00 135.27 ? -29  DC  I P     1 
ATOM   6965  O  OP1   . DC  I 5 44  ? -44.034 6.229   13.211 1.00 130.20 ? -29  DC  I OP1   1 
ATOM   6966  O  OP2   . DC  I 5 44  ? -43.695 5.492   15.647 1.00 138.54 ? -29  DC  I OP2   1 
ATOM   6967  O  "O5'" . DC  I 5 44  ? -45.024 4.084   14.072 1.00 124.11 ? -29  DC  I "O5'" 1 
ATOM   6968  C  "C5'" . DC  I 5 44  ? -45.317 3.490   12.796 1.00 129.23 ? -29  DC  I "C5'" 1 
ATOM   6969  C  "C4'" . DC  I 5 44  ? -45.903 2.109   12.962 1.00 141.80 ? -29  DC  I "C4'" 1 
ATOM   6970  O  "O4'" . DC  I 5 44  ? -44.994 1.249   13.709 1.00 151.71 ? -29  DC  I "O4'" 1 
ATOM   6971  C  "C3'" . DC  I 5 44  ? -47.250 2.011   13.694 1.00 151.61 ? -29  DC  I "C3'" 1 
ATOM   6972  O  "O3'" . DC  I 5 44  ? -48.134 1.203   12.906 1.00 152.63 ? -29  DC  I "O3'" 1 
ATOM   6973  C  "C2'" . DC  I 5 44  ? -46.865 1.338   15.009 1.00 158.02 ? -29  DC  I "C2'" 1 
ATOM   6974  C  "C1'" . DC  I 5 44  ? -45.777 0.398   14.511 1.00 158.84 ? -29  DC  I "C1'" 1 
ATOM   6975  N  N1    . DC  I 5 44  ? -44.954 -0.227  15.557 1.00 159.85 ? -29  DC  I N1    1 
ATOM   6976  C  C2    . DC  I 5 44  ? -44.944 -1.623  15.648 1.00 160.83 ? -29  DC  I C2    1 
ATOM   6977  O  O2    . DC  I 5 44  ? -45.598 -2.282  14.824 1.00 162.01 ? -29  DC  I O2    1 
ATOM   6978  N  N3    . DC  I 5 44  ? -44.220 -2.218  16.624 1.00 152.70 ? -29  DC  I N3    1 
ATOM   6979  C  C4    . DC  I 5 44  ? -43.539 -1.471  17.497 1.00 152.17 ? -29  DC  I C4    1 
ATOM   6980  N  N4    . DC  I 5 44  ? -42.838 -2.095  18.444 1.00 158.44 ? -29  DC  I N4    1 
ATOM   6981  C  C5    . DC  I 5 44  ? -43.548 -0.047  17.438 1.00 154.59 ? -29  DC  I C5    1 
ATOM   6982  C  C6    . DC  I 5 44  ? -44.270 0.529   16.468 1.00 157.03 ? -29  DC  I C6    1 
ATOM   6983  P  P     . DT  I 5 45  ? -49.425 0.466   13.552 1.00 151.35 ? -28  DT  I P     1 
ATOM   6984  O  OP1   . DT  I 5 45  ? -50.390 0.211   12.454 1.00 140.50 ? -28  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I 5 45  ? -49.858 1.241   14.747 1.00 137.80 ? -28  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I 5 45  ? -48.853 -0.950  14.020 1.00 165.93 ? -28  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I 5 45  ? -49.478 -2.196  13.636 1.00 157.71 ? -28  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I 5 45  ? -49.890 -2.982  14.860 1.00 158.88 ? -28  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I 5 45  ? -48.810 -3.047  15.831 1.00 163.16 ? -28  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I 5 45  ? -51.089 -2.411  15.625 1.00 156.30 ? -28  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I 5 45  ? -51.801 -3.493  16.218 1.00 156.07 ? -28  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I 5 45  ? -50.444 -1.731  16.813 1.00 157.30 ? -28  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I 5 45  ? -49.385 -2.773  17.102 1.00 159.15 ? -28  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I 5 45  ? -48.310 -2.425  18.053 1.00 150.29 ? -28  DT  I N1    1 
ATOM   6995  C  C2    . DT  I 5 45  ? -47.576 -3.462  18.582 1.00 143.04 ? -28  DT  I C2    1 
ATOM   6996  O  O2    . DT  I 5 45  ? -47.749 -4.629  18.270 1.00 128.80 ? -28  DT  I O2    1 
ATOM   6997  N  N3    . DT  I 5 45  ? -46.612 -3.079  19.481 1.00 147.51 ? -28  DT  I N3    1 
ATOM   6998  C  C4    . DT  I 5 45  ? -46.329 -1.795  19.907 1.00 147.43 ? -28  DT  I C4    1 
ATOM   6999  O  O4    . DT  I 5 45  ? -45.429 -1.605  20.719 1.00 149.43 ? -28  DT  I O4    1 
ATOM   7000  C  C5    . DT  I 5 45  ? -47.156 -0.759  19.333 1.00 147.51 ? -28  DT  I C5    1 
ATOM   7001  C  C7    . DT  I 5 45  ? -46.921 0.664   19.733 1.00 142.16 ? -28  DT  I C7    1 
ATOM   7002  C  C6    . DT  I 5 45  ? -48.100 -1.122  18.453 1.00 149.03 ? -28  DT  I C6    1 
ATOM   7003  P  P     . DG  I 5 46  ? -53.171 -3.987  15.625 1.00 145.67 ? -27  DG  I P     1 
ATOM   7004  O  OP1   . DG  I 5 46  ? -53.363 -3.329  14.311 1.00 151.00 ? -27  DG  I OP1   1 
ATOM   7005  O  OP2   . DG  I 5 46  ? -54.191 -3.825  16.692 1.00 131.61 ? -27  DG  I OP2   1 
ATOM   7006  O  "O5'" . DG  I 5 46  ? -52.922 -5.543  15.371 1.00 137.45 ? -27  DG  I "O5'" 1 
ATOM   7007  C  "C5'" . DG  I 5 46  ? -51.642 -6.171  15.606 1.00 138.68 ? -27  DG  I "C5'" 1 
ATOM   7008  C  "C4'" . DG  I 5 46  ? -51.751 -7.323  16.591 1.00 142.37 ? -27  DG  I "C4'" 1 
ATOM   7009  O  "O4'" . DG  I 5 46  ? -50.940 -7.032  17.764 1.00 142.26 ? -27  DG  I "O4'" 1 
ATOM   7010  C  "C3'" . DG  I 5 46  ? -53.124 -7.672  17.157 1.00 142.13 ? -27  DG  I "C3'" 1 
ATOM   7011  O  "O3'" . DG  I 5 46  ? -53.054 -9.060  17.501 1.00 136.53 ? -27  DG  I "O3'" 1 
ATOM   7012  C  "C2'" . DG  I 5 46  ? -53.213 -6.743  18.365 1.00 138.48 ? -27  DG  I "C2'" 1 
ATOM   7013  C  "C1'" . DG  I 5 46  ? -51.779 -6.821  18.889 1.00 142.06 ? -27  DG  I "C1'" 1 
ATOM   7014  N  N9    . DG  I 5 46  ? -51.296 -5.638  19.594 1.00 149.85 ? -27  DG  I N9    1 
ATOM   7015  C  C8    . DG  I 5 46  ? -51.701 -4.334  19.438 1.00 155.26 ? -27  DG  I C8    1 
ATOM   7016  N  N7    . DG  I 5 46  ? -51.046 -3.501  20.201 1.00 145.57 ? -27  DG  I N7    1 
ATOM   7017  C  C5    . DG  I 5 46  ? -50.148 -4.302  20.892 1.00 135.64 ? -27  DG  I C5    1 
ATOM   7018  C  C6    . DG  I 5 46  ? -49.175 -3.965  21.869 1.00 130.48 ? -27  DG  I C6    1 
ATOM   7019  O  O6    . DG  I 5 46  ? -48.899 -2.852  22.334 1.00 120.21 ? -27  DG  I O6    1 
ATOM   7020  N  N1    . DG  I 5 46  ? -48.488 -5.089  22.313 1.00 138.73 ? -27  DG  I N1    1 
ATOM   7021  C  C2    . DG  I 5 46  ? -48.704 -6.372  21.875 1.00 138.12 ? -27  DG  I C2    1 
ATOM   7022  N  N2    . DG  I 5 46  ? -47.939 -7.326  22.422 1.00 140.33 ? -27  DG  I N2    1 
ATOM   7023  N  N3    . DG  I 5 46  ? -49.605 -6.698  20.966 1.00 138.29 ? -27  DG  I N3    1 
ATOM   7024  C  C4    . DG  I 5 46  ? -50.285 -5.622  20.521 1.00 142.76 ? -27  DG  I C4    1 
ATOM   7025  P  P     . DC  I 5 47  ? -54.367 -9.893  17.928 1.00 135.53 ? -26  DC  I P     1 
ATOM   7026  O  OP1   . DC  I 5 47  ? -54.394 -11.155 17.129 1.00 112.58 ? -26  DC  I OP1   1 
ATOM   7027  O  OP2   . DC  I 5 47  ? -55.529 -8.964  17.955 1.00 121.22 ? -26  DC  I OP2   1 
ATOM   7028  O  "O5'" . DC  I 5 47  ? -54.073 -10.298 19.440 1.00 142.42 ? -26  DC  I "O5'" 1 
ATOM   7029  C  "C5'" . DC  I 5 47  ? -52.980 -11.175 19.774 1.00 131.63 ? -26  DC  I "C5'" 1 
ATOM   7030  C  "C4'" . DC  I 5 47  ? -52.685 -11.068 21.246 1.00 117.88 ? -26  DC  I "C4'" 1 
ATOM   7031  O  "O4'" . DC  I 5 47  ? -52.293 -9.705  21.555 1.00 118.72 ? -26  DC  I "O4'" 1 
ATOM   7032  C  "C3'" . DC  I 5 47  ? -53.857 -11.395 22.171 1.00 115.72 ? -26  DC  I "C3'" 1 
ATOM   7033  O  "O3'" . DC  I 5 47  ? -53.439 -12.286 23.191 1.00 120.68 ? -26  DC  I "O3'" 1 
ATOM   7034  C  "C2'" . DC  I 5 47  ? -54.255 -10.044 22.760 1.00 118.50 ? -26  DC  I "C2'" 1 
ATOM   7035  C  "C1'" . DC  I 5 47  ? -52.921 -9.306  22.752 1.00 122.36 ? -26  DC  I "C1'" 1 
ATOM   7036  N  N1    . DC  I 5 47  ? -53.030 -7.839  22.758 1.00 120.49 ? -26  DC  I N1    1 
ATOM   7037  C  C2    . DC  I 5 47  ? -51.939 -7.085  23.197 1.00 127.59 ? -26  DC  I C2    1 
ATOM   7038  O  O2    . DC  I 5 47  ? -50.913 -7.673  23.568 1.00 128.59 ? -26  DC  I O2    1 
ATOM   7039  N  N3    . DC  I 5 47  ? -52.029 -5.735  23.207 1.00 129.91 ? -26  DC  I N3    1 
ATOM   7040  C  C4    . DC  I 5 47  ? -53.149 -5.140  22.793 1.00 123.02 ? -26  DC  I C4    1 
ATOM   7041  N  N4    . DC  I 5 47  ? -53.193 -3.808  22.816 1.00 123.12 ? -26  DC  I N4    1 
ATOM   7042  C  C5    . DC  I 5 47  ? -54.273 -5.884  22.336 1.00 128.90 ? -26  DC  I C5    1 
ATOM   7043  C  C6    . DC  I 5 47  ? -54.172 -7.219  22.335 1.00 127.50 ? -26  DC  I C6    1 
ATOM   7044  P  P     . DT  I 5 48  ? -53.864 -13.820 23.130 1.00 123.76 ? -25  DT  I P     1 
ATOM   7045  O  OP1   . DT  I 5 48  ? -53.301 -14.417 21.888 1.00 111.06 ? -25  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I 5 48  ? -55.317 -13.901 23.415 1.00 141.06 ? -25  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I 5 48  ? -53.135 -14.442 24.397 1.00 123.97 ? -25  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I 5 48  ? -53.081 -13.709 25.625 1.00 118.25 ? -25  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I 5 48  ? -51.652 -13.331 25.942 1.00 107.37 ? -25  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I 5 48  ? -51.449 -11.924 25.666 1.00 98.59  ? -25  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I 5 48  ? -51.308 -13.512 27.417 1.00 109.89 ? -25  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I 5 48  ? -49.938 -13.880 27.638 1.00 104.22 ? -25  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I 5 48  ? -51.701 -12.175 28.008 1.00 110.39 ? -25  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I 5 48  ? -51.369 -11.195 26.892 1.00 112.52 ? -25  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I 5 48  ? -52.297 -10.036 26.823 1.00 120.53 ? -25  DT  I N1    1 
ATOM   7056  C  C2    . DT  I 5 48  ? -51.793 -8.795  27.144 1.00 119.76 ? -25  DT  I C2    1 
ATOM   7057  O  O2    . DT  I 5 48  ? -50.628 -8.608  27.444 1.00 139.88 ? -25  DT  I O2    1 
ATOM   7058  N  N3    . DT  I 5 48  ? -52.705 -7.772  27.084 1.00 122.15 ? -25  DT  I N3    1 
ATOM   7059  C  C4    . DT  I 5 48  ? -54.043 -7.866  26.762 1.00 132.76 ? -25  DT  I C4    1 
ATOM   7060  O  O4    . DT  I 5 48  ? -54.740 -6.855  26.758 1.00 136.46 ? -25  DT  I O4    1 
ATOM   7061  C  C5    . DT  I 5 48  ? -54.512 -9.202  26.454 1.00 133.94 ? -25  DT  I C5    1 
ATOM   7062  C  C7    . DT  I 5 48  ? -55.951 -9.405  26.099 1.00 135.32 ? -25  DT  I C7    1 
ATOM   7063  C  C6    . DT  I 5 48  ? -53.629 -10.207 26.513 1.00 126.62 ? -25  DT  I C6    1 
ATOM   7064  P  P     . DC  I 5 49  ? -49.543 -14.871 28.851 1.00 93.09  ? -24  DC  I P     1 
ATOM   7065  O  OP1   . DC  I 5 49  ? -48.243 -15.510 28.508 1.00 79.11  ? -24  DC  I OP1   1 
ATOM   7066  O  OP2   . DC  I 5 49  ? -50.721 -15.715 29.169 1.00 82.04  ? -24  DC  I OP2   1 
ATOM   7067  O  "O5'" . DC  I 5 49  ? -49.377 -13.887 30.092 1.00 84.47  ? -24  DC  I "O5'" 1 
ATOM   7068  C  "C5'" . DC  I 5 49  ? -48.670 -12.646 29.954 1.00 84.02  ? -24  DC  I "C5'" 1 
ATOM   7069  C  "C4'" . DC  I 5 49  ? -49.111 -11.688 31.027 1.00 94.40  ? -24  DC  I "C4'" 1 
ATOM   7070  O  "O4'" . DC  I 5 49  ? -50.252 -10.896 30.573 1.00 111.68 ? -24  DC  I "O4'" 1 
ATOM   7071  C  "C3'" . DC  I 5 49  ? -49.569 -12.327 32.333 1.00 96.49  ? -24  DC  I "C3'" 1 
ATOM   7072  O  "O3'" . DC  I 5 49  ? -49.264 -11.389 33.348 1.00 100.88 ? -24  DC  I "O3'" 1 
ATOM   7073  C  "C2'" . DC  I 5 49  ? -51.082 -12.321 32.189 1.00 105.93 ? -24  DC  I "C2'" 1 
ATOM   7074  C  "C1'" . DC  I 5 49  ? -51.264 -10.944 31.563 1.00 112.06 ? -24  DC  I "C1'" 1 
ATOM   7075  N  N1    . DC  I 5 49  ? -52.576 -10.653 30.954 1.00 121.05 ? -24  DC  I N1    1 
ATOM   7076  C  C2    . DC  I 5 49  ? -52.978 -9.316  30.861 1.00 119.88 ? -24  DC  I C2    1 
ATOM   7077  O  O2    . DC  I 5 49  ? -52.212 -8.430  31.270 1.00 100.34 ? -24  DC  I O2    1 
ATOM   7078  N  N3    . DC  I 5 49  ? -54.187 -9.024  30.328 1.00 128.55 ? -24  DC  I N3    1 
ATOM   7079  C  C4    . DC  I 5 49  ? -54.982 -10.006 29.900 1.00 125.36 ? -24  DC  I C4    1 
ATOM   7080  N  N4    . DC  I 5 49  ? -56.161 -9.669  29.376 1.00 125.28 ? -24  DC  I N4    1 
ATOM   7081  C  C5    . DC  I 5 49  ? -54.601 -11.378 29.989 1.00 125.13 ? -24  DC  I C5    1 
ATOM   7082  C  C6    . DC  I 5 49  ? -53.407 -11.655 30.531 1.00 122.19 ? -24  DC  I C6    1 
ATOM   7083  P  P     . DC  I 5 50  ? -47.949 -11.547 34.186 1.00 88.99  ? -23  DC  I P     1 
ATOM   7084  O  OP1   . DC  I 5 50  ? -46.800 -11.520 33.246 1.00 88.52  ? -23  DC  I OP1   1 
ATOM   7085  O  OP2   . DC  I 5 50  ? -48.148 -12.705 35.093 1.00 92.19  ? -23  DC  I OP2   1 
ATOM   7086  O  "O5'" . DC  I 5 50  ? -47.907 -10.191 35.016 1.00 84.06  ? -23  DC  I "O5'" 1 
ATOM   7087  C  "C5'" . DC  I 5 50  ? -47.324 -9.004  34.441 1.00 86.74  ? -23  DC  I "C5'" 1 
ATOM   7088  C  "C4'" . DC  I 5 50  ? -48.130 -7.815  34.869 1.00 84.32  ? -23  DC  I "C4'" 1 
ATOM   7089  O  "O4'" . DC  I 5 50  ? -49.432 -7.889  34.226 1.00 96.75  ? -23  DC  I "O4'" 1 
ATOM   7090  C  "C3'" . DC  I 5 50  ? -48.399 -7.769  36.368 1.00 82.45  ? -23  DC  I "C3'" 1 
ATOM   7091  O  "O3'" . DC  I 5 50  ? -48.052 -6.490  36.873 1.00 80.96  ? -23  DC  I "O3'" 1 
ATOM   7092  C  "C2'" . DC  I 5 50  ? -49.884 -8.127  36.480 1.00 89.39  ? -23  DC  I "C2'" 1 
ATOM   7093  C  "C1'" . DC  I 5 50  ? -50.428 -7.571  35.168 1.00 99.55  ? -23  DC  I "C1'" 1 
ATOM   7094  N  N1    . DC  I 5 50  ? -51.703 -8.158  34.716 1.00 106.76 ? -23  DC  I N1    1 
ATOM   7095  C  C2    . DC  I 5 50  ? -52.742 -7.312  34.301 1.00 104.46 ? -23  DC  I C2    1 
ATOM   7096  O  O2    . DC  I 5 50  ? -52.572 -6.085  34.339 1.00 100.36 ? -23  DC  I O2    1 
ATOM   7097  N  N3    . DC  I 5 50  ? -53.905 -7.855  33.876 1.00 105.67 ? -23  DC  I N3    1 
ATOM   7098  C  C4    . DC  I 5 50  ? -54.054 -9.181  33.855 1.00 111.04 ? -23  DC  I C4    1 
ATOM   7099  N  N4    . DC  I 5 50  ? -55.218 -9.672  33.424 1.00 119.77 ? -23  DC  I N4    1 
ATOM   7100  C  C5    . DC  I 5 50  ? -53.013 -10.063 34.264 1.00 114.52 ? -23  DC  I C5    1 
ATOM   7101  C  C6    . DC  I 5 50  ? -51.864 -9.515  34.683 1.00 105.44 ? -23  DC  I C6    1 
ATOM   7102  P  P     . DA  I 5 51  ? -47.885 -6.280  38.454 1.00 83.69  ? -22  DA  I P     1 
ATOM   7103  O  OP1   . DA  I 5 51  ? -46.548 -5.682  38.694 1.00 83.96  ? -22  DA  I OP1   1 
ATOM   7104  O  OP2   . DA  I 5 51  ? -48.292 -7.546  39.125 1.00 80.16  ? -22  DA  I OP2   1 
ATOM   7105  O  "O5'" . DA  I 5 51  ? -48.936 -5.134  38.819 1.00 98.46  ? -22  DA  I "O5'" 1 
ATOM   7106  C  "C5'" . DA  I 5 51  ? -48.949 -3.887  38.087 1.00 98.68  ? -22  DA  I "C5'" 1 
ATOM   7107  C  "C4'" . DA  I 5 51  ? -50.139 -3.014  38.444 1.00 91.16  ? -22  DA  I "C4'" 1 
ATOM   7108  O  "O4'" . DA  I 5 51  ? -51.341 -3.512  37.810 1.00 89.40  ? -22  DA  I "O4'" 1 
ATOM   7109  C  "C3'" . DA  I 5 51  ? -50.472 -2.849  39.925 1.00 89.97  ? -22  DA  I "C3'" 1 
ATOM   7110  O  "O3'" . DA  I 5 51  ? -50.779 -1.470  40.108 1.00 98.17  ? -22  DA  I "O3'" 1 
ATOM   7111  C  "C2'" . DA  I 5 51  ? -51.607 -3.845  40.143 1.00 86.69  ? -22  DA  I "C2'" 1 
ATOM   7112  C  "C1'" . DA  I 5 51  ? -52.311 -3.828  38.789 1.00 98.49  ? -22  DA  I "C1'" 1 
ATOM   7113  N  N9    . DA  I 5 51  ? -52.870 -5.125  38.432 1.00 113.35 ? -22  DA  I N9    1 
ATOM   7114  C  C8    . DA  I 5 51  ? -52.237 -6.335  38.564 1.00 117.86 ? -22  DA  I C8    1 
ATOM   7115  N  N7    . DA  I 5 51  ? -52.936 -7.348  38.114 1.00 128.41 ? -22  DA  I N7    1 
ATOM   7116  C  C5    . DA  I 5 51  ? -54.101 -6.765  37.638 1.00 124.94 ? -22  DA  I C5    1 
ATOM   7117  C  C6    . DA  I 5 51  ? -55.247 -7.307  37.039 1.00 124.25 ? -22  DA  I C6    1 
ATOM   7118  N  N6    . DA  I 5 51  ? -55.412 -8.610  36.808 1.00 121.43 ? -22  DA  I N6    1 
ATOM   7119  N  N1    . DA  I 5 51  ? -56.235 -6.454  36.685 1.00 136.98 ? -22  DA  I N1    1 
ATOM   7120  C  C2    . DA  I 5 51  ? -56.066 -5.146  36.919 1.00 138.81 ? -22  DA  I C2    1 
ATOM   7121  N  N3    . DA  I 5 51  ? -55.032 -4.517  37.478 1.00 136.54 ? -22  DA  I N3    1 
ATOM   7122  C  C4    . DA  I 5 51  ? -54.072 -5.395  37.820 1.00 130.63 ? -22  DA  I C4    1 
ATOM   7123  P  P     . DT  I 5 52  ? -51.403 -0.915  41.490 1.00 115.60 ? -21  DT  I P     1 
ATOM   7124  O  OP1   . DT  I 5 52  ? -51.112 0.538   41.576 1.00 114.16 ? -21  DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I 5 52  ? -50.995 -1.798  42.608 1.00 103.70 ? -21  DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I 5 52  ? -52.962 -1.125  41.256 1.00 118.83 ? -21  DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I 5 52  ? -53.637 -0.530  40.135 1.00 109.51 ? -21  DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I 5 52  ? -55.118 -0.763  40.294 1.00 119.12 ? -21  DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I 5 52  ? -55.436 -2.096  39.832 1.00 121.17 ? -21  DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I 5 52  ? -55.596 -0.687  41.749 1.00 130.11 ? -21  DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I 5 52  ? -56.687 0.228   41.889 1.00 137.02 ? -21  DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I 5 52  ? -55.977 -2.117  42.095 1.00 119.20 ? -21  DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I 5 52  ? -56.337 -2.693  40.742 1.00 118.48 ? -21  DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I 5 52  ? -56.198 -4.150  40.622 1.00 118.27 ? -21  DT  I N1    1 
ATOM   7135  C  C2    . DT  I 5 52  ? -57.157 -4.844  39.918 1.00 125.77 ? -21  DT  I C2    1 
ATOM   7136  O  O2    . DT  I 5 52  ? -58.112 -4.306  39.384 1.00 127.16 ? -21  DT  I O2    1 
ATOM   7137  N  N3    . DT  I 5 52  ? -56.950 -6.199  39.851 1.00 133.03 ? -21  DT  I N3    1 
ATOM   7138  C  C4    . DT  I 5 52  ? -55.904 -6.912  40.406 1.00 134.01 ? -21  DT  I C4    1 
ATOM   7139  O  O4    . DT  I 5 52  ? -55.847 -8.130  40.255 1.00 123.13 ? -21  DT  I O4    1 
ATOM   7140  C  C5    . DT  I 5 52  ? -54.932 -6.119  41.131 1.00 122.10 ? -21  DT  I C5    1 
ATOM   7141  C  C7    . DT  I 5 52  ? -53.765 -6.802  41.770 1.00 104.66 ? -21  DT  I C7    1 
ATOM   7142  C  C6    . DT  I 5 52  ? -55.125 -4.796  41.198 1.00 124.13 ? -21  DT  I C6    1 
ATOM   7143  P  P     . DC  I 5 53  ? -57.184 0.673   43.349 1.00 132.24 ? -20  DC  I P     1 
ATOM   7144  O  OP1   . DC  I 5 53  ? -57.370 2.142   43.324 1.00 137.21 ? -20  DC  I OP1   1 
ATOM   7145  O  OP2   . DC  I 5 53  ? -56.275 0.083   44.369 1.00 127.38 ? -20  DC  I OP2   1 
ATOM   7146  O  "O5'" . DC  I 5 53  ? -58.578 -0.089  43.479 1.00 129.48 ? -20  DC  I "O5'" 1 
ATOM   7147  C  "C5'" . DC  I 5 53  ? -59.316 -0.499  42.308 1.00 134.14 ? -20  DC  I "C5'" 1 
ATOM   7148  C  "C4'" . DC  I 5 53  ? -60.453 -1.426  42.683 1.00 140.90 ? -20  DC  I "C4'" 1 
ATOM   7149  O  "O4'" . DC  I 5 53  ? -60.074 -2.806  42.407 1.00 136.95 ? -20  DC  I "O4'" 1 
ATOM   7150  C  "C3'" . DC  I 5 53  ? -60.886 -1.406  44.148 1.00 151.42 ? -20  DC  I "C3'" 1 
ATOM   7151  O  "O3'" . DC  I 5 53  ? -62.284 -1.635  44.263 1.00 163.76 ? -20  DC  I "O3'" 1 
ATOM   7152  C  "C2'" . DC  I 5 53  ? -60.156 -2.608  44.724 1.00 140.81 ? -20  DC  I "C2'" 1 
ATOM   7153  C  "C1'" . DC  I 5 53  ? -60.298 -3.587  43.564 1.00 145.76 ? -20  DC  I "C1'" 1 
ATOM   7154  N  N1    . DC  I 5 53  ? -59.341 -4.704  43.590 1.00 152.77 ? -20  DC  I N1    1 
ATOM   7155  C  C2    . DC  I 5 53  ? -59.546 -5.792  42.735 1.00 149.87 ? -20  DC  I C2    1 
ATOM   7156  O  O2    . DC  I 5 53  ? -60.508 -5.767  41.954 1.00 147.96 ? -20  DC  I O2    1 
ATOM   7157  N  N3    . DC  I 5 53  ? -58.686 -6.837  42.776 1.00 143.37 ? -20  DC  I N3    1 
ATOM   7158  C  C4    . DC  I 5 53  ? -57.662 -6.823  43.635 1.00 138.10 ? -20  DC  I C4    1 
ATOM   7159  N  N4    . DC  I 5 53  ? -56.833 -7.868  43.641 1.00 139.22 ? -20  DC  I N4    1 
ATOM   7160  C  C5    . DC  I 5 53  ? -57.436 -5.731  44.521 1.00 135.60 ? -20  DC  I C5    1 
ATOM   7161  C  C6    . DC  I 5 53  ? -58.294 -4.705  44.470 1.00 144.90 ? -20  DC  I C6    1 
ATOM   7162  P  P     . DA  I 5 54  ? -63.105 -0.953  45.444 1.00 156.91 ? -19  DA  I P     1 
ATOM   7163  O  OP1   . DA  I 5 54  ? -63.497 0.403   44.987 1.00 142.16 ? -19  DA  I OP1   1 
ATOM   7164  O  OP2   . DA  I 5 54  ? -62.315 -1.111  46.696 1.00 143.95 ? -19  DA  I OP2   1 
ATOM   7165  O  "O5'" . DA  I 5 54  ? -64.408 -1.861  45.544 1.00 140.88 ? -19  DA  I "O5'" 1 
ATOM   7166  C  "C5'" . DA  I 5 54  ? -65.210 -2.130  44.383 1.00 150.79 ? -19  DA  I "C5'" 1 
ATOM   7167  C  "C4'" . DA  I 5 54  ? -65.732 -3.540  44.457 1.00 163.12 ? -19  DA  I "C4'" 1 
ATOM   7168  O  "O4'" . DA  I 5 54  ? -64.615 -4.468  44.341 1.00 169.73 ? -19  DA  I "O4'" 1 
ATOM   7169  C  "C3'" . DA  I 5 54  ? -66.445 -3.893  45.766 1.00 170.57 ? -19  DA  I "C3'" 1 
ATOM   7170  O  "O3'" . DA  I 5 54  ? -67.604 -4.688  45.526 1.00 173.71 ? -19  DA  I "O3'" 1 
ATOM   7171  C  "C2'" . DA  I 5 54  ? -65.374 -4.656  46.536 1.00 179.16 ? -19  DA  I "C2'" 1 
ATOM   7172  C  "C1'" . DA  I 5 54  ? -64.674 -5.398  45.402 1.00 176.63 ? -19  DA  I "C1'" 1 
ATOM   7173  N  N9    . DA  I 5 54  ? -63.316 -5.824  45.742 1.00 170.20 ? -19  DA  I N9    1 
ATOM   7174  C  C8    . DA  I 5 54  ? -62.323 -5.085  46.338 1.00 148.63 ? -19  DA  I C8    1 
ATOM   7175  N  N7    . DA  I 5 54  ? -61.214 -5.754  46.538 1.00 133.80 ? -19  DA  I N7    1 
ATOM   7176  C  C5    . DA  I 5 54  ? -61.501 -7.024  46.057 1.00 146.14 ? -19  DA  I C5    1 
ATOM   7177  C  C6    . DA  I 5 54  ? -60.735 -8.198  45.981 1.00 141.03 ? -19  DA  I C6    1 
ATOM   7178  N  N6    . DA  I 5 54  ? -59.474 -8.281  46.407 1.00 137.76 ? -19  DA  I N6    1 
ATOM   7179  N  N1    . DA  I 5 54  ? -61.317 -9.295  45.447 1.00 150.52 ? -19  DA  I N1    1 
ATOM   7180  C  C2    . DA  I 5 54  ? -62.585 -9.206  45.021 1.00 154.78 ? -19  DA  I C2    1 
ATOM   7181  N  N3    . DA  I 5 54  ? -63.406 -8.156  45.037 1.00 163.35 ? -19  DA  I N3    1 
ATOM   7182  C  C4    . DA  I 5 54  ? -62.794 -7.084  45.572 1.00 163.89 ? -19  DA  I C4    1 
ATOM   7183  P  P     . DA  I 5 55  ? -68.524 -5.195  46.749 1.00 172.06 ? -18  DA  I P     1 
ATOM   7184  O  OP1   . DA  I 5 55  ? -69.934 -5.180  46.287 1.00 173.48 ? -18  DA  I OP1   1 
ATOM   7185  O  OP2   . DA  I 5 55  ? -68.155 -4.424  47.970 1.00 133.96 ? -18  DA  I OP2   1 
ATOM   7186  O  "O5'" . DA  I 5 55  ? -68.081 -6.719  46.927 1.00 176.70 ? -18  DA  I "O5'" 1 
ATOM   7187  C  "C5'" . DA  I 5 55  ? -68.651 -7.775  46.114 1.00 175.97 ? -18  DA  I "C5'" 1 
ATOM   7188  C  "C4'" . DA  I 5 55  ? -68.166 -9.136  46.568 1.00 173.88 ? -18  DA  I "C4'" 1 
ATOM   7189  O  "O4'" . DA  I 5 55  ? -66.722 -9.098  46.774 1.00 181.43 ? -18  DA  I "O4'" 1 
ATOM   7190  C  "C3'" . DA  I 5 55  ? -68.746 -9.647  47.887 1.00 167.47 ? -18  DA  I "C3'" 1 
ATOM   7191  O  "O3'" . DA  I 5 55  ? -68.819 -11.072 47.840 1.00 162.60 ? -18  DA  I "O3'" 1 
ATOM   7192  C  "C2'" . DA  I 5 55  ? -67.711 -9.164  48.893 1.00 167.18 ? -18  DA  I "C2'" 1 
ATOM   7193  C  "C1'" . DA  I 5 55  ? -66.429 -9.450  48.115 1.00 177.46 ? -18  DA  I "C1'" 1 
ATOM   7194  N  N9    . DA  I 5 55  ? -65.251 -8.697  48.549 1.00 169.37 ? -18  DA  I N9    1 
ATOM   7195  C  C8    . DA  I 5 55  ? -65.169 -7.383  48.937 1.00 155.02 ? -18  DA  I C8    1 
ATOM   7196  N  N7    . DA  I 5 55  ? -63.957 -7.001  49.257 1.00 140.57 ? -18  DA  I N7    1 
ATOM   7197  C  C5    . DA  I 5 55  ? -63.188 -8.141  49.071 1.00 143.81 ? -18  DA  I C5    1 
ATOM   7198  C  C6    . DA  I 5 55  ? -61.817 -8.396  49.240 1.00 122.65 ? -18  DA  I C6    1 
ATOM   7199  N  N6    . DA  I 5 55  ? -60.940 -7.481  49.653 1.00 118.41 ? -18  DA  I N6    1 
ATOM   7200  N  N1    . DA  I 5 55  ? -61.372 -9.640  48.966 1.00 130.21 ? -18  DA  I N1    1 
ATOM   7201  C  C2    . DA  I 5 55  ? -62.252 -10.559 48.548 1.00 141.59 ? -18  DA  I C2    1 
ATOM   7202  N  N3    . DA  I 5 55  ? -63.561 -10.441 48.349 1.00 145.93 ? -18  DA  I N3    1 
ATOM   7203  C  C4    . DA  I 5 55  ? -63.972 -9.193  48.632 1.00 156.94 ? -18  DA  I C4    1 
ATOM   7204  P  P     . DA  I 5 56  ? -69.793 -11.870 48.836 1.00 166.86 ? -17  DA  I P     1 
ATOM   7205  O  OP1   . DA  I 5 56  ? -71.155 -11.849 48.254 1.00 178.59 ? -17  DA  I OP1   1 
ATOM   7206  O  OP2   . DA  I 5 56  ? -69.575 -11.355 50.216 1.00 152.53 ? -17  DA  I OP2   1 
ATOM   7207  O  "O5'" . DA  I 5 56  ? -69.283 -13.381 48.756 1.00 164.87 ? -17  DA  I "O5'" 1 
ATOM   7208  C  "C5'" . DA  I 5 56  ? -68.163 -13.791 47.939 1.00 165.49 ? -17  DA  I "C5'" 1 
ATOM   7209  C  "C4'" . DA  I 5 56  ? -67.062 -14.432 48.769 1.00 161.67 ? -17  DA  I "C4'" 1 
ATOM   7210  O  "O4'" . DA  I 5 56  ? -66.033 -13.447 49.053 1.00 160.21 ? -17  DA  I "O4'" 1 
ATOM   7211  C  "C3'" . DA  I 5 56  ? -67.453 -15.061 50.117 1.00 164.01 ? -17  DA  I "C3'" 1 
ATOM   7212  O  "O3'" . DA  I 5 56  ? -67.059 -16.440 50.167 1.00 151.59 ? -17  DA  I "O3'" 1 
ATOM   7213  C  "C2'" . DA  I 5 56  ? -66.756 -14.171 51.152 1.00 166.44 ? -17  DA  I "C2'" 1 
ATOM   7214  C  "C1'" . DA  I 5 56  ? -65.561 -13.646 50.364 1.00 160.72 ? -17  DA  I "C1'" 1 
ATOM   7215  N  N9    . DA  I 5 56  ? -65.061 -12.375 50.882 1.00 146.85 ? -17  DA  I N9    1 
ATOM   7216  C  C8    . DA  I 5 56  ? -65.771 -11.232 51.156 1.00 144.55 ? -17  DA  I C8    1 
ATOM   7217  N  N7    . DA  I 5 56  ? -65.037 -10.257 51.633 1.00 139.88 ? -17  DA  I N7    1 
ATOM   7218  C  C5    . DA  I 5 56  ? -63.761 -10.798 51.690 1.00 138.06 ? -17  DA  I C5    1 
ATOM   7219  C  C6    . DA  I 5 56  ? -62.530 -10.273 52.115 1.00 134.38 ? -17  DA  I C6    1 
ATOM   7220  N  N6    . DA  I 5 56  ? -62.374 -9.033  52.578 1.00 138.39 ? -17  DA  I N6    1 
ATOM   7221  N  N1    . DA  I 5 56  ? -61.448 -11.079 52.049 1.00 139.58 ? -17  DA  I N1    1 
ATOM   7222  C  C2    . DA  I 5 56  ? -61.602 -12.325 51.581 1.00 135.32 ? -17  DA  I C2    1 
ATOM   7223  N  N3    . DA  I 5 56  ? -62.707 -12.932 51.158 1.00 129.96 ? -17  DA  I N3    1 
ATOM   7224  C  C4    . DA  I 5 56  ? -63.763 -12.104 51.237 1.00 138.44 ? -17  DA  I C4    1 
ATOM   7225  P  P     . DA  I 5 57  ? -67.006 -17.258 51.568 1.00 146.83 ? -16  DA  I P     1 
ATOM   7226  O  OP1   . DA  I 5 57  ? -67.383 -18.673 51.304 1.00 130.45 ? -16  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I 5 57  ? -67.708 -16.477 52.626 1.00 145.21 ? -16  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I 5 57  ? -65.453 -17.250 51.913 1.00 167.81 ? -16  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I 5 57  ? -64.481 -17.654 50.929 1.00 156.84 ? -16  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I 5 57  ? -63.114 -17.734 51.561 1.00 138.85 ? -16  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I 5 57  ? -62.687 -16.395 51.932 1.00 124.57 ? -16  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I 5 57  ? -63.027 -18.584 52.833 1.00 137.55 ? -16  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I 5 57  ? -61.837 -19.370 52.788 1.00 137.84 ? -16  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I 5 57  ? -63.066 -17.540 53.948 1.00 130.28 ? -16  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I 5 57  ? -62.323 -16.378 53.295 1.00 130.34 ? -16  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I 5 57  ? -62.662 -15.068 53.841 1.00 132.95 ? -16  DA  I N9    1 
ATOM   7237  C  C8    . DA  I 5 57  ? -63.904 -14.507 54.006 1.00 143.58 ? -16  DA  I C8    1 
ATOM   7238  N  N7    . DA  I 5 57  ? -63.874 -13.300 54.517 1.00 152.27 ? -16  DA  I N7    1 
ATOM   7239  C  C5    . DA  I 5 57  ? -62.522 -13.049 54.700 1.00 138.16 ? -16  DA  I C5    1 
ATOM   7240  C  C6    . DA  I 5 57  ? -61.824 -11.935 55.203 1.00 128.70 ? -16  DA  I C6    1 
ATOM   7241  N  N6    . DA  I 5 57  ? -62.417 -10.824 55.640 1.00 128.70 ? -16  DA  I N6    1 
ATOM   7242  N  N1    . DA  I 5 57  ? -60.477 -12.008 55.251 1.00 132.59 ? -16  DA  I N1    1 
ATOM   7243  C  C2    . DA  I 5 57  ? -59.879 -13.121 54.809 1.00 143.90 ? -16  DA  I C2    1 
ATOM   7244  N  N3    . DA  I 5 57  ? -60.425 -14.229 54.310 1.00 145.81 ? -16  DA  I N3    1 
ATOM   7245  C  C4    . DA  I 5 57  ? -61.764 -14.128 54.285 1.00 139.00 ? -16  DA  I C4    1 
ATOM   7246  P  P     . DG  I 5 58  ? -61.571 -20.531 53.865 1.00 140.95 ? -15  DG  I P     1 
ATOM   7247  O  OP1   . DG  I 5 58  ? -61.508 -21.824 53.124 1.00 105.20 ? -15  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I 5 58  ? -62.525 -20.359 55.005 1.00 127.57 ? -15  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I 5 58  ? -60.128 -20.153 54.431 1.00 137.98 ? -15  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I 5 58  ? -59.707 -18.774 54.549 1.00 125.74 ? -15  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I 5 58  ? -58.842 -18.550 55.773 1.00 129.25 ? -15  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I 5 58  ? -59.108 -17.217 56.299 1.00 124.25 ? -15  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I 5 58  ? -59.077 -19.479 56.960 1.00 130.02 ? -15  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I 5 58  ? -57.962 -19.514 57.859 1.00 123.67 ? -15  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I 5 58  ? -60.235 -18.781 57.661 1.00 134.74 ? -15  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I 5 58  ? -59.801 -17.321 57.530 1.00 130.79 ? -15  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I 5 58  ? -60.883 -16.340 57.532 1.00 138.75 ? -15  DG  I N9    1 
ATOM   7258  C  C8    . DG  I 5 58  ? -62.207 -16.532 57.212 1.00 135.95 ? -15  DG  I C8    1 
ATOM   7259  N  N7    . DG  I 5 58  ? -62.918 -15.441 57.304 1.00 125.88 ? -15  DG  I N7    1 
ATOM   7260  C  C5    . DG  I 5 58  ? -62.011 -14.473 57.713 1.00 133.14 ? -15  DG  I C5    1 
ATOM   7261  C  C6    . DG  I 5 58  ? -62.197 -13.093 57.986 1.00 132.69 ? -15  DG  I C6    1 
ATOM   7262  O  O6    . DG  I 5 58  ? -63.235 -12.429 57.918 1.00 126.22 ? -15  DG  I O6    1 
ATOM   7263  N  N1    . DG  I 5 58  ? -61.007 -12.480 58.365 1.00 136.92 ? -15  DG  I N1    1 
ATOM   7264  C  C2    . DG  I 5 58  ? -59.794 -13.114 58.477 1.00 130.86 ? -15  DG  I C2    1 
ATOM   7265  N  N2    . DG  I 5 58  ? -58.759 -12.353 58.862 1.00 130.36 ? -15  DG  I N2    1 
ATOM   7266  N  N3    . DG  I 5 58  ? -59.607 -14.400 58.229 1.00 122.26 ? -15  DG  I N3    1 
ATOM   7267  C  C4    . DG  I 5 58  ? -60.750 -15.012 57.855 1.00 133.28 ? -15  DG  I C4    1 
ATOM   7268  P  P     . DG  I 5 59  ? -56.683 -20.484 57.602 1.00 110.28 ? -14  DG  I P     1 
ATOM   7269  O  OP1   . DG  I 5 59  ? -56.534 -20.695 56.143 1.00 110.47 ? -14  DG  I OP1   1 
ATOM   7270  O  OP2   . DG  I 5 59  ? -56.792 -21.668 58.503 1.00 90.93  ? -14  DG  I OP2   1 
ATOM   7271  O  "O5'" . DG  I 5 59  ? -55.458 -19.571 58.052 1.00 90.54  ? -14  DG  I "O5'" 1 
ATOM   7272  C  "C5'" . DG  I 5 59  ? -54.828 -18.687 57.111 1.00 98.99  ? -14  DG  I "C5'" 1 
ATOM   7273  C  "C4'" . DG  I 5 59  ? -54.206 -17.502 57.817 1.00 109.99 ? -14  DG  I "C4'" 1 
ATOM   7274  O  "O4'" . DG  I 5 59  ? -55.244 -16.687 58.434 1.00 112.68 ? -14  DG  I "O4'" 1 
ATOM   7275  C  "C3'" . DG  I 5 59  ? -53.253 -17.814 58.960 1.00 109.38 ? -14  DG  I "C3'" 1 
ATOM   7276  O  "O3'" . DG  I 5 59  ? -52.473 -16.637 59.140 1.00 105.61 ? -14  DG  I "O3'" 1 
ATOM   7277  C  "C2'" . DG  I 5 59  ? -54.218 -17.961 60.123 1.00 109.09 ? -14  DG  I "C2'" 1 
ATOM   7278  C  "C1'" . DG  I 5 59  ? -55.149 -16.782 59.849 1.00 112.65 ? -14  DG  I "C1'" 1 
ATOM   7279  N  N9    . DG  I 5 59  ? -56.500 -16.930 60.368 1.00 123.69 ? -14  DG  I N9    1 
ATOM   7280  C  C8    . DG  I 5 59  ? -57.280 -18.060 60.336 1.00 131.47 ? -14  DG  I C8    1 
ATOM   7281  N  N7    . DG  I 5 59  ? -58.473 -17.873 60.829 1.00 138.75 ? -14  DG  I N7    1 
ATOM   7282  C  C5    . DG  I 5 59  ? -58.488 -16.533 61.191 1.00 132.04 ? -14  DG  I C5    1 
ATOM   7283  C  C6    . DG  I 5 59  ? -59.518 -15.749 61.772 1.00 130.65 ? -14  DG  I C6    1 
ATOM   7284  O  O6    . DG  I 5 59  ? -60.660 -16.095 62.100 1.00 125.88 ? -14  DG  I O6    1 
ATOM   7285  N  N1    . DG  I 5 59  ? -59.106 -14.436 61.977 1.00 132.50 ? -14  DG  I N1    1 
ATOM   7286  C  C2    . DG  I 5 59  ? -57.864 -13.939 61.661 1.00 124.75 ? -14  DG  I C2    1 
ATOM   7287  N  N2    . DG  I 5 59  ? -57.657 -12.642 61.928 1.00 126.84 ? -14  DG  I N2    1 
ATOM   7288  N  N3    . DG  I 5 59  ? -56.899 -14.658 61.115 1.00 111.06 ? -14  DG  I N3    1 
ATOM   7289  C  C4    . DG  I 5 59  ? -57.279 -15.935 60.906 1.00 120.93 ? -14  DG  I C4    1 
ATOM   7290  P  P     . DC  I 5 60  ? -51.005 -16.699 59.749 1.00 87.17  ? -13  DC  I P     1 
ATOM   7291  O  OP1   . DC  I 5 60  ? -50.076 -16.471 58.613 1.00 82.27  ? -13  DC  I OP1   1 
ATOM   7292  O  OP2   . DC  I 5 60  ? -50.895 -17.911 60.612 1.00 81.81  ? -13  DC  I OP2   1 
ATOM   7293  O  "O5'" . DC  I 5 60  ? -51.014 -15.511 60.813 1.00 91.09  ? -13  DC  I "O5'" 1 
ATOM   7294  C  "C5'" . DC  I 5 60  ? -51.305 -14.143 60.435 1.00 100.27 ? -13  DC  I "C5'" 1 
ATOM   7295  C  "C4'" . DC  I 5 60  ? -51.747 -13.333 61.634 1.00 98.31  ? -13  DC  I "C4'" 1 
ATOM   7296  O  "O4'" . DC  I 5 60  ? -53.081 -13.765 62.017 1.00 105.21 ? -13  DC  I "O4'" 1 
ATOM   7297  C  "C3'" . DC  I 5 60  ? -50.894 -13.458 62.897 1.00 100.63 ? -13  DC  I "C3'" 1 
ATOM   7298  O  "O3'" . DC  I 5 60  ? -50.859 -12.256 63.644 1.00 89.22  ? -13  DC  I "O3'" 1 
ATOM   7299  C  "C2'" . DC  I 5 60  ? -51.681 -14.452 63.743 1.00 110.90 ? -13  DC  I "C2'" 1 
ATOM   7300  C  "C1'" . DC  I 5 60  ? -53.108 -14.032 63.408 1.00 116.41 ? -13  DC  I "C1'" 1 
ATOM   7301  N  N1    . DC  I 5 60  ? -54.109 -15.077 63.652 1.00 117.06 ? -13  DC  I N1    1 
ATOM   7302  C  C2    . DC  I 5 60  ? -55.314 -14.743 64.277 1.00 106.57 ? -13  DC  I C2    1 
ATOM   7303  O  O2    . DC  I 5 60  ? -55.496 -13.571 64.637 1.00 101.55 ? -13  DC  I O2    1 
ATOM   7304  N  N3    . DC  I 5 60  ? -56.238 -15.709 64.490 1.00 107.84 ? -13  DC  I N3    1 
ATOM   7305  C  C4    . DC  I 5 60  ? -55.998 -16.962 64.090 1.00 109.93 ? -13  DC  I C4    1 
ATOM   7306  N  N4    . DC  I 5 60  ? -56.936 -17.888 64.309 1.00 93.58  ? -13  DC  I N4    1 
ATOM   7307  C  C5    . DC  I 5 60  ? -54.783 -17.325 63.444 1.00 123.56 ? -13  DC  I C5    1 
ATOM   7308  C  C6    . DC  I 5 60  ? -53.876 -16.360 63.245 1.00 119.92 ? -13  DC  I C6    1 
ATOM   7309  P  P     . DA  I 5 61  ? -49.600 -11.315 63.573 1.00 86.96  ? -12  DA  I P     1 
ATOM   7310  O  OP1   . DA  I 5 61  ? -49.558 -10.725 62.215 1.00 89.47  ? -12  DA  I OP1   1 
ATOM   7311  O  OP2   . DA  I 5 61  ? -48.445 -12.062 64.110 1.00 90.48  ? -12  DA  I OP2   1 
ATOM   7312  O  "O5'" . DA  I 5 61  ? -49.932 -10.181 64.639 1.00 91.37  ? -12  DA  I "O5'" 1 
ATOM   7313  C  "C5'" . DA  I 5 61  ? -50.913 -9.150  64.378 1.00 94.47  ? -12  DA  I "C5'" 1 
ATOM   7314  C  "C4'" . DA  I 5 61  ? -51.674 -8.816  65.641 1.00 90.04  ? -12  DA  I "C4'" 1 
ATOM   7315  O  "O4'" . DA  I 5 61  ? -52.602 -9.893  65.942 1.00 92.38  ? -12  DA  I "O4'" 1 
ATOM   7316  C  "C3'" . DA  I 5 61  ? -50.832 -8.601  66.904 1.00 90.76  ? -12  DA  I "C3'" 1 
ATOM   7317  O  "O3'" . DA  I 5 61  ? -51.322 -7.459  67.591 1.00 98.16  ? -12  DA  I "O3'" 1 
ATOM   7318  C  "C2'" . DA  I 5 61  ? -51.018 -9.896  67.691 1.00 86.36  ? -12  DA  I "C2'" 1 
ATOM   7319  C  "C1'" . DA  I 5 61  ? -52.432 -10.300 67.282 1.00 95.64  ? -12  DA  I "C1'" 1 
ATOM   7320  N  N9    . DA  I 5 61  ? -52.679 -11.734 67.338 1.00 102.94 ? -12  DA  I N9    1 
ATOM   7321  C  C8    . DA  I 5 61  ? -51.805 -12.763 67.097 1.00 111.87 ? -12  DA  I C8    1 
ATOM   7322  N  N7    . DA  I 5 61  ? -52.344 -13.951 67.214 1.00 116.03 ? -12  DA  I N7    1 
ATOM   7323  C  C5    . DA  I 5 61  ? -53.664 -13.686 67.543 1.00 124.88 ? -12  DA  I C5    1 
ATOM   7324  C  C6    . DA  I 5 61  ? -54.755 -14.523 67.802 1.00 134.97 ? -12  DA  I C6    1 
ATOM   7325  N  N6    . DA  I 5 61  ? -54.685 -15.854 67.762 1.00 141.32 ? -12  DA  I N6    1 
ATOM   7326  N  N1    . DA  I 5 61  ? -55.939 -13.942 68.097 1.00 136.22 ? -12  DA  I N1    1 
ATOM   7327  C  C2    . DA  I 5 61  ? -56.005 -12.605 68.130 1.00 130.09 ? -12  DA  I C2    1 
ATOM   7328  N  N3    . DA  I 5 61  ? -55.045 -11.711 67.908 1.00 129.03 ? -12  DA  I N3    1 
ATOM   7329  C  C4    . DA  I 5 61  ? -53.886 -12.324 67.613 1.00 121.03 ? -12  DA  I C4    1 
ATOM   7330  P  P     . DT  I 5 62  ? -50.506 -6.814  68.803 1.00 109.06 ? -11  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5 62  ? -50.748 -5.347  68.774 1.00 104.13 ? -11  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5 62  ? -49.115 -7.317  68.758 1.00 108.61 ? -11  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5 62  ? -51.227 -7.456  70.071 1.00 111.90 ? -11  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5 62  ? -52.606 -7.142  70.328 1.00 106.99 ? -11  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5 62  ? -53.214 -8.088  71.335 1.00 100.05 ? -11  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5 62  ? -53.473 -9.372  70.737 1.00 103.57 ? -11  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5 62  ? -52.374 -8.400  72.566 1.00 90.64  ? -11  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5 62  ? -52.602 -7.402  73.562 1.00 106.25 ? -11  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5 62  ? -52.940 -9.736  73.017 1.00 103.74 ? -11  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5 62  ? -53.643 -10.312 71.787 1.00 104.94 ? -11  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5 62  ? -53.078 -11.591 71.346 1.00 108.66 ? -11  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5 62  ? -53.906 -12.683 71.234 1.00 115.86 ? -11  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5 62  ? -55.099 -12.640 71.469 1.00 133.59 ? -11  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5 62  ? -53.283 -13.833 70.827 1.00 122.21 ? -11  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5 62  ? -51.942 -13.999 70.542 1.00 115.52 ? -11  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5 62  ? -51.526 -15.096 70.194 1.00 107.41 ? -11  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5 62  ? -51.129 -12.814 70.691 1.00 115.11 ? -11  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5 62  ? -49.664 -12.896 70.403 1.00 113.14 ? -11  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5 62  ? -51.730 -11.685 71.081 1.00 115.90 ? -11  DT  I C6    1 
ATOM   7350  P  P     . DG  I 5 63  ? -51.762 -7.399  74.944 1.00 135.35 ? -10  DG  I P     1 
ATOM   7351  O  OP1   . DG  I 5 63  ? -50.976 -6.144  74.995 1.00 128.86 ? -10  DG  I OP1   1 
ATOM   7352  O  OP2   . DG  I 5 63  ? -51.071 -8.696  75.092 1.00 135.12 ? -10  DG  I OP2   1 
ATOM   7353  O  "O5'" . DG  I 5 63  ? -52.877 -7.346  76.087 1.00 134.06 ? -10  DG  I "O5'" 1 
ATOM   7354  C  "C5'" . DG  I 5 63  ? -53.862 -8.387  76.269 1.00 129.32 ? -10  DG  I "C5'" 1 
ATOM   7355  C  "C4'" . DG  I 5 63  ? -53.542 -9.290  77.449 1.00 136.77 ? -10  DG  I "C4'" 1 
ATOM   7356  O  "O4'" . DG  I 5 63  ? -53.386 -10.651 76.962 1.00 138.20 ? -10  DG  I "O4'" 1 
ATOM   7357  C  "C3'" . DG  I 5 63  ? -52.297 -8.964  78.282 1.00 138.19 ? -10  DG  I "C3'" 1 
ATOM   7358  O  "O3'" . DG  I 5 63  ? -52.576 -8.773  79.689 1.00 140.52 ? -10  DG  I "O3'" 1 
ATOM   7359  C  "C2'" . DG  I 5 63  ? -51.279 -10.018 77.838 1.00 141.85 ? -10  DG  I "C2'" 1 
ATOM   7360  C  "C1'" . DG  I 5 63  ? -52.172 -11.194 77.437 1.00 139.72 ? -10  DG  I "C1'" 1 
ATOM   7361  N  N9    . DG  I 5 63  ? -51.603 -12.038 76.388 1.00 132.49 ? -10  DG  I N9    1 
ATOM   7362  C  C8    . DG  I 5 63  ? -50.569 -11.723 75.540 1.00 121.42 ? -10  DG  I C8    1 
ATOM   7363  N  N7    . DG  I 5 63  ? -50.279 -12.684 74.707 1.00 120.67 ? -10  DG  I N7    1 
ATOM   7364  C  C5    . DG  I 5 63  ? -51.170 -13.697 75.026 1.00 130.99 ? -10  DG  I C5    1 
ATOM   7365  C  C6    . DG  I 5 63  ? -51.332 -14.989 74.464 1.00 138.75 ? -10  DG  I C6    1 
ATOM   7366  O  O6    . DG  I 5 63  ? -50.702 -15.511 73.537 1.00 124.58 ? -10  DG  I O6    1 
ATOM   7367  N  N1    . DG  I 5 63  ? -52.354 -15.694 75.091 1.00 142.85 ? -10  DG  I N1    1 
ATOM   7368  C  C2    . DG  I 5 63  ? -53.128 -15.216 76.120 1.00 135.29 ? -10  DG  I C2    1 
ATOM   7369  N  N2    . DG  I 5 63  ? -54.072 -16.043 76.586 1.00 140.38 ? -10  DG  I N2    1 
ATOM   7370  N  N3    . DG  I 5 63  ? -52.987 -14.013 76.652 1.00 125.26 ? -10  DG  I N3    1 
ATOM   7371  C  C4    . DG  I 5 63  ? -51.996 -13.314 76.062 1.00 129.89 ? -10  DG  I C4    1 
ATOM   7372  P  P     . DT  I 5 64  ? -52.593 -9.994  80.796 1.00 150.82 ? -9   DT  I P     1 
ATOM   7373  O  OP1   . DT  I 5 64  ? -53.310 -9.495  81.995 1.00 151.74 ? -9   DT  I OP1   1 
ATOM   7374  O  OP2   . DT  I 5 64  ? -51.207 -10.506 80.960 1.00 135.52 ? -9   DT  I OP2   1 
ATOM   7375  O  "O5'" . DT  I 5 64  ? -53.513 -11.132 80.154 1.00 137.94 ? -9   DT  I "O5'" 1 
ATOM   7376  C  "C5'" . DT  I 5 64  ? -54.495 -11.855 80.938 1.00 129.32 ? -9   DT  I "C5'" 1 
ATOM   7377  C  "C4'" . DT  I 5 64  ? -54.079 -13.287 81.203 1.00 131.98 ? -9   DT  I "C4'" 1 
ATOM   7378  O  "O4'" . DT  I 5 64  ? -53.280 -13.828 80.121 1.00 147.08 ? -9   DT  I "O4'" 1 
ATOM   7379  C  "C3'" . DT  I 5 64  ? -53.273 -13.519 82.488 1.00 135.46 ? -9   DT  I "C3'" 1 
ATOM   7380  O  "O3'" . DT  I 5 64  ? -53.923 -14.536 83.262 1.00 139.51 ? -9   DT  I "O3'" 1 
ATOM   7381  C  "C2'" . DT  I 5 64  ? -51.909 -13.969 81.989 1.00 141.49 ? -9   DT  I "C2'" 1 
ATOM   7382  C  "C1'" . DT  I 5 64  ? -52.267 -14.649 80.682 1.00 144.94 ? -9   DT  I "C1'" 1 
ATOM   7383  N  N1    . DT  I 5 64  ? -51.159 -14.776 79.695 1.00 137.99 ? -9   DT  I N1    1 
ATOM   7384  C  C2    . DT  I 5 64  ? -50.938 -16.006 79.113 1.00 127.68 ? -9   DT  I C2    1 
ATOM   7385  O  O2    . DT  I 5 64  ? -51.609 -16.995 79.364 1.00 127.49 ? -9   DT  I O2    1 
ATOM   7386  N  N3    . DT  I 5 64  ? -49.895 -16.038 78.223 1.00 119.67 ? -9   DT  I N3    1 
ATOM   7387  C  C4    . DT  I 5 64  ? -49.067 -14.990 77.868 1.00 118.63 ? -9   DT  I C4    1 
ATOM   7388  O  O4    . DT  I 5 64  ? -48.169 -15.169 77.051 1.00 113.48 ? -9   DT  I O4    1 
ATOM   7389  C  C5    . DT  I 5 64  ? -49.350 -13.734 78.519 1.00 116.35 ? -9   DT  I C5    1 
ATOM   7390  C  C7    . DT  I 5 64  ? -48.503 -12.543 78.198 1.00 112.72 ? -9   DT  I C7    1 
ATOM   7391  C  C6    . DT  I 5 64  ? -50.363 -13.692 79.393 1.00 126.53 ? -9   DT  I C6    1 
ATOM   7392  P  P     . DT  I 5 65  ? -53.235 -15.127 84.591 1.00 140.98 ? -8   DT  I P     1 
ATOM   7393  O  OP1   . DT  I 5 65  ? -54.311 -15.582 85.511 1.00 139.78 ? -8   DT  I OP1   1 
ATOM   7394  O  OP2   . DT  I 5 65  ? -52.185 -14.171 85.050 1.00 139.94 ? -8   DT  I OP2   1 
ATOM   7395  O  "O5'" . DT  I 5 65  ? -52.508 -16.437 84.070 1.00 132.99 ? -8   DT  I "O5'" 1 
ATOM   7396  C  "C5'" . DT  I 5 65  ? -53.259 -17.595 83.690 1.00 134.59 ? -8   DT  I "C5'" 1 
ATOM   7397  C  "C4'" . DT  I 5 65  ? -52.296 -18.741 83.509 1.00 137.38 ? -8   DT  I "C4'" 1 
ATOM   7398  O  "O4'" . DT  I 5 65  ? -51.396 -18.432 82.414 1.00 144.66 ? -8   DT  I "O4'" 1 
ATOM   7399  C  "C3'" . DT  I 5 65  ? -51.420 -18.985 84.742 1.00 136.32 ? -8   DT  I "C3'" 1 
ATOM   7400  O  "O3'" . DT  I 5 65  ? -51.499 -20.358 85.148 1.00 121.52 ? -8   DT  I "O3'" 1 
ATOM   7401  C  "C2'" . DT  I 5 65  ? -50.031 -18.541 84.306 1.00 148.46 ? -8   DT  I "C2'" 1 
ATOM   7402  C  "C1'" . DT  I 5 65  ? -50.069 -18.745 82.797 1.00 150.07 ? -8   DT  I "C1'" 1 
ATOM   7403  N  N1    . DT  I 5 65  ? -49.140 -17.912 81.989 1.00 138.25 ? -8   DT  I N1    1 
ATOM   7404  C  C2    . DT  I 5 65  ? -48.611 -18.458 80.840 1.00 123.41 ? -8   DT  I C2    1 
ATOM   7405  O  O2    . DT  I 5 65  ? -48.878 -19.583 80.452 1.00 116.98 ? -8   DT  I O2    1 
ATOM   7406  N  N3    . DT  I 5 65  ? -47.753 -17.633 80.157 1.00 114.09 ? -8   DT  I N3    1 
ATOM   7407  C  C4    . DT  I 5 65  ? -47.378 -16.349 80.501 1.00 120.47 ? -8   DT  I C4    1 
ATOM   7408  O  O4    . DT  I 5 65  ? -46.597 -15.728 79.787 1.00 119.32 ? -8   DT  I O4    1 
ATOM   7409  C  C5    . DT  I 5 65  ? -47.967 -15.840 81.718 1.00 132.96 ? -8   DT  I C5    1 
ATOM   7410  C  C7    . DT  I 5 65  ? -47.622 -14.456 82.169 1.00 138.24 ? -8   DT  I C7    1 
ATOM   7411  C  C6    . DT  I 5 65  ? -48.805 -16.637 82.393 1.00 136.41 ? -8   DT  I C6    1 
ATOM   7412  P  P     . DC  I 5 66  ? -50.728 -20.843 86.467 1.00 124.96 ? -7   DC  I P     1 
ATOM   7413  O  OP1   . DC  I 5 66  ? -51.536 -21.895 87.136 1.00 122.01 ? -7   DC  I OP1   1 
ATOM   7414  O  OP2   . DC  I 5 66  ? -50.278 -19.630 87.202 1.00 114.84 ? -7   DC  I OP2   1 
ATOM   7415  O  "O5'" . DC  I 5 66  ? -49.438 -21.589 85.906 1.00 135.23 ? -7   DC  I "O5'" 1 
ATOM   7416  C  "C5'" . DC  I 5 66  ? -49.522 -22.623 84.906 1.00 125.47 ? -7   DC  I "C5'" 1 
ATOM   7417  C  "C4'" . DC  I 5 66  ? -48.133 -22.945 84.415 1.00 117.75 ? -7   DC  I "C4'" 1 
ATOM   7418  O  "O4'" . DC  I 5 66  ? -47.586 -21.790 83.708 1.00 114.39 ? -7   DC  I "O4'" 1 
ATOM   7419  C  "C3'" . DC  I 5 66  ? -47.124 -23.274 85.518 1.00 107.13 ? -7   DC  I "C3'" 1 
ATOM   7420  O  "O3'" . DC  I 5 66  ? -46.288 -24.351 85.144 1.00 102.18 ? -7   DC  I "O3'" 1 
ATOM   7421  C  "C2'" . DC  I 5 66  ? -46.279 -22.009 85.611 1.00 110.12 ? -7   DC  I "C2'" 1 
ATOM   7422  C  "C1'" . DC  I 5 66  ? -46.262 -21.575 84.150 1.00 118.19 ? -7   DC  I "C1'" 1 
ATOM   7423  N  N1    . DC  I 5 66  ? -45.895 -20.169 83.921 1.00 126.19 ? -7   DC  I N1    1 
ATOM   7424  C  C2    . DC  I 5 66  ? -45.520 -19.783 82.632 1.00 125.70 ? -7   DC  I C2    1 
ATOM   7425  O  O2    . DC  I 5 66  ? -45.539 -20.628 81.727 1.00 116.57 ? -7   DC  I O2    1 
ATOM   7426  N  N3    . DC  I 5 66  ? -45.164 -18.497 82.403 1.00 131.88 ? -7   DC  I N3    1 
ATOM   7427  C  C4    . DC  I 5 66  ? -45.156 -17.619 83.409 1.00 129.05 ? -7   DC  I C4    1 
ATOM   7428  N  N4    . DC  I 5 66  ? -44.793 -16.363 83.141 1.00 130.67 ? -7   DC  I N4    1 
ATOM   7429  C  C5    . DC  I 5 66  ? -45.520 -17.989 84.736 1.00 121.66 ? -7   DC  I C5    1 
ATOM   7430  C  C6    . DC  I 5 66  ? -45.874 -19.264 84.946 1.00 127.63 ? -7   DC  I C6    1 
ATOM   7431  P  P     . DA  I 5 67  ? -46.637 -25.812 85.632 1.00 105.70 ? -6   DA  I P     1 
ATOM   7432  O  OP1   . DA  I 5 67  ? -48.096 -25.976 85.452 1.00 103.08 ? -6   DA  I OP1   1 
ATOM   7433  O  OP2   . DA  I 5 67  ? -46.002 -25.998 86.965 1.00 103.36 ? -6   DA  I OP2   1 
ATOM   7434  O  "O5'" . DA  I 5 67  ? -45.882 -26.763 84.591 1.00 103.08 ? -6   DA  I "O5'" 1 
ATOM   7435  C  "C5'" . DA  I 5 67  ? -46.310 -26.858 83.207 1.00 102.04 ? -6   DA  I "C5'" 1 
ATOM   7436  C  "C4'" . DA  I 5 67  ? -45.145 -27.012 82.239 1.00 90.96  ? -6   DA  I "C4'" 1 
ATOM   7437  O  "O4'" . DA  I 5 67  ? -44.469 -25.739 82.030 1.00 82.18  ? -6   DA  I "O4'" 1 
ATOM   7438  C  "C3'" . DA  I 5 67  ? -44.047 -28.004 82.616 1.00 85.18  ? -6   DA  I "C3'" 1 
ATOM   7439  O  "O3'" . DA  I 5 67  ? -43.658 -28.547 81.366 1.00 78.34  ? -6   DA  I "O3'" 1 
ATOM   7440  C  "C2'" . DA  I 5 67  ? -43.007 -27.122 83.308 1.00 82.61  ? -6   DA  I "C2'" 1 
ATOM   7441  C  "C1'" . DA  I 5 67  ? -43.137 -25.816 82.519 1.00 87.92  ? -6   DA  I "C1'" 1 
ATOM   7442  N  N9    . DA  I 5 67  ? -42.881 -24.607 83.297 1.00 84.06  ? -6   DA  I N9    1 
ATOM   7443  C  C8    . DA  I 5 67  ? -43.044 -24.408 84.645 1.00 103.40 ? -6   DA  I C8    1 
ATOM   7444  N  N7    . DA  I 5 67  ? -42.764 -23.188 85.038 1.00 93.32  ? -6   DA  I N7    1 
ATOM   7445  C  C5    . DA  I 5 67  ? -42.406 -22.538 83.868 1.00 90.86  ? -6   DA  I C5    1 
ATOM   7446  C  C6    . DA  I 5 67  ? -42.004 -21.221 83.609 1.00 100.37 ? -6   DA  I C6    1 
ATOM   7447  N  N6    . DA  I 5 67  ? -41.893 -20.286 84.552 1.00 103.75 ? -6   DA  I N6    1 
ATOM   7448  N  N1    . DA  I 5 67  ? -41.712 -20.892 82.331 1.00 104.86 ? -6   DA  I N1    1 
ATOM   7449  C  C2    . DA  I 5 67  ? -41.823 -21.834 81.386 1.00 102.40 ? -6   DA  I C2    1 
ATOM   7450  N  N3    . DA  I 5 67  ? -42.182 -23.111 81.509 1.00 100.12 ? -6   DA  I N3    1 
ATOM   7451  C  C4    . DA  I 5 67  ? -42.472 -23.399 82.788 1.00 91.21  ? -6   DA  I C4    1 
ATOM   7452  P  P     . DG  I 5 68  ? -42.684 -29.825 81.258 1.00 91.86  ? -5   DG  I P     1 
ATOM   7453  O  OP1   . DG  I 5 68  ? -43.235 -30.733 80.235 1.00 103.31 ? -5   DG  I OP1   1 
ATOM   7454  O  OP2   . DG  I 5 68  ? -42.370 -30.359 82.600 1.00 85.01  ? -5   DG  I OP2   1 
ATOM   7455  O  "O5'" . DG  I 5 68  ? -41.341 -29.190 80.693 1.00 95.82  ? -5   DG  I "O5'" 1 
ATOM   7456  C  "C5'" . DG  I 5 68  ? -41.354 -27.999 79.887 1.00 93.58  ? -5   DG  I "C5'" 1 
ATOM   7457  C  "C4'" . DG  I 5 68  ? -39.985 -27.378 79.884 1.00 91.49  ? -5   DG  I "C4'" 1 
ATOM   7458  O  "O4'" . DG  I 5 68  ? -39.986 -26.207 80.749 1.00 88.66  ? -5   DG  I "O4'" 1 
ATOM   7459  C  "C3'" . DG  I 5 68  ? -38.866 -28.275 80.416 1.00 96.63  ? -5   DG  I "C3'" 1 
ATOM   7460  O  "O3'" . DG  I 5 68  ? -37.636 -27.867 79.850 1.00 102.87 ? -5   DG  I "O3'" 1 
ATOM   7461  C  "C2'" . DG  I 5 68  ? -38.765 -27.837 81.866 1.00 90.03  ? -5   DG  I "C2'" 1 
ATOM   7462  C  "C1'" . DG  I 5 68  ? -38.931 -26.337 81.677 1.00 94.97  ? -5   DG  I "C1'" 1 
ATOM   7463  N  N9    . DG  I 5 68  ? -39.229 -25.570 82.879 1.00 103.41 ? -5   DG  I N9    1 
ATOM   7464  C  C8    . DG  I 5 68  ? -39.687 -26.030 84.091 1.00 105.14 ? -5   DG  I C8    1 
ATOM   7465  N  N7    . DG  I 5 68  ? -39.779 -25.090 84.991 1.00 103.75 ? -5   DG  I N7    1 
ATOM   7466  C  C5    . DG  I 5 68  ? -39.331 -23.948 84.341 1.00 101.32 ? -5   DG  I C5    1 
ATOM   7467  C  C6    . DG  I 5 68  ? -39.206 -22.617 84.806 1.00 99.79  ? -5   DG  I C6    1 
ATOM   7468  O  O6    . DG  I 5 68  ? -39.471 -22.165 85.923 1.00 105.19 ? -5   DG  I O6    1 
ATOM   7469  N  N1    . DG  I 5 68  ? -38.707 -21.774 83.817 1.00 99.54  ? -5   DG  I N1    1 
ATOM   7470  C  C2    . DG  I 5 68  ? -38.376 -22.163 82.543 1.00 99.17  ? -5   DG  I C2    1 
ATOM   7471  N  N2    . DG  I 5 68  ? -37.917 -21.203 81.729 1.00 105.27 ? -5   DG  I N2    1 
ATOM   7472  N  N3    . DG  I 5 68  ? -38.488 -23.401 82.098 1.00 94.55  ? -5   DG  I N3    1 
ATOM   7473  C  C4    . DG  I 5 68  ? -38.977 -24.233 83.040 1.00 99.45  ? -5   DG  I C4    1 
ATOM   7474  P  P     . DC  I 5 69  ? -36.896 -28.737 78.750 1.00 93.25  ? -4   DC  I P     1 
ATOM   7475  O  OP1   . DC  I 5 69  ? -37.886 -29.132 77.707 1.00 75.47  ? -4   DC  I OP1   1 
ATOM   7476  O  OP2   . DC  I 5 69  ? -36.085 -29.769 79.445 1.00 81.29  ? -4   DC  I OP2   1 
ATOM   7477  O  "O5'" . DC  I 5 69  ? -35.932 -27.639 78.134 1.00 81.72  ? -4   DC  I "O5'" 1 
ATOM   7478  C  "C5'" . DC  I 5 69  ? -36.512 -26.584 77.378 1.00 77.32  ? -4   DC  I "C5'" 1 
ATOM   7479  C  "C4'" . DC  I 5 69  ? -35.773 -25.305 77.638 1.00 82.08  ? -4   DC  I "C4'" 1 
ATOM   7480  O  "O4'" . DC  I 5 69  ? -36.128 -24.790 78.945 1.00 75.50  ? -4   DC  I "O4'" 1 
ATOM   7481  C  "C3'" . DC  I 5 69  ? -34.257 -25.423 77.598 1.00 80.62  ? -4   DC  I "C3'" 1 
ATOM   7482  O  "O3'" . DC  I 5 69  ? -33.717 -24.451 76.720 1.00 73.69  ? -4   DC  I "O3'" 1 
ATOM   7483  C  "C2'" . DC  I 5 69  ? -33.831 -25.173 79.039 1.00 83.13  ? -4   DC  I "C2'" 1 
ATOM   7484  C  "C1'" . DC  I 5 69  ? -34.976 -24.317 79.576 1.00 82.13  ? -4   DC  I "C1'" 1 
ATOM   7485  N  N1    . DC  I 5 69  ? -35.125 -24.563 81.005 1.00 91.21  ? -4   DC  I N1    1 
ATOM   7486  C  C2    . DC  I 5 69  ? -35.017 -23.502 81.905 1.00 92.50  ? -4   DC  I C2    1 
ATOM   7487  O  O2    . DC  I 5 69  ? -34.845 -22.358 81.466 1.00 95.01  ? -4   DC  I O2    1 
ATOM   7488  N  N3    . DC  I 5 69  ? -35.108 -23.750 83.230 1.00 86.69  ? -4   DC  I N3    1 
ATOM   7489  C  C4    . DC  I 5 69  ? -35.279 -25.001 83.661 1.00 92.95  ? -4   DC  I C4    1 
ATOM   7490  N  N4    . DC  I 5 69  ? -35.378 -25.204 84.976 1.00 101.49 ? -4   DC  I N4    1 
ATOM   7491  C  C5    . DC  I 5 69  ? -35.362 -26.102 82.764 1.00 95.10  ? -4   DC  I C5    1 
ATOM   7492  C  C6    . DC  I 5 69  ? -35.267 -25.843 81.458 1.00 91.04  ? -4   DC  I C6    1 
ATOM   7493  P  P     . DT  I 5 70  ? -32.184 -24.511 76.335 1.00 70.41  ? -3   DT  I P     1 
ATOM   7494  O  OP1   . DT  I 5 70  ? -32.115 -24.359 74.859 1.00 59.73  ? -3   DT  I OP1   1 
ATOM   7495  O  OP2   . DT  I 5 70  ? -31.542 -25.689 77.013 1.00 59.37  ? -3   DT  I OP2   1 
ATOM   7496  O  "O5'" . DT  I 5 70  ? -31.613 -23.248 77.108 1.00 62.75  ? -3   DT  I "O5'" 1 
ATOM   7497  C  "C5'" . DT  I 5 70  ? -32.197 -21.969 76.864 1.00 67.68  ? -3   DT  I "C5'" 1 
ATOM   7498  C  "C4'" . DT  I 5 70  ? -31.602 -20.963 77.816 1.00 73.97  ? -3   DT  I "C4'" 1 
ATOM   7499  O  "O4'" . DT  I 5 70  ? -31.925 -21.356 79.162 1.00 84.20  ? -3   DT  I "O4'" 1 
ATOM   7500  C  "C3'" . DT  I 5 70  ? -30.081 -20.861 77.782 1.00 77.64  ? -3   DT  I "C3'" 1 
ATOM   7501  O  "O3'" . DT  I 5 70  ? -29.755 -19.500 78.000 1.00 79.94  ? -3   DT  I "O3'" 1 
ATOM   7502  C  "C2'" . DT  I 5 70  ? -29.635 -21.718 78.951 1.00 77.25  ? -3   DT  I "C2'" 1 
ATOM   7503  C  "C1'" . DT  I 5 70  ? -30.748 -21.450 79.936 1.00 81.25  ? -3   DT  I "C1'" 1 
ATOM   7504  N  N1    . DT  I 5 70  ? -30.982 -22.474 80.956 1.00 87.55  ? -3   DT  I N1    1 
ATOM   7505  C  C2    . DT  I 5 70  ? -31.275 -22.055 82.234 1.00 88.14  ? -3   DT  I C2    1 
ATOM   7506  O  O2    . DT  I 5 70  ? -31.290 -20.880 82.563 1.00 91.64  ? -3   DT  I O2    1 
ATOM   7507  N  N3    . DT  I 5 70  ? -31.524 -23.069 83.125 1.00 81.06  ? -3   DT  I N3    1 
ATOM   7508  C  C4    . DT  I 5 70  ? -31.528 -24.424 82.864 1.00 84.92  ? -3   DT  I C4    1 
ATOM   7509  O  O4    . DT  I 5 70  ? -31.765 -25.218 83.767 1.00 89.38  ? -3   DT  I O4    1 
ATOM   7510  C  C5    . DT  I 5 70  ? -31.233 -24.791 81.500 1.00 93.82  ? -3   DT  I C5    1 
ATOM   7511  C  C7    . DT  I 5 70  ? -31.209 -26.240 81.128 1.00 95.06  ? -3   DT  I C7    1 
ATOM   7512  C  C6    . DT  I 5 70  ? -30.991 -23.809 80.621 1.00 91.25  ? -3   DT  I C6    1 
ATOM   7513  P  P     . DG  I 5 71  ? -28.311 -19.005 77.690 1.00 76.07  ? -2   DG  I P     1 
ATOM   7514  O  OP1   . DG  I 5 71  ? -28.414 -17.674 77.027 1.00 67.16  ? -2   DG  I OP1   1 
ATOM   7515  O  OP2   . DG  I 5 71  ? -27.549 -20.150 77.165 1.00 64.22  ? -2   DG  I OP2   1 
ATOM   7516  O  "O5'" . DG  I 5 71  ? -27.678 -18.793 79.127 1.00 83.90  ? -2   DG  I "O5'" 1 
ATOM   7517  C  "C5'" . DG  I 5 71  ? -28.202 -17.786 79.997 1.00 82.73  ? -2   DG  I "C5'" 1 
ATOM   7518  C  "C4'" . DG  I 5 71  ? -27.607 -17.993 81.350 1.00 76.73  ? -2   DG  I "C4'" 1 
ATOM   7519  O  "O4'" . DG  I 5 71  ? -28.045 -19.279 81.854 1.00 77.46  ? -2   DG  I "O4'" 1 
ATOM   7520  C  "C3'" . DG  I 5 71  ? -26.083 -18.030 81.365 1.00 79.20  ? -2   DG  I "C3'" 1 
ATOM   7521  O  "O3'" . DG  I 5 71  ? -25.739 -17.250 82.481 1.00 90.07  ? -2   DG  I "O3'" 1 
ATOM   7522  C  "C2'" . DG  I 5 71  ? -25.755 -19.508 81.567 1.00 73.02  ? -2   DG  I "C2'" 1 
ATOM   7523  C  "C1'" . DG  I 5 71  ? -26.944 -19.948 82.412 1.00 78.41  ? -2   DG  I "C1'" 1 
ATOM   7524  N  N9    . DG  I 5 71  ? -27.241 -21.372 82.404 1.00 80.69  ? -2   DG  I N9    1 
ATOM   7525  C  C8    . DG  I 5 71  ? -27.094 -22.257 81.366 1.00 96.50  ? -2   DG  I C8    1 
ATOM   7526  N  N7    . DG  I 5 71  ? -27.462 -23.470 81.673 1.00 84.48  ? -2   DG  I N7    1 
ATOM   7527  C  C5    . DG  I 5 71  ? -27.883 -23.375 82.989 1.00 92.62  ? -2   DG  I C5    1 
ATOM   7528  C  C6    . DG  I 5 71  ? -28.389 -24.365 83.861 1.00 94.29  ? -2   DG  I C6    1 
ATOM   7529  O  O6    . DG  I 5 71  ? -28.579 -25.564 83.634 1.00 100.44 ? -2   DG  I O6    1 
ATOM   7530  N  N1    . DG  I 5 71  ? -28.686 -23.840 85.113 1.00 91.61  ? -2   DG  I N1    1 
ATOM   7531  C  C2    . DG  I 5 71  ? -28.519 -22.526 85.476 1.00 94.92  ? -2   DG  I C2    1 
ATOM   7532  N  N2    . DG  I 5 71  ? -28.866 -22.205 86.727 1.00 102.84 ? -2   DG  I N2    1 
ATOM   7533  N  N3    . DG  I 5 71  ? -28.058 -21.592 84.668 1.00 100.28 ? -2   DG  I N3    1 
ATOM   7534  C  C4    . DG  I 5 71  ? -27.763 -22.083 83.449 1.00 89.00  ? -2   DG  I C4    1 
ATOM   7535  P  P     . DA  I 5 72  ? -24.382 -16.472 82.525 1.00 91.42  ? -1   DA  I P     1 
ATOM   7536  O  OP1   . DA  I 5 72  ? -24.633 -15.118 81.978 1.00 82.27  ? -1   DA  I OP1   1 
ATOM   7537  O  OP2   . DA  I 5 72  ? -23.317 -17.354 81.997 1.00 90.79  ? -1   DA  I OP2   1 
ATOM   7538  O  "O5'" . DA  I 5 72  ? -24.106 -16.380 84.085 1.00 100.13 ? -1   DA  I "O5'" 1 
ATOM   7539  C  "C5'" . DA  I 5 72  ? -25.177 -16.025 84.979 1.00 97.98  ? -1   DA  I "C5'" 1 
ATOM   7540  C  "C4'" . DA  I 5 72  ? -24.953 -16.650 86.332 1.00 96.83  ? -1   DA  I "C4'" 1 
ATOM   7541  O  "O4'" . DA  I 5 72  ? -25.413 -18.027 86.323 1.00 93.27  ? -1   DA  I "O4'" 1 
ATOM   7542  C  "C3'" . DA  I 5 72  ? -23.505 -16.685 86.819 1.00 96.35  ? -1   DA  I "C3'" 1 
ATOM   7543  O  "O3'" . DA  I 5 72  ? -23.521 -16.297 88.186 1.00 111.94 ? -1   DA  I "O3'" 1 
ATOM   7544  C  "C2'" . DA  I 5 72  ? -23.089 -18.133 86.587 1.00 89.82  ? -1   DA  I "C2'" 1 
ATOM   7545  C  "C1'" . DA  I 5 72  ? -24.401 -18.871 86.827 1.00 85.69  ? -1   DA  I "C1'" 1 
ATOM   7546  N  N9    . DA  I 5 72  ? -24.484 -20.141 86.113 1.00 91.54  ? -1   DA  I N9    1 
ATOM   7547  C  C8    . DA  I 5 72  ? -24.150 -20.384 84.805 1.00 97.69  ? -1   DA  I C8    1 
ATOM   7548  N  N7    . DA  I 5 72  ? -24.347 -21.625 84.432 1.00 97.05  ? -1   DA  I N7    1 
ATOM   7549  C  C5    . DA  I 5 72  ? -24.849 -22.240 85.569 1.00 95.63  ? -1   DA  I C5    1 
ATOM   7550  C  C6    . DA  I 5 72  ? -25.258 -23.559 85.830 1.00 90.95  ? -1   DA  I C6    1 
ATOM   7551  N  N6    . DA  I 5 72  ? -25.222 -24.537 84.927 1.00 94.77  ? -1   DA  I N6    1 
ATOM   7552  N  N1    . DA  I 5 72  ? -25.714 -23.842 87.068 1.00 97.91  ? -1   DA  I N1    1 
ATOM   7553  C  C2    . DA  I 5 72  ? -25.749 -22.861 87.977 1.00 103.39 ? -1   DA  I C2    1 
ATOM   7554  N  N3    . DA  I 5 72  ? -25.392 -21.584 87.853 1.00 103.81 ? -1   DA  I N3    1 
ATOM   7555  C  C4    . DA  I 5 72  ? -24.943 -21.336 86.611 1.00 97.85  ? -1   DA  I C4    1 
ATOM   7556  P  P     . DA  I 5 73  ? -22.160 -16.085 88.979 1.00 111.90 ? 0    DA  I P     1 
ATOM   7557  O  OP1   . DA  I 5 73  ? -22.334 -14.918 89.872 1.00 102.55 ? 0    DA  I OP1   1 
ATOM   7558  O  OP2   . DA  I 5 73  ? -21.041 -16.101 87.996 1.00 110.54 ? 0    DA  I OP2   1 
ATOM   7559  O  "O5'" . DA  I 5 73  ? -22.074 -17.404 89.862 1.00 95.57  ? 0    DA  I "O5'" 1 
ATOM   7560  C  "C5'" . DA  I 5 73  ? -23.211 -17.876 90.585 1.00 90.05  ? 0    DA  I "C5'" 1 
ATOM   7561  C  "C4'" . DA  I 5 73  ? -22.786 -19.050 91.422 1.00 104.19 ? 0    DA  I "C4'" 1 
ATOM   7562  O  "O4'" . DA  I 5 73  ? -23.015 -20.276 90.682 1.00 110.98 ? 0    DA  I "O4'" 1 
ATOM   7563  C  "C3'" . DA  I 5 73  ? -21.313 -19.082 91.834 1.00 106.64 ? 0    DA  I "C3'" 1 
ATOM   7564  O  "O3'" . DA  I 5 73  ? -21.242 -19.620 93.142 1.00 118.83 ? 0    DA  I "O3'" 1 
ATOM   7565  C  "C2'" . DA  I 5 73  ? -20.686 -20.025 90.816 1.00 101.09 ? 0    DA  I "C2'" 1 
ATOM   7566  C  "C1'" . DA  I 5 73  ? -21.817 -21.023 90.604 1.00 100.87 ? 0    DA  I "C1'" 1 
ATOM   7567  N  N9    . DA  I 5 73  ? -21.773 -21.644 89.288 1.00 104.59 ? 0    DA  I N9    1 
ATOM   7568  C  C8    . DA  I 5 73  ? -21.514 -21.025 88.091 1.00 104.13 ? 0    DA  I C8    1 
ATOM   7569  N  N7    . DA  I 5 73  ? -21.568 -21.829 87.058 1.00 103.33 ? 0    DA  I N7    1 
ATOM   7570  C  C5    . DA  I 5 73  ? -21.912 -23.055 87.609 1.00 116.46 ? 0    DA  I C5    1 
ATOM   7571  C  C6    . DA  I 5 73  ? -22.124 -24.323 87.039 1.00 124.41 ? 0    DA  I C6    1 
ATOM   7572  N  N6    . DA  I 5 73  ? -22.017 -24.573 85.734 1.00 124.45 ? 0    DA  I N6    1 
ATOM   7573  N  N1    . DA  I 5 73  ? -22.453 -25.338 87.868 1.00 129.17 ? 0    DA  I N1    1 
ATOM   7574  C  C2    . DA  I 5 73  ? -22.551 -25.087 89.180 1.00 124.89 ? 0    DA  I C2    1 
ATOM   7575  N  N3    . DA  I 5 73  ? -22.369 -23.941 89.834 1.00 121.28 ? 0    DA  I N3    1 
ATOM   7576  C  C4    . DA  I 5 73  ? -22.048 -22.954 88.981 1.00 109.75 ? 0    DA  I C4    1 
ATOM   7577  P  P     . DT  I 5 74  ? -19.857 -19.714 93.901 1.00 122.21 ? 1    DT  I P     1 
ATOM   7578  O  OP1   . DT  I 5 74  ? -20.095 -19.310 95.312 1.00 118.26 ? 1    DT  I OP1   1 
ATOM   7579  O  OP2   . DT  I 5 74  ? -18.823 -19.027 93.085 1.00 114.76 ? 1    DT  I OP2   1 
ATOM   7580  O  "O5'" . DT  I 5 74  ? -19.537 -21.269 93.838 1.00 101.59 ? 1    DT  I "O5'" 1 
ATOM   7581  C  "C5'" . DT  I 5 74  ? -20.539 -22.220 94.197 1.00 93.37  ? 1    DT  I "C5'" 1 
ATOM   7582  C  "C4'" . DT  I 5 74  ? -20.005 -23.610 93.965 1.00 101.65 ? 1    DT  I "C4'" 1 
ATOM   7583  O  "O4'" . DT  I 5 74  ? -20.191 -23.990 92.581 1.00 116.58 ? 1    DT  I "O4'" 1 
ATOM   7584  C  "C3'" . DT  I 5 74  ? -18.512 -23.774 94.259 1.00 101.51 ? 1    DT  I "C3'" 1 
ATOM   7585  O  "O3'" . DT  I 5 74  ? -18.403 -24.885 95.150 1.00 109.39 ? 1    DT  I "O3'" 1 
ATOM   7586  C  "C2'" . DT  I 5 74  ? -17.890 -24.027 92.893 1.00 107.91 ? 1    DT  I "C2'" 1 
ATOM   7587  C  "C1'" . DT  I 5 74  ? -19.039 -24.680 92.145 1.00 107.50 ? 1    DT  I "C1'" 1 
ATOM   7588  N  N1    . DT  I 5 74  ? -18.998 -24.600 90.673 1.00 98.51  ? 1    DT  I N1    1 
ATOM   7589  C  C2    . DT  I 5 74  ? -19.250 -25.749 89.959 1.00 101.51 ? 1    DT  I C2    1 
ATOM   7590  O  O2    . DT  I 5 74  ? -19.482 -26.825 90.488 1.00 98.88  ? 1    DT  I O2    1 
ATOM   7591  N  N3    . DT  I 5 74  ? -19.210 -25.595 88.595 1.00 102.49 ? 1    DT  I N3    1 
ATOM   7592  C  C4    . DT  I 5 74  ? -18.953 -24.432 87.893 1.00 102.10 ? 1    DT  I C4    1 
ATOM   7593  O  O4    . DT  I 5 74  ? -18.966 -24.442 86.665 1.00 107.41 ? 1    DT  I O4    1 
ATOM   7594  C  C5    . DT  I 5 74  ? -18.705 -23.264 88.708 1.00 101.08 ? 1    DT  I C5    1 
ATOM   7595  C  C7    . DT  I 5 74  ? -18.415 -21.958 88.038 1.00 101.92 ? 1    DT  I C7    1 
ATOM   7596  C  C6    . DT  I 5 74  ? -18.749 -23.403 90.039 1.00 95.70  ? 1    DT  I C6    1 
ATOM   7597  P  P     . DC  I 5 75  ? -17.031 -25.202 95.905 1.00 117.33 ? 2    DC  I P     1 
ATOM   7598  O  OP1   . DC  I 5 75  ? -17.379 -25.668 97.270 1.00 118.48 ? 2    DC  I OP1   1 
ATOM   7599  O  OP2   . DC  I 5 75  ? -16.136 -24.026 95.767 1.00 97.60  ? 2    DC  I OP2   1 
ATOM   7600  O  "O5'" . DC  I 5 75  ? -16.470 -26.446 95.077 1.00 113.62 ? 2    DC  I "O5'" 1 
ATOM   7601  C  "C5'" . DC  I 5 75  ? -17.280 -27.630 94.908 1.00 112.16 ? 2    DC  I "C5'" 1 
ATOM   7602  C  "C4'" . DC  I 5 75  ? -16.621 -28.597 93.956 1.00 118.92 ? 2    DC  I "C4'" 1 
ATOM   7603  O  "O4'" . DC  I 5 75  ? -16.803 -28.144 92.590 1.00 131.38 ? 2    DC  I "O4'" 1 
ATOM   7604  C  "C3'" . DC  I 5 75  ? -15.125 -28.796 94.155 1.00 118.93 ? 2    DC  I "C3'" 1 
ATOM   7605  O  "O3'" . DC  I 5 75  ? -14.908 -30.179 94.350 1.00 127.24 ? 2    DC  I "O3'" 1 
ATOM   7606  C  "C2'" . DC  I 5 75  ? -14.490 -28.240 92.877 1.00 124.44 ? 2    DC  I "C2'" 1 
ATOM   7607  C  "C1'" . DC  I 5 75  ? -15.621 -28.371 91.857 1.00 120.26 ? 2    DC  I "C1'" 1 
ATOM   7608  N  N1    . DC  I 5 75  ? -15.562 -27.361 90.784 1.00 114.44 ? 2    DC  I N1    1 
ATOM   7609  C  C2    . DC  I 5 75  ? -15.904 -27.716 89.472 1.00 111.20 ? 2    DC  I C2    1 
ATOM   7610  O  O2    . DC  I 5 75  ? -16.224 -28.890 89.231 1.00 104.67 ? 2    DC  I O2    1 
ATOM   7611  N  N3    . DC  I 5 75  ? -15.867 -26.773 88.501 1.00 107.41 ? 2    DC  I N3    1 
ATOM   7612  C  C4    . DC  I 5 75  ? -15.523 -25.518 88.803 1.00 109.38 ? 2    DC  I C4    1 
ATOM   7613  N  N4    . DC  I 5 75  ? -15.500 -24.620 87.817 1.00 101.59 ? 2    DC  I N4    1 
ATOM   7614  C  C5    . DC  I 5 75  ? -15.180 -25.130 90.131 1.00 118.95 ? 2    DC  I C5    1 
ATOM   7615  C  C6    . DC  I 5 75  ? -15.220 -26.071 91.082 1.00 115.30 ? 2    DC  I C6    1 
ATOM   7616  P  P     . DA  I 5 76  ? -13.602 -30.666 95.098 1.00 134.15 ? 3    DA  I P     1 
ATOM   7617  O  OP1   . DA  I 5 76  ? -13.973 -30.969 96.498 1.00 138.17 ? 3    DA  I OP1   1 
ATOM   7618  O  OP2   . DA  I 5 76  ? -12.520 -29.681 94.817 1.00 111.50 ? 3    DA  I OP2   1 
ATOM   7619  O  "O5'" . DA  I 5 76  ? -13.293 -32.058 94.391 1.00 133.14 ? 3    DA  I "O5'" 1 
ATOM   7620  C  "C5'" . DA  I 5 76  ? -14.354 -32.949 93.983 1.00 133.06 ? 3    DA  I "C5'" 1 
ATOM   7621  C  "C4'" . DA  I 5 76  ? -13.966 -33.646 92.704 1.00 126.33 ? 3    DA  I "C4'" 1 
ATOM   7622  O  "O4'" . DA  I 5 76  ? -14.057 -32.704 91.597 1.00 126.59 ? 3    DA  I "O4'" 1 
ATOM   7623  C  "C3'" . DA  I 5 76  ? -12.539 -34.195 92.683 1.00 125.16 ? 3    DA  I "C3'" 1 
ATOM   7624  O  "O3'" . DA  I 5 76  ? -12.623 -35.500 92.131 1.00 121.39 ? 3    DA  I "O3'" 1 
ATOM   7625  C  "C2'" . DA  I 5 76  ? -11.774 -33.138 91.883 1.00 123.22 ? 3    DA  I "C2'" 1 
ATOM   7626  C  "C1'" . DA  I 5 76  ? -12.838 -32.695 90.883 1.00 126.05 ? 3    DA  I "C1'" 1 
ATOM   7627  N  N9    . DA  I 5 76  ? -12.631 -31.355 90.338 1.00 114.63 ? 3    DA  I N9    1 
ATOM   7628  C  C8    . DA  I 5 76  ? -12.115 -30.256 90.975 1.00 109.32 ? 3    DA  I C8    1 
ATOM   7629  N  N7    . DA  I 5 76  ? -12.050 -29.188 90.217 1.00 111.85 ? 3    DA  I N7    1 
ATOM   7630  C  C5    . DA  I 5 76  ? -12.562 -29.611 88.999 1.00 117.19 ? 3    DA  I C5    1 
ATOM   7631  C  C6    . DA  I 5 76  ? -12.767 -28.947 87.773 1.00 104.66 ? 3    DA  I C6    1 
ATOM   7632  N  N6    . DA  I 5 76  ? -12.470 -27.664 87.564 1.00 91.44  ? 3    DA  I N6    1 
ATOM   7633  N  N1    . DA  I 5 76  ? -13.292 -29.660 86.754 1.00 106.54 ? 3    DA  I N1    1 
ATOM   7634  C  C2    . DA  I 5 76  ? -13.586 -30.952 86.960 1.00 112.35 ? 3    DA  I C2    1 
ATOM   7635  N  N3    . DA  I 5 76  ? -13.439 -31.685 88.062 1.00 112.26 ? 3    DA  I N3    1 
ATOM   7636  C  C4    . DA  I 5 76  ? -12.919 -30.946 89.057 1.00 118.78 ? 3    DA  I C4    1 
ATOM   7637  P  P     . DG  I 5 77  ? -11.326 -36.440 92.028 1.00 133.08 ? 4    DG  I P     1 
ATOM   7638  O  OP1   . DG  I 5 77  ? -11.385 -37.444 93.118 1.00 135.81 ? 4    DG  I OP1   1 
ATOM   7639  O  OP2   . DG  I 5 77  ? -10.117 -35.579 91.883 1.00 119.87 ? 4    DG  I OP2   1 
ATOM   7640  O  "O5'" . DG  I 5 77  ? -11.612 -37.271 90.699 1.00 131.26 ? 4    DG  I "O5'" 1 
ATOM   7641  C  "C5'" . DG  I 5 77  ? -12.612 -36.846 89.754 1.00 113.01 ? 4    DG  I "C5'" 1 
ATOM   7642  C  "C4'" . DG  I 5 77  ? -11.977 -36.574 88.413 1.00 95.65  ? 4    DG  I "C4'" 1 
ATOM   7643  O  "O4'" . DG  I 5 77  ? -11.671 -35.160 88.250 1.00 90.99  ? 4    DG  I "O4'" 1 
ATOM   7644  C  "C3'" . DG  I 5 77  ? -10.674 -37.304 88.143 1.00 81.69  ? 4    DG  I "C3'" 1 
ATOM   7645  O  "O3'" . DG  I 5 77  ? -10.959 -37.645 86.814 1.00 85.20  ? 4    DG  I "O3'" 1 
ATOM   7646  C  "C2'" . DG  I 5 77  ? -9.620  -36.212 88.307 1.00 80.99  ? 4    DG  I "C2'" 1 
ATOM   7647  C  "C1'" . DG  I 5 77  ? -10.370 -35.026 87.716 1.00 92.66  ? 4    DG  I "C1'" 1 
ATOM   7648  N  N9    . DG  I 5 77  ? -9.869  -33.689 88.032 1.00 105.81 ? 4    DG  I N9    1 
ATOM   7649  C  C8    . DG  I 5 77  ? -9.216  -33.290 89.172 1.00 105.52 ? 4    DG  I C8    1 
ATOM   7650  N  N7    . DG  I 5 77  ? -8.926  -32.018 89.177 1.00 103.63 ? 4    DG  I N7    1 
ATOM   7651  C  C5    . DG  I 5 77  ? -9.405  -31.550 87.962 1.00 103.65 ? 4    DG  I C5    1 
ATOM   7652  C  C6    . DG  I 5 77  ? -9.364  -30.250 87.400 1.00 108.14 ? 4    DG  I C6    1 
ATOM   7653  O  O6    . DG  I 5 77  ? -8.882  -29.219 87.880 1.00 100.06 ? 4    DG  I O6    1 
ATOM   7654  N  N1    . DG  I 5 77  ? -9.969  -30.215 86.148 1.00 110.77 ? 4    DG  I N1    1 
ATOM   7655  C  C2    . DG  I 5 77  ? -10.532 -31.293 85.513 1.00 113.85 ? 4    DG  I C2    1 
ATOM   7656  N  N2    . DG  I 5 77  ? -11.067 -31.057 84.307 1.00 129.05 ? 4    DG  I N2    1 
ATOM   7657  N  N3    . DG  I 5 77  ? -10.573 -32.512 86.025 1.00 112.11 ? 4    DG  I N3    1 
ATOM   7658  C  C4    . DG  I 5 77  ? -9.995  -32.567 87.245 1.00 109.66 ? 4    DG  I C4    1 
ATOM   7659  P  P     . DC  I 5 78  ? -10.146 -38.773 86.129 1.00 100.83 ? 5    DC  I P     1 
ATOM   7660  O  OP1   . DC  I 5 78  ? -11.119 -39.773 85.620 1.00 102.76 ? 5    DC  I OP1   1 
ATOM   7661  O  OP2   . DC  I 5 78  ? -9.037  -39.151 87.039 1.00 86.59  ? 5    DC  I OP2   1 
ATOM   7662  O  "O5'" . DC  I 5 78  ? -9.446  -38.046 84.895 1.00 116.96 ? 5    DC  I "O5'" 1 
ATOM   7663  C  "C5'" . DC  I 5 78  ? -10.142 -37.112 84.044 1.00 112.70 ? 5    DC  I "C5'" 1 
ATOM   7664  C  "C4'" . DC  I 5 78  ? -9.135  -36.236 83.337 1.00 106.67 ? 5    DC  I "C4'" 1 
ATOM   7665  O  "O4'" . DC  I 5 78  ? -8.743  -35.138 84.206 1.00 95.69  ? 5    DC  I "O4'" 1 
ATOM   7666  C  "C3'" . DC  I 5 78  ? -7.831  -36.920 82.919 1.00 107.10 ? 5    DC  I "C3'" 1 
ATOM   7667  O  "O3'" . DC  I 5 78  ? -7.463  -36.492 81.619 1.00 112.92 ? 5    DC  I "O3'" 1 
ATOM   7668  C  "C2'" . DC  I 5 78  ? -6.809  -36.369 83.907 1.00 108.94 ? 5    DC  I "C2'" 1 
ATOM   7669  C  "C1'" . DC  I 5 78  ? -7.350  -34.962 84.110 1.00 107.61 ? 5    DC  I "C1'" 1 
ATOM   7670  N  N1    . DC  I 5 78  ? -6.879  -34.275 85.316 1.00 114.95 ? 5    DC  I N1    1 
ATOM   7671  C  C2    . DC  I 5 78  ? -6.847  -32.883 85.307 1.00 115.64 ? 5    DC  I C2    1 
ATOM   7672  O  O2    . DC  I 5 78  ? -7.221  -32.285 84.289 1.00 124.79 ? 5    DC  I O2    1 
ATOM   7673  N  N3    . DC  I 5 78  ? -6.423  -32.224 86.408 1.00 118.47 ? 5    DC  I N3    1 
ATOM   7674  C  C4    . DC  I 5 78  ? -6.043  -32.908 87.490 1.00 121.89 ? 5    DC  I C4    1 
ATOM   7675  N  N4    . DC  I 5 78  ? -5.633  -32.217 88.556 1.00 139.41 ? 5    DC  I N4    1 
ATOM   7676  C  C5    . DC  I 5 78  ? -6.061  -34.331 87.524 1.00 116.17 ? 5    DC  I C5    1 
ATOM   7677  C  C6    . DC  I 5 78  ? -6.485  -34.969 86.427 1.00 118.10 ? 5    DC  I C6    1 
ATOM   7678  P  P     . DT  I 5 79  ? -7.470  -37.521 80.415 1.00 103.63 ? 6    DT  I P     1 
ATOM   7679  O  OP1   . DT  I 5 79  ? -8.672  -38.382 80.560 1.00 105.90 ? 6    DT  I OP1   1 
ATOM   7680  O  OP2   . DT  I 5 79  ? -6.088  -38.092 80.275 1.00 80.00  ? 6    DT  I OP2   1 
ATOM   7681  O  "O5'" . DT  I 5 79  ? -7.817  -36.611 79.159 1.00 100.93 ? 6    DT  I "O5'" 1 
ATOM   7682  C  "C5'" . DT  I 5 79  ? -8.790  -35.560 79.236 1.00 86.96  ? 6    DT  I "C5'" 1 
ATOM   7683  C  "C4'" . DT  I 5 79  ? -8.146  -34.255 78.822 1.00 77.65  ? 6    DT  I "C4'" 1 
ATOM   7684  O  "O4'" . DT  I 5 79  ? -7.468  -33.648 79.951 1.00 69.26  ? 6    DT  I "O4'" 1 
ATOM   7685  C  "C3'" . DT  I 5 79  ? -7.094  -34.346 77.711 1.00 71.57  ? 6    DT  I "C3'" 1 
ATOM   7686  O  "O3'" . DT  I 5 79  ? -7.041  -33.095 77.045 1.00 72.36  ? 6    DT  I "O3'" 1 
ATOM   7687  C  "C2'" . DT  I 5 79  ? -5.794  -34.316 78.475 1.00 70.58  ? 6    DT  I "C2'" 1 
ATOM   7688  C  "C1'" . DT  I 5 79  ? -6.153  -33.306 79.547 1.00 76.92  ? 6    DT  I "C1'" 1 
ATOM   7689  N  N1    . DT  I 5 79  ? -5.292  -33.305 80.737 1.00 84.25  ? 6    DT  I N1    1 
ATOM   7690  C  C2    . DT  I 5 79  ? -5.169  -32.136 81.450 1.00 90.10  ? 6    DT  I C2    1 
ATOM   7691  O  O2    . DT  I 5 79  ? -5.743  -31.104 81.145 1.00 86.22  ? 6    DT  I O2    1 
ATOM   7692  N  N3    . DT  I 5 79  ? -4.348  -32.219 82.546 1.00 95.14  ? 6    DT  I N3    1 
ATOM   7693  C  C4    . DT  I 5 79  ? -3.659  -33.328 82.990 1.00 96.74  ? 6    DT  I C4    1 
ATOM   7694  O  O4    . DT  I 5 79  ? -2.951  -33.245 83.990 1.00 107.29 ? 6    DT  I O4    1 
ATOM   7695  C  C5    . DT  I 5 79  ? -3.839  -34.524 82.195 1.00 95.91  ? 6    DT  I C5    1 
ATOM   7696  C  C7    . DT  I 5 79  ? -3.130  -35.780 82.594 1.00 96.40  ? 6    DT  I C7    1 
ATOM   7697  C  C6    . DT  I 5 79  ? -4.629  -34.449 81.119 1.00 92.61  ? 6    DT  I C6    1 
ATOM   7698  P  P     . DG  I 5 80  ? -7.096  -32.958 75.481 1.00 69.36  ? 7    DG  I P     1 
ATOM   7699  O  OP1   . DG  I 5 80  ? -8.466  -32.486 75.164 1.00 64.79  ? 7    DG  I OP1   1 
ATOM   7700  O  OP2   . DG  I 5 80  ? -6.518  -34.165 74.850 1.00 61.66  ? 7    DG  I OP2   1 
ATOM   7701  O  "O5'" . DG  I 5 80  ? -6.072  -31.767 75.232 1.00 67.03  ? 7    DG  I "O5'" 1 
ATOM   7702  C  "C5'" . DG  I 5 80  ? -6.315  -30.490 75.860 1.00 63.70  ? 7    DG  I "C5'" 1 
ATOM   7703  C  "C4'" . DG  I 5 80  ? -5.025  -29.779 76.193 1.00 62.54  ? 7    DG  I "C4'" 1 
ATOM   7704  O  "O4'" . DG  I 5 80  ? -4.442  -30.399 77.359 1.00 67.42  ? 7    DG  I "O4'" 1 
ATOM   7705  C  "C3'" . DG  I 5 80  ? -3.922  -29.759 75.125 1.00 64.09  ? 7    DG  I "C3'" 1 
ATOM   7706  O  "O3'" . DG  I 5 80  ? -3.403  -28.443 75.175 1.00 58.32  ? 7    DG  I "O3'" 1 
ATOM   7707  C  "C2'" . DG  I 5 80  ? -2.916  -30.786 75.633 1.00 62.83  ? 7    DG  I "C2'" 1 
ATOM   7708  C  "C1'" . DG  I 5 80  ? -3.060  -30.587 77.136 1.00 74.43  ? 7    DG  I "C1'" 1 
ATOM   7709  N  N9    . DG  I 5 80  ? -2.606  -31.673 77.996 1.00 77.44  ? 7    DG  I N9    1 
ATOM   7710  C  C8    . DG  I 5 80  ? -2.664  -33.026 77.773 1.00 82.52  ? 7    DG  I C8    1 
ATOM   7711  N  N7    . DG  I 5 80  ? -2.197  -33.728 78.768 1.00 87.70  ? 7    DG  I N7    1 
ATOM   7712  C  C5    . DG  I 5 80  ? -1.802  -32.779 79.699 1.00 93.85  ? 7    DG  I C5    1 
ATOM   7713  C  C6    . DG  I 5 80  ? -1.210  -32.934 80.976 1.00 97.14  ? 7    DG  I C6    1 
ATOM   7714  O  O6    . DG  I 5 80  ? -0.911  -33.979 81.564 1.00 95.66  ? 7    DG  I O6    1 
ATOM   7715  N  N1    . DG  I 5 80  ? -0.975  -31.706 81.582 1.00 93.10  ? 7    DG  I N1    1 
ATOM   7716  C  C2    . DG  I 5 80  ? -1.276  -30.486 81.034 1.00 80.66  ? 7    DG  I C2    1 
ATOM   7717  N  N2    . DG  I 5 80  ? -0.983  -29.413 81.776 1.00 83.07  ? 7    DG  I N2    1 
ATOM   7718  N  N3    . DG  I 5 80  ? -1.836  -30.329 79.852 1.00 88.74  ? 7    DG  I N3    1 
ATOM   7719  C  C4    . DG  I 5 80  ? -2.061  -31.508 79.241 1.00 84.88  ? 7    DG  I C4    1 
ATOM   7720  P  P     . DA  I 5 81  ? -2.441  -27.876 74.045 1.00 61.08  ? 8    DA  I P     1 
ATOM   7721  O  OP1   . DA  I 5 81  ? -3.262  -27.144 73.054 1.00 69.46  ? 8    DA  I OP1   1 
ATOM   7722  O  OP2   . DA  I 5 81  ? -1.526  -28.931 73.579 1.00 64.05  ? 8    DA  I OP2   1 
ATOM   7723  O  "O5'" . DA  I 5 81  ? -1.565  -26.837 74.864 1.00 63.84  ? 8    DA  I "O5'" 1 
ATOM   7724  C  "C5'" . DA  I 5 81  ? -2.079  -26.294 76.103 1.00 63.99  ? 8    DA  I "C5'" 1 
ATOM   7725  C  "C4'" . DA  I 5 81  ? -1.003  -25.549 76.851 1.00 60.20  ? 8    DA  I "C4'" 1 
ATOM   7726  O  "O4'" . DA  I 5 81  ? -0.427  -26.421 77.855 1.00 57.47  ? 8    DA  I "O4'" 1 
ATOM   7727  C  "C3'" . DA  I 5 81  ? 0.181   -25.060 76.018 1.00 58.30  ? 8    DA  I "C3'" 1 
ATOM   7728  O  "O3'" . DA  I 5 81  ? 0.661   -23.883 76.656 1.00 62.91  ? 8    DA  I "O3'" 1 
ATOM   7729  C  "C2'" . DA  I 5 81  ? 1.121   -26.253 76.046 1.00 56.32  ? 8    DA  I "C2'" 1 
ATOM   7730  C  "C1'" . DA  I 5 81  ? 0.867   -26.825 77.443 1.00 66.08  ? 8    DA  I "C1'" 1 
ATOM   7731  N  N9    . DA  I 5 81  ? 0.918   -28.285 77.505 1.00 71.04  ? 8    DA  I N9    1 
ATOM   7732  C  C8    . DA  I 5 81  ? 0.420   -29.177 76.591 1.00 67.52  ? 8    DA  I C8    1 
ATOM   7733  N  N7    . DA  I 5 81  ? 0.571   -30.430 76.940 1.00 73.67  ? 8    DA  I N7    1 
ATOM   7734  C  C5    . DA  I 5 81  ? 1.205   -30.359 78.171 1.00 82.33  ? 8    DA  I C5    1 
ATOM   7735  C  C6    . DA  I 5 81  ? 1.637   -31.346 79.070 1.00 80.69  ? 8    DA  I C6    1 
ATOM   7736  N  N6    . DA  I 5 81  ? 1.507   -32.652 78.850 1.00 86.25  ? 8    DA  I N6    1 
ATOM   7737  N  N1    . DA  I 5 81  ? 2.236   -30.939 80.208 1.00 90.28  ? 8    DA  I N1    1 
ATOM   7738  C  C2    . DA  I 5 81  ? 2.370   -29.626 80.429 1.00 83.54  ? 8    DA  I C2    1 
ATOM   7739  N  N3    . DA  I 5 81  ? 2.001   -28.604 79.665 1.00 86.62  ? 8    DA  I N3    1 
ATOM   7740  C  C4    . DA  I 5 81  ? 1.416   -29.043 78.536 1.00 84.04  ? 8    DA  I C4    1 
ATOM   7741  P  P     . DA  I 5 82  ? 1.811   -22.999 76.003 1.00 66.90  ? 9    DA  I P     1 
ATOM   7742  O  OP1   . DA  I 5 82  ? 1.467   -21.582 76.275 1.00 63.16  ? 9    DA  I OP1   1 
ATOM   7743  O  OP2   . DA  I 5 82  ? 2.045   -23.474 74.609 1.00 65.57  ? 9    DA  I OP2   1 
ATOM   7744  O  "O5'" . DA  I 5 82  ? 3.115   -23.441 76.807 1.00 66.01  ? 9    DA  I "O5'" 1 
ATOM   7745  C  "C5'" . DA  I 5 82  ? 3.149   -23.332 78.239 1.00 64.04  ? 9    DA  I "C5'" 1 
ATOM   7746  C  "C4'" . DA  I 5 82  ? 4.367   -24.016 78.810 1.00 63.17  ? 9    DA  I "C4'" 1 
ATOM   7747  O  "O4'" . DA  I 5 82  ? 4.174   -25.451 78.818 1.00 62.09  ? 9    DA  I "O4'" 1 
ATOM   7748  C  "C3'" . DA  I 5 82  ? 5.700   -23.753 78.110 1.00 61.23  ? 9    DA  I "C3'" 1 
ATOM   7749  O  "O3'" . DA  I 5 82  ? 6.573   -23.216 79.093 1.00 72.73  ? 9    DA  I "O3'" 1 
ATOM   7750  C  "C2'" . DA  I 5 82  ? 6.131   -25.123 77.593 1.00 64.01  ? 9    DA  I "C2'" 1 
ATOM   7751  C  "C1'" . DA  I 5 82  ? 5.405   -26.078 78.535 1.00 66.69  ? 9    DA  I "C1'" 1 
ATOM   7752  N  N9    . DA  I 5 82  ? 5.112   -27.385 77.947 1.00 73.91  ? 9    DA  I N9    1 
ATOM   7753  C  C8    . DA  I 5 82  ? 4.574   -27.618 76.707 1.00 81.60  ? 9    DA  I C8    1 
ATOM   7754  N  N7    . DA  I 5 82  ? 4.371   -28.887 76.450 1.00 85.72  ? 9    DA  I N7    1 
ATOM   7755  C  C5    . DA  I 5 82  ? 4.804   -29.533 77.598 1.00 93.29  ? 9    DA  I C5    1 
ATOM   7756  C  C6    . DA  I 5 82  ? 4.856   -30.889 77.957 1.00 88.56  ? 9    DA  I C6    1 
ATOM   7757  N  N6    . DA  I 5 82  ? 4.458   -31.880 77.161 1.00 91.66  ? 9    DA  I N6    1 
ATOM   7758  N  N1    . DA  I 5 82  ? 5.323   -31.198 79.183 1.00 87.57  ? 9    DA  I N1    1 
ATOM   7759  C  C2    . DA  I 5 82  ? 5.724   -30.206 79.981 1.00 91.66  ? 9    DA  I C2    1 
ATOM   7760  N  N3    . DA  I 5 82  ? 5.733   -28.895 79.756 1.00 98.19  ? 9    DA  I N3    1 
ATOM   7761  C  C4    . DA  I 5 82  ? 5.249   -28.620 78.534 1.00 87.61  ? 9    DA  I C4    1 
ATOM   7762  P  P     . DC  I 5 83  ? 7.996   -22.584 78.708 1.00 75.06  ? 10   DC  I P     1 
ATOM   7763  O  OP1   . DC  I 5 83  ? 8.237   -21.462 79.667 1.00 69.28  ? 10   DC  I OP1   1 
ATOM   7764  O  OP2   . DC  I 5 83  ? 8.052   -22.387 77.241 1.00 71.55  ? 10   DC  I OP2   1 
ATOM   7765  O  "O5'" . DC  I 5 83  ? 9.011   -23.790 78.916 1.00 71.83  ? 10   DC  I "O5'" 1 
ATOM   7766  C  "C5'" . DC  I 5 83  ? 8.926   -24.613 80.088 1.00 70.40  ? 10   DC  I "C5'" 1 
ATOM   7767  C  "C4'" . DC  I 5 83  ? 9.879   -25.765 79.959 1.00 70.09  ? 10   DC  I "C4'" 1 
ATOM   7768  O  "O4'" . DC  I 5 83  ? 9.191   -26.925 79.422 1.00 72.96  ? 10   DC  I "O4'" 1 
ATOM   7769  C  "C3'" . DC  I 5 83  ? 11.081  -25.538 79.046 1.00 73.56  ? 10   DC  I "C3'" 1 
ATOM   7770  O  "O3'" . DC  I 5 83  ? 12.162  -26.124 79.747 1.00 83.80  ? 10   DC  I "O3'" 1 
ATOM   7771  C  "C2'" . DC  I 5 83  ? 10.717  -26.342 77.807 1.00 75.18  ? 10   DC  I "C2'" 1 
ATOM   7772  C  "C1'" . DC  I 5 83  ? 10.018  -27.526 78.456 1.00 76.51  ? 10   DC  I "C1'" 1 
ATOM   7773  N  N1    . DC  I 5 83  ? 9.189   -28.327 77.556 1.00 85.74  ? 10   DC  I N1    1 
ATOM   7774  C  C2    . DC  I 5 83  ? 8.865   -29.629 77.933 1.00 85.16  ? 10   DC  I C2    1 
ATOM   7775  O  O2    . DC  I 5 83  ? 9.268   -30.049 79.019 1.00 95.53  ? 10   DC  I O2    1 
ATOM   7776  N  N3    . DC  I 5 83  ? 8.112   -30.390 77.112 1.00 91.90  ? 10   DC  I N3    1 
ATOM   7777  C  C4    . DC  I 5 83  ? 7.711   -29.904 75.938 1.00 88.75  ? 10   DC  I C4    1 
ATOM   7778  N  N4    . DC  I 5 83  ? 6.975   -30.690 75.158 1.00 89.72  ? 10   DC  I N4    1 
ATOM   7779  C  C5    . DC  I 5 83  ? 8.027   -28.578 75.524 1.00 91.10  ? 10   DC  I C5    1 
ATOM   7780  C  C6    . DC  I 5 83  ? 8.762   -27.830 76.356 1.00 90.09  ? 10   DC  I C6    1 
ATOM   7781  P  P     . DA  I 5 84  ? 13.657  -25.753 79.406 1.00 86.23  ? 11   DA  I P     1 
ATOM   7782  O  OP1   . DA  I 5 84  ? 13.909  -24.406 79.961 1.00 77.64  ? 11   DA  I OP1   1 
ATOM   7783  O  OP2   . DA  I 5 84  ? 13.892  -26.001 77.965 1.00 78.98  ? 11   DA  I OP2   1 
ATOM   7784  O  "O5'" . DA  I 5 84  ? 14.458  -26.886 80.190 1.00 85.65  ? 11   DA  I "O5'" 1 
ATOM   7785  C  "C5'" . DA  I 5 84  ? 13.777  -27.933 80.922 1.00 88.72  ? 11   DA  I "C5'" 1 
ATOM   7786  C  "C4'" . DA  I 5 84  ? 14.450  -29.273 80.711 1.00 95.96  ? 11   DA  I "C4'" 1 
ATOM   7787  O  "O4'" . DA  I 5 84  ? 13.620  -30.101 79.847 1.00 99.50  ? 11   DA  I "O4'" 1 
ATOM   7788  C  "C3'" . DA  I 5 84  ? 15.822  -29.255 80.036 1.00 105.60 ? 11   DA  I "C3'" 1 
ATOM   7789  O  "O3'" . DA  I 5 84  ? 16.516  -30.439 80.436 1.00 126.18 ? 11   DA  I "O3'" 1 
ATOM   7790  C  "C2'" . DA  I 5 84  ? 15.445  -29.327 78.569 1.00 107.00 ? 11   DA  I "C2'" 1 
ATOM   7791  C  "C1'" . DA  I 5 84  ? 14.307  -30.347 78.631 1.00 113.75 ? 11   DA  I "C1'" 1 
ATOM   7792  N  N9    . DA  I 5 84  ? 13.372  -30.222 77.515 1.00 116.95 ? 11   DA  I N9    1 
ATOM   7793  C  C8    . DA  I 5 84  ? 13.087  -29.087 76.797 1.00 113.75 ? 11   DA  I C8    1 
ATOM   7794  N  N7    . DA  I 5 84  ? 12.242  -29.280 75.816 1.00 117.02 ? 11   DA  I N7    1 
ATOM   7795  C  C5    . DA  I 5 84  ? 11.965  -30.638 75.878 1.00 122.20 ? 11   DA  I C5    1 
ATOM   7796  C  C6    . DA  I 5 84  ? 11.138  -31.467 75.106 1.00 116.83 ? 11   DA  I C6    1 
ATOM   7797  N  N6    . DA  I 5 84  ? 10.403  -31.029 74.084 1.00 98.43  ? 11   DA  I N6    1 
ATOM   7798  N  N1    . DA  I 5 84  ? 11.080  -32.778 75.433 1.00 129.42 ? 11   DA  I N1    1 
ATOM   7799  C  C2    . DA  I 5 84  ? 11.818  -33.215 76.463 1.00 120.24 ? 11   DA  I C2    1 
ATOM   7800  N  N3    . DA  I 5 84  ? 12.636  -32.532 77.261 1.00 117.39 ? 11   DA  I N3    1 
ATOM   7801  C  C4    . DA  I 5 84  ? 12.664  -31.234 76.912 1.00 118.37 ? 11   DA  I C4    1 
ATOM   7802  P  P     . DT  I 5 85  ? 18.088  -30.646 80.119 1.00 126.83 ? 12   DT  I P     1 
ATOM   7803  O  OP1   . DT  I 5 85  ? 18.783  -30.919 81.410 1.00 116.86 ? 12   DT  I OP1   1 
ATOM   7804  O  OP2   . DT  I 5 85  ? 18.549  -29.523 79.242 1.00 106.18 ? 12   DT  I OP2   1 
ATOM   7805  O  "O5'" . DT  I 5 85  ? 18.105  -32.008 79.292 1.00 118.44 ? 12   DT  I "O5'" 1 
ATOM   7806  C  "C5'" . DT  I 5 85  ? 17.123  -33.046 79.516 1.00 127.23 ? 12   DT  I "C5'" 1 
ATOM   7807  C  "C4'" . DT  I 5 85  ? 17.078  -33.972 78.323 1.00 130.42 ? 12   DT  I "C4'" 1 
ATOM   7808  O  "O4'" . DT  I 5 85  ? 16.024  -33.556 77.414 1.00 140.84 ? 12   DT  I "O4'" 1 
ATOM   7809  C  "C3'" . DT  I 5 85  ? 18.372  -33.982 77.502 1.00 133.01 ? 12   DT  I "C3'" 1 
ATOM   7810  O  "O3'" . DT  I 5 85  ? 18.790  -35.308 77.163 1.00 134.65 ? 12   DT  I "O3'" 1 
ATOM   7811  C  "C2'" . DT  I 5 85  ? 18.012  -33.189 76.260 1.00 137.66 ? 12   DT  I "C2'" 1 
ATOM   7812  C  "C1'" . DT  I 5 85  ? 16.546  -33.550 76.097 1.00 140.28 ? 12   DT  I "C1'" 1 
ATOM   7813  N  N1    . DT  I 5 85  ? 15.739  -32.623 75.267 1.00 138.01 ? 12   DT  I N1    1 
ATOM   7814  C  C2    . DT  I 5 85  ? 14.718  -33.152 74.509 1.00 128.51 ? 12   DT  I C2    1 
ATOM   7815  O  O2    . DT  I 5 85  ? 14.410  -34.332 74.538 1.00 105.46 ? 12   DT  I O2    1 
ATOM   7816  N  N3    . DT  I 5 85  ? 14.047  -32.238 73.734 1.00 133.44 ? 12   DT  I N3    1 
ATOM   7817  C  C4    . DT  I 5 85  ? 14.298  -30.881 73.637 1.00 133.31 ? 12   DT  I C4    1 
ATOM   7818  O  O4    . DT  I 5 85  ? 13.605  -30.182 72.903 1.00 114.18 ? 12   DT  I O4    1 
ATOM   7819  C  C5    . DT  I 5 85  ? 15.391  -30.397 74.449 1.00 141.12 ? 12   DT  I C5    1 
ATOM   7820  C  C7    . DT  I 5 85  ? 15.734  -28.941 74.412 1.00 138.97 ? 12   DT  I C7    1 
ATOM   7821  C  C6    . DT  I 5 85  ? 16.054  -31.281 75.204 1.00 144.36 ? 12   DT  I C6    1 
ATOM   7822  P  P     . DG  I 5 86  ? 20.344  -35.605 76.888 1.00 138.58 ? 13   DG  I P     1 
ATOM   7823  O  OP1   . DG  I 5 86  ? 20.906  -36.195 78.129 1.00 139.94 ? 13   DG  I OP1   1 
ATOM   7824  O  OP2   . DG  I 5 86  ? 20.964  -34.386 76.273 1.00 112.42 ? 13   DG  I OP2   1 
ATOM   7825  O  "O5'" . DG  I 5 86  ? 20.334  -36.706 75.735 1.00 134.11 ? 13   DG  I "O5'" 1 
ATOM   7826  C  "C5'" . DG  I 5 86  ? 19.392  -37.797 75.718 1.00 129.95 ? 13   DG  I "C5'" 1 
ATOM   7827  C  "C4'" . DG  I 5 86  ? 19.071  -38.202 74.293 1.00 126.51 ? 13   DG  I "C4'" 1 
ATOM   7828  O  "O4'" . DG  I 5 86  ? 18.123  -37.260 73.710 1.00 133.52 ? 13   DG  I "O4'" 1 
ATOM   7829  C  "C3'" . DG  I 5 86  ? 20.244  -38.268 73.315 1.00 125.94 ? 13   DG  I "C3'" 1 
ATOM   7830  O  "O3'" . DG  I 5 86  ? 20.042  -39.426 72.495 1.00 112.93 ? 13   DG  I "O3'" 1 
ATOM   7831  C  "C2'" . DG  I 5 86  ? 20.142  -36.926 72.587 1.00 124.73 ? 13   DG  I "C2'" 1 
ATOM   7832  C  "C1'" . DG  I 5 86  ? 18.625  -36.785 72.473 1.00 135.61 ? 13   DG  I "C1'" 1 
ATOM   7833  N  N9    . DG  I 5 86  ? 18.121  -35.429 72.266 1.00 136.43 ? 13   DG  I N9    1 
ATOM   7834  C  C8    . DG  I 5 86  ? 18.534  -34.285 72.906 1.00 136.04 ? 13   DG  I C8    1 
ATOM   7835  N  N7    . DG  I 5 86  ? 17.872  -33.222 72.535 1.00 124.80 ? 13   DG  I N7    1 
ATOM   7836  C  C5    . DG  I 5 86  ? 16.964  -33.693 71.597 1.00 129.95 ? 13   DG  I C5    1 
ATOM   7837  C  C6    . DG  I 5 86  ? 15.986  -33.001 70.841 1.00 123.23 ? 13   DG  I C6    1 
ATOM   7838  O  O6    . DG  I 5 86  ? 15.707  -31.798 70.863 1.00 121.47 ? 13   DG  I O6    1 
ATOM   7839  N  N1    . DG  I 5 86  ? 15.286  -33.860 70.001 1.00 134.12 ? 13   DG  I N1    1 
ATOM   7840  C  C2    . DG  I 5 86  ? 15.500  -35.213 69.900 1.00 136.47 ? 13   DG  I C2    1 
ATOM   7841  N  N2    . DG  I 5 86  ? 14.714  -35.874 69.039 1.00 143.56 ? 13   DG  I N2    1 
ATOM   7842  N  N3    . DG  I 5 86  ? 16.408  -35.872 70.603 1.00 142.45 ? 13   DG  I N3    1 
ATOM   7843  C  C4    . DG  I 5 86  ? 17.100  -35.054 71.424 1.00 139.01 ? 13   DG  I C4    1 
ATOM   7844  P  P     . DC  I 5 87  ? 21.143  -39.880 71.412 1.00 113.31 ? 14   DC  I P     1 
ATOM   7845  O  OP1   . DC  I 5 87  ? 21.233  -41.360 71.435 1.00 113.43 ? 14   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I 5 87  ? 22.347  -39.020 71.551 1.00 104.57 ? 14   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I 5 87  ? 20.528  -39.425 70.021 1.00 121.32 ? 14   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I 5 87  ? 19.407  -40.103 69.441 1.00 123.35 ? 14   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I 5 87  ? 18.996  -39.370 68.193 1.00 112.68 ? 14   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I 5 87  ? 18.610  -38.019 68.561 1.00 98.30  ? 14   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I 5 87  ? 20.094  -39.230 67.129 1.00 103.21 ? 14   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I 5 87  ? 19.683  -39.611 65.813 1.00 98.49  ? 14   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I 5 87  ? 20.439  -37.739 67.168 1.00 105.21 ? 14   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I 5 87  ? 19.100  -37.136 67.585 1.00 108.73 ? 14   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I 5 87  ? 19.139  -35.784 68.163 1.00 120.77 ? 14   DC  I N1    1 
ATOM   7856  C  C2    . DC  I 5 87  ? 18.370  -34.786 67.562 1.00 123.18 ? 14   DC  I C2    1 
ATOM   7857  O  O2    . DC  I 5 87  ? 17.718  -35.065 66.543 1.00 118.39 ? 14   DC  I O2    1 
ATOM   7858  N  N3    . DC  I 5 87  ? 18.371  -33.539 68.091 1.00 113.95 ? 14   DC  I N3    1 
ATOM   7859  C  C4    . DC  I 5 87  ? 19.098  -33.277 69.179 1.00 105.18 ? 14   DC  I C4    1 
ATOM   7860  N  N4    . DC  I 5 87  ? 19.069  -32.036 69.665 1.00 103.22 ? 14   DC  I N4    1 
ATOM   7861  C  C5    . DC  I 5 87  ? 19.880  -34.281 69.822 1.00 117.91 ? 14   DC  I C5    1 
ATOM   7862  C  C6    . DC  I 5 87  ? 19.865  -35.511 69.290 1.00 125.14 ? 14   DC  I C6    1 
ATOM   7863  P  P     . DC  I 5 88  ? 19.323  -41.149 65.470 1.00 96.90  ? 15   DC  I P     1 
ATOM   7864  O  OP1   . DC  I 5 88  ? 18.920  -41.827 66.737 1.00 82.87  ? 15   DC  I OP1   1 
ATOM   7865  O  OP2   . DC  I 5 88  ? 20.389  -41.692 64.583 1.00 87.89  ? 15   DC  I OP2   1 
ATOM   7866  O  "O5'" . DC  I 5 88  ? 18.011  -41.048 64.570 1.00 100.04 ? 15   DC  I "O5'" 1 
ATOM   7867  C  "C5'" . DC  I 5 88  ? 16.710  -40.789 65.161 1.00 92.80  ? 15   DC  I "C5'" 1 
ATOM   7868  C  "C4'" . DC  I 5 88  ? 15.856  -39.957 64.228 1.00 82.34  ? 15   DC  I "C4'" 1 
ATOM   7869  O  "O4'" . DC  I 5 88  ? 16.412  -38.614 64.135 1.00 79.86  ? 15   DC  I "O4'" 1 
ATOM   7870  C  "C3'" . DC  I 5 88  ? 15.754  -40.467 62.790 1.00 79.17  ? 15   DC  I "C3'" 1 
ATOM   7871  O  "O3'" . DC  I 5 88  ? 14.472  -40.167 62.236 1.00 83.46  ? 15   DC  I "O3'" 1 
ATOM   7872  C  "C2'" . DC  I 5 88  ? 16.862  -39.695 62.092 1.00 75.09  ? 15   DC  I "C2'" 1 
ATOM   7873  C  "C1'" . DC  I 5 88  ? 16.749  -38.346 62.789 1.00 83.62  ? 15   DC  I "C1'" 1 
ATOM   7874  N  N1    . DC  I 5 88  ? 17.974  -37.536 62.745 1.00 95.01  ? 15   DC  I N1    1 
ATOM   7875  C  C2    . DC  I 5 88  ? 17.844  -36.149 62.800 1.00 104.44 ? 15   DC  I C2    1 
ATOM   7876  O  O2    . DC  I 5 88  ? 16.713  -35.660 62.940 1.00 101.03 ? 15   DC  I O2    1 
ATOM   7877  N  N3    . DC  I 5 88  ? 18.952  -35.376 62.719 1.00 124.73 ? 15   DC  I N3    1 
ATOM   7878  C  C4    . DC  I 5 88  ? 20.150  -35.944 62.563 1.00 115.28 ? 15   DC  I C4    1 
ATOM   7879  N  N4    . DC  I 5 88  ? 21.215  -35.146 62.482 1.00 113.28 ? 15   DC  I N4    1 
ATOM   7880  C  C5    . DC  I 5 88  ? 20.307  -37.356 62.475 1.00 106.49 ? 15   DC  I C5    1 
ATOM   7881  C  C6    . DC  I 5 88  ? 19.203  -38.108 62.564 1.00 101.53 ? 15   DC  I C6    1 
ATOM   7882  P  P     . DT  I 5 89  ? 13.964  -40.811 60.823 1.00 91.77  ? 16   DT  I P     1 
ATOM   7883  O  OP1   . DT  I 5 89  ? 12.732  -41.597 61.082 1.00 73.97  ? 16   DT  I OP1   1 
ATOM   7884  O  OP2   . DT  I 5 89  ? 15.118  -41.392 60.084 1.00 82.35  ? 16   DT  I OP2   1 
ATOM   7885  O  "O5'" . DT  I 5 89  ? 13.524  -39.536 59.983 1.00 83.04  ? 16   DT  I "O5'" 1 
ATOM   7886  C  "C5'" . DT  I 5 89  ? 12.968  -38.406 60.652 1.00 75.12  ? 16   DT  I "C5'" 1 
ATOM   7887  C  "C4'" . DT  I 5 89  ? 13.242  -37.164 59.842 1.00 74.84  ? 16   DT  I "C4'" 1 
ATOM   7888  O  "O4'" . DT  I 5 89  ? 14.594  -36.688 60.029 1.00 66.01  ? 16   DT  I "O4'" 1 
ATOM   7889  C  "C3'" . DT  I 5 89  ? 13.050  -37.326 58.334 1.00 71.97  ? 16   DT  I "C3'" 1 
ATOM   7890  O  "O3'" . DT  I 5 89  ? 11.995  -36.401 58.011 1.00 66.29  ? 16   DT  I "O3'" 1 
ATOM   7891  C  "C2'" . DT  I 5 89  ? 14.438  -37.057 57.760 1.00 72.63  ? 16   DT  I "C2'" 1 
ATOM   7892  C  "C1'" . DT  I 5 89  ? 15.053  -36.152 58.808 1.00 72.02  ? 16   DT  I "C1'" 1 
ATOM   7893  N  N1    . DT  I 5 89  ? 16.529  -36.089 58.877 1.00 86.19  ? 16   DT  I N1    1 
ATOM   7894  C  C2    . DT  I 5 89  ? 17.142  -34.856 58.928 1.00 91.67  ? 16   DT  I C2    1 
ATOM   7895  O  O2    . DT  I 5 89  ? 16.533  -33.803 58.852 1.00 91.86  ? 16   DT  I O2    1 
ATOM   7896  N  N3    . DT  I 5 89  ? 18.508  -34.901 59.051 1.00 104.97 ? 16   DT  I N3    1 
ATOM   7897  C  C4    . DT  I 5 89  ? 19.302  -36.029 59.145 1.00 102.22 ? 16   DT  I C4    1 
ATOM   7898  O  O4    . DT  I 5 89  ? 20.522  -35.912 59.259 1.00 97.93  ? 16   DT  I O4    1 
ATOM   7899  C  C5    . DT  I 5 89  ? 18.591  -37.287 59.099 1.00 89.80  ? 16   DT  I C5    1 
ATOM   7900  C  C7    . DT  I 5 89  ? 19.365  -38.563 59.185 1.00 89.14  ? 16   DT  I C7    1 
ATOM   7901  C  C6    . DT  I 5 89  ? 17.258  -37.253 58.984 1.00 92.38  ? 16   DT  I C6    1 
ATOM   7902  P  P     . DT  I 5 90  ? 11.469  -36.249 56.520 1.00 75.73  ? 17   DT  I P     1 
ATOM   7903  O  OP1   . DT  I 5 90  ? 9.999   -36.462 56.550 1.00 71.64  ? 17   DT  I OP1   1 
ATOM   7904  O  OP2   . DT  I 5 90  ? 12.353  -37.021 55.585 1.00 70.96  ? 17   DT  I OP2   1 
ATOM   7905  O  "O5'" . DT  I 5 90  ? 11.828  -34.752 56.139 1.00 74.30  ? 17   DT  I "O5'" 1 
ATOM   7906  C  "C5'" . DT  I 5 90  ? 11.680  -33.714 57.102 1.00 72.18  ? 17   DT  I "C5'" 1 
ATOM   7907  C  "C4'" . DT  I 5 90  ? 12.670  -32.626 56.782 1.00 71.75  ? 17   DT  I "C4'" 1 
ATOM   7908  O  "O4'" . DT  I 5 90  ? 14.001  -33.169 56.907 1.00 80.55  ? 17   DT  I "O4'" 1 
ATOM   7909  C  "C3'" . DT  I 5 90  ? 12.568  -32.051 55.366 1.00 66.19  ? 17   DT  I "C3'" 1 
ATOM   7910  O  "O3'" . DT  I 5 90  ? 12.298  -30.651 55.497 1.00 62.16  ? 17   DT  I "O3'" 1 
ATOM   7911  C  "C2'" . DT  I 5 90  ? 13.922  -32.365 54.744 1.00 78.71  ? 17   DT  I "C2'" 1 
ATOM   7912  C  "C1'" . DT  I 5 90  ? 14.816  -32.520 55.955 1.00 87.62  ? 17   DT  I "C1'" 1 
ATOM   7913  N  N1    . DT  I 5 90  ? 16.035  -33.332 55.787 1.00 105.38 ? 17   DT  I N1    1 
ATOM   7914  C  C2    . DT  I 5 90  ? 17.258  -32.756 56.040 1.00 101.64 ? 17   DT  I C2    1 
ATOM   7915  O  O2    . DT  I 5 90  ? 17.393  -31.582 56.340 1.00 100.20 ? 17   DT  I O2    1 
ATOM   7916  N  N3    . DT  I 5 90  ? 18.327  -33.607 55.908 1.00 106.54 ? 17   DT  I N3    1 
ATOM   7917  C  C4    . DT  I 5 90  ? 18.293  -34.945 55.566 1.00 100.96 ? 17   DT  I C4    1 
ATOM   7918  O  O4    . DT  I 5 90  ? 19.338  -35.583 55.486 1.00 108.66 ? 17   DT  I O4    1 
ATOM   7919  C  C5    . DT  I 5 90  ? 16.979  -35.487 55.334 1.00 107.54 ? 17   DT  I C5    1 
ATOM   7920  C  C7    . DT  I 5 90  ? 16.844  -36.928 54.957 1.00 104.25 ? 17   DT  I C7    1 
ATOM   7921  C  C6    . DT  I 5 90  ? 15.928  -34.668 55.467 1.00 117.25 ? 17   DT  I C6    1 
ATOM   7922  P  P     . DT  I 5 91  ? 12.032  -29.732 54.218 1.00 69.76  ? 18   DT  I P     1 
ATOM   7923  O  OP1   . DT  I 5 91  ? 10.968  -28.779 54.581 1.00 67.70  ? 18   DT  I OP1   1 
ATOM   7924  O  OP2   . DT  I 5 91  ? 11.932  -30.579 52.983 1.00 58.04  ? 18   DT  I OP2   1 
ATOM   7925  O  "O5'" . DT  I 5 91  ? 13.383  -28.908 54.060 1.00 68.66  ? 18   DT  I "O5'" 1 
ATOM   7926  C  "C5'" . DT  I 5 91  ? 14.090  -28.381 55.195 1.00 67.74  ? 18   DT  I "C5'" 1 
ATOM   7927  C  "C4'" . DT  I 5 91  ? 15.461  -27.906 54.771 1.00 72.89  ? 18   DT  I "C4'" 1 
ATOM   7928  O  "O4'" . DT  I 5 91  ? 16.388  -29.022 54.693 1.00 82.75  ? 18   DT  I "O4'" 1 
ATOM   7929  C  "C3'" . DT  I 5 91  ? 15.515  -27.218 53.408 1.00 75.59  ? 18   DT  I "C3'" 1 
ATOM   7930  O  "O3'" . DT  I 5 91  ? 16.373  -26.091 53.549 1.00 84.49  ? 18   DT  I "O3'" 1 
ATOM   7931  C  "C2'" . DT  I 5 91  ? 16.124  -28.267 52.494 1.00 80.62  ? 18   DT  I "C2'" 1 
ATOM   7932  C  "C1'" . DT  I 5 91  ? 17.065  -28.986 53.446 1.00 87.82  ? 18   DT  I "C1'" 1 
ATOM   7933  N  N1    . DT  I 5 91  ? 17.433  -30.373 53.089 1.00 106.01 ? 18   DT  I N1    1 
ATOM   7934  C  C2    . DT  I 5 91  ? 18.706  -30.815 53.380 1.00 114.79 ? 18   DT  I C2    1 
ATOM   7935  O  O2    . DT  I 5 91  ? 19.555  -30.113 53.904 1.00 123.63 ? 18   DT  I O2    1 
ATOM   7936  N  N3    . DT  I 5 91  ? 18.950  -32.121 53.036 1.00 116.16 ? 18   DT  I N3    1 
ATOM   7937  C  C4    . DT  I 5 91  ? 18.071  -33.007 52.442 1.00 112.54 ? 18   DT  I C4    1 
ATOM   7938  O  O4    . DT  I 5 91  ? 18.431  -34.151 52.191 1.00 114.41 ? 18   DT  I O4    1 
ATOM   7939  C  C5    . DT  I 5 91  ? 16.758  -32.478 52.164 1.00 114.56 ? 18   DT  I C5    1 
ATOM   7940  C  C7    . DT  I 5 91  ? 15.741  -33.365 51.519 1.00 104.78 ? 18   DT  I C7    1 
ATOM   7941  C  C6    . DT  I 5 91  ? 16.506  -31.206 52.501 1.00 115.81 ? 18   DT  I C6    1 
ATOM   7942  P  P     . DT  I 5 92  ? 16.383  -24.951 52.443 1.00 94.23  ? 19   DT  I P     1 
ATOM   7943  O  OP1   . DT  I 5 92  ? 16.178  -23.650 53.136 1.00 92.79  ? 19   DT  I OP1   1 
ATOM   7944  O  OP2   . DT  I 5 92  ? 15.511  -25.374 51.312 1.00 87.18  ? 19   DT  I OP2   1 
ATOM   7945  O  "O5'" . DT  I 5 92  ? 17.843  -25.051 51.821 1.00 104.81 ? 19   DT  I "O5'" 1 
ATOM   7946  C  "C5'" . DT  I 5 92  ? 19.013  -25.155 52.648 1.00 106.50 ? 19   DT  I "C5'" 1 
ATOM   7947  C  "C4'" . DT  I 5 92  ? 20.199  -25.544 51.797 1.00 106.24 ? 19   DT  I "C4'" 1 
ATOM   7948  O  "O4'" . DT  I 5 92  ? 20.214  -26.981 51.637 1.00 103.73 ? 19   DT  I "O4'" 1 
ATOM   7949  C  "C3'" . DT  I 5 92  ? 20.226  -24.958 50.379 1.00 110.12 ? 19   DT  I "C3'" 1 
ATOM   7950  O  "O3'" . DT  I 5 92  ? 21.539  -24.426 50.152 1.00 112.45 ? 19   DT  I "O3'" 1 
ATOM   7951  C  "C2'" . DT  I 5 92  ? 19.852  -26.138 49.492 1.00 101.96 ? 19   DT  I "C2'" 1 
ATOM   7952  C  "C1'" . DT  I 5 92  ? 20.446  -27.294 50.274 1.00 105.71 ? 19   DT  I "C1'" 1 
ATOM   7953  N  N1    . DT  I 5 92  ? 19.895  -28.636 50.024 1.00 108.90 ? 19   DT  I N1    1 
ATOM   7954  C  C2    . DT  I 5 92  ? 20.732  -29.713 50.213 1.00 112.43 ? 19   DT  I C2    1 
ATOM   7955  O  O2    . DT  I 5 92  ? 21.901  -29.600 50.542 1.00 110.42 ? 19   DT  I O2    1 
ATOM   7956  N  N3    . DT  I 5 92  ? 20.151  -30.936 49.987 1.00 114.28 ? 19   DT  I N3    1 
ATOM   7957  C  C4    . DT  I 5 92  ? 18.842  -31.183 49.622 1.00 113.31 ? 19   DT  I C4    1 
ATOM   7958  O  O4    . DT  I 5 92  ? 18.459  -32.339 49.464 1.00 104.90 ? 19   DT  I O4    1 
ATOM   7959  C  C5    . DT  I 5 92  ? 18.018  -30.008 49.450 1.00 117.54 ? 19   DT  I C5    1 
ATOM   7960  C  C7    . DT  I 5 92  ? 16.589  -30.176 49.044 1.00 122.76 ? 19   DT  I C7    1 
ATOM   7961  C  C6    . DT  I 5 92  ? 18.576  -28.810 49.665 1.00 118.49 ? 19   DT  I C6    1 
ATOM   7962  P  P     . DG  I 5 93  ? 21.975  -23.876 48.710 1.00 114.36 ? 20   DG  I P     1 
ATOM   7963  O  OP1   . DG  I 5 93  ? 22.935  -22.770 48.933 1.00 110.53 ? 20   DG  I OP1   1 
ATOM   7964  O  OP2   . DG  I 5 93  ? 20.754  -23.645 47.884 1.00 102.78 ? 20   DG  I OP2   1 
ATOM   7965  O  "O5'" . DG  I 5 93  ? 22.768  -25.109 48.092 1.00 112.67 ? 20   DG  I "O5'" 1 
ATOM   7966  C  "C5'" . DG  I 5 93  ? 24.134  -25.361 48.471 1.00 122.79 ? 20   DG  I "C5'" 1 
ATOM   7967  C  "C4'" . DG  I 5 93  ? 24.817  -26.194 47.415 1.00 134.47 ? 20   DG  I "C4'" 1 
ATOM   7968  O  "O4'" . DG  I 5 93  ? 24.164  -27.493 47.344 1.00 124.86 ? 20   DG  I "O4'" 1 
ATOM   7969  C  "C3'" . DG  I 5 93  ? 24.770  -25.645 45.991 1.00 135.96 ? 20   DG  I "C3'" 1 
ATOM   7970  O  "O3'" . DG  I 5 93  ? 25.939  -26.133 45.335 1.00 143.20 ? 20   DG  I "O3'" 1 
ATOM   7971  C  "C2'" . DG  I 5 93  ? 23.487  -26.273 45.466 1.00 131.56 ? 20   DG  I "C2'" 1 
ATOM   7972  C  "C1'" . DG  I 5 93  ? 23.616  -27.674 46.053 1.00 127.95 ? 20   DG  I "C1'" 1 
ATOM   7973  N  N9    . DG  I 5 93  ? 22.360  -28.397 46.187 1.00 137.61 ? 20   DG  I N9    1 
ATOM   7974  C  C8    . DG  I 5 93  ? 21.092  -27.871 46.245 1.00 150.56 ? 20   DG  I C8    1 
ATOM   7975  N  N7    . DG  I 5 93  ? 20.167  -28.782 46.374 1.00 154.34 ? 20   DG  I N7    1 
ATOM   7976  C  C5    . DG  I 5 93  ? 20.866  -29.981 46.406 1.00 142.80 ? 20   DG  I C5    1 
ATOM   7977  C  C6    . DG  I 5 93  ? 20.399  -31.314 46.530 1.00 138.39 ? 20   DG  I C6    1 
ATOM   7978  O  O6    . DG  I 5 93  ? 19.236  -31.715 46.636 1.00 131.14 ? 20   DG  I O6    1 
ATOM   7979  N  N1    . DG  I 5 93  ? 21.449  -32.227 46.515 1.00 141.81 ? 20   DG  I N1    1 
ATOM   7980  C  C2    . DG  I 5 93  ? 22.777  -31.901 46.400 1.00 150.70 ? 20   DG  I C2    1 
ATOM   7981  N  N2    . DG  I 5 93  ? 23.642  -32.925 46.406 1.00 149.95 ? 20   DG  I N2    1 
ATOM   7982  N  N3    . DG  I 5 93  ? 23.225  -30.662 46.283 1.00 161.89 ? 20   DG  I N3    1 
ATOM   7983  C  C4    . DG  I 5 93  ? 22.221  -29.759 46.294 1.00 147.02 ? 20   DG  I C4    1 
ATOM   7984  P  P     . DA  I 5 94  ? 26.231  -25.824 43.787 1.00 153.08 ? 21   DA  I P     1 
ATOM   7985  O  OP1   . DA  I 5 94  ? 26.789  -24.449 43.700 1.00 146.48 ? 21   DA  I OP1   1 
ATOM   7986  O  OP2   . DA  I 5 94  ? 25.040  -26.193 42.975 1.00 135.67 ? 21   DA  I OP2   1 
ATOM   7987  O  "O5'" . DA  I 5 94  ? 27.343  -26.904 43.416 1.00 151.48 ? 21   DA  I "O5'" 1 
ATOM   7988  C  "C5'" . DA  I 5 94  ? 27.542  -28.103 44.195 1.00 136.52 ? 21   DA  I "C5'" 1 
ATOM   7989  C  "C4'" . DA  I 5 94  ? 27.412  -29.337 43.333 1.00 135.88 ? 21   DA  I "C4'" 1 
ATOM   7990  O  "O4'" . DA  I 5 94  ? 26.123  -29.968 43.589 1.00 126.79 ? 21   DA  I "O4'" 1 
ATOM   7991  C  "C3'" . DA  I 5 94  ? 27.483  -29.139 41.812 1.00 149.73 ? 21   DA  I "C3'" 1 
ATOM   7992  O  "O3'" . DA  I 5 94  ? 28.266  -30.199 41.256 1.00 151.63 ? 21   DA  I "O3'" 1 
ATOM   7993  C  "C2'" . DA  I 5 94  ? 26.014  -29.216 41.405 1.00 145.92 ? 21   DA  I "C2'" 1 
ATOM   7994  C  "C1'" . DA  I 5 94  ? 25.529  -30.304 42.353 1.00 141.64 ? 21   DA  I "C1'" 1 
ATOM   7995  N  N9    . DA  I 5 94  ? 24.079  -30.374 42.513 1.00 142.36 ? 21   DA  I N9    1 
ATOM   7996  C  C8    . DA  I 5 94  ? 23.142  -29.390 42.313 1.00 148.00 ? 21   DA  I C8    1 
ATOM   7997  N  N7    . DA  I 5 94  ? 21.909  -29.784 42.522 1.00 136.97 ? 21   DA  I N7    1 
ATOM   7998  C  C5    . DA  I 5 94  ? 22.041  -31.122 42.864 1.00 141.79 ? 21   DA  I C5    1 
ATOM   7999  C  C6    . DA  I 5 94  ? 21.100  -32.109 43.208 1.00 141.09 ? 21   DA  I C6    1 
ATOM   8000  N  N6    . DA  I 5 94  ? 19.784  -31.891 43.262 1.00 133.74 ? 21   DA  I N6    1 
ATOM   8001  N  N1    . DA  I 5 94  ? 21.562  -33.346 43.495 1.00 138.46 ? 21   DA  I N1    1 
ATOM   8002  C  C2    . DA  I 5 94  ? 22.882  -33.566 43.441 1.00 143.91 ? 21   DA  I C2    1 
ATOM   8003  N  N3    . DA  I 5 94  ? 23.865  -32.718 43.137 1.00 146.77 ? 21   DA  I N3    1 
ATOM   8004  C  C4    . DA  I 5 94  ? 23.371  -31.501 42.853 1.00 142.13 ? 21   DA  I C4    1 
ATOM   8005  P  P     . DT  I 5 95  ? 28.355  -30.445 39.661 1.00 136.02 ? 22   DT  I P     1 
ATOM   8006  O  OP1   . DT  I 5 95  ? 29.796  -30.535 39.315 1.00 151.64 ? 22   DT  I OP1   1 
ATOM   8007  O  OP2   . DT  I 5 95  ? 27.511  -29.434 38.975 1.00 114.36 ? 22   DT  I OP2   1 
ATOM   8008  O  "O5'" . DT  I 5 95  ? 27.678  -31.880 39.468 1.00 132.20 ? 22   DT  I "O5'" 1 
ATOM   8009  C  "C5'" . DT  I 5 95  ? 28.352  -32.943 38.749 1.00 154.45 ? 22   DT  I "C5'" 1 
ATOM   8010  C  "C4'" . DT  I 5 95  ? 27.454  -34.147 38.565 1.00 171.97 ? 22   DT  I "C4'" 1 
ATOM   8011  O  "O4'" . DT  I 5 95  ? 26.169  -33.902 39.195 1.00 192.57 ? 22   DT  I "O4'" 1 
ATOM   8012  C  "C3'" . DT  I 5 95  ? 27.139  -34.525 37.108 1.00 187.14 ? 22   DT  I "C3'" 1 
ATOM   8013  O  "O3'" . DT  I 5 95  ? 27.079  -35.943 36.868 1.00 188.34 ? 22   DT  I "O3'" 1 
ATOM   8014  C  "C2'" . DT  I 5 95  ? 25.730  -33.996 36.921 1.00 202.41 ? 22   DT  I "C2'" 1 
ATOM   8015  C  "C1'" . DT  I 5 95  ? 25.156  -34.309 38.289 1.00 207.80 ? 22   DT  I "C1'" 1 
ATOM   8016  N  N1    . DT  I 5 95  ? 23.891  -33.628 38.656 1.00 202.91 ? 22   DT  I N1    1 
ATOM   8017  C  C2    . DT  I 5 95  ? 23.050  -34.250 39.555 1.00 187.52 ? 22   DT  I C2    1 
ATOM   8018  O  O2    . DT  I 5 95  ? 23.307  -35.320 40.081 1.00 162.02 ? 22   DT  I O2    1 
ATOM   8019  N  N3    . DT  I 5 95  ? 21.893  -33.560 39.826 1.00 185.19 ? 22   DT  I N3    1 
ATOM   8020  C  C4    . DT  I 5 95  ? 21.499  -32.348 39.291 1.00 181.02 ? 22   DT  I C4    1 
ATOM   8021  O  O4    . DT  I 5 95  ? 20.432  -31.848 39.630 1.00 151.47 ? 22   DT  I O4    1 
ATOM   8022  C  C5    . DT  I 5 95  ? 22.422  -31.762 38.344 1.00 188.92 ? 22   DT  I C5    1 
ATOM   8023  C  C7    . DT  I 5 95  ? 22.080  -30.449 37.714 1.00 182.40 ? 22   DT  I C7    1 
ATOM   8024  C  C6    . DT  I 5 95  ? 23.553  -32.425 38.075 1.00 197.67 ? 22   DT  I C6    1 
ATOM   8025  P  P     . DG  I 5 96  ? 27.160  -36.516 35.356 1.00 206.15 ? 23   DG  I P     1 
ATOM   8026  O  OP1   . DG  I 5 96  ? 28.357  -37.389 35.274 1.00 216.32 ? 23   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I 5 96  ? 27.020  -35.364 34.425 1.00 197.38 ? 23   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I 5 96  ? 25.878  -37.458 35.184 1.00 187.05 ? 23   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I 5 96  ? 25.540  -38.033 33.883 1.00 179.17 ? 23   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I 5 96  ? 24.420  -39.054 33.989 1.00 183.24 ? 23   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I 5 96  ? 23.521  -38.662 35.062 1.00 191.64 ? 23   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I 5 96  ? 23.505  -39.202 32.774 1.00 182.17 ? 23   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I 5 96  ? 22.763  -40.428 32.768 1.00 181.08 ? 23   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I 5 96  ? 22.504  -38.080 32.998 1.00 178.36 ? 23   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I 5 96  ? 22.315  -38.154 34.514 1.00 183.99 ? 23   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I 5 96  ? 22.058  -36.843 35.097 1.00 176.31 ? 23   DG  I N9    1 
ATOM   8037  C  C8    . DG  I 5 96  ? 22.940  -36.052 35.792 1.00 166.98 ? 23   DG  I C8    1 
ATOM   8038  N  N7    . DG  I 5 96  ? 22.422  -34.914 36.166 1.00 159.88 ? 23   DG  I N7    1 
ATOM   8039  C  C5    . DG  I 5 96  ? 21.123  -34.953 35.681 1.00 162.43 ? 23   DG  I C5    1 
ATOM   8040  C  C6    . DG  I 5 96  ? 20.083  -33.996 35.769 1.00 145.65 ? 23   DG  I C6    1 
ATOM   8041  O  O6    . DG  I 5 96  ? 20.102  -32.888 36.317 1.00 134.78 ? 23   DG  I O6    1 
ATOM   8042  N  N1    . DG  I 5 96  ? 18.928  -34.436 35.129 1.00 133.69 ? 23   DG  I N1    1 
ATOM   8043  C  C2    . DG  I 5 96  ? 18.789  -35.647 34.495 1.00 133.28 ? 23   DG  I C2    1 
ATOM   8044  N  N2    . DG  I 5 96  ? 17.596  -35.895 33.943 1.00 127.51 ? 23   DG  I N2    1 
ATOM   8045  N  N3    . DG  I 5 96  ? 19.754  -36.546 34.402 1.00 148.88 ? 23   DG  I N3    1 
ATOM   8046  C  C4    . DG  I 5 96  ? 20.885  -36.135 35.013 1.00 169.27 ? 23   DG  I C4    1 
ATOM   8047  P  P     . DG  I 5 97  ? 21.919  -40.892 31.455 1.00 178.52 ? 24   DG  I P     1 
ATOM   8048  O  OP1   . DG  I 5 97  ? 22.083  -42.360 31.286 1.00 173.87 ? 24   DG  I OP1   1 
ATOM   8049  O  OP2   . DG  I 5 97  ? 22.239  -39.966 30.337 1.00 156.11 ? 24   DG  I OP2   1 
ATOM   8050  O  "O5'" . DG  I 5 97  ? 20.387  -40.719 31.869 1.00 178.43 ? 24   DG  I "O5'" 1 
ATOM   8051  C  "C5'" . DG  I 5 97  ? 19.374  -41.585 31.290 1.00 155.83 ? 24   DG  I "C5'" 1 
ATOM   8052  C  "C4'" . DG  I 5 97  ? 18.031  -40.885 31.161 1.00 144.79 ? 24   DG  I "C4'" 1 
ATOM   8053  O  "O4'" . DG  I 5 97  ? 18.111  -39.518 31.655 1.00 147.19 ? 24   DG  I "O4'" 1 
ATOM   8054  C  "C3'" . DG  I 5 97  ? 17.473  -40.760 29.748 1.00 140.26 ? 24   DG  I "C3'" 1 
ATOM   8055  O  "O3'" . DG  I 5 97  ? 16.059  -40.847 29.809 1.00 134.79 ? 24   DG  I "O3'" 1 
ATOM   8056  C  "C2'" . DG  I 5 97  ? 17.942  -39.374 29.323 1.00 137.68 ? 24   DG  I "C2'" 1 
ATOM   8057  C  "C1'" . DG  I 5 97  ? 17.749  -38.610 30.626 1.00 139.56 ? 24   DG  I "C1'" 1 
ATOM   8058  N  N9    . DG  I 5 97  ? 18.562  -37.412 30.794 1.00 138.75 ? 24   DG  I N9    1 
ATOM   8059  C  C8    . DG  I 5 97  ? 19.933  -37.338 30.838 1.00 146.28 ? 24   DG  I C8    1 
ATOM   8060  N  N7    . DG  I 5 97  ? 20.373  -36.134 31.086 1.00 144.93 ? 24   DG  I N7    1 
ATOM   8061  C  C5    . DG  I 5 97  ? 19.222  -35.374 31.240 1.00 144.52 ? 24   DG  I C5    1 
ATOM   8062  C  C6    . DG  I 5 97  ? 19.062  -33.995 31.534 1.00 142.80 ? 24   DG  I C6    1 
ATOM   8063  O  O6    . DG  I 5 97  ? 19.935  -33.138 31.718 1.00 143.02 ? 24   DG  I O6    1 
ATOM   8064  N  N1    . DG  I 5 97  ? 17.719  -33.641 31.604 1.00 137.15 ? 24   DG  I N1    1 
ATOM   8065  C  C2    . DG  I 5 97  ? 16.666  -34.500 31.415 1.00 137.10 ? 24   DG  I C2    1 
ATOM   8066  N  N2    . DG  I 5 97  ? 15.442  -33.971 31.532 1.00 143.46 ? 24   DG  I N2    1 
ATOM   8067  N  N3    . DG  I 5 97  ? 16.801  -35.787 31.147 1.00 130.98 ? 24   DG  I N3    1 
ATOM   8068  C  C4    . DG  I 5 97  ? 18.096  -36.151 31.069 1.00 137.26 ? 24   DG  I C4    1 
ATOM   8069  P  P     . DA  I 5 98  ? 15.375  -42.256 29.589 1.00 144.66 ? 25   DA  I P     1 
ATOM   8070  O  OP1   . DA  I 5 98  ? 15.944  -43.196 30.588 1.00 138.43 ? 25   DA  I OP1   1 
ATOM   8071  O  OP2   . DA  I 5 98  ? 15.421  -42.553 28.140 1.00 145.73 ? 25   DA  I OP2   1 
ATOM   8072  O  "O5'" . DA  I 5 98  ? 13.843  -42.013 29.936 1.00 155.62 ? 25   DA  I "O5'" 1 
ATOM   8073  C  "C5'" . DA  I 5 98  ? 13.366  -42.059 31.288 1.00 145.47 ? 25   DA  I "C5'" 1 
ATOM   8074  C  "C4'" . DA  I 5 98  ? 12.316  -40.994 31.466 1.00 133.82 ? 25   DA  I "C4'" 1 
ATOM   8075  O  "O4'" . DA  I 5 98  ? 12.906  -39.689 31.194 1.00 125.27 ? 25   DA  I "O4'" 1 
ATOM   8076  C  "C3'" . DA  I 5 98  ? 11.117  -41.106 30.525 1.00 124.49 ? 25   DA  I "C3'" 1 
ATOM   8077  O  "O3'" . DA  I 5 98  ? 9.981   -40.618 31.227 1.00 114.66 ? 25   DA  I "O3'" 1 
ATOM   8078  C  "C2'" . DA  I 5 98  ? 11.535  -40.229 29.348 1.00 127.18 ? 25   DA  I "C2'" 1 
ATOM   8079  C  "C1'" . DA  I 5 98  ? 12.271  -39.103 30.070 1.00 128.96 ? 25   DA  I "C1'" 1 
ATOM   8080  N  N9    . DA  I 5 98  ? 13.291  -38.438 29.264 1.00 134.99 ? 25   DA  I N9    1 
ATOM   8081  C  C8    . DA  I 5 98  ? 14.200  -39.005 28.406 1.00 141.60 ? 25   DA  I C8    1 
ATOM   8082  N  N7    . DA  I 5 98  ? 14.999  -38.137 27.835 1.00 149.25 ? 25   DA  I N7    1 
ATOM   8083  C  C5    . DA  I 5 98  ? 14.593  -36.917 28.357 1.00 140.64 ? 25   DA  I C5    1 
ATOM   8084  C  C6    . DA  I 5 98  ? 15.043  -35.602 28.150 1.00 129.68 ? 25   DA  I C6    1 
ATOM   8085  N  N6    . DA  I 5 98  ? 16.044  -35.283 27.328 1.00 124.38 ? 25   DA  I N6    1 
ATOM   8086  N  N1    . DA  I 5 98  ? 14.412  -34.611 28.815 1.00 131.67 ? 25   DA  I N1    1 
ATOM   8087  C  C2    . DA  I 5 98  ? 13.399  -34.929 29.631 1.00 125.63 ? 25   DA  I C2    1 
ATOM   8088  N  N3    . DA  I 5 98  ? 12.895  -36.126 29.917 1.00 132.76 ? 25   DA  I N3    1 
ATOM   8089  C  C4    . DA  I 5 98  ? 13.542  -37.088 29.238 1.00 138.24 ? 25   DA  I C4    1 
ATOM   8090  P  P     . DG  I 5 99  ? 8.539   -40.646 30.551 1.00 113.95 ? 26   DG  I P     1 
ATOM   8091  O  OP1   . DG  I 5 99  ? 7.549   -40.999 31.611 1.00 98.95  ? 26   DG  I OP1   1 
ATOM   8092  O  OP2   . DG  I 5 99  ? 8.621   -41.468 29.314 1.00 112.23 ? 26   DG  I OP2   1 
ATOM   8093  O  "O5'" . DG  I 5 99  ? 8.369   -39.163 29.991 1.00 106.07 ? 26   DG  I "O5'" 1 
ATOM   8094  C  "C5'" . DG  I 5 99  ? 8.549   -37.995 30.815 1.00 97.57  ? 26   DG  I "C5'" 1 
ATOM   8095  C  "C4'" . DG  I 5 99  ? 8.282   -36.752 30.005 1.00 93.85  ? 26   DG  I "C4'" 1 
ATOM   8096  O  "O4'" . DG  I 5 99  ? 9.466   -36.431 29.211 1.00 105.75 ? 26   DG  I "O4'" 1 
ATOM   8097  C  "C3'" . DG  I 5 99  ? 7.128   -36.856 29.009 1.00 93.86  ? 26   DG  I "C3'" 1 
ATOM   8098  O  "O3'" . DG  I 5 99  ? 6.535   -35.566 28.874 1.00 92.57  ? 26   DG  I "O3'" 1 
ATOM   8099  C  "C2'" . DG  I 5 99  ? 7.859   -37.186 27.707 1.00 103.38 ? 26   DG  I "C2'" 1 
ATOM   8100  C  "C1'" . DG  I 5 99  ? 9.093   -36.292 27.849 1.00 117.84 ? 26   DG  I "C1'" 1 
ATOM   8101  N  N9    . DG  I 5 99  ? 10.248  -36.583 26.991 1.00 131.25 ? 26   DG  I N9    1 
ATOM   8102  C  C8    . DG  I 5 99  ? 10.551  -37.766 26.357 1.00 135.14 ? 26   DG  I C8    1 
ATOM   8103  N  N7    . DG  I 5 99  ? 11.647  -37.703 25.649 1.00 128.56 ? 26   DG  I N7    1 
ATOM   8104  C  C5    . DG  I 5 99  ? 12.090  -36.397 25.815 1.00 133.26 ? 26   DG  I C5    1 
ATOM   8105  C  C6    . DG  I 5 99  ? 13.234  -35.738 25.288 1.00 136.05 ? 26   DG  I C6    1 
ATOM   8106  O  O6    . DG  I 5 99  ? 14.115  -36.193 24.549 1.00 113.46 ? 26   DG  I O6    1 
ATOM   8107  N  N1    . DG  I 5 99  ? 13.304  -34.414 25.713 1.00 148.66 ? 26   DG  I N1    1 
ATOM   8108  C  C2    . DG  I 5 99  ? 12.391  -33.801 26.537 1.00 152.48 ? 26   DG  I C2    1 
ATOM   8109  N  N2    . DG  I 5 99  ? 12.632  -32.515 26.836 1.00 144.34 ? 26   DG  I N2    1 
ATOM   8110  N  N3    . DG  I 5 99  ? 11.323  -34.404 27.036 1.00 146.11 ? 26   DG  I N3    1 
ATOM   8111  C  C4    . DG  I 5 99  ? 11.234  -35.691 26.635 1.00 134.66 ? 26   DG  I C4    1 
ATOM   8112  P  P     . DC  I 5 100 ? 5.038   -35.228 29.361 1.00 81.26  ? 27   DC  I P     1 
ATOM   8113  O  OP1   . DC  I 5 100 ? 4.899   -35.669 30.767 1.00 84.33  ? 27   DC  I OP1   1 
ATOM   8114  O  OP2   . DC  I 5 100 ? 4.077   -35.694 28.338 1.00 78.85  ? 27   DC  I OP2   1 
ATOM   8115  O  "O5'" . DC  I 5 100 ? 5.023   -33.640 29.278 1.00 98.72  ? 27   DC  I "O5'" 1 
ATOM   8116  C  "C5'" . DC  I 5 100 ? 6.139   -32.883 29.804 1.00 107.69 ? 27   DC  I "C5'" 1 
ATOM   8117  C  "C4'" . DC  I 5 100 ? 6.714   -31.939 28.771 1.00 105.91 ? 27   DC  I "C4'" 1 
ATOM   8118  O  "O4'" . DC  I 5 100 ? 7.645   -32.627 27.891 1.00 106.23 ? 27   DC  I "O4'" 1 
ATOM   8119  C  "C3'" . DC  I 5 100 ? 5.706   -31.237 27.865 1.00 105.60 ? 27   DC  I "C3'" 1 
ATOM   8120  O  "O3'" . DC  I 5 100 ? 5.957   -29.849 28.053 1.00 112.34 ? 27   DC  I "O3'" 1 
ATOM   8121  C  "C2'" . DC  I 5 100 ? 6.026   -31.789 26.471 1.00 106.84 ? 27   DC  I "C2'" 1 
ATOM   8122  C  "C1'" . DC  I 5 100 ? 7.517   -32.099 26.594 1.00 103.90 ? 27   DC  I "C1'" 1 
ATOM   8123  N  N1    . DC  I 5 100 ? 8.080   -33.076 25.639 1.00 107.87 ? 27   DC  I N1    1 
ATOM   8124  C  C2    . DC  I 5 100 ? 9.347   -32.829 25.092 1.00 115.17 ? 27   DC  I C2    1 
ATOM   8125  O  O2    . DC  I 5 100 ? 9.936   -31.782 25.393 1.00 118.56 ? 27   DC  I O2    1 
ATOM   8126  N  N3    . DC  I 5 100 ? 9.890   -33.730 24.241 1.00 118.48 ? 27   DC  I N3    1 
ATOM   8127  C  C4    . DC  I 5 100 ? 9.225   -34.846 23.940 1.00 117.00 ? 27   DC  I C4    1 
ATOM   8128  N  N4    . DC  I 5 100 ? 9.800   -35.707 23.097 1.00 110.48 ? 27   DC  I N4    1 
ATOM   8129  C  C5    . DC  I 5 100 ? 7.936   -35.126 24.484 1.00 119.94 ? 27   DC  I C5    1 
ATOM   8130  C  C6    . DC  I 5 100 ? 7.409   -34.225 25.327 1.00 110.71 ? 27   DC  I C6    1 
ATOM   8131  P  P     . DA  I 5 101 ? 4.805   -28.752 27.839 1.00 116.42 ? 28   DA  I P     1 
ATOM   8132  O  OP1   . DA  I 5 101 ? 4.536   -28.094 29.144 1.00 86.78  ? 28   DA  I OP1   1 
ATOM   8133  O  OP2   . DA  I 5 101 ? 3.705   -29.380 27.048 1.00 117.03 ? 28   DA  I OP2   1 
ATOM   8134  O  "O5'" . DA  I 5 101 ? 5.513   -27.656 26.920 1.00 131.31 ? 28   DA  I "O5'" 1 
ATOM   8135  C  "C5'" . DA  I 5 101 ? 6.935   -27.693 26.651 1.00 132.48 ? 28   DA  I "C5'" 1 
ATOM   8136  C  "C4'" . DA  I 5 101 ? 7.220   -27.635 25.166 1.00 124.46 ? 28   DA  I "C4'" 1 
ATOM   8137  O  "O4'" . DA  I 5 101 ? 7.552   -28.958 24.652 1.00 122.75 ? 28   DA  I "O4'" 1 
ATOM   8138  C  "C3'" . DA  I 5 101 ? 6.103   -27.122 24.249 1.00 124.15 ? 28   DA  I "C3'" 1 
ATOM   8139  O  "O3'" . DA  I 5 101 ? 6.773   -26.362 23.254 1.00 138.36 ? 28   DA  I "O3'" 1 
ATOM   8140  C  "C2'" . DA  I 5 101 ? 5.625   -28.397 23.564 1.00 118.00 ? 28   DA  I "C2'" 1 
ATOM   8141  C  "C1'" . DA  I 5 101 ? 6.968   -29.086 23.374 1.00 121.01 ? 28   DA  I "C1'" 1 
ATOM   8142  N  N9    . DA  I 5 101 ? 6.964   -30.489 22.971 1.00 123.82 ? 28   DA  I N9    1 
ATOM   8143  C  C8    . DA  I 5 101 ? 6.106   -31.503 23.320 1.00 123.58 ? 28   DA  I C8    1 
ATOM   8144  N  N7    . DA  I 5 101 ? 6.396   -32.654 22.764 1.00 121.72 ? 28   DA  I N7    1 
ATOM   8145  C  C5    . DA  I 5 101 ? 7.508   -32.375 21.981 1.00 118.91 ? 28   DA  I C5    1 
ATOM   8146  C  C6    . DA  I 5 101 ? 8.287   -33.173 21.128 1.00 107.42 ? 28   DA  I C6    1 
ATOM   8147  N  N6    . DA  I 5 101 ? 8.058   -34.471 20.920 1.00 97.53  ? 28   DA  I N6    1 
ATOM   8148  N  N1    . DA  I 5 101 ? 9.322   -32.584 20.486 1.00 112.41 ? 28   DA  I N1    1 
ATOM   8149  C  C2    . DA  I 5 101 ? 9.551   -31.281 20.699 1.00 108.47 ? 28   DA  I C2    1 
ATOM   8150  N  N3    . DA  I 5 101 ? 8.887   -30.427 21.476 1.00 109.65 ? 28   DA  I N3    1 
ATOM   8151  C  C4    . DA  I 5 101 ? 7.868   -31.045 22.098 1.00 116.86 ? 28   DA  I C4    1 
ATOM   8152  P  P     . DG  I 5 102 ? 6.276   -24.904 22.834 1.00 135.63 ? 29   DG  I P     1 
ATOM   8153  O  OP1   . DG  I 5 102 ? 6.880   -23.925 23.774 1.00 129.97 ? 29   DG  I OP1   1 
ATOM   8154  O  OP2   . DG  I 5 102 ? 4.805   -24.953 22.656 1.00 121.46 ? 29   DG  I OP2   1 
ATOM   8155  O  "O5'" . DG  I 5 102 ? 6.965   -24.723 21.409 1.00 128.81 ? 29   DG  I "O5'" 1 
ATOM   8156  C  "C5'" . DG  I 5 102 ? 8.403   -24.638 21.303 1.00 139.94 ? 29   DG  I "C5'" 1 
ATOM   8157  C  "C4'" . DG  I 5 102 ? 8.892   -25.249 20.009 1.00 138.06 ? 29   DG  I "C4'" 1 
ATOM   8158  O  "O4'" . DG  I 5 102 ? 8.697   -26.687 20.049 1.00 136.79 ? 29   DG  I "O4'" 1 
ATOM   8159  C  "C3'" . DG  I 5 102 ? 8.201   -24.748 18.744 1.00 149.00 ? 29   DG  I "C3'" 1 
ATOM   8160  O  "O3'" . DG  I 5 102 ? 9.146   -24.429 17.728 1.00 166.83 ? 29   DG  I "O3'" 1 
ATOM   8161  C  "C2'" . DG  I 5 102 ? 7.273   -25.899 18.360 1.00 142.60 ? 29   DG  I "C2'" 1 
ATOM   8162  C  "C1'" . DG  I 5 102 ? 8.047   -27.109 18.874 1.00 136.85 ? 29   DG  I "C1'" 1 
ATOM   8163  N  N9    . DG  I 5 102 ? 7.175   -28.227 19.214 1.00 145.53 ? 29   DG  I N9    1 
ATOM   8164  C  C8    . DG  I 5 102 ? 6.090   -28.201 20.057 1.00 152.18 ? 29   DG  I C8    1 
ATOM   8165  N  N7    . DG  I 5 102 ? 5.493   -29.357 20.158 1.00 156.37 ? 29   DG  I N7    1 
ATOM   8166  C  C5    . DG  I 5 102 ? 6.225   -30.195 19.327 1.00 152.76 ? 29   DG  I C5    1 
ATOM   8167  C  C6    . DG  I 5 102 ? 6.056   -31.572 19.031 1.00 149.92 ? 29   DG  I C6    1 
ATOM   8168  O  O6    . DG  I 5 102 ? 5.196   -32.352 19.455 1.00 126.52 ? 29   DG  I O6    1 
ATOM   8169  N  N1    . DG  I 5 102 ? 7.026   -32.027 18.143 1.00 167.15 ? 29   DG  I N1    1 
ATOM   8170  C  C2    . DG  I 5 102 ? 8.028   -31.255 17.605 1.00 170.69 ? 29   DG  I C2    1 
ATOM   8171  N  N2    . DG  I 5 102 ? 8.867   -31.875 16.763 1.00 171.95 ? 29   DG  I N2    1 
ATOM   8172  N  N3    . DG  I 5 102 ? 8.197   -29.971 17.875 1.00 156.14 ? 29   DG  I N3    1 
ATOM   8173  C  C4    . DG  I 5 102 ? 7.266   -29.510 18.736 1.00 149.35 ? 29   DG  I C4    1 
ATOM   8174  P  P     . DT  I 5 103 ? 8.733   -23.467 16.507 1.00 177.07 ? 30   DT  I P     1 
ATOM   8175  O  OP1   . DT  I 5 103 ? 9.885   -22.570 16.228 1.00 170.55 ? 30   DT  I OP1   1 
ATOM   8176  O  OP2   . DT  I 5 103 ? 7.395   -22.884 16.799 1.00 162.30 ? 30   DT  I OP2   1 
ATOM   8177  O  "O5'" . DT  I 5 103 ? 8.554   -24.482 15.289 1.00 173.29 ? 30   DT  I "O5'" 1 
ATOM   8178  C  "C5'" . DT  I 5 103 ? 9.598   -24.668 14.311 1.00 162.94 ? 30   DT  I "C5'" 1 
ATOM   8179  C  "C4'" . DT  I 5 103 ? 9.385   -25.946 13.531 1.00 161.89 ? 30   DT  I "C4'" 1 
ATOM   8180  O  "O4'" . DT  I 5 103 ? 8.791   -26.964 14.368 1.00 152.79 ? 30   DT  I "O4'" 1 
ATOM   8181  C  "C3'" . DT  I 5 103 ? 8.464   -25.819 12.314 1.00 164.01 ? 30   DT  I "C3'" 1 
ATOM   8182  O  "O3'" . DT  I 5 103 ? 9.222   -25.833 11.098 1.00 170.18 ? 30   DT  I "O3'" 1 
ATOM   8183  C  "C2'" . DT  I 5 103 ? 7.537   -27.024 12.413 1.00 168.78 ? 30   DT  I "C2'" 1 
ATOM   8184  C  "C1'" . DT  I 5 103 ? 8.147   -27.879 13.508 1.00 159.55 ? 30   DT  I "C1'" 1 
ATOM   8185  N  N1    . DT  I 5 103 ? 7.162   -28.640 14.299 1.00 164.01 ? 30   DT  I N1    1 
ATOM   8186  C  C2    . DT  I 5 103 ? 7.114   -30.007 14.145 1.00 167.29 ? 30   DT  I C2    1 
ATOM   8187  O  O2    . DT  I 5 103 ? 7.862   -30.621 13.401 1.00 168.54 ? 30   DT  I O2    1 
ATOM   8188  N  N3    . DT  I 5 103 ? 6.156   -30.635 14.902 1.00 168.07 ? 30   DT  I N3    1 
ATOM   8189  C  C4    . DT  I 5 103 ? 5.260   -30.042 15.773 1.00 158.46 ? 30   DT  I C4    1 
ATOM   8190  O  O4    . DT  I 5 103 ? 4.459   -30.736 16.390 1.00 168.48 ? 30   DT  I O4    1 
ATOM   8191  C  C5    . DT  I 5 103 ? 5.360   -28.605 15.878 1.00 160.12 ? 30   DT  I C5    1 
ATOM   8192  C  C7    . DT  I 5 103 ? 4.431   -27.877 16.798 1.00 154.06 ? 30   DT  I C7    1 
ATOM   8193  C  C6    . DT  I 5 103 ? 6.293   -27.984 15.144 1.00 170.16 ? 30   DT  I C6    1 
ATOM   8194  P  P     . DT  I 5 104 ? 8.501   -25.544 9.696  1.00 163.90 ? 31   DT  I P     1 
ATOM   8195  O  OP1   . DT  I 5 104 ? 9.553   -25.240 8.695  1.00 167.76 ? 31   DT  I OP1   1 
ATOM   8196  O  OP2   . DT  I 5 104 ? 7.394   -24.578 9.931  1.00 152.72 ? 31   DT  I OP2   1 
ATOM   8197  O  "O5'" . DT  I 5 104 ? 7.868   -26.953 9.316  1.00 160.18 ? 31   DT  I "O5'" 1 
ATOM   8198  C  "C5'" . DT  I 5 104 ? 8.699   -28.104 9.095  1.00 160.81 ? 31   DT  I "C5'" 1 
ATOM   8199  C  "C4'" . DT  I 5 104 ? 7.854   -29.254 8.602  1.00 170.31 ? 31   DT  I "C4'" 1 
ATOM   8200  O  "O4'" . DT  I 5 104 ? 7.075   -29.796 9.695  1.00 168.18 ? 31   DT  I "O4'" 1 
ATOM   8201  C  "C3'" . DT  I 5 104 ? 6.845   -28.896 7.507  1.00 173.50 ? 31   DT  I "C3'" 1 
ATOM   8202  O  "O3'" . DT  I 5 104 ? 6.845   -29.926 6.521  1.00 177.95 ? 31   DT  I "O3'" 1 
ATOM   8203  C  "C2'" . DT  I 5 104 ? 5.510   -28.902 8.229  1.00 168.47 ? 31   DT  I "C2'" 1 
ATOM   8204  C  "C1'" . DT  I 5 104 ? 5.746   -29.998 9.247  1.00 169.59 ? 31   DT  I "C1'" 1 
ATOM   8205  N  N1    . DT  I 5 104 ? 4.865   -29.977 10.425 1.00 166.43 ? 31   DT  I N1    1 
ATOM   8206  C  C2    . DT  I 5 104 ? 4.258   -31.149 10.823 1.00 169.26 ? 31   DT  I C2    1 
ATOM   8207  O  O2    . DT  I 5 104 ? 4.388   -32.206 10.227 1.00 152.61 ? 31   DT  I O2    1 
ATOM   8208  N  N3    . DT  I 5 104 ? 3.472   -31.032 11.942 1.00 175.90 ? 31   DT  I N3    1 
ATOM   8209  C  C4    . DT  I 5 104 ? 3.245   -29.890 12.687 1.00 174.76 ? 31   DT  I C4    1 
ATOM   8210  O  O4    . DT  I 5 104 ? 2.513   -29.939 13.671 1.00 180.22 ? 31   DT  I O4    1 
ATOM   8211  C  C5    . DT  I 5 104 ? 3.919   -28.701 12.217 1.00 170.00 ? 31   DT  I C5    1 
ATOM   8212  C  C7    . DT  I 5 104 ? 3.726   -27.414 12.955 1.00 168.06 ? 31   DT  I C7    1 
ATOM   8213  C  C6    . DT  I 5 104 ? 4.688   -28.804 11.126 1.00 168.03 ? 31   DT  I C6    1 
ATOM   8214  P  P     . DT  I 5 105 ? 6.719   -29.555 4.985  1.00 187.42 ? 32   DT  I P     1 
ATOM   8215  O  OP1   . DT  I 5 105 ? 8.090   -29.515 4.418  1.00 197.73 ? 32   DT  I OP1   1 
ATOM   8216  O  OP2   . DT  I 5 105 ? 5.837   -28.362 4.877  1.00 163.97 ? 32   DT  I OP2   1 
ATOM   8217  O  "O5'" . DT  I 5 105 ? 5.975   -30.823 4.370  1.00 190.19 ? 32   DT  I "O5'" 1 
ATOM   8218  C  "C5'" . DT  I 5 105 ? 6.367   -32.165 4.721  1.00 183.50 ? 32   DT  I "C5'" 1 
ATOM   8219  C  "C4'" . DT  I 5 105 ? 5.146   -33.027 4.937  1.00 186.99 ? 32   DT  I "C4'" 1 
ATOM   8220  O  "O4'" . DT  I 5 105 ? 4.570   -32.768 6.239  1.00 190.70 ? 32   DT  I "O4'" 1 
ATOM   8221  C  "C3'" . DT  I 5 105 ? 4.012   -32.827 3.919  1.00 185.05 ? 32   DT  I "C3'" 1 
ATOM   8222  O  "O3'" . DT  I 5 105 ? 3.941   -33.990 3.079  1.00 173.99 ? 32   DT  I "O3'" 1 
ATOM   8223  C  "C2'" . DT  I 5 105 ? 2.794   -32.508 4.779  1.00 194.30 ? 32   DT  I "C2'" 1 
ATOM   8224  C  "C1'" . DT  I 5 105 ? 3.193   -33.056 6.136  1.00 201.92 ? 32   DT  I "C1'" 1 
ATOM   8225  N  N1    . DT  I 5 105 ? 2.497   -32.469 7.306  1.00 211.17 ? 32   DT  I N1    1 
ATOM   8226  C  C2    . DT  I 5 105 ? 1.879   -33.332 8.185  1.00 213.04 ? 32   DT  I C2    1 
ATOM   8227  O  O2    . DT  I 5 105 ? 1.899   -34.545 8.055  1.00 203.53 ? 32   DT  I O2    1 
ATOM   8228  N  N3    . DT  I 5 105 ? 1.238   -32.718 9.234  1.00 217.13 ? 32   DT  I N3    1 
ATOM   8229  C  C4    . DT  I 5 105 ? 1.150   -31.360 9.479  1.00 216.56 ? 32   DT  I C4    1 
ATOM   8230  O  O4    . DT  I 5 105 ? 0.541   -30.954 10.466 1.00 212.38 ? 32   DT  I O4    1 
ATOM   8231  C  C5    . DT  I 5 105 ? 1.813   -30.514 8.513  1.00 213.79 ? 32   DT  I C5    1 
ATOM   8232  C  C7    . DT  I 5 105 ? 1.771   -29.029 8.697  1.00 206.37 ? 32   DT  I C7    1 
ATOM   8233  C  C6    . DT  I 5 105 ? 2.442   -31.103 7.487  1.00 215.02 ? 32   DT  I C6    1 
ATOM   8234  P  P     . DC  I 5 106 ? 2.543   -34.729 2.778  1.00 191.21 ? 33   DC  I P     1 
ATOM   8235  O  OP1   . DC  I 5 106 ? 2.807   -35.827 1.811  1.00 196.99 ? 33   DC  I OP1   1 
ATOM   8236  O  OP2   . DC  I 5 106 ? 1.535   -33.693 2.436  1.00 190.25 ? 33   DC  I OP2   1 
ATOM   8237  O  "O5'" . DC  I 5 106 ? 2.174   -35.401 4.176  1.00 189.44 ? 33   DC  I "O5'" 1 
ATOM   8238  C  "C5'" . DC  I 5 106 ? 1.610   -36.725 4.250  1.00 186.13 ? 33   DC  I "C5'" 1 
ATOM   8239  C  "C4'" . DC  I 5 106 ? 0.121   -36.661 4.506  1.00 182.54 ? 33   DC  I "C4'" 1 
ATOM   8240  O  "O4'" . DC  I 5 106 ? -0.193  -35.576 5.422  1.00 190.42 ? 33   DC  I "O4'" 1 
ATOM   8241  C  "C3'" . DC  I 5 106 ? -0.767  -36.451 3.282  1.00 166.37 ? 33   DC  I "C3'" 1 
ATOM   8242  O  "O3'" . DC  I 5 106 ? -1.813  -37.397 3.374  1.00 163.58 ? 33   DC  I "O3'" 1 
ATOM   8243  C  "C2'" . DC  I 5 106 ? -1.305  -35.033 3.461  1.00 162.49 ? 33   DC  I "C2'" 1 
ATOM   8244  C  "C1'" . DC  I 5 106 ? -1.368  -34.932 4.982  1.00 174.36 ? 33   DC  I "C1'" 1 
ATOM   8245  N  N1    . DC  I 5 106 ? -1.372  -33.558 5.511  1.00 173.45 ? 33   DC  I N1    1 
ATOM   8246  C  C2    . DC  I 5 106 ? -1.985  -33.311 6.743  1.00 170.56 ? 33   DC  I C2    1 
ATOM   8247  O  O2    . DC  I 5 106 ? -2.517  -34.255 7.346  1.00 163.08 ? 33   DC  I O2    1 
ATOM   8248  N  N3    . DC  I 5 106 ? -1.982  -32.053 7.243  1.00 179.58 ? 33   DC  I N3    1 
ATOM   8249  C  C4    . DC  I 5 106 ? -1.398  -31.064 6.559  1.00 171.86 ? 33   DC  I C4    1 
ATOM   8250  N  N4    . DC  I 5 106 ? -1.420  -29.838 7.087  1.00 163.88 ? 33   DC  I N4    1 
ATOM   8251  C  C5    . DC  I 5 106 ? -0.765  -31.290 5.303  1.00 172.13 ? 33   DC  I C5    1 
ATOM   8252  C  C6    . DC  I 5 106 ? -0.772  -32.540 4.822  1.00 174.97 ? 33   DC  I C6    1 
ATOM   8253  P  P     . DC  I 5 107 ? -2.594  -37.842 2.076  1.00 169.78 ? 34   DC  I P     1 
ATOM   8254  O  OP1   . DC  I 5 107 ? -1.667  -38.662 1.259  1.00 185.04 ? 34   DC  I OP1   1 
ATOM   8255  O  OP2   . DC  I 5 107 ? -3.219  -36.632 1.481  1.00 157.36 ? 34   DC  I OP2   1 
ATOM   8256  O  "O5'" . DC  I 5 107 ? -3.745  -38.779 2.658  1.00 154.90 ? 34   DC  I "O5'" 1 
ATOM   8257  C  "C5'" . DC  I 5 107 ? -3.636  -39.392 3.963  1.00 150.54 ? 34   DC  I "C5'" 1 
ATOM   8258  C  "C4'" . DC  I 5 107 ? -4.753  -38.930 4.878  1.00 142.30 ? 34   DC  I "C4'" 1 
ATOM   8259  O  "O4'" . DC  I 5 107 ? -4.572  -37.530 5.233  1.00 139.31 ? 34   DC  I "O4'" 1 
ATOM   8260  C  "C3'" . DC  I 5 107 ? -6.176  -39.021 4.318  1.00 140.97 ? 34   DC  I "C3'" 1 
ATOM   8261  O  "O3'" . DC  I 5 107 ? -7.080  -39.436 5.323  1.00 136.40 ? 34   DC  I "O3'" 1 
ATOM   8262  C  "C2'" . DC  I 5 107 ? -6.535  -37.570 4.036  1.00 136.95 ? 34   DC  I "C2'" 1 
ATOM   8263  C  "C1'" . DC  I 5 107 ? -5.836  -36.901 5.208  1.00 143.64 ? 34   DC  I "C1'" 1 
ATOM   8264  N  N1    . DC  I 5 107 ? -5.668  -35.445 5.093  1.00 149.42 ? 34   DC  I N1    1 
ATOM   8265  C  C2    . DC  I 5 107 ? -6.146  -34.639 6.132  1.00 151.97 ? 34   DC  I C2    1 
ATOM   8266  O  O2    . DC  I 5 107 ? -6.681  -35.180 7.113  1.00 133.93 ? 34   DC  I O2    1 
ATOM   8267  N  N3    . DC  I 5 107 ? -6.009  -33.295 6.044  1.00 159.67 ? 34   DC  I N3    1 
ATOM   8268  C  C4    . DC  I 5 107 ? -5.429  -32.753 4.970  1.00 156.67 ? 34   DC  I C4    1 
ATOM   8269  N  N4    . DC  I 5 107 ? -5.319  -31.423 4.922  1.00 150.53 ? 34   DC  I N4    1 
ATOM   8270  C  C5    . DC  I 5 107 ? -4.942  -33.550 3.893  1.00 151.95 ? 34   DC  I C5    1 
ATOM   8271  C  C6    . DC  I 5 107 ? -5.087  -34.879 3.992  1.00 150.72 ? 34   DC  I C6    1 
ATOM   8272  P  P     . DA  I 5 108 ? -7.515  -40.946 5.398  1.00 147.25 ? 35   DA  I P     1 
ATOM   8273  O  OP1   . DA  I 5 108 ? -6.279  -41.763 5.501  1.00 131.88 ? 35   DA  I OP1   1 
ATOM   8274  O  OP2   . DA  I 5 108 ? -8.494  -41.181 4.309  1.00 130.61 ? 35   DA  I OP2   1 
ATOM   8275  O  "O5'" . DA  I 5 108 ? -8.290  -41.037 6.785  1.00 145.49 ? 35   DA  I "O5'" 1 
ATOM   8276  C  "C5'" . DA  I 5 108 ? -7.719  -40.504 7.996  1.00 143.30 ? 35   DA  I "C5'" 1 
ATOM   8277  C  "C4'" . DA  I 5 108 ? -8.713  -39.606 8.698  1.00 134.52 ? 35   DA  I "C4'" 1 
ATOM   8278  O  "O4'" . DA  I 5 108 ? -8.621  -38.264 8.149  1.00 120.83 ? 35   DA  I "O4'" 1 
ATOM   8279  C  "C3'" . DA  I 5 108 ? -10.191 -40.011 8.601  1.00 126.02 ? 35   DA  I "C3'" 1 
ATOM   8280  O  "O3'" . DA  I 5 108 ? -10.760 -40.059 9.917  1.00 124.55 ? 35   DA  I "O3'" 1 
ATOM   8281  C  "C2'" . DA  I 5 108 ? -10.768 -38.981 7.627  1.00 114.40 ? 35   DA  I "C2'" 1 
ATOM   8282  C  "C1'" . DA  I 5 108 ? -9.922  -37.758 7.953  1.00 115.11 ? 35   DA  I "C1'" 1 
ATOM   8283  N  N9    . DA  I 5 108 ? -9.864  -36.779 6.879  1.00 114.39 ? 35   DA  I N9    1 
ATOM   8284  C  C8    . DA  I 5 108 ? -9.872  -37.029 5.532  1.00 122.18 ? 35   DA  I C8    1 
ATOM   8285  N  N7    . DA  I 5 108 ? -9.779  -35.950 4.795  1.00 132.69 ? 35   DA  I N7    1 
ATOM   8286  C  C5    . DA  I 5 108 ? -9.695  -34.920 5.720  1.00 123.44 ? 35   DA  I C5    1 
ATOM   8287  C  C6    . DA  I 5 108 ? -9.572  -33.525 5.577  1.00 133.35 ? 35   DA  I C6    1 
ATOM   8288  N  N6    . DA  I 5 108 ? -9.521  -32.902 4.398  1.00 136.07 ? 35   DA  I N6    1 
ATOM   8289  N  N1    . DA  I 5 108 ? -9.517  -32.781 6.703  1.00 131.03 ? 35   DA  I N1    1 
ATOM   8290  C  C2    . DA  I 5 108 ? -9.572  -33.405 7.886  1.00 132.10 ? 35   DA  I C2    1 
ATOM   8291  N  N3    . DA  I 5 108 ? -9.685  -34.706 8.147  1.00 136.42 ? 35   DA  I N3    1 
ATOM   8292  C  C4    . DA  I 5 108 ? -9.744  -35.417 7.008  1.00 121.01 ? 35   DA  I C4    1 
ATOM   8293  P  P     . DA  I 5 109 ? -12.319 -39.732 10.169 1.00 135.07 ? 36   DA  I P     1 
ATOM   8294  O  OP1   . DA  I 5 109 ? -12.677 -40.196 11.530 1.00 118.51 ? 36   DA  I OP1   1 
ATOM   8295  O  OP2   . DA  I 5 109 ? -13.102 -40.206 9.002  1.00 137.69 ? 36   DA  I OP2   1 
ATOM   8296  O  "O5'" . DA  I 5 109 ? -12.366 -38.142 10.143 1.00 138.20 ? 36   DA  I "O5'" 1 
ATOM   8297  C  "C5'" . DA  I 5 109 ? -11.776 -37.365 11.199 1.00 132.06 ? 36   DA  I "C5'" 1 
ATOM   8298  C  "C4'" . DA  I 5 109 ? -12.429 -36.007 11.246 1.00 127.45 ? 36   DA  I "C4'" 1 
ATOM   8299  O  "O4'" . DA  I 5 109 ? -12.091 -35.273 10.035 1.00 128.52 ? 36   DA  I "O4'" 1 
ATOM   8300  C  "C3'" . DA  I 5 109 ? -13.961 -36.013 11.307 1.00 126.10 ? 36   DA  I "C3'" 1 
ATOM   8301  O  "O3'" . DA  I 5 109 ? -14.391 -34.949 12.151 1.00 129.18 ? 36   DA  I "O3'" 1 
ATOM   8302  C  "C2'" . DA  I 5 109 ? -14.346 -35.750 9.859  1.00 131.31 ? 36   DA  I "C2'" 1 
ATOM   8303  C  "C1'" . DA  I 5 109 ? -13.274 -34.738 9.483  1.00 136.62 ? 36   DA  I "C1'" 1 
ATOM   8304  N  N9    . DA  I 5 109 ? -13.094 -34.545 8.046  1.00 144.89 ? 36   DA  I N9    1 
ATOM   8305  C  C8    . DA  I 5 109 ? -13.181 -35.477 7.043  1.00 145.60 ? 36   DA  I C8    1 
ATOM   8306  N  N7    . DA  I 5 109 ? -12.985 -34.982 5.846  1.00 152.72 ? 36   DA  I N7    1 
ATOM   8307  C  C5    . DA  I 5 109 ? -12.772 -33.630 6.074  1.00 149.21 ? 36   DA  I C5    1 
ATOM   8308  C  C6    . DA  I 5 109 ? -12.501 -32.554 5.209  1.00 151.83 ? 36   DA  I C6    1 
ATOM   8309  N  N6    . DA  I 5 109 ? -12.402 -32.675 3.884  1.00 153.42 ? 36   DA  I N6    1 
ATOM   8310  N  N1    . DA  I 5 109 ? -12.327 -31.333 5.761  1.00 148.65 ? 36   DA  I N1    1 
ATOM   8311  C  C2    . DA  I 5 109 ? -12.422 -31.212 7.090  1.00 143.76 ? 36   DA  I C2    1 
ATOM   8312  N  N3    . DA  I 5 109 ? -12.672 -32.146 8.005  1.00 149.01 ? 36   DA  I N3    1 
ATOM   8313  C  C4    . DA  I 5 109 ? -12.839 -33.347 7.424  1.00 145.86 ? 36   DA  I C4    1 
ATOM   8314  P  P     . DA  I 5 110 ? -15.933 -34.806 12.584 1.00 128.75 ? 37   DA  I P     1 
ATOM   8315  O  OP1   . DA  I 5 110 ? -16.062 -35.250 13.995 1.00 122.54 ? 37   DA  I OP1   1 
ATOM   8316  O  OP2   . DA  I 5 110 ? -16.779 -35.423 11.531 1.00 114.03 ? 37   DA  I OP2   1 
ATOM   8317  O  "O5'" . DA  I 5 110 ? -16.162 -33.230 12.563 1.00 124.57 ? 37   DA  I "O5'" 1 
ATOM   8318  C  "C5'" . DA  I 5 110 ? -15.130 -32.323 12.998 1.00 117.89 ? 37   DA  I "C5'" 1 
ATOM   8319  C  "C4'" . DA  I 5 110 ? -15.356 -30.958 12.394 1.00 117.47 ? 37   DA  I "C4'" 1 
ATOM   8320  O  "O4'" . DA  I 5 110 ? -14.945 -30.983 10.998 1.00 125.44 ? 37   DA  I "O4'" 1 
ATOM   8321  C  "C3'" . DA  I 5 110 ? -16.807 -30.466 12.387 1.00 109.71 ? 37   DA  I "C3'" 1 
ATOM   8322  O  "O3'" . DA  I 5 110 ? -16.836 -29.048 12.518 1.00 101.80 ? 37   DA  I "O3'" 1 
ATOM   8323  C  "C2'" . DA  I 5 110 ? -17.293 -30.913 11.019 1.00 119.82 ? 37   DA  I "C2'" 1 
ATOM   8324  C  "C1'" . DA  I 5 110 ? -16.050 -30.639 10.178 1.00 137.87 ? 37   DA  I "C1'" 1 
ATOM   8325  N  N9    . DA  I 5 110 ? -16.008 -31.431 8.948  1.00 146.38 ? 37   DA  I N9    1 
ATOM   8326  C  C8    . DA  I 5 110 ? -16.291 -32.766 8.785  1.00 152.63 ? 37   DA  I C8    1 
ATOM   8327  N  N7    . DA  I 5 110 ? -16.195 -33.179 7.544  1.00 142.36 ? 37   DA  I N7    1 
ATOM   8328  C  C5    . DA  I 5 110 ? -15.851 -32.035 6.839  1.00 140.14 ? 37   DA  I C5    1 
ATOM   8329  C  C6    . DA  I 5 110 ? -15.607 -31.804 5.476  1.00 144.17 ? 37   DA  I C6    1 
ATOM   8330  N  N6    . DA  I 5 110 ? -15.672 -32.753 4.543  1.00 141.60 ? 37   DA  I N6    1 
ATOM   8331  N  N1    . DA  I 5 110 ? -15.280 -30.548 5.101  1.00 156.01 ? 37   DA  I N1    1 
ATOM   8332  C  C2    . DA  I 5 110 ? -15.210 -29.595 6.041  1.00 156.79 ? 37   DA  I C2    1 
ATOM   8333  N  N3    . DA  I 5 110 ? -15.422 -29.689 7.352  1.00 135.00 ? 37   DA  I N3    1 
ATOM   8334  C  C4    . DA  I 5 110 ? -15.742 -30.950 7.690  1.00 136.18 ? 37   DA  I C4    1 
ATOM   8335  P  P     . DT  I 5 111 ? -18.229 -28.261 12.473 1.00 98.09  ? 38   DT  I P     1 
ATOM   8336  O  OP1   . DT  I 5 111 ? -18.273 -27.294 13.609 1.00 86.03  ? 38   DT  I OP1   1 
ATOM   8337  O  OP2   . DT  I 5 111 ? -19.313 -29.268 12.295 1.00 92.01  ? 38   DT  I OP2   1 
ATOM   8338  O  "O5'" . DT  I 5 111 ? -18.074 -27.346 11.185 1.00 100.60 ? 38   DT  I "O5'" 1 
ATOM   8339  C  "C5'" . DT  I 5 111 ? -16.884 -26.554 11.005 1.00 117.64 ? 38   DT  I "C5'" 1 
ATOM   8340  C  "C4'" . DT  I 5 111 ? -16.963 -25.788 9.706  1.00 126.60 ? 38   DT  I "C4'" 1 
ATOM   8341  O  "O4'" . DT  I 5 111 ? -16.819 -26.706 8.589  1.00 131.39 ? 38   DT  I "O4'" 1 
ATOM   8342  C  "C3'" . DT  I 5 111 ? -18.290 -25.048 9.501  1.00 129.10 ? 38   DT  I "C3'" 1 
ATOM   8343  O  "O3'" . DT  I 5 111 ? -18.051 -23.677 9.140  1.00 127.03 ? 38   DT  I "O3'" 1 
ATOM   8344  C  "C2'" . DT  I 5 111 ? -18.997 -25.863 8.429  1.00 138.32 ? 38   DT  I "C2'" 1 
ATOM   8345  C  "C1'" . DT  I 5 111 ? -17.846 -26.467 7.639  1.00 136.69 ? 38   DT  I "C1'" 1 
ATOM   8346  N  N1    . DT  I 5 111 ? -18.151 -27.746 6.953  1.00 132.54 ? 38   DT  I N1    1 
ATOM   8347  C  C2    . DT  I 5 111 ? -17.945 -27.828 5.591  1.00 133.75 ? 38   DT  I C2    1 
ATOM   8348  O  O2    . DT  I 5 111 ? -17.507 -26.905 4.925  1.00 127.66 ? 38   DT  I O2    1 
ATOM   8349  N  N3    . DT  I 5 111 ? -18.259 -29.045 5.037  1.00 128.12 ? 38   DT  I N3    1 
ATOM   8350  C  C4    . DT  I 5 111 ? -18.745 -30.160 5.693  1.00 135.34 ? 38   DT  I C4    1 
ATOM   8351  O  O4    . DT  I 5 111 ? -18.972 -31.189 5.063  1.00 131.66 ? 38   DT  I O4    1 
ATOM   8352  C  C5    . DT  I 5 111 ? -18.946 -30.000 7.117  1.00 136.38 ? 38   DT  I C5    1 
ATOM   8353  C  C7    . DT  I 5 111 ? -19.476 -31.153 7.911  1.00 137.74 ? 38   DT  I C7    1 
ATOM   8354  C  C6    . DT  I 5 111 ? -18.645 -28.816 7.667  1.00 122.37 ? 38   DT  I C6    1 
ATOM   8355  P  P     . DA  I 5 112 ? -19.272 -22.628 9.031  1.00 122.92 ? 39   DA  I P     1 
ATOM   8356  O  OP1   . DA  I 5 112 ? -18.742 -21.262 9.262  1.00 111.54 ? 39   DA  I OP1   1 
ATOM   8357  O  OP2   . DA  I 5 112 ? -20.406 -23.143 9.839  1.00 116.72 ? 39   DA  I OP2   1 
ATOM   8358  O  "O5'" . DA  I 5 112 ? -19.685 -22.698 7.494  1.00 150.55 ? 39   DA  I "O5'" 1 
ATOM   8359  C  "C5'" . DA  I 5 112 ? -18.702 -22.691 6.434  1.00 152.08 ? 39   DA  I "C5'" 1 
ATOM   8360  C  "C4'" . DA  I 5 112 ? -19.378 -22.882 5.093  1.00 145.85 ? 39   DA  I "C4'" 1 
ATOM   8361  O  "O4'" . DA  I 5 112 ? -19.433 -24.297 4.760  1.00 140.11 ? 39   DA  I "O4'" 1 
ATOM   8362  C  "C3'" . DA  I 5 112 ? -20.817 -22.362 5.000  1.00 145.00 ? 39   DA  I "C3'" 1 
ATOM   8363  O  "O3'" . DA  I 5 112 ? -20.948 -21.508 3.873  1.00 152.68 ? 39   DA  I "O3'" 1 
ATOM   8364  C  "C2'" . DA  I 5 112 ? -21.656 -23.637 4.899  1.00 140.40 ? 39   DA  I "C2'" 1 
ATOM   8365  C  "C1'" . DA  I 5 112 ? -20.690 -24.581 4.194  1.00 138.34 ? 39   DA  I "C1'" 1 
ATOM   8366  N  N9    . DA  I 5 112 ? -21.004 -25.992 4.407  1.00 141.00 ? 39   DA  I N9    1 
ATOM   8367  C  C8    . DA  I 5 112 ? -21.150 -26.667 5.593  1.00 143.11 ? 39   DA  I C8    1 
ATOM   8368  N  N7    . DA  I 5 112 ? -21.469 -27.930 5.446  1.00 142.94 ? 39   DA  I N7    1 
ATOM   8369  C  C5    . DA  I 5 112 ? -21.556 -28.093 4.071  1.00 151.76 ? 39   DA  I C5    1 
ATOM   8370  C  C6    . DA  I 5 112 ? -21.865 -29.205 3.267  1.00 156.29 ? 39   DA  I C6    1 
ATOM   8371  N  N6    . DA  I 5 112 ? -22.151 -30.413 3.755  1.00 147.77 ? 39   DA  I N6    1 
ATOM   8372  N  N1    . DA  I 5 112 ? -21.871 -29.030 1.927  1.00 163.34 ? 39   DA  I N1    1 
ATOM   8373  C  C2    . DA  I 5 112 ? -21.583 -27.816 1.438  1.00 170.42 ? 39   DA  I C2    1 
ATOM   8374  N  N3    . DA  I 5 112 ? -21.275 -26.696 2.091  1.00 162.08 ? 39   DA  I N3    1 
ATOM   8375  C  C4    . DA  I 5 112 ? -21.279 -26.905 3.419  1.00 150.53 ? 39   DA  I C4    1 
ATOM   8376  P  P     . DC  I 5 113 ? -22.245 -20.585 3.703  1.00 147.16 ? 40   DC  I P     1 
ATOM   8377  O  OP1   . DC  I 5 113 ? -21.878 -19.205 4.111  1.00 131.50 ? 40   DC  I OP1   1 
ATOM   8378  O  OP2   . DC  I 5 113 ? -23.389 -21.259 4.373  1.00 136.39 ? 40   DC  I OP2   1 
ATOM   8379  O  "O5'" . DC  I 5 113 ? -22.474 -20.605 2.124  1.00 145.81 ? 40   DC  I "O5'" 1 
ATOM   8380  C  "C5'" . DC  I 5 113 ? -21.938 -21.657 1.291  1.00 140.25 ? 40   DC  I "C5'" 1 
ATOM   8381  C  "C4'" . DC  I 5 113 ? -23.058 -22.419 0.627  1.00 142.31 ? 40   DC  I "C4'" 1 
ATOM   8382  O  "O4'" . DC  I 5 113 ? -23.178 -23.738 1.211  1.00 142.27 ? 40   DC  I "O4'" 1 
ATOM   8383  C  "C3'" . DC  I 5 113 ? -24.453 -21.789 0.717  1.00 149.80 ? 40   DC  I "C3'" 1 
ATOM   8384  O  "O3'" . DC  I 5 113 ? -24.858 -21.413 -0.599 1.00 159.55 ? 40   DC  I "O3'" 1 
ATOM   8385  C  "C2'" . DC  I 5 113 ? -25.315 -22.866 1.394  1.00 145.94 ? 40   DC  I "C2'" 1 
ATOM   8386  C  "C1'" . DC  I 5 113 ? -24.520 -24.139 1.107  1.00 155.22 ? 40   DC  I "C1'" 1 
ATOM   8387  N  N1    . DC  I 5 113 ? -24.760 -25.255 2.043  1.00 159.19 ? 40   DC  I N1    1 
ATOM   8388  C  C2    . DC  I 5 113 ? -24.943 -26.547 1.527  1.00 154.40 ? 40   DC  I C2    1 
ATOM   8389  O  O2    . DC  I 5 113 ? -24.894 -26.719 0.300  1.00 130.61 ? 40   DC  I O2    1 
ATOM   8390  N  N3    . DC  I 5 113 ? -25.167 -27.573 2.379  1.00 154.88 ? 40   DC  I N3    1 
ATOM   8391  C  C4    . DC  I 5 113 ? -25.213 -27.349 3.695  1.00 151.46 ? 40   DC  I C4    1 
ATOM   8392  N  N4    . DC  I 5 113 ? -25.431 -28.392 4.498  1.00 154.69 ? 40   DC  I N4    1 
ATOM   8393  C  C5    . DC  I 5 113 ? -25.035 -26.045 4.246  1.00 147.36 ? 40   DC  I C5    1 
ATOM   8394  C  C6    . DC  I 5 113 ? -24.813 -25.037 3.392  1.00 149.77 ? 40   DC  I C6    1 
ATOM   8395  P  P     . DA  I 5 114 ? -26.274 -20.699 -0.852 1.00 151.74 ? 41   DA  I P     1 
ATOM   8396  O  OP1   . DA  I 5 114 ? -26.104 -19.714 -1.948 1.00 149.50 ? 41   DA  I OP1   1 
ATOM   8397  O  OP2   . DA  I 5 114 ? -26.792 -20.231 0.453  1.00 142.71 ? 41   DA  I OP2   1 
ATOM   8398  O  "O5'" . DA  I 5 114 ? -27.172 -21.905 -1.383 1.00 145.57 ? 41   DA  I "O5'" 1 
ATOM   8399  C  "C5'" . DA  I 5 114 ? -26.647 -22.846 -2.342 1.00 144.48 ? 41   DA  I "C5'" 1 
ATOM   8400  C  "C4'" . DA  I 5 114 ? -27.556 -24.046 -2.472 1.00 153.80 ? 41   DA  I "C4'" 1 
ATOM   8401  O  "O4'" . DA  I 5 114 ? -27.296 -24.984 -1.383 1.00 165.22 ? 41   DA  I "O4'" 1 
ATOM   8402  C  "C3'" . DA  I 5 114 ? -29.063 -23.767 -2.416 1.00 159.85 ? 41   DA  I "C3'" 1 
ATOM   8403  O  "O3'" . DA  I 5 114 ? -29.722 -24.633 -3.340 1.00 165.82 ? 41   DA  I "O3'" 1 
ATOM   8404  C  "C2'" . DA  I 5 114 ? -29.401 -24.157 -0.985 1.00 164.57 ? 41   DA  I "C2'" 1 
ATOM   8405  C  "C1'" . DA  I 5 114 ? -28.534 -25.400 -0.849 1.00 172.71 ? 41   DA  I "C1'" 1 
ATOM   8406  N  N9    . DA  I 5 114 ? -28.354 -25.891 0.517  1.00 175.64 ? 41   DA  I N9    1 
ATOM   8407  C  C8    . DA  I 5 114 ? -28.073 -25.185 1.662  1.00 176.44 ? 41   DA  I C8    1 
ATOM   8408  N  N7    . DA  I 5 114 ? -28.014 -25.929 2.740  1.00 166.15 ? 41   DA  I N7    1 
ATOM   8409  C  C5    . DA  I 5 114 ? -28.300 -27.206 2.278  1.00 171.89 ? 41   DA  I C5    1 
ATOM   8410  C  C6    . DA  I 5 114 ? -28.391 -28.448 2.929  1.00 168.91 ? 41   DA  I C6    1 
ATOM   8411  N  N6    . DA  I 5 114 ? -28.204 -28.608 4.239  1.00 154.45 ? 41   DA  I N6    1 
ATOM   8412  N  N1    . DA  I 5 114 ? -28.691 -29.532 2.178  1.00 166.34 ? 41   DA  I N1    1 
ATOM   8413  C  C2    . DA  I 5 114 ? -28.881 -29.367 0.862  1.00 155.31 ? 41   DA  I C2    1 
ATOM   8414  N  N3    . DA  I 5 114 ? -28.818 -28.253 0.136  1.00 157.35 ? 41   DA  I N3    1 
ATOM   8415  C  C4    . DA  I 5 114 ? -28.520 -27.196 0.913  1.00 168.63 ? 41   DA  I C4    1 
ATOM   8416  P  P     . DC  I 5 115 ? -31.323 -24.591 -3.535 1.00 162.99 ? 42   DC  I P     1 
ATOM   8417  O  OP1   . DC  I 5 115 ? -31.631 -23.519 -4.511 1.00 162.38 ? 42   DC  I OP1   1 
ATOM   8418  O  OP2   . DC  I 5 115 ? -31.979 -24.558 -2.207 1.00 154.76 ? 42   DC  I OP2   1 
ATOM   8419  O  "O5'" . DC  I 5 115 ? -31.645 -26.022 -4.163 1.00 184.65 ? 42   DC  I "O5'" 1 
ATOM   8420  C  "C5'" . DC  I 5 115 ? -30.778 -27.165 -3.965 1.00 187.99 ? 42   DC  I "C5'" 1 
ATOM   8421  C  "C4'" . DC  I 5 115 ? -31.477 -28.262 -3.186 1.00 186.47 ? 42   DC  I "C4'" 1 
ATOM   8422  O  "O4'" . DC  I 5 115 ? -31.123 -28.165 -1.785 1.00 188.49 ? 42   DC  I "O4'" 1 
ATOM   8423  C  "C3'" . DC  I 5 115 ? -33.011 -28.306 -3.249 1.00 175.47 ? 42   DC  I "C3'" 1 
ATOM   8424  O  "O3'" . DC  I 5 115 ? -33.379 -29.440 -4.051 1.00 167.02 ? 42   DC  I "O3'" 1 
ATOM   8425  C  "C2'" . DC  I 5 115 ? -33.457 -28.234 -1.779 1.00 182.86 ? 42   DC  I "C2'" 1 
ATOM   8426  C  "C1'" . DC  I 5 115 ? -32.197 -28.646 -1.017 1.00 183.83 ? 42   DC  I "C1'" 1 
ATOM   8427  N  N1    . DC  I 5 115 ? -32.115 -28.055 0.333  1.00 171.09 ? 42   DC  I N1    1 
ATOM   8428  C  C2    . DC  I 5 115 ? -32.396 -28.858 1.445  1.00 152.20 ? 42   DC  I C2    1 
ATOM   8429  O  O2    . DC  I 5 115 ? -32.690 -30.050 1.267  1.00 126.91 ? 42   DC  I O2    1 
ATOM   8430  N  N3    . DC  I 5 115 ? -32.340 -28.313 2.683  1.00 149.87 ? 42   DC  I N3    1 
ATOM   8431  C  C4    . DC  I 5 115 ? -32.031 -27.022 2.831  1.00 138.77 ? 42   DC  I C4    1 
ATOM   8432  N  N4    . DC  I 5 115 ? -31.987 -26.528 4.068  1.00 135.34 ? 42   DC  I N4    1 
ATOM   8433  C  C5    . DC  I 5 115 ? -31.746 -26.183 1.717  1.00 147.61 ? 42   DC  I C5    1 
ATOM   8434  C  C6    . DC  I 5 115 ? -31.807 -26.732 0.497  1.00 165.72 ? 42   DC  I C6    1 
ATOM   8435  P  P     . DT  I 5 116 ? -34.680 -30.355 -3.733 1.00 166.23 ? 43   DT  I P     1 
ATOM   8436  O  OP1   . DT  I 5 116 ? -34.944 -31.197 -4.932 1.00 160.39 ? 43   DT  I OP1   1 
ATOM   8437  O  OP2   . DT  I 5 116 ? -35.758 -29.479 -3.199 1.00 143.78 ? 43   DT  I OP2   1 
ATOM   8438  O  "O5'" . DT  I 5 116 ? -34.162 -31.340 -2.591 1.00 168.24 ? 43   DT  I "O5'" 1 
ATOM   8439  C  "C5'" . DT  I 5 116 ? -34.554 -32.729 -2.542 1.00 157.18 ? 43   DT  I "C5'" 1 
ATOM   8440  C  "C4'" . DT  I 5 116 ? -35.424 -32.976 -1.332 1.00 149.68 ? 43   DT  I "C4'" 1 
ATOM   8441  O  "O4'" . DT  I 5 116 ? -35.051 -32.067 -0.271 1.00 160.87 ? 43   DT  I "O4'" 1 
ATOM   8442  C  "C3'" . DT  I 5 116 ? -36.922 -32.759 -1.574 1.00 143.91 ? 43   DT  I "C3'" 1 
ATOM   8443  O  "O3'" . DT  I 5 116 ? -37.590 -34.026 -1.688 1.00 144.30 ? 43   DT  I "O3'" 1 
ATOM   8444  C  "C2'" . DT  I 5 116 ? -37.362 -31.826 -0.454 1.00 154.09 ? 43   DT  I "C2'" 1 
ATOM   8445  C  "C1'" . DT  I 5 116 ? -36.197 -31.852 0.524  1.00 166.91 ? 43   DT  I "C1'" 1 
ATOM   8446  N  N1    . DT  I 5 116 ? -36.002 -30.608 1.308  1.00 164.23 ? 43   DT  I N1    1 
ATOM   8447  C  C2    . DT  I 5 116 ? -35.789 -30.717 2.666  1.00 145.86 ? 43   DT  I C2    1 
ATOM   8448  O  O2    . DT  I 5 116 ? -35.711 -31.787 3.247  1.00 131.44 ? 43   DT  I O2    1 
ATOM   8449  N  N3    . DT  I 5 116 ? -35.664 -29.520 3.323  1.00 142.41 ? 43   DT  I N3    1 
ATOM   8450  C  C4    . DT  I 5 116 ? -35.731 -28.254 2.773  1.00 158.17 ? 43   DT  I C4    1 
ATOM   8451  O  O4    . DT  I 5 116 ? -35.586 -27.269 3.489  1.00 170.08 ? 43   DT  I O4    1 
ATOM   8452  C  C5    . DT  I 5 116 ? -35.974 -28.212 1.348  1.00 162.54 ? 43   DT  I C5    1 
ATOM   8453  C  C7    . DT  I 5 116 ? -36.062 -26.885 0.664  1.00 160.28 ? 43   DT  I C7    1 
ATOM   8454  C  C6    . DT  I 5 116 ? -36.099 -29.375 0.697  1.00 164.10 ? 43   DT  I C6    1 
ATOM   8455  P  P     . DT  I 5 117 ? -38.443 -34.658 -0.479 1.00 146.91 ? 44   DT  I P     1 
ATOM   8456  O  OP1   . DT  I 5 117 ? -38.796 -36.051 -0.854 1.00 142.76 ? 44   DT  I OP1   1 
ATOM   8457  O  OP2   . DT  I 5 117 ? -39.537 -33.713 -0.133 1.00 138.95 ? 44   DT  I OP2   1 
ATOM   8458  O  "O5'" . DT  I 5 117 ? -37.391 -34.707 0.719  1.00 173.07 ? 44   DT  I "O5'" 1 
ATOM   8459  C  "C5'" . DT  I 5 117 ? -37.107 -35.924 1.449  1.00 164.05 ? 44   DT  I "C5'" 1 
ATOM   8460  C  "C4'" . DT  I 5 117 ? -37.434 -35.768 2.918  1.00 145.09 ? 44   DT  I "C4'" 1 
ATOM   8461  O  "O4'" . DT  I 5 117 ? -37.367 -34.378 3.317  1.00 144.10 ? 44   DT  I "O4'" 1 
ATOM   8462  C  "C3'" . DT  I 5 117 ? -38.822 -36.263 3.349  1.00 134.24 ? 44   DT  I "C3'" 1 
ATOM   8463  O  "O3'" . DT  I 5 117 ? -38.611 -37.167 4.434  1.00 123.09 ? 44   DT  I "O3'" 1 
ATOM   8464  C  "C2'" . DT  I 5 117 ? -39.550 -34.995 3.769  1.00 137.04 ? 44   DT  I "C2'" 1 
ATOM   8465  C  "C1'" . DT  I 5 117 ? -38.394 -34.159 4.265  1.00 148.11 ? 44   DT  I "C1'" 1 
ATOM   8466  N  N1    . DT  I 5 117 ? -38.617 -32.702 4.377  1.00 151.56 ? 44   DT  I N1    1 
ATOM   8467  C  C2    . DT  I 5 117 ? -38.552 -32.131 5.630  1.00 146.88 ? 44   DT  I C2    1 
ATOM   8468  O  O2    . DT  I 5 117 ? -38.353 -32.774 6.648  1.00 138.32 ? 44   DT  I O2    1 
ATOM   8469  N  N3    . DT  I 5 117 ? -38.747 -30.772 5.650  1.00 144.44 ? 44   DT  I N3    1 
ATOM   8470  C  C4    . DT  I 5 117 ? -38.985 -29.947 4.567  1.00 148.80 ? 44   DT  I C4    1 
ATOM   8471  O  O4    . DT  I 5 117 ? -39.141 -28.743 4.741  1.00 138.38 ? 44   DT  I O4    1 
ATOM   8472  C  C5    . DT  I 5 117 ? -39.033 -30.611 3.284  1.00 159.94 ? 44   DT  I C5    1 
ATOM   8473  C  C7    . DT  I 5 117 ? -39.294 -29.797 2.056  1.00 162.05 ? 44   DT  I C7    1 
ATOM   8474  C  C6    . DT  I 5 117 ? -38.848 -31.937 3.253  1.00 157.29 ? 44   DT  I C6    1 
ATOM   8475  P  P     . DT  I 5 118 ? -39.841 -37.803 5.222  1.00 133.81 ? 45   DT  I P     1 
ATOM   8476  O  OP1   . DT  I 5 118 ? -39.515 -39.232 5.505  1.00 129.35 ? 45   DT  I OP1   1 
ATOM   8477  O  OP2   . DT  I 5 118 ? -41.102 -37.413 4.535  1.00 116.86 ? 45   DT  I OP2   1 
ATOM   8478  O  "O5'" . DT  I 5 118 ? -39.835 -37.008 6.600  1.00 153.69 ? 45   DT  I "O5'" 1 
ATOM   8479  C  "C5'" . DT  I 5 118 ? -39.044 -37.423 7.734  1.00 142.87 ? 45   DT  I "C5'" 1 
ATOM   8480  C  "C4'" . DT  I 5 118 ? -39.499 -36.633 8.936  1.00 130.06 ? 45   DT  I "C4'" 1 
ATOM   8481  O  "O4'" . DT  I 5 118 ? -39.450 -35.235 8.585  1.00 127.15 ? 45   DT  I "O4'" 1 
ATOM   8482  C  "C3'" . DT  I 5 118 ? -40.958 -36.904 9.308  1.00 138.39 ? 45   DT  I "C3'" 1 
ATOM   8483  O  "O3'" . DT  I 5 118 ? -41.184 -37.845 10.363 1.00 134.76 ? 45   DT  I "O3'" 1 
ATOM   8484  C  "C2'" . DT  I 5 118 ? -41.516 -35.543 9.690  1.00 138.48 ? 45   DT  I "C2'" 1 
ATOM   8485  C  "C1'" . DT  I 5 118 ? -40.435 -34.536 9.329  1.00 140.21 ? 45   DT  I "C1'" 1 
ATOM   8486  N  N1    . DT  I 5 118 ? -40.945 -33.435 8.495  1.00 142.71 ? 45   DT  I N1    1 
ATOM   8487  C  C2    . DT  I 5 118 ? -41.053 -32.178 9.050  1.00 144.57 ? 45   DT  I C2    1 
ATOM   8488  O  O2    . DT  I 5 118 ? -40.711 -31.921 10.191 1.00 145.27 ? 45   DT  I O2    1 
ATOM   8489  N  N3    . DT  I 5 118 ? -41.562 -31.223 8.208  1.00 149.99 ? 45   DT  I N3    1 
ATOM   8490  C  C4    . DT  I 5 118 ? -41.970 -31.396 6.900  1.00 159.03 ? 45   DT  I C4    1 
ATOM   8491  O  O4    . DT  I 5 118 ? -42.403 -30.438 6.264  1.00 140.46 ? 45   DT  I O4    1 
ATOM   8492  C  C5    . DT  I 5 118 ? -41.846 -32.744 6.387  1.00 163.37 ? 45   DT  I C5    1 
ATOM   8493  C  C7    . DT  I 5 118 ? -42.266 -33.029 4.980  1.00 159.51 ? 45   DT  I C7    1 
ATOM   8494  C  C6    . DT  I 5 118 ? -41.353 -33.684 7.203  1.00 155.98 ? 45   DT  I C6    1 
ATOM   8495  P  P     . DT  I 5 119 ? -40.267 -37.874 11.663 1.00 125.52 ? 46   DT  I P     1 
ATOM   8496  O  OP1   . DT  I 5 119 ? -38.944 -38.470 11.271 1.00 101.81 ? 46   DT  I OP1   1 
ATOM   8497  O  OP2   . DT  I 5 119 ? -41.087 -38.444 12.774 1.00 96.83  ? 46   DT  I OP2   1 
ATOM   8498  O  "O5'" . DT  I 5 119 ? -40.052 -36.336 12.015 1.00 124.93 ? 46   DT  I "O5'" 1 
ATOM   8499  C  "C5'" . DT  I 5 119 ? -38.810 -35.880 12.584 1.00 123.56 ? 46   DT  I "C5'" 1 
ATOM   8500  C  "C4'" . DT  I 5 119 ? -39.047 -34.698 13.495 1.00 120.58 ? 46   DT  I "C4'" 1 
ATOM   8501  O  "O4'" . DT  I 5 119 ? -39.876 -33.710 12.834 1.00 119.93 ? 46   DT  I "O4'" 1 
ATOM   8502  C  "C3'" . DT  I 5 119 ? -39.733 -35.019 14.824 1.00 126.59 ? 46   DT  I "C3'" 1 
ATOM   8503  O  "O3'" . DT  I 5 119 ? -39.030 -34.291 15.835 1.00 132.13 ? 46   DT  I "O3'" 1 
ATOM   8504  C  "C2'" . DT  I 5 119 ? -41.158 -34.529 14.627 1.00 130.06 ? 46   DT  I "C2'" 1 
ATOM   8505  C  "C1'" . DT  I 5 119 ? -40.991 -33.365 13.651 1.00 137.81 ? 46   DT  I "C1'" 1 
ATOM   8506  N  N1    . DT  I 5 119 ? -42.143 -33.082 12.749 1.00 138.04 ? 46   DT  I N1    1 
ATOM   8507  C  C2    . DT  I 5 119 ? -42.403 -31.780 12.361 1.00 133.55 ? 46   DT  I C2    1 
ATOM   8508  O  O2    . DT  I 5 119 ? -41.755 -30.819 12.744 1.00 108.66 ? 46   DT  I O2    1 
ATOM   8509  N  N3    . DT  I 5 119 ? -43.462 -31.644 11.499 1.00 144.17 ? 46   DT  I N3    1 
ATOM   8510  C  C4    . DT  I 5 119 ? -44.269 -32.649 11.000 1.00 154.65 ? 46   DT  I C4    1 
ATOM   8511  O  O4    . DT  I 5 119 ? -45.190 -32.370 10.237 1.00 166.29 ? 46   DT  I O4    1 
ATOM   8512  C  C5    . DT  I 5 119 ? -43.940 -33.985 11.447 1.00 147.91 ? 46   DT  I C5    1 
ATOM   8513  C  C7    . DT  I 5 119 ? -44.763 -35.139 10.963 1.00 139.10 ? 46   DT  I C7    1 
ATOM   8514  C  C6    . DT  I 5 119 ? -42.908 -34.131 12.286 1.00 143.16 ? 46   DT  I C6    1 
ATOM   8515  P  P     . DG  I 5 120 ? -39.170 -34.646 17.389 1.00 117.87 ? 47   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 5 120 ? -37.805 -34.932 17.914 1.00 94.94  ? 47   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 5 120 ? -40.272 -35.637 17.557 1.00 111.82 ? 47   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 5 120 ? -39.635 -33.254 17.996 1.00 106.87 ? 47   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 5 120 ? -39.047 -32.021 17.537 1.00 102.52 ? 47   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 5 120 ? -40.037 -30.900 17.693 1.00 102.57 ? 47   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 5 120 ? -41.072 -31.038 16.683 1.00 112.26 ? 47   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 5 120 ? -40.755 -30.857 19.039 1.00 107.43 ? 47   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 5 120 ? -40.855 -29.511 19.461 1.00 103.34 ? 47   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 5 120 ? -42.123 -31.461 18.733 1.00 116.14 ? 47   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 5 120 ? -42.345 -30.993 17.297 1.00 122.84 ? 47   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 5 120 ? -43.253 -31.836 16.525 1.00 129.39 ? 47   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 5 120 ? -43.449 -33.190 16.660 1.00 139.63 ? 47   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 5 120 ? -44.311 -33.670 15.805 1.00 139.05 ? 47   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 5 120 ? -44.716 -32.565 15.069 1.00 135.25 ? 47   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 5 120 ? -45.647 -32.461 14.003 1.00 129.40 ? 47   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 5 120 ? -46.323 -33.354 13.479 1.00 115.02 ? 47   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 5 120 ? -45.751 -31.153 13.542 1.00 136.79 ? 47   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 5 120 ? -45.047 -30.081 14.040 1.00 136.35 ? 47   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 5 120 ? -45.286 -28.892 13.466 1.00 129.58 ? 47   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 5 120 ? -44.181 -30.165 15.035 1.00 136.67 ? 47   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 5 120 ? -44.067 -31.427 15.499 1.00 131.87 ? 47   DG  I C4    1 
ATOM   8537  P  P     . DG  I 5 121 ? -40.842 -29.148 21.006 1.00 97.80  ? 48   DG  I P     1 
ATOM   8538  O  OP1   . DG  I 5 121 ? -39.473 -28.663 21.317 1.00 92.61  ? 48   DG  I OP1   1 
ATOM   8539  O  OP2   . DG  I 5 121 ? -41.405 -30.298 21.762 1.00 88.51  ? 48   DG  I OP2   1 
ATOM   8540  O  "O5'" . DG  I 5 121 ? -41.857 -27.917 21.064 1.00 98.26  ? 48   DG  I "O5'" 1 
ATOM   8541  C  "C5'" . DG  I 5 121 ? -41.565 -26.720 20.291 1.00 114.62 ? 48   DG  I "C5'" 1 
ATOM   8542  C  "C4'" . DG  I 5 121 ? -42.812 -25.946 19.896 1.00 112.21 ? 48   DG  I "C4'" 1 
ATOM   8543  O  "O4'" . DG  I 5 121 ? -43.555 -26.671 18.877 1.00 113.87 ? 48   DG  I "O4'" 1 
ATOM   8544  C  "C3'" . DG  I 5 121 ? -43.817 -25.655 21.005 1.00 106.05 ? 48   DG  I "C3'" 1 
ATOM   8545  O  "O3'" . DG  I 5 121 ? -44.468 -24.416 20.789 1.00 100.93 ? 48   DG  I "O3'" 1 
ATOM   8546  C  "C2'" . DG  I 5 121 ? -44.835 -26.766 20.820 1.00 112.46 ? 48   DG  I "C2'" 1 
ATOM   8547  C  "C1'" . DG  I 5 121 ? -44.892 -26.817 19.302 1.00 118.21 ? 48   DG  I "C1'" 1 
ATOM   8548  N  N9    . DG  I 5 121 ? -45.416 -28.064 18.770 1.00 129.99 ? 48   DG  I N9    1 
ATOM   8549  C  C8    . DG  I 5 121 ? -45.269 -29.334 19.273 1.00 134.90 ? 48   DG  I C8    1 
ATOM   8550  N  N7    . DG  I 5 121 ? -45.880 -30.240 18.560 1.00 129.24 ? 48   DG  I N7    1 
ATOM   8551  C  C5    . DG  I 5 121 ? -46.473 -29.522 17.532 1.00 136.02 ? 48   DG  I C5    1 
ATOM   8552  C  C6    . DG  I 5 121 ? -47.267 -29.961 16.447 1.00 159.24 ? 48   DG  I C6    1 
ATOM   8553  O  O6    . DG  I 5 121 ? -47.620 -31.114 16.168 1.00 169.89 ? 48   DG  I O6    1 
ATOM   8554  N  N1    . DG  I 5 121 ? -47.657 -28.899 15.636 1.00 171.82 ? 48   DG  I N1    1 
ATOM   8555  C  C2    . DG  I 5 121 ? -47.324 -27.582 15.845 1.00 155.98 ? 48   DG  I C2    1 
ATOM   8556  N  N2    . DG  I 5 121 ? -47.796 -26.699 14.953 1.00 157.60 ? 48   DG  I N2    1 
ATOM   8557  N  N3    . DG  I 5 121 ? -46.587 -27.161 16.855 1.00 136.47 ? 48   DG  I N3    1 
ATOM   8558  C  C4    . DG  I 5 121 ? -46.197 -28.177 17.651 1.00 133.16 ? 48   DG  I C4    1 
ATOM   8559  P  P     . DT  I 5 122 ? -45.418 -23.828 21.930 1.00 111.05 ? 49   DT  I P     1 
ATOM   8560  O  OP1   . DT  I 5 122 ? -44.688 -22.729 22.622 1.00 119.83 ? 49   DT  I OP1   1 
ATOM   8561  O  OP2   . DT  I 5 122 ? -45.983 -24.968 22.692 1.00 105.61 ? 49   DT  I OP2   1 
ATOM   8562  O  "O5'" . DT  I 5 122 ? -46.667 -23.230 21.145 1.00 123.25 ? 49   DT  I "O5'" 1 
ATOM   8563  C  "C5'" . DT  I 5 122 ? -46.637 -22.932 19.740 1.00 122.09 ? 49   DT  I "C5'" 1 
ATOM   8564  C  "C4'" . DT  I 5 122 ? -48.038 -23.044 19.192 1.00 122.02 ? 49   DT  I "C4'" 1 
ATOM   8565  O  "O4'" . DT  I 5 122 ? -48.296 -24.409 18.778 1.00 124.10 ? 49   DT  I "O4'" 1 
ATOM   8566  C  "C3'" . DT  I 5 122 ? -49.135 -22.685 20.198 1.00 131.80 ? 49   DT  I "C3'" 1 
ATOM   8567  O  "O3'" . DT  I 5 122 ? -50.028 -21.809 19.514 1.00 149.65 ? 49   DT  I "O3'" 1 
ATOM   8568  C  "C2'" . DT  I 5 122 ? -49.733 -24.032 20.571 1.00 129.58 ? 49   DT  I "C2'" 1 
ATOM   8569  C  "C1'" . DT  I 5 122 ? -49.556 -24.815 19.283 1.00 130.40 ? 49   DT  I "C1'" 1 
ATOM   8570  N  N1    . DT  I 5 122 ? -49.562 -26.299 19.381 1.00 137.04 ? 49   DT  I N1    1 
ATOM   8571  C  C2    . DT  I 5 122 ? -49.809 -27.010 18.228 1.00 131.93 ? 49   DT  I C2    1 
ATOM   8572  O  O2    . DT  I 5 122 ? -50.003 -26.479 17.148 1.00 130.96 ? 49   DT  I O2    1 
ATOM   8573  N  N3    . DT  I 5 122 ? -49.815 -28.375 18.384 1.00 131.98 ? 49   DT  I N3    1 
ATOM   8574  C  C4    . DT  I 5 122 ? -49.609 -29.082 19.554 1.00 130.71 ? 49   DT  I C4    1 
ATOM   8575  O  O4    . DT  I 5 122 ? -49.646 -30.309 19.540 1.00 122.59 ? 49   DT  I O4    1 
ATOM   8576  C  C5    . DT  I 5 122 ? -49.365 -28.274 20.728 1.00 142.93 ? 49   DT  I C5    1 
ATOM   8577  C  C7    . DT  I 5 122 ? -49.131 -28.953 22.041 1.00 142.55 ? 49   DT  I C7    1 
ATOM   8578  C  C6    . DT  I 5 122 ? -49.354 -26.941 20.585 1.00 142.64 ? 49   DT  I C6    1 
ATOM   8579  P  P     . DA  I 5 123 ? -51.046 -20.850 20.298 1.00 152.58 ? 50   DA  I P     1 
ATOM   8580  O  OP1   . DA  I 5 123 ? -50.387 -19.532 20.494 1.00 139.40 ? 50   DA  I OP1   1 
ATOM   8581  O  OP2   . DA  I 5 123 ? -51.605 -21.591 21.462 1.00 132.11 ? 50   DA  I OP2   1 
ATOM   8582  O  "O5'" . DA  I 5 123 ? -52.199 -20.670 19.215 1.00 160.68 ? 50   DA  I "O5'" 1 
ATOM   8583  C  "C5'" . DA  I 5 123 ? -52.193 -21.455 18.000 1.00 159.30 ? 50   DA  I "C5'" 1 
ATOM   8584  C  "C4'" . DA  I 5 123 ? -53.378 -22.388 17.966 1.00 153.59 ? 50   DA  I "C4'" 1 
ATOM   8585  O  "O4'" . DA  I 5 123 ? -52.980 -23.751 18.303 1.00 141.01 ? 50   DA  I "O4'" 1 
ATOM   8586  C  "C3'" . DA  I 5 123 ? -54.521 -22.051 18.931 1.00 157.46 ? 50   DA  I "C3'" 1 
ATOM   8587  O  "O3'" . DA  I 5 123 ? -55.726 -22.259 18.212 1.00 168.91 ? 50   DA  I "O3'" 1 
ATOM   8588  C  "C2'" . DA  I 5 123 ? -54.368 -23.118 20.006 1.00 153.61 ? 50   DA  I "C2'" 1 
ATOM   8589  C  "C1'" . DA  I 5 123 ? -53.980 -24.300 19.131 1.00 154.38 ? 50   DA  I "C1'" 1 
ATOM   8590  N  N9    . DA  I 5 123 ? -53.469 -25.478 19.828 1.00 166.55 ? 50   DA  I N9    1 
ATOM   8591  C  C8    . DA  I 5 123 ? -52.914 -25.576 21.080 1.00 168.31 ? 50   DA  I C8    1 
ATOM   8592  N  N7    . DA  I 5 123 ? -52.609 -26.804 21.426 1.00 170.00 ? 50   DA  I N7    1 
ATOM   8593  C  C5    . DA  I 5 123 ? -53.010 -27.566 20.338 1.00 181.60 ? 50   DA  I C5    1 
ATOM   8594  C  C6    . DA  I 5 123 ? -52.964 -28.948 20.080 1.00 183.44 ? 50   DA  I C6    1 
ATOM   8595  N  N6    . DA  I 5 123 ? -52.465 -29.843 20.932 1.00 181.17 ? 50   DA  I N6    1 
ATOM   8596  N  N1    . DA  I 5 123 ? -53.456 -29.384 18.898 1.00 172.25 ? 50   DA  I N1    1 
ATOM   8597  C  C2    . DA  I 5 123 ? -53.960 -28.485 18.043 1.00 165.93 ? 50   DA  I C2    1 
ATOM   8598  N  N3    . DA  I 5 123 ? -54.058 -27.164 18.172 1.00 166.35 ? 50   DA  I N3    1 
ATOM   8599  C  C4    . DA  I 5 123 ? -53.560 -26.764 19.355 1.00 174.80 ? 50   DA  I C4    1 
ATOM   8600  P  P     . DG  I 5 124 ? -57.103 -21.650 18.730 1.00 168.26 ? 51   DG  I P     1 
ATOM   8601  O  OP1   . DG  I 5 124 ? -56.929 -20.183 18.863 1.00 168.54 ? 51   DG  I OP1   1 
ATOM   8602  O  OP2   . DG  I 5 124 ? -57.558 -22.442 19.903 1.00 164.70 ? 51   DG  I OP2   1 
ATOM   8603  O  "O5'" . DG  I 5 124 ? -58.081 -21.936 17.505 1.00 173.61 ? 51   DG  I "O5'" 1 
ATOM   8604  C  "C5'" . DG  I 5 124 ? -57.849 -23.031 16.588 1.00 178.73 ? 51   DG  I "C5'" 1 
ATOM   8605  C  "C4'" . DG  I 5 124 ? -58.520 -24.288 17.087 1.00 184.94 ? 51   DG  I "C4'" 1 
ATOM   8606  O  "O4'" . DG  I 5 124 ? -57.554 -25.111 17.771 1.00 177.09 ? 51   DG  I "O4'" 1 
ATOM   8607  C  "C3'" . DG  I 5 124 ? -59.642 -24.077 18.101 1.00 201.89 ? 51   DG  I "C3'" 1 
ATOM   8608  O  "O3'" . DG  I 5 124 ? -60.915 -24.010 17.456 1.00 217.27 ? 51   DG  I "O3'" 1 
ATOM   8609  C  "C2'" . DG  I 5 124 ? -59.520 -25.255 19.079 1.00 197.44 ? 51   DG  I "C2'" 1 
ATOM   8610  C  "C1'" . DG  I 5 124 ? -58.244 -25.977 18.634 1.00 186.80 ? 51   DG  I "C1'" 1 
ATOM   8611  N  N9    . DG  I 5 124 ? -57.377 -26.294 19.763 1.00 209.30 ? 51   DG  I N9    1 
ATOM   8612  C  C8    . DG  I 5 124 ? -56.859 -25.407 20.675 1.00 220.24 ? 51   DG  I C8    1 
ATOM   8613  N  N7    . DG  I 5 124 ? -56.133 -25.983 21.595 1.00 222.67 ? 51   DG  I N7    1 
ATOM   8614  C  C5    . DG  I 5 124 ? -56.188 -27.334 21.280 1.00 216.01 ? 51   DG  I C5    1 
ATOM   8615  C  C6    . DG  I 5 124 ? -55.600 -28.455 21.928 1.00 198.90 ? 51   DG  I C6    1 
ATOM   8616  O  O6    . DG  I 5 124 ? -54.883 -28.476 22.936 1.00 167.42 ? 51   DG  I O6    1 
ATOM   8617  N  N1    . DG  I 5 124 ? -55.916 -29.644 21.278 1.00 202.81 ? 51   DG  I N1    1 
ATOM   8618  C  C2    . DG  I 5 124 ? -56.699 -29.745 20.153 1.00 216.44 ? 51   DG  I C2    1 
ATOM   8619  N  N2    . DG  I 5 124 ? -56.892 -30.982 19.673 1.00 217.88 ? 51   DG  I N2    1 
ATOM   8620  N  N3    . DG  I 5 124 ? -57.255 -28.709 19.543 1.00 221.79 ? 51   DG  I N3    1 
ATOM   8621  C  C4    . DG  I 5 124 ? -56.961 -27.544 20.157 1.00 218.99 ? 51   DG  I C4    1 
ATOM   8622  P  P     . DT  I 5 125 ? -62.229 -23.537 18.269 1.00 210.17 ? 52   DT  I P     1 
ATOM   8623  O  OP1   . DT  I 5 125 ? -63.030 -22.652 17.383 1.00 204.80 ? 52   DT  I OP1   1 
ATOM   8624  O  OP2   . DT  I 5 125 ? -61.810 -23.049 19.612 1.00 189.09 ? 52   DT  I OP2   1 
ATOM   8625  O  "O5'" . DT  I 5 125 ? -63.043 -24.893 18.470 1.00 200.98 ? 52   DT  I "O5'" 1 
ATOM   8626  C  "C5'" . DT  I 5 125 ? -62.725 -26.107 17.754 1.00 193.06 ? 52   DT  I "C5'" 1 
ATOM   8627  C  "C4'" . DT  I 5 125 ? -62.813 -27.294 18.686 1.00 194.54 ? 52   DT  I "C4'" 1 
ATOM   8628  O  "O4'" . DT  I 5 125 ? -61.531 -27.555 19.297 1.00 187.13 ? 52   DT  I "O4'" 1 
ATOM   8629  C  "C3'" . DT  I 5 125 ? -63.796 -27.133 19.851 1.00 200.94 ? 52   DT  I "C3'" 1 
ATOM   8630  O  "O3'" . DT  I 5 125 ? -65.040 -27.792 19.580 1.00 221.01 ? 52   DT  I "O3'" 1 
ATOM   8631  C  "C2'" . DT  I 5 125 ? -63.070 -27.738 21.045 1.00 196.28 ? 52   DT  I "C2'" 1 
ATOM   8632  C  "C1'" . DT  I 5 125 ? -61.773 -28.289 20.477 1.00 192.60 ? 52   DT  I "C1'" 1 
ATOM   8633  N  N1    . DT  I 5 125 ? -60.628 -28.105 21.384 1.00 208.87 ? 52   DT  I N1    1 
ATOM   8634  C  C2    . DT  I 5 125 ? -59.842 -29.197 21.684 1.00 210.51 ? 52   DT  I C2    1 
ATOM   8635  O  O2    . DT  I 5 125 ? -60.024 -30.303 21.201 1.00 178.08 ? 52   DT  I O2    1 
ATOM   8636  N  N3    . DT  I 5 125 ? -58.821 -28.941 22.568 1.00 219.36 ? 52   DT  I N3    1 
ATOM   8637  C  C4    . DT  I 5 125 ? -58.533 -27.736 23.185 1.00 224.00 ? 52   DT  I C4    1 
ATOM   8638  O  O4    . DT  I 5 125 ? -57.581 -27.658 23.958 1.00 224.01 ? 52   DT  I O4    1 
ATOM   8639  C  C5    . DT  I 5 125 ? -59.407 -26.638 22.834 1.00 216.19 ? 52   DT  I C5    1 
ATOM   8640  C  C7    . DT  I 5 125 ? -59.166 -25.292 23.443 1.00 198.25 ? 52   DT  I C7    1 
ATOM   8641  C  C6    . DT  I 5 125 ? -60.402 -26.877 21.971 1.00 214.75 ? 52   DT  I C6    1 
ATOM   8642  P  P     . DA  I 5 126 ? -66.117 -28.032 20.758 1.00 213.72 ? 53   DA  I P     1 
ATOM   8643  O  OP1   . DA  I 5 126 ? -67.468 -28.079 20.142 1.00 208.28 ? 53   DA  I OP1   1 
ATOM   8644  O  OP2   . DA  I 5 126 ? -65.848 -27.051 21.842 1.00 206.97 ? 53   DA  I OP2   1 
ATOM   8645  O  "O5'" . DA  I 5 126 ? -65.756 -29.493 21.291 1.00 213.80 ? 53   DA  I "O5'" 1 
ATOM   8646  C  "C5'" . DA  I 5 126 ? -65.046 -30.458 20.477 1.00 210.10 ? 53   DA  I "C5'" 1 
ATOM   8647  C  "C4'" . DA  I 5 126 ? -64.390 -31.506 21.347 1.00 199.33 ? 53   DA  I "C4'" 1 
ATOM   8648  O  "O4'" . DA  I 5 126 ? -63.098 -31.043 21.811 1.00 202.66 ? 53   DA  I "O4'" 1 
ATOM   8649  C  "C3'" . DA  I 5 126 ? -65.174 -31.899 22.603 1.00 194.94 ? 53   DA  I "C3'" 1 
ATOM   8650  O  "O3'" . DA  I 5 126 ? -65.739 -33.189 22.386 1.00 194.29 ? 53   DA  I "O3'" 1 
ATOM   8651  C  "C2'" . DA  I 5 126 ? -64.180 -31.705 23.759 1.00 200.49 ? 53   DA  I "C2'" 1 
ATOM   8652  C  "C1'" . DA  I 5 126 ? -62.832 -31.662 23.042 1.00 209.83 ? 53   DA  I "C1'" 1 
ATOM   8653  N  N9    . DA  I 5 126 ? -61.826 -30.889 23.772 1.00 217.27 ? 53   DA  I N9    1 
ATOM   8654  C  C8    . DA  I 5 126 ? -61.918 -29.598 24.232 1.00 221.02 ? 53   DA  I C8    1 
ATOM   8655  N  N7    . DA  I 5 126 ? -60.862 -29.199 24.900 1.00 216.45 ? 53   DA  I N7    1 
ATOM   8656  C  C5    . DA  I 5 126 ? -60.027 -30.308 24.899 1.00 195.01 ? 53   DA  I C5    1 
ATOM   8657  C  C6    . DA  I 5 126 ? -58.746 -30.529 25.436 1.00 176.42 ? 53   DA  I C6    1 
ATOM   8658  N  N6    . DA  I 5 126 ? -58.058 -29.609 26.112 1.00 167.19 ? 53   DA  I N6    1 
ATOM   8659  N  N1    . DA  I 5 126 ? -58.190 -31.746 25.251 1.00 169.52 ? 53   DA  I N1    1 
ATOM   8660  C  C2    . DA  I 5 126 ? -58.879 -32.670 24.570 1.00 174.94 ? 53   DA  I C2    1 
ATOM   8661  N  N3    . DA  I 5 126 ? -60.086 -32.579 24.014 1.00 190.33 ? 53   DA  I N3    1 
ATOM   8662  C  C4    . DA  I 5 126 ? -60.611 -31.357 24.213 1.00 202.26 ? 53   DA  I C4    1 
ATOM   8663  P  P     . DT  I 5 127 ? -65.233 -34.474 23.192 1.00 201.56 ? 54   DT  I P     1 
ATOM   8664  O  OP1   . DT  I 5 127 ? -65.889 -35.661 22.590 1.00 194.92 ? 54   DT  I OP1   1 
ATOM   8665  O  OP2   . DT  I 5 127 ? -65.427 -34.210 24.643 1.00 194.59 ? 54   DT  I OP2   1 
ATOM   8666  O  "O5'" . DT  I 5 127 ? -63.674 -34.536 22.853 1.00 190.11 ? 54   DT  I "O5'" 1 
ATOM   8667  C  "C5'" . DT  I 5 127 ? -62.992 -35.785 22.574 1.00 180.33 ? 54   DT  I "C5'" 1 
ATOM   8668  C  "C4'" . DT  I 5 127 ? -62.295 -36.332 23.802 1.00 170.18 ? 54   DT  I "C4'" 1 
ATOM   8669  O  "O4'" . DT  I 5 127 ? -61.525 -35.293 24.452 1.00 171.78 ? 54   DT  I "O4'" 1 
ATOM   8670  C  "C3'" . DT  I 5 127 ? -63.206 -36.935 24.884 1.00 161.95 ? 54   DT  I "C3'" 1 
ATOM   8671  O  "O3'" . DT  I 5 127 ? -62.911 -38.323 25.106 1.00 150.86 ? 54   DT  I "O3'" 1 
ATOM   8672  C  "C2'" . DT  I 5 127 ? -62.911 -36.111 26.128 1.00 159.81 ? 54   DT  I "C2'" 1 
ATOM   8673  C  "C1'" . DT  I 5 127 ? -61.532 -35.547 25.843 1.00 167.22 ? 54   DT  I "C1'" 1 
ATOM   8674  N  N1    . DT  I 5 127 ? -61.201 -34.286 26.543 1.00 168.12 ? 54   DT  I N1    1 
ATOM   8675  C  C2    . DT  I 5 127 ? -59.965 -34.174 27.142 1.00 159.10 ? 54   DT  I C2    1 
ATOM   8676  O  O2    . DT  I 5 127 ? -59.125 -35.060 27.117 1.00 139.79 ? 54   DT  I O2    1 
ATOM   8677  N  N3    . DT  I 5 127 ? -59.741 -32.971 27.766 1.00 154.03 ? 54   DT  I N3    1 
ATOM   8678  C  C4    . DT  I 5 127 ? -60.612 -31.901 27.855 1.00 148.48 ? 54   DT  I C4    1 
ATOM   8679  O  O4    . DT  I 5 127 ? -60.270 -30.884 28.448 1.00 143.70 ? 54   DT  I O4    1 
ATOM   8680  C  C5    . DT  I 5 127 ? -61.890 -32.090 27.209 1.00 158.88 ? 54   DT  I C5    1 
ATOM   8681  C  C7    . DT  I 5 127 ? -62.899 -30.987 27.259 1.00 159.42 ? 54   DT  I C7    1 
ATOM   8682  C  C6    . DT  I 5 127 ? -62.117 -33.257 26.593 1.00 165.84 ? 54   DT  I C6    1 
ATOM   8683  P  P     . DC  I 5 128 ? -63.661 -39.155 26.276 1.00 141.06 ? 55   DC  I P     1 
ATOM   8684  O  OP1   . DC  I 5 128 ? -63.814 -40.562 25.823 1.00 119.03 ? 55   DC  I OP1   1 
ATOM   8685  O  OP2   . DC  I 5 128 ? -64.835 -38.372 26.750 1.00 134.49 ? 55   DC  I OP2   1 
ATOM   8686  O  "O5'" . DC  I 5 128 ? -62.591 -39.164 27.449 1.00 150.96 ? 55   DC  I "O5'" 1 
ATOM   8687  C  "C5'" . DC  I 5 128 ? -61.209 -39.435 27.158 1.00 154.66 ? 55   DC  I "C5'" 1 
ATOM   8688  C  "C4'" . DC  I 5 128 ? -60.374 -39.275 28.404 1.00 145.19 ? 55   DC  I "C4'" 1 
ATOM   8689  O  "O4'" . DC  I 5 128 ? -60.252 -37.864 28.732 1.00 140.75 ? 55   DC  I "O4'" 1 
ATOM   8690  C  "C3'" . DC  I 5 128 ? -60.915 -39.961 29.660 1.00 138.84 ? 55   DC  I "C3'" 1 
ATOM   8691  O  "O3'" . DC  I 5 128 ? -59.827 -40.618 30.301 1.00 124.16 ? 55   DC  I "O3'" 1 
ATOM   8692  C  "C2'" . DC  I 5 128 ? -61.467 -38.801 30.485 1.00 133.45 ? 55   DC  I "C2'" 1 
ATOM   8693  C  "C1'" . DC  I 5 128 ? -60.487 -37.695 30.112 1.00 142.65 ? 55   DC  I "C1'" 1 
ATOM   8694  N  N1    . DC  I 5 128 ? -60.965 -36.324 30.340 1.00 144.32 ? 55   DC  I N1    1 
ATOM   8695  C  C2    . DC  I 5 128 ? -60.410 -35.590 31.389 1.00 148.07 ? 55   DC  I C2    1 
ATOM   8696  O  O2    . DC  I 5 128 ? -59.554 -36.127 32.108 1.00 146.95 ? 55   DC  I O2    1 
ATOM   8697  N  N3    . DC  I 5 128 ? -60.822 -34.319 31.598 1.00 159.18 ? 55   DC  I N3    1 
ATOM   8698  C  C4    . DC  I 5 128 ? -61.748 -33.779 30.802 1.00 149.71 ? 55   DC  I C4    1 
ATOM   8699  N  N4    . DC  I 5 128 ? -62.127 -32.524 31.046 1.00 142.19 ? 55   DC  I N4    1 
ATOM   8700  C  C5    . DC  I 5 128 ? -62.325 -34.504 29.720 1.00 147.03 ? 55   DC  I C5    1 
ATOM   8701  C  C6    . DC  I 5 128 ? -61.906 -35.760 29.525 1.00 146.80 ? 55   DC  I C6    1 
ATOM   8702  P  P     . DT  I 5 129 ? -60.065 -41.898 31.237 1.00 126.47 ? 56   DT  I P     1 
ATOM   8703  O  OP1   . DT  I 5 129 ? -59.248 -43.030 30.703 1.00 111.36 ? 56   DT  I OP1   1 
ATOM   8704  O  OP2   . DT  I 5 129 ? -61.520 -42.066 31.458 1.00 117.06 ? 56   DT  I OP2   1 
ATOM   8705  O  "O5'" . DT  I 5 129 ? -59.456 -41.426 32.631 1.00 136.45 ? 56   DT  I "O5'" 1 
ATOM   8706  C  "C5'" . DT  I 5 129 ? -58.111 -40.908 32.723 1.00 123.23 ? 56   DT  I "C5'" 1 
ATOM   8707  C  "C4'" . DT  I 5 129 ? -57.913 -40.205 34.045 1.00 112.73 ? 56   DT  I "C4'" 1 
ATOM   8708  O  "O4'" . DT  I 5 129 ? -58.511 -38.883 34.008 1.00 108.46 ? 56   DT  I "O4'" 1 
ATOM   8709  C  "C3'" . DT  I 5 129 ? -58.547 -40.925 35.239 1.00 109.10 ? 56   DT  I "C3'" 1 
ATOM   8710  O  "O3'" . DT  I 5 129 ? -57.637 -40.922 36.336 1.00 108.47 ? 56   DT  I "O3'" 1 
ATOM   8711  C  "C2'" . DT  I 5 129 ? -59.771 -40.083 35.552 1.00 113.84 ? 56   DT  I "C2'" 1 
ATOM   8712  C  "C1'" . DT  I 5 129 ? -59.271 -38.700 35.192 1.00 112.35 ? 56   DT  I "C1'" 1 
ATOM   8713  N  N1    . DT  I 5 129 ? -60.306 -37.681 34.922 1.00 114.30 ? 56   DT  I N1    1 
ATOM   8714  C  C2    . DT  I 5 129 ? -60.141 -36.446 35.507 1.00 120.26 ? 56   DT  I C2    1 
ATOM   8715  O  O2    . DT  I 5 129 ? -59.199 -36.173 36.231 1.00 110.01 ? 56   DT  I O2    1 
ATOM   8716  N  N3    . DT  I 5 129 ? -61.132 -35.541 35.220 1.00 129.22 ? 56   DT  I N3    1 
ATOM   8717  C  C4    . DT  I 5 129 ? -62.241 -35.741 34.421 1.00 124.49 ? 56   DT  I C4    1 
ATOM   8718  O  O4    . DT  I 5 129 ? -63.045 -34.831 34.255 1.00 118.10 ? 56   DT  I O4    1 
ATOM   8719  C  C5    . DT  I 5 129 ? -62.347 -37.056 33.832 1.00 124.86 ? 56   DT  I C5    1 
ATOM   8720  C  C7    . DT  I 5 129 ? -63.517 -37.366 32.953 1.00 129.32 ? 56   DT  I C7    1 
ATOM   8721  C  C6    . DT  I 5 129 ? -61.387 -37.949 34.109 1.00 121.73 ? 56   DT  I C6    1 
ATOM   8722  P  P     . DG  I 5 130 ? -56.570 -42.109 36.519 1.00 110.85 ? 57   DG  I P     1 
ATOM   8723  O  OP1   . DG  I 5 130 ? -55.960 -42.421 35.191 1.00 97.90  ? 57   DG  I OP1   1 
ATOM   8724  O  OP2   . DG  I 5 130 ? -57.218 -43.184 37.314 1.00 100.63 ? 57   DG  I OP2   1 
ATOM   8725  O  "O5'" . DG  I 5 130 ? -55.477 -41.432 37.460 1.00 108.38 ? 57   DG  I "O5'" 1 
ATOM   8726  C  "C5'" . DG  I 5 130 ? -54.721 -40.290 37.013 1.00 103.52 ? 57   DG  I "C5'" 1 
ATOM   8727  C  "C4'" . DG  I 5 130 ? -54.363 -39.367 38.158 1.00 98.96  ? 57   DG  I "C4'" 1 
ATOM   8728  O  "O4'" . DG  I 5 130 ? -55.441 -38.424 38.380 1.00 89.48  ? 57   DG  I "O4'" 1 
ATOM   8729  C  "C3'" . DG  I 5 130 ? -54.076 -39.980 39.526 1.00 100.98 ? 57   DG  I "C3'" 1 
ATOM   8730  O  "O3'" . DG  I 5 130 ? -53.078 -39.129 40.110 1.00 106.32 ? 57   DG  I "O3'" 1 
ATOM   8731  C  "C2'" . DG  I 5 130 ? -55.458 -39.982 40.189 1.00 99.34  ? 57   DG  I "C2'" 1 
ATOM   8732  C  "C1'" . DG  I 5 130 ? -56.108 -38.728 39.594 1.00 94.90  ? 57   DG  I "C1'" 1 
ATOM   8733  N  N9    . DG  I 5 130 ? -57.524 -38.864 39.274 1.00 101.24 ? 57   DG  I N9    1 
ATOM   8734  C  C8    . DG  I 5 130 ? -58.172 -40.000 38.857 1.00 106.35 ? 57   DG  I C8    1 
ATOM   8735  N  N7    . DG  I 5 130 ? -59.429 -39.797 38.572 1.00 112.58 ? 57   DG  I N7    1 
ATOM   8736  C  C5    . DG  I 5 130 ? -59.614 -38.438 38.785 1.00 109.79 ? 57   DG  I C5    1 
ATOM   8737  C  C6    . DG  I 5 130 ? -60.774 -37.637 38.643 1.00 116.55 ? 57   DG  I C6    1 
ATOM   8738  O  O6    . DG  I 5 130 ? -61.906 -37.976 38.277 1.00 122.97 ? 57   DG  I O6    1 
ATOM   8739  N  N1    . DG  I 5 130 ? -60.523 -36.311 38.979 1.00 110.70 ? 57   DG  I N1    1 
ATOM   8740  C  C2    . DG  I 5 130 ? -59.312 -35.820 39.395 1.00 105.96 ? 57   DG  I C2    1 
ATOM   8741  N  N2    . DG  I 5 130 ? -59.266 -34.509 39.664 1.00 118.10 ? 57   DG  I N2    1 
ATOM   8742  N  N3    . DG  I 5 130 ? -58.224 -36.557 39.532 1.00 104.01 ? 57   DG  I N3    1 
ATOM   8743  C  C4    . DG  I 5 130 ? -58.446 -37.847 39.212 1.00 98.75  ? 57   DG  I C4    1 
ATOM   8744  P  P     . DC  I 5 131 ? -52.407 -39.436 41.549 1.00 103.48 ? 58   DC  I P     1 
ATOM   8745  O  OP1   . DC  I 5 131 ? -51.009 -38.945 41.498 1.00 100.52 ? 58   DC  I OP1   1 
ATOM   8746  O  OP2   . DC  I 5 131 ? -52.656 -40.860 41.889 1.00 103.71 ? 58   DC  I OP2   1 
ATOM   8747  O  "O5'" . DC  I 5 131 ? -53.200 -38.455 42.525 1.00 84.90  ? 58   DC  I "O5'" 1 
ATOM   8748  C  "C5'" . DC  I 5 131 ? -53.559 -37.143 42.057 1.00 88.17  ? 58   DC  I "C5'" 1 
ATOM   8749  C  "C4'" . DC  I 5 131 ? -54.491 -36.434 43.012 1.00 98.37  ? 58   DC  I "C4'" 1 
ATOM   8750  O  "O4'" . DC  I 5 131 ? -55.870 -36.571 42.553 1.00 108.10 ? 58   DC  I "O4'" 1 
ATOM   8751  C  "C3'" . DC  I 5 131 ? -54.488 -36.930 44.452 1.00 102.52 ? 58   DC  I "C3'" 1 
ATOM   8752  O  "O3'" . DC  I 5 131 ? -54.730 -35.832 45.324 1.00 109.75 ? 58   DC  I "O3'" 1 
ATOM   8753  C  "C2'" . DC  I 5 131 ? -55.694 -37.859 44.471 1.00 110.15 ? 58   DC  I "C2'" 1 
ATOM   8754  C  "C1'" . DC  I 5 131 ? -56.669 -37.055 43.616 1.00 118.28 ? 58   DC  I "C1'" 1 
ATOM   8755  N  N1    . DC  I 5 131 ? -57.803 -37.814 43.054 1.00 124.33 ? 58   DC  I N1    1 
ATOM   8756  C  C2    . DC  I 5 131 ? -59.011 -37.147 42.816 1.00 119.90 ? 58   DC  I C2    1 
ATOM   8757  O  O2    . DC  I 5 131 ? -59.093 -35.940 43.086 1.00 118.23 ? 58   DC  I O2    1 
ATOM   8758  N  N3    . DC  I 5 131 ? -60.053 -37.833 42.293 1.00 125.13 ? 58   DC  I N3    1 
ATOM   8759  C  C4    . DC  I 5 131 ? -59.924 -39.132 42.013 1.00 115.87 ? 58   DC  I C4    1 
ATOM   8760  N  N4    . DC  I 5 131 ? -60.979 -39.767 41.500 1.00 113.44 ? 58   DC  I N4    1 
ATOM   8761  C  C5    . DC  I 5 131 ? -58.706 -39.836 42.245 1.00 115.03 ? 58   DC  I C5    1 
ATOM   8762  C  C6    . DC  I 5 131 ? -57.682 -39.146 42.764 1.00 118.82 ? 58   DC  I C6    1 
ATOM   8763  P  P     . DA  I 5 132 ? -53.522 -35.093 46.083 1.00 98.29  ? 59   DA  I P     1 
ATOM   8764  O  OP1   . DA  I 5 132 ? -52.546 -34.670 45.057 1.00 87.00  ? 59   DA  I OP1   1 
ATOM   8765  O  OP2   . DA  I 5 132 ? -53.108 -35.922 47.261 1.00 80.57  ? 59   DA  I OP2   1 
ATOM   8766  O  "O5'" . DA  I 5 132 ? -54.222 -33.775 46.634 1.00 96.67  ? 59   DA  I "O5'" 1 
ATOM   8767  C  "C5'" . DA  I 5 132 ? -54.560 -32.731 45.710 1.00 105.86 ? 59   DA  I "C5'" 1 
ATOM   8768  C  "C4'" . DA  I 5 132 ? -55.701 -31.901 46.242 1.00 111.13 ? 59   DA  I "C4'" 1 
ATOM   8769  O  "O4'" . DA  I 5 132 ? -56.952 -32.592 46.024 1.00 111.05 ? 59   DA  I "O4'" 1 
ATOM   8770  C  "C3'" . DA  I 5 132 ? -55.658 -31.545 47.727 1.00 112.83 ? 59   DA  I "C3'" 1 
ATOM   8771  O  "O3'" . DA  I 5 132 ? -55.953 -30.144 47.798 1.00 106.75 ? 59   DA  I "O3'" 1 
ATOM   8772  C  "C2'" . DA  I 5 132 ? -56.543 -32.610 48.384 1.00 110.68 ? 59   DA  I "C2'" 1 
ATOM   8773  C  "C1'" . DA  I 5 132 ? -57.489 -33.031 47.254 1.00 109.29 ? 59   DA  I "C1'" 1 
ATOM   8774  N  N9    . DA  I 5 132 ? -57.670 -34.477 47.148 1.00 114.83 ? 59   DA  I N9    1 
ATOM   8775  C  C8    . DA  I 5 132 ? -56.784 -35.456 47.521 1.00 122.17 ? 59   DA  I C8    1 
ATOM   8776  N  N7    . DA  I 5 132 ? -57.203 -36.672 47.267 1.00 113.81 ? 59   DA  I N7    1 
ATOM   8777  C  C5    . DA  I 5 132 ? -58.436 -36.480 46.661 1.00 118.96 ? 59   DA  I C5    1 
ATOM   8778  C  C6    . DA  I 5 132 ? -59.388 -37.378 46.148 1.00 109.05 ? 59   DA  I C6    1 
ATOM   8779  N  N6    . DA  I 5 132 ? -59.238 -38.702 46.164 1.00 114.85 ? 59   DA  I N6    1 
ATOM   8780  N  N1    . DA  I 5 132 ? -60.517 -36.862 45.618 1.00 103.93 ? 59   DA  I N1    1 
ATOM   8781  C  C2    . DA  I 5 132 ? -60.673 -35.532 45.612 1.00 106.94 ? 59   DA  I C2    1 
ATOM   8782  N  N3    . DA  I 5 132 ? -59.851 -34.586 46.062 1.00 112.78 ? 59   DA  I N3    1 
ATOM   8783  C  C4    . DA  I 5 132 ? -58.734 -35.132 46.575 1.00 121.51 ? 59   DA  I C4    1 
ATOM   8784  P  P     . DG  I 5 133 ? -57.036 -29.539 48.813 1.00 111.93 ? 60   DG  I P     1 
ATOM   8785  O  OP1   . DG  I 5 133 ? -57.143 -28.085 48.538 1.00 105.41 ? 60   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I 5 133 ? -56.715 -30.012 50.190 1.00 100.16 ? 60   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I 5 133 ? -58.410 -30.171 48.321 1.00 114.25 ? 60   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I 5 133 ? -59.642 -29.455 48.518 1.00 113.75 ? 60   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I 5 133 ? -60.648 -30.300 49.266 1.00 116.13 ? 60   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I 5 133 ? -60.443 -31.715 48.994 1.00 114.69 ? 60   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I 5 133 ? -60.665 -30.185 50.794 1.00 115.64 ? 60   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I 5 133 ? -62.046 -30.099 51.130 1.00 121.22 ? 60   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I 5 133 ? -60.101 -31.530 51.246 1.00 106.32 ? 60   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I 5 133 ? -60.707 -32.428 50.178 1.00 113.68 ? 60   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I 5 133 ? -60.177 -33.779 50.045 1.00 115.92 ? 60   DG  I N9    1 
ATOM   8796  C  C8    . DG  I 5 133 ? -58.878 -34.196 50.206 1.00 111.26 ? 60   DG  I C8    1 
ATOM   8797  N  N7    . DG  I 5 133 ? -58.723 -35.475 50.001 1.00 97.57  ? 60   DG  I N7    1 
ATOM   8798  C  C5    . DG  I 5 133 ? -59.994 -35.929 49.681 1.00 106.04 ? 60   DG  I C5    1 
ATOM   8799  C  C6    . DG  I 5 133 ? -60.448 -37.229 49.348 1.00 104.86 ? 60   DG  I C6    1 
ATOM   8800  O  O6    . DG  I 5 133 ? -59.797 -38.277 49.279 1.00 93.47  ? 60   DG  I O6    1 
ATOM   8801  N  N1    . DG  I 5 133 ? -61.815 -37.244 49.091 1.00 118.31 ? 60   DG  I N1    1 
ATOM   8802  C  C2    . DG  I 5 133 ? -62.641 -36.148 49.149 1.00 121.09 ? 60   DG  I C2    1 
ATOM   8803  N  N2    . DG  I 5 133 ? -63.933 -36.366 48.871 1.00 128.45 ? 60   DG  I N2    1 
ATOM   8804  N  N3    . DG  I 5 133 ? -62.230 -34.930 49.456 1.00 115.15 ? 60   DG  I N3    1 
ATOM   8805  C  C4    . DG  I 5 133 ? -60.903 -34.893 49.704 1.00 116.44 ? 60   DG  I C4    1 
ATOM   8806  P  P     . DG  I 5 134 ? -62.525 -29.392 52.474 1.00 130.42 ? 61   DG  I P     1 
ATOM   8807  O  OP1   . DG  I 5 134 ? -63.104 -28.073 52.113 1.00 122.05 ? 61   DG  I OP1   1 
ATOM   8808  O  OP2   . DG  I 5 134 ? -61.410 -29.469 53.458 1.00 123.74 ? 61   DG  I OP2   1 
ATOM   8809  O  "O5'" . DG  I 5 134 ? -63.711 -30.336 52.967 1.00 131.64 ? 61   DG  I "O5'" 1 
ATOM   8810  C  "C5'" . DG  I 5 134 ? -64.831 -30.652 52.116 1.00 127.50 ? 61   DG  I "C5'" 1 
ATOM   8811  C  "C4'" . DG  I 5 134 ? -65.374 -32.023 52.451 1.00 126.40 ? 61   DG  I "C4'" 1 
ATOM   8812  O  "O4'" . DG  I 5 134 ? -64.458 -33.047 51.993 1.00 128.73 ? 61   DG  I "O4'" 1 
ATOM   8813  C  "C3'" . DG  I 5 134 ? -65.605 -32.313 53.935 1.00 125.30 ? 61   DG  I "C3'" 1 
ATOM   8814  O  "O3'" . DG  I 5 134 ? -66.981 -32.517 54.225 1.00 132.94 ? 61   DG  I "O3'" 1 
ATOM   8815  C  "C2'" . DG  I 5 134 ? -64.787 -33.578 54.215 1.00 125.68 ? 61   DG  I "C2'" 1 
ATOM   8816  C  "C1'" . DG  I 5 134 ? -64.606 -34.169 52.821 1.00 127.61 ? 61   DG  I "C1'" 1 
ATOM   8817  N  N9    . DG  I 5 134 ? -63.402 -34.987 52.733 1.00 130.38 ? 61   DG  I N9    1 
ATOM   8818  C  C8    . DG  I 5 134 ? -62.129 -34.598 53.072 1.00 124.94 ? 61   DG  I C8    1 
ATOM   8819  N  N7    . DG  I 5 134 ? -61.249 -35.552 52.939 1.00 121.13 ? 61   DG  I N7    1 
ATOM   8820  C  C5    . DG  I 5 134 ? -61.987 -36.643 52.503 1.00 118.31 ? 61   DG  I C5    1 
ATOM   8821  C  C6    . DG  I 5 134 ? -61.575 -37.963 52.192 1.00 115.40 ? 61   DG  I C6    1 
ATOM   8822  O  O6    . DG  I 5 134 ? -60.438 -38.444 52.236 1.00 101.38 ? 61   DG  I O6    1 
ATOM   8823  N  N1    . DG  I 5 134 ? -62.647 -38.750 51.779 1.00 126.10 ? 61   DG  I N1    1 
ATOM   8824  C  C2    . DG  I 5 134 ? -63.950 -38.327 51.693 1.00 127.50 ? 61   DG  I C2    1 
ATOM   8825  N  N2    . DG  I 5 134 ? -64.842 -39.241 51.283 1.00 121.86 ? 61   DG  I N2    1 
ATOM   8826  N  N3    . DG  I 5 134 ? -64.349 -37.099 51.986 1.00 130.09 ? 61   DG  I N3    1 
ATOM   8827  C  C4    . DG  I 5 134 ? -63.321 -36.315 52.382 1.00 127.03 ? 61   DG  I C4    1 
ATOM   8828  P  P     . DT  I 5 135 ? -67.431 -32.827 55.723 1.00 139.43 ? 62   DT  I P     1 
ATOM   8829  O  OP1   . DT  I 5 135 ? -68.724 -32.135 55.974 1.00 120.62 ? 62   DT  I OP1   1 
ATOM   8830  O  OP2   . DT  I 5 135 ? -66.265 -32.578 56.612 1.00 133.25 ? 62   DT  I OP2   1 
ATOM   8831  O  "O5'" . DT  I 5 135 ? -67.652 -34.402 55.706 1.00 142.01 ? 62   DT  I "O5'" 1 
ATOM   8832  C  "C5'" . DT  I 5 135 ? -68.740 -34.996 54.984 1.00 146.61 ? 62   DT  I "C5'" 1 
ATOM   8833  C  "C4'" . DT  I 5 135 ? -68.805 -36.464 55.327 1.00 151.21 ? 62   DT  I "C4'" 1 
ATOM   8834  O  "O4'" . DT  I 5 135 ? -67.619 -37.103 54.803 1.00 149.61 ? 62   DT  I "O4'" 1 
ATOM   8835  C  "C3'" . DT  I 5 135 ? -68.844 -36.750 56.834 1.00 150.27 ? 62   DT  I "C3'" 1 
ATOM   8836  O  "O3'" . DT  I 5 135 ? -70.076 -37.391 57.191 1.00 147.21 ? 62   DT  I "O3'" 1 
ATOM   8837  C  "C2'" . DT  I 5 135 ? -67.581 -37.550 57.110 1.00 156.21 ? 62   DT  I "C2'" 1 
ATOM   8838  C  "C1'" . DT  I 5 135 ? -67.082 -38.003 55.748 1.00 149.45 ? 62   DT  I "C1'" 1 
ATOM   8839  N  N1    . DT  I 5 135 ? -65.613 -37.965 55.620 1.00 142.45 ? 62   DT  I N1    1 
ATOM   8840  C  C2    . DT  I 5 135 ? -64.971 -39.033 55.033 1.00 138.63 ? 62   DT  I C2    1 
ATOM   8841  O  O2    . DT  I 5 135 ? -65.560 -40.004 54.589 1.00 143.83 ? 62   DT  I O2    1 
ATOM   8842  N  N3    . DT  I 5 135 ? -63.606 -38.917 54.974 1.00 139.51 ? 62   DT  I N3    1 
ATOM   8843  C  C4    . DT  I 5 135 ? -62.837 -37.865 55.435 1.00 145.40 ? 62   DT  I C4    1 
ATOM   8844  O  O4    . DT  I 5 135 ? -61.617 -37.896 55.301 1.00 139.72 ? 62   DT  I O4    1 
ATOM   8845  C  C5    . DT  I 5 135 ? -63.575 -36.783 56.048 1.00 145.44 ? 62   DT  I C5    1 
ATOM   8846  C  C7    . DT  I 5 135 ? -62.828 -35.602 56.582 1.00 145.31 ? 62   DT  I C7    1 
ATOM   8847  C  C6    . DT  I 5 135 ? -64.908 -36.885 56.106 1.00 140.61 ? 62   DT  I C6    1 
ATOM   8848  P  P     . DG  I 5 136 ? -70.149 -38.417 58.412 1.00 149.16 ? 63   DG  I P     1 
ATOM   8849  O  OP1   . DG  I 5 136 ? -71.580 -38.601 58.752 1.00 145.27 ? 63   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I 5 136 ? -69.222 -37.934 59.475 1.00 141.44 ? 63   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I 5 136 ? -69.607 -39.767 57.752 1.00 155.42 ? 63   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I 5 136 ? -70.243 -41.052 57.949 1.00 159.83 ? 63   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I 5 136 ? -69.465 -41.862 58.958 1.00 165.59 ? 63   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I 5 136 ? -68.062 -41.826 58.604 1.00 169.53 ? 63   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I 5 136 ? -69.582 -41.370 60.402 1.00 170.89 ? 63   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I 5 136 ? -70.359 -42.300 61.172 1.00 167.47 ? 63   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I 5 136 ? -68.152 -40.972 60.804 1.00 170.93 ? 63   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I 5 136 ? -67.284 -41.698 59.773 1.00 172.56 ? 63   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I 5 136 ? -66.052 -40.988 59.425 1.00 161.73 ? 63   DG  I N9    1 
ATOM   8860  C  C8    . DG  I 5 136 ? -65.837 -39.629 59.463 1.00 145.99 ? 63   DG  I C8    1 
ATOM   8861  N  N7    . DG  I 5 136 ? -64.634 -39.290 59.087 1.00 125.27 ? 63   DG  I N7    1 
ATOM   8862  C  C5    . DG  I 5 136 ? -64.017 -40.496 58.776 1.00 130.38 ? 63   DG  I C5    1 
ATOM   8863  C  C6    . DG  I 5 136 ? -62.701 -40.765 58.314 1.00 126.97 ? 63   DG  I C6    1 
ATOM   8864  O  O6    . DG  I 5 136 ? -61.791 -39.965 58.073 1.00 131.04 ? 63   DG  I O6    1 
ATOM   8865  N  N1    . DG  I 5 136 ? -62.489 -42.128 58.138 1.00 118.43 ? 63   DG  I N1    1 
ATOM   8866  C  C2    . DG  I 5 136 ? -63.420 -43.109 58.372 1.00 115.81 ? 63   DG  I C2    1 
ATOM   8867  N  N2    . DG  I 5 136 ? -63.024 -44.368 58.137 1.00 114.46 ? 63   DG  I N2    1 
ATOM   8868  N  N3    . DG  I 5 136 ? -64.650 -42.873 58.803 1.00 126.74 ? 63   DG  I N3    1 
ATOM   8869  C  C4    . DG  I 5 136 ? -64.878 -41.554 58.982 1.00 141.04 ? 63   DG  I C4    1 
ATOM   8870  P  P     . DG  I 5 137 ? -69.692 -43.470 62.055 1.00 167.27 ? 64   DG  I P     1 
ATOM   8871  O  OP1   . DG  I 5 137 ? -70.777 -44.390 62.477 1.00 180.59 ? 64   DG  I OP1   1 
ATOM   8872  O  OP2   . DG  I 5 137 ? -68.830 -42.835 63.094 1.00 148.62 ? 64   DG  I OP2   1 
ATOM   8873  O  "O5'" . DG  I 5 137 ? -68.857 -44.330 61.004 1.00 154.19 ? 64   DG  I "O5'" 1 
ATOM   8874  C  "C5'" . DG  I 5 137 ? -68.515 -45.709 61.282 1.00 147.53 ? 64   DG  I "C5'" 1 
ATOM   8875  C  "C4'" . DG  I 5 137 ? -67.288 -45.802 62.171 1.00 150.60 ? 64   DG  I "C4'" 1 
ATOM   8876  O  "O4'" . DG  I 5 137 ? -66.312 -44.806 61.775 1.00 153.88 ? 64   DG  I "O4'" 1 
ATOM   8877  C  "C3'" . DG  I 5 137 ? -67.513 -45.596 63.678 1.00 148.80 ? 64   DG  I "C3'" 1 
ATOM   8878  O  "O3'" . DG  I 5 137 ? -67.511 -46.833 64.413 1.00 150.88 ? 64   DG  I "O3'" 1 
ATOM   8879  C  "C2'" . DG  I 5 137 ? -66.523 -44.491 64.080 1.00 146.64 ? 64   DG  I "C2'" 1 
ATOM   8880  C  "C1'" . DG  I 5 137 ? -65.545 -44.469 62.904 1.00 144.35 ? 64   DG  I "C1'" 1 
ATOM   8881  N  N9    . DG  I 5 137 ? -64.896 -43.177 62.682 1.00 129.12 ? 64   DG  I N9    1 
ATOM   8882  C  C8    . DG  I 5 137 ? -65.407 -41.925 62.930 1.00 125.62 ? 64   DG  I C8    1 
ATOM   8883  N  N7    . DG  I 5 137 ? -64.564 -40.965 62.657 1.00 116.69 ? 64   DG  I N7    1 
ATOM   8884  C  C5    . DG  I 5 137 ? -63.424 -41.623 62.219 1.00 117.07 ? 64   DG  I C5    1 
ATOM   8885  C  C6    . DG  I 5 137 ? -62.178 -41.108 61.779 1.00 114.08 ? 64   DG  I C6    1 
ATOM   8886  O  O6    . DG  I 5 137 ? -61.821 -39.927 61.689 1.00 120.83 ? 64   DG  I O6    1 
ATOM   8887  N  N1    . DG  I 5 137 ? -61.302 -42.127 61.413 1.00 107.12 ? 64   DG  I N1    1 
ATOM   8888  C  C2    . DG  I 5 137 ? -61.586 -43.469 61.470 1.00 106.17 ? 64   DG  I C2    1 
ATOM   8889  N  N2    . DG  I 5 137 ? -60.609 -44.300 61.082 1.00 100.65 ? 64   DG  I N2    1 
ATOM   8890  N  N3    . DG  I 5 137 ? -62.742 -43.962 61.881 1.00 121.68 ? 64   DG  I N3    1 
ATOM   8891  C  C4    . DG  I 5 137 ? -63.610 -42.989 62.232 1.00 126.24 ? 64   DG  I C4    1 
ATOM   8892  P  P     . DA  I 5 138 ? -66.165 -47.522 65.039 1.00 147.43 ? 65   DA  I P     1 
ATOM   8893  O  OP1   . DA  I 5 138 ? -66.516 -48.908 65.441 1.00 146.30 ? 65   DA  I OP1   1 
ATOM   8894  O  OP2   . DA  I 5 138 ? -65.590 -46.614 66.066 1.00 125.17 ? 65   DA  I OP2   1 
ATOM   8895  O  "O5'" . DA  I 5 138 ? -65.198 -47.714 63.785 1.00 148.97 ? 65   DA  I "O5'" 1 
ATOM   8896  C  "C5'" . DA  I 5 138 ? -64.592 -49.001 63.504 1.00 135.32 ? 65   DA  I "C5'" 1 
ATOM   8897  C  "C4'" . DA  I 5 138 ? -63.119 -49.006 63.861 1.00 131.93 ? 65   DA  I "C4'" 1 
ATOM   8898  O  "O4'" . DA  I 5 138 ? -62.547 -47.687 63.624 1.00 138.38 ? 65   DA  I "O4'" 1 
ATOM   8899  C  "C3'" . DA  I 5 138 ? -62.758 -49.356 65.311 1.00 130.73 ? 65   DA  I "C3'" 1 
ATOM   8900  O  "O3'" . DA  I 5 138 ? -61.577 -50.168 65.327 1.00 128.67 ? 65   DA  I "O3'" 1 
ATOM   8901  C  "C2'" . DA  I 5 138 ? -62.535 -47.981 65.926 1.00 127.90 ? 65   DA  I "C2'" 1 
ATOM   8902  C  "C1'" . DA  I 5 138 ? -61.828 -47.283 64.771 1.00 132.26 ? 65   DA  I "C1'" 1 
ATOM   8903  N  N9    . DA  I 5 138 ? -61.860 -45.829 64.864 1.00 129.63 ? 65   DA  I N9    1 
ATOM   8904  C  C8    . DA  I 5 138 ? -62.910 -45.022 65.226 1.00 131.31 ? 65   DA  I C8    1 
ATOM   8905  N  N7    . DA  I 5 138 ? -62.617 -43.746 65.239 1.00 119.54 ? 65   DA  I N7    1 
ATOM   8906  C  C5    . DA  I 5 138 ? -61.281 -43.710 64.870 1.00 117.56 ? 65   DA  I C5    1 
ATOM   8907  C  C6    . DA  I 5 138 ? -60.384 -42.651 64.699 1.00 113.72 ? 65   DA  I C6    1 
ATOM   8908  N  N6    . DA  I 5 138 ? -60.720 -41.373 64.882 1.00 114.94 ? 65   DA  I N6    1 
ATOM   8909  N  N1    . DA  I 5 138 ? -59.120 -42.950 64.324 1.00 115.54 ? 65   DA  I N1    1 
ATOM   8910  C  C2    . DA  I 5 138 ? -58.793 -44.237 64.140 1.00 116.70 ? 65   DA  I C2    1 
ATOM   8911  N  N3    . DA  I 5 138 ? -59.551 -45.324 64.274 1.00 118.21 ? 65   DA  I N3    1 
ATOM   8912  C  C4    . DA  I 5 138 ? -60.799 -44.986 64.644 1.00 122.42 ? 65   DA  I C4    1 
ATOM   8913  P  P     . DT  I 5 139 ? -60.622 -50.231 66.632 1.00 137.15 ? 66   DT  I P     1 
ATOM   8914  O  OP1   . DT  I 5 139 ? -59.855 -51.515 66.630 1.00 112.75 ? 66   DT  I OP1   1 
ATOM   8915  O  OP2   . DT  I 5 139 ? -61.426 -49.828 67.819 1.00 115.74 ? 66   DT  I OP2   1 
ATOM   8916  O  "O5'" . DT  I 5 139 ? -59.546 -49.102 66.330 1.00 143.33 ? 66   DT  I "O5'" 1 
ATOM   8917  C  "C5'" . DT  I 5 139 ? -58.370 -49.403 65.566 1.00 130.80 ? 66   DT  I "C5'" 1 
ATOM   8918  C  "C4'" . DT  I 5 139 ? -57.211 -48.585 66.083 1.00 121.59 ? 66   DT  I "C4'" 1 
ATOM   8919  O  "O4'" . DT  I 5 139 ? -57.594 -47.193 66.164 1.00 123.05 ? 66   DT  I "O4'" 1 
ATOM   8920  C  "C3'" . DT  I 5 139 ? -56.692 -48.965 67.473 1.00 113.28 ? 66   DT  I "C3'" 1 
ATOM   8921  O  "O3'" . DT  I 5 139 ? -55.269 -49.024 67.272 1.00 109.62 ? 66   DT  I "O3'" 1 
ATOM   8922  C  "C2'" . DT  I 5 139 ? -57.293 -47.896 68.380 1.00 106.58 ? 66   DT  I "C2'" 1 
ATOM   8923  C  "C1'" . DT  I 5 139 ? -57.326 -46.685 67.464 1.00 110.20 ? 66   DT  I "C1'" 1 
ATOM   8924  N  N1    . DT  I 5 139 ? -58.308 -45.602 67.733 1.00 102.97 ? 66   DT  I N1    1 
ATOM   8925  C  C2    . DT  I 5 139 ? -57.897 -44.314 67.463 1.00 110.04 ? 66   DT  I C2    1 
ATOM   8926  O  O2    . DT  I 5 139 ? -56.768 -44.038 67.087 1.00 116.59 ? 66   DT  I O2    1 
ATOM   8927  N  N3    . DT  I 5 139 ? -58.853 -43.352 67.671 1.00 100.42 ? 66   DT  I N3    1 
ATOM   8928  C  C4    . DT  I 5 139 ? -60.155 -43.546 68.083 1.00 100.15 ? 66   DT  I C4    1 
ATOM   8929  O  O4    . DT  I 5 139 ? -60.897 -42.581 68.224 1.00 95.94  ? 66   DT  I O4    1 
ATOM   8930  C  C5    . DT  I 5 139 ? -60.528 -44.922 68.321 1.00 104.32 ? 66   DT  I C5    1 
ATOM   8931  C  C7    . DT  I 5 139 ? -61.920 -45.227 68.779 1.00 109.48 ? 66   DT  I C7    1 
ATOM   8932  C  C6    . DT  I 5 139 ? -59.602 -45.870 68.124 1.00 97.68  ? 66   DT  I C6    1 
ATOM   8933  P  P     . DA  I 5 140 ? -54.216 -49.217 68.474 1.00 108.57 ? 67   DA  I P     1 
ATOM   8934  O  OP1   . DA  I 5 140 ? -53.622 -50.563 68.362 1.00 104.16 ? 67   DA  I OP1   1 
ATOM   8935  O  OP2   . DA  I 5 140 ? -54.850 -48.787 69.746 1.00 108.86 ? 67   DA  I OP2   1 
ATOM   8936  O  "O5'" . DA  I 5 140 ? -53.080 -48.171 68.084 1.00 111.59 ? 67   DA  I "O5'" 1 
ATOM   8937  C  "C5'" . DA  I 5 140 ? -53.413 -47.077 67.200 1.00 112.59 ? 67   DA  I "C5'" 1 
ATOM   8938  C  "C4'" . DA  I 5 140 ? -52.565 -45.845 67.446 1.00 109.12 ? 67   DA  I "C4'" 1 
ATOM   8939  O  "O4'" . DA  I 5 140 ? -53.429 -44.701 67.703 1.00 108.76 ? 67   DA  I "O4'" 1 
ATOM   8940  C  "C3'" . DA  I 5 140 ? -51.575 -45.868 68.609 1.00 100.08 ? 67   DA  I "C3'" 1 
ATOM   8941  O  "O3'" . DA  I 5 140 ? -50.489 -45.055 68.182 1.00 96.67  ? 67   DA  I "O3'" 1 
ATOM   8942  C  "C2'" . DA  I 5 140 ? -52.397 -45.283 69.754 1.00 95.90  ? 67   DA  I "C2'" 1 
ATOM   8943  C  "C1'" . DA  I 5 140 ? -53.237 -44.233 69.026 1.00 95.39  ? 67   DA  I "C1'" 1 
ATOM   8944  N  N9    . DA  I 5 140 ? -54.556 -44.013 69.612 1.00 94.73  ? 67   DA  I N9    1 
ATOM   8945  C  C8    . DA  I 5 140 ? -55.479 -44.978 69.927 1.00 94.76  ? 67   DA  I C8    1 
ATOM   8946  N  N7    . DA  I 5 140 ? -56.602 -44.500 70.404 1.00 94.27  ? 67   DA  I N7    1 
ATOM   8947  C  C5    . DA  I 5 140 ? -56.406 -43.127 70.406 1.00 88.04  ? 67   DA  I C5    1 
ATOM   8948  C  C6    . DA  I 5 140 ? -57.228 -42.057 70.794 1.00 91.81  ? 67   DA  I C6    1 
ATOM   8949  N  N6    . DA  I 5 140 ? -58.459 -42.211 71.281 1.00 97.91  ? 67   DA  I N6    1 
ATOM   8950  N  N1    . DA  I 5 140 ? -56.738 -40.805 70.658 1.00 95.16  ? 67   DA  I N1    1 
ATOM   8951  C  C2    . DA  I 5 140 ? -55.504 -40.651 70.161 1.00 93.33  ? 67   DA  I C2    1 
ATOM   8952  N  N3    . DA  I 5 140 ? -54.637 -41.579 69.757 1.00 91.13  ? 67   DA  I N3    1 
ATOM   8953  C  C4    . DA  I 5 140 ? -55.155 -42.811 69.909 1.00 94.51  ? 67   DA  I C4    1 
ATOM   8954  P  P     . DT  I 5 141 ? -49.192 -44.869 69.084 1.00 104.56 ? 68   DT  I P     1 
ATOM   8955  O  OP1   . DT  I 5 141 ? -48.046 -44.618 68.174 1.00 107.08 ? 68   DT  I OP1   1 
ATOM   8956  O  OP2   . DT  I 5 141 ? -49.132 -45.999 70.038 1.00 90.93  ? 68   DT  I OP2   1 
ATOM   8957  O  "O5'" . DT  I 5 141 ? -49.472 -43.486 69.831 1.00 91.05  ? 68   DT  I "O5'" 1 
ATOM   8958  C  "C5'" . DT  I 5 141 ? -49.880 -42.332 69.064 1.00 90.61  ? 68   DT  I "C5'" 1 
ATOM   8959  C  "C4'" . DT  I 5 141 ? -49.914 -41.070 69.899 1.00 92.05  ? 68   DT  I "C4'" 1 
ATOM   8960  O  "O4'" . DT  I 5 141 ? -51.229 -40.835 70.460 1.00 104.10 ? 68   DT  I "O4'" 1 
ATOM   8961  C  "C3'" . DT  I 5 141 ? -48.939 -40.992 71.073 1.00 94.53  ? 68   DT  I "C3'" 1 
ATOM   8962  O  "O3'" . DT  I 5 141 ? -48.416 -39.656 71.043 1.00 98.24  ? 68   DT  I "O3'" 1 
ATOM   8963  C  "C2'" . DT  I 5 141 ? -49.816 -41.292 72.279 1.00 93.29  ? 68   DT  I "C2'" 1 
ATOM   8964  C  "C1'" . DT  I 5 141 ? -51.150 -40.679 71.873 1.00 95.90  ? 68   DT  I "C1'" 1 
ATOM   8965  N  N1    . DT  I 5 141 ? -52.379 -41.274 72.462 1.00 97.28  ? 68   DT  I N1    1 
ATOM   8966  C  C2    . DT  I 5 141 ? -53.438 -40.436 72.746 1.00 104.35 ? 68   DT  I C2    1 
ATOM   8967  O  O2    . DT  I 5 141 ? -53.399 -39.229 72.574 1.00 94.71  ? 68   DT  I O2    1 
ATOM   8968  N  N3    . DT  I 5 141 ? -54.548 -41.066 73.254 1.00 108.70 ? 68   DT  I N3    1 
ATOM   8969  C  C4    . DT  I 5 141 ? -54.708 -42.419 73.482 1.00 101.46 ? 68   DT  I C4    1 
ATOM   8970  O  O4    . DT  I 5 141 ? -55.769 -42.838 73.935 1.00 99.57  ? 68   DT  I O4    1 
ATOM   8971  C  C5    . DT  I 5 141 ? -53.564 -43.241 73.150 1.00 89.08  ? 68   DT  I C5    1 
ATOM   8972  C  C7    . DT  I 5 141 ? -53.644 -44.720 73.358 1.00 88.10  ? 68   DT  I C7    1 
ATOM   8973  C  C6    . DT  I 5 141 ? -52.476 -42.636 72.655 1.00 93.52  ? 68   DT  I C6    1 
ATOM   8974  P  P     . DT  I 5 142 ? -47.144 -39.230 71.926 1.00 92.42  ? 69   DT  I P     1 
ATOM   8975  O  OP1   . DT  I 5 142 ? -46.274 -38.383 71.099 1.00 91.28  ? 69   DT  I OP1   1 
ATOM   8976  O  OP2   . DT  I 5 142 ? -46.593 -40.451 72.571 1.00 90.92  ? 69   DT  I OP2   1 
ATOM   8977  O  "O5'" . DT  I 5 142 ? -47.778 -38.199 72.960 1.00 84.92  ? 69   DT  I "O5'" 1 
ATOM   8978  C  "C5'" . DT  I 5 142 ? -48.686 -37.183 72.475 1.00 91.67  ? 69   DT  I "C5'" 1 
ATOM   8979  C  "C4'" . DT  I 5 142 ? -49.576 -36.697 73.596 1.00 95.11  ? 69   DT  I "C4'" 1 
ATOM   8980  O  "O4'" . DT  I 5 142 ? -50.555 -37.712 73.920 1.00 96.67  ? 69   DT  I "O4'" 1 
ATOM   8981  C  "C3'" . DT  I 5 142 ? -48.834 -36.393 74.901 1.00 95.75  ? 69   DT  I "C3'" 1 
ATOM   8982  O  "O3'" . DT  I 5 142 ? -49.086 -35.050 75.316 1.00 92.47  ? 69   DT  I "O3'" 1 
ATOM   8983  C  "C2'" . DT  I 5 142 ? -49.372 -37.418 75.887 1.00 100.00 ? 69   DT  I "C2'" 1 
ATOM   8984  C  "C1'" . DT  I 5 142 ? -50.743 -37.704 75.318 1.00 96.39  ? 69   DT  I "C1'" 1 
ATOM   8985  N  N1    . DT  I 5 142 ? -51.362 -38.984 75.694 1.00 91.57  ? 69   DT  I N1    1 
ATOM   8986  C  C2    . DT  I 5 142 ? -52.672 -38.955 76.110 1.00 88.74  ? 69   DT  I C2    1 
ATOM   8987  O  O2    . DT  I 5 142 ? -53.311 -37.920 76.221 1.00 72.75  ? 69   DT  I O2    1 
ATOM   8988  N  N3    . DT  I 5 142 ? -53.207 -40.186 76.404 1.00 90.22  ? 69   DT  I N3    1 
ATOM   8989  C  C4    . DT  I 5 142 ? -52.571 -41.413 76.326 1.00 99.57  ? 69   DT  I C4    1 
ATOM   8990  O  O4    . DT  I 5 142 ? -53.176 -42.438 76.630 1.00 115.84 ? 69   DT  I O4    1 
ATOM   8991  C  C5    . DT  I 5 142 ? -51.199 -41.368 75.878 1.00 96.77  ? 69   DT  I C5    1 
ATOM   8992  C  C7    . DT  I 5 142 ? -50.432 -42.647 75.762 1.00 88.26  ? 69   DT  I C7    1 
ATOM   8993  C  C6    . DT  I 5 142 ? -50.673 -40.172 75.577 1.00 95.57  ? 69   DT  I C6    1 
ATOM   8994  P  P     . DG  I 5 143 ? -48.207 -34.413 76.489 1.00 92.05  ? 70   DG  I P     1 
ATOM   8995  O  OP1   . DG  I 5 143 ? -47.910 -32.998 76.147 1.00 84.78  ? 70   DG  I OP1   1 
ATOM   8996  O  OP2   . DG  I 5 143 ? -47.146 -35.376 76.856 1.00 71.63  ? 70   DG  I OP2   1 
ATOM   8997  O  "O5'" . DG  I 5 143 ? -49.245 -34.304 77.678 1.00 105.60 ? 70   DG  I "O5'" 1 
ATOM   8998  C  "C5'" . DG  I 5 143 ? -50.467 -33.586 77.464 1.00 115.76 ? 70   DG  I "C5'" 1 
ATOM   8999  C  "C4'" . DG  I 5 143 ? -51.394 -33.878 78.605 1.00 113.50 ? 70   DG  I "C4'" 1 
ATOM   9000  O  "O4'" . DG  I 5 143 ? -51.841 -35.263 78.520 1.00 110.35 ? 70   DG  I "O4'" 1 
ATOM   9001  C  "C3'" . DG  I 5 143 ? -50.723 -33.751 79.969 1.00 107.08 ? 70   DG  I "C3'" 1 
ATOM   9002  O  "O3'" . DG  I 5 143 ? -51.648 -33.158 80.864 1.00 107.09 ? 70   DG  I "O3'" 1 
ATOM   9003  C  "C2'" . DG  I 5 143 ? -50.383 -35.199 80.302 1.00 95.75  ? 70   DG  I "C2'" 1 
ATOM   9004  C  "C1'" . DG  I 5 143 ? -51.645 -35.863 79.776 1.00 110.34 ? 70   DG  I "C1'" 1 
ATOM   9005  N  N9    . DG  I 5 143 ? -51.657 -37.313 79.640 1.00 113.34 ? 70   DG  I N9    1 
ATOM   9006  C  C8    . DG  I 5 143 ? -50.617 -38.163 79.349 1.00 109.12 ? 70   DG  I C8    1 
ATOM   9007  N  N7    . DG  I 5 143 ? -50.971 -39.420 79.347 1.00 106.08 ? 70   DG  I N7    1 
ATOM   9008  C  C5    . DG  I 5 143 ? -52.318 -39.398 79.683 1.00 103.27 ? 70   DG  I C5    1 
ATOM   9009  C  C6    . DG  I 5 143 ? -53.241 -40.459 79.844 1.00 96.89  ? 70   DG  I C6    1 
ATOM   9010  O  O6    . DG  I 5 143 ? -53.046 -41.671 79.717 1.00 93.26  ? 70   DG  I O6    1 
ATOM   9011  N  N1    . DG  I 5 143 ? -54.506 -39.991 80.190 1.00 101.05 ? 70   DG  I N1    1 
ATOM   9012  C  C2    . DG  I 5 143 ? -54.840 -38.669 80.361 1.00 108.11 ? 70   DG  I C2    1 
ATOM   9013  N  N2    . DG  I 5 143 ? -56.115 -38.416 80.688 1.00 115.68 ? 70   DG  I N2    1 
ATOM   9014  N  N3    . DG  I 5 143 ? -53.986 -37.670 80.219 1.00 100.63 ? 70   DG  I N3    1 
ATOM   9015  C  C4    . DG  I 5 143 ? -52.754 -38.105 79.875 1.00 108.28 ? 70   DG  I C4    1 
ATOM   9016  P  P     . DA  I 5 144 ? -51.096 -32.523 82.199 1.00 126.06 ? 71   DA  I P     1 
ATOM   9017  O  OP1   . DA  I 5 144 ? -50.499 -31.212 81.841 1.00 124.36 ? 71   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I 5 144 ? -50.265 -33.558 82.893 1.00 102.82 ? 71   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I 5 144 ? -52.403 -32.218 83.060 1.00 122.51 ? 71   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I 5 144 ? -53.743 -32.384 82.557 1.00 124.06 ? 71   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I 5 144 ? -54.494 -33.392 83.400 1.00 121.47 ? 71   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I 5 144 ? -54.205 -34.730 82.925 1.00 108.82 ? 71   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I 5 144 ? -54.186 -33.402 84.904 1.00 126.43 ? 71   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I 5 144 ? -55.396 -33.225 85.630 1.00 143.71 ? 71   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I 5 144 ? -53.573 -34.781 85.154 1.00 106.08 ? 71   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I 5 144 ? -54.176 -35.601 84.020 1.00 95.69  ? 71   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I 5 144 ? -53.318 -36.716 83.671 1.00 94.17  ? 71   DA  I N9    1 
ATOM   9028  C  C8    . DA  I 5 144 ? -51.971 -36.643 83.425 1.00 98.49  ? 71   DA  I C8    1 
ATOM   9029  N  N7    . DA  I 5 144 ? -51.419 -37.803 83.164 1.00 100.34 ? 71   DA  I N7    1 
ATOM   9030  C  C5    . DA  I 5 144 ? -52.473 -38.701 83.254 1.00 90.40  ? 71   DA  I C5    1 
ATOM   9031  C  C6    . DA  I 5 144 ? -52.542 -40.093 83.091 1.00 86.33  ? 71   DA  I C6    1 
ATOM   9032  N  N6    . DA  I 5 144 ? -51.490 -40.851 82.782 1.00 88.17  ? 71   DA  I N6    1 
ATOM   9033  N  N1    . DA  I 5 144 ? -53.743 -40.687 83.258 1.00 84.39  ? 71   DA  I N1    1 
ATOM   9034  C  C2    . DA  I 5 144 ? -54.796 -39.922 83.571 1.00 90.68  ? 71   DA  I C2    1 
ATOM   9035  N  N3    . DA  I 5 144 ? -54.855 -38.604 83.758 1.00 88.58  ? 71   DA  I N3    1 
ATOM   9036  C  C4    . DA  I 5 144 ? -53.646 -38.047 83.577 1.00 89.60  ? 71   DA  I C4    1 
ATOM   9037  P  P     . DT  I 5 145 ? -55.386 -32.866 87.200 1.00 135.38 ? 72   DT  I P     1 
ATOM   9038  O  OP1   . DT  I 5 145 ? -56.667 -32.169 87.490 1.00 118.67 ? 72   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I 5 145 ? -54.080 -32.243 87.562 1.00 111.71 ? 72   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I 5 145 ? -55.369 -34.296 87.894 1.00 125.24 ? 72   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I 5 145 ? -56.483 -35.186 87.737 1.00 121.29 ? 72   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I 5 145 ? -56.176 -36.509 88.397 1.00 118.70 ? 72   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I 5 145 ? -55.479 -37.370 87.480 1.00 116.08 ? 72   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I 5 145 ? -55.263 -36.427 89.615 1.00 116.55 ? 72   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I 5 145 ? -56.062 -36.215 90.783 1.00 116.29 ? 72   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I 5 145 ? -54.546 -37.769 89.612 1.00 115.39 ? 72   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I 5 145 ? -54.861 -38.384 88.246 1.00 115.86 ? 72   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I 5 145 ? -53.679 -38.862 87.503 1.00 114.54 ? 72   DT  I N1    1 
ATOM   9049  C  C2    . DT  I 5 145 ? -53.660 -40.172 87.084 1.00 106.41 ? 72   DT  I C2    1 
ATOM   9050  O  O2    . DT  I 5 145 ? -54.584 -40.944 87.274 1.00 121.79 ? 72   DT  I O2    1 
ATOM   9051  N  N3    . DT  I 5 145 ? -52.518 -40.546 86.422 1.00 103.45 ? 72   DT  I N3    1 
ATOM   9052  C  C4    . DT  I 5 145 ? -51.417 -39.758 86.149 1.00 111.21 ? 72   DT  I C4    1 
ATOM   9053  O  O4    . DT  I 5 145 ? -50.460 -40.236 85.545 1.00 107.56 ? 72   DT  I O4    1 
ATOM   9054  C  C5    . DT  I 5 145 ? -51.505 -38.391 86.616 1.00 112.61 ? 72   DT  I C5    1 
ATOM   9055  C  C7    . DT  I 5 145 ? -50.357 -37.463 86.372 1.00 110.72 ? 72   DT  I C7    1 
ATOM   9056  C  C6    . DT  I 5 145 ? -52.615 -38.019 87.267 1.00 118.31 ? 72   DT  I C6    1 
ATOM   9057  O  "O5'" . DA  J 6 1   ? -49.625 -50.286 85.072 1.00 145.35 ? -72  DA  J "O5'" 1 
ATOM   9058  C  "C5'" . DA  J 6 1   ? -50.950 -50.663 84.649 1.00 139.88 ? -72  DA  J "C5'" 1 
ATOM   9059  C  "C4'" . DA  J 6 1   ? -52.007 -50.090 85.579 1.00 133.27 ? -72  DA  J "C4'" 1 
ATOM   9060  O  "O4'" . DA  J 6 1   ? -51.548 -49.383 86.753 1.00 131.31 ? -72  DA  J "O4'" 1 
ATOM   9061  C  "C3'" . DA  J 6 1   ? -53.240 -49.381 85.020 1.00 132.22 ? -72  DA  J "C3'" 1 
ATOM   9062  O  "O3'" . DA  J 6 1   ? -54.224 -50.363 84.705 1.00 126.67 ? -72  DA  J "O3'" 1 
ATOM   9063  C  "C2'" . DA  J 6 1   ? -53.634 -48.408 86.141 1.00 124.48 ? -72  DA  J "C2'" 1 
ATOM   9064  C  "C1'" . DA  J 6 1   ? -52.319 -48.209 86.905 1.00 127.26 ? -72  DA  J "C1'" 1 
ATOM   9065  N  N9    . DA  J 6 1   ? -51.523 -47.068 86.454 1.00 128.73 ? -72  DA  J N9    1 
ATOM   9066  C  C8    . DA  J 6 1   ? -50.268 -47.070 85.894 1.00 126.60 ? -72  DA  J C8    1 
ATOM   9067  N  N7    . DA  J 6 1   ? -49.814 -45.874 85.609 1.00 122.41 ? -72  DA  J N7    1 
ATOM   9068  C  C5    . DA  J 6 1   ? -50.834 -45.025 86.016 1.00 118.37 ? -72  DA  J C5    1 
ATOM   9069  C  C6    . DA  J 6 1   ? -50.972 -43.624 85.982 1.00 105.40 ? -72  DA  J C6    1 
ATOM   9070  N  N6    . DA  J 6 1   ? -50.039 -42.798 85.502 1.00 101.26 ? -72  DA  J N6    1 
ATOM   9071  N  N1    . DA  J 6 1   ? -52.119 -43.093 86.461 1.00 98.57  ? -72  DA  J N1    1 
ATOM   9072  C  C2    . DA  J 6 1   ? -53.056 -43.921 86.943 1.00 105.24 ? -72  DA  J C2    1 
ATOM   9073  N  N3    . DA  J 6 1   ? -53.045 -45.252 87.023 1.00 119.42 ? -72  DA  J N3    1 
ATOM   9074  C  C4    . DA  J 6 1   ? -51.891 -45.747 86.542 1.00 125.43 ? -72  DA  J C4    1 
ATOM   9075  P  P     . DT  J 6 2   ? -55.714 -49.928 84.292 1.00 129.67 ? -71  DT  J P     1 
ATOM   9076  O  OP1   . DT  J 6 2   ? -56.485 -51.168 84.016 1.00 132.09 ? -71  DT  J OP1   1 
ATOM   9077  O  OP2   . DT  J 6 2   ? -55.625 -48.889 83.232 1.00 108.35 ? -71  DT  J OP2   1 
ATOM   9078  O  "O5'" . DT  J 6 2   ? -56.262 -49.287 85.643 1.00 135.52 ? -71  DT  J "O5'" 1 
ATOM   9079  C  "C5'" . DT  J 6 2   ? -57.668 -49.166 85.908 1.00 140.48 ? -71  DT  J "C5'" 1 
ATOM   9080  C  "C4'" . DT  J 6 2   ? -58.129 -47.781 85.526 1.00 135.67 ? -71  DT  J "C4'" 1 
ATOM   9081  O  "O4'" . DT  J 6 2   ? -57.009 -46.870 85.597 1.00 136.16 ? -71  DT  J "O4'" 1 
ATOM   9082  C  "C3'" . DT  J 6 2   ? -58.671 -47.673 84.095 1.00 141.85 ? -71  DT  J "C3'" 1 
ATOM   9083  O  "O3'" . DT  J 6 2   ? -60.099 -47.567 83.996 1.00 147.76 ? -71  DT  J "O3'" 1 
ATOM   9084  C  "C2'" . DT  J 6 2   ? -57.980 -46.450 83.516 1.00 147.71 ? -71  DT  J "C2'" 1 
ATOM   9085  C  "C1'" . DT  J 6 2   ? -57.271 -45.811 84.700 1.00 142.21 ? -71  DT  J "C1'" 1 
ATOM   9086  N  N1    . DT  J 6 2   ? -55.987 -45.173 84.327 1.00 136.12 ? -71  DT  J N1    1 
ATOM   9087  C  C2    . DT  J 6 2   ? -55.946 -43.796 84.271 1.00 123.08 ? -71  DT  J C2    1 
ATOM   9088  O  O2    . DT  J 6 2   ? -56.892 -43.085 84.575 1.00 114.08 ? -71  DT  J O2    1 
ATOM   9089  N  N3    . DT  J 6 2   ? -54.741 -43.276 83.866 1.00 110.94 ? -71  DT  J N3    1 
ATOM   9090  C  C4    . DT  J 6 2   ? -53.611 -43.979 83.494 1.00 113.15 ? -71  DT  J C4    1 
ATOM   9091  O  O4    . DT  J 6 2   ? -52.600 -43.372 83.159 1.00 107.94 ? -71  DT  J O4    1 
ATOM   9092  C  C5    . DT  J 6 2   ? -53.731 -45.419 83.552 1.00 119.26 ? -71  DT  J C5    1 
ATOM   9093  C  C7    . DT  J 6 2   ? -52.557 -46.262 83.164 1.00 116.48 ? -71  DT  J C7    1 
ATOM   9094  C  C6    . DT  J 6 2   ? -54.900 -45.937 83.954 1.00 128.03 ? -71  DT  J C6    1 
ATOM   9095  P  P     . DC  J 6 3   ? -60.927 -46.469 84.843 1.00 165.18 ? -70  DC  J P     1 
ATOM   9096  O  OP1   . DC  J 6 3   ? -60.519 -46.567 86.266 1.00 161.79 ? -70  DC  J OP1   1 
ATOM   9097  O  OP2   . DC  J 6 3   ? -62.366 -46.594 84.485 1.00 158.20 ? -70  DC  J OP2   1 
ATOM   9098  O  "O5'" . DC  J 6 3   ? -60.444 -45.064 84.263 1.00 159.87 ? -70  DC  J "O5'" 1 
ATOM   9099  C  "C5'" . DC  J 6 3   ? -60.905 -43.846 84.885 1.00 149.56 ? -70  DC  J "C5'" 1 
ATOM   9100  C  "C4'" . DC  J 6 3   ? -60.924 -42.688 83.912 1.00 142.83 ? -70  DC  J "C4'" 1 
ATOM   9101  O  "O4'" . DC  J 6 3   ? -59.586 -42.450 83.393 1.00 141.57 ? -70  DC  J "O4'" 1 
ATOM   9102  C  "C3'" . DC  J 6 3   ? -61.830 -42.822 82.688 1.00 133.31 ? -70  DC  J "C3'" 1 
ATOM   9103  O  "O3'" . DC  J 6 3   ? -62.376 -41.533 82.436 1.00 134.57 ? -70  DC  J "O3'" 1 
ATOM   9104  C  "C2'" . DC  J 6 3   ? -60.847 -43.200 81.588 1.00 137.22 ? -70  DC  J "C2'" 1 
ATOM   9105  C  "C1'" . DC  J 6 3   ? -59.646 -42.345 81.985 1.00 136.60 ? -70  DC  J "C1'" 1 
ATOM   9106  N  N1    . DC  J 6 3   ? -58.359 -42.791 81.435 1.00 130.45 ? -70  DC  J N1    1 
ATOM   9107  C  C2    . DC  J 6 3   ? -57.333 -41.853 81.271 1.00 119.56 ? -70  DC  J C2    1 
ATOM   9108  O  O2    . DC  J 6 3   ? -57.547 -40.670 81.576 1.00 105.99 ? -70  DC  J O2    1 
ATOM   9109  N  N3    . DC  J 6 3   ? -56.141 -42.257 80.775 1.00 120.14 ? -70  DC  J N3    1 
ATOM   9110  C  C4    . DC  J 6 3   ? -55.955 -43.539 80.449 1.00 131.95 ? -70  DC  J C4    1 
ATOM   9111  N  N4    . DC  J 6 3   ? -54.765 -43.896 79.962 1.00 130.30 ? -70  DC  J N4    1 
ATOM   9112  C  C5    . DC  J 6 3   ? -56.983 -44.514 80.605 1.00 130.29 ? -70  DC  J C5    1 
ATOM   9113  C  C6    . DC  J 6 3   ? -58.156 -44.101 81.100 1.00 128.61 ? -70  DC  J C6    1 
ATOM   9114  P  P     . DA  J 6 4   ? -63.594 -41.357 81.422 1.00 146.11 ? -69  DA  J P     1 
ATOM   9115  O  OP1   . DA  J 6 4   ? -64.840 -41.625 82.176 1.00 143.74 ? -69  DA  J OP1   1 
ATOM   9116  O  OP2   . DA  J 6 4   ? -63.293 -42.152 80.191 1.00 126.43 ? -69  DA  J OP2   1 
ATOM   9117  O  "O5'" . DA  J 6 4   ? -63.624 -39.789 81.105 1.00 135.74 ? -69  DA  J "O5'" 1 
ATOM   9118  C  "C5'" . DA  J 6 4   ? -62.620 -38.850 81.570 1.00 129.71 ? -69  DA  J "C5'" 1 
ATOM   9119  C  "C4'" . DA  J 6 4   ? -61.961 -38.134 80.406 1.00 118.78 ? -69  DA  J "C4'" 1 
ATOM   9120  O  "O4'" . DA  J 6 4   ? -60.702 -38.799 80.081 1.00 117.14 ? -69  DA  J "O4'" 1 
ATOM   9121  C  "C3'" . DA  J 6 4   ? -62.747 -38.095 79.088 1.00 116.78 ? -69  DA  J "C3'" 1 
ATOM   9122  O  "O3'" . DA  J 6 4   ? -62.450 -36.935 78.326 1.00 111.05 ? -69  DA  J "O3'" 1 
ATOM   9123  C  "C2'" . DA  J 6 4   ? -62.103 -39.223 78.294 1.00 120.80 ? -69  DA  J "C2'" 1 
ATOM   9124  C  "C1'" . DA  J 6 4   ? -60.646 -39.003 78.683 1.00 116.68 ? -69  DA  J "C1'" 1 
ATOM   9125  N  N9    . DA  J 6 4   ? -59.714 -40.087 78.378 1.00 109.95 ? -69  DA  J N9    1 
ATOM   9126  C  C8    . DA  J 6 4   ? -59.927 -41.444 78.333 1.00 110.14 ? -69  DA  J C8    1 
ATOM   9127  N  N7    . DA  J 6 4   ? -58.865 -42.133 77.991 1.00 103.01 ? -69  DA  J N7    1 
ATOM   9128  C  C5    . DA  J 6 4   ? -57.894 -41.165 77.778 1.00 101.76 ? -69  DA  J C5    1 
ATOM   9129  C  C6    . DA  J 6 4   ? -56.546 -41.245 77.389 1.00 89.45  ? -69  DA  J C6    1 
ATOM   9130  N  N6    . DA  J 6 4   ? -55.914 -42.393 77.143 1.00 94.30  ? -69  DA  J N6    1 
ATOM   9131  N  N1    . DA  J 6 4   ? -55.857 -40.091 77.273 1.00 85.09  ? -69  DA  J N1    1 
ATOM   9132  C  C2    . DA  J 6 4   ? -56.486 -38.937 77.530 1.00 88.86  ? -69  DA  J C2    1 
ATOM   9133  N  N3    . DA  J 6 4   ? -57.748 -38.732 77.894 1.00 99.60  ? -69  DA  J N3    1 
ATOM   9134  C  C4    . DA  J 6 4   ? -58.404 -39.901 78.007 1.00 108.47 ? -69  DA  J C4    1 
ATOM   9135  P  P     . DA  J 6 5   ? -63.323 -35.620 78.471 1.00 122.89 ? -68  DA  J P     1 
ATOM   9136  O  OP1   . DA  J 6 5   ? -63.323 -35.236 79.911 1.00 117.50 ? -68  DA  J OP1   1 
ATOM   9137  O  OP2   . DA  J 6 5   ? -64.597 -35.831 77.736 1.00 133.52 ? -68  DA  J OP2   1 
ATOM   9138  O  "O5'" . DA  J 6 5   ? -62.509 -34.551 77.613 1.00 139.44 ? -68  DA  J "O5'" 1 
ATOM   9139  C  "C5'" . DA  J 6 5   ? -61.265 -33.994 78.100 1.00 142.18 ? -68  DA  J "C5'" 1 
ATOM   9140  C  "C4'" . DA  J 6 5   ? -60.239 -33.845 76.991 1.00 125.44 ? -68  DA  J "C4'" 1 
ATOM   9141  O  "O4'" . DA  J 6 5   ? -59.537 -35.102 76.781 1.00 113.74 ? -68  DA  J "O4'" 1 
ATOM   9142  C  "C3'" . DA  J 6 5   ? -60.762 -33.399 75.621 1.00 115.55 ? -68  DA  J "C3'" 1 
ATOM   9143  O  "O3'" . DA  J 6 5   ? -59.937 -32.300 75.232 1.00 115.64 ? -68  DA  J "O3'" 1 
ATOM   9144  C  "C2'" . DA  J 6 5   ? -60.674 -34.671 74.773 1.00 98.19  ? -68  DA  J "C2'" 1 
ATOM   9145  C  "C1'" . DA  J 6 5   ? -59.470 -35.374 75.400 1.00 108.77 ? -68  DA  J "C1'" 1 
ATOM   9146  N  N9    . DA  J 6 5   ? -59.448 -36.825 75.226 1.00 113.34 ? -68  DA  J N9    1 
ATOM   9147  C  C8    . DA  J 6 5   ? -60.479 -37.708 75.428 1.00 121.41 ? -68  DA  J C8    1 
ATOM   9148  N  N7    . DA  J 6 5   ? -60.159 -38.958 75.186 1.00 118.25 ? -68  DA  J N7    1 
ATOM   9149  C  C5    . DA  J 6 5   ? -58.829 -38.893 74.796 1.00 104.61 ? -68  DA  J C5    1 
ATOM   9150  C  C6    . DA  J 6 5   ? -57.904 -39.883 74.415 1.00 104.77 ? -68  DA  J C6    1 
ATOM   9151  N  N6    . DA  J 6 5   ? -58.191 -41.182 74.352 1.00 107.71 ? -68  DA  J N6    1 
ATOM   9152  N  N1    . DA  J 6 5   ? -56.655 -39.484 74.093 1.00 111.01 ? -68  DA  J N1    1 
ATOM   9153  C  C2    . DA  J 6 5   ? -56.364 -38.179 74.154 1.00 118.16 ? -68  DA  J C2    1 
ATOM   9154  N  N3    . DA  J 6 5   ? -57.145 -37.156 74.500 1.00 109.32 ? -68  DA  J N3    1 
ATOM   9155  C  C4    . DA  J 6 5   ? -58.376 -37.587 74.824 1.00 106.89 ? -68  DA  J C4    1 
ATOM   9156  P  P     . DT  J 6 6   ? -60.329 -31.356 73.991 1.00 122.99 ? -67  DT  J P     1 
ATOM   9157  O  OP1   . DT  J 6 6   ? -60.011 -29.949 74.365 1.00 102.15 ? -67  DT  J OP1   1 
ATOM   9158  O  OP2   . DT  J 6 6   ? -61.693 -31.711 73.531 1.00 110.71 ? -67  DT  J OP2   1 
ATOM   9159  O  "O5'" . DT  J 6 6   ? -59.354 -31.868 72.839 1.00 127.77 ? -67  DT  J "O5'" 1 
ATOM   9160  C  "C5'" . DT  J 6 6   ? -57.963 -32.120 73.109 1.00 124.88 ? -67  DT  J "C5'" 1 
ATOM   9161  C  "C4'" . DT  J 6 6   ? -57.357 -33.026 72.061 1.00 117.51 ? -67  DT  J "C4'" 1 
ATOM   9162  O  "O4'" . DT  J 6 6   ? -57.667 -34.426 72.291 1.00 115.58 ? -67  DT  J "O4'" 1 
ATOM   9163  C  "C3'" . DT  J 6 6   ? -57.753 -32.736 70.609 1.00 116.22 ? -67  DT  J "C3'" 1 
ATOM   9164  O  "O3'" . DT  J 6 6   ? -56.515 -32.582 69.916 1.00 121.88 ? -67  DT  J "O3'" 1 
ATOM   9165  C  "C2'" . DT  J 6 6   ? -58.457 -34.008 70.167 1.00 111.16 ? -67  DT  J "C2'" 1 
ATOM   9166  C  "C1'" . DT  J 6 6   ? -57.749 -35.040 71.020 1.00 110.48 ? -67  DT  J "C1'" 1 
ATOM   9167  N  N1    . DT  J 6 6   ? -58.425 -36.350 71.168 1.00 110.48 ? -67  DT  J N1    1 
ATOM   9168  C  C2    . DT  J 6 6   ? -57.690 -37.489 70.924 1.00 102.90 ? -67  DT  J C2    1 
ATOM   9169  O  O2    . DT  J 6 6   ? -56.512 -37.469 70.615 1.00 99.64  ? -67  DT  J O2    1 
ATOM   9170  N  N3    . DT  J 6 6   ? -58.390 -38.663 71.061 1.00 107.62 ? -67  DT  J N3    1 
ATOM   9171  C  C4    . DT  J 6 6   ? -59.720 -38.806 71.410 1.00 114.34 ? -67  DT  J C4    1 
ATOM   9172  O  O4    . DT  J 6 6   ? -60.207 -39.927 71.506 1.00 115.63 ? -67  DT  J O4    1 
ATOM   9173  C  C5    . DT  J 6 6   ? -60.436 -37.568 71.635 1.00 126.07 ? -67  DT  J C5    1 
ATOM   9174  C  C7    . DT  J 6 6   ? -61.884 -37.622 72.009 1.00 131.57 ? -67  DT  J C7    1 
ATOM   9175  C  C6    . DT  J 6 6   ? -59.762 -36.418 71.500 1.00 122.12 ? -67  DT  J C6    1 
ATOM   9176  P  P     . DA  J 6 7   ? -56.409 -31.841 68.501 1.00 113.48 ? -66  DA  J P     1 
ATOM   9177  O  OP1   . DA  J 6 7   ? -56.109 -30.407 68.770 1.00 96.55  ? -66  DA  J OP1   1 
ATOM   9178  O  OP2   . DA  J 6 7   ? -57.557 -32.245 67.645 1.00 98.59  ? -66  DA  J OP2   1 
ATOM   9179  O  "O5'" . DA  J 6 7   ? -55.143 -32.559 67.864 1.00 102.25 ? -66  DA  J "O5'" 1 
ATOM   9180  C  "C5'" . DA  J 6 7   ? -54.118 -33.081 68.725 1.00 98.40  ? -66  DA  J "C5'" 1 
ATOM   9181  C  "C4'" . DA  J 6 7   ? -53.665 -34.419 68.220 1.00 99.11  ? -66  DA  J "C4'" 1 
ATOM   9182  O  "O4'" . DA  J 6 7   ? -54.683 -35.416 68.510 1.00 101.35 ? -66  DA  J "O4'" 1 
ATOM   9183  C  "C3'" . DA  J 6 7   ? -53.428 -34.480 66.710 1.00 104.03 ? -66  DA  J "C3'" 1 
ATOM   9184  O  "O3'" . DA  J 6 7   ? -52.175 -35.111 66.447 1.00 102.38 ? -66  DA  J "O3'" 1 
ATOM   9185  C  "C2'" . DA  J 6 7   ? -54.648 -35.249 66.206 1.00 110.11 ? -66  DA  J "C2'" 1 
ATOM   9186  C  "C1'" . DA  J 6 7   ? -54.880 -36.213 67.366 1.00 106.65 ? -66  DA  J "C1'" 1 
ATOM   9187  N  N9    . DA  J 6 7   ? -56.213 -36.818 67.431 1.00 106.26 ? -66  DA  J N9    1 
ATOM   9188  C  C8    . DA  J 6 7   ? -57.422 -36.186 67.582 1.00 104.43 ? -66  DA  J C8    1 
ATOM   9189  N  N7    . DA  J 6 7   ? -58.447 -37.005 67.604 1.00 105.85 ? -66  DA  J N7    1 
ATOM   9190  C  C5    . DA  J 6 7   ? -57.874 -38.260 67.455 1.00 104.68 ? -66  DA  J C5    1 
ATOM   9191  C  C6    . DA  J 6 7   ? -58.425 -39.553 67.414 1.00 110.68 ? -66  DA  J C6    1 
ATOM   9192  N  N6    . DA  J 6 7   ? -59.731 -39.804 67.511 1.00 116.81 ? -66  DA  J N6    1 
ATOM   9193  N  N1    . DA  J 6 7   ? -57.577 -40.592 67.256 1.00 111.31 ? -66  DA  J N1    1 
ATOM   9194  C  C2    . DA  J 6 7   ? -56.266 -40.340 67.153 1.00 102.22 ? -66  DA  J C2    1 
ATOM   9195  N  N3    . DA  J 6 7   ? -55.629 -39.171 67.184 1.00 93.26  ? -66  DA  J N3    1 
ATOM   9196  C  C4    . DA  J 6 7   ? -56.500 -38.160 67.344 1.00 98.22  ? -66  DA  J C4    1 
ATOM   9197  P  P     . DT  J 6 8   ? -51.556 -35.093 64.971 1.00 92.08  ? -65  DT  J P     1 
ATOM   9198  O  OP1   . DT  J 6 8   ? -50.087 -35.165 65.090 1.00 100.76 ? -65  DT  J OP1   1 
ATOM   9199  O  OP2   . DT  J 6 8   ? -52.183 -33.976 64.220 1.00 83.40  ? -65  DT  J OP2   1 
ATOM   9200  O  "O5'" . DT  J 6 8   ? -51.948 -36.525 64.404 1.00 91.94  ? -65  DT  J "O5'" 1 
ATOM   9201  C  "C5'" . DT  J 6 8   ? -51.533 -37.705 65.112 1.00 94.91  ? -65  DT  J "C5'" 1 
ATOM   9202  C  "C4'" . DT  J 6 8   ? -52.127 -38.940 64.478 1.00 100.57 ? -65  DT  J "C4'" 1 
ATOM   9203  O  "O4'" . DT  J 6 8   ? -53.535 -39.042 64.803 1.00 109.31 ? -65  DT  J "O4'" 1 
ATOM   9204  C  "C3'" . DT  J 6 8   ? -52.028 -39.019 62.947 1.00 95.53  ? -65  DT  J "C3'" 1 
ATOM   9205  O  "O3'" . DT  J 6 8   ? -51.334 -40.240 62.651 1.00 101.78 ? -65  DT  J "O3'" 1 
ATOM   9206  C  "C2'" . DT  J 6 8   ? -53.479 -39.016 62.485 1.00 98.73  ? -65  DT  J "C2'" 1 
ATOM   9207  C  "C1'" . DT  J 6 8   ? -54.193 -39.613 63.690 1.00 106.51 ? -65  DT  J "C1'" 1 
ATOM   9208  N  N1    . DT  J 6 8   ? -55.646 -39.342 63.822 1.00 104.63 ? -65  DT  J N1    1 
ATOM   9209  C  C2    . DT  J 6 8   ? -56.495 -40.405 64.031 1.00 102.92 ? -65  DT  J C2    1 
ATOM   9210  O  O2    . DT  J 6 8   ? -56.112 -41.562 64.110 1.00 111.76 ? -65  DT  J O2    1 
ATOM   9211  N  N3    . DT  J 6 8   ? -57.820 -40.064 64.139 1.00 99.89  ? -65  DT  J N3    1 
ATOM   9212  C  C4    . DT  J 6 8   ? -58.366 -38.796 64.063 1.00 107.93 ? -65  DT  J C4    1 
ATOM   9213  O  O4    . DT  J 6 8   ? -59.578 -38.642 64.187 1.00 125.00 ? -65  DT  J O4    1 
ATOM   9214  C  C5    . DT  J 6 8   ? -57.420 -37.732 63.838 1.00 103.74 ? -65  DT  J C5    1 
ATOM   9215  C  C7    . DT  J 6 8   ? -57.920 -36.324 63.754 1.00 99.60  ? -65  DT  J C7    1 
ATOM   9216  C  C6    . DT  J 6 8   ? -56.124 -38.052 63.735 1.00 107.52 ? -65  DT  J C6    1 
ATOM   9217  P  P     . DC  J 6 9   ? -50.927 -40.658 61.140 1.00 103.56 ? -64  DC  J P     1 
ATOM   9218  O  OP1   . DC  J 6 9   ? -49.578 -41.287 61.194 1.00 89.48  ? -64  DC  J OP1   1 
ATOM   9219  O  OP2   . DC  J 6 9   ? -51.215 -39.511 60.224 1.00 87.77  ? -64  DC  J OP2   1 
ATOM   9220  O  "O5'" . DC  J 6 9   ? -51.942 -41.833 60.778 1.00 109.36 ? -64  DC  J "O5'" 1 
ATOM   9221  C  "C5'" . DC  J 6 9   ? -51.986 -43.070 61.521 1.00 111.92 ? -64  DC  J "C5'" 1 
ATOM   9222  C  "C4'" . DC  J 6 9   ? -53.234 -43.828 61.141 1.00 116.41 ? -64  DC  J "C4'" 1 
ATOM   9223  O  "O4'" . DC  J 6 9   ? -54.388 -43.110 61.622 1.00 117.87 ? -64  DC  J "O4'" 1 
ATOM   9224  C  "C3'" . DC  J 6 9   ? -53.444 -43.964 59.639 1.00 114.96 ? -64  DC  J "C3'" 1 
ATOM   9225  O  "O3'" . DC  J 6 9   ? -52.950 -45.233 59.228 1.00 114.95 ? -64  DC  J "O3'" 1 
ATOM   9226  C  "C2'" . DC  J 6 9   ? -54.957 -43.817 59.425 1.00 117.84 ? -64  DC  J "C2'" 1 
ATOM   9227  C  "C1'" . DC  J 6 9   ? -55.488 -43.417 60.804 1.00 113.28 ? -64  DC  J "C1'" 1 
ATOM   9228  N  N1    . DC  J 6 9   ? -56.361 -42.236 60.763 1.00 109.31 ? -64  DC  J N1    1 
ATOM   9229  C  C2    . DC  J 6 9   ? -57.748 -42.412 60.800 1.00 112.90 ? -64  DC  J C2    1 
ATOM   9230  O  O2    . DC  J 6 9   ? -58.205 -43.563 60.863 1.00 118.88 ? -64  DC  J O2    1 
ATOM   9231  N  N3    . DC  J 6 9   ? -58.553 -41.326 60.766 1.00 109.03 ? -64  DC  J N3    1 
ATOM   9232  C  C4    . DC  J 6 9   ? -58.021 -40.104 60.695 1.00 100.31 ? -64  DC  J C4    1 
ATOM   9233  N  N4    . DC  J 6 9   ? -58.850 -39.060 60.664 1.00 103.10 ? -64  DC  J N4    1 
ATOM   9234  C  C5    . DC  J 6 9   ? -56.612 -39.898 60.646 1.00 105.01 ? -64  DC  J C5    1 
ATOM   9235  C  C6    . DC  J 6 9   ? -55.827 -40.981 60.683 1.00 101.69 ? -64  DC  J C6    1 
ATOM   9236  P  P     . DC  J 6 10  ? -52.678 -45.527 57.684 1.00 106.99 ? -63  DC  J P     1 
ATOM   9237  O  OP1   . DC  J 6 10  ? -51.638 -46.588 57.589 1.00 92.24  ? -63  DC  J OP1   1 
ATOM   9238  O  OP2   . DC  J 6 10  ? -52.500 -44.226 56.989 1.00 99.05  ? -63  DC  J OP2   1 
ATOM   9239  O  "O5'" . DC  J 6 10  ? -54.055 -46.151 57.190 1.00 108.23 ? -63  DC  J "O5'" 1 
ATOM   9240  C  "C5'" . DC  J 6 10  ? -54.709 -47.187 57.938 1.00 116.01 ? -63  DC  J "C5'" 1 
ATOM   9241  C  "C4'" . DC  J 6 10  ? -56.153 -47.273 57.516 1.00 122.50 ? -63  DC  J "C4'" 1 
ATOM   9242  O  "O4'" . DC  J 6 10  ? -56.876 -46.130 58.025 1.00 118.05 ? -63  DC  J "O4'" 1 
ATOM   9243  C  "C3'" . DC  J 6 10  ? -56.377 -47.296 56.004 1.00 123.78 ? -63  DC  J "C3'" 1 
ATOM   9244  O  "O3'" . DC  J 6 10  ? -57.002 -48.509 55.636 1.00 128.51 ? -63  DC  J "O3'" 1 
ATOM   9245  C  "C2'" . DC  J 6 10  ? -57.284 -46.098 55.710 1.00 114.89 ? -63  DC  J "C2'" 1 
ATOM   9246  C  "C1'" . DC  J 6 10  ? -57.850 -45.761 57.087 1.00 112.67 ? -63  DC  J "C1'" 1 
ATOM   9247  N  N1    . DC  J 6 10  ? -58.087 -44.327 57.224 1.00 105.31 ? -63  DC  J N1    1 
ATOM   9248  C  C2    . DC  J 6 10  ? -59.339 -43.888 57.660 1.00 115.70 ? -63  DC  J C2    1 
ATOM   9249  O  O2    . DC  J 6 10  ? -60.205 -44.730 57.942 1.00 134.96 ? -63  DC  J O2    1 
ATOM   9250  N  N3    . DC  J 6 10  ? -59.574 -42.561 57.764 1.00 109.32 ? -63  DC  J N3    1 
ATOM   9251  C  C4    . DC  J 6 10  ? -58.614 -41.688 57.452 1.00 97.45  ? -63  DC  J C4    1 
ATOM   9252  N  N4    . DC  J 6 10  ? -58.887 -40.389 57.582 1.00 95.11  ? -63  DC  J N4    1 
ATOM   9253  C  C5    . DC  J 6 10  ? -57.331 -42.109 56.994 1.00 94.93  ? -63  DC  J C5    1 
ATOM   9254  C  C6    . DC  J 6 10  ? -57.116 -43.425 56.888 1.00 95.40  ? -63  DC  J C6    1 
ATOM   9255  P  P     . DA  J 6 11  ? -57.097 -48.923 54.105 1.00 127.69 ? -62  DA  J P     1 
ATOM   9256  O  OP1   . DA  J 6 11  ? -56.850 -50.388 54.037 1.00 120.55 ? -62  DA  J OP1   1 
ATOM   9257  O  OP2   . DA  J 6 11  ? -56.263 -47.986 53.306 1.00 108.80 ? -62  DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  J 6 11  ? -58.621 -48.623 53.766 1.00 121.10 ? -62  DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  J 6 11  ? -59.660 -49.244 54.539 1.00 122.50 ? -62  DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  J 6 11  ? -60.975 -48.618 54.181 1.00 117.15 ? -62  DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  J 6 11  ? -60.991 -47.279 54.718 1.00 107.97 ? -62  DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  J 6 11  ? -61.222 -48.499 52.675 1.00 111.03 ? -62  DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  J 6 11  ? -62.249 -49.405 52.244 1.00 113.18 ? -62  DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  J 6 11  ? -61.465 -47.001 52.439 1.00 110.40 ? -62  DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  J 6 11  ? -61.698 -46.448 53.846 1.00 109.04 ? -62  DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  J 6 11  ? -61.165 -45.099 53.992 1.00 112.46 ? -62  DA  J N9    1 
ATOM   9267  C  C8    . DA  J 6 11  ? -59.868 -44.707 53.768 1.00 107.51 ? -62  DA  J C8    1 
ATOM   9268  N  N7    . DA  J 6 11  ? -59.664 -43.427 53.956 1.00 108.20 ? -62  DA  J N7    1 
ATOM   9269  C  C5    . DA  J 6 11  ? -60.909 -42.941 54.330 1.00 107.60 ? -62  DA  J C5    1 
ATOM   9270  C  C6    . DA  J 6 11  ? -61.360 -41.652 54.667 1.00 110.75 ? -62  DA  J C6    1 
ATOM   9271  N  N6    . DA  J 6 11  ? -60.572 -40.576 54.690 1.00 110.80 ? -62  DA  J N6    1 
ATOM   9272  N  N1    . DA  J 6 11  ? -62.667 -41.503 54.976 1.00 114.54 ? -62  DA  J N1    1 
ATOM   9273  C  C2    . DA  J 6 11  ? -63.456 -42.585 54.959 1.00 120.87 ? -62  DA  J C2    1 
ATOM   9274  N  N3    . DA  J 6 11  ? -63.148 -43.848 54.663 1.00 117.31 ? -62  DA  J N3    1 
ATOM   9275  C  C4    . DA  J 6 11  ? -61.845 -43.959 54.351 1.00 113.21 ? -62  DA  J C4    1 
ATOM   9276  P  P     . DC  J 6 12  ? -62.610 -49.558 50.668 1.00 112.91 ? -61  DC  J P     1 
ATOM   9277  O  OP1   . DC  J 6 12  ? -63.067 -50.948 50.419 1.00 98.21  ? -61  DC  J OP1   1 
ATOM   9278  O  OP2   . DC  J 6 12  ? -61.465 -49.037 49.875 1.00 112.31 ? -61  DC  J OP2   1 
ATOM   9279  O  "O5'" . DC  J 6 12  ? -63.852 -48.568 50.503 1.00 101.85 ? -61  DC  J "O5'" 1 
ATOM   9280  C  "C5'" . DC  J 6 12  ? -64.658 -48.152 51.639 1.00 102.54 ? -61  DC  J "C5'" 1 
ATOM   9281  C  "C4'" . DC  J 6 12  ? -65.508 -46.960 51.265 1.00 106.76 ? -61  DC  J "C4'" 1 
ATOM   9282  O  "O4'" . DC  J 6 12  ? -64.872 -45.743 51.753 1.00 117.31 ? -61  DC  J "O4'" 1 
ATOM   9283  C  "C3'" . DC  J 6 12  ? -65.718 -46.747 49.761 1.00 113.42 ? -61  DC  J "C3'" 1 
ATOM   9284  O  "O3'" . DC  J 6 12  ? -67.051 -46.359 49.417 1.00 114.67 ? -61  DC  J "O3'" 1 
ATOM   9285  C  "C2'" . DC  J 6 12  ? -64.745 -45.619 49.446 1.00 124.39 ? -61  DC  J "C2'" 1 
ATOM   9286  C  "C1'" . DC  J 6 12  ? -64.867 -44.781 50.712 1.00 129.42 ? -61  DC  J "C1'" 1 
ATOM   9287  N  N1    . DC  J 6 12  ? -63.732 -43.853 50.888 1.00 127.79 ? -61  DC  J N1    1 
ATOM   9288  C  C2    . DC  J 6 12  ? -63.975 -42.509 51.217 1.00 123.96 ? -61  DC  J C2    1 
ATOM   9289  O  O2    . DC  J 6 12  ? -65.145 -42.135 51.399 1.00 111.76 ? -61  DC  J O2    1 
ATOM   9290  N  N3    . DC  J 6 12  ? -62.927 -41.658 51.339 1.00 121.85 ? -61  DC  J N3    1 
ATOM   9291  C  C4    . DC  J 6 12  ? -61.683 -42.099 51.123 1.00 114.78 ? -61  DC  J C4    1 
ATOM   9292  N  N4    . DC  J 6 12  ? -60.675 -41.234 51.257 1.00 92.37  ? -61  DC  J N4    1 
ATOM   9293  C  C5    . DC  J 6 12  ? -61.413 -43.452 50.763 1.00 127.25 ? -61  DC  J C5    1 
ATOM   9294  C  C6    . DC  J 6 12  ? -62.457 -44.282 50.643 1.00 124.20 ? -61  DC  J C6    1 
ATOM   9295  P  P     . DC  J 6 13  ? -67.447 -46.019 47.873 1.00 107.86 ? -60  DC  J P     1 
ATOM   9296  O  OP1   . DC  J 6 13  ? -68.803 -46.564 47.617 1.00 107.93 ? -60  DC  J OP1   1 
ATOM   9297  O  OP2   . DC  J 6 13  ? -66.323 -46.447 46.987 1.00 94.58  ? -60  DC  J OP2   1 
ATOM   9298  O  "O5'" . DC  J 6 13  ? -67.599 -44.429 47.881 1.00 111.31 ? -60  DC  J "O5'" 1 
ATOM   9299  C  "C5'" . DC  J 6 13  ? -68.527 -43.774 48.782 1.00 117.54 ? -60  DC  J "C5'" 1 
ATOM   9300  C  "C4'" . DC  J 6 13  ? -68.723 -42.333 48.374 1.00 119.89 ? -60  DC  J "C4'" 1 
ATOM   9301  O  "O4'" . DC  J 6 13  ? -67.535 -41.569 48.741 1.00 130.39 ? -60  DC  J "O4'" 1 
ATOM   9302  C  "C3'" . DC  J 6 13  ? -68.919 -42.107 46.877 1.00 126.10 ? -60  DC  J "C3'" 1 
ATOM   9303  O  "O3'" . DC  J 6 13  ? -69.868 -41.067 46.647 1.00 139.09 ? -60  DC  J "O3'" 1 
ATOM   9304  C  "C2'" . DC  J 6 13  ? -67.512 -41.748 46.413 1.00 133.48 ? -60  DC  J "C2'" 1 
ATOM   9305  C  "C1'" . DC  J 6 13  ? -67.021 -40.917 47.596 1.00 131.22 ? -60  DC  J "C1'" 1 
ATOM   9306  N  N1    . DC  J 6 13  ? -65.549 -40.838 47.695 1.00 122.85 ? -60  DC  J N1    1 
ATOM   9307  C  C2    . DC  J 6 13  ? -64.950 -39.603 47.966 1.00 120.39 ? -60  DC  J C2    1 
ATOM   9308  O  O2    . DC  J 6 13  ? -65.674 -38.615 48.154 1.00 124.61 ? -60  DC  J O2    1 
ATOM   9309  N  N3    . DC  J 6 13  ? -63.600 -39.522 48.028 1.00 114.36 ? -60  DC  J N3    1 
ATOM   9310  C  C4    . DC  J 6 13  ? -62.857 -40.612 47.823 1.00 112.39 ? -60  DC  J C4    1 
ATOM   9311  N  N4    . DC  J 6 13  ? -61.531 -40.492 47.906 1.00 110.76 ? -60  DC  J N4    1 
ATOM   9312  C  C5    . DC  J 6 13  ? -63.441 -41.877 47.531 1.00 120.23 ? -60  DC  J C5    1 
ATOM   9313  C  C6    . DC  J 6 13  ? -64.777 -41.943 47.470 1.00 121.86 ? -60  DC  J C6    1 
ATOM   9314  P  P     . DT  J 6 14  ? -70.364 -40.718 45.150 1.00 136.17 ? -59  DT  J P     1 
ATOM   9315  O  OP1   . DT  J 6 14  ? -71.716 -41.311 44.957 1.00 117.18 ? -59  DT  J OP1   1 
ATOM   9316  O  OP2   . DT  J 6 14  ? -69.282 -41.100 44.197 1.00 130.11 ? -59  DT  J OP2   1 
ATOM   9317  O  "O5'" . DT  J 6 14  ? -70.547 -39.131 45.196 1.00 129.70 ? -59  DT  J "O5'" 1 
ATOM   9318  C  "C5'" . DT  J 6 14  ? -69.841 -38.284 46.132 1.00 134.74 ? -59  DT  J "C5'" 1 
ATOM   9319  C  "C4'" . DT  J 6 14  ? -68.985 -37.263 45.414 1.00 141.76 ? -59  DT  J "C4'" 1 
ATOM   9320  O  "O4'" . DT  J 6 14  ? -67.582 -37.594 45.575 1.00 140.59 ? -59  DT  J "O4'" 1 
ATOM   9321  C  "C3'" . DT  J 6 14  ? -69.211 -37.120 43.900 1.00 148.20 ? -59  DT  J "C3'" 1 
ATOM   9322  O  "O3'" . DT  J 6 14  ? -69.302 -35.752 43.500 1.00 143.26 ? -59  DT  J "O3'" 1 
ATOM   9323  C  "C2'" . DT  J 6 14  ? -67.936 -37.668 43.288 1.00 147.03 ? -59  DT  J "C2'" 1 
ATOM   9324  C  "C1'" . DT  J 6 14  ? -66.935 -37.285 44.354 1.00 150.16 ? -59  DT  J "C1'" 1 
ATOM   9325  N  N1    . DT  J 6 14  ? -65.660 -38.017 44.300 1.00 140.71 ? -59  DT  J N1    1 
ATOM   9326  C  C2    . DT  J 6 14  ? -64.486 -37.299 44.352 1.00 128.91 ? -59  DT  J C2    1 
ATOM   9327  O  O2    . DT  J 6 14  ? -64.449 -36.086 44.476 1.00 124.81 ? -59  DT  J O2    1 
ATOM   9328  N  N3    . DT  J 6 14  ? -63.348 -38.059 44.268 1.00 126.53 ? -59  DT  J N3    1 
ATOM   9329  C  C4    . DT  J 6 14  ? -63.270 -39.431 44.133 1.00 136.94 ? -59  DT  J C4    1 
ATOM   9330  O  O4    . DT  J 6 14  ? -62.174 -39.976 44.077 1.00 134.81 ? -59  DT  J O4    1 
ATOM   9331  C  C5    . DT  J 6 14  ? -64.540 -40.119 44.070 1.00 147.12 ? -59  DT  J C5    1 
ATOM   9332  C  C7    . DT  J 6 14  ? -64.556 -41.608 43.923 1.00 141.35 ? -59  DT  J C7    1 
ATOM   9333  C  C6    . DT  J 6 14  ? -65.657 -39.385 44.148 1.00 143.56 ? -59  DT  J C6    1 
ATOM   9334  P  P     . DG  J 6 15  ? -69.900 -35.380 42.064 1.00 148.30 ? -58  DG  J P     1 
ATOM   9335  O  OP1   . DG  J 6 15  ? -71.378 -35.474 42.172 1.00 155.27 ? -58  DG  J OP1   1 
ATOM   9336  O  OP2   . DG  J 6 15  ? -69.194 -36.186 41.020 1.00 116.29 ? -58  DG  J OP2   1 
ATOM   9337  O  "O5'" . DG  J 6 15  ? -69.498 -33.845 41.892 1.00 145.01 ? -58  DG  J "O5'" 1 
ATOM   9338  C  "C5'" . DG  J 6 15  ? -68.917 -33.071 42.966 1.00 135.80 ? -58  DG  J "C5'" 1 
ATOM   9339  C  "C4'" . DG  J 6 15  ? -67.925 -32.070 42.414 1.00 127.03 ? -58  DG  J "C4'" 1 
ATOM   9340  O  "O4'" . DG  J 6 15  ? -66.618 -32.690 42.295 1.00 122.50 ? -58  DG  J "O4'" 1 
ATOM   9341  C  "C3'" . DG  J 6 15  ? -68.245 -31.500 41.038 1.00 132.53 ? -58  DG  J "C3'" 1 
ATOM   9342  O  "O3'" . DG  J 6 15  ? -67.987 -30.096 41.118 1.00 131.25 ? -58  DG  J "O3'" 1 
ATOM   9343  C  "C2'" . DG  J 6 15  ? -67.472 -32.426 40.091 1.00 132.25 ? -58  DG  J "C2'" 1 
ATOM   9344  C  "C1'" . DG  J 6 15  ? -66.249 -32.801 40.928 1.00 133.41 ? -58  DG  J "C1'" 1 
ATOM   9345  N  N9    . DG  J 6 15  ? -65.771 -34.162 40.702 1.00 127.83 ? -58  DG  J N9    1 
ATOM   9346  C  C8    . DG  J 6 15  ? -66.471 -35.212 40.159 1.00 121.45 ? -58  DG  J C8    1 
ATOM   9347  N  N7    . DG  J 6 15  ? -65.785 -36.322 40.128 1.00 119.09 ? -58  DG  J N7    1 
ATOM   9348  C  C5    . DG  J 6 15  ? -64.559 -35.984 40.684 1.00 120.99 ? -58  DG  J C5    1 
ATOM   9349  C  C6    . DG  J 6 15  ? -63.405 -36.778 40.918 1.00 121.47 ? -58  DG  J C6    1 
ATOM   9350  O  O6    . DG  J 6 15  ? -63.230 -37.977 40.671 1.00 107.60 ? -58  DG  J O6    1 
ATOM   9351  N  N1    . DG  J 6 15  ? -62.385 -36.036 41.506 1.00 125.81 ? -58  DG  J N1    1 
ATOM   9352  C  C2    . DG  J 6 15  ? -62.466 -34.704 41.834 1.00 123.81 ? -58  DG  J C2    1 
ATOM   9353  N  N2    . DG  J 6 15  ? -61.376 -34.168 42.400 1.00 124.12 ? -58  DG  J N2    1 
ATOM   9354  N  N3    . DG  J 6 15  ? -63.535 -33.954 41.620 1.00 123.93 ? -58  DG  J N3    1 
ATOM   9355  C  C4    . DG  J 6 15  ? -64.537 -34.655 41.048 1.00 126.20 ? -58  DG  J C4    1 
ATOM   9356  P  P     . DC  J 6 16  ? -67.155 -29.319 39.993 1.00 131.89 ? -57  DC  J P     1 
ATOM   9357  O  OP1   . DC  J 6 16  ? -67.321 -27.870 40.254 1.00 126.11 ? -57  DC  J OP1   1 
ATOM   9358  O  OP2   . DC  J 6 16  ? -67.525 -29.877 38.660 1.00 106.61 ? -57  DC  J OP2   1 
ATOM   9359  O  "O5'" . DC  J 6 16  ? -65.649 -29.737 40.320 1.00 142.87 ? -57  DC  J "O5'" 1 
ATOM   9360  C  "C5'" . DC  J 6 16  ? -64.590 -28.774 40.524 1.00 119.28 ? -57  DC  J "C5'" 1 
ATOM   9361  C  "C4'" . DC  J 6 16  ? -63.437 -29.063 39.588 1.00 113.99 ? -57  DC  J "C4'" 1 
ATOM   9362  O  "O4'" . DC  J 6 16  ? -63.224 -30.498 39.482 1.00 100.45 ? -57  DC  J "O4'" 1 
ATOM   9363  C  "C3'" . DC  J 6 16  ? -63.605 -28.551 38.150 1.00 108.10 ? -57  DC  J "C3'" 1 
ATOM   9364  O  "O3'" . DC  J 6 16  ? -62.478 -27.820 37.678 1.00 101.71 ? -57  DC  J "O3'" 1 
ATOM   9365  C  "C2'" . DC  J 6 16  ? -63.752 -29.829 37.329 1.00 99.36  ? -57  DC  J "C2'" 1 
ATOM   9366  C  "C1'" . DC  J 6 16  ? -62.905 -30.798 38.146 1.00 105.97 ? -57  DC  J "C1'" 1 
ATOM   9367  N  N1    . DC  J 6 16  ? -63.188 -32.215 37.901 1.00 117.65 ? -57  DC  J N1    1 
ATOM   9368  C  C2    . DC  J 6 16  ? -62.394 -33.172 38.532 1.00 115.17 ? -57  DC  J C2    1 
ATOM   9369  O  O2    . DC  J 6 16  ? -61.485 -32.792 39.281 1.00 115.23 ? -57  DC  J O2    1 
ATOM   9370  N  N3    . DC  J 6 16  ? -62.633 -34.483 38.308 1.00 118.80 ? -57  DC  J N3    1 
ATOM   9371  C  C4    . DC  J 6 16  ? -63.617 -34.849 37.486 1.00 114.35 ? -57  DC  J C4    1 
ATOM   9372  N  N4    . DC  J 6 16  ? -63.816 -36.152 37.292 1.00 122.62 ? -57  DC  J N4    1 
ATOM   9373  C  C5    . DC  J 6 16  ? -64.447 -33.894 36.834 1.00 116.97 ? -57  DC  J C5    1 
ATOM   9374  C  C6    . DC  J 6 16  ? -64.195 -32.600 37.061 1.00 122.50 ? -57  DC  J C6    1 
ATOM   9375  P  P     . DA  J 6 17  ? -62.145 -26.379 38.281 1.00 110.49 ? -56  DA  J P     1 
ATOM   9376  O  OP1   . DA  J 6 17  ? -62.874 -26.225 39.571 1.00 103.84 ? -56  DA  J OP1   1 
ATOM   9377  O  OP2   . DA  J 6 17  ? -62.332 -25.381 37.209 1.00 111.35 ? -56  DA  J OP2   1 
ATOM   9378  O  "O5'" . DA  J 6 17  ? -60.586 -26.475 38.585 1.00 116.85 ? -56  DA  J "O5'" 1 
ATOM   9379  C  "C5'" . DA  J 6 17  ? -60.115 -26.949 39.866 1.00 125.06 ? -56  DA  J "C5'" 1 
ATOM   9380  C  "C4'" . DA  J 6 17  ? -58.779 -27.638 39.724 1.00 120.02 ? -56  DA  J "C4'" 1 
ATOM   9381  O  "O4'" . DA  J 6 17  ? -58.944 -28.904 39.032 1.00 117.51 ? -56  DA  J "O4'" 1 
ATOM   9382  C  "C3'" . DA  J 6 17  ? -57.722 -26.889 38.919 1.00 119.99 ? -56  DA  J "C3'" 1 
ATOM   9383  O  "O3'" . DA  J 6 17  ? -56.476 -27.326 39.430 1.00 121.29 ? -56  DA  J "O3'" 1 
ATOM   9384  C  "C2'" . DA  J 6 17  ? -57.983 -27.371 37.497 1.00 108.79 ? -56  DA  J "C2'" 1 
ATOM   9385  C  "C1'" . DA  J 6 17  ? -58.359 -28.830 37.744 1.00 112.47 ? -56  DA  J "C1'" 1 
ATOM   9386  N  N9    . DA  J 6 17  ? -59.335 -29.335 36.792 1.00 117.58 ? -56  DA  J N9    1 
ATOM   9387  C  C8    . DA  J 6 17  ? -60.192 -28.618 35.994 1.00 118.45 ? -56  DA  J C8    1 
ATOM   9388  N  N7    . DA  J 6 17  ? -60.976 -29.366 35.258 1.00 120.74 ? -56  DA  J N7    1 
ATOM   9389  C  C5    . DA  J 6 17  ? -60.626 -30.662 35.609 1.00 124.24 ? -56  DA  J C5    1 
ATOM   9390  C  C6    . DA  J 6 17  ? -61.098 -31.916 35.187 1.00 123.52 ? -56  DA  J C6    1 
ATOM   9391  N  N6    . DA  J 6 17  ? -62.062 -32.077 34.278 1.00 125.49 ? -56  DA  J N6    1 
ATOM   9392  N  N1    . DA  J 6 17  ? -60.524 -33.016 35.723 1.00 111.78 ? -56  DA  J N1    1 
ATOM   9393  C  C2    . DA  J 6 17  ? -59.555 -32.854 36.632 1.00 109.04 ? -56  DA  J C2    1 
ATOM   9394  N  N3    . DA  J 6 17  ? -59.036 -31.730 37.117 1.00 109.34 ? -56  DA  J N3    1 
ATOM   9395  C  C4    . DA  J 6 17  ? -59.619 -30.658 36.555 1.00 119.98 ? -56  DA  J C4    1 
ATOM   9396  P  P     . DG  J 6 18  ? -55.111 -26.745 38.860 1.00 122.45 ? -55  DG  J P     1 
ATOM   9397  O  OP1   . DG  J 6 18  ? -54.239 -26.476 40.031 1.00 105.77 ? -55  DG  J OP1   1 
ATOM   9398  O  OP2   . DG  J 6 18  ? -55.416 -25.670 37.873 1.00 113.46 ? -55  DG  J OP2   1 
ATOM   9399  O  "O5'" . DG  J 6 18  ? -54.534 -27.965 38.019 1.00 109.13 ? -55  DG  J "O5'" 1 
ATOM   9400  C  "C5'" . DG  J 6 18  ? -54.440 -29.263 38.619 1.00 106.99 ? -55  DG  J "C5'" 1 
ATOM   9401  C  "C4'" . DG  J 6 18  ? -54.214 -30.279 37.544 1.00 107.91 ? -55  DG  J "C4'" 1 
ATOM   9402  O  "O4'" . DG  J 6 18  ? -55.465 -30.514 36.832 1.00 118.31 ? -55  DG  J "O4'" 1 
ATOM   9403  C  "C3'" . DG  J 6 18  ? -53.208 -29.862 36.474 1.00 108.13 ? -55  DG  J "C3'" 1 
ATOM   9404  O  "O3'" . DG  J 6 18  ? -52.568 -31.044 36.026 1.00 114.00 ? -55  DG  J "O3'" 1 
ATOM   9405  C  "C2'" . DG  J 6 18  ? -54.107 -29.388 35.344 1.00 115.97 ? -55  DG  J "C2'" 1 
ATOM   9406  C  "C1'" . DG  J 6 18  ? -55.205 -30.436 35.450 1.00 125.90 ? -55  DG  J "C1'" 1 
ATOM   9407  N  N9    . DG  J 6 18  ? -56.437 -30.185 34.712 1.00 125.37 ? -55  DG  J N9    1 
ATOM   9408  C  C8    . DG  J 6 18  ? -56.999 -28.982 34.356 1.00 119.27 ? -55  DG  J C8    1 
ATOM   9409  N  N7    . DG  J 6 18  ? -58.079 -29.118 33.634 1.00 123.25 ? -55  DG  J N7    1 
ATOM   9410  C  C5    . DG  J 6 18  ? -58.218 -30.491 33.480 1.00 131.48 ? -55  DG  J C5    1 
ATOM   9411  C  C6    . DG  J 6 18  ? -59.200 -31.246 32.789 1.00 129.40 ? -55  DG  J C6    1 
ATOM   9412  O  O6    . DG  J 6 18  ? -60.183 -30.840 32.161 1.00 132.92 ? -55  DG  J O6    1 
ATOM   9413  N  N1    . DG  J 6 18  ? -58.963 -32.613 32.898 1.00 125.29 ? -55  DG  J N1    1 
ATOM   9414  C  C2    . DG  J 6 18  ? -57.920 -33.181 33.585 1.00 107.39 ? -55  DG  J C2    1 
ATOM   9415  N  N2    . DG  J 6 18  ? -57.854 -34.517 33.569 1.00 108.04 ? -55  DG  J N2    1 
ATOM   9416  N  N3    . DG  J 6 18  ? -56.997 -32.490 34.226 1.00 108.42 ? -55  DG  J N3    1 
ATOM   9417  C  C4    . DG  J 6 18  ? -57.208 -31.161 34.134 1.00 123.27 ? -55  DG  J C4    1 
ATOM   9418  P  P     . DA  J 6 19  ? -51.047 -31.025 35.628 1.00 113.39 ? -54  DA  J P     1 
ATOM   9419  O  OP1   . DA  J 6 19  ? -50.280 -31.426 36.830 1.00 113.64 ? -54  DA  J OP1   1 
ATOM   9420  O  OP2   . DA  J 6 19  ? -50.765 -29.747 34.935 1.00 105.56 ? -54  DA  J OP2   1 
ATOM   9421  O  "O5'" . DA  J 6 19  ? -50.936 -32.161 34.522 1.00 100.22 ? -54  DA  J "O5'" 1 
ATOM   9422  C  "C5'" . DA  J 6 19  ? -50.945 -33.534 34.913 1.00 105.77 ? -54  DA  J "C5'" 1 
ATOM   9423  C  "C4'" . DA  J 6 19  ? -51.971 -34.308 34.123 1.00 111.45 ? -54  DA  J "C4'" 1 
ATOM   9424  O  "O4'" . DA  J 6 19  ? -53.178 -33.549 33.950 1.00 114.76 ? -54  DA  J "O4'" 1 
ATOM   9425  C  "C3'" . DA  J 6 19  ? -51.585 -34.700 32.705 1.00 102.08 ? -54  DA  J "C3'" 1 
ATOM   9426  O  "O3'" . DA  J 6 19  ? -50.859 -35.910 32.853 1.00 105.82 ? -54  DA  J "O3'" 1 
ATOM   9427  C  "C2'" . DA  J 6 19  ? -52.933 -34.916 32.013 1.00 106.57 ? -54  DA  J "C2'" 1 
ATOM   9428  C  "C1'" . DA  J 6 19  ? -53.911 -34.116 32.888 1.00 119.84 ? -54  DA  J "C1'" 1 
ATOM   9429  N  N9    . DA  J 6 19  ? -54.600 -33.032 32.191 1.00 127.48 ? -54  DA  J N9    1 
ATOM   9430  C  C8    . DA  J 6 19  ? -54.301 -31.694 32.267 1.00 127.06 ? -54  DA  J C8    1 
ATOM   9431  N  N7    . DA  J 6 19  ? -55.089 -30.935 31.546 1.00 125.39 ? -54  DA  J N7    1 
ATOM   9432  C  C5    . DA  J 6 19  ? -55.971 -31.832 30.960 1.00 116.90 ? -54  DA  J C5    1 
ATOM   9433  C  C6    . DA  J 6 19  ? -57.046 -31.654 30.080 1.00 115.69 ? -54  DA  J C6    1 
ATOM   9434  N  N6    . DA  J 6 19  ? -57.434 -30.464 29.620 1.00 119.08 ? -54  DA  J N6    1 
ATOM   9435  N  N1    . DA  J 6 19  ? -57.720 -32.755 29.680 1.00 119.04 ? -54  DA  J N1    1 
ATOM   9436  C  C2    . DA  J 6 19  ? -57.330 -33.948 30.144 1.00 114.94 ? -54  DA  J C2    1 
ATOM   9437  N  N3    . DA  J 6 19  ? -56.335 -34.242 30.977 1.00 112.95 ? -54  DA  J N3    1 
ATOM   9438  C  C4    . DA  J 6 19  ? -55.685 -33.126 31.351 1.00 120.32 ? -54  DA  J C4    1 
ATOM   9439  P  P     . DT  J 6 20  ? -49.799 -36.349 31.765 1.00 120.19 ? -53  DT  J P     1 
ATOM   9440  O  OP1   . DT  J 6 20  ? -48.994 -37.471 32.328 1.00 111.95 ? -53  DT  J OP1   1 
ATOM   9441  O  OP2   . DT  J 6 20  ? -49.099 -35.131 31.312 1.00 122.03 ? -53  DT  J OP2   1 
ATOM   9442  O  "O5'" . DT  J 6 20  ? -50.727 -36.914 30.596 1.00 131.45 ? -53  DT  J "O5'" 1 
ATOM   9443  C  "C5'" . DT  J 6 20  ? -51.541 -38.083 30.826 1.00 127.79 ? -53  DT  J "C5'" 1 
ATOM   9444  C  "C4'" . DT  J 6 20  ? -52.613 -38.246 29.772 1.00 129.71 ? -53  DT  J "C4'" 1 
ATOM   9445  O  "O4'" . DT  J 6 20  ? -53.434 -37.058 29.669 1.00 124.77 ? -53  DT  J "O4'" 1 
ATOM   9446  C  "C3'" . DT  J 6 20  ? -52.124 -38.557 28.353 1.00 126.79 ? -53  DT  J "C3'" 1 
ATOM   9447  O  "O3'" . DT  J 6 20  ? -52.880 -39.682 27.873 1.00 139.05 ? -53  DT  J "O3'" 1 
ATOM   9448  C  "C2'" . DT  J 6 20  ? -52.408 -37.271 27.594 1.00 121.61 ? -53  DT  J "C2'" 1 
ATOM   9449  C  "C1'" . DT  J 6 20  ? -53.647 -36.756 28.303 1.00 118.82 ? -53  DT  J "C1'" 1 
ATOM   9450  N  N1    . DT  J 6 20  ? -53.882 -35.309 28.207 1.00 122.96 ? -53  DT  J N1    1 
ATOM   9451  C  C2    . DT  J 6 20  ? -55.058 -34.846 27.657 1.00 130.97 ? -53  DT  J C2    1 
ATOM   9452  O  O2    . DT  J 6 20  ? -55.914 -35.581 27.193 1.00 148.53 ? -53  DT  J O2    1 
ATOM   9453  N  N3    . DT  J 6 20  ? -55.190 -33.479 27.657 1.00 128.50 ? -53  DT  J N3    1 
ATOM   9454  C  C4    . DT  J 6 20  ? -54.289 -32.554 28.151 1.00 134.37 ? -53  DT  J C4    1 
ATOM   9455  O  O4    . DT  J 6 20  ? -54.547 -31.356 28.084 1.00 122.28 ? -53  DT  J O4    1 
ATOM   9456  C  C5    . DT  J 6 20  ? -53.085 -33.113 28.731 1.00 139.42 ? -53  DT  J C5    1 
ATOM   9457  C  C7    . DT  J 6 20  ? -52.053 -32.191 29.298 1.00 135.20 ? -53  DT  J C7    1 
ATOM   9458  C  C6    . DT  J 6 20  ? -52.949 -34.444 28.735 1.00 135.59 ? -53  DT  J C6    1 
ATOM   9459  P  P     . DA  J 6 21  ? -52.548 -40.388 26.468 1.00 140.91 ? -52  DA  J P     1 
ATOM   9460  O  OP1   . DA  J 6 21  ? -52.976 -41.808 26.560 1.00 138.87 ? -52  DA  J OP1   1 
ATOM   9461  O  OP2   . DA  J 6 21  ? -51.143 -40.078 26.107 1.00 138.76 ? -52  DA  J OP2   1 
ATOM   9462  O  "O5'" . DA  J 6 21  ? -53.527 -39.641 25.454 1.00 151.92 ? -52  DA  J "O5'" 1 
ATOM   9463  C  "C5'" . DA  J 6 21  ? -54.961 -39.721 25.606 1.00 156.69 ? -52  DA  J "C5'" 1 
ATOM   9464  C  "C4'" . DA  J 6 21  ? -55.666 -39.121 24.407 1.00 156.45 ? -52  DA  J "C4'" 1 
ATOM   9465  O  "O4'" . DA  J 6 21  ? -55.795 -37.682 24.591 1.00 146.31 ? -52  DA  J "O4'" 1 
ATOM   9466  C  "C3'" . DA  J 6 21  ? -54.989 -39.324 23.045 1.00 150.79 ? -52  DA  J "C3'" 1 
ATOM   9467  O  "O3'" . DA  J 6 21  ? -55.990 -39.772 22.118 1.00 154.19 ? -52  DA  J "O3'" 1 
ATOM   9468  C  "C2'" . DA  J 6 21  ? -54.319 -37.972 22.803 1.00 136.89 ? -52  DA  J "C2'" 1 
ATOM   9469  C  "C1'" . DA  J 6 21  ? -55.332 -37.021 23.434 1.00 142.34 ? -52  DA  J "C1'" 1 
ATOM   9470  N  N9    . DA  J 6 21  ? -54.764 -35.735 23.831 1.00 145.95 ? -52  DA  J N9    1 
ATOM   9471  C  C8    . DA  J 6 21  ? -53.644 -35.508 24.593 1.00 142.46 ? -52  DA  J C8    1 
ATOM   9472  N  N7    . DA  J 6 21  ? -53.376 -34.238 24.773 1.00 136.41 ? -52  DA  J N7    1 
ATOM   9473  C  C5    . DA  J 6 21  ? -54.382 -33.583 24.075 1.00 145.86 ? -52  DA  J C5    1 
ATOM   9474  C  C6    . DA  J 6 21  ? -54.662 -32.218 23.873 1.00 146.86 ? -52  DA  J C6    1 
ATOM   9475  N  N6    . DA  J 6 21  ? -53.926 -31.226 24.378 1.00 135.30 ? -52  DA  J N6    1 
ATOM   9476  N  N1    . DA  J 6 21  ? -55.748 -31.902 23.133 1.00 158.63 ? -52  DA  J N1    1 
ATOM   9477  C  C2    . DA  J 6 21  ? -56.489 -32.896 22.625 1.00 161.42 ? -52  DA  J C2    1 
ATOM   9478  N  N3    . DA  J 6 21  ? -56.329 -34.213 22.747 1.00 158.20 ? -52  DA  J N3    1 
ATOM   9479  C  C4    . DA  J 6 21  ? -55.244 -34.493 23.491 1.00 151.93 ? -52  DA  J C4    1 
ATOM   9480  P  P     . DC  J 6 22  ? -55.845 -39.570 20.520 1.00 153.14 ? -51  DC  J P     1 
ATOM   9481  O  OP1   . DC  J 6 22  ? -56.936 -40.336 19.872 1.00 159.84 ? -51  DC  J OP1   1 
ATOM   9482  O  OP2   . DC  J 6 22  ? -54.435 -39.854 20.126 1.00 132.22 ? -51  DC  J OP2   1 
ATOM   9483  O  "O5'" . DC  J 6 22  ? -56.171 -38.020 20.327 1.00 153.88 ? -51  DC  J "O5'" 1 
ATOM   9484  C  "C5'" . DC  J 6 22  ? -57.494 -37.536 20.010 1.00 151.41 ? -51  DC  J "C5'" 1 
ATOM   9485  C  "C4'" . DC  J 6 22  ? -57.403 -36.514 18.903 1.00 160.47 ? -51  DC  J "C4'" 1 
ATOM   9486  O  "O4'" . DC  J 6 22  ? -56.703 -35.333 19.392 1.00 156.50 ? -51  DC  J "O4'" 1 
ATOM   9487  C  "C3'" . DC  J 6 22  ? -56.639 -36.978 17.664 1.00 171.84 ? -51  DC  J "C3'" 1 
ATOM   9488  O  "O3'" . DC  J 6 22  ? -57.236 -36.525 16.457 1.00 181.66 ? -51  DC  J "O3'" 1 
ATOM   9489  C  "C2'" . DC  J 6 22  ? -55.262 -36.352 17.856 1.00 170.08 ? -51  DC  J "C2'" 1 
ATOM   9490  C  "C1'" . DC  J 6 22  ? -55.630 -35.029 18.521 1.00 162.37 ? -51  DC  J "C1'" 1 
ATOM   9491  N  N1    . DC  J 6 22  ? -54.522 -34.463 19.307 1.00 162.89 ? -51  DC  J N1    1 
ATOM   9492  C  C2    . DC  J 6 22  ? -54.394 -33.072 19.409 1.00 159.58 ? -51  DC  J C2    1 
ATOM   9493  O  O2    . DC  J 6 22  ? -55.236 -32.350 18.854 1.00 144.51 ? -51  DC  J O2    1 
ATOM   9494  N  N3    . DC  J 6 22  ? -53.366 -32.554 20.122 1.00 162.47 ? -51  DC  J N3    1 
ATOM   9495  C  C4    . DC  J 6 22  ? -52.483 -33.368 20.708 1.00 157.55 ? -51  DC  J C4    1 
ATOM   9496  N  N4    . DC  J 6 22  ? -51.481 -32.820 21.401 1.00 151.20 ? -51  DC  J N4    1 
ATOM   9497  C  C5    . DC  J 6 22  ? -52.586 -34.786 20.611 1.00 157.88 ? -51  DC  J C5    1 
ATOM   9498  C  C6    . DC  J 6 22  ? -53.606 -35.285 19.902 1.00 163.00 ? -51  DC  J C6    1 
ATOM   9499  P  P     . DT  J 6 23  ? -56.840 -37.212 15.068 1.00 190.69 ? -50  DT  J P     1 
ATOM   9500  O  OP1   . DT  J 6 23  ? -57.209 -38.648 15.158 1.00 177.18 ? -50  DT  J OP1   1 
ATOM   9501  O  OP2   . DT  J 6 23  ? -55.429 -36.859 14.754 1.00 177.89 ? -50  DT  J OP2   1 
ATOM   9502  O  "O5'" . DT  J 6 23  ? -57.776 -36.457 14.016 1.00 192.50 ? -50  DT  J "O5'" 1 
ATOM   9503  C  "C5'" . DT  J 6 23  ? -58.260 -35.104 14.221 1.00 182.90 ? -50  DT  J "C5'" 1 
ATOM   9504  C  "C4'" . DT  J 6 23  ? -57.402 -34.076 13.510 1.00 189.07 ? -50  DT  J "C4'" 1 
ATOM   9505  O  "O4'" . DT  J 6 23  ? -56.583 -33.396 14.488 1.00 178.09 ? -50  DT  J "O4'" 1 
ATOM   9506  C  "C3'" . DT  J 6 23  ? -56.438 -34.602 12.430 1.00 193.57 ? -50  DT  J "C3'" 1 
ATOM   9507  O  "O3'" . DT  J 6 23  ? -56.892 -34.380 11.073 1.00 199.34 ? -50  DT  J "O3'" 1 
ATOM   9508  C  "C2'" . DT  J 6 23  ? -55.080 -34.031 12.817 1.00 186.13 ? -50  DT  J "C2'" 1 
ATOM   9509  C  "C1'" . DT  J 6 23  ? -55.400 -32.961 13.851 1.00 180.45 ? -50  DT  J "C1'" 1 
ATOM   9510  N  N1    . DT  J 6 23  ? -54.368 -32.748 14.892 1.00 179.40 ? -50  DT  J N1    1 
ATOM   9511  C  C2    . DT  J 6 23  ? -54.420 -31.582 15.622 1.00 182.44 ? -50  DT  J C2    1 
ATOM   9512  O  O2    . DT  J 6 23  ? -55.283 -30.733 15.464 1.00 176.56 ? -50  DT  J O2    1 
ATOM   9513  N  N3    . DT  J 6 23  ? -53.419 -31.446 16.555 1.00 182.48 ? -50  DT  J N3    1 
ATOM   9514  C  C4    . DT  J 6 23  ? -52.399 -32.341 16.823 1.00 168.23 ? -50  DT  J C4    1 
ATOM   9515  O  O4    . DT  J 6 23  ? -51.568 -32.079 17.688 1.00 159.17 ? -50  DT  J O4    1 
ATOM   9516  C  C5    . DT  J 6 23  ? -52.404 -33.540 16.015 1.00 156.93 ? -50  DT  J C5    1 
ATOM   9517  C  C7    . DT  J 6 23  ? -51.338 -34.568 16.232 1.00 138.02 ? -50  DT  J C7    1 
ATOM   9518  C  C6    . DT  J 6 23  ? -53.372 -33.679 15.101 1.00 172.10 ? -50  DT  J C6    1 
ATOM   9519  P  P     . DA  J 6 24  ? -56.472 -33.075 10.188 1.00 193.46 ? -49  DA  J P     1 
ATOM   9520  O  OP1   . DA  J 6 24  ? -57.300 -33.091 8.951  1.00 175.59 ? -49  DA  J OP1   1 
ATOM   9521  O  OP2   . DA  J 6 24  ? -54.990 -33.025 10.061 1.00 156.65 ? -49  DA  J OP2   1 
ATOM   9522  O  "O5'" . DA  J 6 24  ? -56.969 -31.848 11.074 1.00 194.00 ? -49  DA  J "O5'" 1 
ATOM   9523  C  "C5'" . DA  J 6 24  ? -57.517 -30.663 10.464 1.00 196.17 ? -49  DA  J "C5'" 1 
ATOM   9524  C  "C4'" . DA  J 6 24  ? -56.560 -29.506 10.623 1.00 195.06 ? -49  DA  J "C4'" 1 
ATOM   9525  O  "O4'" . DA  J 6 24  ? -55.619 -29.802 11.690 1.00 191.46 ? -49  DA  J "O4'" 1 
ATOM   9526  C  "C3'" . DA  J 6 24  ? -55.713 -29.150 9.394  1.00 203.98 ? -49  DA  J "C3'" 1 
ATOM   9527  O  "O3'" . DA  J 6 24  ? -55.893 -27.760 9.106  1.00 217.15 ? -49  DA  J "O3'" 1 
ATOM   9528  C  "C2'" . DA  J 6 24  ? -54.311 -29.617 9.793  1.00 199.68 ? -49  DA  J "C2'" 1 
ATOM   9529  C  "C1'" . DA  J 6 24  ? -54.338 -29.373 11.297 1.00 198.42 ? -49  DA  J "C1'" 1 
ATOM   9530  N  N9    . DA  J 6 24  ? -53.335 -30.132 12.041 1.00 196.66 ? -49  DA  J N9    1 
ATOM   9531  C  C8    . DA  J 6 24  ? -52.892 -31.407 11.791 1.00 199.86 ? -49  DA  J C8    1 
ATOM   9532  N  N7    . DA  J 6 24  ? -51.971 -31.819 12.627 1.00 197.30 ? -49  DA  J N7    1 
ATOM   9533  C  C5    . DA  J 6 24  ? -51.787 -30.740 13.479 1.00 188.28 ? -49  DA  J C5    1 
ATOM   9534  C  C6    . DA  J 6 24  ? -50.937 -30.539 14.581 1.00 188.19 ? -49  DA  J C6    1 
ATOM   9535  N  N6    . DA  J 6 24  ? -50.085 -31.462 15.036 1.00 182.85 ? -49  DA  J N6    1 
ATOM   9536  N  N1    . DA  J 6 24  ? -51.002 -29.348 15.215 1.00 185.36 ? -49  DA  J N1    1 
ATOM   9537  C  C2    . DA  J 6 24  ? -51.858 -28.425 14.760 1.00 176.58 ? -49  DA  J C2    1 
ATOM   9538  N  N3    . DA  J 6 24  ? -52.701 -28.493 13.731 1.00 176.14 ? -49  DA  J N3    1 
ATOM   9539  C  C4    . DA  J 6 24  ? -52.616 -29.691 13.127 1.00 186.76 ? -49  DA  J C4    1 
ATOM   9540  P  P     . DC  J 6 25  ? -54.670 -26.832 8.627  1.00 221.37 ? -48  DC  J P     1 
ATOM   9541  O  OP1   . DC  J 6 25  ? -55.235 -25.561 8.107  1.00 215.95 ? -48  DC  J OP1   1 
ATOM   9542  O  OP2   . DC  J 6 25  ? -53.774 -27.645 7.757  1.00 204.45 ? -48  DC  J OP2   1 
ATOM   9543  O  "O5'" . DC  J 6 25  ? -53.936 -26.484 9.997  1.00 212.76 ? -48  DC  J "O5'" 1 
ATOM   9544  C  "C5'" . DC  J 6 25  ? -53.341 -25.195 10.219 1.00 211.34 ? -48  DC  J "C5'" 1 
ATOM   9545  C  "C4'" . DC  J 6 25  ? -51.874 -25.246 9.879  1.00 211.91 ? -48  DC  J "C4'" 1 
ATOM   9546  O  "O4'" . DC  J 6 25  ? -51.238 -26.291 10.662 1.00 210.38 ? -48  DC  J "O4'" 1 
ATOM   9547  C  "C3'" . DC  J 6 25  ? -51.533 -25.541 8.412  1.00 207.49 ? -48  DC  J "C3'" 1 
ATOM   9548  O  "O3'" . DC  J 6 25  ? -50.621 -24.621 7.824  1.00 214.56 ? -48  DC  J "O3'" 1 
ATOM   9549  C  "C2'" . DC  J 6 25  ? -50.888 -26.926 8.459  1.00 197.67 ? -48  DC  J "C2'" 1 
ATOM   9550  C  "C1'" . DC  J 6 25  ? -50.278 -26.931 9.859  1.00 199.79 ? -48  DC  J "C1'" 1 
ATOM   9551  N  N1    . DC  J 6 25  ? -50.006 -28.273 10.405 1.00 190.43 ? -48  DC  J N1    1 
ATOM   9552  C  C2    . DC  J 6 25  ? -49.346 -28.390 11.634 1.00 170.73 ? -48  DC  J C2    1 
ATOM   9553  O  O2    . DC  J 6 25  ? -49.027 -27.360 12.245 1.00 162.28 ? -48  DC  J O2    1 
ATOM   9554  N  N3    . DC  J 6 25  ? -49.070 -29.622 12.122 1.00 156.89 ? -48  DC  J N3    1 
ATOM   9555  C  C4    . DC  J 6 25  ? -49.420 -30.708 11.428 1.00 154.03 ? -48  DC  J C4    1 
ATOM   9556  N  N4    . DC  J 6 25  ? -49.137 -31.901 11.950 1.00 146.41 ? -48  DC  J N4    1 
ATOM   9557  C  C5    . DC  J 6 25  ? -50.090 -30.617 10.174 1.00 173.89 ? -48  DC  J C5    1 
ATOM   9558  C  C6    . DC  J 6 25  ? -50.355 -29.392 9.701  1.00 187.85 ? -48  DC  J C6    1 
ATOM   9559  P  P     . DC  J 6 26  ? -51.117 -23.169 7.360  1.00 217.51 ? -47  DC  J P     1 
ATOM   9560  O  OP1   . DC  J 6 26  ? -52.467 -22.929 7.935  1.00 206.77 ? -47  DC  J OP1   1 
ATOM   9561  O  OP2   . DC  J 6 26  ? -50.914 -23.057 5.892  1.00 200.10 ? -47  DC  J OP2   1 
ATOM   9562  O  "O5'" . DC  J 6 26  ? -50.078 -22.202 8.083  1.00 203.19 ? -47  DC  J "O5'" 1 
ATOM   9563  C  "C5'" . DC  J 6 26  ? -49.469 -22.573 9.335  1.00 183.11 ? -47  DC  J "C5'" 1 
ATOM   9564  C  "C4'" . DC  J 6 26  ? -48.064 -23.097 9.136  1.00 178.85 ? -47  DC  J "C4'" 1 
ATOM   9565  O  "O4'" . DC  J 6 26  ? -47.955 -24.485 9.542  1.00 180.21 ? -47  DC  J "O4'" 1 
ATOM   9566  C  "C3'" . DC  J 6 26  ? -47.450 -23.043 7.732  1.00 170.86 ? -47  DC  J "C3'" 1 
ATOM   9567  O  "O3'" . DC  J 6 26  ? -46.171 -22.432 7.828  1.00 186.42 ? -47  DC  J "O3'" 1 
ATOM   9568  C  "C2'" . DC  J 6 26  ? -47.203 -24.512 7.395  1.00 164.29 ? -47  DC  J "C2'" 1 
ATOM   9569  C  "C1'" . DC  J 6 26  ? -46.922 -25.065 8.787  1.00 176.47 ? -47  DC  J "C1'" 1 
ATOM   9570  N  N1    . DC  J 6 26  ? -46.955 -26.527 8.950  1.00 182.34 ? -47  DC  J N1    1 
ATOM   9571  C  C2    . DC  J 6 26  ? -46.599 -27.075 10.188 1.00 176.17 ? -47  DC  J C2    1 
ATOM   9572  O  O2    . DC  J 6 26  ? -46.293 -26.313 11.116 1.00 178.44 ? -47  DC  J O2    1 
ATOM   9573  N  N3    . DC  J 6 26  ? -46.607 -28.420 10.342 1.00 169.29 ? -47  DC  J N3    1 
ATOM   9574  C  C4    . DC  J 6 26  ? -46.942 -29.207 9.317  1.00 161.38 ? -47  DC  J C4    1 
ATOM   9575  N  N4    . DC  J 6 26  ? -46.937 -30.527 9.515  1.00 142.39 ? -47  DC  J N4    1 
ATOM   9576  C  C5    . DC  J 6 26  ? -47.295 -28.675 8.042  1.00 183.04 ? -47  DC  J C5    1 
ATOM   9577  C  C6    . DC  J 6 26  ? -47.281 -27.342 7.902  1.00 191.61 ? -47  DC  J C6    1 
ATOM   9578  P  P     . DA  J 6 27  ? -46.001 -20.869 7.565  1.00 203.87 ? -46  DA  J P     1 
ATOM   9579  O  OP1   . DA  J 6 27  ? -47.354 -20.277 7.392  1.00 210.62 ? -46  DA  J OP1   1 
ATOM   9580  O  OP2   . DA  J 6 27  ? -44.975 -20.702 6.497  1.00 181.89 ? -46  DA  J OP2   1 
ATOM   9581  O  "O5'" . DA  J 6 27  ? -45.395 -20.297 8.928  1.00 189.66 ? -46  DA  J "O5'" 1 
ATOM   9582  C  "C5'" . DA  J 6 27  ? -45.542 -20.945 10.209 1.00 165.37 ? -46  DA  J "C5'" 1 
ATOM   9583  C  "C4'" . DA  J 6 27  ? -44.260 -21.644 10.586 1.00 149.21 ? -46  DA  J "C4'" 1 
ATOM   9584  O  "O4'" . DA  J 6 27  ? -44.373 -23.071 10.327 1.00 145.63 ? -46  DA  J "O4'" 1 
ATOM   9585  C  "C3'" . DA  J 6 27  ? -43.009 -21.186 9.830  1.00 135.70 ? -46  DA  J "C3'" 1 
ATOM   9586  O  "O3'" . DA  J 6 27  ? -41.985 -21.107 10.787 1.00 140.60 ? -46  DA  J "O3'" 1 
ATOM   9587  C  "C2'" . DA  J 6 27  ? -42.737 -22.337 8.871  1.00 133.21 ? -46  DA  J "C2'" 1 
ATOM   9588  C  "C1'" . DA  J 6 27  ? -43.176 -23.518 9.727  1.00 145.67 ? -46  DA  J "C1'" 1 
ATOM   9589  N  N9    . DA  J 6 27  ? -43.454 -24.742 8.986  1.00 148.71 ? -46  DA  J N9    1 
ATOM   9590  C  C8    . DA  J 6 27  ? -43.773 -24.874 7.658  1.00 150.71 ? -46  DA  J C8    1 
ATOM   9591  N  N7    . DA  J 6 27  ? -43.973 -26.113 7.284  1.00 149.14 ? -46  DA  J N7    1 
ATOM   9592  C  C5    . DA  J 6 27  ? -43.764 -26.849 8.441  1.00 155.37 ? -46  DA  J C5    1 
ATOM   9593  C  C6    . DA  J 6 27  ? -43.815 -28.230 8.709  1.00 168.18 ? -46  DA  J C6    1 
ATOM   9594  N  N6    . DA  J 6 27  ? -44.108 -29.153 7.791  1.00 172.17 ? -46  DA  J N6    1 
ATOM   9595  N  N1    . DA  J 6 27  ? -43.554 -28.635 9.971  1.00 183.14 ? -46  DA  J N1    1 
ATOM   9596  C  C2    . DA  J 6 27  ? -43.259 -27.710 10.894 1.00 183.13 ? -46  DA  J C2    1 
ATOM   9597  N  N3    . DA  J 6 27  ? -43.176 -26.387 10.763 1.00 177.45 ? -46  DA  J N3    1 
ATOM   9598  C  C4    . DA  J 6 27  ? -43.443 -26.017 9.498  1.00 159.62 ? -46  DA  J C4    1 
ATOM   9599  P  P     . DA  J 6 28  ? -40.626 -20.387 10.439 1.00 171.33 ? -45  DA  J P     1 
ATOM   9600  O  OP1   . DA  J 6 28  ? -40.915 -18.946 10.244 1.00 174.26 ? -45  DA  J OP1   1 
ATOM   9601  O  OP2   . DA  J 6 28  ? -39.974 -21.146 9.345  1.00 160.92 ? -45  DA  J OP2   1 
ATOM   9602  O  "O5'" . DA  J 6 28  ? -39.797 -20.567 11.792 1.00 174.99 ? -45  DA  J "O5'" 1 
ATOM   9603  C  "C5'" . DA  J 6 28  ? -40.241 -21.469 12.835 1.00 157.41 ? -45  DA  J "C5'" 1 
ATOM   9604  C  "C4'" . DA  J 6 28  ? -39.437 -22.747 12.807 1.00 147.54 ? -45  DA  J "C4'" 1 
ATOM   9605  O  "O4'" . DA  J 6 28  ? -40.019 -23.708 11.877 1.00 137.90 ? -45  DA  J "O4'" 1 
ATOM   9606  C  "C3'" . DA  J 6 28  ? -37.979 -22.590 12.367 1.00 145.76 ? -45  DA  J "C3'" 1 
ATOM   9607  O  "O3'" . DA  J 6 28  ? -37.154 -23.440 13.139 1.00 145.26 ? -45  DA  J "O3'" 1 
ATOM   9608  C  "C2'" . DA  J 6 28  ? -37.993 -23.123 10.945 1.00 144.47 ? -45  DA  J "C2'" 1 
ATOM   9609  C  "C1'" . DA  J 6 28  ? -38.978 -24.269 11.106 1.00 140.89 ? -45  DA  J "C1'" 1 
ATOM   9610  N  N9    . DA  J 6 28  ? -39.517 -24.760 9.846  1.00 143.96 ? -45  DA  J N9    1 
ATOM   9611  C  C8    . DA  J 6 28  ? -39.769 -24.063 8.691  1.00 137.03 ? -45  DA  J C8    1 
ATOM   9612  N  N7    . DA  J 6 28  ? -40.231 -24.806 7.717  1.00 139.65 ? -45  DA  J N7    1 
ATOM   9613  C  C5    . DA  J 6 28  ? -40.262 -26.083 8.258  1.00 146.69 ? -45  DA  J C5    1 
ATOM   9614  C  C6    . DA  J 6 28  ? -40.649 -27.325 7.730  1.00 157.94 ? -45  DA  J C6    1 
ATOM   9615  N  N6    . DA  J 6 28  ? -41.098 -27.493 6.486  1.00 166.99 ? -45  DA  J N6    1 
ATOM   9616  N  N1    . DA  J 6 28  ? -40.560 -28.406 8.536  1.00 166.67 ? -45  DA  J N1    1 
ATOM   9617  C  C2    . DA  J 6 28  ? -40.110 -28.238 9.786  1.00 150.44 ? -45  DA  J C2    1 
ATOM   9618  N  N3    . DA  J 6 28  ? -39.715 -27.123 10.395 1.00 143.17 ? -45  DA  J N3    1 
ATOM   9619  C  C4    . DA  J 6 28  ? -39.818 -26.069 9.566  1.00 144.26 ? -45  DA  J C4    1 
ATOM   9620  P  P     . DA  J 6 29  ? -36.365 -22.849 14.364 1.00 129.36 ? -44  DA  J P     1 
ATOM   9621  O  OP1   . DA  J 6 29  ? -36.985 -23.377 15.604 1.00 137.63 ? -44  DA  J OP1   1 
ATOM   9622  O  OP2   . DA  J 6 29  ? -36.254 -21.386 14.155 1.00 131.20 ? -44  DA  J OP2   1 
ATOM   9623  O  "O5'" . DA  J 6 29  ? -34.917 -23.491 14.208 1.00 130.10 ? -44  DA  J "O5'" 1 
ATOM   9624  C  "C5'" . DA  J 6 29  ? -34.684 -24.567 13.291 1.00 120.01 ? -44  DA  J "C5'" 1 
ATOM   9625  C  "C4'" . DA  J 6 29  ? -35.046 -25.893 13.922 1.00 109.90 ? -44  DA  J "C4'" 1 
ATOM   9626  O  "O4'" . DA  J 6 29  ? -36.157 -26.500 13.213 1.00 103.32 ? -44  DA  J "O4'" 1 
ATOM   9627  C  "C3'" . DA  J 6 29  ? -33.946 -26.939 13.823 1.00 111.56 ? -44  DA  J "C3'" 1 
ATOM   9628  O  "O3'" . DA  J 6 29  ? -34.151 -28.000 14.733 1.00 116.07 ? -44  DA  J "O3'" 1 
ATOM   9629  C  "C2'" . DA  J 6 29  ? -34.133 -27.473 12.412 1.00 120.51 ? -44  DA  J "C2'" 1 
ATOM   9630  C  "C1'" . DA  J 6 29  ? -35.655 -27.434 12.263 1.00 126.52 ? -44  DA  J "C1'" 1 
ATOM   9631  N  N9    . DA  J 6 29  ? -36.080 -27.028 10.917 1.00 137.25 ? -44  DA  J N9    1 
ATOM   9632  C  C8    . DA  J 6 29  ? -36.055 -25.771 10.362 1.00 129.20 ? -44  DA  J C8    1 
ATOM   9633  N  N7    . DA  J 6 29  ? -36.506 -25.727 9.133  1.00 117.67 ? -44  DA  J N7    1 
ATOM   9634  C  C5    . DA  J 6 29  ? -36.818 -27.047 8.846  1.00 114.64 ? -44  DA  J C5    1 
ATOM   9635  C  C6    . DA  J 6 29  ? -37.333 -27.664 7.698  1.00 112.01 ? -44  DA  J C6    1 
ATOM   9636  N  N6    . DA  J 6 29  ? -37.632 -27.006 6.578  1.00 107.03 ? -44  DA  J N6    1 
ATOM   9637  N  N1    . DA  J 6 29  ? -37.534 -28.999 7.739  1.00 121.22 ? -44  DA  J N1    1 
ATOM   9638  C  C2    . DA  J 6 29  ? -37.240 -29.657 8.866  1.00 128.50 ? -44  DA  J C2    1 
ATOM   9639  N  N3    . DA  J 6 29  ? -36.747 -29.189 10.010 1.00 131.51 ? -44  DA  J N3    1 
ATOM   9640  C  C4    . DA  J 6 29  ? -36.557 -27.860 9.933  1.00 126.39 ? -44  DA  J C4    1 
ATOM   9641  P  P     . DA  J 6 30  ? -32.917 -28.888 15.201 1.00 128.60 ? -43  DA  J P     1 
ATOM   9642  O  OP1   . DA  J 6 30  ? -33.194 -29.356 16.583 1.00 122.94 ? -43  DA  J OP1   1 
ATOM   9643  O  OP2   . DA  J 6 30  ? -31.660 -28.157 14.880 1.00 103.53 ? -43  DA  J OP2   1 
ATOM   9644  O  "O5'" . DA  J 6 30  ? -32.974 -30.133 14.215 1.00 125.51 ? -43  DA  J "O5'" 1 
ATOM   9645  C  "C5'" . DA  J 6 30  ? -33.754 -31.301 14.505 1.00 114.48 ? -43  DA  J "C5'" 1 
ATOM   9646  C  "C4'" . DA  J 6 30  ? -33.668 -32.215 13.314 1.00 116.37 ? -43  DA  J "C4'" 1 
ATOM   9647  O  "O4'" . DA  J 6 30  ? -34.126 -31.489 12.133 1.00 125.35 ? -43  DA  J "O4'" 1 
ATOM   9648  C  "C3'" . DA  J 6 30  ? -32.249 -32.695 12.984 1.00 114.94 ? -43  DA  J "C3'" 1 
ATOM   9649  O  "O3'" . DA  J 6 30  ? -32.230 -34.065 12.592 1.00 110.90 ? -43  DA  J "O3'" 1 
ATOM   9650  C  "C2'" . DA  J 6 30  ? -31.838 -31.785 11.834 1.00 115.85 ? -43  DA  J "C2'" 1 
ATOM   9651  C  "C1'" . DA  J 6 30  ? -33.168 -31.638 11.102 1.00 135.04 ? -43  DA  J "C1'" 1 
ATOM   9652  N  N9    . DA  J 6 30  ? -33.247 -30.490 10.195 1.00 135.25 ? -43  DA  J N9    1 
ATOM   9653  C  C8    . DA  J 6 30  ? -32.672 -29.253 10.349 1.00 125.08 ? -43  DA  J C8    1 
ATOM   9654  N  N7    . DA  J 6 30  ? -32.910 -28.432 9.355  1.00 115.05 ? -43  DA  J N7    1 
ATOM   9655  C  C5    . DA  J 6 30  ? -33.668 -29.189 8.473  1.00 128.59 ? -43  DA  J C5    1 
ATOM   9656  C  C6    . DA  J 6 30  ? -34.237 -28.894 7.224  1.00 120.84 ? -43  DA  J C6    1 
ATOM   9657  N  N6    . DA  J 6 30  ? -34.121 -27.711 6.619  1.00 112.85 ? -43  DA  J N6    1 
ATOM   9658  N  N1    . DA  J 6 30  ? -34.939 -29.870 6.607  1.00 128.10 ? -43  DA  J N1    1 
ATOM   9659  C  C2    . DA  J 6 30  ? -35.053 -31.059 7.212  1.00 120.75 ? -43  DA  J C2    1 
ATOM   9660  N  N3    . DA  J 6 30  ? -34.569 -31.454 8.387  1.00 128.05 ? -43  DA  J N3    1 
ATOM   9661  C  C4    . DA  J 6 30  ? -33.877 -30.461 8.973  1.00 136.22 ? -43  DA  J C4    1 
ATOM   9662  P  P     . DG  J 6 31  ? -30.838 -34.872 12.510 1.00 123.12 ? -42  DG  J P     1 
ATOM   9663  O  OP1   . DG  J 6 31  ? -30.774 -35.836 13.644 1.00 125.41 ? -42  DG  J OP1   1 
ATOM   9664  O  OP2   . DG  J 6 31  ? -29.738 -33.898 12.296 1.00 120.94 ? -42  DG  J OP2   1 
ATOM   9665  O  "O5'" . DG  J 6 31  ? -30.987 -35.709 11.166 1.00 143.08 ? -42  DG  J "O5'" 1 
ATOM   9666  C  "C5'" . DG  J 6 31  ? -32.276 -36.137 10.680 1.00 139.51 ? -42  DG  J "C5'" 1 
ATOM   9667  C  "C4'" . DG  J 6 31  ? -32.278 -36.138 9.173  1.00 126.03 ? -42  DG  J "C4'" 1 
ATOM   9668  O  "O4'" . DG  J 6 31  ? -32.430 -34.774 8.699  1.00 111.73 ? -42  DG  J "O4'" 1 
ATOM   9669  C  "C3'" . DG  J 6 31  ? -31.007 -36.684 8.520  1.00 124.01 ? -42  DG  J "C3'" 1 
ATOM   9670  O  "O3'" . DG  J 6 31  ? -31.355 -37.653 7.538  1.00 128.67 ? -42  DG  J "O3'" 1 
ATOM   9671  C  "C2'" . DG  J 6 31  ? -30.329 -35.436 7.953  1.00 116.35 ? -42  DG  J "C2'" 1 
ATOM   9672  C  "C1'" . DG  J 6 31  ? -31.535 -34.559 7.636  1.00 121.59 ? -42  DG  J "C1'" 1 
ATOM   9673  N  N9    . DG  J 6 31  ? -31.259 -33.129 7.543  1.00 137.31 ? -42  DG  J N9    1 
ATOM   9674  C  C8    . DG  J 6 31  ? -30.665 -32.328 8.489  1.00 142.42 ? -42  DG  J C8    1 
ATOM   9675  N  N7    . DG  J 6 31  ? -30.569 -31.080 8.115  1.00 134.98 ? -42  DG  J N7    1 
ATOM   9676  C  C5    . DG  J 6 31  ? -31.139 -31.056 6.850  1.00 137.33 ? -42  DG  J C5    1 
ATOM   9677  C  C6    . DG  J 6 31  ? -31.312 -29.982 5.940  1.00 137.08 ? -42  DG  J C6    1 
ATOM   9678  O  O6    . DG  J 6 31  ? -30.994 -28.797 6.079  1.00 140.53 ? -42  DG  J O6    1 
ATOM   9679  N  N1    . DG  J 6 31  ? -31.921 -30.400 4.762  1.00 148.26 ? -42  DG  J N1    1 
ATOM   9680  C  C2    . DG  J 6 31  ? -32.321 -31.686 4.494  1.00 155.83 ? -42  DG  J C2    1 
ATOM   9681  N  N2    . DG  J 6 31  ? -32.901 -31.890 3.301  1.00 164.53 ? -42  DG  J N2    1 
ATOM   9682  N  N3    . DG  J 6 31  ? -32.165 -32.697 5.333  1.00 152.75 ? -42  DG  J N3    1 
ATOM   9683  C  C4    . DG  J 6 31  ? -31.571 -32.312 6.483  1.00 143.29 ? -42  DG  J C4    1 
ATOM   9684  P  P     . DT  J 6 32  ? -30.234 -38.596 6.899  1.00 120.18 ? -41  DT  J P     1 
ATOM   9685  O  OP1   . DT  J 6 32  ? -30.723 -39.995 6.948  1.00 126.18 ? -41  DT  J OP1   1 
ATOM   9686  O  OP2   . DT  J 6 32  ? -28.927 -38.249 7.494  1.00 118.22 ? -41  DT  J OP2   1 
ATOM   9687  O  "O5'" . DT  J 6 32  ? -30.166 -38.093 5.393  1.00 130.59 ? -41  DT  J "O5'" 1 
ATOM   9688  C  "C5'" . DT  J 6 32  ? -31.337 -38.068 4.562  1.00 128.90 ? -41  DT  J "C5'" 1 
ATOM   9689  C  "C4'" . DT  J 6 32  ? -31.017 -37.394 3.247  1.00 135.24 ? -41  DT  J "C4'" 1 
ATOM   9690  O  "O4'" . DT  J 6 32  ? -30.937 -35.959 3.432  1.00 126.32 ? -41  DT  J "O4'" 1 
ATOM   9691  C  "C3'" . DT  J 6 32  ? -29.695 -37.818 2.591  1.00 142.75 ? -41  DT  J "C3'" 1 
ATOM   9692  O  "O3'" . DT  J 6 32  ? -29.952 -38.103 1.209  1.00 153.04 ? -41  DT  J "O3'" 1 
ATOM   9693  C  "C2'" . DT  J 6 32  ? -28.795 -36.611 2.796  1.00 136.98 ? -41  DT  J "C2'" 1 
ATOM   9694  C  "C1'" . DT  J 6 32  ? -29.791 -35.470 2.759  1.00 137.04 ? -41  DT  J "C1'" 1 
ATOM   9695  N  N1    . DT  J 6 32  ? -29.376 -34.211 3.416  1.00 149.83 ? -41  DT  J N1    1 
ATOM   9696  C  C2    . DT  J 6 32  ? -29.640 -33.030 2.759  1.00 159.83 ? -41  DT  J C2    1 
ATOM   9697  O  O2    . DT  J 6 32  ? -30.183 -32.980 1.667  1.00 177.60 ? -41  DT  J O2    1 
ATOM   9698  N  N3    . DT  J 6 32  ? -29.239 -31.901 3.427  1.00 157.40 ? -41  DT  J N3    1 
ATOM   9699  C  C4    . DT  J 6 32  ? -28.623 -31.836 4.661  1.00 162.69 ? -41  DT  J C4    1 
ATOM   9700  O  O4    . DT  J 6 32  ? -28.322 -30.746 5.134  1.00 166.18 ? -41  DT  J O4    1 
ATOM   9701  C  C5    . DT  J 6 32  ? -28.379 -33.112 5.297  1.00 162.00 ? -41  DT  J C5    1 
ATOM   9702  C  C7    . DT  J 6 32  ? -27.713 -33.141 6.637  1.00 154.36 ? -41  DT  J C7    1 
ATOM   9703  C  C6    . DT  J 6 32  ? -28.765 -34.221 4.652  1.00 159.73 ? -41  DT  J C6    1 
ATOM   9704  P  P     . DG  J 6 33  ? -28.827 -38.733 0.246  1.00 146.65 ? -40  DG  J P     1 
ATOM   9705  O  OP1   . DG  J 6 33  ? -29.131 -40.174 0.042  1.00 148.69 ? -40  DG  J OP1   1 
ATOM   9706  O  OP2   . DG  J 6 33  ? -27.488 -38.330 0.740  1.00 143.83 ? -40  DG  J OP2   1 
ATOM   9707  O  "O5'" . DG  J 6 33  ? -29.141 -37.992 -1.125 1.00 160.12 ? -40  DG  J "O5'" 1 
ATOM   9708  C  "C5'" . DG  J 6 33  ? -28.204 -37.997 -2.203 1.00 170.42 ? -40  DG  J "C5'" 1 
ATOM   9709  C  "C4'" . DG  J 6 33  ? -27.603 -36.624 -2.386 1.00 174.09 ? -40  DG  J "C4'" 1 
ATOM   9710  O  "O4'" . DG  J 6 33  ? -27.736 -35.815 -1.183 1.00 182.42 ? -40  DG  J "O4'" 1 
ATOM   9711  C  "C3'" . DG  J 6 33  ? -26.112 -36.625 -2.715 1.00 174.01 ? -40  DG  J "C3'" 1 
ATOM   9712  O  "O3'" . DG  J 6 33  ? -25.870 -36.044 -3.983 1.00 167.78 ? -40  DG  J "O3'" 1 
ATOM   9713  C  "C2'" . DG  J 6 33  ? -25.473 -35.807 -1.588 1.00 184.22 ? -40  DG  J "C2'" 1 
ATOM   9714  C  "C1'" . DG  J 6 33  ? -26.637 -34.935 -1.131 1.00 183.33 ? -40  DG  J "C1'" 1 
ATOM   9715  N  N9    . DG  J 6 33  ? -26.468 -34.431 0.231  1.00 172.89 ? -40  DG  J N9    1 
ATOM   9716  C  C8    . DG  J 6 33  ? -26.405 -35.176 1.383  1.00 163.08 ? -40  DG  J C8    1 
ATOM   9717  N  N7    . DG  J 6 33  ? -26.213 -34.453 2.452  1.00 151.74 ? -40  DG  J N7    1 
ATOM   9718  C  C5    . DG  J 6 33  ? -26.108 -33.154 1.974  1.00 154.18 ? -40  DG  J C5    1 
ATOM   9719  C  C6    . DG  J 6 33  ? -25.887 -31.937 2.666  1.00 150.01 ? -40  DG  J C6    1 
ATOM   9720  O  O6    . DG  J 6 33  ? -25.732 -31.758 3.878  1.00 137.08 ? -40  DG  J O6    1 
ATOM   9721  N  N1    . DG  J 6 33  ? -25.850 -30.852 1.796  1.00 152.96 ? -40  DG  J N1    1 
ATOM   9722  C  C2    . DG  J 6 33  ? -26.007 -30.927 0.436  1.00 152.04 ? -40  DG  J C2    1 
ATOM   9723  N  N2    . DG  J 6 33  ? -25.940 -29.764 -0.228 1.00 156.57 ? -40  DG  J N2    1 
ATOM   9724  N  N3    . DG  J 6 33  ? -26.214 -32.056 -0.224 1.00 155.77 ? -40  DG  J N3    1 
ATOM   9725  C  C4    . DG  J 6 33  ? -26.251 -33.124 0.603  1.00 159.85 ? -40  DG  J C4    1 
ATOM   9726  P  P     . DT  J 6 34  ? -24.383 -35.970 -4.528 1.00 173.63 ? -39  DT  J P     1 
ATOM   9727  O  OP1   . DT  J 6 34  ? -24.425 -36.199 -5.992 1.00 184.79 ? -39  DT  J OP1   1 
ATOM   9728  O  OP2   . DT  J 6 34  ? -23.547 -36.863 -3.677 1.00 157.75 ? -39  DT  J OP2   1 
ATOM   9729  O  "O5'" . DT  J 6 34  ? -23.986 -34.447 -4.265 1.00 168.15 ? -39  DT  J "O5'" 1 
ATOM   9730  C  "C5'" . DT  J 6 34  ? -24.479 -33.377 -5.101 1.00 160.36 ? -39  DT  J "C5'" 1 
ATOM   9731  C  "C4'" . DT  J 6 34  ? -23.502 -32.223 -5.119 1.00 164.62 ? -39  DT  J "C4'" 1 
ATOM   9732  O  "O4'" . DT  J 6 34  ? -23.499 -31.571 -3.826 1.00 167.80 ? -39  DT  J "O4'" 1 
ATOM   9733  C  "C3'" . DT  J 6 34  ? -22.044 -32.594 -5.400 1.00 167.34 ? -39  DT  J "C3'" 1 
ATOM   9734  O  "O3'" . DT  J 6 34  ? -21.422 -31.549 -6.158 1.00 172.72 ? -39  DT  J "O3'" 1 
ATOM   9735  C  "C2'" . DT  J 6 34  ? -21.457 -32.730 -4.009 1.00 172.58 ? -39  DT  J "C2'" 1 
ATOM   9736  C  "C1'" . DT  J 6 34  ? -22.201 -31.643 -3.247 1.00 180.51 ? -39  DT  J "C1'" 1 
ATOM   9737  N  N1    . DT  J 6 34  ? -22.360 -31.881 -1.794 1.00 185.04 ? -39  DT  J N1    1 
ATOM   9738  C  C2    . DT  J 6 34  ? -22.529 -30.791 -0.968 1.00 186.17 ? -39  DT  J C2    1 
ATOM   9739  O  O2    . DT  J 6 34  ? -22.559 -29.642 -1.376 1.00 194.41 ? -39  DT  J O2    1 
ATOM   9740  N  N3    . DT  J 6 34  ? -22.668 -31.098 0.363  1.00 173.95 ? -39  DT  J N3    1 
ATOM   9741  C  C4    . DT  J 6 34  ? -22.653 -32.355 0.935  1.00 170.49 ? -39  DT  J C4    1 
ATOM   9742  O  O4    . DT  J 6 34  ? -22.793 -32.474 2.148  1.00 166.54 ? -39  DT  J O4    1 
ATOM   9743  C  C5    . DT  J 6 34  ? -22.467 -33.451 0.012  1.00 169.75 ? -39  DT  J C5    1 
ATOM   9744  C  C7    . DT  J 6 34  ? -22.436 -34.850 0.541  1.00 168.47 ? -39  DT  J C7    1 
ATOM   9745  C  C6    . DT  J 6 34  ? -22.333 -33.163 -1.288 1.00 174.27 ? -39  DT  J C6    1 
ATOM   9746  P  P     . DA  J 6 35  ? -19.824 -31.433 -6.241 1.00 176.92 ? -38  DA  J P     1 
ATOM   9747  O  OP1   . DA  J 6 35  ? -19.473 -30.861 -7.567 1.00 160.70 ? -38  DA  J OP1   1 
ATOM   9748  O  OP2   . DA  J 6 35  ? -19.237 -32.736 -5.818 1.00 164.26 ? -38  DA  J OP2   1 
ATOM   9749  O  "O5'" . DA  J 6 35  ? -19.498 -30.303 -5.167 1.00 171.12 ? -38  DA  J "O5'" 1 
ATOM   9750  C  "C5'" . DA  J 6 35  ? -19.953 -28.949 -5.360 1.00 167.21 ? -38  DA  J "C5'" 1 
ATOM   9751  C  "C4'" . DA  J 6 35  ? -19.043 -27.978 -4.644 1.00 165.31 ? -38  DA  J "C4'" 1 
ATOM   9752  O  "O4'" . DA  J 6 35  ? -19.141 -28.183 -3.210 1.00 160.71 ? -38  DA  J "O4'" 1 
ATOM   9753  C  "C3'" . DA  J 6 35  ? -17.554 -28.084 -4.963 1.00 163.97 ? -38  DA  J "C3'" 1 
ATOM   9754  O  "O3'" . DA  J 6 35  ? -17.043 -26.757 -4.874 1.00 155.28 ? -38  DA  J "O3'" 1 
ATOM   9755  C  "C2'" . DA  J 6 35  ? -17.063 -29.090 -3.925 1.00 156.30 ? -38  DA  J "C2'" 1 
ATOM   9756  C  "C1'" . DA  J 6 35  ? -17.930 -28.732 -2.717 1.00 166.88 ? -38  DA  J "C1'" 1 
ATOM   9757  N  N9    . DA  J 6 35  ? -18.263 -29.885 -1.882 1.00 170.55 ? -38  DA  J N9    1 
ATOM   9758  C  C8    . DA  J 6 35  ? -18.442 -31.185 -2.286 1.00 169.75 ? -38  DA  J C8    1 
ATOM   9759  N  N7    . DA  J 6 35  ? -18.741 -32.006 -1.309 1.00 160.48 ? -38  DA  J N7    1 
ATOM   9760  C  C5    . DA  J 6 35  ? -18.762 -31.193 -0.186 1.00 155.99 ? -38  DA  J C5    1 
ATOM   9761  C  C6    . DA  J 6 35  ? -19.019 -31.461 1.167  1.00 154.16 ? -38  DA  J C6    1 
ATOM   9762  N  N6    . DA  J 6 35  ? -19.313 -32.675 1.636  1.00 145.50 ? -38  DA  J N6    1 
ATOM   9763  N  N1    . DA  J 6 35  ? -18.958 -30.427 2.035  1.00 170.61 ? -38  DA  J N1    1 
ATOM   9764  C  C2    . DA  J 6 35  ? -18.661 -29.208 1.561  1.00 164.17 ? -38  DA  J C2    1 
ATOM   9765  N  N3    . DA  J 6 35  ? -18.400 -28.832 0.312  1.00 155.29 ? -38  DA  J N3    1 
ATOM   9766  C  C4    . DA  J 6 35  ? -18.470 -29.883 -0.523 1.00 163.54 ? -38  DA  J C4    1 
ATOM   9767  P  P     . DT  J 6 36  ? -15.487 -26.490 -4.641 1.00 164.03 ? -37  DT  J P     1 
ATOM   9768  O  OP1   . DT  J 6 36  ? -15.154 -25.176 -5.256 1.00 153.59 ? -37  DT  J OP1   1 
ATOM   9769  O  OP2   . DT  J 6 36  ? -14.732 -27.712 -5.050 1.00 144.90 ? -37  DT  J OP2   1 
ATOM   9770  O  "O5'" . DT  J 6 36  ? -15.404 -26.329 -3.058 1.00 170.02 ? -37  DT  J "O5'" 1 
ATOM   9771  C  "C5'" . DT  J 6 36  ? -16.255 -25.395 -2.354 1.00 162.63 ? -37  DT  J "C5'" 1 
ATOM   9772  C  "C4'" . DT  J 6 36  ? -15.637 -24.997 -1.032 1.00 156.74 ? -37  DT  J "C4'" 1 
ATOM   9773  O  "O4'" . DT  J 6 36  ? -15.930 -25.997 -0.022 1.00 150.92 ? -37  DT  J "O4'" 1 
ATOM   9774  C  "C3'" . DT  J 6 36  ? -14.113 -24.830 -1.054 1.00 156.93 ? -37  DT  J "C3'" 1 
ATOM   9775  O  "O3'" . DT  J 6 36  ? -13.761 -23.557 -0.489 1.00 154.80 ? -37  DT  J "O3'" 1 
ATOM   9776  C  "C2'" . DT  J 6 36  ? -13.602 -26.047 -0.302 1.00 153.69 ? -37  DT  J "C2'" 1 
ATOM   9777  C  "C1'" . DT  J 6 36  ? -14.737 -26.355 0.658  1.00 157.05 ? -37  DT  J "C1'" 1 
ATOM   9778  N  N1    . DT  J 6 36  ? -14.837 -27.777 1.045  1.00 157.46 ? -37  DT  J N1    1 
ATOM   9779  C  C2    . DT  J 6 36  ? -14.798 -28.097 2.385  1.00 154.61 ? -37  DT  J C2    1 
ATOM   9780  O  O2    . DT  J 6 36  ? -14.703 -27.262 3.270  1.00 147.34 ? -37  DT  J O2    1 
ATOM   9781  N  N3    . DT  J 6 36  ? -14.881 -29.440 2.655  1.00 147.24 ? -37  DT  J N3    1 
ATOM   9782  C  C4    . DT  J 6 36  ? -14.994 -30.469 1.741  1.00 147.51 ? -37  DT  J C4    1 
ATOM   9783  O  O4    . DT  J 6 36  ? -15.068 -31.627 2.135  1.00 138.69 ? -37  DT  J O4    1 
ATOM   9784  C  C5    . DT  J 6 36  ? -15.021 -30.064 0.355  1.00 155.66 ? -37  DT  J C5    1 
ATOM   9785  C  C7    . DT  J 6 36  ? -15.135 -31.113 -0.706 1.00 154.15 ? -37  DT  J C7    1 
ATOM   9786  C  C6    . DT  J 6 36  ? -14.936 -28.756 0.079  1.00 156.71 ? -37  DT  J C6    1 
ATOM   9787  P  P     . DT  J 6 37  ? -12.219 -23.164 -0.205 1.00 158.26 ? -36  DT  J P     1 
ATOM   9788  O  OP1   . DT  J 6 37  ? -12.075 -21.691 -0.373 1.00 128.18 ? -36  DT  J OP1   1 
ATOM   9789  O  OP2   . DT  J 6 37  ? -11.328 -24.102 -0.964 1.00 138.36 ? -36  DT  J OP2   1 
ATOM   9790  O  "O5'" . DT  J 6 37  ? -12.103 -23.423 1.361  1.00 160.10 ? -36  DT  J "O5'" 1 
ATOM   9791  C  "C5'" . DT  J 6 37  ? -13.232 -23.152 2.219  1.00 141.66 ? -36  DT  J "C5'" 1 
ATOM   9792  C  "C4'" . DT  J 6 37  ? -12.907 -23.520 3.648  1.00 126.61 ? -36  DT  J "C4'" 1 
ATOM   9793  O  "O4'" . DT  J 6 37  ? -13.048 -24.947 3.839  1.00 120.69 ? -36  DT  J "O4'" 1 
ATOM   9794  C  "C3'" . DT  J 6 37  ? -11.486 -23.169 4.091  1.00 126.94 ? -36  DT  J "C3'" 1 
ATOM   9795  O  "O3'" . DT  J 6 37  ? -11.541 -22.564 5.382  1.00 124.60 ? -36  DT  J "O3'" 1 
ATOM   9796  C  "C2'" . DT  J 6 37  ? -10.757 -24.502 4.081  1.00 121.88 ? -36  DT  J "C2'" 1 
ATOM   9797  C  "C1'" . DT  J 6 37  ? -11.867 -25.480 4.415  1.00 125.91 ? -36  DT  J "C1'" 1 
ATOM   9798  N  N1    . DT  J 6 37  ? -11.672 -26.837 3.875  1.00 133.69 ? -36  DT  J N1    1 
ATOM   9799  C  C2    . DT  J 6 37  ? -11.757 -27.909 4.735  1.00 148.38 ? -36  DT  J C2    1 
ATOM   9800  O  O2    . DT  J 6 37  ? -11.985 -27.793 5.928  1.00 159.74 ? -36  DT  J O2    1 
ATOM   9801  N  N3    . DT  J 6 37  ? -11.560 -29.133 4.145  1.00 151.38 ? -36  DT  J N3    1 
ATOM   9802  C  C4    . DT  J 6 37  ? -11.294 -29.384 2.814  1.00 154.27 ? -36  DT  J C4    1 
ATOM   9803  O  O4    . DT  J 6 37  ? -11.145 -30.539 2.429  1.00 149.41 ? -36  DT  J O4    1 
ATOM   9804  C  C5    . DT  J 6 37  ? -11.222 -28.214 1.968  1.00 162.81 ? -36  DT  J C5    1 
ATOM   9805  C  C7    . DT  J 6 37  ? -10.937 -28.389 0.509  1.00 165.14 ? -36  DT  J C7    1 
ATOM   9806  C  C6    . DT  J 6 37  ? -11.409 -27.016 2.534  1.00 152.12 ? -36  DT  J C6    1 
ATOM   9807  P  P     . DT  J 6 38  ? -10.204 -22.091 6.096  1.00 130.22 ? -35  DT  J P     1 
ATOM   9808  O  OP1   . DT  J 6 38  ? -10.454 -20.752 6.699  1.00 119.20 ? -35  DT  J OP1   1 
ATOM   9809  O  OP2   . DT  J 6 38  ? -9.071  -22.281 5.142  1.00 116.09 ? -35  DT  J OP2   1 
ATOM   9810  O  "O5'" . DT  J 6 38  ? -10.009 -23.183 7.243  1.00 146.79 ? -35  DT  J "O5'" 1 
ATOM   9811  C  "C5'" . DT  J 6 38  ? -11.111 -23.721 8.009  1.00 134.70 ? -35  DT  J "C5'" 1 
ATOM   9812  C  "C4'" . DT  J 6 38  ? -10.645 -24.889 8.851  1.00 137.60 ? -35  DT  J "C4'" 1 
ATOM   9813  O  "O4'" . DT  J 6 38  ? -10.609 -26.123 8.083  1.00 135.89 ? -35  DT  J "O4'" 1 
ATOM   9814  C  "C3'" . DT  J 6 38  ? -9.249  -24.740 9.458  1.00 148.76 ? -35  DT  J "C3'" 1 
ATOM   9815  O  "O3'" . DT  J 6 38  ? -9.313  -25.254 10.780 1.00 151.21 ? -35  DT  J "O3'" 1 
ATOM   9816  C  "C2'" . DT  J 6 38  ? -8.389  -25.667 8.619  1.00 139.70 ? -35  DT  J "C2'" 1 
ATOM   9817  C  "C1'" . DT  J 6 38  ? -9.373  -26.782 8.321  1.00 134.32 ? -35  DT  J "C1'" 1 
ATOM   9818  N  N1    . DT  J 6 38  ? -9.056  -27.615 7.140  1.00 138.03 ? -35  DT  J N1    1 
ATOM   9819  C  C2    . DT  J 6 38  ? -9.200  -28.982 7.245  1.00 138.71 ? -35  DT  J C2    1 
ATOM   9820  O  O2    . DT  J 6 38  ? -9.581  -29.537 8.261  1.00 134.06 ? -35  DT  J O2    1 
ATOM   9821  N  N3    . DT  J 6 38  ? -8.885  -29.679 6.104  1.00 141.37 ? -35  DT  J N3    1 
ATOM   9822  C  C4    . DT  J 6 38  ? -8.449  -29.157 4.900  1.00 134.91 ? -35  DT  J C4    1 
ATOM   9823  O  O4    . DT  J 6 38  ? -8.212  -29.909 3.960  1.00 127.21 ? -35  DT  J O4    1 
ATOM   9824  C  C5    . DT  J 6 38  ? -8.314  -27.718 4.864  1.00 131.45 ? -35  DT  J C5    1 
ATOM   9825  C  C7    . DT  J 6 38  ? -7.851  -27.061 3.602  1.00 133.07 ? -35  DT  J C7    1 
ATOM   9826  C  C6    . DT  J 6 38  ? -8.618  -27.029 5.971  1.00 140.86 ? -35  DT  J C6    1 
ATOM   9827  P  P     . DG  J 6 39  ? -8.440  -24.627 11.935 1.00 131.18 ? -34  DG  J P     1 
ATOM   9828  O  OP1   . DG  J 6 39  ? -9.094  -23.357 12.352 1.00 124.45 ? -34  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J 6 39  ? -7.019  -24.636 11.506 1.00 108.40 ? -34  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J 6 39  ? -8.620  -25.725 13.067 1.00 127.35 ? -34  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J 6 39  ? -9.807  -26.538 13.095 1.00 125.89 ? -34  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J 6 39  ? -9.427  -27.970 13.320 1.00 118.72 ? -34  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J 6 39  ? -8.946  -28.542 12.076 1.00 124.28 ? -34  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J 6 39  ? -8.303  -28.146 14.331 1.00 130.11 ? -34  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J 6 39  ? -8.590  -29.240 15.185 1.00 129.47 ? -34  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J 6 39  ? -7.080  -28.385 13.453 1.00 134.68 ? -34  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J 6 39  ? -7.704  -29.169 12.306 1.00 141.99 ? -34  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J 6 39  ? -6.930  -29.143 11.070 1.00 169.66 ? -34  DG  J N9    1 
ATOM   9839  C  C8    . DG  J 6 39  ? -6.389  -28.043 10.449 1.00 178.67 ? -34  DG  J C8    1 
ATOM   9840  N  N7    . DG  J 6 39  ? -5.748  -28.339 9.350  1.00 177.99 ? -34  DG  J N7    1 
ATOM   9841  C  C5    . DG  J 6 39  ? -5.867  -29.718 9.245  1.00 185.29 ? -34  DG  J C5    1 
ATOM   9842  C  C6    . DG  J 6 39  ? -5.373  -30.609 8.259  1.00 189.31 ? -34  DG  J C6    1 
ATOM   9843  O  O6    . DG  J 6 39  ? -4.715  -30.348 7.244  1.00 197.10 ? -34  DG  J O6    1 
ATOM   9844  N  N1    . DG  J 6 39  ? -5.724  -31.927 8.538  1.00 189.94 ? -34  DG  J N1    1 
ATOM   9845  C  C2    . DG  J 6 39  ? -6.453  -32.336 9.628  1.00 181.24 ? -34  DG  J C2    1 
ATOM   9846  N  N2    . DG  J 6 39  ? -6.688  -33.652 9.725  1.00 186.49 ? -34  DG  J N2    1 
ATOM   9847  N  N3    . DG  J 6 39  ? -6.918  -31.515 10.555 1.00 176.21 ? -34  DG  J N3    1 
ATOM   9848  C  C4    . DG  J 6 39  ? -6.591  -30.230 10.301 1.00 180.39 ? -34  DG  J C4    1 
ATOM   9849  P  P     . DG  J 6 40  ? -8.220  -29.157 16.725 1.00 116.15 ? -33  DG  J P     1 
ATOM   9850  O  OP1   . DG  J 6 40  ? -9.497  -29.110 17.481 1.00 112.97 ? -33  DG  J OP1   1 
ATOM   9851  O  OP2   . DG  J 6 40  ? -7.201  -28.081 16.897 1.00 96.66  ? -33  DG  J OP2   1 
ATOM   9852  O  "O5'" . DG  J 6 40  ? -7.490  -30.546 16.993 1.00 118.02 ? -33  DG  J "O5'" 1 
ATOM   9853  C  "C5'" . DG  J 6 40  ? -7.925  -31.753 16.337 1.00 132.75 ? -33  DG  J "C5'" 1 
ATOM   9854  C  "C4'" . DG  J 6 40  ? -6.732  -32.592 15.951 1.00 140.85 ? -33  DG  J "C4'" 1 
ATOM   9855  O  "O4'" . DG  J 6 40  ? -6.144  -32.107 14.705 1.00 132.60 ? -33  DG  J "O4'" 1 
ATOM   9856  C  "C3'" . DG  J 6 40  ? -5.579  -32.603 16.956 1.00 146.62 ? -33  DG  J "C3'" 1 
ATOM   9857  O  "O3'" . DG  J 6 40  ? -4.981  -33.886 16.950 1.00 148.02 ? -33  DG  J "O3'" 1 
ATOM   9858  C  "C2'" . DG  J 6 40  ? -4.567  -31.667 16.314 1.00 144.26 ? -33  DG  J "C2'" 1 
ATOM   9859  C  "C1'" . DG  J 6 40  ? -4.741  -32.079 14.861 1.00 144.77 ? -33  DG  J "C1'" 1 
ATOM   9860  N  N9    . DG  J 6 40  ? -4.153  -31.190 13.869 1.00 148.70 ? -33  DG  J N9    1 
ATOM   9861  C  C8    . DG  J 6 40  ? -3.821  -29.864 14.014 1.00 136.72 ? -33  DG  J C8    1 
ATOM   9862  N  N7    . DG  J 6 40  ? -3.280  -29.353 12.942 1.00 132.67 ? -33  DG  J N7    1 
ATOM   9863  C  C5    . DG  J 6 40  ? -3.238  -30.409 12.042 1.00 149.44 ? -33  DG  J C5    1 
ATOM   9864  C  C6    . DG  J 6 40  ? -2.757  -30.461 10.711 1.00 161.80 ? -33  DG  J C6    1 
ATOM   9865  O  O6    . DG  J 6 40  ? -2.256  -29.553 10.037 1.00 174.31 ? -33  DG  J O6    1 
ATOM   9866  N  N1    . DG  J 6 40  ? -2.900  -31.734 10.165 1.00 169.42 ? -33  DG  J N1    1 
ATOM   9867  C  C2    . DG  J 6 40  ? -3.438  -32.818 10.817 1.00 165.38 ? -33  DG  J C2    1 
ATOM   9868  N  N2    . DG  J 6 40  ? -3.493  -33.965 10.123 1.00 175.64 ? -33  DG  J N2    1 
ATOM   9869  N  N3    . DG  J 6 40  ? -3.892  -32.780 12.058 1.00 160.30 ? -33  DG  J N3    1 
ATOM   9870  C  C4    . DG  J 6 40  ? -3.760  -31.553 12.606 1.00 154.88 ? -33  DG  J C4    1 
ATOM   9871  P  P     . DA  J 6 41  ? -5.259  -34.876 18.127 1.00 137.28 ? -32  DA  J P     1 
ATOM   9872  O  OP1   . DA  J 6 41  ? -6.718  -35.165 18.128 1.00 126.35 ? -32  DA  J OP1   1 
ATOM   9873  O  OP2   . DA  J 6 41  ? -4.631  -34.291 19.334 1.00 130.59 ? -32  DA  J OP2   1 
ATOM   9874  O  "O5'" . DA  J 6 41  ? -4.404  -36.153 17.704 1.00 135.99 ? -32  DA  J "O5'" 1 
ATOM   9875  C  "C5'" . DA  J 6 41  ? -5.009  -37.430 17.442 1.00 135.11 ? -32  DA  J "C5'" 1 
ATOM   9876  C  "C4'" . DA  J 6 41  ? -4.184  -38.173 16.423 1.00 147.53 ? -32  DA  J "C4'" 1 
ATOM   9877  O  "O4'" . DA  J 6 41  ? -3.786  -37.237 15.381 1.00 147.43 ? -32  DA  J "O4'" 1 
ATOM   9878  C  "C3'" . DA  J 6 41  ? -2.884  -38.808 16.933 1.00 155.57 ? -32  DA  J "C3'" 1 
ATOM   9879  O  "O3'" . DA  J 6 41  ? -2.745  -40.081 16.286 1.00 163.17 ? -32  DA  J "O3'" 1 
ATOM   9880  C  "C2'" . DA  J 6 41  ? -1.850  -37.747 16.576 1.00 155.75 ? -32  DA  J "C2'" 1 
ATOM   9881  C  "C1'" . DA  J 6 41  ? -2.382  -37.281 15.225 1.00 158.45 ? -32  DA  J "C1'" 1 
ATOM   9882  N  N9    . DA  J 6 41  ? -1.913  -35.957 14.826 1.00 152.60 ? -32  DA  J N9    1 
ATOM   9883  C  C8    . DA  J 6 41  ? -1.836  -34.822 15.594 1.00 140.45 ? -32  DA  J C8    1 
ATOM   9884  N  N7    . DA  J 6 41  ? -1.362  -33.782 14.952 1.00 134.37 ? -32  DA  J N7    1 
ATOM   9885  C  C5    . DA  J 6 41  ? -1.102  -34.267 13.678 1.00 140.59 ? -32  DA  J C5    1 
ATOM   9886  C  C6    . DA  J 6 41  ? -0.587  -33.657 12.522 1.00 134.32 ? -32  DA  J C6    1 
ATOM   9887  N  N6    . DA  J 6 41  ? -0.226  -32.374 12.464 1.00 126.75 ? -32  DA  J N6    1 
ATOM   9888  N  N1    . DA  J 6 41  ? -0.454  -34.421 11.415 1.00 150.77 ? -32  DA  J N1    1 
ATOM   9889  C  C2    . DA  J 6 41  ? -0.818  -35.709 11.476 1.00 155.44 ? -32  DA  J C2    1 
ATOM   9890  N  N3    . DA  J 6 41  ? -1.314  -36.395 12.504 1.00 153.07 ? -32  DA  J N3    1 
ATOM   9891  C  C4    . DA  J 6 41  ? -1.434  -35.606 13.587 1.00 150.13 ? -32  DA  J C4    1 
ATOM   9892  P  P     . DA  J 6 42  ? -1.304  -40.774 16.052 1.00 165.56 ? -31  DA  J P     1 
ATOM   9893  O  OP1   . DA  J 6 42  ? -1.485  -42.244 16.174 1.00 175.01 ? -31  DA  J OP1   1 
ATOM   9894  O  OP2   . DA  J 6 42  ? -0.309  -40.090 16.918 1.00 153.87 ? -31  DA  J OP2   1 
ATOM   9895  O  "O5'" . DA  J 6 42  ? -0.988  -40.457 14.519 1.00 165.38 ? -31  DA  J "O5'" 1 
ATOM   9896  C  "C5'" . DA  J 6 42  ? -0.478  -41.467 13.616 1.00 159.68 ? -31  DA  J "C5'" 1 
ATOM   9897  C  "C4'" . DA  J 6 42  ? 0.970   -41.190 13.295 1.00 156.33 ? -31  DA  J "C4'" 1 
ATOM   9898  O  "O4'" . DA  J 6 42  ? 1.113   -39.773 13.048 1.00 144.47 ? -31  DA  J "O4'" 1 
ATOM   9899  C  "C3'" . DA  J 6 42  ? 1.956   -41.558 14.413 1.00 156.47 ? -31  DA  J "C3'" 1 
ATOM   9900  O  "O3'" . DA  J 6 42  ? 2.907   -42.616 14.218 1.00 154.31 ? -31  DA  J "O3'" 1 
ATOM   9901  C  "C2'" . DA  J 6 42  ? 2.648   -40.245 14.789 1.00 155.54 ? -31  DA  J "C2'" 1 
ATOM   9902  C  "C1'" . DA  J 6 42  ? 2.310   -39.316 13.622 1.00 151.41 ? -31  DA  J "C1'" 1 
ATOM   9903  N  N9    . DA  J 6 42  ? 2.102   -37.933 14.047 1.00 154.73 ? -31  DA  J N9    1 
ATOM   9904  C  C8    . DA  J 6 42  ? 1.465   -37.491 15.180 1.00 154.64 ? -31  DA  J C8    1 
ATOM   9905  N  N7    . DA  J 6 42  ? 1.429   -36.186 15.291 1.00 154.10 ? -31  DA  J N7    1 
ATOM   9906  C  C5    . DA  J 6 42  ? 2.086   -35.737 14.154 1.00 166.44 ? -31  DA  J C5    1 
ATOM   9907  C  C6    . DA  J 6 42  ? 2.382   -34.448 13.681 1.00 173.75 ? -31  DA  J C6    1 
ATOM   9908  N  N6    . DA  J 6 42  ? 2.042   -33.329 14.323 1.00 180.25 ? -31  DA  J N6    1 
ATOM   9909  N  N1    . DA  J 6 42  ? 3.051   -34.346 12.511 1.00 172.63 ? -31  DA  J N1    1 
ATOM   9910  C  C2    . DA  J 6 42  ? 3.393   -35.471 11.868 1.00 174.03 ? -31  DA  J C2    1 
ATOM   9911  N  N3    . DA  J 6 42  ? 3.170   -36.738 12.212 1.00 177.57 ? -31  DA  J N3    1 
ATOM   9912  C  C4    . DA  J 6 42  ? 2.504   -36.803 13.379 1.00 167.46 ? -31  DA  J C4    1 
ATOM   9913  P  P     . DA  J 6 43  ? 3.627   -42.898 12.800 1.00 172.15 ? -30  DA  J P     1 
ATOM   9914  O  OP1   . DA  J 6 43  ? 2.582   -43.248 11.802 1.00 156.46 ? -30  DA  J OP1   1 
ATOM   9915  O  OP2   . DA  J 6 43  ? 4.751   -43.841 13.042 1.00 171.95 ? -30  DA  J OP2   1 
ATOM   9916  O  "O5'" . DA  J 6 43  ? 4.320   -41.515 12.415 1.00 178.05 ? -30  DA  J "O5'" 1 
ATOM   9917  C  "C5'" . DA  J 6 43  ? 5.088   -41.417 11.193 1.00 171.14 ? -30  DA  J "C5'" 1 
ATOM   9918  C  "C4'" . DA  J 6 43  ? 6.174   -40.372 11.303 1.00 168.48 ? -30  DA  J "C4'" 1 
ATOM   9919  O  "O4'" . DA  J 6 43  ? 5.657   -39.183 11.955 1.00 159.73 ? -30  DA  J "O4'" 1 
ATOM   9920  C  "C3'" . DA  J 6 43  ? 7.432   -40.773 12.086 1.00 172.11 ? -30  DA  J "C3'" 1 
ATOM   9921  O  "O3'" . DA  J 6 43  ? 8.610   -40.591 11.299 1.00 173.72 ? -30  DA  J "O3'" 1 
ATOM   9922  C  "C2'" . DA  J 6 43  ? 7.422   -39.834 13.294 1.00 164.41 ? -30  DA  J "C2'" 1 
ATOM   9923  C  "C1'" . DA  J 6 43  ? 6.684   -38.623 12.734 1.00 160.98 ? -30  DA  J "C1'" 1 
ATOM   9924  N  N9    . DA  J 6 43  ? 6.087   -37.766 13.756 1.00 167.11 ? -30  DA  J N9    1 
ATOM   9925  C  C8    . DA  J 6 43  ? 5.422   -38.156 14.893 1.00 164.65 ? -30  DA  J C8    1 
ATOM   9926  N  N7    . DA  J 6 43  ? 5.014   -37.157 15.636 1.00 159.42 ? -30  DA  J N7    1 
ATOM   9927  C  C5    . DA  J 6 43  ? 5.447   -36.031 14.948 1.00 161.59 ? -30  DA  J C5    1 
ATOM   9928  C  C6    . DA  J 6 43  ? 5.332   -34.656 15.217 1.00 160.76 ? -30  DA  J C6    1 
ATOM   9929  N  N6    . DA  J 6 43  ? 4.714   -34.161 16.291 1.00 172.40 ? -30  DA  J N6    1 
ATOM   9930  N  N1    . DA  J 6 43  ? 5.873   -33.794 14.328 1.00 155.66 ? -30  DA  J N1    1 
ATOM   9931  C  C2    . DA  J 6 43  ? 6.490   -34.291 13.249 1.00 170.59 ? -30  DA  J C2    1 
ATOM   9932  N  N3    . DA  J 6 43  ? 6.663   -35.562 12.888 1.00 179.83 ? -30  DA  J N3    1 
ATOM   9933  C  C4    . DA  J 6 43  ? 6.113   -36.392 13.791 1.00 169.15 ? -30  DA  J C4    1 
ATOM   9934  P  P     . DC  J 6 44  ? 10.030  -41.159 11.802 1.00 159.03 ? -29  DC  J P     1 
ATOM   9935  O  OP1   . DC  J 6 44  ? 10.761  -41.668 10.614 1.00 152.84 ? -29  DC  J OP1   1 
ATOM   9936  O  OP2   . DC  J 6 44  ? 9.797   -42.049 12.971 1.00 147.10 ? -29  DC  J OP2   1 
ATOM   9937  O  "O5'" . DC  J 6 44  ? 10.782  -39.858 12.332 1.00 151.02 ? -29  DC  J "O5'" 1 
ATOM   9938  C  "C5'" . DC  J 6 44  ? 11.054  -38.751 11.456 1.00 149.34 ? -29  DC  J "C5'" 1 
ATOM   9939  C  "C4'" . DC  J 6 44  ? 11.384  -37.517 12.260 1.00 154.64 ? -29  DC  J "C4'" 1 
ATOM   9940  O  "O4'" . DC  J 6 44  ? 10.258  -37.143 13.086 1.00 165.71 ? -29  DC  J "O4'" 1 
ATOM   9941  C  "C3'" . DC  J 6 44  ? 12.567  -37.638 13.223 1.00 160.09 ? -29  DC  J "C3'" 1 
ATOM   9942  O  "O3'" . DC  J 6 44  ? 13.680  -36.896 12.735 1.00 159.94 ? -29  DC  J "O3'" 1 
ATOM   9943  C  "C2'" . DC  J 6 44  ? 12.042  -37.100 14.565 1.00 167.43 ? -29  DC  J "C2'" 1 
ATOM   9944  C  "C1'" . DC  J 6 44  ? 10.751  -36.386 14.162 1.00 169.88 ? -29  DC  J "C1'" 1 
ATOM   9945  N  N1    . DC  J 6 44  ? 9.724   -36.321 15.225 1.00 163.73 ? -29  DC  J N1    1 
ATOM   9946  C  C2    . DC  J 6 44  ? 9.319   -35.068 15.704 1.00 163.28 ? -29  DC  J C2    1 
ATOM   9947  O  O2    . DC  J 6 44  ? 9.823   -34.046 15.215 1.00 159.93 ? -29  DC  J O2    1 
ATOM   9948  N  N3    . DC  J 6 44  ? 8.384   -35.002 16.681 1.00 154.46 ? -29  DC  J N3    1 
ATOM   9949  C  C4    . DC  J 6 44  ? 7.866   -36.125 17.183 1.00 157.29 ? -29  DC  J C4    1 
ATOM   9950  N  N4    . DC  J 6 44  ? 6.948   -36.014 18.144 1.00 162.15 ? -29  DC  J N4    1 
ATOM   9951  C  C5    . DC  J 6 44  ? 8.262   -37.413 16.716 1.00 156.90 ? -29  DC  J C5    1 
ATOM   9952  C  C6    . DC  J 6 44  ? 9.189   -37.464 15.750 1.00 154.63 ? -29  DC  J C6    1 
ATOM   9953  P  P     . DT  J 6 45  ? 15.148  -37.152 13.324 1.00 162.48 ? -28  DT  J P     1 
ATOM   9954  O  OP1   . DT  J 6 45  ? 16.134  -36.808 12.270 1.00 159.15 ? -28  DT  J OP1   1 
ATOM   9955  O  OP2   . DT  J 6 45  ? 15.174  -38.496 13.959 1.00 158.41 ? -28  DT  J OP2   1 
ATOM   9956  O  "O5'" . DT  J 6 45  ? 15.294  -36.025 14.437 1.00 148.51 ? -28  DT  J "O5'" 1 
ATOM   9957  C  "C5'" . DT  J 6 45  ? 15.190  -34.638 14.080 1.00 143.75 ? -28  DT  J "C5'" 1 
ATOM   9958  C  "C4'" . DT  J 6 45  ? 15.095  -33.790 15.325 1.00 142.87 ? -28  DT  J "C4'" 1 
ATOM   9959  O  "O4'" . DT  J 6 45  ? 13.861  -34.077 16.030 1.00 147.34 ? -28  DT  J "O4'" 1 
ATOM   9960  C  "C3'" . DT  J 6 45  ? 16.226  -34.003 16.337 1.00 145.92 ? -28  DT  J "C3'" 1 
ATOM   9961  O  "O3'" . DT  J 6 45  ? 16.743  -32.726 16.724 1.00 150.72 ? -28  DT  J "O3'" 1 
ATOM   9962  C  "C2'" . DT  J 6 45  ? 15.543  -34.711 17.496 1.00 151.65 ? -28  DT  J "C2'" 1 
ATOM   9963  C  "C1'" . DT  J 6 45  ? 14.143  -34.132 17.417 1.00 156.74 ? -28  DT  J "C1'" 1 
ATOM   9964  N  N1    . DT  J 6 45  ? 13.056  -34.893 18.086 1.00 165.04 ? -28  DT  J N1    1 
ATOM   9965  C  C2    . DT  J 6 45  ? 11.923  -34.206 18.464 1.00 161.49 ? -28  DT  J C2    1 
ATOM   9966  O  O2    . DT  J 6 45  ? 11.772  -33.010 18.272 1.00 152.21 ? -28  DT  J O2    1 
ATOM   9967  N  N3    . DT  J 6 45  ? 10.965  -34.976 19.075 1.00 162.13 ? -28  DT  J N3    1 
ATOM   9968  C  C4    . DT  J 6 45  ? 11.028  -36.331 19.345 1.00 160.40 ? -28  DT  J C4    1 
ATOM   9969  O  O4    . DT  J 6 45  ? 10.084  -36.889 19.898 1.00 142.12 ? -28  DT  J O4    1 
ATOM   9970  C  C5    . DT  J 6 45  ? 12.247  -36.986 18.927 1.00 166.74 ? -28  DT  J C5    1 
ATOM   9971  C  C7    . DT  J 6 45  ? 12.405  -38.454 19.173 1.00 161.06 ? -28  DT  J C7    1 
ATOM   9972  C  C6    . DT  J 6 45  ? 13.187  -36.244 18.328 1.00 169.04 ? -28  DT  J C6    1 
ATOM   9973  P  P     . DG  J 6 46  ? 18.205  -32.585 17.381 1.00 159.91 ? -27  DG  J P     1 
ATOM   9974  O  OP1   . DG  J 6 46  ? 19.191  -32.486 16.279 1.00 167.03 ? -27  DG  J OP1   1 
ATOM   9975  O  OP2   . DG  J 6 46  ? 18.365  -33.643 18.418 1.00 133.14 ? -27  DG  J OP2   1 
ATOM   9976  O  "O5'" . DG  J 6 46  ? 18.141  -31.158 18.094 1.00 165.77 ? -27  DG  J "O5'" 1 
ATOM   9977  C  "C5'" . DG  J 6 46  ? 17.541  -30.015 17.437 1.00 160.86 ? -27  DG  J "C5'" 1 
ATOM   9978  C  "C4'" . DG  J 6 46  ? 16.901  -29.070 18.435 1.00 152.66 ? -27  DG  J "C4'" 1 
ATOM   9979  O  "O4'" . DG  J 6 46  ? 15.749  -29.687 19.072 1.00 147.01 ? -27  DG  J "O4'" 1 
ATOM   9980  C  "C3'" . DG  J 6 46  ? 17.780  -28.597 19.579 1.00 152.08 ? -27  DG  J "C3'" 1 
ATOM   9981  O  "O3'" . DG  J 6 46  ? 17.349  -27.291 19.924 1.00 157.55 ? -27  DG  J "O3'" 1 
ATOM   9982  C  "C2'" . DG  J 6 46  ? 17.500  -29.621 20.674 1.00 147.08 ? -27  DG  J "C2'" 1 
ATOM   9983  C  "C1'" . DG  J 6 46  ? 16.021  -29.930 20.443 1.00 150.81 ? -27  DG  J "C1'" 1 
ATOM   9984  N  N9    . DG  J 6 46  ? 15.680  -31.322 20.717 1.00 159.32 ? -27  DG  J N9    1 
ATOM   9985  C  C8    . DG  J 6 46  ? 16.372  -32.427 20.287 1.00 174.89 ? -27  DG  J C8    1 
ATOM   9986  N  N7    . DG  J 6 46  ? 15.823  -33.552 20.655 1.00 174.72 ? -27  DG  J N7    1 
ATOM   9987  C  C5    . DG  J 6 46  ? 14.694  -33.166 21.364 1.00 163.92 ? -27  DG  J C5    1 
ATOM   9988  C  C6    . DG  J 6 46  ? 13.705  -33.950 22.007 1.00 158.15 ? -27  DG  J C6    1 
ATOM   9989  O  O6    . DG  J 6 46  ? 13.618  -35.181 22.071 1.00 153.08 ? -27  DG  J O6    1 
ATOM   9990  N  N1    . DG  J 6 46  ? 12.738  -33.155 22.612 1.00 163.57 ? -27  DG  J N1    1 
ATOM   9991  C  C2    . DG  J 6 46  ? 12.725  -31.781 22.598 1.00 168.30 ? -27  DG  J C2    1 
ATOM   9992  N  N2    . DG  J 6 46  ? 11.704  -31.193 23.235 1.00 176.01 ? -27  DG  J N2    1 
ATOM   9993  N  N3    . DG  J 6 46  ? 13.642  -31.038 22.000 1.00 158.46 ? -27  DG  J N3    1 
ATOM   9994  C  C4    . DG  J 6 46  ? 14.590  -31.792 21.407 1.00 158.53 ? -27  DG  J C4    1 
ATOM   9995  P  P     . DC  J 6 47  ? 18.247  -26.374 20.866 1.00 163.05 ? -26  DC  J P     1 
ATOM   9996  O  OP1   . DC  J 6 47  ? 17.948  -24.954 20.547 1.00 155.54 ? -26  DC  J OP1   1 
ATOM   9997  O  OP2   . DC  J 6 47  ? 19.643  -26.877 20.817 1.00 158.86 ? -26  DC  J OP2   1 
ATOM   9998  O  "O5'" . DC  J 6 47  ? 17.684  -26.695 22.318 1.00 163.23 ? -26  DC  J "O5'" 1 
ATOM   9999  C  "C5'" . DC  J 6 47  ? 16.275  -26.625 22.603 1.00 146.34 ? -26  DC  J "C5'" 1 
ATOM   10000 C  "C4'" . DC  J 6 47  ? 16.016  -27.166 23.983 1.00 130.32 ? -26  DC  J "C4'" 1 
ATOM   10001 O  "O4'" . DC  J 6 47  ? 15.725  -28.592 23.905 1.00 132.21 ? -26  DC  J "O4'" 1 
ATOM   10002 C  "C3'" . DC  J 6 47  ? 17.182  -27.047 24.967 1.00 125.64 ? -26  DC  J "C3'" 1 
ATOM   10003 O  "O3'" . DC  J 6 47  ? 16.682  -26.723 26.256 1.00 128.22 ? -26  DC  J "O3'" 1 
ATOM   10004 C  "C2'" . DC  J 6 47  ? 17.712  -28.474 25.031 1.00 126.59 ? -26  DC  J "C2'" 1 
ATOM   10005 C  "C1'" . DC  J 6 47  ? 16.394  -29.233 24.969 1.00 136.61 ? -26  DC  J "C1'" 1 
ATOM   10006 N  N1    . DC  J 6 47  ? 16.452  -30.680 24.714 1.00 142.68 ? -26  DC  J N1    1 
ATOM   10007 C  C2    . DC  J 6 47  ? 15.608  -31.520 25.449 1.00 149.30 ? -26  DC  J C2    1 
ATOM   10008 O  O2    . DC  J 6 47  ? 14.837  -31.019 26.280 1.00 150.56 ? -26  DC  J O2    1 
ATOM   10009 N  N3    . DC  J 6 47  ? 15.642  -32.853 25.225 1.00 154.69 ? -26  DC  J N3    1 
ATOM   10010 C  C4    . DC  J 6 47  ? 16.485  -33.354 24.319 1.00 162.18 ? -26  DC  J C4    1 
ATOM   10011 N  N4    . DC  J 6 47  ? 16.489  -34.675 24.133 1.00 174.91 ? -26  DC  J N4    1 
ATOM   10012 C  C5    . DC  J 6 47  ? 17.363  -32.523 23.565 1.00 156.61 ? -26  DC  J C5    1 
ATOM   10013 C  C6    . DC  J 6 47  ? 17.313  -31.204 23.791 1.00 146.99 ? -26  DC  J C6    1 
ATOM   10014 P  P     . DT  J 6 48  ? 16.911  -25.275 26.878 1.00 134.23 ? -25  DT  J P     1 
ATOM   10015 O  OP1   . DT  J 6 48  ? 16.631  -24.265 25.820 1.00 123.57 ? -25  DT  J OP1   1 
ATOM   10016 O  OP2   . DT  J 6 48  ? 18.212  -25.288 27.594 1.00 125.52 ? -25  DT  J OP2   1 
ATOM   10017 O  "O5'" . DT  J 6 48  ? 15.778  -25.174 27.994 1.00 142.36 ? -25  DT  J "O5'" 1 
ATOM   10018 C  "C5'" . DT  J 6 48  ? 14.389  -24.995 27.644 1.00 136.85 ? -25  DT  J "C5'" 1 
ATOM   10019 C  "C4'" . DT  J 6 48  ? 13.513  -25.878 28.502 1.00 122.70 ? -25  DT  J "C4'" 1 
ATOM   10020 O  "O4'" . DT  J 6 48  ? 13.831  -27.270 28.264 1.00 118.70 ? -25  DT  J "O4'" 1 
ATOM   10021 C  "C3'" . DT  J 6 48  ? 13.660  -25.674 30.015 1.00 115.81 ? -25  DT  J "C3'" 1 
ATOM   10022 O  "O3'" . DT  J 6 48  ? 12.353  -25.760 30.590 1.00 115.02 ? -25  DT  J "O3'" 1 
ATOM   10023 C  "C2'" . DT  J 6 48  ? 14.501  -26.861 30.448 1.00 111.96 ? -25  DT  J "C2'" 1 
ATOM   10024 C  "C1'" . DT  J 6 48  ? 13.925  -27.911 29.523 1.00 121.12 ? -25  DT  J "C1'" 1 
ATOM   10025 N  N1    . DT  J 6 48  ? 14.679  -29.161 29.347 1.00 120.27 ? -25  DT  J N1    1 
ATOM   10026 C  C2    . DT  J 6 48  ? 14.022  -30.340 29.620 1.00 134.63 ? -25  DT  J C2    1 
ATOM   10027 O  O2    . DT  J 6 48  ? 12.873  -30.384 30.031 1.00 144.99 ? -25  DT  J O2    1 
ATOM   10028 N  N3    . DT  J 6 48  ? 14.768  -31.472 29.407 1.00 135.39 ? -25  DT  J N3    1 
ATOM   10029 C  C4    . DT  J 6 48  ? 16.070  -31.540 28.951 1.00 136.32 ? -25  DT  J C4    1 
ATOM   10030 O  O4    . DT  J 6 48  ? 16.611  -32.632 28.806 1.00 151.32 ? -25  DT  J O4    1 
ATOM   10031 C  C5    . DT  J 6 48  ? 16.694  -30.267 28.676 1.00 129.10 ? -25  DT  J C5    1 
ATOM   10032 C  C7    . DT  J 6 48  ? 18.104  -30.244 28.181 1.00 131.16 ? -25  DT  J C7    1 
ATOM   10033 C  C6    . DT  J 6 48  ? 15.976  -29.155 28.882 1.00 121.44 ? -25  DT  J C6    1 
ATOM   10034 P  P     . DC  J 6 49  ? 12.065  -25.206 32.069 1.00 117.08 ? -24  DC  J P     1 
ATOM   10035 O  OP1   . DC  J 6 49  ? 10.753  -24.507 32.042 1.00 109.10 ? -24  DC  J OP1   1 
ATOM   10036 O  OP2   . DC  J 6 49  ? 13.289  -24.515 32.581 1.00 102.62 ? -24  DC  J OP2   1 
ATOM   10037 O  "O5'" . DC  J 6 49  ? 11.914  -26.531 32.939 1.00 118.17 ? -24  DC  J "O5'" 1 
ATO