data_5DNN
# 
_entry.id   5DNN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DNN         
WWPDB D_1000213492 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5DNM 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DNN 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adhireksan, Z.' 1 
'Ma, Z.'         2 
'Davey, C.A.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                14860 
_citation.page_last                 14860 
_citation.title                     'Allosteric cross-talk in chromatin can mediate drug-drug synergy' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms14860 
_citation.pdbx_database_id_PubMed   28358030 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Adhireksan, Z.'    1 
primary 'Palermo, G.'       2 
primary 'Riedel, T.'        3 
primary 'Ma, Z.'            4 
primary 'Muhammad, R.'      5 
primary 'Rothlisberger, U.' 6 
primary 'Dyson, P.J.'       7 
primary 'Davey, C.A.'       8 
# 
_cell.entry_id           5DNN 
_cell.length_a           106.726 
_cell.length_b           109.948 
_cell.length_c           182.041 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5DNN 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.2' 15303.930 2 ? ? ? ? 
2  polymer     man 'Histone H4' 11263.231 2 ? ? ? ? 
3  polymer     man 'Histone H2A' 13907.163 2 ? ? ? ? 
4  polymer     man 'Histone H2B 1.1' 13848.097 2 ? ? ? ? 
5  polymer     syn 'DNA (145-MER)' 44749.664 1 ? ? ? ? 
6  polymer     syn 'DNA (145-MER)' 44740.648 1 ? ? ? ? 
7  non-polymer syn 'triethylphosphanuidylgold(1+)' 315.124   2 ? ? ? ? 
8  non-polymer syn 'SULFATE ION' 96.063    3 ? ? ? ? 
9  non-polymer syn 'MAGNESIUM ION' 24.305    1 ? ? ? ? 
10 non-polymer syn 
'dichloro[(1,2,3,4,5,6-eta)-6-methylbenzene]1,3,5-triaza-7lambda~5~-phosphatricyclo[3.3.1.1~3,7~]dec-7-ylruthenium' 421.268   2 ? 
? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 LYS n 
3 127 SER n 
3 128 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 128 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 125 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 145 'synthetic construct' ? 32630 ? 
6 1 sample 1 145 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
4 UNP H2B11_XENLA  P02281 ? 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 
5 PDB 5DNN         5DNN   ? 5 ? 1 
6 PDB 5DNN         5DNN   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5DNN A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 5DNN B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 5DNN C 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
4  4 5DNN D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 5DNN E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 5DNN F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 5DNN G 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
8  4 5DNN H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 5DNN I 1 ? 145 ? 5DNN   -72 ? 72  ? -72 72  
10 6 5DNN J 1 ? 145 ? 5DNN   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DNN ALA A 102 ? UNP P84233 GLY 103 variant  102 1 
3 5DNN ?   C ?   ? UNP Q6AZJ8 ALA 127 deletion ?   2 
4 5DNN THR D 32  ? UNP P02281 SER 33  variant  29  3 
5 5DNN ALA E 102 ? UNP P84233 GLY 103 variant  102 4 
7 5DNN ?   G ?   ? UNP Q6AZJ8 ALA 127 deletion ?   5 
8 5DNN THR H 32  ? UNP P02281 SER 33  variant  29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                           'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE ?                           'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                           'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                           'C4 H7 N O4'          133.103 
AUF non-polymer         . 'triethylphosphanuidylgold(1+)' 'gold(I)-triethylphosphane' 'C6 H15 Au P'         315.124 
CYS 'L-peptide linking' y CYSTEINE ?                           'C3 H7 N O2 S'        121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                           'C10 H14 N5 O6 P'     331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                           'C9 H14 N3 O7 P'      307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                           'C10 H14 N5 O7 P'     347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                           'C10 H15 N2 O8 P'     322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                           'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                           'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE ?                           'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE ?                           'C6 H10 N3 O2 1'      156.162 
ILE 'L-peptide linking' y ISOLEUCINE ?                           'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE ?                           'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE ?                           'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE ?                           'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                           'Mg 2'                24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?                           'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE ?                           'C5 H9 N O2'          115.130 
RAX non-polymer         . 
'dichloro[(1,2,3,4,5,6-eta)-6-methylbenzene]1,3,5-triaza-7lambda~5~-phosphatricyclo[3.3.1.1~3,7~]dec-7-ylruthenium' ? 
'C13 H20 Cl2 N3 P Ru' 421.268 
SER 'L-peptide linking' y SERINE ?                           'C3 H7 N O3'          105.093 
SO4 non-polymer         . 'SULFATE ION' ?                           'O4 S -2'             96.063  
THR 'L-peptide linking' y THREONINE ?                           'C4 H9 N O3'          119.119 
TYR 'L-peptide linking' y TYROSINE ?                           'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE ?                           'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DNN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.70 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.36 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '40 mM MnCl2, 30 mM KCl, 20 mM K-Cacodylate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-09-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DNN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.80 
_reflns.d_resolution_low                 48.87 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       51082 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.0 
_reflns.pdbx_Rmerge_I_obs                0.037 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            23.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.80 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        76.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.433 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5DNN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     48472 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.87 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    95.58 
_refine.ls_R_factor_obs                          0.21574 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21463 
_refine.ls_R_factor_R_free                       0.23648 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2553 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.948 
_refine.B_iso_mean                               98.672 
_refine.aniso_B[1][1]                            1.55 
_refine.aniso_B[2][2]                            -3.93 
_refine.aniso_B[3][3]                            2.38 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      5DNM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       6.830 
_refine.pdbx_overall_ESU_R_Free                  0.342 
_refine.overall_SU_ML                            0.277 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             14.221 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         68 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12093 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        48.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.015  ? 12907 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.459  1.661  ? 18716 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.145  5.000  ? 757   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.478 21.255 ? 271   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.024 15.000 ? 1183  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.173 15.000 ? 86    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.107  0.200  ? 1836  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 7619  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.802 
_refine_ls_shell.d_res_low                        2.875 
_refine_ls_shell.number_reflns_R_work             2481 
_refine_ls_shell.R_factor_R_work                  0.373 
_refine_ls_shell.percent_reflns_obs               69.09 
_refine_ls_shell.R_factor_R_free                  0.405 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             123 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5DNN 
_struct.title                        
'Nucleosome core particle containing adducts of gold(I)-triethylphosphane and ruthenium(II)-toluene PTA complexes' 
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DNN 
_struct_keywords.text            
'nucleosome, gold antitumour compound, ruthenium antitumour compound, histone binding, STRUCTURAL PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 3  ? 
H N N 4  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 9  ? 
N N N 7  ? 
O N N 8  ? 
P N N 10 ? 
Q N N 8  ? 
R N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASP B 24  ? ILE B 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  AA6 THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 ALA C 45  ? ASN C 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 AB3 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO D 103 ? SER D 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 AC1 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 AC6 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 AD3 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 AD4 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO H 103 ? ALA H 124 ? PRO H 100 ALA H 121 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A HIS 113 ND1 ? ? ? 1_555 K AUF .   AU1 ? ? A HIS 113 A AUF 201  1_555 ? ? ? ? ? ? ?               2.086 ? 
metalc2   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 M MG  .   MG  ? ? E ASP 77  E MG  1001 1_555 ? ? ? ? ? ? ?               2.102 ? 
metalc3   metalc ? ? E HIS 113 ND1 ? ? ? 1_555 N AUF .   AU1 ? ? E HIS 113 E AUF 1002 1_555 ? ? ? ? ? ? ?               2.139 ? 
metalc4   metalc ? ? G GLU 61  OE2 ? ? ? 1_555 P RAX .   RU  ? ? G GLU 61  G RAX 202  1_555 ? ? ? ? ? ? ?               2.578 ? 
metalc5   metalc ? ? G GLU 64  OE1 ? ? ? 1_555 P RAX .   RU  ? ? G GLU 64  G RAX 202  1_555 ? ? ? ? ? ? ?               2.429 ? 
metalc6   metalc ? ? H HIS 109 NE2 ? ? ? 1_555 R RAX .   RU  ? ? H HIS 106 H RAX 202  1_555 ? ? ? ? ? ? ?               2.326 ? 
metalc7   metalc ? ? D VAL 48  O   ? ? ? 1_555 M MG  .   MG  ? ? D VAL 45  E MG  1001 3_555 ? ? ? ? ? ? ?               2.413 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT  145 N3  ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT  145 O4  ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA  144 N1  ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA  144 N6  ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG  143 N2  ? ? I DC  -70 J DG  70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog6   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT  142 N3  ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J DT  142 O4  ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT  141 N3  ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  5   N6  ? ? ? 1_555 J DT  141 O4  ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA  140 N1  ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA  140 N6  ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT  139 N3  ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT  139 O4  ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA  138 N1  ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA  138 N6  ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  137 N1  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  137 O6  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  137 N2  ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  136 N1  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG  136 O6  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  136 N2  ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT  135 N3  ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J DT  135 O4  ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J DG  134 N2  ? ? I DC  -61 J DG  61   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog25  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG  133 N2  ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog26  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA  132 N1  ? ? I DT  -59 J DA  59   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog27  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC  131 N3  ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J DC  131 O2  ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J DC  131 N4  ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG  130 N1  ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG  130 O6  ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG  130 N2  ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT  129 N3  ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J DT  129 O4  ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC  128 N3  ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J DC  128 O2  ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J DC  128 N4  ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J DT  127 N3  ? ? I DA  -54 J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT  127 O4  ? ? I DA  -54 J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J DA  126 N6  ? ? I DT  -53 J DA  53   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog41  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT  125 N3  ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT  125 O4  ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG  124 N1  ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog44  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J DA  123 N1  ? ? I DT  -50 J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J DA  123 N6  ? ? I DT  -50 J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DG  121 N1  ? ? I DA  -49 J DG  48   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog47  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DG  121 O6  ? ? I DA  -49 J DG  48   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog48  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DT  122 N3  ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DT  122 O4  ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG  121 N1  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  121 O6  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  121 N2  ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG  120 N2  ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog54  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT  119 N3  ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT  119 O4  ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT  118 N3  ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT  118 O4  ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  116 O4  ? ? I DA  -44 J DT  43   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog59  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT  117 N3  ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  117 O4  ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J DT  116 N3  ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J DT  116 O4  ? ? I DA  -43 J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DG  31  N1  ? ? ? 1_555 J DC  115 N3  ? ? I DG  -42 J DC  42   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog64  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J DA  114 N1  ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J DA  114 N6  ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC  113 N3  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J DC  113 O2  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J DC  113 N4  ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA  112 N1  ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA  112 N6  ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J DT  111 N3  ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT  111 O4  ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J DA  110 N1  ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J DA  110 N6  ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA  109 N1  ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  109 N6  ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA  108 N1  ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DA  108 N6  ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC  106 N3  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC  106 O2  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J DC  106 N4  ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC  107 O2  ? ? I DG  -33 J DC  34   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog83  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J DT  105 N3  ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J DT  105 O4  ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT  104 N3  ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J DT  104 O4  ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT  103 N3  ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT  103 O4  ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG  102 N2  ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog90  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  101 N1  ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  101 N6  ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J DC  100 N3  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC  100 O2  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J DC  100 N4  ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG  99  N1  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG  99  O6  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG  99  N2  ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA  98  N1  ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DT  48  O4  ? ? ? 1_555 J DA  98  N6  ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG  97  N1  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG  97  O6  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG  97  N2  ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  50  N3  ? ? ? 1_555 J DG  96  N1  ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DC  50  N4  ? ? ? 1_555 J DG  96  O6  ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DC  50  O2  ? ? ? 1_555 J DG  96  N2  ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT  95  N3  ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J DT  95  O4  ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J DA  94  N1  ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DA  94  N6  ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG  93  N1  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG  93  O6  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG  93  N2  ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DT  92  N3  ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DT  92  O4  ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J DT  91  N3  ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J DT  91  O4  ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  89  O4  ? ? I DA  -17 J DT  16   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog118 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT  90  N3  ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  90  O4  ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J DT  89  N3  ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J DT  89  O4  ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  87  N3  ? ? I DG  -15 J DC  14   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog123 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  88  N3  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J DC  88  O2  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J DC  88  N4  ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J DG  86  O6  ? ? I DG  -14 J DG  13   1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog127 hydrog ? ? I DC  60  N4  ? ? ? 1_555 J DT  85  O4  ? ? I DC  -13 J DT  12   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog128 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J DG  86  N1  ? ? I DC  -13 J DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog129 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DA  84  N1  ? ? I DA  -12 J DA  11   1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     ? 
hydrog130 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT  85  N3  ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT  85  O4  ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J DA  84  N1  ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J DA  84  N6  ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC  83  N3  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC  83  O2  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC  83  N4  ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J DA  82  N1  ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J DA  82  N6  ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J DA  81  N1  ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J DA  81  N6  ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J DG  80  N1  ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J DG  80  O6  ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J DG  80  N2  ? ? I DC  -7  J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J DT  79  N3  ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J DT  79  O4  ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC  78  N3  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC  78  O2  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC  78  N4  ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG  77  N1  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG  77  O6  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG  77  N2  ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J DA  76  N1  ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J DA  76  N6  ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J DC  75  N3  ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J DC  75  O2  ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J DC  75  N4  ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT  74  N3  ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT  74  O4  ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT  73  N3  ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT  73  O4  ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA  72  N1  ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA  72  N6  ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG  71  N1  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG  71  O6  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG  71  N2  ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J DT  70  N3  ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J DT  70  O4  ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC  69  N3  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J DC  69  O2  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J DC  69  N4  ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG  68  N1  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG  68  O6  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG  68  N2  ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA  67  N1  ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA  67  N6  ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J DC  66  N3  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC  66  O2  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J DC  66  N4  ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J DT  65  N3  ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J DT  65  O4  ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT  64  N3  ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J DT  64  O4  ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  63  N1  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  63  O6  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  63  N2  ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J DT  62  N3  ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J DT  62  O4  ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA  61  N1  ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA  61  N6  ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC  60  N3  ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC  60  O2  ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC  60  N4  ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG  59  N1  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG  59  O6  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG  59  N2  ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J DG  58  N2  ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog197 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA  57  N1  ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA  57  N6  ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J DA  56  N1  ? ? I DT  17  J DA  -17  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog200 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J DA  55  N1  ? ? I DT  18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DT  91  O4  ? ? ? 1_555 J DA  55  N6  ? ? I DT  18  J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J DA  54  N1  ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J DA  54  N6  ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J DA  54  N1  ? ? I DG  20  J DA  -19  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog205 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J DA  54  N6  ? ? I DG  20  J DA  -19  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog206 hydrog ? ? I DG  96  N1  ? ? ? 1_555 J DC  50  N3  ? ? I DG  23  J DC  -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog207 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DT  48  O4  ? ? I DG  24  J DT  -25  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog208 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC  49  N3  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC  49  O2  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC  49  N4  ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DC  47  N3  ? ? I DA  25  J DC  -26  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog212 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J DT  48  N3  ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DT  48  O4  ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC  47  N3  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J DC  47  O2  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J DC  47  N4  ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J DG  46  N2  ? ? I DC  27  J DG  -27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog218 hydrog ? ? I DA  101 N1  ? ? ? 1_555 J DT  45  N3  ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DA  101 N6  ? ? ? 1_555 J DT  45  O4  ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DC  44  O2  ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog221 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA  43  N1  ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DT  103 O4  ? ? ? 1_555 J DA  43  N6  ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA  42  N1  ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DA  42  N6  ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA  41  N1  ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA  41  N6  ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DC  106 N3  ? ? ? 1_555 J DG  40  N1  ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DC  106 N4  ? ? ? 1_555 J DG  40  O6  ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J DG  40  N2  ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DG  39  N1  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J DG  39  O6  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG  39  N2  ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J DT  38  N3  ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT  38  O4  ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT  37  N3  ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT  37  O4  ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT  36  N3  ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT  36  O4  ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA  35  N1  ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog240 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT  34  N3  ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT  34  O4  ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG  33  N1  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG  33  O6  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG  33  N2  ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DT  32  N3  ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DT  32  O4  ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG  31  N1  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG  31  O6  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG  31  N2  ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DA  30  N1  ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J DA  30  N6  ? ? I DT  43  J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA  28  N6  ? ? I DT  44  J DA  -45  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog253 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA  29  N1  ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA  29  N6  ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  27  N6  ? ? I DT  45  J DA  -46  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog256 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA  28  N1  ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  28  N6  ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J DC  26  N4  ? ? I DT  46  J DC  -47  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog259 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J DA  27  N1  ? ? I DT  46  J DA  -46  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog260 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC  26  N3  ? ? I DG  47  J DC  -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog261 hydrog ? ? I DG  121 N1  ? ? ? 1_555 J DA  24  N1  ? ? I DG  48  J DA  -49  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog262 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DA  24  N6  ? ? I DG  48  J DA  -49  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog263 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC  25  O2  ? ? I DG  48  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog264 hydrog ? ? I DA  123 N6  ? ? ? 1_555 J DC  22  N3  ? ? I DA  50  J DC  -51  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog265 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT  23  N3  ? ? I DA  50  J DT  -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog266 hydrog ? ? I DG  124 N1  ? ? ? 1_555 J DA  21  N1  ? ? I DG  51  J DA  -52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog267 hydrog ? ? I DG  124 O6  ? ? ? 1_555 J DA  21  N6  ? ? I DG  51  J DA  -52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog268 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA  19  N1  ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J DA  19  N6  ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG  18  N1  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG  18  O6  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG  18  N2  ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J DA  17  N1  ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J DA  17  N6  ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC  16  N3  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC  16  O2  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC  16  N4  ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J DG  15  N1  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J DG  15  O6  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG  15  N2  ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT  14  N3  ? ? I DA  59  J DT  -59  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog282 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J DC  13  N3  ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DG  133 N2  ? ? ? 1_555 J DC  13  O2  ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DG  133 O6  ? ? ? 1_555 J DC  13  N4  ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC  12  N3  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC  12  O2  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC  12  N4  ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA  11  N1  ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J DA  11  N6  ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC  10  N3  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC  10  O2  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC  10  N4  ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC  9   N3  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC  9   O2  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC  9   N4  ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT  8   N3  ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT  8   O4  ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA  7   N1  ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA  7   N6  ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT  6   N3  ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT  6   O4  ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA  5   N1  ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA  5   N6  ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA  4   N1  ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA  4   N6  ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC  3   N3  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC  3   O2  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC  3   N4  ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  2   N3  ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  2   O4  ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA  1   N1  ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA  1   N6  ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
AA1 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
AA2 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
AA2 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
AA3 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
AA3 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA4 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA4 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
AA5 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
AA5 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
AA6 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
AA6 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
AA7 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
AA7 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
AA8 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
AA8 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
AA9 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA9 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
AB1 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AB1 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
AA2 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
AA3 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
AA4 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
AA5 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
AA6 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
AA7 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
AA8 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
AA9 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
AB1 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A AUF 201  ? 2 'binding site for residue AUF A 201'  
AC2 Software C SO4 1101 ? 6 'binding site for residue SO4 C 1101' 
AC3 Software E MG  1001 ? 2 'binding site for residue MG E 1001'  
AC4 Software E AUF 1002 ? 2 'binding site for residue AUF E 1002' 
AC5 Software G SO4 201  ? 7 'binding site for residue SO4 G 201'  
AC6 Software G RAX 202  ? 3 'binding site for residue RAX G 202'  
AC7 Software H SO4 201  ? 4 'binding site for residue SO4 H 201'  
AC8 Software H RAX 202  ? 3 'binding site for residue RAX H 202'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 LEU A 109 ? LEU A 109 . ? 1_555 ? 
2  AC1 2 HIS A 113 ? HIS A 113 . ? 1_555 ? 
3  AC2 6 GLY C 44  ? GLY C 44  . ? 1_555 ? 
4  AC2 6 ALA C 45  ? ALA C 45  . ? 1_555 ? 
5  AC2 6 GLY C 46  ? GLY C 46  . ? 1_555 ? 
6  AC2 6 ALA C 47  ? ALA C 47  . ? 1_555 ? 
7  AC2 6 THR D 90  ? THR D 87  . ? 1_555 ? 
8  AC2 6 SER D 91  ? SER D 88  . ? 1_555 ? 
9  AC3 2 VAL D 48  ? VAL D 45  . ? 3_545 ? 
10 AC3 2 ASP E 77  ? ASP E 77  . ? 1_555 ? 
11 AC4 2 LEU E 109 ? LEU E 109 . ? 1_555 ? 
12 AC4 2 HIS E 113 ? HIS E 113 . ? 1_555 ? 
13 AC5 7 GLY G 44  ? GLY G 44  . ? 1_555 ? 
14 AC5 7 ALA G 45  ? ALA G 45  . ? 1_555 ? 
15 AC5 7 GLY G 46  ? GLY G 46  . ? 1_555 ? 
16 AC5 7 ALA G 47  ? ALA G 47  . ? 1_555 ? 
17 AC5 7 THR H 90  ? THR H 87  . ? 1_555 ? 
18 AC5 7 SER H 91  ? SER H 88  . ? 1_555 ? 
19 AC5 7 DA  I 110 ? DA  I 37  . ? 1_555 ? 
20 AC6 3 GLU G 61  ? GLU G 61  . ? 1_555 ? 
21 AC6 3 GLU G 64  ? GLU G 64  . ? 1_555 ? 
22 AC6 3 RAX R .   ? RAX H 202 . ? 1_555 ? 
23 AC7 4 HIS H 49  ? HIS H 46  . ? 1_555 ? 
24 AC7 4 PRO H 50  ? PRO H 47  . ? 1_555 ? 
25 AC7 4 ASP H 51  ? ASP H 48  . ? 1_555 ? 
26 AC7 4 THR H 52  ? THR H 49  . ? 1_555 ? 
27 AC8 3 RAX P .   ? RAX G 202 . ? 1_555 ? 
28 AC8 3 GLU H 105 ? GLU H 102 . ? 1_555 ? 
29 AC8 3 HIS H 109 ? HIS H 106 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DNN 
_atom_sites.fract_transf_matrix[1][1]   0.009370 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009095 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005493 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AU 
C  
MG 
N  
O  
P  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1  38  ? -60.629 -29.314 80.333 1.00 129.75 ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1  38  ? -59.427 -28.722 80.928 1.00 133.30 ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1  38  ? -58.147 -29.482 80.524 1.00 140.57 ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1  38  ? -57.517 -30.125 81.372 1.00 141.58 ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1  38  ? -59.695 -28.843 82.436 1.00 121.29 ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1  38  ? -60.603 -30.027 82.571 1.00 118.64 ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1  38  ? -61.377 -30.159 81.285 1.00 122.15 ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1  39  ? -57.771 -29.400 79.243 1.00 138.54 ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1  39  ? -56.677 -30.226 78.687 1.00 133.26 ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1  39  ? -55.648 -29.453 77.898 1.00 119.06 ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1  39  ? -55.941 -28.871 76.846 1.00 103.21 ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1  39  ? -57.246 -31.387 77.864 1.00 141.74 ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1  39  ? -56.235 -32.062 76.964 1.00 141.67 ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1  39  ? -55.969 -31.620 75.715 1.00 134.93 ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1  39  ? -55.429 -33.182 77.167 1.00 135.27 ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1  39  ? -55.042 -32.412 75.149 1.00 132.54 ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1  39  ? -54.713 -33.370 76.038 1.00 136.36 ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1  40  ? -54.417 -29.482 78.399 1.00 115.95 ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1  40  ? -53.329 -28.675 77.857 1.00 109.31 ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1  40  ? -52.181 -29.579 77.395 1.00 106.51 ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1  40  ? -51.879 -30.592 78.046 1.00 108.64 ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1  40  ? -52.859 -27.689 78.931 1.00 98.90  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1  40  ? -52.066 -26.500 78.428 1.00 100.01 ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1  40  ? -51.795 -25.546 79.577 1.00 91.41  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1  40  ? -50.922 -24.441 79.187 1.00 93.91  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1  40  ? -51.321 -23.347 78.534 1.00 100.00 ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1  40  ? -52.592 -23.193 78.165 1.00 102.62 ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1  40  ? -50.441 -22.395 78.242 1.00 92.92  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1  41  ? -51.568 -29.228 76.261 1.00 100.06 ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1  41  ? -50.392 -29.955 75.761 1.00 94.12  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1  41  ? -49.083 -29.376 76.324 1.00 89.36  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1  41  ? -48.931 -28.147 76.453 1.00 92.38  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1  41  ? -50.360 -29.950 74.230 1.00 90.52  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1  41  ? -51.213 -31.004 73.545 1.00 87.35  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1  41  ? -52.186 -30.639 72.606 1.00 86.48  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1  41  ? -51.023 -32.366 73.802 1.00 86.26  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1  41  ? -52.956 -31.600 71.958 1.00 85.44  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1  41  ? -51.792 -33.333 73.162 1.00 88.31  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1  41  ? -52.756 -32.949 72.244 1.00 85.33  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1  41  ? -53.503 -33.926 71.621 1.00 84.45  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1  42  ? -48.147 -30.262 76.663 1.00 85.87  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1  42  ? -46.838 -29.854 77.201 1.00 87.75  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1  42  ? -46.048 -28.987 76.205 1.00 91.21  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1  42  ? -46.176 -29.170 74.984 1.00 86.56  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1  42  ? -46.001 -31.085 77.580 1.00 87.07  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1  42  ? -46.722 -32.127 78.422 1.00 92.41  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1  42  ? -46.667 -31.798 79.898 1.00 93.37  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1  42  ? -45.347 -32.083 80.436 1.00 94.93  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1  42  ? -45.065 -33.101 81.241 1.00 101.52 ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1  42  ? -46.022 -33.939 81.619 1.00 102.18 ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1  42  ? -43.823 -33.266 81.689 1.00 108.47 ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1  43  ? -45.218 -28.048 76.717 1.00 91.47  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  43  ? -44.355 -27.280 75.825 1.00 88.13  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  43  ? -43.553 -28.232 74.956 1.00 87.90  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1  43  ? -42.912 -29.159 75.481 1.00 81.03  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  43  ? -43.412 -26.554 76.785 1.00 86.16  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  43  ? -44.181 -26.437 78.044 1.00 89.16  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  43  ? -44.960 -27.720 78.131 1.00 93.95  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1  44  ? -43.631 -28.033 73.639 1.00 85.35  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1  44  ? -42.806 -28.796 72.704 1.00 83.28  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1  44  ? -43.511 -29.941 72.021 1.00 82.95  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1  44  ? -42.999 -30.495 71.053 1.00 90.79  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1  45  ? -44.680 -30.308 72.529 1.00 79.99  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1  45  ? -45.471 -31.349 71.908 1.00 75.89  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1  45  ? -45.984 -30.840 70.572 1.00 78.78  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1  45  ? -45.785 -31.484 69.537 1.00 81.91  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1  45  ? -46.646 -31.769 72.796 1.00 79.03  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  45  ? -46.159 -32.060 74.108 1.00 86.63  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  45  ? -47.322 -33.011 72.238 1.00 81.58  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  46  ? -46.627 -29.678 70.587 1.00 78.18  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  46  ? -47.119 -29.094 69.347 1.00 81.57  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  46  ? -45.946 -28.727 68.443 1.00 83.07  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1  46  ? -46.058 -28.817 67.222 1.00 88.32  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  46  ? -48.029 -27.866 69.577 1.00 84.51  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  46  ? -48.854 -27.576 68.332 1.00 80.22  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  46  ? -48.959 -28.107 70.753 1.00 88.04  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1  47  ? -44.822 -28.331 69.043 1.00 80.78  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1  47  ? -43.622 -27.992 68.278 1.00 76.74  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1  47  ? -43.185 -29.174 67.429 1.00 78.83  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1  47  ? -43.038 -29.050 66.212 1.00 88.83  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1  47  ? -42.502 -27.556 69.194 1.00 77.40  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1  48  ? -42.997 -30.321 68.072 1.00 74.31  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1  48  ? -42.751 -31.580 67.375 1.00 74.08  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1  48  ? -43.820 -31.931 66.330 1.00 76.06  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1  48  ? -43.511 -32.483 65.265 1.00 71.33  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1  48  ? -42.659 -32.695 68.399 1.00 72.55  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1  48  ? -41.278 -33.094 68.913 1.00 80.26  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1  48  ? -40.126 -32.299 68.316 1.00 80.86  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1  48  ? -41.289 -32.984 70.430 1.00 83.57  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1  49  ? -45.075 -31.614 66.644 1.00 76.58  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1  49  ? -46.182 -31.989 65.785 1.00 77.33  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1  49  ? -46.049 -31.218 64.490 1.00 75.94  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1  49  ? -46.166 -31.789 63.398 1.00 78.30  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1  49  ? -47.523 -31.711 66.476 1.00 79.00  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1  49  ? -48.739 -32.328 65.788 1.00 80.74  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1  49  ? -49.797 -32.838 66.773 1.00 84.49  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1  49  ? -50.566 -31.767 67.404 1.00 85.40  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1  49  ? -50.670 -31.586 68.721 1.00 84.19  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1  49  ? -50.069 -32.420 69.576 1.00 74.50  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1  49  ? -51.391 -30.568 69.183 1.00 84.62  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1  50  ? -45.772 -29.924 64.629 1.00 71.21  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  50  ? -45.595 -29.037 63.489 1.00 71.06  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  50  ? -44.377 -29.406 62.644 1.00 73.44  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1  50  ? -44.449 -29.375 61.410 1.00 79.29  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  50  ? -45.489 -27.591 63.940 1.00 70.01  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  50  ? -46.786 -27.000 64.439 1.00 73.55  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  50  ? -46.625 -25.680 65.176 1.00 76.81  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  50  ? -45.596 -24.976 65.033 1.00 79.21  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  50  ? -47.565 -25.333 65.912 1.00 82.61  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1  51  ? -43.265 -29.762 63.285 1.00 65.56  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1  51  ? -42.104 -30.216 62.523 1.00 66.63  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1  51  ? -42.528 -31.326 61.566 1.00 67.85  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1  51  ? -42.233 -31.278 60.368 1.00 70.88  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1  51  ? -40.933 -30.672 63.423 1.00 64.22  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1  51  ? -40.305 -29.473 64.120 1.00 64.89  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1  51  ? -39.860 -31.390 62.625 1.00 58.35  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1  51  ? -39.658 -29.810 65.453 1.00 66.02  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1  52  ? -43.255 -32.303 62.095 1.00 70.38  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  52  ? -43.671 -33.447 61.297 1.00 71.02  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  52  ? -44.590 -33.007 60.164 1.00 70.69  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1  52  ? -44.389 -33.383 59.004 1.00 69.74  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  52  ? -44.286 -34.535 62.187 1.00 69.69  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  52  ? -43.240 -35.117 63.131 1.00 78.65  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  52  ? -43.618 -36.419 63.820 1.00 82.49  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  52  ? -42.488 -36.916 64.622 1.00 89.82  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  52  ? -42.355 -36.779 65.945 1.00 87.25  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  52  ? -43.285 -36.161 66.665 1.00 79.13  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  52  ? -41.278 -37.272 66.553 1.00 87.14  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1  53  ? -45.569 -32.178 60.505 1.00 70.34  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1  53  ? -46.496 -31.656 59.529 1.00 71.54  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1  53  ? -45.740 -30.937 58.418 1.00 75.04  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1  53  ? -45.840 -31.296 57.240 1.00 77.63  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1  53  ? -47.478 -30.705 60.205 1.00 74.98  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1  53  ? -48.485 -30.098 59.253 1.00 77.26  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1  53  ? -49.299 -29.042 59.963 1.00 84.44  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1  53  ? -50.146 -28.325 59.011 1.00 96.72  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1  53  ? -50.670 -27.115 59.217 1.00 100.93 ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1  53  ? -50.431 -26.457 60.347 1.00 103.45 ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1  53  ? -51.433 -26.550 58.289 1.00 101.88 ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1  54  ? -44.951 -29.941 58.793 1.00 71.70  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1  54  ? -44.318 -29.115 57.783 1.00 70.29  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1  54  ? -43.216 -29.814 56.989 1.00 69.59  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1  54  ? -42.970 -29.454 55.826 1.00 69.31  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1  54  ? -43.879 -27.784 58.375 1.00 68.49  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1  54  ? -45.070 -26.933 58.746 1.00 69.53  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1  54  ? -45.407 -26.697 60.084 1.00 69.99  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1  54  ? -45.885 -26.387 57.758 1.00 71.72  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1  54  ? -46.507 -25.918 60.426 1.00 71.61  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1  54  ? -46.988 -25.617 58.090 1.00 75.90  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1  54  ? -47.295 -25.383 59.421 1.00 74.94  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1  54  ? -48.395 -24.618 59.738 1.00 77.50  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1  55  ? -42.588 -30.828 57.590 1.00 63.83  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1  55  ? -41.561 -31.578 56.887 1.00 62.95  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1  55  ? -42.198 -32.474 55.858 1.00 64.81  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1  55  ? -41.542 -32.937 54.931 1.00 73.26  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1  55  ? -40.641 -32.329 57.850 1.00 62.91  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1  55  ? -39.620 -31.386 58.477 1.00 68.61  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1  55  ? -38.485 -32.054 59.232 1.00 72.07  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1  55  ? -38.499 -33.254 59.511 1.00 73.01  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1  55  ? -37.488 -31.257 59.579 1.00 73.09  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1  56  ? -43.500 -32.674 56.004 1.00 68.37  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1  56  ? -44.229 -33.568 55.131 1.00 71.15  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1  56  ? -44.814 -32.823 53.948 1.00 72.87  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1  56  ? -44.886 -33.389 52.851 1.00 74.08  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1  56  ? -45.322 -34.309 55.902 1.00 78.89  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1  56  ? -45.259 -35.827 55.729 1.00 93.69  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1  56  ? -45.406 -36.528 57.084 1.00 108.62 ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1  56  ? -44.352 -37.624 57.291 1.00 113.37 ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1  56  ? -44.192 -38.001 58.731 1.00 105.77 ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1  57  ? -45.225 -31.567 54.158 1.00 67.35  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1  57  ? -45.792 -30.777 53.068 1.00 66.62  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1  57  ? -44.746 -30.004 52.268 1.00 70.65  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1  57  ? -43.550 -30.019 52.595 1.00 76.57  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1  57  ? -46.866 -29.832 53.583 1.00 68.33  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1  57  ? -46.336 -28.945 54.543 1.00 76.41  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1  58  ? -45.217 -29.324 51.222 1.00 71.22  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1  58  ? -44.382 -28.453 50.402 1.00 64.49  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1  58  ? -44.972 -27.051 50.137 1.00 63.63  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1  58  ? -44.337 -26.242 49.476 1.00 60.82  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1  58  ? -44.074 -29.111 49.063 1.00 61.23  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1  58  ? -45.292 -29.279 48.350 1.00 67.43  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1  58  ? -43.440 -30.472 49.275 1.00 66.22  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1  59  ? -46.171 -26.746 50.636 1.00 66.45  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1  59  ? -46.696 -25.391 50.410 1.00 70.76  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1  59  ? -45.729 -24.350 50.948 1.00 72.40  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1  59  ? -44.952 -24.610 51.871 1.00 69.14  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1  59  ? -48.145 -25.101 50.912 1.00 68.09  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1  59  ? -48.816 -25.970 51.974 1.00 74.90  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1  59  ? -48.020 -26.150 53.244 1.00 82.77  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1  59  ? -48.544 -25.833 54.329 1.00 87.42  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1  59  ? -46.876 -26.639 53.164 1.00 92.09  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1  60  ? -45.775 -23.181 50.328 1.00 70.86  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1  60  ? -45.095 -22.025 50.846 1.00 71.40  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1  60  ? -45.763 -21.593 52.139 1.00 71.68  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1  60  ? -46.986 -21.691 52.275 1.00 73.97  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1  60  ? -45.103 -20.890 49.826 1.00 74.67  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1  60  ? -44.348 -21.161 48.523 1.00 76.47  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1  60  ? -44.511 -19.988 47.581 1.00 81.35  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1  60  ? -42.871 -21.449 48.760 1.00 78.06  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1  61  ? -44.944 -21.104 53.068 1.00 70.39  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1  61  ? -45.338 -20.888 54.450 1.00 67.68  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1  61  ? -45.374 -19.406 54.819 1.00 70.90  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1  61  ? -45.622 -19.046 55.973 1.00 73.62  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1  61  ? -44.395 -21.669 55.369 1.00 69.77  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1  61  ? -44.179 -23.151 55.008 1.00 73.61  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1  61  ? -43.098 -23.804 55.859 1.00 74.42  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1  61  ? -45.466 -23.957 55.086 1.00 70.09  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1  62  ? -45.115 -18.551 53.832 1.00 73.69  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1  62  ? -45.299 -17.100 53.960 1.00 70.18  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1  62  ? -46.508 -16.744 53.092 1.00 68.15  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1  62  ? -46.688 -17.333 52.029 1.00 75.24  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1  62  ? -44.029 -16.333 53.498 1.00 66.64  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1  62  ? -42.827 -16.733 54.331 1.00 66.93  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1  62  ? -44.176 -14.824 53.638 1.00 67.89  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1  62  ? -41.567 -15.985 53.957 1.00 68.28  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1  63  ? -47.333 -15.796 53.529 1.00 67.81  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1  63  ? -48.528 -15.420 52.759 1.00 71.88  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1  63  ? -48.126 -14.629 51.533 1.00 70.35  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1  63  ? -47.297 -13.720 51.631 1.00 70.96  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1  63  ? -49.501 -14.582 53.591 1.00 77.81  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1  63  ? -49.694 -14.998 55.044 1.00 81.79  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1  63  ? -50.582 -16.221 55.189 1.00 94.38  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1  63  ? -51.887 -16.085 54.533 1.00 116.42 ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1  63  ? -52.879 -15.297 54.956 1.00 124.26 ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1  63  ? -52.733 -14.518 56.031 1.00 123.51 ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1  63  ? -54.022 -15.273 54.284 1.00 123.71 ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1  64  ? -48.731 -14.959 50.395 1.00 69.01  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1  64  ? -48.334 -14.378 49.116 1.00 72.80  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1  64  ? -48.261 -12.849 49.106 1.00 75.76  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1  64  ? -47.249 -12.282 48.699 1.00 86.39  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1  64  ? -49.207 -14.907 47.979 1.00 73.06  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1  64  ? -49.209 -16.423 47.890 1.00 80.91  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1  64  ? -49.350 -16.894 46.455 1.00 86.46  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1  64  ? -49.181 -18.406 46.368 1.00 97.07  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1  64  ? -49.180 -18.890 44.953 1.00 94.39  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1  65  ? -49.304 -12.185 49.584 1.00 75.69  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1  65  ? -49.375 -10.727 49.502 1.00 75.90  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1  65  ? -48.258 -10.000 50.250 1.00 73.05  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1  65  ? -47.503 -9.269  49.604 1.00 75.06  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1  65  ? -50.758 -10.210 49.922 1.00 85.80  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1  65  ? -51.006 -8.704  49.808 1.00 82.93  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1  65  ? -51.159 -8.292  48.350 1.00 78.56  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1  65  ? -52.230 -8.335  50.634 1.00 83.97  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1  66  ? -48.132 -10.201 51.594 1.00 72.68  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1  66  ? -47.042 -9.553  52.349 1.00 72.88  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1  66  ? -45.704 -9.672  51.613 1.00 80.30  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1  66  ? -45.000 -8.670  51.452 1.00 80.62  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1  66  ? -46.961 -10.353 53.649 1.00 68.76  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1  66  ? -48.274 -11.009 53.804 1.00 72.51  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1  66  ? -48.897 -11.138 52.439 1.00 75.37  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1  67  ? -45.383 -10.886 51.155 1.00 76.89  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1  67  ? -44.154 -11.149 50.429 1.00 70.17  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1  67  ? -44.051 -10.320 49.153 1.00 75.02  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1  67  ? -42.990 -9.780  48.859 1.00 80.10  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1  67  ? -44.029 -12.635 50.112 1.00 70.38  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1  67  ? -42.706 -13.012 49.522 1.00 68.69  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1  67  ? -41.627 -13.265 50.339 1.00 64.06  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1  67  ? -42.537 -13.099 48.140 1.00 73.36  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1  67  ? -40.396 -13.587 49.802 1.00 63.49  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1  67  ? -41.308 -13.428 47.596 1.00 70.76  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1  67  ? -40.232 -13.668 48.430 1.00 66.26  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1  68  ? -45.147 -10.208 48.405 1.00 80.21  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1  68  ? -45.159 -9.444  47.145 1.00 84.15  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1  68  ? -44.852 -7.943  47.370 1.00 84.41  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1  68  ? -44.095 -7.309  46.607 1.00 76.58  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1  68  ? -46.498 -9.635  46.419 1.00 84.21  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1  68  ? -46.385 -9.560  44.904 1.00 93.96  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1  68  ? -47.694 -9.868  44.201 1.00 104.23 ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1  68  ? -48.763 -9.608  44.746 1.00 111.55 ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1  68  ? -47.620 -10.415 42.981 1.00 98.62  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1  69  ? -45.423 -7.387  48.434 1.00 76.72  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1  69  ? -45.137 -6.014  48.785 1.00 75.20  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1  69  ? -43.665 -5.846  49.113 1.00 70.51  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1  69  ? -43.020 -4.915  48.630 1.00 72.34  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1  69  ? -46.006 -5.564  49.958 1.00 79.76  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1  69  ? -47.496 -5.535  49.643 1.00 83.58  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1  69  ? -48.237 -4.576  50.567 1.00 86.73  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1  69  ? -48.090 -4.916  51.985 1.00 78.73  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1  69  ? -48.930 -5.688  52.672 1.00 79.19  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1  69  ? -50.006 -6.224  52.091 1.00 76.97  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1  69  ? -48.689 -5.927  53.953 1.00 80.22  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1  70  ? -43.128 -6.759  49.922 1.00 73.26  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1  70  ? -41.734 -6.660  50.368 1.00 69.79  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1  70  ? -40.786 -6.707  49.183 1.00 69.01  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1  70  ? -39.854 -5.909  49.098 1.00 68.09  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1  70  ? -41.392 -7.750  51.371 1.00 67.41  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1  70  ? -39.983 -7.670  51.949 1.00 70.66  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1  70  ? -39.847 -6.488  52.891 1.00 69.15  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1  70  ? -39.643 -8.971  52.659 1.00 74.16  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1  71  ? -41.058 -7.619  48.256 1.00 62.96  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1  71  ? -40.332 -7.652  47.011 1.00 62.70  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1  71  ? -40.374 -6.294  46.314 1.00 66.10  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1  71  ? -39.322 -5.695  46.107 1.00 71.74  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1  71  ? -40.842 -8.770  46.088 1.00 67.23  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1  71  ? -40.174 -8.693  44.726 1.00 69.19  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1  71  ? -40.574 -10.126 46.707 1.00 63.49  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1  72  ? -41.569 -5.787  45.990 1.00 70.93  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1  72  ? -41.707 -4.500  45.260 1.00 68.71  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1  72  ? -41.044 -3.305  45.945 1.00 67.05  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1  72  ? -40.408 -2.486  45.280 1.00 69.67  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1  72  ? -43.161 -4.201  44.964 1.00 66.71  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1  72  ? -43.817 -5.276  44.126 1.00 70.22  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1  72  ? -45.324 -5.113  44.110 1.00 72.88  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1  72  ? -45.942 -6.096  43.231 1.00 76.22  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1  72  ? -45.966 -5.995  41.905 1.00 80.67  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1  72  ? -45.404 -4.950  41.294 1.00 81.93  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1  72  ? -46.548 -6.945  41.190 1.00 77.39  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1  73  ? -41.162 -3.232  47.269 1.00 65.20  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1  73  ? -40.528 -2.180  48.049 1.00 64.75  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1  73  ? -39.020 -2.202  47.857 1.00 70.06  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1  73  ? -38.408 -1.169  47.578 1.00 73.17  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1  73  ? -40.883 -2.355  49.515 1.00 69.30  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1  73  ? -40.066 -1.506  50.474 1.00 71.56  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1  73  ? -40.446 -1.773  51.917 1.00 75.02  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1  73  ? -41.644 -2.017  52.200 1.00 74.19  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1  73  ? -39.541 -1.748  52.768 1.00 79.63  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1  74  ? -38.431 -3.388  48.003 1.00 73.37  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1  74  ? -36.999 -3.582  47.818 1.00 69.84  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1  74  ? -36.569 -3.229  46.390 1.00 72.15  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1  74  ? -35.562 -2.528  46.201 1.00 72.75  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1  74  ? -36.571 -5.005  48.215 1.00 66.56  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1  74  ? -36.593 -5.133  49.736 1.00 69.76  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1  74  ? -35.178 -5.324  47.704 1.00 66.70  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1  74  ? -36.696 -6.555  50.263 1.00 70.67  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1  75  ? -37.337 -3.669  45.395 1.00 66.91  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1  75  ? -36.981 -3.362  44.006 1.00 72.96  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1  75  ? -37.015 -1.854  43.685 1.00 80.06  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1  75  ? -36.209 -1.367  42.879 1.00 78.10  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1  75  ? -37.847 -4.142  43.043 1.00 66.76  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1  76  ? -37.931 -1.131  44.340 1.00 80.68  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1  76  ? -38.077 0.319   44.176 1.00 83.07  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1  76  ? -36.772 1.087   44.358 1.00 81.56  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1  76  ? -36.542 2.043   43.635 1.00 89.89  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1  76  ? -39.143 0.874   45.132 1.00 92.49  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1  76  ? -39.644 2.285   44.813 1.00 100.17 ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1  76  ? -40.721 2.308   43.734 1.00 104.74 ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1  76  ? -41.499 1.360   43.601 1.00 109.18 ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1  76  ? -40.772 3.392   42.958 1.00 94.97  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1  77  ? -35.931 0.681   45.313 1.00 79.72  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1  77  ? -34.633 1.325   45.525 1.00 75.19  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1  77  ? -33.685 1.054   44.368 1.00 79.01  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1  77  ? -32.594 1.610   44.322 1.00 91.19  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1  77  ? -33.967 0.831   46.812 1.00 80.44  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1  77  ? -34.739 1.194   48.053 1.00 88.69  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1  77  ? -35.291 0.266   48.684 1.00 91.47  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1  77  ? -34.788 2.399   48.405 1.00 91.83  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1  78  ? -34.060 0.181   43.442 1.00 76.80  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1  78  ? -33.147 -0.124  42.335 1.00 81.11  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1  78  ? -33.623 0.465   41.022 1.00 80.21  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1  78  ? -32.821 0.902   40.189 1.00 84.74  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1  78  ? -32.891 -1.638  42.194 1.00 79.89  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1  78  ? -32.322 -2.272  43.429 1.00 74.25  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1  78  ? -32.960 -3.353  44.020 1.00 72.17  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1  78  ? -31.161 -1.774  44.018 1.00 71.09  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1  78  ? -32.450 -3.934  45.171 1.00 70.61  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1  78  ? -30.645 -2.348  45.167 1.00 70.15  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1  78  ? -31.291 -3.427  45.747 1.00 72.27  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1  79  ? -34.933 0.429   40.828 1.00 76.60  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1  79  ? -35.564 1.113   39.718 1.00 78.77  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1  79  ? -37.042 1.327   40.031 1.00 89.55  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1  79  ? -37.703 0.475   40.650 1.00 93.38  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1  79  ? -35.353 0.368   38.408 1.00 74.01  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1  79  ? -36.200 0.884   37.268 1.00 83.82  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1  79  ? -35.569 0.615   35.915 1.00 90.50  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1  79  ? -36.266 1.423   34.831 1.00 95.13  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1  79  ? -35.738 1.117   33.474 1.00 101.49 ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1  80  ? -37.539 2.494   39.630 1.00 98.76  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1  80  ? -38.929 2.872   39.862 1.00 98.56  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1  80  ? -39.796 2.466   38.669 1.00 97.20  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1  80  ? -39.296 2.292   37.549 1.00 90.37  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1  80  ? -39.059 4.388   40.091 1.00 93.65  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1  80  ? -38.636 5.076   38.910 1.00 97.93  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1  80  ? -38.199 4.841   41.279 1.00 92.81  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1  81  ? -41.094 2.312   38.932 1.00 99.85  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1  81  ? -42.098 2.028   37.902 1.00 103.33 ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1  81  ? -41.898 0.603   37.357 1.00 107.36 ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1  81  ? -41.986 0.343   36.140 1.00 110.79 ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1  81  ? -42.061 3.104   36.791 1.00 107.56 ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1  81  ? -43.405 3.292   36.100 1.00 105.81 ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1  81  ? -44.445 3.105   36.779 1.00 90.47  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1  81  ? -43.408 3.632   34.885 1.00 106.48 ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1  82  ? -41.621 -0.319  38.279 1.00 97.30  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1  82  ? -41.346 -1.706  37.906 1.00 87.18  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1  82  ? -42.577 -2.571  37.973 1.00 78.15  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1  82  ? -43.399 -2.430  38.857 1.00 74.18  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1  82  ? -40.233 -2.316  38.762 1.00 78.99  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1  82  ? -38.808 -2.056  38.263 1.00 75.46  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1  82  ? -37.782 -2.603  39.239 1.00 73.87  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1  82  ? -38.587 -2.630  36.873 1.00 70.66  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1  83  ? -42.697 -3.467  37.011 1.00 76.93  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1  83  ? -43.741 -4.468  37.056 1.00 81.01  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1  83  ? -43.062 -5.845  37.142 1.00 87.52  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1  83  ? -41.894 -6.007  36.748 1.00 81.45  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1  83  ? -44.689 -4.331  35.854 1.00 85.51  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1  83  ? -45.277 -2.921  35.714 1.00 93.18  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1  83  ? -46.214 -2.748  34.524 1.00 90.00  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1  83  ? -47.603 -2.987  34.899 1.00 93.20  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1  83  ? -48.576 -3.310  34.052 1.00 101.71 ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1  83  ? -48.324 -3.443  32.747 1.00 111.03 ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1  83  ? -49.806 -3.506  34.522 1.00 100.73 ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1  84  ? -43.792 -6.815  37.692 1.00 80.91  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1  84  ? -43.265 -8.134  38.010 1.00 75.65  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1  84  ? -44.154 -9.185  37.408 1.00 71.13  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1  84  ? -45.357 -9.148  37.623 1.00 78.72  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1  84  ? -43.286 -8.351  39.528 1.00 75.86  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1  84  ? -42.059 -7.851  40.233 1.00 81.98  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1  84  ? -42.003 -6.547  40.709 1.00 82.19  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1  84  ? -40.960 -8.685  40.431 1.00 76.18  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1  84  ? -40.873 -6.077  41.356 1.00 82.54  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1  84  ? -39.830 -8.217  41.080 1.00 73.40  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1  84  ? -39.786 -6.914  41.538 1.00 79.09  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1  85  ? -43.583 -10.145 36.688 1.00 70.55  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1  85  ? -44.371 -11.293 36.251 1.00 70.38  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1  85  ? -44.849 -12.052 37.480 1.00 75.73  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1  85  ? -44.192 -12.011 38.514 1.00 79.61  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1  85  ? -43.554 -12.211 35.370 1.00 63.93  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1  85  ? -43.402 -11.741 33.949 1.00 62.81  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1  85  ? -42.760 -12.804 33.099 1.00 68.11  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1  85  ? -42.272 -13.805 33.612 1.00 72.99  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1  85  ? -42.746 -12.596 31.798 1.00 68.21  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1  86  ? -45.996 -12.726 37.372 1.00 80.92  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1  86  ? -46.556 -13.519 38.470 1.00 75.70  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1  86  ? -45.594 -14.623 38.867 1.00 78.13  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1  86  ? -45.385 -14.864 40.057 1.00 79.65  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1  86  ? -47.880 -14.150 38.050 1.00 79.00  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1  86  ? -48.255 -15.167 38.961 1.00 82.14  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1  87  ? -45.019 -15.289 37.863 1.00 71.44  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1  87  ? -44.062 -16.361 38.091 1.00 68.95  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1  87  ? -42.727 -15.871 38.673 1.00 70.68  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1  87  ? -42.059 -16.611 39.393 1.00 69.83  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1  87  ? -43.822 -17.134 36.799 1.00 66.54  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1  87  ? -43.265 -16.290 35.813 1.00 67.47  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1  88  ? -42.337 -14.637 38.361 1.00 72.69  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1  88  ? -41.126 -14.041 38.947 1.00 71.88  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1  88  ? -41.218 -13.873 40.467 1.00 66.68  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1  88  ? -40.251 -14.145 41.182 1.00 70.79  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1  88  ? -40.792 -12.712 38.286 1.00 71.05  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1  89  ? -42.370 -13.428 40.952 1.00 61.54  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1  89  ? -42.590 -13.271 42.383 1.00 65.30  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1  89  ? -42.577 -14.663 43.006 1.00 71.28  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1  89  ? -41.964 -14.867 44.049 1.00 73.19  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1  89  ? -43.921 -12.542 42.699 1.00 63.43  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1  89  ? -44.157 -12.467 44.199 1.00 65.64  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1  89  ? -43.939 -11.141 42.107 1.00 57.15  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1  90  ? -43.250 -15.610 42.348 1.00 76.88  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1  90  ? -43.258 -17.012 42.768 1.00 80.23  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1  90  ? -41.831 -17.556 42.891 1.00 76.06  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1  90  ? -41.421 -18.017 43.960 1.00 80.13  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1  90  ? -44.107 -17.887 41.819 1.00 84.90  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1  90  ? -45.610 -17.877 42.099 1.00 89.15  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1  90  ? -46.003 -18.063 43.861 1.00 102.64 ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1  90  ? -45.643 -19.814 44.105 1.00 111.74 ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1  91  ? -41.068 -17.479 41.809 1.00 68.47  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1  91  ? -39.694 -17.944 41.847 1.00 66.18  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1  91  ? -38.940 -17.347 43.049 1.00 67.29  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1  91  ? -38.357 -18.098 43.825 1.00 69.41  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1  91  ? -38.982 -17.688 40.529 1.00 57.76  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1  92  ? -39.006 -16.027 43.242 1.00 66.60  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1  92  ? -38.387 -15.401 44.421 1.00 65.61  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1  92  ? -38.853 -16.017 45.739 1.00 67.54  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1  92  ? -38.048 -16.212 46.644 1.00 72.68  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1  92  ? -38.600 -13.881 44.458 1.00 66.27  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1  92  ? -37.761 -12.991 43.521 1.00 70.62  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1  92  ? -38.296 -11.570 43.464 1.00 63.69  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1  92  ? -36.293 -12.965 43.903 1.00 67.02  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1  93  ? -40.135 -16.349 45.854 1.00 68.71  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1  93  ? -40.627 -16.918 47.108 1.00 65.82  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1  93  ? -40.059 -18.319 47.321 1.00 65.17  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1  93  ? -39.580 -18.662 48.408 1.00 65.17  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1  93  ? -42.158 -16.898 47.201 1.00 61.87  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1  93  ? -42.632 -16.690 48.631 1.00 64.06  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1  93  ? -44.131 -16.769 48.797 1.00 65.77  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1  93  ? -44.891 -16.248 47.973 1.00 72.26  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1  93  ? -44.571 -17.423 49.873 1.00 59.82  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1  94  ? -40.079 -19.111 46.264 1.00 62.28  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1  94  ? -39.605 -20.461 46.334 1.00 62.47  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1  94  ? -38.172 -20.462 46.832 1.00 61.40  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1  94  ? -37.821 -21.221 47.736 1.00 62.29  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1  94  ? -39.664 -21.091 44.944 1.00 73.60  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1  94  ? -41.043 -21.540 44.489 1.00 76.16  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1  94  ? -41.559 -22.733 45.262 1.00 75.48  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1  94  ? -42.777 -22.777 45.565 1.00 79.22  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1  94  ? -40.742 -23.621 45.561 1.00 72.77  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1  95  ? -37.357 -19.598 46.233 1.00 58.80  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1  95  ? -35.946 -19.474 46.557 1.00 53.28  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1  95  ? -35.704 -18.945 47.967 1.00 56.27  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1  95  ? -34.878 -19.509 48.686 1.00 56.52  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1  95  ? -35.245 -18.599 45.528 1.00 51.60  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1  96  ? -36.420 -17.885 48.360 1.00 55.92  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1  96  ? -36.324 -17.359 49.731 1.00 59.30  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1  96  ? -36.667 -18.367 50.820 1.00 58.76  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1  96  ? -35.966 -18.456 51.826 1.00 59.71  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1  96  ? -37.175 -16.109 49.915 1.00 56.27  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1  96  ? -36.793 -15.141 48.971 1.00 60.89  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1  97  ? -37.736 -19.136 50.620 1.00 61.49  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1  97  ? -38.169 -20.088 51.651 1.00 59.29  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1  97  ? -37.219 -21.287 51.722 1.00 54.62  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1  97  ? -36.899 -21.783 52.796 1.00 49.71  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1  97  ? -39.623 -20.508 51.447 1.00 60.08  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1  97  ? -40.644 -19.365 51.528 1.00 65.55  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1  97  ? -42.061 -19.857 51.847 1.00 70.72  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1  97  ? -42.225 -21.082 52.054 1.00 75.67  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1  97  ? -43.010 -19.034 51.908 1.00 66.48  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1  98  ? -36.739 -21.730 50.568 1.00 56.22  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1  98  ? -35.720 -22.766 50.530 1.00 52.52  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1  98  ? -34.489 -22.307 51.313 1.00 54.12  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1  98  ? -33.972 -23.031 52.152 1.00 55.43  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1  98  ? -35.350 -23.062 49.095 1.00 48.03  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1  99  ? -34.052 -21.082 51.031 1.00 55.36  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1  99  ? -32.887 -20.491 51.641 1.00 52.93  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1  99  ? -33.073 -20.456 53.136 1.00 57.56  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1  99  ? -32.174 -20.834 53.893 1.00 63.96  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1  99  ? -32.657 -19.060 51.111 1.00 53.61  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1  99  ? -31.639 -18.284 51.916 1.00 56.68  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1  99  ? -30.262 -18.493 51.746 1.00 56.40  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1  99  ? -32.046 -17.392 52.896 1.00 57.31  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1  99  ? -29.329 -17.809 52.510 1.00 53.77  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1  99  ? -31.120 -16.715 53.662 1.00 59.92  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1  99  ? -29.765 -16.918 53.465 1.00 57.73  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1  99  ? -28.852 -16.207 54.240 1.00 64.82  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1  100 ? -34.232 -19.981 53.565 1.00 58.63  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1  100 ? -34.458 -19.770 54.981 1.00 57.94  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1  100 ? -34.658 -21.086 55.721 1.00 62.49  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1  100 ? -34.205 -21.229 56.866 1.00 67.68  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1  100 ? -35.632 -18.822 55.214 1.00 53.59  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1  100 ? -35.455 -17.330 54.954 1.00 53.61  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1  100 ? -36.775 -16.658 55.256 1.00 57.23  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1  100 ? -34.375 -16.682 55.796 1.00 55.03  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1  101 ? -35.317 -22.049 55.073 1.00 58.35  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1  101 ? -35.508 -23.360 55.682 1.00 56.21  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1  101 ? -34.146 -23.990 55.944 1.00 55.39  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1  101 ? -33.890 -24.503 57.038 1.00 57.16  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1  101 ? -36.362 -24.300 54.817 1.00 54.13  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1  101 ? -36.195 -25.731 55.289 1.00 51.86  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1  101 ? -37.824 -23.884 54.869 1.00 49.85  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1  102 ? -33.262 -23.907 54.953 1.00 51.77  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1  102 ? -31.948 -24.532 55.059 1.00 48.19  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1  102 ? -31.098 -23.841 56.105 1.00 51.81  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1  102 ? -30.400 -24.510 56.859 1.00 60.21  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1  102 ? -31.253 -24.573 53.722 1.00 40.16  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1  103 ? -31.189 -22.517 56.182 1.00 49.55  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1  103 ? -30.453 -21.763 57.183 1.00 50.84  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1  103 ? -30.923 -22.099 58.567 1.00 54.42  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1  103 ? -30.140 -22.044 59.507 1.00 56.05  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1  103 ? -30.596 -20.256 56.966 1.00 54.04  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1  103 ? -29.880 -19.269 57.898 1.00 49.90  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1  103 ? -28.388 -19.382 57.748 1.00 48.88  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1  103 ? -30.312 -17.842 57.603 1.00 49.97  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1  104 ? -32.206 -22.432 58.705 1.00 57.17  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1  104 ? -32.692 -22.881 59.997 1.00 57.57  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1  104 ? -32.104 -24.260 60.339 1.00 60.53  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1  104 ? -31.923 -24.586 61.511 1.00 59.67  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1  104 ? -34.218 -22.863 60.061 1.00 55.40  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1  104 ? -34.810 -21.484 60.299 1.00 57.73  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1  104 ? -35.664 -20.908 59.357 1.00 57.03  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1  104 ? -34.544 -20.770 61.472 1.00 51.68  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1  104 ? -36.229 -19.660 59.582 1.00 52.80  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1  104 ? -35.085 -19.514 61.681 1.00 48.05  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1  104 ? -35.930 -18.960 60.739 1.00 50.72  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1  105 ? -31.774 -25.065 59.330 1.00 55.76  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1  105 ? -31.178 -26.343 59.638 1.00 55.68  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1  105 ? -29.834 -26.039 60.305 1.00 56.29  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1  105 ? -29.634 -26.414 61.461 1.00 59.37  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1  105 ? -31.063 -27.258 58.404 1.00 58.22  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1  105 ? -32.390 -27.836 57.907 1.00 64.93  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1  105 ? -32.416 -28.149 56.405 1.00 67.79  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1  105 ? -31.336 -28.323 55.822 1.00 74.11  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1  105 ? -33.509 -28.223 55.787 1.00 67.93  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1  106 ? -28.951 -25.311 59.613 1.00 54.39  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1  106 ? -27.586 -25.006 60.110 1.00 51.72  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1  106 ? -27.619 -24.274 61.443 1.00 52.90  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1  106 ? -26.819 -24.547 62.336 1.00 53.42  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1  106 ? -26.835 -24.126 59.130 1.00 53.21  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1  106 ? -26.760 -24.716 57.729 1.00 57.86  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1  106 ? -27.300 -25.818 57.485 1.00 59.85  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1  106 ? -26.149 -24.063 56.851 1.00 60.04  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1  107 ? -28.565 -23.349 61.568 1.00 53.27  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1  107 ? -28.821 -22.639 62.806 1.00 57.76  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1  107 ? -29.135 -23.624 63.933 1.00 61.69  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1  107 ? -28.553 -23.545 65.037 1.00 59.27  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1  107 ? -29.978 -21.621 62.644 1.00 57.33  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1  107 ? -29.593 -20.623 61.694 1.00 58.24  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1  107 ? -30.279 -20.921 63.959 1.00 54.82  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1  108 ? -30.044 -24.557 63.647 1.00 62.00  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1  108 ? -30.415 -25.560 64.635 1.00 58.66  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1  108 ? -29.169 -26.333 65.025 1.00 56.52  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1  108 ? -28.934 -26.514 66.224 1.00 54.40  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1  108 ? -31.527 -26.485 64.136 1.00 60.27  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  108 ? -32.302 -27.150 65.266 1.00 63.69  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  108 ? -32.405 -26.628 66.373 1.00 71.54  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  108 ? -32.869 -28.309 64.978 1.00 67.06  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  109 ? -28.346 -26.734 64.044 1.00 50.84  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1  109 ? -27.114 -27.452 64.389 1.00 54.41  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1  109 ? -26.221 -26.603 65.290 1.00 56.19  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1  109 ? -25.664 -27.096 66.277 1.00 54.07  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1  109 ? -26.344 -27.949 63.169 1.00 56.32  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  109 ? -27.024 -28.996 62.293 1.00 55.85  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  109 ? -26.179 -29.223 61.065 1.00 55.58  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  109 ? -27.181 -30.301 63.028 1.00 55.71  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1  110 ? -26.134 -25.314 64.989 1.00 54.13  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1  110 ? -25.358 -24.437 65.842 1.00 54.34  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1  110 ? -25.873 -24.353 67.307 1.00 55.82  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1  110 ? -25.061 -24.409 68.239 1.00 55.50  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1  110 ? -25.233 -23.065 65.198 1.00 53.12  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1  110 ? -24.256 -23.116 63.682 1.00 56.44  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1  111 ? -27.194 -24.232 67.506 1.00 51.56  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1  111 ? -27.779 -24.309 68.843 1.00 47.08  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1  111 ? -27.416 -25.624 69.516 1.00 50.98  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1  111 ? -26.886 -25.649 70.622 1.00 54.61  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1  111 ? -29.265 -24.148 68.782 1.00 44.85  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1  112 ? -27.649 -26.730 68.834 1.00 53.66  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1  112 ? -27.303 -28.018 69.407 1.00 55.39  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1  112 ? -25.808 -28.093 69.796 1.00 58.62  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1  112 ? -25.438 -28.648 70.845 1.00 59.74  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1  112 ? -27.768 -29.171 68.494 1.00 54.67  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1  112 ? -29.296 -29.219 68.499 1.00 53.70  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1  112 ? -27.269 -30.514 68.996 1.00 51.71  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1  112 ? -29.927 -29.849 67.277 1.00 51.85  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1  113 ? -24.948 -27.493 68.984 1.00 59.66  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1  113 ? -23.504 -27.551 69.247 1.00 59.13  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1  113 ? -23.151 -26.921 70.563 1.00 58.38  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1  113 ? -22.171 -27.320 71.213 1.00 57.94  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1  113 ? -22.742 -26.890 68.106 1.00 61.29  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1  113 ? -21.243 -27.020 68.195 1.00 57.38  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1  113 ? -20.585 -28.106 67.752 1.00 54.56  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1  113 ? -20.279 -26.126 68.651 1.00 53.62  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1  113 ? -19.268 -27.926 67.950 1.00 54.29  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1  113 ? -19.089 -26.709 68.497 1.00 51.87  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1  114 ? -23.949 -25.925 70.953 1.00 60.64  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1  114 ? -23.731 -25.174 72.183 1.00 59.18  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1  114 ? -24.591 -25.756 73.304 1.00 65.01  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1  114 ? -24.808 -25.119 74.342 1.00 64.40  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1  114 ? -24.035 -23.707 71.965 1.00 54.21  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1  115 ? -25.077 -26.976 73.069 1.00 66.57  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1  115 ? -25.778 -27.778 74.071 1.00 64.80  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1  115 ? -27.130 -27.182 74.447 1.00 65.65  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1  115 ? -27.590 -27.298 75.585 1.00 69.85  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1  115 ? -24.883 -28.040 75.290 1.00 60.08  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1  115 ? -23.680 -28.896 74.947 1.00 65.33  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1  115 ? -22.791 -29.157 76.149 1.00 71.73  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1  115 ? -21.696 -30.163 75.797 1.00 83.51  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1  115 ? -21.008 -30.753 76.992 1.00 83.89  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1  116 ? -27.761 -26.553 73.467 1.00 60.38  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1  116 ? -29.058 -25.933 73.655 1.00 59.33  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1  116 ? -30.085 -26.630 72.759 1.00 59.40  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1  116 ? -29.734 -27.507 71.965 1.00 64.74  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1  116 ? -28.978 -24.433 73.329 1.00 59.19  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1  116 ? -28.160 -23.608 74.319 1.00 58.59  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1  116 ? -28.338 -22.101 74.096 1.00 60.29  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1  116 ? -27.338 -21.545 73.176 1.00 61.40  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1  116 ? -27.526 -21.328 71.867 1.00 61.50  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1  116 ? -28.683 -21.606 71.281 1.00 59.53  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1  116 ? -26.547 -20.816 71.129 1.00 61.48  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1  117 ? -31.350 -26.247 72.900 1.00 57.62  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1  117 ? -32.402 -26.678 71.983 1.00 57.39  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1  117 ? -33.157 -25.451 71.475 1.00 58.23  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1  117 ? -34.162 -25.576 70.773 1.00 65.71  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1  117 ? -33.413 -27.683 72.615 1.00 57.13  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1  117 ? -32.751 -29.007 72.984 1.00 55.72  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1  117 ? -34.134 -27.064 73.807 1.00 57.98  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1  118 ? -32.665 -24.264 71.813 1.00 56.37  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1  118 ? -33.357 -23.026 71.470 1.00 57.34  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1  118 ? -32.545 -22.187 70.511 1.00 59.19  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1  118 ? -31.504 -21.671 70.888 1.00 59.24  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1  118 ? -33.552 -22.156 72.722 1.00 60.70  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1  118 ? -34.019 -22.966 73.811 1.00 70.69  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1  118 ? -34.529 -21.016 72.445 1.00 59.24  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1  119 ? -33.012 -21.996 69.286 1.00 62.76  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1  119 ? -32.225 -21.172 68.362 1.00 63.02  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1  119 ? -32.159 -19.677 68.748 1.00 66.35  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1  119 ? -33.155 -19.074 69.152 1.00 66.14  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1  119 ? -32.651 -21.357 66.905 1.00 57.92  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1  119 ? -34.051 -20.819 66.682 1.00 56.98  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1  119 ? -32.537 -22.819 66.515 1.00 56.88  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1  119 ? -34.380 -20.663 65.211 1.00 60.22  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1  120 ? -30.968 -19.097 68.628 1.00 63.29  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1  120 ? -30.739 -17.723 69.061 1.00 62.61  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1  120 ? -30.022 -16.967 67.966 1.00 63.81  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1  120 ? -29.438 -17.594 67.096 1.00 67.97  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1  120 ? -29.915 -17.701 70.334 1.00 60.46  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1  120 ? -30.462 -18.591 71.420 1.00 59.96  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1  120 ? -29.657 -18.214 72.978 1.00 68.55  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1  120 ? -30.779 -18.990 74.164 1.00 64.40  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1  121 ? -30.070 -15.616 67.987 1.00 62.89  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1  121 ? -29.497 -14.865 66.880 1.00 63.10  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1  121 ? -28.040 -15.237 66.673 1.00 66.09  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1  121 ? -27.564 -15.261 65.530 1.00 68.34  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1  121 ? -29.637 -13.415 67.337 1.00 59.78  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  121 ? -30.866 -13.445 68.167 1.00 59.00  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  121 ? -30.716 -14.715 68.953 1.00 61.45  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1  122 ? -27.340 -15.564 67.754 1.00 61.04  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1  122 ? -25.959 -15.936 67.587 1.00 58.87  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1  122 ? -25.823 -17.137 66.679 1.00 60.15  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1  122 ? -24.964 -17.136 65.812 1.00 65.98  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1  122 ? -25.219 -16.131 68.912 1.00 62.82  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1  122 ? -25.968 -16.828 70.020 1.00 61.05  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1  122 ? -25.095 -16.858 71.259 1.00 64.71  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1  122 ? -25.939 -17.151 72.483 1.00 71.32  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1  122 ? -25.135 -17.183 73.736 1.00 78.82  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1  123 ? -26.686 -18.138 66.854 1.00 57.29  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1  123 ? -26.662 -19.343 66.026 1.00 52.13  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1  123 ? -26.840 -19.012 64.552 1.00 57.53  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1  123 ? -26.096 -19.512 63.721 1.00 64.90  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1  123 ? -27.728 -20.344 66.463 1.00 52.48  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1  123 ? -27.639 -20.699 67.950 1.00 54.58  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1  123 ? -26.517 -20.885 68.481 1.00 51.48  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1  123 ? -28.713 -20.806 68.578 1.00 51.16  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1  124 ? -27.811 -18.165 64.217 1.00 59.34  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1  124 ? -27.927 -17.660 62.842 1.00 58.47  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1  124 ? -26.637 -16.968 62.423 1.00 57.75  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1  124 ? -26.166 -17.129 61.303 1.00 58.98  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1  124 ? -29.117 -16.680 62.651 1.00 59.21  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1  124 ? -30.429 -17.312 63.114 1.00 60.75  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1  124 ? -29.286 -16.298 61.190 1.00 54.94  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1  124 ? -31.647 -16.463 62.829 1.00 55.66  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1  125 ? -26.051 -16.200 63.329 1.00 64.49  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1  125 ? -24.835 -15.460 62.997 1.00 61.88  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1  125 ? -23.683 -16.423 62.695 1.00 58.14  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1  125 ? -23.045 -16.336 61.655 1.00 60.09  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1  125 ? -24.506 -14.471 64.107 1.00 59.40  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  125 ? -25.344 -13.205 64.037 1.00 62.04  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  125 ? -25.562 -12.560 65.397 1.00 65.07  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  125 ? -24.797 -12.776 66.336 1.00 66.58  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  125 ? -26.617 -11.764 65.509 1.00 65.33  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1  126 ? -23.460 -17.375 63.583 1.00 55.98  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1  126 ? -22.434 -18.379 63.370 1.00 54.67  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1  126 ? -22.633 -19.122 62.051 1.00 55.17  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1  126 ? -21.677 -19.323 61.300 1.00 57.89  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1  126 ? -22.404 -19.362 64.526 1.00 50.15  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1  126 ? -21.256 -20.326 64.373 1.00 52.95  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1  126 ? -19.916 -19.592 64.411 1.00 53.31  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1  126 ? -21.370 -21.391 65.448 1.00 53.53  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1  127 ? -23.867 -19.521 61.764 1.00 50.49  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1  127 ? -24.123 -20.191 60.519 1.00 50.01  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1  127 ? -23.734 -19.321 59.321 1.00 51.62  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1  127 ? -22.967 -19.745 58.468 1.00 49.74  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1  127 ? -25.556 -20.624 60.442 1.00 54.15  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1  128 ? -24.202 -18.080 59.291 1.00 53.38  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1  128 ? -23.902 -17.216 58.166 1.00 49.87  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1  128 ? -22.440 -16.878 58.068 1.00 49.27  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1  128 ? -21.914 -16.727 56.980 1.00 53.33  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1  128 ? -24.741 -15.974 58.212 1.00 51.38  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1  128 ? -26.213 -16.277 58.055 1.00 52.15  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1  128 ? -26.996 -14.997 57.888 1.00 58.33  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1  128 ? -26.683 -14.296 56.640 1.00 63.46  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1  128 ? -26.358 -13.007 56.577 1.00 60.63  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1  128 ? -26.305 -12.307 57.698 1.00 55.94  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1  128 ? -26.100 -12.421 55.408 1.00 59.50  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1  129 ? -21.758 -16.808 59.198 1.00 53.80  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1  129 ? -20.310 -16.533 59.167 1.00 55.55  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1  129 ? -19.562 -17.696 58.488 1.00 53.71  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1  129 ? -18.816 -17.492 57.548 1.00 51.74  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1  129 ? -19.792 -16.143 60.566 1.00 45.57  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1  129 ? -18.301 -16.135 60.788 1.00 47.64  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1  129 ? -17.505 -15.356 59.769 1.00 55.54  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1  129 ? -16.082 -15.571 60.013 1.00 62.79  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1  129 ? -15.400 -16.615 59.555 1.00 61.28  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1  129 ? -16.002 -17.524 58.798 1.00 56.61  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1  129 ? -14.114 -16.740 59.849 1.00 66.21  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1  130 ? -19.837 -18.916 58.923 1.00 56.37  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1  130 ? -19.162 -20.080 58.386 1.00 57.24  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1  130 ? -19.519 -20.362 56.928 1.00 57.60  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1  130 ? -18.690 -20.857 56.157 1.00 55.98  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1  130 ? -19.402 -21.282 59.275 1.00 54.90  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1  130 ? -18.759 -20.991 60.622 1.00 55.08  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1  130 ? -18.818 -22.530 58.647 1.00 53.19  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1  130 ? -19.388 -21.787 61.735 1.00 65.30  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1  131 ? -20.741 -20.016 56.547 1.00 60.04  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1  131 ? -21.172 -20.125 55.154 1.00 59.82  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1  131 ? -20.433 -19.116 54.272 1.00 62.09  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1  131 ? -20.509 -19.176 53.046 1.00 59.09  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1  131 ? -22.663 -19.852 55.042 1.00 54.28  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1  131 ? -23.571 -21.000 55.392 1.00 53.33  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1  131 ? -24.983 -20.458 55.401 1.00 58.39  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1  131 ? -26.030 -21.446 55.594 1.00 60.42  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1  131 ? -27.149 -21.472 54.878 1.00 65.91  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1  131 ? -27.324 -20.581 53.923 1.00 70.75  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1  131 ? -28.088 -22.387 55.091 1.00 65.91  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1  132 ? -19.737 -18.178 54.901 1.00 60.73  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1  132 ? -19.052 -17.147 54.160 1.00 64.22  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1  132 ? -20.007 -16.077 53.681 1.00 71.06  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1  132 ? -19.763 -15.440 52.662 1.00 82.46  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1  133 ? -21.101 -15.874 54.401 1.00 70.75  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1  133 ? -21.989 -14.749 54.115 1.00 72.35  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1  133 ? -21.595 -13.494 54.928 1.00 83.06  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1  133 ? -22.079 -12.394 54.640 1.00 88.23  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1  133 ? -23.467 -15.138 54.341 1.00 67.28  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1  133 ? -24.041 -16.115 53.313 1.00 66.56  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1  133 ? -25.389 -16.731 53.696 1.00 65.98  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1  133 ? -26.184 -16.090 54.415 1.00 66.10  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1  133 ? -25.672 -17.869 53.257 1.00 64.40  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1  134 ? -20.711 -13.655 55.924 1.00 92.60  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1  134 ? -20.271 -12.528 56.796 1.00 103.39 ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1  134 ? -18.763 -12.224 56.693 1.00 108.95 ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A 1  134 ? -18.122 -11.820 57.681 1.00 104.65 ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1  134 ? -20.629 -12.753 58.282 1.00 100.45 ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1  134 ? -22.027 -13.282 58.565 1.00 102.30 ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1  134 ? -22.577 -12.779 59.899 1.00 107.62 ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1  134 ? -22.952 -11.363 59.782 1.00 124.91 ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1  134 ? -24.049 -10.807 60.302 1.00 122.85 ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1  134 ? -24.930 -11.544 60.985 1.00 116.36 ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1  134 ? -24.271 -9.505  60.124 1.00 111.94 ? 134  ARG A NH2   1 
ATOM   803   N  N     . VAL B 2  21  ? -53.544 1.829   60.414 1.00 151.52 ? 21   VAL B N     1 
ATOM   804   C  CA    . VAL B 2  21  ? -52.595 0.925   61.144 1.00 148.83 ? 21   VAL B CA    1 
ATOM   805   C  C     . VAL B 2  21  ? -51.263 0.833   60.357 1.00 147.49 ? 21   VAL B C     1 
ATOM   806   O  O     . VAL B 2  21  ? -50.916 -0.218  59.791 1.00 140.64 ? 21   VAL B O     1 
ATOM   807   C  CB    . VAL B 2  21  ? -53.247 -0.461  61.453 1.00 144.34 ? 21   VAL B CB    1 
ATOM   808   C  CG1   . VAL B 2  21  ? -52.496 -1.191  62.563 1.00 136.72 ? 21   VAL B CG1   1 
ATOM   809   C  CG2   . VAL B 2  21  ? -54.721 -0.301  61.840 1.00 122.45 ? 21   VAL B CG2   1 
ATOM   810   N  N     . LEU B 2  22  ? -50.539 1.962   60.339 1.00 146.12 ? 22   LEU B N     1 
ATOM   811   C  CA    . LEU B 2  22  ? -49.291 2.154   59.561 1.00 146.96 ? 22   LEU B CA    1 
ATOM   812   C  C     . LEU B 2  22  ? -48.172 1.182   59.960 1.00 145.87 ? 22   LEU B C     1 
ATOM   813   O  O     . LEU B 2  22  ? -47.824 1.079   61.141 1.00 148.94 ? 22   LEU B O     1 
ATOM   814   C  CB    . LEU B 2  22  ? -48.811 3.624   59.646 1.00 144.30 ? 22   LEU B CB    1 
ATOM   815   C  CG    . LEU B 2  22  ? -48.442 4.293   60.989 1.00 139.18 ? 22   LEU B CG    1 
ATOM   816   C  CD1   . LEU B 2  22  ? -46.927 4.410   61.157 1.00 124.25 ? 22   LEU B CD1   1 
ATOM   817   C  CD2   . LEU B 2  22  ? -49.099 5.667   61.114 1.00 128.13 ? 22   LEU B CD2   1 
ATOM   818   N  N     . ARG B 2  23  ? -47.615 0.476   58.973 1.00 136.81 ? 23   ARG B N     1 
ATOM   819   C  CA    . ARG B 2  23  ? -46.694 -0.632  59.250 1.00 135.81 ? 23   ARG B CA    1 
ATOM   820   C  C     . ARG B 2  23  ? -45.760 -0.966  58.079 1.00 132.39 ? 23   ARG B C     1 
ATOM   821   O  O     . ARG B 2  23  ? -46.200 -1.015  56.924 1.00 131.79 ? 23   ARG B O     1 
ATOM   822   C  CB    . ARG B 2  23  ? -47.503 -1.873  59.644 1.00 135.38 ? 23   ARG B CB    1 
ATOM   823   C  CG    . ARG B 2  23  ? -46.740 -2.903  60.463 1.00 137.63 ? 23   ARG B CG    1 
ATOM   824   C  CD    . ARG B 2  23  ? -47.608 -4.112  60.787 1.00 137.79 ? 23   ARG B CD    1 
ATOM   825   N  NE    . ARG B 2  23  ? -48.569 -4.433  59.724 1.00 148.88 ? 23   ARG B NE    1 
ATOM   826   C  CZ    . ARG B 2  23  ? -48.268 -4.980  58.544 1.00 149.43 ? 23   ARG B CZ    1 
ATOM   827   N  NH1   . ARG B 2  23  ? -47.011 -5.270  58.227 1.00 148.68 ? 23   ARG B NH1   1 
ATOM   828   N  NH2   . ARG B 2  23  ? -49.232 -5.226  57.668 1.00 142.64 ? 23   ARG B NH2   1 
ATOM   829   N  N     . ASP B 2  24  ? -44.480 -1.198  58.390 1.00 123.58 ? 24   ASP B N     1 
ATOM   830   C  CA    . ASP B 2  24  ? -43.474 -1.601  57.394 1.00 116.89 ? 24   ASP B CA    1 
ATOM   831   C  C     . ASP B 2  24  ? -43.831 -2.928  56.753 1.00 108.60 ? 24   ASP B C     1 
ATOM   832   O  O     . ASP B 2  24  ? -44.404 -3.803  57.412 1.00 105.05 ? 24   ASP B O     1 
ATOM   833   C  CB    . ASP B 2  24  ? -42.099 -1.740  58.042 1.00 124.06 ? 24   ASP B CB    1 
ATOM   834   C  CG    . ASP B 2  24  ? -41.531 -0.419  58.470 1.00 131.48 ? 24   ASP B CG    1 
ATOM   835   O  OD1   . ASP B 2  24  ? -41.173 0.386   57.578 1.00 136.21 ? 24   ASP B OD1   1 
ATOM   836   O  OD2   . ASP B 2  24  ? -41.445 -0.190  59.699 1.00 127.54 ? 24   ASP B OD2   1 
ATOM   837   N  N     . ASN B 2  25  ? -43.484 -3.085  55.478 1.00 99.90  ? 25   ASN B N     1 
ATOM   838   C  CA    . ASN B 2  25  ? -43.787 -4.324  54.766 1.00 89.78  ? 25   ASN B CA    1 
ATOM   839   C  C     . ASN B 2  25  ? -43.012 -5.521  55.296 1.00 89.58  ? 25   ASN B C     1 
ATOM   840   O  O     . ASN B 2  25  ? -43.548 -6.627  55.319 1.00 94.93  ? 25   ASN B O     1 
ATOM   841   C  CB    . ASN B 2  25  ? -43.550 -4.175  53.269 1.00 92.50  ? 25   ASN B CB    1 
ATOM   842   C  CG    . ASN B 2  25  ? -44.636 -3.377  52.578 1.00 90.78  ? 25   ASN B CG    1 
ATOM   843   O  OD1   . ASN B 2  25  ? -45.824 -3.686  52.684 1.00 94.43  ? 25   ASN B OD1   1 
ATOM   844   N  ND2   . ASN B 2  25  ? -44.229 -2.358  51.840 1.00 85.53  ? 25   ASN B ND2   1 
ATOM   845   N  N     . ILE B 2  26  ? -41.765 -5.293  55.724 1.00 84.22  ? 26   ILE B N     1 
ATOM   846   C  CA    . ILE B 2  26  ? -40.930 -6.332  56.337 1.00 82.25  ? 26   ILE B CA    1 
ATOM   847   C  C     . ILE B 2  26  ? -41.624 -7.011  57.527 1.00 80.85  ? 26   ILE B C     1 
ATOM   848   O  O     . ILE B 2  26  ? -41.358 -8.174  57.864 1.00 78.24  ? 26   ILE B O     1 
ATOM   849   C  CB    . ILE B 2  26  ? -39.531 -5.779  56.744 1.00 84.05  ? 26   ILE B CB    1 
ATOM   850   C  CG1   . ILE B 2  26  ? -38.576 -6.902  57.173 1.00 78.03  ? 26   ILE B CG1   1 
ATOM   851   C  CG2   . ILE B 2  26  ? -39.642 -4.734  57.843 1.00 84.87  ? 26   ILE B CG2   1 
ATOM   852   C  CD1   . ILE B 2  26  ? -38.332 -7.931  56.090 1.00 74.93  ? 26   ILE B CD1   1 
ATOM   853   N  N     . GLN B 2  27  ? -42.532 -6.280  58.153 1.00 79.93  ? 27   GLN B N     1 
ATOM   854   C  CA    . GLN B 2  27  ? -43.225 -6.796  59.314 1.00 81.32  ? 27   GLN B CA    1 
ATOM   855   C  C     . GLN B 2  27  ? -44.393 -7.684  58.917 1.00 80.19  ? 27   GLN B C     1 
ATOM   856   O  O     . GLN B 2  27  ? -44.979 -8.373  59.771 1.00 77.78  ? 27   GLN B O     1 
ATOM   857   C  CB    . GLN B 2  27  ? -43.657 -5.647  60.205 1.00 80.59  ? 27   GLN B CB    1 
ATOM   858   C  CG    . GLN B 2  27  ? -42.478 -4.891  60.790 1.00 81.69  ? 27   GLN B CG    1 
ATOM   859   C  CD    . GLN B 2  27  ? -41.691 -5.725  61.782 1.00 83.50  ? 27   GLN B CD    1 
ATOM   860   O  OE1   . GLN B 2  27  ? -42.256 -6.511  62.551 1.00 88.20  ? 27   GLN B OE1   1 
ATOM   861   N  NE2   . GLN B 2  27  ? -40.378 -5.556  61.771 1.00 85.92  ? 27   GLN B NE2   1 
ATOM   862   N  N     . GLY B 2  28  ? -44.690 -7.686  57.614 1.00 77.30  ? 28   GLY B N     1 
ATOM   863   C  CA    . GLY B 2  28  ? -45.708 -8.552  57.011 1.00 82.59  ? 28   GLY B CA    1 
ATOM   864   C  C     . GLY B 2  28  ? -45.282 -10.005 57.047 1.00 87.17  ? 28   GLY B C     1 
ATOM   865   O  O     . GLY B 2  28  ? -46.119 -10.918 56.965 1.00 87.28  ? 28   GLY B O     1 
ATOM   866   N  N     . ILE B 2  29  ? -43.965 -10.195 57.151 1.00 78.11  ? 29   ILE B N     1 
ATOM   867   C  CA    . ILE B 2  29  ? -43.363 -11.487 57.399 1.00 69.03  ? 29   ILE B CA    1 
ATOM   868   C  C     . ILE B 2  29  ? -43.460 -11.719 58.897 1.00 66.18  ? 29   ILE B C     1 
ATOM   869   O  O     . ILE B 2  29  ? -42.643 -11.261 59.689 1.00 69.44  ? 29   ILE B O     1 
ATOM   870   C  CB    . ILE B 2  29  ? -41.896 -11.529 56.927 1.00 68.78  ? 29   ILE B CB    1 
ATOM   871   C  CG1   . ILE B 2  29  ? -41.743 -10.874 55.544 1.00 60.49  ? 29   ILE B CG1   1 
ATOM   872   C  CG2   . ILE B 2  29  ? -41.332 -12.956 57.010 1.00 65.70  ? 29   ILE B CG2   1 
ATOM   873   C  CD1   . ILE B 2  29  ? -42.416 -11.600 54.400 1.00 62.52  ? 29   ILE B CD1   1 
ATOM   874   N  N     . THR B 2  30  ? -44.486 -12.442 59.275 1.00 65.92  ? 30   THR B N     1 
ATOM   875   C  CA    . THR B 2  30  ? -44.946 -12.415 60.640 1.00 69.61  ? 30   THR B CA    1 
ATOM   876   C  C     . THR B 2  30  ? -44.304 -13.505 61.483 1.00 66.25  ? 30   THR B C     1 
ATOM   877   O  O     . THR B 2  30  ? -43.749 -14.465 60.953 1.00 68.77  ? 30   THR B O     1 
ATOM   878   C  CB    . THR B 2  30  ? -46.476 -12.592 60.647 1.00 72.05  ? 30   THR B CB    1 
ATOM   879   O  OG1   . THR B 2  30  ? -46.796 -13.928 60.240 1.00 74.90  ? 30   THR B OG1   1 
ATOM   880   C  CG2   . THR B 2  30  ? -47.146 -11.597 59.683 1.00 66.38  ? 30   THR B CG2   1 
ATOM   881   N  N     . LYS B 2  31  ? -44.415 -13.365 62.797 1.00 65.47  ? 31   LYS B N     1 
ATOM   882   C  CA    . LYS B 2  31  ? -43.990 -14.405 63.721 1.00 64.32  ? 31   LYS B CA    1 
ATOM   883   C  C     . LYS B 2  31  ? -44.431 -15.826 63.327 1.00 68.92  ? 31   LYS B C     1 
ATOM   884   O  O     . LYS B 2  31  ? -43.589 -16.721 63.236 1.00 74.25  ? 31   LYS B O     1 
ATOM   885   C  CB    . LYS B 2  31  ? -44.388 -14.069 65.161 1.00 61.75  ? 31   LYS B CB    1 
ATOM   886   C  CG    . LYS B 2  31  ? -44.213 -15.239 66.116 1.00 68.64  ? 31   LYS B CG    1 
ATOM   887   C  CD    . LYS B 2  31  ? -44.147 -14.804 67.568 1.00 72.42  ? 31   LYS B CD    1 
ATOM   888   C  CE    . LYS B 2  31  ? -44.213 -15.998 68.519 1.00 72.17  ? 31   LYS B CE    1 
ATOM   889   N  NZ    . LYS B 2  31  ? -43.860 -15.600 69.919 1.00 71.68  ? 31   LYS B NZ    1 
ATOM   890   N  N     . PRO B 2  32  ? -45.736 -16.046 63.075 1.00 74.06  ? 32   PRO B N     1 
ATOM   891   C  CA    . PRO B 2  32  ? -46.202 -17.411 62.756 1.00 72.71  ? 32   PRO B CA    1 
ATOM   892   C  C     . PRO B 2  32  ? -45.622 -17.995 61.462 1.00 77.18  ? 32   PRO B C     1 
ATOM   893   O  O     . PRO B 2  32  ? -45.395 -19.206 61.387 1.00 76.07  ? 32   PRO B O     1 
ATOM   894   C  CB    . PRO B 2  32  ? -47.705 -17.236 62.585 1.00 74.06  ? 32   PRO B CB    1 
ATOM   895   C  CG    . PRO B 2  32  ? -48.028 -15.951 63.273 1.00 78.38  ? 32   PRO B CG    1 
ATOM   896   C  CD    . PRO B 2  32  ? -46.844 -15.079 63.067 1.00 71.56  ? 32   PRO B CD    1 
ATOM   897   N  N     . ALA B 2  33  ? -45.408 -17.143 60.454 1.00 76.42  ? 33   ALA B N     1 
ATOM   898   C  CA    . ALA B 2  33  ? -44.802 -17.558 59.184 1.00 72.42  ? 33   ALA B CA    1 
ATOM   899   C  C     . ALA B 2  33  ? -43.334 -17.924 59.357 1.00 75.13  ? 33   ALA B C     1 
ATOM   900   O  O     . ALA B 2  33  ? -42.848 -18.906 58.773 1.00 76.07  ? 33   ALA B O     1 
ATOM   901   C  CB    . ALA B 2  33  ? -44.932 -16.465 58.149 1.00 67.73  ? 33   ALA B CB    1 
ATOM   902   N  N     . ILE B 2  34  ? -42.620 -17.122 60.140 1.00 68.76  ? 34   ILE B N     1 
ATOM   903   C  CA    . ILE B 2  34  ? -41.219 -17.408 60.413 1.00 66.08  ? 34   ILE B CA    1 
ATOM   904   C  C     . ILE B 2  34  ? -41.123 -18.685 61.242 1.00 65.98  ? 34   ILE B C     1 
ATOM   905   O  O     . ILE B 2  34  ? -40.247 -19.515 61.034 1.00 67.78  ? 34   ILE B O     1 
ATOM   906   C  CB    . ILE B 2  34  ? -40.518 -16.231 61.109 1.00 62.65  ? 34   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2  34  ? -40.486 -15.021 60.186 1.00 62.17  ? 34   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2  34  ? -39.096 -16.597 61.475 1.00 61.85  ? 34   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2  34  ? -40.223 -13.723 60.919 1.00 64.78  ? 34   ILE B CD1   1 
ATOM   910   N  N     . ARG B 2  35  ? -42.058 -18.848 62.162 1.00 70.65  ? 35   ARG B N     1 
ATOM   911   C  CA    . ARG B 2  35  ? -42.126 -20.039 62.993 1.00 67.84  ? 35   ARG B CA    1 
ATOM   912   C  C     . ARG B 2  35  ? -42.337 -21.303 62.139 1.00 71.86  ? 35   ARG B C     1 
ATOM   913   O  O     . ARG B 2  35  ? -41.705 -22.345 62.390 1.00 69.00  ? 35   ARG B O     1 
ATOM   914   C  CB    . ARG B 2  35  ? -43.228 -19.828 64.010 1.00 64.23  ? 35   ARG B CB    1 
ATOM   915   C  CG    . ARG B 2  35  ? -43.628 -21.002 64.861 1.00 69.86  ? 35   ARG B CG    1 
ATOM   916   C  CD    . ARG B 2  35  ? -44.401 -20.467 66.053 1.00 75.74  ? 35   ARG B CD    1 
ATOM   917   N  NE    . ARG B 2  35  ? -43.481 -20.066 67.107 1.00 75.10  ? 35   ARG B NE    1 
ATOM   918   C  CZ    . ARG B 2  35  ? -43.477 -20.593 68.331 1.00 80.45  ? 35   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B 2  35  ? -44.373 -21.515 68.688 1.00 76.31  ? 35   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B 2  35  ? -42.585 -20.181 69.218 1.00 82.32  ? 35   ARG B NH2   1 
ATOM   921   N  N     . ARG B 2  36  ? -43.193 -21.197 61.115 1.00 71.50  ? 36   ARG B N     1 
ATOM   922   C  CA    . ARG B 2  36  ? -43.475 -22.327 60.219 1.00 67.15  ? 36   ARG B CA    1 
ATOM   923   C  C     . ARG B 2  36  ? -42.221 -22.768 59.476 1.00 67.02  ? 36   ARG B C     1 
ATOM   924   O  O     . ARG B 2  36  ? -41.930 -23.972 59.390 1.00 64.13  ? 36   ARG B O     1 
ATOM   925   C  CB    . ARG B 2  36  ? -44.594 -22.000 59.225 1.00 71.32  ? 36   ARG B CB    1 
ATOM   926   C  CG    . ARG B 2  36  ? -45.986 -22.069 59.826 1.00 72.66  ? 36   ARG B CG    1 
ATOM   927   C  CD    . ARG B 2  36  ? -47.047 -22.075 58.747 1.00 68.99  ? 36   ARG B CD    1 
ATOM   928   N  NE    . ARG B 2  36  ? -47.156 -20.826 57.996 1.00 70.39  ? 36   ARG B NE    1 
ATOM   929   C  CZ    . ARG B 2  36  ? -47.798 -19.743 58.427 1.00 71.71  ? 36   ARG B CZ    1 
ATOM   930   N  NH1   . ARG B 2  36  ? -48.361 -19.734 59.623 1.00 69.56  ? 36   ARG B NH1   1 
ATOM   931   N  NH2   . ARG B 2  36  ? -47.863 -18.659 57.666 1.00 72.93  ? 36   ARG B NH2   1 
ATOM   932   N  N     . LEU B 2  37  ? -41.478 -21.783 58.966 1.00 65.32  ? 37   LEU B N     1 
ATOM   933   C  CA    . LEU B 2  37  ? -40.240 -22.031 58.246 1.00 58.41  ? 37   LEU B CA    1 
ATOM   934   C  C     . LEU B 2  37  ? -39.243 -22.729 59.137 1.00 56.94  ? 37   LEU B C     1 
ATOM   935   O  O     . LEU B 2  37  ? -38.671 -23.746 58.762 1.00 60.74  ? 37   LEU B O     1 
ATOM   936   C  CB    . LEU B 2  37  ? -39.648 -20.728 57.756 1.00 58.21  ? 37   LEU B CB    1 
ATOM   937   C  CG    . LEU B 2  37  ? -40.345 -20.093 56.575 1.00 60.57  ? 37   LEU B CG    1 
ATOM   938   C  CD1   . LEU B 2  37  ? -39.914 -18.634 56.514 1.00 60.98  ? 37   LEU B CD1   1 
ATOM   939   C  CD2   . LEU B 2  37  ? -40.037 -20.856 55.288 1.00 58.05  ? 37   LEU B CD2   1 
ATOM   940   N  N     . ALA B 2  38  ? -39.046 -22.193 60.330 1.00 57.97  ? 38   ALA B N     1 
ATOM   941   C  CA    . ALA B 2  38  ? -38.181 -22.831 61.306 1.00 59.85  ? 38   ALA B CA    1 
ATOM   942   C  C     . ALA B 2  38  ? -38.580 -24.302 61.458 1.00 61.32  ? 38   ALA B C     1 
ATOM   943   O  O     . ALA B 2  38  ? -37.730 -25.196 61.521 1.00 59.51  ? 38   ALA B O     1 
ATOM   944   C  CB    . ALA B 2  38  ? -38.280 -22.109 62.644 1.00 56.27  ? 38   ALA B CB    1 
ATOM   945   N  N     . ARG B 2  39  ? -39.886 -24.542 61.497 1.00 60.52  ? 39   ARG B N     1 
ATOM   946   C  CA    . ARG B 2  39  ? -40.404 -25.865 61.777 1.00 63.15  ? 39   ARG B CA    1 
ATOM   947   C  C     . ARG B 2  39  ? -40.011 -26.813 60.661 1.00 64.76  ? 39   ARG B C     1 
ATOM   948   O  O     . ARG B 2  39  ? -39.528 -27.927 60.918 1.00 64.39  ? 39   ARG B O     1 
ATOM   949   C  CB    . ARG B 2  39  ? -41.927 -25.811 61.976 1.00 66.07  ? 39   ARG B CB    1 
ATOM   950   C  CG    . ARG B 2  39  ? -42.386 -25.080 63.243 1.00 61.35  ? 39   ARG B CG    1 
ATOM   951   C  CD    . ARG B 2  39  ? -42.206 -25.971 64.473 1.00 68.47  ? 39   ARG B CD    1 
ATOM   952   N  NE    . ARG B 2  39  ? -42.843 -25.425 65.678 1.00 72.24  ? 39   ARG B NE    1 
ATOM   953   C  CZ    . ARG B 2  39  ? -42.220 -24.694 66.596 1.00 76.08  ? 39   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B 2  39  ? -40.931 -24.396 66.473 1.00 75.05  ? 39   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B 2  39  ? -42.894 -24.253 67.640 1.00 80.24  ? 39   ARG B NH2   1 
ATOM   956   N  N     . ARG B 2  40  ? -40.181 -26.359 59.419 1.00 62.95  ? 40   ARG B N     1 
ATOM   957   C  CA    . ARG B 2  40  ? -39.787 -27.159 58.278 1.00 59.24  ? 40   ARG B CA    1 
ATOM   958   C  C     . ARG B 2  40  ? -38.308 -27.510 58.372 1.00 63.85  ? 40   ARG B C     1 
ATOM   959   O  O     . ARG B 2  40  ? -37.883 -28.589 57.952 1.00 66.50  ? 40   ARG B O     1 
ATOM   960   C  CB    . ARG B 2  40  ? -40.107 -26.440 56.971 1.00 60.49  ? 40   ARG B CB    1 
ATOM   961   C  CG    . ARG B 2  40  ? -39.929 -27.308 55.725 1.00 61.41  ? 40   ARG B CG    1 
ATOM   962   C  CD    . ARG B 2  40  ? -40.604 -26.715 54.504 1.00 61.99  ? 40   ARG B CD    1 
ATOM   963   N  NE    . ARG B 2  40  ? -42.009 -27.113 54.419 1.00 71.69  ? 40   ARG B NE    1 
ATOM   964   C  CZ    . ARG B 2  40  ? -42.916 -26.501 53.663 1.00 72.55  ? 40   ARG B CZ    1 
ATOM   965   N  NH1   . ARG B 2  40  ? -42.578 -25.446 52.933 1.00 71.08  ? 40   ARG B NH1   1 
ATOM   966   N  NH2   . ARG B 2  40  ? -44.163 -26.941 53.638 1.00 68.96  ? 40   ARG B NH2   1 
ATOM   967   N  N     . GLY B 2  41  ? -37.525 -26.594 58.935 1.00 66.88  ? 41   GLY B N     1 
ATOM   968   C  CA    . GLY B 2  41  ? -36.092 -26.829 59.163 1.00 61.37  ? 41   GLY B CA    1 
ATOM   969   C  C     . GLY B 2  41  ? -35.745 -27.615 60.418 1.00 57.61  ? 41   GLY B C     1 
ATOM   970   O  O     . GLY B 2  41  ? -34.580 -27.751 60.766 1.00 62.08  ? 41   GLY B O     1 
ATOM   971   N  N     . GLY B 2  42  ? -36.753 -28.134 61.105 1.00 56.66  ? 42   GLY B N     1 
ATOM   972   C  CA    . GLY B 2  42  ? -36.525 -29.005 62.246 1.00 55.73  ? 42   GLY B CA    1 
ATOM   973   C  C     . GLY B 2  42  ? -36.242 -28.297 63.551 1.00 53.45  ? 42   GLY B C     1 
ATOM   974   O  O     . GLY B 2  42  ? -35.603 -28.875 64.434 1.00 55.74  ? 42   GLY B O     1 
ATOM   975   N  N     . VAL B 2  43  ? -36.735 -27.069 63.678 1.00 53.16  ? 43   VAL B N     1 
ATOM   976   C  CA    . VAL B 2  43  ? -36.520 -26.249 64.871 1.00 59.87  ? 43   VAL B CA    1 
ATOM   977   C  C     . VAL B 2  43  ? -37.673 -26.378 65.878 1.00 61.47  ? 43   VAL B C     1 
ATOM   978   O  O     . VAL B 2  43  ? -38.824 -26.115 65.537 1.00 59.75  ? 43   VAL B O     1 
ATOM   979   C  CB    . VAL B 2  43  ? -36.314 -24.764 64.493 1.00 62.01  ? 43   VAL B CB    1 
ATOM   980   C  CG1   . VAL B 2  43  ? -36.040 -23.915 65.723 1.00 62.22  ? 43   VAL B CG1   1 
ATOM   981   C  CG2   . VAL B 2  43  ? -35.159 -24.620 63.513 1.00 67.52  ? 43   VAL B CG2   1 
ATOM   982   N  N     . LYS B 2  44  ? -37.339 -26.752 67.118 1.00 64.68  ? 44   LYS B N     1 
ATOM   983   C  CA    . LYS B 2  44  ? -38.308 -27.026 68.193 1.00 61.27  ? 44   LYS B CA    1 
ATOM   984   C  C     . LYS B 2  44  ? -38.610 -25.793 69.026 1.00 63.50  ? 44   LYS B C     1 
ATOM   985   O  O     . LYS B 2  44  ? -39.762 -25.490 69.290 1.00 71.74  ? 44   LYS B O     1 
ATOM   986   C  CB    . LYS B 2  44  ? -37.750 -28.106 69.112 1.00 62.93  ? 44   LYS B CB    1 
ATOM   987   C  CG    . LYS B 2  44  ? -38.691 -28.561 70.205 1.00 69.63  ? 44   LYS B CG    1 
ATOM   988   C  CD    . LYS B 2  44  ? -38.054 -29.641 71.082 1.00 73.65  ? 44   LYS B CD    1 
ATOM   989   C  CE    . LYS B 2  44  ? -39.117 -30.331 71.930 1.00 76.57  ? 44   LYS B CE    1 
ATOM   990   N  NZ    . LYS B 2  44  ? -38.555 -31.347 72.853 1.00 83.23  ? 44   LYS B NZ    1 
ATOM   991   N  N     . ARG B 2  45  ? -37.570 -25.085 69.446 1.00 64.73  ? 45   ARG B N     1 
ATOM   992   C  CA    . ARG B 2  45  ? -37.724 -23.974 70.354 1.00 64.88  ? 45   ARG B CA    1 
ATOM   993   C  C     . ARG B 2  45  ? -36.996 -22.755 69.793 1.00 67.75  ? 45   ARG B C     1 
ATOM   994   O  O     . ARG B 2  45  ? -35.853 -22.865 69.319 1.00 62.26  ? 45   ARG B O     1 
ATOM   995   C  CB    . ARG B 2  45  ? -37.183 -24.365 71.730 1.00 68.81  ? 45   ARG B CB    1 
ATOM   996   C  CG    . ARG B 2  45  ? -37.771 -23.578 72.885 1.00 71.87  ? 45   ARG B CG    1 
ATOM   997   C  CD    . ARG B 2  45  ? -37.446 -24.223 74.232 1.00 75.13  ? 45   ARG B CD    1 
ATOM   998   N  NE    . ARG B 2  45  ? -37.963 -23.386 75.314 1.00 79.16  ? 45   ARG B NE    1 
ATOM   999   C  CZ    . ARG B 2  45  ? -37.294 -22.376 75.884 1.00 86.14  ? 45   ARG B CZ    1 
ATOM   1000  N  NH1   . ARG B 2  45  ? -36.048 -22.081 75.524 1.00 77.92  ? 45   ARG B NH1   1 
ATOM   1001  N  NH2   . ARG B 2  45  ? -37.866 -21.657 76.837 1.00 90.83  ? 45   ARG B NH2   1 
ATOM   1002  N  N     . ILE B 2  46  ? -37.666 -21.597 69.884 1.00 66.72  ? 46   ILE B N     1 
ATOM   1003  C  CA    . ILE B 2  46  ? -37.247 -20.358 69.218 1.00 61.26  ? 46   ILE B CA    1 
ATOM   1004  C  C     . ILE B 2  46  ? -37.157 -19.125 70.145 1.00 63.76  ? 46   ILE B C     1 
ATOM   1005  O  O     . ILE B 2  46  ? -38.156 -18.641 70.649 1.00 66.15  ? 46   ILE B O     1 
ATOM   1006  C  CB    . ILE B 2  46  ? -38.189 -20.059 68.035 1.00 56.19  ? 46   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B 2  46  ? -38.211 -21.235 67.056 1.00 54.79  ? 46   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B 2  46  ? -37.778 -18.790 67.312 1.00 54.73  ? 46   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B 2  46  ? -39.420 -21.242 66.148 1.00 56.07  ? 46   ILE B CD1   1 
ATOM   1010  N  N     . SER B 2  47  ? -35.952 -18.603 70.350 1.00 66.99  ? 47   SER B N     1 
ATOM   1011  C  CA    . SER B 2  47  ? -35.775 -17.339 71.053 1.00 61.95  ? 47   SER B CA    1 
ATOM   1012  C  C     . SER B 2  47  ? -36.562 -16.207 70.408 1.00 64.65  ? 47   SER B C     1 
ATOM   1013  O  O     . SER B 2  47  ? -36.630 -16.094 69.179 1.00 64.14  ? 47   SER B O     1 
ATOM   1014  C  CB    . SER B 2  47  ? -34.301 -16.974 71.082 1.00 65.19  ? 47   SER B CB    1 
ATOM   1015  O  OG    . SER B 2  47  ? -34.112 -15.577 71.214 1.00 73.54  ? 47   SER B OG    1 
ATOM   1016  N  N     . GLY B 2  48  ? -37.125 -15.347 71.253 1.00 68.73  ? 48   GLY B N     1 
ATOM   1017  C  CA    . GLY B 2  48  ? -37.929 -14.199 70.808 1.00 67.07  ? 48   GLY B CA    1 
ATOM   1018  C  C     . GLY B 2  48  ? -37.237 -13.250 69.840 1.00 71.06  ? 48   GLY B C     1 
ATOM   1019  O  O     . GLY B 2  48  ? -37.909 -12.569 69.050 1.00 73.12  ? 48   GLY B O     1 
ATOM   1020  N  N     . LEU B 2  49  ? -35.901 -13.213 69.876 1.00 65.00  ? 49   LEU B N     1 
ATOM   1021  C  CA    . LEU B 2  49  ? -35.154 -12.245 69.087 1.00 65.09  ? 49   LEU B CA    1 
ATOM   1022  C  C     . LEU B 2  49  ? -34.946 -12.715 67.641 1.00 68.64  ? 49   LEU B C     1 
ATOM   1023  O  O     . LEU B 2  49  ? -34.517 -11.934 66.769 1.00 62.57  ? 49   LEU B O     1 
ATOM   1024  C  CB    . LEU B 2  49  ? -33.834 -11.889 69.775 1.00 65.00  ? 49   LEU B CB    1 
ATOM   1025  C  CG    . LEU B 2  49  ? -33.966 -11.112 71.100 1.00 62.75  ? 49   LEU B CG    1 
ATOM   1026  C  CD1   . LEU B 2  49  ? -32.873 -11.517 72.079 1.00 58.65  ? 49   LEU B CD1   1 
ATOM   1027  C  CD2   . LEU B 2  49  ? -33.986 -9.608  70.876 1.00 59.69  ? 49   LEU B CD2   1 
ATOM   1028  N  N     . ILE B 2  50  ? -35.286 -13.987 67.401 1.00 67.89  ? 50   ILE B N     1 
ATOM   1029  C  CA    . ILE B 2  50  ? -35.090 -14.631 66.099 1.00 65.37  ? 50   ILE B CA    1 
ATOM   1030  C  C     . ILE B 2  50  ? -35.872 -13.948 64.987 1.00 66.61  ? 50   ILE B C     1 
ATOM   1031  O  O     . ILE B 2  50  ? -35.391 -13.854 63.859 1.00 73.48  ? 50   ILE B O     1 
ATOM   1032  C  CB    . ILE B 2  50  ? -35.442 -16.135 66.136 1.00 63.27  ? 50   ILE B CB    1 
ATOM   1033  C  CG1   . ILE B 2  50  ? -34.454 -16.921 67.025 1.00 64.99  ? 50   ILE B CG1   1 
ATOM   1034  C  CG2   . ILE B 2  50  ? -35.481 -16.723 64.733 1.00 59.41  ? 50   ILE B CG2   1 
ATOM   1035  C  CD1   . ILE B 2  50  ? -33.074 -17.146 66.432 1.00 62.78  ? 50   ILE B CD1   1 
ATOM   1036  N  N     . TYR B 2  51  ? -37.055 -13.444 65.312 1.00 64.23  ? 51   TYR B N     1 
ATOM   1037  C  CA    . TYR B 2  51  ? -37.946 -12.894 64.300 1.00 64.28  ? 51   TYR B CA    1 
ATOM   1038  C  C     . TYR B 2  51  ? -37.356 -11.658 63.631 1.00 66.77  ? 51   TYR B C     1 
ATOM   1039  O  O     . TYR B 2  51  ? -37.345 -11.559 62.399 1.00 66.75  ? 51   TYR B O     1 
ATOM   1040  C  CB    . TYR B 2  51  ? -39.358 -12.683 64.872 1.00 64.29  ? 51   TYR B CB    1 
ATOM   1041  C  CG    . TYR B 2  51  ? -39.832 -13.927 65.607 1.00 62.06  ? 51   TYR B CG    1 
ATOM   1042  C  CD1   . TYR B 2  51  ? -40.284 -15.050 64.908 1.00 58.66  ? 51   TYR B CD1   1 
ATOM   1043  C  CD2   . TYR B 2  51  ? -39.772 -13.996 66.996 1.00 55.84  ? 51   TYR B CD2   1 
ATOM   1044  C  CE1   . TYR B 2  51  ? -40.665 -16.198 65.580 1.00 61.17  ? 51   TYR B CE1   1 
ATOM   1045  C  CE2   . TYR B 2  51  ? -40.158 -15.127 67.675 1.00 55.11  ? 51   TYR B CE2   1 
ATOM   1046  C  CZ    . TYR B 2  51  ? -40.602 -16.235 66.979 1.00 61.17  ? 51   TYR B CZ    1 
ATOM   1047  O  OH    . TYR B 2  51  ? -40.971 -17.386 67.683 1.00 57.86  ? 51   TYR B OH    1 
ATOM   1048  N  N     . GLU B 2  52  ? -36.825 -10.738 64.433 1.00 69.95  ? 52   GLU B N     1 
ATOM   1049  C  CA    . GLU B 2  52  ? -36.168 -9.564  63.861 1.00 70.13  ? 52   GLU B CA    1 
ATOM   1050  C  C     . GLU B 2  52  ? -34.938 -9.979  63.080 1.00 67.15  ? 52   GLU B C     1 
ATOM   1051  O  O     . GLU B 2  52  ? -34.780 -9.545  61.933 1.00 71.94  ? 52   GLU B O     1 
ATOM   1052  C  CB    . GLU B 2  52  ? -35.857 -8.472  64.906 1.00 71.76  ? 52   GLU B CB    1 
ATOM   1053  C  CG    . GLU B 2  52  ? -37.046 -7.578  65.277 1.00 72.27  ? 52   GLU B CG    1 
ATOM   1054  C  CD    . GLU B 2  52  ? -37.679 -6.872  64.082 1.00 79.89  ? 52   GLU B CD    1 
ATOM   1055  O  OE1   . GLU B 2  52  ? -37.007 -6.006  63.477 1.00 81.73  ? 52   GLU B OE1   1 
ATOM   1056  O  OE2   . GLU B 2  52  ? -38.853 -7.181  63.743 1.00 81.92  ? 52   GLU B OE2   1 
ATOM   1057  N  N     . GLU B 2  53  ? -34.111 -10.848 63.670 1.00 61.99  ? 53   GLU B N     1 
ATOM   1058  C  CA    . GLU B 2  53  ? -32.912 -11.371 62.990 1.00 63.10  ? 53   GLU B CA    1 
ATOM   1059  C  C     . GLU B 2  53  ? -33.237 -11.966 61.595 1.00 64.01  ? 53   GLU B C     1 
ATOM   1060  O  O     . GLU B 2  53  ? -32.612 -11.603 60.591 1.00 63.52  ? 53   GLU B O     1 
ATOM   1061  C  CB    . GLU B 2  53  ? -32.184 -12.387 63.878 1.00 61.06  ? 53   GLU B CB    1 
ATOM   1062  C  CG    . GLU B 2  53  ? -30.770 -12.766 63.436 1.00 65.68  ? 53   GLU B CG    1 
ATOM   1063  C  CD    . GLU B 2  53  ? -29.711 -11.713 63.751 1.00 72.45  ? 53   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B 2  53  ? -29.873 -10.969 64.753 1.00 71.69  ? 53   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B 2  53  ? -28.700 -11.638 62.997 1.00 69.32  ? 53   GLU B OE2   1 
ATOM   1066  N  N     . THR B 2  54  ? -34.237 -12.843 61.545 1.00 58.36  ? 54   THR B N     1 
ATOM   1067  C  CA    . THR B 2  54  ? -34.639 -13.487 60.312 1.00 58.65  ? 54   THR B CA    1 
ATOM   1068  C  C     . THR B 2  54  ? -35.067 -12.477 59.251 1.00 64.11  ? 54   THR B C     1 
ATOM   1069  O  O     . THR B 2  54  ? -34.704 -12.603 58.057 1.00 62.69  ? 54   THR B O     1 
ATOM   1070  C  CB    . THR B 2  54  ? -35.764 -14.512 60.557 1.00 59.68  ? 54   THR B CB    1 
ATOM   1071  O  OG1   . THR B 2  54  ? -35.303 -15.530 61.460 1.00 56.16  ? 54   THR B OG1   1 
ATOM   1072  C  CG2   . THR B 2  54  ? -36.213 -15.161 59.251 1.00 55.08  ? 54   THR B CG2   1 
ATOM   1073  N  N     . ARG B 2  55  ? -35.821 -11.464 59.679 1.00 66.01  ? 55   ARG B N     1 
ATOM   1074  C  CA    . ARG B 2  55  ? -36.261 -10.415 58.746 1.00 64.22  ? 55   ARG B CA    1 
ATOM   1075  C  C     . ARG B 2  55  ? -35.045 -9.734  58.133 1.00 60.50  ? 55   ARG B C     1 
ATOM   1076  O  O     . ARG B 2  55  ? -34.990 -9.512  56.920 1.00 56.89  ? 55   ARG B O     1 
ATOM   1077  C  CB    . ARG B 2  55  ? -37.198 -9.421  59.423 1.00 63.95  ? 55   ARG B CB    1 
ATOM   1078  C  CG    . ARG B 2  55  ? -38.508 -10.059 59.864 1.00 71.54  ? 55   ARG B CG    1 
ATOM   1079  C  CD    . ARG B 2  55  ? -39.534 -9.041  60.358 1.00 74.46  ? 55   ARG B CD    1 
ATOM   1080  N  NE    . ARG B 2  55  ? -40.710 -9.713  60.906 1.00 64.77  ? 55   ARG B NE    1 
ATOM   1081  C  CZ    . ARG B 2  55  ? -40.900 -9.962  62.200 1.00 62.55  ? 55   ARG B CZ    1 
ATOM   1082  N  NH1   . ARG B 2  55  ? -40.004 -9.572  63.105 1.00 58.90  ? 55   ARG B NH1   1 
ATOM   1083  N  NH2   . ARG B 2  55  ? -41.999 -10.604 62.588 1.00 62.06  ? 55   ARG B NH2   1 
ATOM   1084  N  N     . GLY B 2  56  ? -34.052 -9.466  58.981 1.00 60.50  ? 56   GLY B N     1 
ATOM   1085  C  CA    . GLY B 2  56  ? -32.803 -8.849  58.547 1.00 61.36  ? 56   GLY B CA    1 
ATOM   1086  C  C     . GLY B 2  56  ? -32.129 -9.657  57.460 1.00 60.00  ? 56   GLY B C     1 
ATOM   1087  O  O     . GLY B 2  56  ? -31.799 -9.125  56.383 1.00 64.29  ? 56   GLY B O     1 
ATOM   1088  N  N     . VAL B 2  57  ? -31.957 -10.946 57.750 1.00 55.27  ? 57   VAL B N     1 
ATOM   1089  C  CA    . VAL B 2  57  ? -31.363 -11.912 56.839 1.00 53.86  ? 57   VAL B CA    1 
ATOM   1090  C  C     . VAL B 2  57  ? -32.161 -12.014 55.529 1.00 54.56  ? 57   VAL B C     1 
ATOM   1091  O  O     . VAL B 2  57  ? -31.576 -12.037 54.443 1.00 53.07  ? 57   VAL B O     1 
ATOM   1092  C  CB    . VAL B 2  57  ? -31.251 -13.293 57.524 1.00 55.59  ? 57   VAL B CB    1 
ATOM   1093  C  CG1   . VAL B 2  57  ? -31.048 -14.405 56.500 1.00 58.67  ? 57   VAL B CG1   1 
ATOM   1094  C  CG2   . VAL B 2  57  ? -30.137 -13.311 58.571 1.00 50.57  ? 57   VAL B CG2   1 
ATOM   1095  N  N     . LEU B 2  58  ? -33.491 -12.054 55.627 1.00 54.38  ? 58   LEU B N     1 
ATOM   1096  C  CA    . LEU B 2  58  ? -34.314 -12.187 54.429 1.00 54.44  ? 58   LEU B CA    1 
ATOM   1097  C  C     . LEU B 2  58  ? -34.216 -10.936 53.540 1.00 61.06  ? 58   LEU B C     1 
ATOM   1098  O  O     . LEU B 2  58  ? -34.188 -11.029 52.281 1.00 61.52  ? 58   LEU B O     1 
ATOM   1099  C  CB    . LEU B 2  58  ? -35.758 -12.521 54.801 1.00 53.90  ? 58   LEU B CB    1 
ATOM   1100  C  CG    . LEU B 2  58  ? -36.813 -12.434 53.692 1.00 55.24  ? 58   LEU B CG    1 
ATOM   1101  C  CD1   . LEU B 2  58  ? -36.495 -13.332 52.502 1.00 50.55  ? 58   LEU B CD1   1 
ATOM   1102  C  CD2   . LEU B 2  58  ? -38.212 -12.700 54.242 1.00 54.16  ? 58   LEU B CD2   1 
ATOM   1103  N  N     . LYS B 2  59  ? -34.143 -9.774  54.194 1.00 59.27  ? 59   LYS B N     1 
ATOM   1104  C  CA    . LYS B 2  59  ? -33.991 -8.518  53.481 1.00 60.63  ? 59   LYS B CA    1 
ATOM   1105  C  C     . LYS B 2  59  ? -32.685 -8.487  52.684 1.00 59.45  ? 59   LYS B C     1 
ATOM   1106  O  O     . LYS B 2  59  ? -32.692 -8.047  51.524 1.00 62.10  ? 59   LYS B O     1 
ATOM   1107  C  CB    . LYS B 2  59  ? -34.104 -7.328  54.430 1.00 65.91  ? 59   LYS B CB    1 
ATOM   1108  C  CG    . LYS B 2  59  ? -34.073 -5.960  53.753 1.00 70.53  ? 59   LYS B CG    1 
ATOM   1109  C  CD    . LYS B 2  59  ? -34.569 -4.876  54.706 1.00 78.44  ? 59   LYS B CD    1 
ATOM   1110  C  CE    . LYS B 2  59  ? -34.187 -3.479  54.232 1.00 79.31  ? 59   LYS B CE    1 
ATOM   1111  N  NZ    . LYS B 2  59  ? -32.816 -3.099  54.675 1.00 68.63  ? 59   LYS B NZ    1 
ATOM   1112  N  N     . VAL B 2  60  ? -31.590 -8.984  53.274 1.00 52.81  ? 60   VAL B N     1 
ATOM   1113  C  CA    . VAL B 2  60  ? -30.297 -8.980  52.571 1.00 51.04  ? 60   VAL B CA    1 
ATOM   1114  C  C     . VAL B 2  60  ? -30.363 -9.946  51.390 1.00 52.17  ? 60   VAL B C     1 
ATOM   1115  O  O     . VAL B 2  60  ? -29.825 -9.669  50.310 1.00 52.33  ? 60   VAL B O     1 
ATOM   1116  C  CB    . VAL B 2  60  ? -29.130 -9.386  53.480 1.00 49.93  ? 60   VAL B CB    1 
ATOM   1117  C  CG1   . VAL B 2  60  ? -27.899 -9.651  52.643 1.00 53.59  ? 60   VAL B CG1   1 
ATOM   1118  C  CG2   . VAL B 2  60  ? -28.815 -8.324  54.517 1.00 52.04  ? 60   VAL B CG2   1 
ATOM   1119  N  N     . PHE B 2  61  ? -31.042 -11.074 51.601 1.00 51.83  ? 61   PHE B N     1 
ATOM   1120  C  CA    . PHE B 2  61  ? -31.192 -12.077 50.568 1.00 53.84  ? 61   PHE B CA    1 
ATOM   1121  C  C     . PHE B 2  61  ? -31.921 -11.459 49.382 1.00 58.21  ? 61   PHE B C     1 
ATOM   1122  O  O     . PHE B 2  61  ? -31.402 -11.434 48.262 1.00 64.02  ? 61   PHE B O     1 
ATOM   1123  C  CB    . PHE B 2  61  ? -31.911 -13.342 51.087 1.00 52.67  ? 61   PHE B CB    1 
ATOM   1124  C  CG    . PHE B 2  61  ? -32.059 -14.425 50.038 1.00 54.97  ? 61   PHE B CG    1 
ATOM   1125  C  CD1   . PHE B 2  61  ? -31.050 -15.351 49.808 1.00 52.46  ? 61   PHE B CD1   1 
ATOM   1126  C  CD2   . PHE B 2  61  ? -33.206 -14.509 49.256 1.00 57.77  ? 61   PHE B CD2   1 
ATOM   1127  C  CE1   . PHE B 2  61  ? -31.187 -16.339 48.833 1.00 50.89  ? 61   PHE B CE1   1 
ATOM   1128  C  CE2   . PHE B 2  61  ? -33.346 -15.496 48.276 1.00 55.02  ? 61   PHE B CE2   1 
ATOM   1129  C  CZ    . PHE B 2  61  ? -32.338 -16.408 48.063 1.00 50.27  ? 61   PHE B CZ    1 
ATOM   1130  N  N     . LEU B 2  62  ? -33.107 -10.920 49.635 1.00 59.00  ? 62   LEU B N     1 
ATOM   1131  C  CA    . LEU B 2  62  ? -33.885 -10.328 48.553 1.00 59.60  ? 62   LEU B CA    1 
ATOM   1132  C  C     . LEU B 2  62  ? -33.171 -9.167  47.864 1.00 58.76  ? 62   LEU B C     1 
ATOM   1133  O  O     . LEU B 2  62  ? -33.184 -9.077  46.634 1.00 59.48  ? 62   LEU B O     1 
ATOM   1134  C  CB    . LEU B 2  62  ? -35.279 -9.930  49.036 1.00 59.66  ? 62   LEU B CB    1 
ATOM   1135  C  CG    . LEU B 2  62  ? -36.169 -11.130 49.359 1.00 56.47  ? 62   LEU B CG    1 
ATOM   1136  C  CD1   . LEU B 2  62  ? -37.460 -10.649 49.970 1.00 58.09  ? 62   LEU B CD1   1 
ATOM   1137  C  CD2   . LEU B 2  62  ? -36.432 -11.959 48.104 1.00 54.62  ? 62   LEU B CD2   1 
ATOM   1138  N  N     . GLU B 2  63  ? -32.538 -8.291  48.645 1.00 55.08  ? 63   GLU B N     1 
ATOM   1139  C  CA    . GLU B 2  63  ? -31.762 -7.218  48.056 1.00 53.93  ? 63   GLU B CA    1 
ATOM   1140  C  C     . GLU B 2  63  ? -30.816 -7.779  47.020 1.00 53.88  ? 63   GLU B C     1 
ATOM   1141  O  O     . GLU B 2  63  ? -30.888 -7.387  45.851 1.00 53.60  ? 63   GLU B O     1 
ATOM   1142  C  CB    . GLU B 2  63  ? -31.001 -6.426  49.103 1.00 54.37  ? 63   GLU B CB    1 
ATOM   1143  C  CG    . GLU B 2  63  ? -31.814 -5.324  49.738 1.00 58.23  ? 63   GLU B CG    1 
ATOM   1144  C  CD    . GLU B 2  63  ? -31.294 -4.912  51.099 1.00 66.39  ? 63   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B 2  63  ? -30.077 -5.060  51.351 1.00 69.77  ? 63   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B 2  63  ? -32.111 -4.442  51.926 1.00 70.16  ? 63   GLU B OE2   1 
ATOM   1147  N  N     . ASN B 2  64  ? -29.967 -8.724  47.434 1.00 57.33  ? 64   ASN B N     1 
ATOM   1148  C  CA    . ASN B 2  64  ? -28.902 -9.228  46.553 1.00 58.08  ? 64   ASN B CA    1 
ATOM   1149  C  C     . ASN B 2  64  ? -29.433 -9.838  45.270 1.00 57.84  ? 64   ASN B C     1 
ATOM   1150  O  O     . ASN B 2  64  ? -28.895 -9.569  44.187 1.00 60.41  ? 64   ASN B O     1 
ATOM   1151  C  CB    . ASN B 2  64  ? -27.985 -10.196 47.280 1.00 58.44  ? 64   ASN B CB    1 
ATOM   1152  C  CG    . ASN B 2  64  ? -27.119 -9.510  48.294 1.00 63.21  ? 64   ASN B CG    1 
ATOM   1153  O  OD1   . ASN B 2  64  ? -26.504 -8.493  48.005 1.00 80.88  ? 64   ASN B OD1   1 
ATOM   1154  N  ND2   . ASN B 2  64  ? -27.065 -10.051 49.489 1.00 65.55  ? 64   ASN B ND2   1 
ATOM   1155  N  N     . VAL B 2  65  ? -30.503 -10.624 45.402 1.00 53.35  ? 65   VAL B N     1 
ATOM   1156  C  CA    . VAL B 2  65  ? -31.103 -11.312 44.275 1.00 55.79  ? 65   VAL B CA    1 
ATOM   1157  C  C     . VAL B 2  65  ? -31.851 -10.351 43.361 1.00 58.08  ? 65   VAL B C     1 
ATOM   1158  O  O     . VAL B 2  65  ? -31.647 -10.384 42.140 1.00 57.81  ? 65   VAL B O     1 
ATOM   1159  C  CB    . VAL B 2  65  ? -32.047 -12.427 44.744 1.00 54.48  ? 65   VAL B CB    1 
ATOM   1160  C  CG1   . VAL B 2  65  ? -32.556 -13.201 43.548 1.00 53.46  ? 65   VAL B CG1   1 
ATOM   1161  C  CG2   . VAL B 2  65  ? -31.319 -13.359 45.699 1.00 55.73  ? 65   VAL B CG2   1 
ATOM   1162  N  N     . ILE B 2  66  ? -32.702 -9.510  43.966 1.00 57.61  ? 66   ILE B N     1 
ATOM   1163  C  CA    . ILE B 2  66  ? -33.500 -8.525  43.253 1.00 58.05  ? 66   ILE B CA    1 
ATOM   1164  C  C     . ILE B 2  66  ? -32.598 -7.535  42.501 1.00 61.39  ? 66   ILE B C     1 
ATOM   1165  O  O     . ILE B 2  66  ? -32.794 -7.304  41.298 1.00 57.63  ? 66   ILE B O     1 
ATOM   1166  C  CB    . ILE B 2  66  ? -34.502 -7.808  44.195 1.00 65.35  ? 66   ILE B CB    1 
ATOM   1167  C  CG1   . ILE B 2  66  ? -35.653 -8.762  44.558 1.00 63.13  ? 66   ILE B CG1   1 
ATOM   1168  C  CG2   . ILE B 2  66  ? -35.084 -6.554  43.535 1.00 67.90  ? 66   ILE B CG2   1 
ATOM   1169  C  CD1   . ILE B 2  66  ? -36.489 -8.363  45.754 1.00 57.42  ? 66   ILE B CD1   1 
ATOM   1170  N  N     . ARG B 2  67  ? -31.597 -6.980  43.192 1.00 60.76  ? 67   ARG B N     1 
ATOM   1171  C  CA    . ARG B 2  67  ? -30.622 -6.107  42.541 1.00 57.68  ? 67   ARG B CA    1 
ATOM   1172  C  C     . ARG B 2  67  ? -30.170 -6.710  41.214 1.00 57.83  ? 67   ARG B C     1 
ATOM   1173  O  O     . ARG B 2  67  ? -30.252 -6.050  40.190 1.00 59.43  ? 67   ARG B O     1 
ATOM   1174  C  CB    . ARG B 2  67  ? -29.433 -5.810  43.464 1.00 62.34  ? 67   ARG B CB    1 
ATOM   1175  C  CG    . ARG B 2  67  ? -28.317 -4.980  42.821 1.00 70.85  ? 67   ARG B CG    1 
ATOM   1176  C  CD    . ARG B 2  67  ? -27.036 -4.995  43.659 1.00 76.81  ? 67   ARG B CD    1 
ATOM   1177  N  NE    . ARG B 2  67  ? -27.196 -4.289  44.939 1.00 82.97  ? 67   ARG B NE    1 
ATOM   1178  C  CZ    . ARG B 2  67  ? -27.044 -4.836  46.144 1.00 83.80  ? 67   ARG B CZ    1 
ATOM   1179  N  NH1   . ARG B 2  67  ? -26.713 -6.118  46.277 1.00 84.65  ? 67   ARG B NH1   1 
ATOM   1180  N  NH2   . ARG B 2  67  ? -27.206 -4.082  47.222 1.00 83.59  ? 67   ARG B NH2   1 
ATOM   1181  N  N     . ASP B 2  68  ? -29.741 -7.975  41.246 1.00 60.36  ? 68   ASP B N     1 
ATOM   1182  C  CA    . ASP B 2  68  ? -29.221 -8.678  40.074 1.00 58.98  ? 68   ASP B CA    1 
ATOM   1183  C  C     . ASP B 2  68  ? -30.307 -8.906  39.031 1.00 60.29  ? 68   ASP B C     1 
ATOM   1184  O  O     . ASP B 2  68  ? -30.044 -8.750  37.842 1.00 62.64  ? 68   ASP B O     1 
ATOM   1185  C  CB    . ASP B 2  68  ? -28.580 -10.016 40.469 1.00 59.18  ? 68   ASP B CB    1 
ATOM   1186  C  CG    . ASP B 2  68  ? -27.161 -9.868  41.022 1.00 60.08  ? 68   ASP B CG    1 
ATOM   1187  O  OD1   . ASP B 2  68  ? -26.814 -8.842  41.640 1.00 62.86  ? 68   ASP B OD1   1 
ATOM   1188  O  OD2   . ASP B 2  68  ? -26.371 -10.811 40.863 1.00 61.61  ? 68   ASP B OD2   1 
ATOM   1189  N  N     . ALA B 2  69  ? -31.519 -9.265  39.464 1.00 59.19  ? 69   ALA B N     1 
ATOM   1190  C  CA    . ALA B 2  69  ? -32.655 -9.488  38.533 1.00 60.19  ? 69   ALA B CA    1 
ATOM   1191  C  C     . ALA B 2  69  ? -33.009 -8.218  37.779 1.00 62.70  ? 69   ALA B C     1 
ATOM   1192  O  O     . ALA B 2  69  ? -33.022 -8.193  36.544 1.00 63.39  ? 69   ALA B O     1 
ATOM   1193  C  CB    . ALA B 2  69  ? -33.880 -9.994  39.277 1.00 57.88  ? 69   ALA B CB    1 
ATOM   1194  N  N     . VAL B 2  70  ? -33.275 -7.159  38.542 1.00 65.20  ? 70   VAL B N     1 
ATOM   1195  C  CA    . VAL B 2  70  ? -33.538 -5.846  37.983 1.00 59.51  ? 70   VAL B CA    1 
ATOM   1196  C  C     . VAL B 2  70  ? -32.436 -5.473  37.000 1.00 58.83  ? 70   VAL B C     1 
ATOM   1197  O  O     . VAL B 2  70  ? -32.731 -5.032  35.899 1.00 64.96  ? 70   VAL B O     1 
ATOM   1198  C  CB    . VAL B 2  70  ? -33.735 -4.800  39.088 1.00 57.69  ? 70   VAL B CB    1 
ATOM   1199  C  CG1   . VAL B 2  70  ? -33.855 -3.401  38.508 1.00 58.03  ? 70   VAL B CG1   1 
ATOM   1200  C  CG2   . VAL B 2  70  ? -34.974 -5.162  39.897 1.00 55.82  ? 70   VAL B CG2   1 
ATOM   1201  N  N     . THR B 2  71  ? -31.178 -5.701  37.360 1.00 54.50  ? 71   THR B N     1 
ATOM   1202  C  CA    . THR B 2  71  ? -30.084 -5.416  36.433 1.00 54.53  ? 71   THR B CA    1 
ATOM   1203  C  C     . THR B 2  71  ? -30.248 -6.127  35.103 1.00 56.48  ? 71   THR B C     1 
ATOM   1204  O  O     . THR B 2  71  ? -29.825 -5.627  34.075 1.00 58.47  ? 71   THR B O     1 
ATOM   1205  C  CB    . THR B 2  71  ? -28.727 -5.776  37.028 1.00 53.27  ? 71   THR B CB    1 
ATOM   1206  O  OG1   . THR B 2  71  ? -28.620 -5.207  38.332 1.00 59.49  ? 71   THR B OG1   1 
ATOM   1207  C  CG2   . THR B 2  71  ? -27.610 -5.243  36.172 1.00 51.90  ? 71   THR B CG2   1 
ATOM   1208  N  N     . TYR B 2  72  ? -30.857 -7.305  35.129 1.00 65.07  ? 72   TYR B N     1 
ATOM   1209  C  CA    . TYR B 2  72  ? -31.141 -8.043  33.898 1.00 66.93  ? 72   TYR B CA    1 
ATOM   1210  C  C     . TYR B 2  72  ? -32.253 -7.371  33.129 1.00 69.98  ? 72   TYR B C     1 
ATOM   1211  O  O     . TYR B 2  72  ? -32.129 -7.192  31.925 1.00 69.64  ? 72   TYR B O     1 
ATOM   1212  C  CB    . TYR B 2  72  ? -31.496 -9.498  34.196 1.00 65.65  ? 72   TYR B CB    1 
ATOM   1213  C  CG    . TYR B 2  72  ? -30.271 -10.351 34.461 1.00 63.61  ? 72   TYR B CG    1 
ATOM   1214  C  CD1   . TYR B 2  72  ? -30.068 -10.951 35.700 1.00 54.58  ? 72   TYR B CD1   1 
ATOM   1215  C  CD2   . TYR B 2  72  ? -29.308 -10.546 33.461 1.00 62.96  ? 72   TYR B CD2   1 
ATOM   1216  C  CE1   . TYR B 2  72  ? -28.952 -11.730 35.930 1.00 52.80  ? 72   TYR B CE1   1 
ATOM   1217  C  CE2   . TYR B 2  72  ? -28.193 -11.326 33.688 1.00 60.65  ? 72   TYR B CE2   1 
ATOM   1218  C  CZ    . TYR B 2  72  ? -28.025 -11.909 34.930 1.00 54.35  ? 72   TYR B CZ    1 
ATOM   1219  O  OH    . TYR B 2  72  ? -26.913 -12.660 35.161 1.00 53.97  ? 72   TYR B OH    1 
ATOM   1220  N  N     . THR B 2  73  ? -33.317 -6.994  33.850 1.00 70.55  ? 73   THR B N     1 
ATOM   1221  C  CA    . THR B 2  73  ? -34.456 -6.243  33.314 1.00 67.38  ? 73   THR B CA    1 
ATOM   1222  C  C     . THR B 2  73  ? -34.023 -4.984  32.567 1.00 70.81  ? 73   THR B C     1 
ATOM   1223  O  O     . THR B 2  73  ? -34.281 -4.869  31.360 1.00 75.72  ? 73   THR B O     1 
ATOM   1224  C  CB    . THR B 2  73  ? -35.421 -5.844  34.434 1.00 63.24  ? 73   THR B CB    1 
ATOM   1225  O  OG1   . THR B 2  73  ? -35.648 -6.980  35.267 1.00 66.01  ? 73   THR B OG1   1 
ATOM   1226  C  CG2   . THR B 2  73  ? -36.741 -5.375  33.863 1.00 63.84  ? 73   THR B CG2   1 
ATOM   1227  N  N     . GLU B 2  74  ? -33.377 -4.055  33.281 1.00 71.11  ? 74   GLU B N     1 
ATOM   1228  C  CA    . GLU B 2  74  ? -32.820 -2.832  32.688 1.00 73.81  ? 74   GLU B CA    1 
ATOM   1229  C  C     . GLU B 2  74  ? -32.028 -3.151  31.430 1.00 76.22  ? 74   GLU B C     1 
ATOM   1230  O  O     . GLU B 2  74  ? -32.134 -2.443  30.428 1.00 79.77  ? 74   GLU B O     1 
ATOM   1231  C  CB    . GLU B 2  74  ? -31.906 -2.081  33.664 1.00 80.15  ? 74   GLU B CB    1 
ATOM   1232  C  CG    . GLU B 2  74  ? -32.614 -1.096  34.588 1.00 93.74  ? 74   GLU B CG    1 
ATOM   1233  C  CD    . GLU B 2  74  ? -31.740 -0.611  35.745 1.00 106.96 ? 74   GLU B CD    1 
ATOM   1234  O  OE1   . GLU B 2  74  ? -32.218 0.252   36.514 1.00 115.81 ? 74   GLU B OE1   1 
ATOM   1235  O  OE2   . GLU B 2  74  ? -30.585 -1.086  35.904 1.00 110.38 ? 74   GLU B OE2   1 
ATOM   1236  N  N     . HIS B 2  75  ? -31.246 -4.225  31.462 1.00 73.28  ? 75   HIS B N     1 
ATOM   1237  C  CA    . HIS B 2  75  ? -30.444 -4.531  30.299 1.00 71.48  ? 75   HIS B CA    1 
ATOM   1238  C  C     . HIS B 2  75  ? -31.302 -4.861  29.119 1.00 70.85  ? 75   HIS B C     1 
ATOM   1239  O  O     . HIS B 2  75  ? -31.014 -4.439  28.017 1.00 75.88  ? 75   HIS B O     1 
ATOM   1240  C  CB    . HIS B 2  75  ? -29.447 -5.629  30.572 1.00 67.72  ? 75   HIS B CB    1 
ATOM   1241  C  CG    . HIS B 2  75  ? -28.510 -5.865  29.433 1.00 62.71  ? 75   HIS B CG    1 
ATOM   1242  N  ND1   . HIS B 2  75  ? -27.366 -5.186  29.296 1.00 61.65  ? 75   HIS B ND1   1 
ATOM   1243  C  CD2   . HIS B 2  75  ? -28.595 -6.728  28.349 1.00 62.88  ? 75   HIS B CD2   1 
ATOM   1244  C  CE1   . HIS B 2  75  ? -26.730 -5.600  28.185 1.00 65.67  ? 75   HIS B CE1   1 
ATOM   1245  N  NE2   . HIS B 2  75  ? -27.491 -6.543  27.603 1.00 66.01  ? 75   HIS B NE2   1 
ATOM   1246  N  N     . ALA B 2  76  ? -32.377 -5.603  29.355 1.00 76.94  ? 76   ALA B N     1 
ATOM   1247  C  CA    . ALA B 2  76  ? -33.301 -6.031  28.315 1.00 75.89  ? 76   ALA B CA    1 
ATOM   1248  C  C     . ALA B 2  76  ? -34.264 -4.898  27.912 1.00 84.69  ? 76   ALA B C     1 
ATOM   1249  O  O     . ALA B 2  76  ? -35.215 -5.113  27.143 1.00 81.98  ? 76   ALA B O     1 
ATOM   1250  C  CB    . ALA B 2  76  ? -34.075 -7.236  28.807 1.00 73.34  ? 76   ALA B CB    1 
ATOM   1251  N  N     . LYS B 2  77  ? -34.006 -3.697  28.437 1.00 81.94  ? 77   LYS B N     1 
ATOM   1252  C  CA    . LYS B 2  77  ? -34.831 -2.517  28.183 1.00 78.36  ? 77   LYS B CA    1 
ATOM   1253  C  C     . LYS B 2  77  ? -36.309 -2.808  28.443 1.00 76.54  ? 77   LYS B C     1 
ATOM   1254  O  O     . LYS B 2  77  ? -37.166 -2.398  27.667 1.00 79.38  ? 77   LYS B O     1 
ATOM   1255  C  CB    . LYS B 2  77  ? -34.621 -2.002  26.755 1.00 77.01  ? 77   LYS B CB    1 
ATOM   1256  C  CG    . LYS B 2  77  ? -33.190 -1.615  26.426 1.00 82.32  ? 77   LYS B CG    1 
ATOM   1257  C  CD    . LYS B 2  77  ? -32.934 -1.675  24.922 1.00 89.33  ? 77   LYS B CD    1 
ATOM   1258  C  CE    . LYS B 2  77  ? -31.485 -1.324  24.586 1.00 92.61  ? 77   LYS B CE    1 
ATOM   1259  N  NZ    . LYS B 2  77  ? -31.195 -1.356  23.117 1.00 99.78  ? 77   LYS B NZ    1 
ATOM   1260  N  N     . ARG B 2  78  ? -36.600 -3.522  29.528 1.00 71.49  ? 78   ARG B N     1 
ATOM   1261  C  CA    . ARG B 2  78  ? -37.982 -3.860  29.875 1.00 74.55  ? 78   ARG B CA    1 
ATOM   1262  C  C     . ARG B 2  78  ? -38.383 -3.072  31.108 1.00 75.64  ? 78   ARG B C     1 
ATOM   1263  O  O     . ARG B 2  78  ? -37.561 -2.352  31.651 1.00 79.31  ? 78   ARG B O     1 
ATOM   1264  C  CB    . ARG B 2  78  ? -38.160 -5.375  30.099 1.00 75.82  ? 78   ARG B CB    1 
ATOM   1265  C  CG    . ARG B 2  78  ? -38.146 -6.222  28.831 1.00 75.39  ? 78   ARG B CG    1 
ATOM   1266  C  CD    . ARG B 2  78  ? -38.442 -7.692  29.128 1.00 79.95  ? 78   ARG B CD    1 
ATOM   1267  N  NE    . ARG B 2  78  ? -37.230 -8.443  29.469 1.00 82.95  ? 78   ARG B NE    1 
ATOM   1268  C  CZ    . ARG B 2  78  ? -36.857 -8.764  30.711 1.00 81.10  ? 78   ARG B CZ    1 
ATOM   1269  N  NH1   . ARG B 2  78  ? -37.603 -8.423  31.759 1.00 77.69  ? 78   ARG B NH1   1 
ATOM   1270  N  NH2   . ARG B 2  78  ? -35.733 -9.435  30.906 1.00 72.48  ? 78   ARG B NH2   1 
ATOM   1271  N  N     . LYS B 2  79  ? -39.646 -3.184  31.526 1.00 82.41  ? 79   LYS B N     1 
ATOM   1272  C  CA    . LYS B 2  79  ? -40.155 -2.542  32.747 1.00 80.25  ? 79   LYS B CA    1 
ATOM   1273  C  C     . LYS B 2  79  ? -40.776 -3.611  33.644 1.00 84.19  ? 79   LYS B C     1 
ATOM   1274  O  O     . LYS B 2  79  ? -41.282 -3.322  34.745 1.00 86.34  ? 79   LYS B O     1 
ATOM   1275  C  CB    . LYS B 2  79  ? -41.209 -1.487  32.411 1.00 85.79  ? 79   LYS B CB    1 
ATOM   1276  C  CG    . LYS B 2  79  ? -40.705 -0.249  31.679 1.00 87.53  ? 79   LYS B CG    1 
ATOM   1277  C  CD    . LYS B 2  79  ? -41.392 0.974   32.258 1.00 95.08  ? 79   LYS B CD    1 
ATOM   1278  C  CE    . LYS B 2  79  ? -41.280 2.184   31.355 1.00 100.32 ? 79   LYS B CE    1 
ATOM   1279  N  NZ    . LYS B 2  79  ? -42.168 3.255   31.898 1.00 111.12 ? 79   LYS B NZ    1 
ATOM   1280  N  N     . THR B 2  80  ? -40.733 -4.848  33.148 1.00 81.44  ? 80   THR B N     1 
ATOM   1281  C  CA    . THR B 2  80  ? -41.230 -6.020  33.858 1.00 75.41  ? 80   THR B CA    1 
ATOM   1282  C  C     . THR B 2  80  ? -40.090 -6.986  34.201 1.00 79.27  ? 80   THR B C     1 
ATOM   1283  O  O     . THR B 2  80  ? -39.352 -7.461  33.321 1.00 75.85  ? 80   THR B O     1 
ATOM   1284  C  CB    . THR B 2  80  ? -42.272 -6.791  33.030 1.00 73.31  ? 80   THR B CB    1 
ATOM   1285  O  OG1   . THR B 2  80  ? -43.033 -5.882  32.226 1.00 85.70  ? 80   THR B OG1   1 
ATOM   1286  C  CG2   . THR B 2  80  ? -43.191 -7.548  33.936 1.00 72.55  ? 80   THR B CG2   1 
ATOM   1287  N  N     . VAL B 2  81  ? -39.953 -7.264  35.493 1.00 80.80  ? 81   VAL B N     1 
ATOM   1288  C  CA    . VAL B 2  81  ? -39.090 -8.328  35.965 1.00 72.90  ? 81   VAL B CA    1 
ATOM   1289  C  C     . VAL B 2  81  ? -39.751 -9.645  35.583 1.00 70.66  ? 81   VAL B C     1 
ATOM   1290  O  O     . VAL B 2  81  ? -40.853 -9.944  36.061 1.00 68.64  ? 81   VAL B O     1 
ATOM   1291  C  CB    . VAL B 2  81  ? -38.927 -8.256  37.489 1.00 71.14  ? 81   VAL B CB    1 
ATOM   1292  C  CG1   . VAL B 2  81  ? -38.069 -9.400  37.991 1.00 71.73  ? 81   VAL B CG1   1 
ATOM   1293  C  CG2   . VAL B 2  81  ? -38.289 -6.935  37.878 1.00 74.93  ? 81   VAL B CG2   1 
ATOM   1294  N  N     . THR B 2  82  ? -39.091 -10.406 34.705 1.00 69.15  ? 82   THR B N     1 
ATOM   1295  C  CA    . THR B 2  82  ? -39.563 -11.742 34.300 1.00 66.92  ? 82   THR B CA    1 
ATOM   1296  C  C     . THR B 2  82  ? -39.003 -12.839 35.204 1.00 67.29  ? 82   THR B C     1 
ATOM   1297  O  O     . THR B 2  82  ? -37.930 -12.702 35.779 1.00 66.58  ? 82   THR B O     1 
ATOM   1298  C  CB    . THR B 2  82  ? -39.245 -12.064 32.818 1.00 66.14  ? 82   THR B CB    1 
ATOM   1299  O  OG1   . THR B 2  82  ? -37.830 -12.201 32.617 1.00 67.07  ? 82   THR B OG1   1 
ATOM   1300  C  CG2   . THR B 2  82  ? -39.733 -10.941 31.929 1.00 72.63  ? 82   THR B CG2   1 
ATOM   1301  N  N     . ALA B 2  83  ? -39.747 -13.927 35.332 1.00 70.84  ? 83   ALA B N     1 
ATOM   1302  C  CA    . ALA B 2  83  ? -39.255 -15.115 35.998 1.00 66.43  ? 83   ALA B CA    1 
ATOM   1303  C  C     . ALA B 2  83  ? -37.831 -15.465 35.544 1.00 62.60  ? 83   ALA B C     1 
ATOM   1304  O  O     . ALA B 2  83  ? -37.013 -15.836 36.377 1.00 67.24  ? 83   ALA B O     1 
ATOM   1305  C  CB    . ALA B 2  83  ? -40.205 -16.276 35.764 1.00 65.12  ? 83   ALA B CB    1 
ATOM   1306  N  N     . MET B 2  84  ? -37.525 -15.326 34.251 1.00 58.69  ? 84   MET B N     1 
ATOM   1307  C  CA    . MET B 2  84  ? -36.163 -15.588 33.757 1.00 60.82  ? 84   MET B CA    1 
ATOM   1308  C  C     . MET B 2  84  ? -35.142 -14.598 34.290 1.00 62.90  ? 84   MET B C     1 
ATOM   1309  O  O     . MET B 2  84  ? -33.970 -14.936 34.454 1.00 66.75  ? 84   MET B O     1 
ATOM   1310  C  CB    . MET B 2  84  ? -36.069 -15.594 32.233 1.00 62.48  ? 84   MET B CB    1 
ATOM   1311  C  CG    . MET B 2  84  ? -36.700 -16.795 31.556 1.00 67.89  ? 84   MET B CG    1 
ATOM   1312  S  SD    . MET B 2  84  ? -36.268 -18.342 32.362 1.00 74.55  ? 84   MET B SD    1 
ATOM   1313  C  CE    . MET B 2  84  ? -34.531 -18.471 31.927 1.00 73.09  ? 84   MET B CE    1 
ATOM   1314  N  N     . ASP B 2  85  ? -35.573 -13.374 34.545 1.00 60.22  ? 85   ASP B N     1 
ATOM   1315  C  CA    . ASP B 2  85  ? -34.697 -12.402 35.190 1.00 66.97  ? 85   ASP B CA    1 
ATOM   1316  C  C     . ASP B 2  85  ? -34.298 -12.881 36.583 1.00 66.01  ? 85   ASP B C     1 
ATOM   1317  O  O     . ASP B 2  85  ? -33.135 -12.752 36.988 1.00 66.76  ? 85   ASP B O     1 
ATOM   1318  C  CB    . ASP B 2  85  ? -35.386 -11.041 35.330 1.00 70.34  ? 85   ASP B CB    1 
ATOM   1319  C  CG    . ASP B 2  85  ? -35.383 -10.251 34.061 1.00 72.89  ? 85   ASP B CG    1 
ATOM   1320  O  OD1   . ASP B 2  85  ? -34.610 -10.587 33.132 1.00 78.81  ? 85   ASP B OD1   1 
ATOM   1321  O  OD2   . ASP B 2  85  ? -36.164 -9.280  34.011 1.00 72.40  ? 85   ASP B OD2   1 
ATOM   1322  N  N     . VAL B 2  86  ? -35.275 -13.403 37.319 1.00 58.22  ? 86   VAL B N     1 
ATOM   1323  C  CA    . VAL B 2  86  ? -35.029 -13.959 38.635 1.00 61.46  ? 86   VAL B CA    1 
ATOM   1324  C  C     . VAL B 2  86  ? -34.173 -15.236 38.573 1.00 65.54  ? 86   VAL B C     1 
ATOM   1325  O  O     . VAL B 2  86  ? -33.156 -15.351 39.274 1.00 67.01  ? 86   VAL B O     1 
ATOM   1326  C  CB    . VAL B 2  86  ? -36.345 -14.216 39.362 1.00 63.06  ? 86   VAL B CB    1 
ATOM   1327  C  CG1   . VAL B 2  86  ? -36.115 -15.023 40.611 1.00 65.92  ? 86   VAL B CG1   1 
ATOM   1328  C  CG2   . VAL B 2  86  ? -36.990 -12.891 39.728 1.00 68.88  ? 86   VAL B CG2   1 
ATOM   1329  N  N     . VAL B 2  87  ? -34.562 -16.169 37.706 1.00 62.21  ? 87   VAL B N     1 
ATOM   1330  C  CA    . VAL B 2  87  ? -33.852 -17.429 37.558 1.00 59.13  ? 87   VAL B CA    1 
ATOM   1331  C  C     . VAL B 2  87  ? -32.363 -17.234 37.277 1.00 59.99  ? 87   VAL B C     1 
ATOM   1332  O  O     . VAL B 2  87  ? -31.521 -17.897 37.881 1.00 67.93  ? 87   VAL B O     1 
ATOM   1333  C  CB    . VAL B 2  87  ? -34.508 -18.313 36.492 1.00 58.07  ? 87   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B 2  87  ? -33.660 -19.537 36.187 1.00 55.85  ? 87   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B 2  87  ? -35.873 -18.756 36.979 1.00 65.49  ? 87   VAL B CG2   1 
ATOM   1336  N  N     . TYR B 2  88  ? -32.039 -16.325 36.376 1.00 58.86  ? 88   TYR B N     1 
ATOM   1337  C  CA    . TYR B 2  88  ? -30.652 -16.005 36.090 1.00 58.81  ? 88   TYR B CA    1 
ATOM   1338  C  C     . TYR B 2  88  ? -29.919 -15.358 37.269 1.00 59.29  ? 88   TYR B C     1 
ATOM   1339  O  O     . TYR B 2  88  ? -28.699 -15.515 37.414 1.00 59.06  ? 88   TYR B O     1 
ATOM   1340  C  CB    . TYR B 2  88  ? -30.556 -15.071 34.890 1.00 63.28  ? 88   TYR B CB    1 
ATOM   1341  C  CG    . TYR B 2  88  ? -31.012 -15.656 33.575 1.00 68.25  ? 88   TYR B CG    1 
ATOM   1342  C  CD1   . TYR B 2  88  ? -31.577 -14.851 32.602 1.00 71.98  ? 88   TYR B CD1   1 
ATOM   1343  C  CD2   . TYR B 2  88  ? -30.864 -17.006 33.298 1.00 75.72  ? 88   TYR B CD2   1 
ATOM   1344  C  CE1   . TYR B 2  88  ? -31.993 -15.371 31.389 1.00 78.76  ? 88   TYR B CE1   1 
ATOM   1345  C  CE2   . TYR B 2  88  ? -31.269 -17.539 32.086 1.00 81.00  ? 88   TYR B CE2   1 
ATOM   1346  C  CZ    . TYR B 2  88  ? -31.834 -16.716 31.132 1.00 82.71  ? 88   TYR B CZ    1 
ATOM   1347  O  OH    . TYR B 2  88  ? -32.231 -17.248 29.923 1.00 83.57  ? 88   TYR B OH    1 
ATOM   1348  N  N     . ALA B 2  89  ? -30.649 -14.620 38.100 1.00 58.34  ? 89   ALA B N     1 
ATOM   1349  C  CA    . ALA B 2  89  ? -30.016 -13.897 39.198 1.00 57.00  ? 89   ALA B CA    1 
ATOM   1350  C  C     . ALA B 2  89  ? -29.653 -14.929 40.248 1.00 56.49  ? 89   ALA B C     1 
ATOM   1351  O  O     . ALA B 2  89  ? -28.528 -14.952 40.771 1.00 53.85  ? 89   ALA B O     1 
ATOM   1352  C  CB    . ALA B 2  89  ? -30.966 -12.864 39.770 1.00 61.08  ? 89   ALA B CB    1 
ATOM   1353  N  N     . LEU B 2  90  ? -30.616 -15.802 40.524 1.00 53.78  ? 90   LEU B N     1 
ATOM   1354  C  CA    . LEU B 2  90  ? -30.409 -16.934 41.398 1.00 52.13  ? 90   LEU B CA    1 
ATOM   1355  C  C     . LEU B 2  90  ? -29.223 -17.814 40.941 1.00 54.08  ? 90   LEU B C     1 
ATOM   1356  O  O     . LEU B 2  90  ? -28.425 -18.275 41.778 1.00 50.13  ? 90   LEU B O     1 
ATOM   1357  C  CB    . LEU B 2  90  ? -31.705 -17.733 41.501 1.00 50.33  ? 90   LEU B CB    1 
ATOM   1358  C  CG    . LEU B 2  90  ? -32.793 -17.063 42.339 1.00 52.85  ? 90   LEU B CG    1 
ATOM   1359  C  CD1   . LEU B 2  90  ? -34.151 -17.642 42.020 1.00 53.86  ? 90   LEU B CD1   1 
ATOM   1360  C  CD2   . LEU B 2  90  ? -32.528 -17.175 43.839 1.00 55.78  ? 90   LEU B CD2   1 
ATOM   1361  N  N     . LYS B 2  91  ? -29.090 -18.028 39.628 1.00 52.17  ? 91   LYS B N     1 
ATOM   1362  C  CA    . LYS B 2  91  ? -28.028 -18.887 39.160 1.00 52.60  ? 91   LYS B CA    1 
ATOM   1363  C  C     . LYS B 2  91  ? -26.677 -18.297 39.493 1.00 56.32  ? 91   LYS B C     1 
ATOM   1364  O  O     . LYS B 2  91  ? -25.865 -18.965 40.116 1.00 65.78  ? 91   LYS B O     1 
ATOM   1365  C  CB    . LYS B 2  91  ? -28.137 -19.252 37.697 1.00 51.79  ? 91   LYS B CB    1 
ATOM   1366  C  CG    . LYS B 2  91  ? -27.021 -20.201 37.282 1.00 56.67  ? 91   LYS B CG    1 
ATOM   1367  C  CD    . LYS B 2  91  ? -27.455 -21.243 36.272 1.00 59.18  ? 91   LYS B CD    1 
ATOM   1368  C  CE    . LYS B 2  91  ? -27.641 -20.644 34.885 1.00 68.85  ? 91   LYS B CE    1 
ATOM   1369  N  NZ    . LYS B 2  91  ? -28.279 -21.637 33.967 1.00 75.81  ? 91   LYS B NZ    1 
ATOM   1370  N  N     . ARG B 2  92  ? -26.434 -17.046 39.135 1.00 56.75  ? 92   ARG B N     1 
ATOM   1371  C  CA    . ARG B 2  92  ? -25.143 -16.423 39.487 1.00 56.77  ? 92   ARG B CA    1 
ATOM   1372  C  C     . ARG B 2  92  ? -24.930 -16.164 40.987 1.00 59.39  ? 92   ARG B C     1 
ATOM   1373  O  O     . ARG B 2  92  ? -23.782 -16.050 41.424 1.00 62.73  ? 92   ARG B O     1 
ATOM   1374  C  CB    . ARG B 2  92  ? -24.886 -15.146 38.697 1.00 54.82  ? 92   ARG B CB    1 
ATOM   1375  C  CG    . ARG B 2  92  ? -25.795 -13.991 39.079 1.00 55.88  ? 92   ARG B CG    1 
ATOM   1376  C  CD    . ARG B 2  92  ? -25.441 -12.745 38.284 1.00 57.37  ? 92   ARG B CD    1 
ATOM   1377  N  NE    . ARG B 2  92  ? -24.000 -12.554 38.294 1.00 59.10  ? 92   ARG B NE    1 
ATOM   1378  C  CZ    . ARG B 2  92  ? -23.328 -12.035 39.315 1.00 60.67  ? 92   ARG B CZ    1 
ATOM   1379  N  NH1   . ARG B 2  92  ? -23.977 -11.639 40.406 1.00 63.76  ? 92   ARG B NH1   1 
ATOM   1380  N  NH2   . ARG B 2  92  ? -22.008 -11.923 39.255 1.00 59.84  ? 92   ARG B NH2   1 
ATOM   1381  N  N     . GLN B 2  93  ? -25.999 -16.084 41.782 1.00 56.52  ? 93   GLN B N     1 
ATOM   1382  C  CA    . GLN B 2  93  ? -25.815 -15.993 43.235 1.00 57.58  ? 93   GLN B CA    1 
ATOM   1383  C  C     . GLN B 2  93  ? -25.492 -17.346 43.855 1.00 58.06  ? 93   GLN B C     1 
ATOM   1384  O  O     . GLN B 2  93  ? -25.456 -17.448 45.075 1.00 60.39  ? 93   GLN B O     1 
ATOM   1385  C  CB    . GLN B 2  93  ? -27.070 -15.453 43.951 1.00 61.99  ? 93   GLN B CB    1 
ATOM   1386  C  CG    . GLN B 2  93  ? -27.465 -14.006 43.686 1.00 62.88  ? 93   GLN B CG    1 
ATOM   1387  C  CD    . GLN B 2  93  ? -26.396 -12.997 44.056 1.00 67.86  ? 93   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B 2  93  ? -25.717 -13.114 45.080 1.00 70.16  ? 93   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B 2  93  ? -26.244 -11.985 43.216 1.00 75.92  ? 93   GLN B NE2   1 
ATOM   1390  N  N     . GLY B 2  94  ? -25.307 -18.378 43.030 1.00 55.81  ? 94   GLY B N     1 
ATOM   1391  C  CA    . GLY B 2  94  ? -25.125 -19.750 43.497 1.00 55.19  ? 94   GLY B CA    1 
ATOM   1392  C  C     . GLY B 2  94  ? -26.338 -20.443 44.103 1.00 57.22  ? 94   GLY B C     1 
ATOM   1393  O  O     . GLY B 2  94  ? -26.196 -21.407 44.837 1.00 61.77  ? 94   GLY B O     1 
ATOM   1394  N  N     . ARG B 2  95  ? -27.532 -19.949 43.797 1.00 62.01  ? 95   ARG B N     1 
ATOM   1395  C  CA    . ARG B 2  95  ? -28.775 -20.528 44.288 1.00 55.15  ? 95   ARG B CA    1 
ATOM   1396  C  C     . ARG B 2  95  ? -29.682 -20.996 43.140 1.00 53.98  ? 95   ARG B C     1 
ATOM   1397  O  O     . ARG B 2  95  ? -30.852 -20.656 43.134 1.00 55.26  ? 95   ARG B O     1 
ATOM   1398  C  CB    . ARG B 2  95  ? -29.567 -19.504 45.114 1.00 57.63  ? 95   ARG B CB    1 
ATOM   1399  C  CG    . ARG B 2  95  ? -28.809 -18.560 46.033 1.00 55.92  ? 95   ARG B CG    1 
ATOM   1400  C  CD    . ARG B 2  95  ? -28.552 -19.101 47.420 1.00 59.86  ? 95   ARG B CD    1 
ATOM   1401  N  NE    . ARG B 2  95  ? -29.580 -20.031 47.870 1.00 72.88  ? 95   ARG B NE    1 
ATOM   1402  C  CZ    . ARG B 2  95  ? -29.406 -20.947 48.826 1.00 75.98  ? 95   ARG B CZ    1 
ATOM   1403  N  NH1   . ARG B 2  95  ? -28.227 -21.053 49.455 1.00 73.93  ? 95   ARG B NH1   1 
ATOM   1404  N  NH2   . ARG B 2  95  ? -30.419 -21.754 49.152 1.00 68.62  ? 95   ARG B NH2   1 
ATOM   1405  N  N     . THR B 2  96  ? -29.156 -21.759 42.179 1.00 56.25  ? 96   THR B N     1 
ATOM   1406  C  CA    . THR B 2  96  ? -29.944 -22.325 41.067 1.00 50.05  ? 96   THR B CA    1 
ATOM   1407  C  C     . THR B 2  96  ? -31.280 -22.880 41.502 1.00 54.19  ? 96   THR B C     1 
ATOM   1408  O  O     . THR B 2  96  ? -31.349 -23.733 42.394 1.00 61.81  ? 96   THR B O     1 
ATOM   1409  C  CB    . THR B 2  96  ? -29.199 -23.487 40.397 1.00 50.29  ? 96   THR B CB    1 
ATOM   1410  O  OG1   . THR B 2  96  ? -27.995 -23.005 39.795 1.00 53.78  ? 96   THR B OG1   1 
ATOM   1411  C  CG2   . THR B 2  96  ? -30.045 -24.162 39.353 1.00 47.54  ? 96   THR B CG2   1 
ATOM   1412  N  N     . LEU B 2  97  ? -32.336 -22.395 40.850 1.00 58.80  ? 97   LEU B N     1 
ATOM   1413  C  CA    . LEU B 2  97  ? -33.714 -22.825 41.086 1.00 54.70  ? 97   LEU B CA    1 
ATOM   1414  C  C     . LEU B 2  97  ? -34.248 -23.550 39.852 1.00 56.78  ? 97   LEU B C     1 
ATOM   1415  O  O     . LEU B 2  97  ? -33.982 -23.126 38.734 1.00 56.24  ? 97   LEU B O     1 
ATOM   1416  C  CB    . LEU B 2  97  ? -34.553 -21.590 41.371 1.00 52.55  ? 97   LEU B CB    1 
ATOM   1417  C  CG    . LEU B 2  97  ? -36.054 -21.691 41.617 1.00 54.49  ? 97   LEU B CG    1 
ATOM   1418  C  CD1   . LEU B 2  97  ? -36.393 -22.364 42.938 1.00 57.37  ? 97   LEU B CD1   1 
ATOM   1419  C  CD2   . LEU B 2  97  ? -36.643 -20.300 41.608 1.00 51.20  ? 97   LEU B CD2   1 
ATOM   1420  N  N     . TYR B 2  98  ? -34.970 -24.653 40.053 1.00 57.52  ? 98   TYR B N     1 
ATOM   1421  C  CA    . TYR B 2  98  ? -35.571 -25.403 38.950 1.00 55.98  ? 98   TYR B CA    1 
ATOM   1422  C  C     . TYR B 2  98  ? -37.081 -25.235 38.992 1.00 63.02  ? 98   TYR B C     1 
ATOM   1423  O  O     . TYR B 2  98  ? -37.696 -25.240 40.076 1.00 63.04  ? 98   TYR B O     1 
ATOM   1424  C  CB    . TYR B 2  98  ? -35.293 -26.886 39.068 1.00 53.15  ? 98   TYR B CB    1 
ATOM   1425  C  CG    . TYR B 2  98  ? -33.914 -27.382 38.710 1.00 54.81  ? 98   TYR B CG    1 
ATOM   1426  C  CD1   . TYR B 2  98  ? -32.923 -26.539 38.185 1.00 51.34  ? 98   TYR B CD1   1 
ATOM   1427  C  CD2   . TYR B 2  98  ? -33.600 -28.727 38.896 1.00 51.81  ? 98   TYR B CD2   1 
ATOM   1428  C  CE1   . TYR B 2  98  ? -31.667 -27.033 37.846 1.00 47.79  ? 98   TYR B CE1   1 
ATOM   1429  C  CE2   . TYR B 2  98  ? -32.343 -29.212 38.583 1.00 54.09  ? 98   TYR B CE2   1 
ATOM   1430  C  CZ    . TYR B 2  98  ? -31.388 -28.362 38.051 1.00 51.03  ? 98   TYR B CZ    1 
ATOM   1431  O  OH    . TYR B 2  98  ? -30.162 -28.880 37.732 1.00 52.83  ? 98   TYR B OH    1 
ATOM   1432  N  N     . GLY B 2  99  ? -37.685 -25.095 37.815 1.00 62.39  ? 99   GLY B N     1 
ATOM   1433  C  CA    . GLY B 2  99  ? -39.138 -24.992 37.721 1.00 64.41  ? 99   GLY B CA    1 
ATOM   1434  C  C     . GLY B 2  99  ? -39.743 -23.675 37.289 1.00 62.76  ? 99   GLY B C     1 
ATOM   1435  O  O     . GLY B 2  99  ? -40.946 -23.507 37.369 1.00 74.43  ? 99   GLY B O     1 
ATOM   1436  N  N     . PHE B 2  100 ? -38.928 -22.743 36.821 1.00 62.98  ? 100  PHE B N     1 
ATOM   1437  C  CA    . PHE B 2  100 ? -39.439 -21.466 36.366 1.00 62.29  ? 100  PHE B CA    1 
ATOM   1438  C  C     . PHE B 2  100 ? -38.806 -21.041 35.048 1.00 69.08  ? 100  PHE B C     1 
ATOM   1439  O  O     . PHE B 2  100 ? -38.803 -19.857 34.704 1.00 73.82  ? 100  PHE B O     1 
ATOM   1440  C  CB    . PHE B 2  100 ? -39.271 -20.408 37.450 1.00 59.42  ? 100  PHE B CB    1 
ATOM   1441  C  CG    . PHE B 2  100 ? -40.109 -20.670 38.668 1.00 63.77  ? 100  PHE B CG    1 
ATOM   1442  C  CD1   . PHE B 2  100 ? -39.601 -21.396 39.740 1.00 61.80  ? 100  PHE B CD1   1 
ATOM   1443  C  CD2   . PHE B 2  100 ? -41.423 -20.213 38.742 1.00 62.00  ? 100  PHE B CD2   1 
ATOM   1444  C  CE1   . PHE B 2  100 ? -40.379 -21.641 40.865 1.00 60.90  ? 100  PHE B CE1   1 
ATOM   1445  C  CE2   . PHE B 2  100 ? -42.205 -20.457 39.868 1.00 61.28  ? 100  PHE B CE2   1 
ATOM   1446  C  CZ    . PHE B 2  100 ? -41.682 -21.176 40.929 1.00 59.66  ? 100  PHE B CZ    1 
ATOM   1447  N  N     . GLY B 2  101 ? -38.299 -22.020 34.298 1.00 70.23  ? 101  GLY B N     1 
ATOM   1448  C  CA    . GLY B 2  101 ? -37.749 -21.776 32.962 1.00 71.44  ? 101  GLY B CA    1 
ATOM   1449  C  C     . GLY B 2  101 ? -36.244 -21.936 32.935 1.00 77.92  ? 101  GLY B C     1 
ATOM   1450  O  O     . GLY B 2  101 ? -35.638 -22.253 33.951 1.00 82.71  ? 101  GLY B O     1 
ATOM   1451  N  N     . GLY B 2  102 ? -35.635 -21.726 31.768 1.00 89.61  ? 102  GLY B N     1 
ATOM   1452  C  CA    . GLY B 2  102 ? -34.176 -21.796 31.623 1.00 77.37  ? 102  GLY B CA    1 
ATOM   1453  C  C     . GLY B 2  102 ? -33.648 -23.203 31.778 1.00 81.41  ? 102  GLY B C     1 
ATOM   1454  O  O     . GLY B 2  102 ? -32.425 -23.375 31.781 1.00 78.67  ? 102  GLY B O     1 
ATOM   1455  O  OXT   . GLY B 2  102 ? -34.423 -24.170 31.915 1.00 81.52  ? 102  GLY B OXT   1 
ATOM   1456  N  N     . ALA C 3  14  ? -1.261  6.717   12.794 1.00 101.46 ? 14   ALA C N     1 
ATOM   1457  C  CA    . ALA C 3  14  ? -0.224  5.807   13.384 1.00 116.28 ? 14   ALA C CA    1 
ATOM   1458  C  C     . ALA C 3  14  ? -0.442  5.557   14.897 1.00 116.56 ? 14   ALA C C     1 
ATOM   1459  O  O     . ALA C 3  14  ? 0.458   5.070   15.596 1.00 118.75 ? 14   ALA C O     1 
ATOM   1460  C  CB    . ALA C 3  14  ? 1.186   6.341   13.099 1.00 101.78 ? 14   ALA C CB    1 
ATOM   1461  N  N     . LYS C 3  15  ? -1.652  5.863   15.376 1.00 112.78 ? 15   LYS C N     1 
ATOM   1462  C  CA    . LYS C 3  15  ? -1.985  5.834   16.809 1.00 107.88 ? 15   LYS C CA    1 
ATOM   1463  C  C     . LYS C 3  15  ? -2.695  4.566   17.288 1.00 107.72 ? 15   LYS C C     1 
ATOM   1464  O  O     . LYS C 3  15  ? -3.674  4.122   16.673 1.00 101.20 ? 15   LYS C O     1 
ATOM   1465  C  CB    . LYS C 3  15  ? -2.849  7.042   17.166 1.00 104.42 ? 15   LYS C CB    1 
ATOM   1466  C  CG    . LYS C 3  15  ? -2.099  8.352   17.065 1.00 112.49 ? 15   LYS C CG    1 
ATOM   1467  C  CD    . LYS C 3  15  ? -2.555  9.330   18.134 1.00 117.48 ? 15   LYS C CD    1 
ATOM   1468  C  CE    . LYS C 3  15  ? -1.735  10.609  18.062 1.00 123.97 ? 15   LYS C CE    1 
ATOM   1469  N  NZ    . LYS C 3  15  ? -2.101  11.565  19.148 1.00 128.16 ? 15   LYS C NZ    1 
ATOM   1470  N  N     . THR C 3  16  ? -2.210  4.005   18.400 1.00 97.73  ? 16   THR C N     1 
ATOM   1471  C  CA    . THR C 3  16  ? -2.876  2.875   19.056 1.00 88.40  ? 16   THR C CA    1 
ATOM   1472  C  C     . THR C 3  16  ? -4.249  3.289   19.586 1.00 86.28  ? 16   THR C C     1 
ATOM   1473  O  O     . THR C 3  16  ? -4.511  4.473   19.841 1.00 77.90  ? 16   THR C O     1 
ATOM   1474  C  CB    . THR C 3  16  ? -2.077  2.328   20.249 1.00 84.11  ? 16   THR C CB    1 
ATOM   1475  O  OG1   . THR C 3  16  ? -2.114  3.277   21.317 1.00 81.79  ? 16   THR C OG1   1 
ATOM   1476  C  CG2   . THR C 3  16  ? -0.631  2.024   19.866 1.00 88.10  ? 16   THR C CG2   1 
ATOM   1477  N  N     . ARG C 3  17  ? -5.124  2.305   19.756 1.00 83.15  ? 17   ARG C N     1 
ATOM   1478  C  CA    . ARG C 3  17  ? -6.450  2.561   20.305 1.00 83.45  ? 17   ARG C CA    1 
ATOM   1479  C  C     . ARG C 3  17  ? -6.358  2.907   21.796 1.00 81.99  ? 17   ARG C C     1 
ATOM   1480  O  O     . ARG C 3  17  ? -7.201  3.629   22.338 1.00 74.61  ? 17   ARG C O     1 
ATOM   1481  C  CB    . ARG C 3  17  ? -7.349  1.353   20.071 1.00 83.74  ? 17   ARG C CB    1 
ATOM   1482  C  CG    . ARG C 3  17  ? -7.221  0.792   18.666 1.00 86.48  ? 17   ARG C CG    1 
ATOM   1483  C  CD    . ARG C 3  17  ? -8.431  -0.037  18.304 1.00 81.07  ? 17   ARG C CD    1 
ATOM   1484  N  NE    . ARG C 3  17  ? -8.131  -1.459  18.383 1.00 83.40  ? 17   ARG C NE    1 
ATOM   1485  C  CZ    . ARG C 3  17  ? -9.046  -2.390  18.621 1.00 84.87  ? 17   ARG C CZ    1 
ATOM   1486  N  NH1   . ARG C 3  17  ? -10.322 -2.042  18.820 1.00 79.90  ? 17   ARG C NH1   1 
ATOM   1487  N  NH2   . ARG C 3  17  ? -8.674  -3.664  18.677 1.00 84.98  ? 17   ARG C NH2   1 
ATOM   1488  N  N     . SER C 3  18  ? -5.314  2.398   22.449 1.00 83.15  ? 18   SER C N     1 
ATOM   1489  C  CA    . SER C 3  18  ? -5.070  2.690   23.855 1.00 77.65  ? 18   SER C CA    1 
ATOM   1490  C  C     . SER C 3  18  ? -4.891  4.185   24.066 1.00 80.93  ? 18   SER C C     1 
ATOM   1491  O  O     . SER C 3  18  ? -5.693  4.796   24.767 1.00 80.23  ? 18   SER C O     1 
ATOM   1492  C  CB    . SER C 3  18  ? -3.872  1.903   24.370 1.00 73.70  ? 18   SER C CB    1 
ATOM   1493  O  OG    . SER C 3  18  ? -4.159  0.523   24.379 1.00 74.59  ? 18   SER C OG    1 
ATOM   1494  N  N     . SER C 3  19  ? -3.868  4.778   23.441 1.00 81.69  ? 19   SER C N     1 
ATOM   1495  C  CA    . SER C 3  19  ? -3.724  6.243   23.437 1.00 80.41  ? 19   SER C CA    1 
ATOM   1496  C  C     . SER C 3  19  ? -4.998  6.970   22.956 1.00 68.57  ? 19   SER C C     1 
ATOM   1497  O  O     . SER C 3  19  ? -5.405  7.949   23.558 1.00 70.04  ? 19   SER C O     1 
ATOM   1498  C  CB    . SER C 3  19  ? -2.470  6.703   22.673 1.00 83.82  ? 19   SER C CB    1 
ATOM   1499  O  OG    . SER C 3  19  ? -2.413  6.127   21.376 1.00 96.97  ? 19   SER C OG    1 
ATOM   1500  N  N     . ARG C 3  20  ? -5.651  6.476   21.915 1.00 64.28  ? 20   ARG C N     1 
ATOM   1501  C  CA    . ARG C 3  20  ? -6.927  7.056   21.517 1.00 69.85  ? 20   ARG C CA    1 
ATOM   1502  C  C     . ARG C 3  20  ? -7.937  7.108   22.674 1.00 74.90  ? 20   ARG C C     1 
ATOM   1503  O  O     . ARG C 3  20  ? -8.702  8.084   22.796 1.00 75.71  ? 20   ARG C O     1 
ATOM   1504  C  CB    . ARG C 3  20  ? -7.540  6.315   20.321 1.00 80.06  ? 20   ARG C CB    1 
ATOM   1505  C  CG    . ARG C 3  20  ? -6.866  6.539   18.973 1.00 86.63  ? 20   ARG C CG    1 
ATOM   1506  C  CD    . ARG C 3  20  ? -7.622  5.843   17.850 1.00 93.60  ? 20   ARG C CD    1 
ATOM   1507  N  NE    . ARG C 3  20  ? -6.743  5.572   16.709 1.00 112.53 ? 20   ARG C NE    1 
ATOM   1508  C  CZ    . ARG C 3  20  ? -6.577  6.379   15.655 1.00 121.77 ? 20   ARG C CZ    1 
ATOM   1509  N  NH1   . ARG C 3  20  ? -7.228  7.539   15.564 1.00 113.74 ? 20   ARG C NH1   1 
ATOM   1510  N  NH2   . ARG C 3  20  ? -5.750  6.026   14.677 1.00 119.22 ? 20   ARG C NH2   1 
ATOM   1511  N  N     . ALA C 3  21  ? -7.943  6.070   23.520 1.00 79.63  ? 21   ALA C N     1 
ATOM   1512  C  CA    . ALA C 3  21  ? -8.917  5.975   24.636 1.00 76.75  ? 21   ALA C CA    1 
ATOM   1513  C  C     . ALA C 3  21  ? -8.380  6.528   25.945 1.00 75.42  ? 21   ALA C C     1 
ATOM   1514  O  O     . ALA C 3  21  ? -9.112  6.652   26.929 1.00 75.58  ? 21   ALA C O     1 
ATOM   1515  C  CB    . ALA C 3  21  ? -9.385  4.547   24.831 1.00 79.16  ? 21   ALA C CB    1 
ATOM   1516  N  N     . GLY C 3  22  ? -7.098  6.868   25.944 1.00 72.64  ? 22   GLY C N     1 
ATOM   1517  C  CA    . GLY C 3  22  ? -6.467  7.452   27.103 1.00 70.01  ? 22   GLY C CA    1 
ATOM   1518  C  C     . GLY C 3  22  ? -6.124  6.415   28.137 1.00 72.16  ? 22   GLY C C     1 
ATOM   1519  O  O     . GLY C 3  22  ? -6.274  6.668   29.328 1.00 77.57  ? 22   GLY C O     1 
ATOM   1520  N  N     . LEU C 3  23  ? -5.633  5.261   27.680 1.00 71.21  ? 23   LEU C N     1 
ATOM   1521  C  CA    . LEU C 3  23  ? -5.410  4.115   28.550 1.00 62.51  ? 23   LEU C CA    1 
ATOM   1522  C  C     . LEU C 3  23  ? -4.010  3.567   28.434 1.00 65.76  ? 23   LEU C C     1 
ATOM   1523  O  O     . LEU C 3  23  ? -3.394  3.602   27.372 1.00 68.70  ? 23   LEU C O     1 
ATOM   1524  C  CB    . LEU C 3  23  ? -6.422  3.002   28.253 1.00 60.69  ? 23   LEU C CB    1 
ATOM   1525  C  CG    . LEU C 3  23  ? -7.920  3.292   28.458 1.00 58.90  ? 23   LEU C CG    1 
ATOM   1526  C  CD1   . LEU C 3  23  ? -8.733  2.125   27.942 1.00 60.00  ? 23   LEU C CD1   1 
ATOM   1527  C  CD2   . LEU C 3  23  ? -8.298  3.564   29.905 1.00 55.93  ? 23   LEU C CD2   1 
ATOM   1528  N  N     . GLN C 3  24  ? -3.517  3.064   29.558 1.00 69.66  ? 24   GLN C N     1 
ATOM   1529  C  CA    . GLN C 3  24  ? -2.272  2.325   29.607 1.00 67.57  ? 24   GLN C CA    1 
ATOM   1530  C  C     . GLN C 3  24  ? -2.495  0.890   29.138 1.00 65.80  ? 24   GLN C C     1 
ATOM   1531  O  O     . GLN C 3  24  ? -1.691  0.359   28.385 1.00 73.03  ? 24   GLN C O     1 
ATOM   1532  C  CB    . GLN C 3  24  ? -1.727  2.337   31.033 1.00 70.27  ? 24   GLN C CB    1 
ATOM   1533  C  CG    . GLN C 3  24  ? -1.530  3.726   31.632 1.00 69.28  ? 24   GLN C CG    1 
ATOM   1534  C  CD    . GLN C 3  24  ? -0.661  4.627   30.769 1.00 70.19  ? 24   GLN C CD    1 
ATOM   1535  O  OE1   . GLN C 3  24  ? 0.435   4.244   30.285 1.00 71.46  ? 24   GLN C OE1   1 
ATOM   1536  N  NE2   . GLN C 3  24  ? -1.151  5.837   30.558 1.00 67.79  ? 24   GLN C NE2   1 
ATOM   1537  N  N     . PHE C 3  25  ? -3.596  0.278   29.572 1.00 61.90  ? 25   PHE C N     1 
ATOM   1538  C  CA    . PHE C 3  25  ? -3.877  -1.122  29.268 1.00 68.58  ? 25   PHE C CA    1 
ATOM   1539  C  C     . PHE C 3  25  ? -4.147  -1.328  27.783 1.00 70.66  ? 25   PHE C C     1 
ATOM   1540  O  O     . PHE C 3  25  ? -4.614  -0.410  27.121 1.00 76.01  ? 25   PHE C O     1 
ATOM   1541  C  CB    . PHE C 3  25  ? -5.043  -1.616  30.111 1.00 68.19  ? 25   PHE C CB    1 
ATOM   1542  C  CG    . PHE C 3  25  ? -4.622  -2.333  31.353 1.00 68.69  ? 25   PHE C CG    1 
ATOM   1543  C  CD1   . PHE C 3  25  ? -3.785  -1.723  32.286 1.00 68.61  ? 25   PHE C CD1   1 
ATOM   1544  C  CD2   . PHE C 3  25  ? -5.068  -3.625  31.599 1.00 71.97  ? 25   PHE C CD2   1 
ATOM   1545  C  CE1   . PHE C 3  25  ? -3.400  -2.389  33.436 1.00 65.31  ? 25   PHE C CE1   1 
ATOM   1546  C  CE2   . PHE C 3  25  ? -4.690  -4.298  32.748 1.00 65.25  ? 25   PHE C CE2   1 
ATOM   1547  C  CZ    . PHE C 3  25  ? -3.859  -3.675  33.666 1.00 63.93  ? 25   PHE C CZ    1 
ATOM   1548  N  N     . PRO C 3  26  ? -3.861  -2.535  27.255 1.00 72.43  ? 26   PRO C N     1 
ATOM   1549  C  CA    . PRO C 3  26  ? -3.752  -2.689  25.815 1.00 67.63  ? 26   PRO C CA    1 
ATOM   1550  C  C     . PRO C 3  26  ? -5.051  -3.077  25.163 1.00 65.52  ? 26   PRO C C     1 
ATOM   1551  O  O     . PRO C 3  26  ? -5.456  -4.225  25.252 1.00 69.92  ? 26   PRO C O     1 
ATOM   1552  C  CB    . PRO C 3  26  ? -2.728  -3.816  25.667 1.00 66.71  ? 26   PRO C CB    1 
ATOM   1553  C  CG    . PRO C 3  26  ? -2.783  -4.565  26.963 1.00 73.00  ? 26   PRO C CG    1 
ATOM   1554  C  CD    . PRO C 3  26  ? -3.668  -3.825  27.932 1.00 75.98  ? 26   PRO C CD    1 
ATOM   1555  N  N     . VAL C 3  27  ? -5.689  -2.122  24.496 1.00 66.55  ? 27   VAL C N     1 
ATOM   1556  C  CA    . VAL C 3  27  ? -6.951  -2.371  23.777 1.00 70.09  ? 27   VAL C CA    1 
ATOM   1557  C  C     . VAL C 3  27  ? -6.860  -3.448  22.679 1.00 69.54  ? 27   VAL C C     1 
ATOM   1558  O  O     . VAL C 3  27  ? -7.716  -4.314  22.595 1.00 70.69  ? 27   VAL C O     1 
ATOM   1559  C  CB    . VAL C 3  27  ? -7.523  -1.063  23.216 1.00 64.57  ? 27   VAL C CB    1 
ATOM   1560  C  CG1   . VAL C 3  27  ? -8.912  -1.281  22.653 1.00 67.33  ? 27   VAL C CG1   1 
ATOM   1561  C  CG2   . VAL C 3  27  ? -7.583  -0.035  24.327 1.00 62.16  ? 27   VAL C CG2   1 
ATOM   1562  N  N     . GLY C 3  28  ? -5.821  -3.394  21.858 1.00 71.18  ? 28   GLY C N     1 
ATOM   1563  C  CA    . GLY C 3  28  ? -5.602  -4.424  20.861 1.00 77.04  ? 28   GLY C CA    1 
ATOM   1564  C  C     . GLY C 3  28  ? -5.610  -5.807  21.479 1.00 78.96  ? 28   GLY C C     1 
ATOM   1565  O  O     . GLY C 3  28  ? -6.344  -6.692  21.024 1.00 81.52  ? 28   GLY C O     1 
ATOM   1566  N  N     . ARG C 3  29  ? -4.805  -5.985  22.526 1.00 75.89  ? 29   ARG C N     1 
ATOM   1567  C  CA    . ARG C 3  29  ? -4.662  -7.288  23.194 1.00 73.45  ? 29   ARG C CA    1 
ATOM   1568  C  C     . ARG C 3  29  ? -6.001  -7.758  23.725 1.00 72.77  ? 29   ARG C C     1 
ATOM   1569  O  O     . ARG C 3  29  ? -6.383  -8.913  23.550 1.00 74.29  ? 29   ARG C O     1 
ATOM   1570  C  CB    . ARG C 3  29  ? -3.678  -7.199  24.359 1.00 69.22  ? 29   ARG C CB    1 
ATOM   1571  C  CG    . ARG C 3  29  ? -3.269  -8.535  24.910 1.00 64.44  ? 29   ARG C CG    1 
ATOM   1572  C  CD    . ARG C 3  29  ? -1.807  -8.745  24.633 1.00 67.31  ? 29   ARG C CD    1 
ATOM   1573  N  NE    . ARG C 3  29  ? -1.102  -8.761  25.896 1.00 72.18  ? 29   ARG C NE    1 
ATOM   1574  C  CZ    . ARG C 3  29  ? 0.214   -8.657  26.041 1.00 77.04  ? 29   ARG C CZ    1 
ATOM   1575  N  NH1   . ARG C 3  29  ? 1.022   -8.502  24.997 1.00 75.01  ? 29   ARG C NH1   1 
ATOM   1576  N  NH2   . ARG C 3  29  ? 0.718   -8.712  27.261 1.00 84.91  ? 29   ARG C NH2   1 
ATOM   1577  N  N     . VAL C 3  30  ? -6.709  -6.836  24.369 1.00 70.86  ? 30   VAL C N     1 
ATOM   1578  C  CA    . VAL C 3  30  ? -7.992  -7.118  24.969 1.00 68.11  ? 30   VAL C CA    1 
ATOM   1579  C  C     . VAL C 3  30  ? -9.006  -7.430  23.881 1.00 71.54  ? 30   VAL C C     1 
ATOM   1580  O  O     . VAL C 3  30  ? -9.887  -8.252  24.084 1.00 81.76  ? 30   VAL C O     1 
ATOM   1581  C  CB    . VAL C 3  30  ? -8.455  -5.967  25.887 1.00 66.11  ? 30   VAL C CB    1 
ATOM   1582  C  CG1   . VAL C 3  30  ? -9.866  -6.205  26.406 1.00 67.70  ? 30   VAL C CG1   1 
ATOM   1583  C  CG2   . VAL C 3  30  ? -7.510  -5.833  27.062 1.00 63.34  ? 30   VAL C CG2   1 
ATOM   1584  N  N     . HIS C 3  31  ? -8.870  -6.808  22.714 1.00 78.49  ? 31   HIS C N     1 
ATOM   1585  C  CA    . HIS C 3  31  ? -9.737  -7.168  21.592 1.00 79.46  ? 31   HIS C CA    1 
ATOM   1586  C  C     . HIS C 3  31  ? -9.485  -8.572  21.163 1.00 77.09  ? 31   HIS C C     1 
ATOM   1587  O  O     . HIS C 3  31  ? -10.423 -9.333  20.960 1.00 76.69  ? 31   HIS C O     1 
ATOM   1588  C  CB    . HIS C 3  31  ? -9.567  -6.252  20.388 1.00 80.27  ? 31   HIS C CB    1 
ATOM   1589  C  CG    . HIS C 3  31  ? -10.842 -6.076  19.593 1.00 88.75  ? 31   HIS C CG    1 
ATOM   1590  N  ND1   . HIS C 3  31  ? -11.699 -7.094  19.367 1.00 98.64  ? 31   HIS C ND1   1 
ATOM   1591  C  CD2   . HIS C 3  31  ? -11.408 -4.950  18.992 1.00 80.57  ? 31   HIS C CD2   1 
ATOM   1592  C  CE1   . HIS C 3  31  ? -12.760 -6.640  18.662 1.00 94.09  ? 31   HIS C CE1   1 
ATOM   1593  N  NE2   . HIS C 3  31  ? -12.579 -5.333  18.432 1.00 83.65  ? 31   HIS C NE2   1 
ATOM   1594  N  N     . ARG C 3  32  ? -8.205  -8.913  21.033 1.00 72.79  ? 32   ARG C N     1 
ATOM   1595  C  CA    . ARG C 3  32  ? -7.777  -10.197 20.522 1.00 72.05  ? 32   ARG C CA    1 
ATOM   1596  C  C     . ARG C 3  32  ? -8.266  -11.311 21.434 1.00 80.19  ? 32   ARG C C     1 
ATOM   1597  O  O     . ARG C 3  32  ? -8.829  -12.304 20.950 1.00 89.58  ? 32   ARG C O     1 
ATOM   1598  C  CB    . ARG C 3  32  ? -6.250  -10.222 20.383 1.00 68.49  ? 32   ARG C CB    1 
ATOM   1599  C  CG    . ARG C 3  32  ? -5.671  -11.527 19.850 1.00 70.46  ? 32   ARG C CG    1 
ATOM   1600  C  CD    . ARG C 3  32  ? -4.173  -11.602 20.104 1.00 74.18  ? 32   ARG C CD    1 
ATOM   1601  N  NE    . ARG C 3  32  ? -3.887  -11.840 21.517 1.00 79.90  ? 32   ARG C NE    1 
ATOM   1602  C  CZ    . ARG C 3  32  ? -2.780  -11.465 22.163 1.00 83.48  ? 32   ARG C CZ    1 
ATOM   1603  N  NH1   . ARG C 3  32  ? -1.804  -10.816 21.549 1.00 89.29  ? 32   ARG C NH1   1 
ATOM   1604  N  NH2   . ARG C 3  32  ? -2.653  -11.736 23.451 1.00 95.16  ? 32   ARG C NH2   1 
ATOM   1605  N  N     . LEU C 3  33  ? -8.071  -11.133 22.745 1.00 79.27  ? 33   LEU C N     1 
ATOM   1606  C  CA    . LEU C 3  33  ? -8.412  -12.156 23.727 1.00 69.02  ? 33   LEU C CA    1 
ATOM   1607  C  C     . LEU C 3  33  ? -9.919  -12.356 23.823 1.00 70.09  ? 33   LEU C C     1 
ATOM   1608  O  O     . LEU C 3  33  ? -10.366 -13.462 24.124 1.00 74.30  ? 33   LEU C O     1 
ATOM   1609  C  CB    . LEU C 3  33  ? -7.823  -11.834 25.089 1.00 66.04  ? 33   LEU C CB    1 
ATOM   1610  C  CG    . LEU C 3  33  ? -6.299  -11.766 25.217 1.00 69.89  ? 33   LEU C CG    1 
ATOM   1611  C  CD1   . LEU C 3  33  ? -5.939  -11.204 26.586 1.00 72.84  ? 33   LEU C CD1   1 
ATOM   1612  C  CD2   . LEU C 3  33  ? -5.619  -13.109 25.013 1.00 71.07  ? 33   LEU C CD2   1 
ATOM   1613  N  N     . LEU C 3  34  ? -10.699 -11.311 23.543 1.00 62.77  ? 34   LEU C N     1 
ATOM   1614  C  CA    . LEU C 3  34  ? -12.157 -11.459 23.533 1.00 70.25  ? 34   LEU C CA    1 
ATOM   1615  C  C     . LEU C 3  34  ? -12.652 -12.379 22.418 1.00 74.66  ? 34   LEU C C     1 
ATOM   1616  O  O     . LEU C 3  34  ? -13.564 -13.180 22.635 1.00 69.92  ? 34   LEU C O     1 
ATOM   1617  C  CB    . LEU C 3  34  ? -12.876 -10.110 23.433 1.00 70.09  ? 34   LEU C CB    1 
ATOM   1618  C  CG    . LEU C 3  34  ? -13.037 -9.232  24.676 1.00 70.63  ? 34   LEU C CG    1 
ATOM   1619  C  CD1   . LEU C 3  34  ? -13.644 -7.889  24.292 1.00 73.89  ? 34   LEU C CD1   1 
ATOM   1620  C  CD2   . LEU C 3  34  ? -13.881 -9.887  25.752 1.00 66.05  ? 34   LEU C CD2   1 
ATOM   1621  N  N     . ARG C 3  35  ? -12.048 -12.254 21.231 1.00 81.36  ? 35   ARG C N     1 
ATOM   1622  C  CA    . ARG C 3  35  ? -12.426 -13.050 20.056 1.00 83.69  ? 35   ARG C CA    1 
ATOM   1623  C  C     . ARG C 3  35  ? -12.148 -14.539 20.231 1.00 80.64  ? 35   ARG C C     1 
ATOM   1624  O  O     . ARG C 3  35  ? -13.036 -15.367 20.020 1.00 81.37  ? 35   ARG C O     1 
ATOM   1625  C  CB    . ARG C 3  35  ? -11.704 -12.560 18.808 1.00 90.61  ? 35   ARG C CB    1 
ATOM   1626  C  CG    . ARG C 3  35  ? -12.051 -11.144 18.416 1.00 94.91  ? 35   ARG C CG    1 
ATOM   1627  C  CD    . ARG C 3  35  ? -11.495 -10.781 17.043 1.00 89.74  ? 35   ARG C CD    1 
ATOM   1628  N  NE    . ARG C 3  35  ? -11.897 -9.422  16.678 1.00 90.11  ? 35   ARG C NE    1 
ATOM   1629  C  CZ    . ARG C 3  35  ? -13.161 -9.016  16.500 1.00 96.72  ? 35   ARG C CZ    1 
ATOM   1630  N  NH1   . ARG C 3  35  ? -14.190 -9.850  16.659 1.00 93.82  ? 35   ARG C NH1   1 
ATOM   1631  N  NH2   . ARG C 3  35  ? -13.403 -7.755  16.160 1.00 100.58 ? 35   ARG C NH2   1 
ATOM   1632  N  N     . LYS C 3  36  ? -10.921 -14.870 20.617 1.00 75.32  ? 36   LYS C N     1 
ATOM   1633  C  CA    . LYS C 3  36  ? -10.524 -16.264 20.783 1.00 86.73  ? 36   LYS C CA    1 
ATOM   1634  C  C     . LYS C 3  36  ? -11.162 -16.973 21.998 1.00 86.17  ? 36   LYS C C     1 
ATOM   1635  O  O     . LYS C 3  36  ? -11.082 -18.194 22.131 1.00 91.29  ? 36   LYS C O     1 
ATOM   1636  C  CB    . LYS C 3  36  ? -8.998  -16.382 20.824 1.00 88.70  ? 36   LYS C CB    1 
ATOM   1637  C  CG    . LYS C 3  36  ? -8.349  -15.615 21.958 1.00 93.55  ? 36   LYS C CG    1 
ATOM   1638  C  CD    . LYS C 3  36  ? -6.844  -15.830 21.981 1.00 99.46  ? 36   LYS C CD    1 
ATOM   1639  C  CE    . LYS C 3  36  ? -6.467  -17.046 22.815 1.00 105.45 ? 36   LYS C CE    1 
ATOM   1640  N  NZ    . LYS C 3  36  ? -5.009  -17.038 23.128 1.00 109.35 ? 36   LYS C NZ    1 
ATOM   1641  N  N     . GLY C 3  37  ? -11.799 -16.208 22.873 1.00 80.76  ? 37   GLY C N     1 
ATOM   1642  C  CA    . GLY C 3  37  ? -12.420 -16.774 24.056 1.00 74.43  ? 37   GLY C CA    1 
ATOM   1643  C  C     . GLY C 3  37  ? -13.831 -17.248 23.788 1.00 77.99  ? 37   GLY C C     1 
ATOM   1644  O  O     . GLY C 3  37  ? -14.466 -17.824 24.683 1.00 82.39  ? 37   GLY C O     1 
ATOM   1645  N  N     . ASN C 3  38  ? -14.316 -17.020 22.562 1.00 72.80  ? 38   ASN C N     1 
ATOM   1646  C  CA    . ASN C 3  38  ? -15.633 -17.486 22.134 1.00 74.93  ? 38   ASN C CA    1 
ATOM   1647  C  C     . ASN C 3  38  ? -16.707 -17.083 23.107 1.00 74.75  ? 38   ASN C C     1 
ATOM   1648  O  O     . ASN C 3  38  ? -17.433 -17.924 23.660 1.00 80.94  ? 38   ASN C O     1 
ATOM   1649  C  CB    . ASN C 3  38  ? -15.651 -19.001 21.983 1.00 88.77  ? 38   ASN C CB    1 
ATOM   1650  C  CG    . ASN C 3  38  ? -14.971 -19.458 20.725 1.00 104.76 ? 38   ASN C CG    1 
ATOM   1651  O  OD1   . ASN C 3  38  ? -14.081 -20.326 20.766 1.00 115.35 ? 38   ASN C OD1   1 
ATOM   1652  N  ND2   . ASN C 3  38  ? -15.376 -18.872 19.586 1.00 101.03 ? 38   ASN C ND2   1 
ATOM   1653  N  N     . TYR C 3  39  ? -16.800 -15.792 23.355 1.00 68.09  ? 39   TYR C N     1 
ATOM   1654  C  CA    . TYR C 3  39  ? -17.796 -15.346 24.298 1.00 68.23  ? 39   TYR C CA    1 
ATOM   1655  C  C     . TYR C 3  39  ? -19.093 -15.060 23.549 1.00 66.93  ? 39   TYR C C     1 
ATOM   1656  O  O     . TYR C 3  39  ? -20.176 -15.214 24.109 1.00 69.46  ? 39   TYR C O     1 
ATOM   1657  C  CB    . TYR C 3  39  ? -17.269 -14.168 25.125 1.00 67.80  ? 39   TYR C CB    1 
ATOM   1658  C  CG    . TYR C 3  39  ? -16.030 -14.499 25.961 1.00 61.57  ? 39   TYR C CG    1 
ATOM   1659  C  CD1   . TYR C 3  39  ? -14.746 -14.184 25.509 1.00 62.95  ? 39   TYR C CD1   1 
ATOM   1660  C  CD2   . TYR C 3  39  ? -16.146 -15.120 27.189 1.00 56.75  ? 39   TYR C CD2   1 
ATOM   1661  C  CE1   . TYR C 3  39  ? -13.613 -14.475 26.260 1.00 60.68  ? 39   TYR C CE1   1 
ATOM   1662  C  CE2   . TYR C 3  39  ? -15.027 -15.420 27.945 1.00 60.38  ? 39   TYR C CE2   1 
ATOM   1663  C  CZ    . TYR C 3  39  ? -13.763 -15.101 27.480 1.00 64.16  ? 39   TYR C CZ    1 
ATOM   1664  O  OH    . TYR C 3  39  ? -12.655 -15.410 28.247 1.00 64.73  ? 39   TYR C OH    1 
ATOM   1665  N  N     . ALA C 3  40  ? -18.959 -14.696 22.270 1.00 63.44  ? 40   ALA C N     1 
ATOM   1666  C  CA    . ALA C 3  40  ? -20.079 -14.451 21.366 1.00 66.93  ? 40   ALA C CA    1 
ATOM   1667  C  C     . ALA C 3  40  ? -19.585 -14.469 19.915 1.00 73.06  ? 40   ALA C C     1 
ATOM   1668  O  O     . ALA C 3  40  ? -18.371 -14.440 19.670 1.00 72.31  ? 40   ALA C O     1 
ATOM   1669  C  CB    . ALA C 3  40  ? -20.730 -13.118 21.688 1.00 64.94  ? 40   ALA C CB    1 
ATOM   1670  N  N     . GLU C 3  41  ? -20.506 -14.525 18.952 1.00 76.41  ? 41   GLU C N     1 
ATOM   1671  C  CA    . GLU C 3  41  ? -20.093 -14.473 17.542 1.00 84.27  ? 41   GLU C CA    1 
ATOM   1672  C  C     . GLU C 3  41  ? -19.257 -13.218 17.336 1.00 82.57  ? 41   GLU C C     1 
ATOM   1673  O  O     . GLU C 3  41  ? -18.098 -13.292 16.932 1.00 75.64  ? 41   GLU C O     1 
ATOM   1674  C  CB    . GLU C 3  41  ? -21.285 -14.474 16.552 1.00 89.62  ? 41   GLU C CB    1 
ATOM   1675  C  CG    . GLU C 3  41  ? -22.215 -15.685 16.597 1.00 96.95  ? 41   GLU C CG    1 
ATOM   1676  C  CD    . GLU C 3  41  ? -21.471 -17.006 16.727 1.00 108.21 ? 41   GLU C CD    1 
ATOM   1677  O  OE1   . GLU C 3  41  ? -20.647 -17.331 15.838 1.00 108.73 ? 41   GLU C OE1   1 
ATOM   1678  O  OE2   . GLU C 3  41  ? -21.712 -17.722 17.725 1.00 108.72 ? 41   GLU C OE2   1 
ATOM   1679  N  N     . ARG C 3  42  ? -19.849 -12.072 17.664 1.00 85.45  ? 42   ARG C N     1 
ATOM   1680  C  CA    . ARG C 3  42  ? -19.272 -10.775 17.330 1.00 88.46  ? 42   ARG C CA    1 
ATOM   1681  C  C     . ARG C 3  42  ? -18.802 -10.007 18.558 1.00 93.96  ? 42   ARG C C     1 
ATOM   1682  O  O     . ARG C 3  42  ? -19.400 -10.114 19.640 1.00 88.01  ? 42   ARG C O     1 
ATOM   1683  C  CB    . ARG C 3  42  ? -20.298 -9.912  16.598 1.00 88.45  ? 42   ARG C CB    1 
ATOM   1684  C  CG    . ARG C 3  42  ? -20.948 -10.563 15.402 1.00 88.40  ? 42   ARG C CG    1 
ATOM   1685  C  CD    . ARG C 3  42  ? -21.804 -9.568  14.642 1.00 87.96  ? 42   ARG C CD    1 
ATOM   1686  N  NE    . ARG C 3  42  ? -21.911 -10.048 13.273 1.00 100.17 ? 42   ARG C NE    1 
ATOM   1687  C  CZ    . ARG C 3  42  ? -21.928 -9.272  12.200 1.00 99.72  ? 42   ARG C CZ    1 
ATOM   1688  N  NH1   . ARG C 3  42  ? -21.858 -7.948  12.336 1.00 98.52  ? 42   ARG C NH1   1 
ATOM   1689  N  NH2   . ARG C 3  42  ? -22.014 -9.833  10.996 1.00 90.93  ? 42   ARG C NH2   1 
ATOM   1690  N  N     . VAL C 3  43  ? -17.745 -9.215  18.364 1.00 89.11  ? 43   VAL C N     1 
ATOM   1691  C  CA    . VAL C 3  43  ? -17.259 -8.283  19.381 1.00 85.07  ? 43   VAL C CA    1 
ATOM   1692  C  C     . VAL C 3  43  ? -17.279 -6.828  18.918 1.00 80.55  ? 43   VAL C C     1 
ATOM   1693  O  O     . VAL C 3  43  ? -16.477 -6.408  18.080 1.00 81.46  ? 43   VAL C O     1 
ATOM   1694  C  CB    . VAL C 3  43  ? -15.832 -8.628  19.824 1.00 84.69  ? 43   VAL C CB    1 
ATOM   1695  C  CG1   . VAL C 3  43  ? -15.346 -7.654  20.899 1.00 75.89  ? 43   VAL C CG1   1 
ATOM   1696  C  CG2   . VAL C 3  43  ? -15.784 -10.064 20.314 1.00 85.84  ? 43   VAL C CG2   1 
ATOM   1697  N  N     . GLY C 3  44  ? -18.178 -6.054  19.504 1.00 77.33  ? 44   GLY C N     1 
ATOM   1698  C  CA    . GLY C 3  44  ? -18.225 -4.620  19.247 1.00 80.29  ? 44   GLY C CA    1 
ATOM   1699  C  C     . GLY C 3  44  ? -16.931 -3.877  19.550 1.00 74.06  ? 44   GLY C C     1 
ATOM   1700  O  O     . GLY C 3  44  ? -16.068 -4.351  20.289 1.00 75.78  ? 44   GLY C O     1 
ATOM   1701  N  N     . ALA C 3  45  ? -16.825 -2.686  18.983 1.00 75.68  ? 45   ALA C N     1 
ATOM   1702  C  CA    . ALA C 3  45  ? -15.602 -1.897  19.013 1.00 74.27  ? 45   ALA C CA    1 
ATOM   1703  C  C     . ALA C 3  45  ? -15.351 -1.278  20.377 1.00 75.63  ? 45   ALA C C     1 
ATOM   1704  O  O     . ALA C 3  45  ? -14.206 -1.128  20.791 1.00 74.97  ? 45   ALA C O     1 
ATOM   1705  C  CB    . ALA C 3  45  ? -15.673 -0.809  17.952 1.00 74.45  ? 45   ALA C CB    1 
ATOM   1706  N  N     . GLY C 3  46  ? -16.422 -0.896  21.061 1.00 75.12  ? 46   GLY C N     1 
ATOM   1707  C  CA    . GLY C 3  46  ? -16.303 -0.351  22.407 1.00 75.45  ? 46   GLY C CA    1 
ATOM   1708  C  C     . GLY C 3  46  ? -15.956 -1.346  23.509 1.00 71.58  ? 46   GLY C C     1 
ATOM   1709  O  O     . GLY C 3  46  ? -15.377 -0.963  24.525 1.00 74.25  ? 46   GLY C O     1 
ATOM   1710  N  N     . ALA C 3  47  ? -16.299 -2.616  23.317 1.00 68.57  ? 47   ALA C N     1 
ATOM   1711  C  CA    . ALA C 3  47  ? -16.155 -3.604  24.374 1.00 67.55  ? 47   ALA C CA    1 
ATOM   1712  C  C     . ALA C 3  47  ? -14.710 -3.697  24.875 1.00 65.81  ? 47   ALA C C     1 
ATOM   1713  O  O     . ALA C 3  47  ? -14.458 -3.489  26.062 1.00 65.42  ? 47   ALA C O     1 
ATOM   1714  C  CB    . ALA C 3  47  ? -16.685 -4.958  23.934 1.00 70.45  ? 47   ALA C CB    1 
ATOM   1715  N  N     . PRO C 3  48  ? -13.748 -3.947  23.977 1.00 62.34  ? 48   PRO C N     1 
ATOM   1716  C  CA    . PRO C 3  48  ? -12.372 -4.036  24.494 1.00 64.60  ? 48   PRO C CA    1 
ATOM   1717  C  C     . PRO C 3  48  ? -11.888 -2.740  25.144 1.00 67.96  ? 48   PRO C C     1 
ATOM   1718  O  O     . PRO C 3  48  ? -11.035 -2.778  26.042 1.00 73.28  ? 48   PRO C O     1 
ATOM   1719  C  CB    . PRO C 3  48  ? -11.533 -4.330  23.243 1.00 61.24  ? 48   PRO C CB    1 
ATOM   1720  C  CG    . PRO C 3  48  ? -12.357 -3.811  22.122 1.00 61.06  ? 48   PRO C CG    1 
ATOM   1721  C  CD    . PRO C 3  48  ? -13.796 -4.026  22.509 1.00 58.32  ? 48   PRO C CD    1 
ATOM   1722  N  N     . VAL C 3  49  ? -12.422 -1.609  24.680 1.00 68.08  ? 49   VAL C N     1 
ATOM   1723  C  CA    . VAL C 3  49  ? -12.086 -0.297  25.222 1.00 62.45  ? 49   VAL C CA    1 
ATOM   1724  C  C     . VAL C 3  49  ? -12.592 -0.217  26.650 1.00 59.22  ? 49   VAL C C     1 
ATOM   1725  O  O     . VAL C 3  49  ? -11.816 0.025   27.588 1.00 59.62  ? 49   VAL C O     1 
ATOM   1726  C  CB    . VAL C 3  49  ? -12.634 0.848   24.325 1.00 64.01  ? 49   VAL C CB    1 
ATOM   1727  C  CG1   . VAL C 3  49  ? -12.747 2.167   25.090 1.00 66.63  ? 49   VAL C CG1   1 
ATOM   1728  C  CG2   . VAL C 3  49  ? -11.717 1.027   23.118 1.00 60.60  ? 49   VAL C CG2   1 
ATOM   1729  N  N     . TYR C 3  50  ? -13.881 -0.486  26.814 1.00 57.90  ? 50   TYR C N     1 
ATOM   1730  C  CA    . TYR C 3  50  ? -14.538 -0.391  28.111 1.00 60.92  ? 50   TYR C CA    1 
ATOM   1731  C  C     . TYR C 3  50  ? -13.961 -1.389  29.113 1.00 65.15  ? 50   TYR C C     1 
ATOM   1732  O  O     . TYR C 3  50  ? -13.771 -1.053  30.290 1.00 69.05  ? 50   TYR C O     1 
ATOM   1733  C  CB    . TYR C 3  50  ? -16.024 -0.641  27.926 1.00 63.16  ? 50   TYR C CB    1 
ATOM   1734  C  CG    . TYR C 3  50  ? -16.932 -0.236  29.069 1.00 64.42  ? 50   TYR C CG    1 
ATOM   1735  C  CD1   . TYR C 3  50  ? -18.060 0.536   28.820 1.00 61.39  ? 50   TYR C CD1   1 
ATOM   1736  C  CD2   . TYR C 3  50  ? -16.702 -0.662  30.383 1.00 63.25  ? 50   TYR C CD2   1 
ATOM   1737  C  CE1   . TYR C 3  50  ? -18.928 0.897   29.839 1.00 61.97  ? 50   TYR C CE1   1 
ATOM   1738  C  CE2   . TYR C 3  50  ? -17.568 -0.307  31.408 1.00 64.86  ? 50   TYR C CE2   1 
ATOM   1739  C  CZ    . TYR C 3  50  ? -18.685 0.470   31.129 1.00 65.45  ? 50   TYR C CZ    1 
ATOM   1740  O  OH    . TYR C 3  50  ? -19.554 0.836   32.139 1.00 63.87  ? 50   TYR C OH    1 
ATOM   1741  N  N     . LEU C 3  51  ? -13.689 -2.609  28.647 1.00 60.56  ? 51   LEU C N     1 
ATOM   1742  C  CA    . LEU C 3  51  ? -13.124 -3.627  29.504 1.00 57.49  ? 51   LEU C CA    1 
ATOM   1743  C  C     . LEU C 3  51  ? -11.685 -3.276  29.874 1.00 61.82  ? 51   LEU C C     1 
ATOM   1744  O  O     . LEU C 3  51  ? -11.297 -3.375  31.052 1.00 65.57  ? 51   LEU C O     1 
ATOM   1745  C  CB    . LEU C 3  51  ? -13.235 -5.022  28.864 1.00 59.74  ? 51   LEU C CB    1 
ATOM   1746  C  CG    . LEU C 3  51  ? -12.583 -6.247  29.538 1.00 57.68  ? 51   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C 3  51  ? -12.941 -6.443  31.003 1.00 55.87  ? 51   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C 3  51  ? -12.956 -7.473  28.741 1.00 59.39  ? 51   LEU C CD2   1 
ATOM   1749  N  N     . ALA C 3  52  ? -10.888 -2.849  28.899 1.00 57.20  ? 52   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3  52  ? -9.503  -2.524  29.223 1.00 59.39  ? 52   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3  52  ? -9.444  -1.406  30.274 1.00 59.51  ? 52   ALA C C     1 
ATOM   1752  O  O     . ALA C 3  52  ? -8.519  -1.365  31.098 1.00 59.52  ? 52   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3  52  ? -8.709  -2.166  27.980 1.00 53.86  ? 52   ALA C CB    1 
ATOM   1754  N  N     . ALA C 3  53  ? -10.449 -0.528  30.261 1.00 54.46  ? 53   ALA C N     1 
ATOM   1755  C  CA    . ALA C 3  53  ? -10.521 0.561   31.228 1.00 57.16  ? 53   ALA C CA    1 
ATOM   1756  C  C     . ALA C 3  53  ? -10.844 0.072   32.644 1.00 60.13  ? 53   ALA C C     1 
ATOM   1757  O  O     . ALA C 3  53  ? -10.200 0.479   33.636 1.00 55.55  ? 53   ALA C O     1 
ATOM   1758  C  CB    . ALA C 3  53  ? -11.555 1.575   30.784 1.00 60.61  ? 53   ALA C CB    1 
ATOM   1759  N  N     . VAL C 3  54  ? -11.860 -0.789  32.727 1.00 58.63  ? 54   VAL C N     1 
ATOM   1760  C  CA    . VAL C 3  54  ? -12.220 -1.441  33.980 1.00 59.12  ? 54   VAL C CA    1 
ATOM   1761  C  C     . VAL C 3  54  ? -11.022 -2.212  34.568 1.00 56.56  ? 54   VAL C C     1 
ATOM   1762  O  O     . VAL C 3  54  ? -10.691 -2.087  35.766 1.00 52.79  ? 54   VAL C O     1 
ATOM   1763  C  CB    . VAL C 3  54  ? -13.472 -2.319  33.796 1.00 58.52  ? 54   VAL C CB    1 
ATOM   1764  C  CG1   . VAL C 3  54  ? -13.635 -3.303  34.945 1.00 58.10  ? 54   VAL C CG1   1 
ATOM   1765  C  CG2   . VAL C 3  54  ? -14.698 -1.431  33.708 1.00 57.34  ? 54   VAL C CG2   1 
ATOM   1766  N  N     . LEU C 3  55  ? -10.356 -2.970  33.704 1.00 53.86  ? 55   LEU C N     1 
ATOM   1767  C  CA    . LEU C 3  55  ? -9.174  -3.711  34.106 1.00 57.60  ? 55   LEU C CA    1 
ATOM   1768  C  C     . LEU C 3  55  ? -8.146  -2.793  34.725 1.00 57.75  ? 55   LEU C C     1 
ATOM   1769  O  O     . LEU C 3  55  ? -7.666  -3.058  35.822 1.00 55.32  ? 55   LEU C O     1 
ATOM   1770  C  CB    . LEU C 3  55  ? -8.597  -4.492  32.929 1.00 57.27  ? 55   LEU C CB    1 
ATOM   1771  C  CG    . LEU C 3  55  ? -9.534  -5.652  32.525 1.00 60.52  ? 55   LEU C CG    1 
ATOM   1772  C  CD1   . LEU C 3  55  ? -9.158  -6.262  31.190 1.00 66.65  ? 55   LEU C CD1   1 
ATOM   1773  C  CD2   . LEU C 3  55  ? -9.604  -6.740  33.578 1.00 53.29  ? 55   LEU C CD2   1 
ATOM   1774  N  N     . GLU C 3  56  ? -7.870  -1.685  34.038 1.00 61.42  ? 56   GLU C N     1 
ATOM   1775  C  CA    . GLU C 3  56  ? -6.884  -0.706  34.471 1.00 58.59  ? 56   GLU C CA    1 
ATOM   1776  C  C     . GLU C 3  56  ? -7.333  -0.033  35.779 1.00 57.51  ? 56   GLU C C     1 
ATOM   1777  O  O     . GLU C 3  56  ? -6.514  0.194   36.693 1.00 57.28  ? 56   GLU C O     1 
ATOM   1778  C  CB    . GLU C 3  56  ? -6.671  0.309   33.356 1.00 62.81  ? 56   GLU C CB    1 
ATOM   1779  C  CG    . GLU C 3  56  ? -5.481  1.243   33.520 1.00 67.35  ? 56   GLU C CG    1 
ATOM   1780  C  CD    . GLU C 3  56  ? -5.360  2.218   32.361 1.00 68.61  ? 56   GLU C CD    1 
ATOM   1781  O  OE1   . GLU C 3  56  ? -5.312  1.744   31.196 1.00 69.11  ? 56   GLU C OE1   1 
ATOM   1782  O  OE2   . GLU C 3  56  ? -5.308  3.446   32.608 1.00 72.11  ? 56   GLU C OE2   1 
ATOM   1783  N  N     . TYR C 3  57  ? -8.628  0.262   35.883 1.00 55.06  ? 57   TYR C N     1 
ATOM   1784  C  CA    . TYR C 3  57  ? -9.150  0.878   37.094 1.00 53.50  ? 57   TYR C CA    1 
ATOM   1785  C  C     . TYR C 3  57  ? -8.856  -0.018  38.291 1.00 57.97  ? 57   TYR C C     1 
ATOM   1786  O  O     . TYR C 3  57  ? -8.153  0.399   39.207 1.00 57.31  ? 57   TYR C O     1 
ATOM   1787  C  CB    . TYR C 3  57  ? -10.640 1.157   36.967 1.00 55.14  ? 57   TYR C CB    1 
ATOM   1788  C  CG    . TYR C 3  57  ? -11.286 1.410   38.297 1.00 62.17  ? 57   TYR C CG    1 
ATOM   1789  C  CD1   . TYR C 3  57  ? -10.908 2.504   39.089 1.00 62.85  ? 57   TYR C CD1   1 
ATOM   1790  C  CD2   . TYR C 3  57  ? -12.265 0.537   38.789 1.00 61.55  ? 57   TYR C CD2   1 
ATOM   1791  C  CE1   . TYR C 3  57  ? -11.496 2.720   40.331 1.00 65.17  ? 57   TYR C CE1   1 
ATOM   1792  C  CE2   . TYR C 3  57  ? -12.868 0.750   40.020 1.00 61.04  ? 57   TYR C CE2   1 
ATOM   1793  C  CZ    . TYR C 3  57  ? -12.477 1.836   40.795 1.00 67.20  ? 57   TYR C CZ    1 
ATOM   1794  O  OH    . TYR C 3  57  ? -13.072 2.024   42.034 1.00 71.22  ? 57   TYR C OH    1 
ATOM   1795  N  N     . LEU C 3  58  ? -9.362  -1.259  38.256 1.00 59.21  ? 58   LEU C N     1 
ATOM   1796  C  CA    . LEU C 3  58  ? -9.133  -2.252  39.322 1.00 51.89  ? 58   LEU C CA    1 
ATOM   1797  C  C     . LEU C 3  58  ? -7.654  -2.465  39.665 1.00 52.25  ? 58   LEU C C     1 
ATOM   1798  O  O     . LEU C 3  58  ? -7.285  -2.496  40.846 1.00 54.74  ? 58   LEU C O     1 
ATOM   1799  C  CB    . LEU C 3  58  ? -9.791  -3.589  38.972 1.00 50.69  ? 58   LEU C CB    1 
ATOM   1800  C  CG    . LEU C 3  58  ? -11.324 -3.605  38.972 1.00 50.21  ? 58   LEU C CG    1 
ATOM   1801  C  CD1   . LEU C 3  58  ? -11.953 -4.912  38.488 1.00 43.04  ? 58   LEU C CD1   1 
ATOM   1802  C  CD2   . LEU C 3  58  ? -11.858 -3.200  40.347 1.00 52.51  ? 58   LEU C CD2   1 
ATOM   1803  N  N     . THR C 3  59  ? -6.798  -2.604  38.661 1.00 48.33  ? 59   THR C N     1 
ATOM   1804  C  CA    . THR C 3  59  ? -5.407  -2.798  38.982 1.00 49.62  ? 59   THR C CA    1 
ATOM   1805  C  C     . THR C 3  59  ? -4.798  -1.574  39.651 1.00 54.52  ? 59   THR C C     1 
ATOM   1806  O  O     . THR C 3  59  ? -3.958  -1.719  40.552 1.00 58.84  ? 59   THR C O     1 
ATOM   1807  C  CB    . THR C 3  59  ? -4.556  -3.406  37.838 1.00 50.72  ? 59   THR C CB    1 
ATOM   1808  O  OG1   . THR C 3  59  ? -3.408  -2.588  37.573 1.00 52.46  ? 59   THR C OG1   1 
ATOM   1809  C  CG2   . THR C 3  59  ? -5.346  -3.583  36.592 1.00 49.92  ? 59   THR C CG2   1 
ATOM   1810  N  N     . ALA C 3  60  ? -5.254  -0.379  39.271 1.00 51.73  ? 60   ALA C N     1 
ATOM   1811  C  CA    . ALA C 3  60  ? -4.784  0.847   39.942 1.00 50.29  ? 60   ALA C CA    1 
ATOM   1812  C  C     . ALA C 3  60  ? -5.180  0.874   41.416 1.00 50.86  ? 60   ALA C C     1 
ATOM   1813  O  O     . ALA C 3  60  ? -4.399  1.270   42.295 1.00 48.92  ? 60   ALA C O     1 
ATOM   1814  C  CB    . ALA C 3  60  ? -5.294  2.094   39.226 1.00 48.38  ? 60   ALA C CB    1 
ATOM   1815  N  N     . GLU C 3  61  ? -6.406  0.437   41.672 1.00 53.40  ? 61   GLU C N     1 
ATOM   1816  C  CA    . GLU C 3  61  ? -6.998  0.502   42.985 1.00 51.50  ? 61   GLU C CA    1 
ATOM   1817  C  C     . GLU C 3  61  ? -6.217  -0.414  43.918 1.00 54.61  ? 61   GLU C C     1 
ATOM   1818  O  O     . GLU C 3  61  ? -5.863  -0.020  45.030 1.00 52.74  ? 61   GLU C O     1 
ATOM   1819  C  CB    . GLU C 3  61  ? -8.461  0.111   42.871 1.00 54.42  ? 61   GLU C CB    1 
ATOM   1820  C  CG    . GLU C 3  61  ? -9.215  0.160   44.178 1.00 66.02  ? 61   GLU C CG    1 
ATOM   1821  C  CD    . GLU C 3  61  ? -9.624  1.563   44.612 1.00 78.42  ? 61   GLU C CD    1 
ATOM   1822  O  OE1   . GLU C 3  61  ? -9.738  2.475   43.741 1.00 77.65  ? 61   GLU C OE1   1 
ATOM   1823  O  OE2   . GLU C 3  61  ? -9.862  1.730   45.842 1.00 79.16  ? 61   GLU C OE2   1 
ATOM   1824  N  N     . ILE C 3  62  ? -5.907  -1.623  43.450 1.00 54.72  ? 62   ILE C N     1 
ATOM   1825  C  CA    . ILE C 3  62  ? -5.157  -2.572  44.273 1.00 54.89  ? 62   ILE C CA    1 
ATOM   1826  C  C     . ILE C 3  62  ? -3.703  -2.141  44.505 1.00 56.31  ? 62   ILE C C     1 
ATOM   1827  O  O     . ILE C 3  62  ? -3.179  -2.208  45.626 1.00 59.61  ? 62   ILE C O     1 
ATOM   1828  C  CB    . ILE C 3  62  ? -5.284  -4.009  43.738 1.00 54.82  ? 62   ILE C CB    1 
ATOM   1829  C  CG1   . ILE C 3  62  ? -4.377  -4.949  44.477 1.00 55.55  ? 62   ILE C CG1   1 
ATOM   1830  C  CG2   . ILE C 3  62  ? -4.894  -4.104  42.286 1.00 64.53  ? 62   ILE C CG2   1 
ATOM   1831  C  CD1   . ILE C 3  62  ? -4.990  -6.331  44.479 1.00 71.64  ? 62   ILE C CD1   1 
ATOM   1832  N  N     . LEU C 3  63  ? -3.075  -1.643  43.452 1.00 56.26  ? 63   LEU C N     1 
ATOM   1833  C  CA    . LEU C 3  63  ? -1.724  -1.140  43.544 1.00 52.55  ? 63   LEU C CA    1 
ATOM   1834  C  C     . LEU C 3  63  ? -1.597  0.040   44.516 1.00 52.46  ? 63   LEU C C     1 
ATOM   1835  O  O     . LEU C 3  63  ? -0.610  0.142   45.254 1.00 51.24  ? 63   LEU C O     1 
ATOM   1836  C  CB    . LEU C 3  63  ? -1.225  -0.794  42.155 1.00 49.21  ? 63   LEU C CB    1 
ATOM   1837  C  CG    . LEU C 3  63  ? -0.924  -2.041  41.315 1.00 53.90  ? 63   LEU C CG    1 
ATOM   1838  C  CD1   . LEU C 3  63  ? -0.489  -1.624  39.929 1.00 54.19  ? 63   LEU C CD1   1 
ATOM   1839  C  CD2   . LEU C 3  63  ? 0.145   -2.941  41.945 1.00 53.24  ? 63   LEU C CD2   1 
ATOM   1840  N  N     . GLU C 3  64  ? -2.605  0.908   44.546 1.00 51.89  ? 64   GLU C N     1 
ATOM   1841  C  CA    . GLU C 3  64  ? -2.568  2.028   45.457 1.00 54.22  ? 64   GLU C CA    1 
ATOM   1842  C  C     . GLU C 3  64  ? -2.451  1.477   46.872 1.00 59.09  ? 64   GLU C C     1 
ATOM   1843  O  O     . GLU C 3  64  ? -1.466  1.716   47.581 1.00 58.90  ? 64   GLU C O     1 
ATOM   1844  C  CB    . GLU C 3  64  ? -3.829  2.857   45.299 1.00 57.79  ? 64   GLU C CB    1 
ATOM   1845  C  CG    . GLU C 3  64  ? -3.914  4.099   46.189 1.00 63.56  ? 64   GLU C CG    1 
ATOM   1846  C  CD    . GLU C 3  64  ? -2.781  5.093   45.987 1.00 61.68  ? 64   GLU C CD    1 
ATOM   1847  O  OE1   . GLU C 3  64  ? -2.542  5.938   46.875 1.00 65.08  ? 64   GLU C OE1   1 
ATOM   1848  O  OE2   . GLU C 3  64  ? -2.132  5.036   44.938 1.00 66.91  ? 64   GLU C OE2   1 
ATOM   1849  N  N     . LEU C 3  65  ? -3.452  0.690   47.251 1.00 61.53  ? 65   LEU C N     1 
ATOM   1850  C  CA    . LEU C 3  65  ? -3.537  0.059   48.564 1.00 55.16  ? 65   LEU C CA    1 
ATOM   1851  C  C     . LEU C 3  65  ? -2.343  -0.848  48.924 1.00 57.44  ? 65   LEU C C     1 
ATOM   1852  O  O     . LEU C 3  65  ? -1.881  -0.850  50.084 1.00 53.46  ? 65   LEU C O     1 
ATOM   1853  C  CB    . LEU C 3  65  ? -4.836  -0.713  48.646 1.00 50.96  ? 65   LEU C CB    1 
ATOM   1854  C  CG    . LEU C 3  65  ? -6.082  0.151   48.512 1.00 48.35  ? 65   LEU C CG    1 
ATOM   1855  C  CD1   . LEU C 3  65  ? -7.252  -0.791  48.307 1.00 50.88  ? 65   LEU C CD1   1 
ATOM   1856  C  CD2   . LEU C 3  65  ? -6.283  1.015   49.749 1.00 45.18  ? 65   LEU C CD2   1 
ATOM   1857  N  N     . ALA C 3  66  ? -1.850  -1.607  47.942 1.00 54.87  ? 66   ALA C N     1 
ATOM   1858  C  CA    . ALA C 3  66  ? -0.675  -2.452  48.155 1.00 55.41  ? 66   ALA C CA    1 
ATOM   1859  C  C     . ALA C 3  66  ? 0.579   -1.617  48.419 1.00 55.73  ? 66   ALA C C     1 
ATOM   1860  O  O     . ALA C 3  66  ? 1.392   -1.915  49.309 1.00 49.49  ? 66   ALA C O     1 
ATOM   1861  C  CB    . ALA C 3  66  ? -0.471  -3.355  46.957 1.00 57.82  ? 66   ALA C CB    1 
ATOM   1862  N  N     . GLY C 3  67  ? 0.701   -0.540  47.650 1.00 58.98  ? 67   GLY C N     1 
ATOM   1863  C  CA    . GLY C 3  67  ? 1.784   0.411   47.831 1.00 56.81  ? 67   GLY C CA    1 
ATOM   1864  C  C     . GLY C 3  67  ? 1.801   0.940   49.252 1.00 54.37  ? 67   GLY C C     1 
ATOM   1865  O  O     . GLY C 3  67  ? 2.868   1.087   49.858 1.00 54.79  ? 67   GLY C O     1 
ATOM   1866  N  N     . ASN C 3  68  ? 0.625   1.221   49.798 1.00 53.17  ? 68   ASN C N     1 
ATOM   1867  C  CA    . ASN C 3  68  ? 0.574   1.767   51.143 1.00 54.90  ? 68   ASN C CA    1 
ATOM   1868  C  C     . ASN C 3  68  ? 1.009   0.741   52.150 1.00 58.77  ? 68   ASN C C     1 
ATOM   1869  O  O     . ASN C 3  68  ? 1.666   1.076   53.136 1.00 58.47  ? 68   ASN C O     1 
ATOM   1870  C  CB    . ASN C 3  68  ? -0.807  2.314   51.476 1.00 56.20  ? 68   ASN C CB    1 
ATOM   1871  C  CG    . ASN C 3  68  ? -1.241  3.398   50.504 1.00 61.08  ? 68   ASN C CG    1 
ATOM   1872  O  OD1   . ASN C 3  68  ? -0.415  3.997   49.800 1.00 56.70  ? 68   ASN C OD1   1 
ATOM   1873  N  ND2   . ASN C 3  68  ? -2.541  3.649   50.452 1.00 62.06  ? 68   ASN C ND2   1 
ATOM   1874  N  N     . ALA C 3  69  ? 0.685   -0.523  51.885 1.00 60.38  ? 69   ALA C N     1 
ATOM   1875  C  CA    . ALA C 3  69  ? 1.041   -1.554  52.827 1.00 59.10  ? 69   ALA C CA    1 
ATOM   1876  C  C     . ALA C 3  69  ? 2.551   -1.732  52.791 1.00 60.02  ? 69   ALA C C     1 
ATOM   1877  O  O     . ALA C 3  69  ? 3.187   -1.850  53.843 1.00 60.14  ? 69   ALA C O     1 
ATOM   1878  C  CB    . ALA C 3  69  ? 0.311   -2.841  52.528 1.00 60.87  ? 69   ALA C CB    1 
ATOM   1879  N  N     . ALA C 3  70  ? 3.128   -1.704  51.589 1.00 58.11  ? 70   ALA C N     1 
ATOM   1880  C  CA    . ALA C 3  70  ? 4.585   -1.722  51.449 1.00 56.93  ? 70   ALA C CA    1 
ATOM   1881  C  C     . ALA C 3  70  ? 5.206   -0.605  52.289 1.00 59.73  ? 70   ALA C C     1 
ATOM   1882  O  O     . ALA C 3  70  ? 6.084   -0.845  53.110 1.00 62.19  ? 70   ALA C O     1 
ATOM   1883  C  CB    . ALA C 3  70  ? 4.982   -1.575  49.997 1.00 47.23  ? 70   ALA C CB    1 
ATOM   1884  N  N     . ARG C 3  71  ? 4.726   0.617   52.098 1.00 64.12  ? 71   ARG C N     1 
ATOM   1885  C  CA    . ARG C 3  71  ? 5.265   1.746   52.825 1.00 63.18  ? 71   ARG C CA    1 
ATOM   1886  C  C     . ARG C 3  71  ? 5.040   1.625   54.334 1.00 60.77  ? 71   ARG C C     1 
ATOM   1887  O  O     . ARG C 3  71  ? 5.960   1.875   55.099 1.00 65.26  ? 71   ARG C O     1 
ATOM   1888  C  CB    . ARG C 3  71  ? 4.744   3.075   52.267 1.00 67.85  ? 71   ARG C CB    1 
ATOM   1889  C  CG    . ARG C 3  71  ? 4.853   4.231   53.254 1.00 71.07  ? 71   ARG C CG    1 
ATOM   1890  C  CD    . ARG C 3  71  ? 4.407   5.548   52.684 1.00 73.90  ? 71   ARG C CD    1 
ATOM   1891  N  NE    . ARG C 3  71  ? 5.396   6.062   51.748 1.00 91.99  ? 71   ARG C NE    1 
ATOM   1892  C  CZ    . ARG C 3  71  ? 5.452   7.323   51.334 1.00 102.79 ? 71   ARG C CZ    1 
ATOM   1893  N  NH1   . ARG C 3  71  ? 4.568   8.217   51.779 1.00 107.18 ? 71   ARG C NH1   1 
ATOM   1894  N  NH2   . ARG C 3  71  ? 6.393   7.683   50.471 1.00 103.46 ? 71   ARG C NH2   1 
ATOM   1895  N  N     . ASP C 3  72  ? 3.850   1.227   54.768 1.00 58.16  ? 72   ASP C N     1 
ATOM   1896  C  CA    . ASP C 3  72  ? 3.617   0.986   56.201 1.00 63.97  ? 72   ASP C CA    1 
ATOM   1897  C  C     . ASP C 3  72  ? 4.632   -0.002  56.845 1.00 69.81  ? 72   ASP C C     1 
ATOM   1898  O  O     . ASP C 3  72  ? 4.804   0.000   58.063 1.00 72.21  ? 72   ASP C O     1 
ATOM   1899  C  CB    . ASP C 3  72  ? 2.196   0.462   56.451 1.00 61.69  ? 72   ASP C CB    1 
ATOM   1900  C  CG    . ASP C 3  72  ? 1.126   1.471   56.145 1.00 64.57  ? 72   ASP C CG    1 
ATOM   1901  O  OD1   . ASP C 3  72  ? 1.305   2.669   56.457 1.00 66.31  ? 72   ASP C OD1   1 
ATOM   1902  O  OD2   . ASP C 3  72  ? 0.078   1.058   55.592 1.00 69.88  ? 72   ASP C OD2   1 
ATOM   1903  N  N     . ASN C 3  73  ? 5.262   -0.850  56.028 1.00 73.19  ? 73   ASN C N     1 
ATOM   1904  C  CA    . ASN C 3  73  ? 6.235   -1.854  56.487 1.00 79.99  ? 73   ASN C CA    1 
ATOM   1905  C  C     . ASN C 3  73  ? 7.653   -1.426  56.197 1.00 81.36  ? 73   ASN C C     1 
ATOM   1906  O  O     . ASN C 3  73  ? 8.579   -2.237  56.273 1.00 85.05  ? 73   ASN C O     1 
ATOM   1907  C  CB    . ASN C 3  73  ? 6.024   -3.189  55.766 1.00 87.27  ? 73   ASN C CB    1 
ATOM   1908  C  CG    . ASN C 3  73  ? 4.897   -4.006  56.354 1.00 99.39  ? 73   ASN C CG    1 
ATOM   1909  O  OD1   . ASN C 3  73  ? 5.154   -5.030  56.975 1.00 100.86 ? 73   ASN C OD1   1 
ATOM   1910  N  ND2   . ASN C 3  73  ? 3.639   -3.563  56.161 1.00 96.98  ? 73   ASN C ND2   1 
ATOM   1911  N  N     . LYS C 3  74  ? 7.816   -0.161  55.829 1.00 77.54  ? 74   LYS C N     1 
ATOM   1912  C  CA    . LYS C 3  74  ? 9.103   0.371   55.366 1.00 73.75  ? 74   LYS C CA    1 
ATOM   1913  C  C     . LYS C 3  74  ? 9.725   -0.463  54.258 1.00 69.22  ? 74   LYS C C     1 
ATOM   1914  O  O     . LYS C 3  74  ? 10.903  -0.785  54.324 1.00 71.45  ? 74   LYS C O     1 
ATOM   1915  C  CB    . LYS C 3  74  ? 10.088  0.518   56.527 1.00 77.72  ? 74   LYS C CB    1 
ATOM   1916  C  CG    . LYS C 3  74  ? 9.624   1.467   57.622 1.00 90.01  ? 74   LYS C CG    1 
ATOM   1917  C  CD    . LYS C 3  74  ? 10.021  0.938   58.990 1.00 94.51  ? 74   LYS C CD    1 
ATOM   1918  C  CE    . LYS C 3  74  ? 9.025   1.379   60.045 1.00 98.72  ? 74   LYS C CE    1 
ATOM   1919  N  NZ    . LYS C 3  74  ? 9.415   0.866   61.387 1.00 98.75  ? 74   LYS C NZ    1 
ATOM   1920  N  N     . LYS C 3  75  ? 8.942   -0.808  53.242 1.00 65.12  ? 75   LYS C N     1 
ATOM   1921  C  CA    . LYS C 3  75  ? 9.476   -1.524  52.087 1.00 66.04  ? 75   LYS C CA    1 
ATOM   1922  C  C     . LYS C 3  75  ? 9.186   -0.767  50.822 1.00 63.62  ? 75   LYS C C     1 
ATOM   1923  O  O     . LYS C 3  75  ? 8.241   -0.003  50.759 1.00 73.40  ? 75   LYS C O     1 
ATOM   1924  C  CB    . LYS C 3  75  ? 8.843   -2.906  51.955 1.00 69.79  ? 75   LYS C CB    1 
ATOM   1925  C  CG    . LYS C 3  75  ? 9.050   -3.810  53.142 1.00 66.21  ? 75   LYS C CG    1 
ATOM   1926  C  CD    . LYS C 3  75  ? 10.410  -4.466  53.104 1.00 62.47  ? 75   LYS C CD    1 
ATOM   1927  C  CE    . LYS C 3  75  ? 10.584  -5.348  54.327 1.00 68.07  ? 75   LYS C CE    1 
ATOM   1928  N  NZ    . LYS C 3  75  ? 9.996   -4.793  55.596 1.00 66.94  ? 75   LYS C NZ    1 
ATOM   1929  N  N     . THR C 3  76  ? 9.979   -1.038  49.804 1.00 59.78  ? 76   THR C N     1 
ATOM   1930  C  CA    . THR C 3  76  ? 9.965   -0.301  48.560 1.00 62.45  ? 76   THR C CA    1 
ATOM   1931  C  C     . THR C 3  76  ? 9.404   -1.180  47.464 1.00 67.65  ? 76   THR C C     1 
ATOM   1932  O  O     . THR C 3  76  ? 8.966   -0.694  46.415 1.00 65.08  ? 76   THR C O     1 
ATOM   1933  C  CB    . THR C 3  76  ? 11.416  0.112   48.202 1.00 66.81  ? 76   THR C CB    1 
ATOM   1934  O  OG1   . THR C 3  76  ? 11.731  1.325   48.897 1.00 71.28  ? 76   THR C OG1   1 
ATOM   1935  C  CG2   . THR C 3  76  ? 11.662  0.267   46.645 1.00 60.25  ? 76   THR C CG2   1 
ATOM   1936  N  N     . ARG C 3  77  ? 9.460   -2.488  47.700 1.00 72.50  ? 77   ARG C N     1 
ATOM   1937  C  CA    . ARG C 3  77  ? 9.010   -3.463  46.726 1.00 63.90  ? 77   ARG C CA    1 
ATOM   1938  C  C     . ARG C 3  77  ? 7.773   -4.178  47.250 1.00 59.69  ? 77   ARG C C     1 
ATOM   1939  O  O     . ARG C 3  77  ? 7.824   -4.851  48.286 1.00 63.60  ? 77   ARG C O     1 
ATOM   1940  C  CB    . ARG C 3  77  ? 10.118  -4.457  46.453 1.00 63.90  ? 77   ARG C CB    1 
ATOM   1941  C  CG    . ARG C 3  77  ? 9.849   -5.316  45.232 1.00 70.51  ? 77   ARG C CG    1 
ATOM   1942  C  CD    . ARG C 3  77  ? 10.884  -6.416  45.082 1.00 74.62  ? 77   ARG C CD    1 
ATOM   1943  N  NE    . ARG C 3  77  ? 12.211  -5.887  44.776 1.00 82.01  ? 77   ARG C NE    1 
ATOM   1944  C  CZ    . ARG C 3  77  ? 13.294  -6.069  45.527 1.00 88.37  ? 77   ARG C CZ    1 
ATOM   1945  N  NH1   . ARG C 3  77  ? 13.231  -6.781  46.655 1.00 85.82  ? 77   ARG C NH1   1 
ATOM   1946  N  NH2   . ARG C 3  77  ? 14.446  -5.534  45.137 1.00 92.77  ? 77   ARG C NH2   1 
ATOM   1947  N  N     . ILE C 3  78  ? 6.662   -3.999  46.550 1.00 54.06  ? 78   ILE C N     1 
ATOM   1948  C  CA    . ILE C 3  78  ? 5.421   -4.724  46.844 1.00 54.18  ? 78   ILE C CA    1 
ATOM   1949  C  C     . ILE C 3  78  ? 5.665   -6.224  46.661 1.00 59.50  ? 78   ILE C C     1 
ATOM   1950  O  O     . ILE C 3  78  ? 6.124   -6.683  45.590 1.00 61.23  ? 78   ILE C O     1 
ATOM   1951  C  CB    . ILE C 3  78  ? 4.269   -4.310  45.896 1.00 50.59  ? 78   ILE C CB    1 
ATOM   1952  C  CG1   . ILE C 3  78  ? 3.766   -2.883  46.211 1.00 52.93  ? 78   ILE C CG1   1 
ATOM   1953  C  CG2   . ILE C 3  78  ? 3.141   -5.299  46.012 1.00 49.38  ? 78   ILE C CG2   1 
ATOM   1954  C  CD1   . ILE C 3  78  ? 2.813   -2.273  45.206 1.00 47.15  ? 78   ILE C CD1   1 
ATOM   1955  N  N     . ILE C 3  79  ? 5.381   -6.976  47.717 1.00 54.67  ? 79   ILE C N     1 
ATOM   1956  C  CA    . ILE C 3  79  ? 5.397   -8.435  47.668 1.00 51.29  ? 79   ILE C CA    1 
ATOM   1957  C  C     . ILE C 3  79  ? 3.967   -8.992  47.900 1.00 55.54  ? 79   ILE C C     1 
ATOM   1958  O  O     . ILE C 3  79  ? 3.045   -8.225  48.253 1.00 57.85  ? 79   ILE C O     1 
ATOM   1959  C  CB    . ILE C 3  79  ? 6.420   -9.008  48.680 1.00 52.06  ? 79   ILE C CB    1 
ATOM   1960  C  CG1   . ILE C 3  79  ? 5.983   -8.778  50.140 1.00 47.14  ? 79   ILE C CG1   1 
ATOM   1961  C  CG2   . ILE C 3  79  ? 7.793   -8.398  48.439 1.00 55.62  ? 79   ILE C CG2   1 
ATOM   1962  C  CD1   . ILE C 3  79  ? 6.953   -9.339  51.151 1.00 39.95  ? 79   ILE C CD1   1 
ATOM   1963  N  N     . PRO C 3  80  ? 3.761   -10.318 47.709 1.00 53.75  ? 80   PRO C N     1 
ATOM   1964  C  CA    . PRO C 3  80  ? 2.428   -10.889 47.924 1.00 47.72  ? 80   PRO C CA    1 
ATOM   1965  C  C     . PRO C 3  80  ? 1.812   -10.538 49.263 1.00 46.52  ? 80   PRO C C     1 
ATOM   1966  O  O     . PRO C 3  80  ? 0.639   -10.217 49.282 1.00 50.64  ? 80   PRO C O     1 
ATOM   1967  C  CB    . PRO C 3  80  ? 2.666   -12.380 47.785 1.00 45.94  ? 80   PRO C CB    1 
ATOM   1968  C  CG    . PRO C 3  80  ? 3.746   -12.429 46.765 1.00 50.09  ? 80   PRO C CG    1 
ATOM   1969  C  CD    . PRO C 3  80  ? 4.682   -11.324 47.154 1.00 52.95  ? 80   PRO C CD    1 
ATOM   1970  N  N     . ARG C 3  81  ? 2.559   -10.538 50.362 1.00 44.02  ? 81   ARG C N     1 
ATOM   1971  C  CA    . ARG C 3  81  ? 1.914   -10.154 51.623 1.00 45.86  ? 81   ARG C CA    1 
ATOM   1972  C  C     . ARG C 3  81  ? 1.205   -8.809  51.522 1.00 49.95  ? 81   ARG C C     1 
ATOM   1973  O  O     . ARG C 3  81  ? 0.096   -8.654  52.047 1.00 50.70  ? 81   ARG C O     1 
ATOM   1974  C  CB    . ARG C 3  81  ? 2.850   -10.200 52.842 1.00 45.19  ? 81   ARG C CB    1 
ATOM   1975  C  CG    . ARG C 3  81  ? 2.383   -9.295  53.957 1.00 48.79  ? 81   ARG C CG    1 
ATOM   1976  C  CD    . ARG C 3  81  ? 2.210   -9.925  55.336 1.00 53.37  ? 81   ARG C CD    1 
ATOM   1977  N  NE    . ARG C 3  81  ? 1.052   -10.813 55.377 1.00 56.29  ? 81   ARG C NE    1 
ATOM   1978  C  CZ    . ARG C 3  81  ? 0.274   -11.064 56.442 1.00 55.45  ? 81   ARG C CZ    1 
ATOM   1979  N  NH1   . ARG C 3  81  ? 0.460   -10.488 57.628 1.00 48.89  ? 81   ARG C NH1   1 
ATOM   1980  N  NH2   . ARG C 3  81  ? -0.723  -11.927 56.305 1.00 54.80  ? 81   ARG C NH2   1 
ATOM   1981  N  N     . HIS C 3  82  ? 1.824   -7.835  50.836 1.00 54.21  ? 82   HIS C N     1 
ATOM   1982  C  CA    . HIS C 3  82  ? 1.217   -6.478  50.707 1.00 48.79  ? 82   HIS C CA    1 
ATOM   1983  C  C     . HIS C 3  82  ? -0.063  -6.510  49.924 1.00 52.95  ? 82   HIS C C     1 
ATOM   1984  O  O     . HIS C 3  82  ? -1.036  -5.827  50.308 1.00 53.27  ? 82   HIS C O     1 
ATOM   1985  C  CB    . HIS C 3  82  ? 2.147   -5.465  50.078 1.00 42.00  ? 82   HIS C CB    1 
ATOM   1986  C  CG    . HIS C 3  82  ? 3.492   -5.380  50.734 1.00 42.37  ? 82   HIS C CG    1 
ATOM   1987  N  ND1   . HIS C 3  82  ? 4.647   -5.375  50.012 1.00 42.27  ? 82   HIS C ND1   1 
ATOM   1988  C  CD2   . HIS C 3  82  ? 3.860   -5.320  52.083 1.00 40.60  ? 82   HIS C CD2   1 
ATOM   1989  C  CE1   . HIS C 3  82  ? 5.700   -5.322  50.864 1.00 42.43  ? 82   HIS C CE1   1 
ATOM   1990  N  NE2   . HIS C 3  82  ? 5.216   -5.289  52.132 1.00 42.72  ? 82   HIS C NE2   1 
ATOM   1991  N  N     . LEU C 3  83  ? -0.081  -7.289  48.830 1.00 50.11  ? 83   LEU C N     1 
ATOM   1992  C  CA    . LEU C 3  83  ? -1.318  -7.510  48.063 1.00 51.00  ? 83   LEU C CA    1 
ATOM   1993  C  C     . LEU C 3  83  ? -2.425  -8.093  48.954 1.00 50.99  ? 83   LEU C C     1 
ATOM   1994  O  O     . LEU C 3  83  ? -3.615  -7.754  48.842 1.00 46.94  ? 83   LEU C O     1 
ATOM   1995  C  CB    . LEU C 3  83  ? -1.064  -8.423  46.864 1.00 50.28  ? 83   LEU C CB    1 
ATOM   1996  C  CG    . LEU C 3  83  ? -0.149  -7.859  45.763 1.00 55.29  ? 83   LEU C CG    1 
ATOM   1997  C  CD1   . LEU C 3  83  ? 0.225   -8.968  44.790 1.00 50.72  ? 83   LEU C CD1   1 
ATOM   1998  C  CD2   . LEU C 3  83  ? -0.769  -6.685  45.009 1.00 52.83  ? 83   LEU C CD2   1 
ATOM   1999  N  N     . GLN C 3  84  ? -2.022  -8.947  49.878 1.00 48.33  ? 84   GLN C N     1 
ATOM   2000  C  CA    . GLN C 3  84  ? -3.001  -9.581  50.680 1.00 47.87  ? 84   GLN C CA    1 
ATOM   2001  C  C     . GLN C 3  84  ? -3.534  -8.596  51.740 1.00 47.94  ? 84   GLN C C     1 
ATOM   2002  O  O     . GLN C 3  84  ? -4.742  -8.483  51.944 1.00 48.35  ? 84   GLN C O     1 
ATOM   2003  C  CB    . GLN C 3  84  ? -2.425  -10.844 51.271 1.00 48.34  ? 84   GLN C CB    1 
ATOM   2004  C  CG    . GLN C 3  84  ? -3.244  -11.374 52.437 1.00 53.51  ? 84   GLN C CG    1 
ATOM   2005  C  CD    . GLN C 3  84  ? -4.411  -12.253 52.039 1.00 49.61  ? 84   GLN C CD    1 
ATOM   2006  O  OE1   . GLN C 3  84  ? -5.050  -12.100 50.968 1.00 48.90  ? 84   GLN C OE1   1 
ATOM   2007  N  NE2   . GLN C 3  84  ? -4.699  -13.196 52.916 1.00 46.53  ? 84   GLN C NE2   1 
ATOM   2008  N  N     . LEU C 3  85  ? -2.640  -7.853  52.372 1.00 45.69  ? 85   LEU C N     1 
ATOM   2009  C  CA    . LEU C 3  85  ? -3.047  -6.808  53.282 1.00 46.14  ? 85   LEU C CA    1 
ATOM   2010  C  C     . LEU C 3  85  ? -3.992  -5.795  52.612 1.00 50.28  ? 85   LEU C C     1 
ATOM   2011  O  O     . LEU C 3  85  ? -4.996  -5.401  53.214 1.00 46.57  ? 85   LEU C O     1 
ATOM   2012  C  CB    . LEU C 3  85  ? -1.802  -6.110  53.790 1.00 51.57  ? 85   LEU C CB    1 
ATOM   2013  C  CG    . LEU C 3  85  ? -0.997  -6.899  54.820 1.00 54.14  ? 85   LEU C CG    1 
ATOM   2014  C  CD1   . LEU C 3  85  ? 0.217   -6.093  55.208 1.00 56.42  ? 85   LEU C CD1   1 
ATOM   2015  C  CD2   . LEU C 3  85  ? -1.833  -7.211  56.052 1.00 53.49  ? 85   LEU C CD2   1 
ATOM   2016  N  N     . ALA C 3  86  ? -3.662  -5.387  51.371 1.00 49.76  ? 86   ALA C N     1 
ATOM   2017  C  CA    . ALA C 3  86  ? -4.501  -4.507  50.554 1.00 47.83  ? 86   ALA C CA    1 
ATOM   2018  C  C     . ALA C 3  86  ? -5.925  -5.042  50.350 1.00 53.34  ? 86   ALA C C     1 
ATOM   2019  O  O     . ALA C 3  86  ? -6.904  -4.391  50.714 1.00 55.34  ? 86   ALA C O     1 
ATOM   2020  C  CB    . ALA C 3  86  ? -3.840  -4.256  49.214 1.00 50.43  ? 86   ALA C CB    1 
ATOM   2021  N  N     . VAL C 3  87  ? -6.025  -6.239  49.773 1.00 57.62  ? 87   VAL C N     1 
ATOM   2022  C  CA    . VAL C 3  87  ? -7.306  -6.896  49.478 1.00 52.47  ? 87   VAL C CA    1 
ATOM   2023  C  C     . VAL C 3  87  ? -8.125  -7.193  50.738 1.00 51.21  ? 87   VAL C C     1 
ATOM   2024  O  O     . VAL C 3  87  ? -9.300  -6.879  50.800 1.00 54.43  ? 87   VAL C O     1 
ATOM   2025  C  CB    . VAL C 3  87  ? -7.050  -8.205  48.696 1.00 52.74  ? 87   VAL C CB    1 
ATOM   2026  C  CG1   . VAL C 3  87  ? -8.325  -8.989  48.516 1.00 54.33  ? 87   VAL C CG1   1 
ATOM   2027  C  CG2   . VAL C 3  87  ? -6.454  -7.900  47.324 1.00 55.49  ? 87   VAL C CG2   1 
ATOM   2028  N  N     . ARG C 3  88  ? -7.501  -7.793  51.742 1.00 45.20  ? 88   ARG C N     1 
ATOM   2029  C  CA    . ARG C 3  88  ? -8.238  -8.231  52.883 1.00 45.39  ? 88   ARG C CA    1 
ATOM   2030  C  C     . ARG C 3  88  ? -8.683  -7.088  53.767 1.00 46.93  ? 88   ARG C C     1 
ATOM   2031  O  O     . ARG C 3  88  ? -9.674  -7.214  54.494 1.00 49.49  ? 88   ARG C O     1 
ATOM   2032  C  CB    . ARG C 3  88  ? -7.466  -9.303  53.669 1.00 46.00  ? 88   ARG C CB    1 
ATOM   2033  C  CG    . ARG C 3  88  ? -7.224  -10.617 52.907 1.00 41.47  ? 88   ARG C CG    1 
ATOM   2034  C  CD    . ARG C 3  88  ? -8.446  -11.098 52.137 1.00 37.88  ? 88   ARG C CD    1 
ATOM   2035  N  NE    . ARG C 3  88  ? -8.113  -11.892 50.944 1.00 38.72  ? 88   ARG C NE    1 
ATOM   2036  C  CZ    . ARG C 3  88  ? -9.010  -12.259 50.021 1.00 38.38  ? 88   ARG C CZ    1 
ATOM   2037  N  NH1   . ARG C 3  88  ? -10.289 -11.899 50.142 1.00 37.52  ? 88   ARG C NH1   1 
ATOM   2038  N  NH2   . ARG C 3  88  ? -8.646  -12.993 48.972 1.00 35.05  ? 88   ARG C NH2   1 
ATOM   2039  N  N     . ASN C 3  89  ? -7.975  -5.967  53.684 1.00 51.37  ? 89   ASN C N     1 
ATOM   2040  C  CA    . ASN C 3  89  ? -8.315  -4.775  54.490 1.00 52.66  ? 89   ASN C CA    1 
ATOM   2041  C  C     . ASN C 3  89  ? -9.413  -3.892  53.881 1.00 54.17  ? 89   ASN C C     1 
ATOM   2042  O  O     . ASN C 3  89  ? -10.035 -3.098  54.589 1.00 51.73  ? 89   ASN C O     1 
ATOM   2043  C  CB    . ASN C 3  89  ? -7.075  -3.978  54.868 1.00 50.64  ? 89   ASN C CB    1 
ATOM   2044  C  CG    . ASN C 3  89  ? -6.345  -4.591  56.051 1.00 51.68  ? 89   ASN C CG    1 
ATOM   2045  O  OD1   . ASN C 3  89  ? -6.946  -4.838  57.082 1.00 48.26  ? 89   ASN C OD1   1 
ATOM   2046  N  ND2   . ASN C 3  89  ? -5.046  -4.868  55.892 1.00 58.62  ? 89   ASN C ND2   1 
ATOM   2047  N  N     . ASP C 3  90  ? -9.685  -4.105  52.592 1.00 50.81  ? 90   ASP C N     1 
ATOM   2048  C  CA    . ASP C 3  90  ? -10.675 -3.363  51.860 1.00 48.69  ? 90   ASP C CA    1 
ATOM   2049  C  C     . ASP C 3  90  ? -11.933 -4.177  51.631 1.00 56.52  ? 90   ASP C C     1 
ATOM   2050  O  O     . ASP C 3  90  ? -11.933 -5.118  50.844 1.00 65.64  ? 90   ASP C O     1 
ATOM   2051  C  CB    . ASP C 3  90  ? -10.111 -2.998  50.510 1.00 52.69  ? 90   ASP C CB    1 
ATOM   2052  C  CG    . ASP C 3  90  ? -11.046 -2.138  49.720 1.00 59.43  ? 90   ASP C CG    1 
ATOM   2053  O  OD1   . ASP C 3  90  ? -11.096 -0.921  49.980 1.00 63.37  ? 90   ASP C OD1   1 
ATOM   2054  O  OD2   . ASP C 3  90  ? -11.728 -2.679  48.830 1.00 64.93  ? 90   ASP C OD2   1 
ATOM   2055  N  N     . GLU C 3  91  ? -13.020 -3.794  52.283 1.00 58.72  ? 91   GLU C N     1 
ATOM   2056  C  CA    . GLU C 3  91  ? -14.305 -4.477  52.174 1.00 54.67  ? 91   GLU C CA    1 
ATOM   2057  C  C     . GLU C 3  91  ? -14.676 -4.940  50.766 1.00 56.07  ? 91   GLU C C     1 
ATOM   2058  O  O     . GLU C 3  91  ? -15.107 -6.089  50.566 1.00 55.11  ? 91   GLU C O     1 
ATOM   2059  C  CB    . GLU C 3  91  ? -15.388 -3.548  52.677 1.00 61.04  ? 91   GLU C CB    1 
ATOM   2060  C  CG    . GLU C 3  91  ? -16.344 -4.164  53.666 1.00 67.55  ? 91   GLU C CG    1 
ATOM   2061  C  CD    . GLU C 3  91  ? -17.631 -3.379  53.722 1.00 81.25  ? 91   GLU C CD    1 
ATOM   2062  O  OE1   . GLU C 3  91  ? -18.319 -3.273  52.672 1.00 84.44  ? 91   GLU C OE1   1 
ATOM   2063  O  OE2   . GLU C 3  91  ? -17.943 -2.860  54.818 1.00 84.74  ? 91   GLU C OE2   1 
ATOM   2064  N  N     . GLU C 3  92  ? -14.514 -4.052  49.787 1.00 58.75  ? 92   GLU C N     1 
ATOM   2065  C  CA    . GLU C 3  92  ? -14.970 -4.343  48.429 1.00 53.67  ? 92   GLU C CA    1 
ATOM   2066  C  C     . GLU C 3  92  ? -14.070 -5.270  47.639 1.00 53.90  ? 92   GLU C C     1 
ATOM   2067  O  O     . GLU C 3  92  ? -14.562 -6.173  46.964 1.00 54.55  ? 92   GLU C O     1 
ATOM   2068  C  CB    . GLU C 3  92  ? -15.288 -3.076  47.677 1.00 53.43  ? 92   GLU C CB    1 
ATOM   2069  C  CG    . GLU C 3  92  ? -16.606 -2.507  48.163 1.00 59.44  ? 92   GLU C CG    1 
ATOM   2070  C  CD    . GLU C 3  92  ? -17.214 -1.500  47.213 1.00 66.87  ? 92   GLU C CD    1 
ATOM   2071  O  OE1   . GLU C 3  92  ? -16.506 -1.051  46.276 1.00 64.98  ? 92   GLU C OE1   1 
ATOM   2072  O  OE2   . GLU C 3  92  ? -18.408 -1.164  47.416 1.00 71.38  ? 92   GLU C OE2   1 
ATOM   2073  N  N     . LEU C 3  93  ? -12.762 -5.049  47.729 1.00 52.66  ? 93   LEU C N     1 
ATOM   2074  C  CA    . LEU C 3  93  ? -11.795 -5.964  47.154 1.00 52.95  ? 93   LEU C CA    1 
ATOM   2075  C  C     . LEU C 3  93  ? -11.801 -7.332  47.871 1.00 54.94  ? 93   LEU C C     1 
ATOM   2076  O  O     . LEU C 3  93  ? -11.701 -8.375  47.231 1.00 54.08  ? 93   LEU C O     1 
ATOM   2077  C  CB    . LEU C 3  93  ? -10.411 -5.329  47.182 1.00 53.46  ? 93   LEU C CB    1 
ATOM   2078  C  CG    . LEU C 3  93  ? -10.054 -4.266  46.142 1.00 49.04  ? 93   LEU C CG    1 
ATOM   2079  C  CD1   . LEU C 3  93  ? -8.654  -3.795  46.452 1.00 49.82  ? 93   LEU C CD1   1 
ATOM   2080  C  CD2   . LEU C 3  93  ? -10.077 -4.801  44.723 1.00 46.20  ? 93   LEU C CD2   1 
ATOM   2081  N  N     . ASN C 3  94  ? -11.952 -7.328  49.199 1.00 55.80  ? 94   ASN C N     1 
ATOM   2082  C  CA    . ASN C 3  94  ? -12.186 -8.574  49.917 1.00 53.71  ? 94   ASN C CA    1 
ATOM   2083  C  C     . ASN C 3  94  ? -13.387 -9.397  49.412 1.00 52.54  ? 94   ASN C C     1 
ATOM   2084  O  O     . ASN C 3  94  ? -13.323 -10.609 49.386 1.00 58.35  ? 94   ASN C O     1 
ATOM   2085  C  CB    . ASN C 3  94  ? -12.328 -8.364  51.420 1.00 51.29  ? 94   ASN C CB    1 
ATOM   2086  C  CG    . ASN C 3  94  ? -12.444 -9.689  52.169 1.00 46.56  ? 94   ASN C CG    1 
ATOM   2087  O  OD1   . ASN C 3  94  ? -11.595 -10.525 52.028 1.00 49.47  ? 94   ASN C OD1   1 
ATOM   2088  N  ND2   . ASN C 3  94  ? -13.497 -9.885  52.924 1.00 47.29  ? 94   ASN C ND2   1 
ATOM   2089  N  N     . LYS C 3  95  ? -14.485 -8.760  49.051 1.00 51.04  ? 95   LYS C N     1 
ATOM   2090  C  CA    . LYS C 3  95  ? -15.616 -9.516  48.546 1.00 53.35  ? 95   LYS C CA    1 
ATOM   2091  C  C     . LYS C 3  95  ? -15.364 -9.965  47.095 1.00 53.10  ? 95   LYS C C     1 
ATOM   2092  O  O     . LYS C 3  95  ? -15.694 -11.071 46.716 1.00 57.65  ? 95   LYS C O     1 
ATOM   2093  C  CB    . LYS C 3  95  ? -16.898 -8.703  48.695 1.00 53.77  ? 95   LYS C CB    1 
ATOM   2094  C  CG    . LYS C 3  95  ? -18.155 -9.317  48.115 1.00 57.57  ? 95   LYS C CG    1 
ATOM   2095  C  CD    . LYS C 3  95  ? -19.237 -8.243  48.145 1.00 73.41  ? 95   LYS C CD    1 
ATOM   2096  C  CE    . LYS C 3  95  ? -20.639 -8.784  47.909 1.00 82.19  ? 95   LYS C CE    1 
ATOM   2097  N  NZ    . LYS C 3  95  ? -21.625 -7.960  48.689 1.00 90.93  ? 95   LYS C NZ    1 
ATOM   2098  N  N     . LEU C 3  96  ? -14.765 -9.111  46.284 1.00 53.39  ? 96   LEU C N     1 
ATOM   2099  C  CA    . LEU C 3  96  ? -14.541 -9.444  44.886 1.00 51.16  ? 96   LEU C CA    1 
ATOM   2100  C  C     . LEU C 3  96  ? -13.640 -10.654 44.764 1.00 53.31  ? 96   LEU C C     1 
ATOM   2101  O  O     . LEU C 3  96  ? -13.732 -11.401 43.802 1.00 58.15  ? 96   LEU C O     1 
ATOM   2102  C  CB    . LEU C 3  96  ? -13.898 -8.265  44.155 1.00 48.08  ? 96   LEU C CB    1 
ATOM   2103  C  CG    . LEU C 3  96  ? -13.505 -8.550  42.715 1.00 48.35  ? 96   LEU C CG    1 
ATOM   2104  C  CD1   . LEU C 3  96  ? -14.756 -8.763  41.888 1.00 48.20  ? 96   LEU C CD1   1 
ATOM   2105  C  CD2   . LEU C 3  96  ? -12.655 -7.436  42.135 1.00 47.68  ? 96   LEU C CD2   1 
ATOM   2106  N  N     . LEU C 3  97  ? -12.766 -10.827 45.746 1.00 51.76  ? 97   LEU C N     1 
ATOM   2107  C  CA    . LEU C 3  97  ? -11.780 -11.881 45.747 1.00 51.21  ? 97   LEU C CA    1 
ATOM   2108  C  C     . LEU C 3  97  ? -12.002 -12.828 46.951 1.00 55.43  ? 97   LEU C C     1 
ATOM   2109  O  O     . LEU C 3  97  ? -11.049 -13.387 47.539 1.00 49.09  ? 97   LEU C O     1 
ATOM   2110  C  CB    . LEU C 3  97  ? -10.405 -11.250 45.843 1.00 49.22  ? 97   LEU C CB    1 
ATOM   2111  C  CG    . LEU C 3  97  ? -9.894  -10.329 44.746 1.00 52.56  ? 97   LEU C CG    1 
ATOM   2112  C  CD1   . LEU C 3  97  ? -8.451  -9.957  45.055 1.00 50.45  ? 97   LEU C CD1   1 
ATOM   2113  C  CD2   . LEU C 3  97  ? -9.963  -11.054 43.413 1.00 58.04  ? 97   LEU C CD2   1 
ATOM   2114  N  N     . GLY C 3  98  ? -13.266 -13.006 47.314 1.00 54.07  ? 98   GLY C N     1 
ATOM   2115  C  CA    . GLY C 3  98  ? -13.590 -13.709 48.527 1.00 52.49  ? 98   GLY C CA    1 
ATOM   2116  C  C     . GLY C 3  98  ? -13.412 -15.193 48.384 1.00 51.19  ? 98   GLY C C     1 
ATOM   2117  O  O     . GLY C 3  98  ? -13.412 -15.916 49.368 1.00 54.86  ? 98   GLY C O     1 
ATOM   2118  N  N     . ARG C 3  99  ? -13.281 -15.651 47.152 1.00 50.56  ? 99   ARG C N     1 
ATOM   2119  C  CA    . ARG C 3  99  ? -13.125 -17.061 46.903 1.00 47.83  ? 99   ARG C CA    1 
ATOM   2120  C  C     . ARG C 3  99  ? -11.844 -17.261 46.123 1.00 45.54  ? 99   ARG C C     1 
ATOM   2121  O  O     . ARG C 3  99  ? -11.792 -18.099 45.230 1.00 53.20  ? 99   ARG C O     1 
ATOM   2122  C  CB    . ARG C 3  99  ? -14.341 -17.594 46.156 1.00 46.15  ? 99   ARG C CB    1 
ATOM   2123  C  CG    . ARG C 3  99  ? -15.525 -17.858 47.046 1.00 54.83  ? 99   ARG C CG    1 
ATOM   2124  C  CD    . ARG C 3  99  ? -16.594 -18.632 46.271 1.00 78.16  ? 99   ARG C CD    1 
ATOM   2125  N  NE    . ARG C 3  99  ? -17.710 -19.119 47.110 1.00 93.72  ? 99   ARG C NE    1 
ATOM   2126  C  CZ    . ARG C 3  99  ? -18.961 -19.347 46.679 1.00 99.98  ? 99   ARG C CZ    1 
ATOM   2127  N  NH1   . ARG C 3  99  ? -19.306 -19.118 45.407 1.00 99.25  ? 99   ARG C NH1   1 
ATOM   2128  N  NH2   . ARG C 3  99  ? -19.887 -19.790 47.532 1.00 98.73  ? 99   ARG C NH2   1 
ATOM   2129  N  N     . VAL C 3  100 ? -10.821 -16.466 46.445 1.00 42.11  ? 100  VAL C N     1 
ATOM   2130  C  CA    . VAL C 3  100 ? -9.520  -16.500 45.766 1.00 41.05  ? 100  VAL C CA    1 
ATOM   2131  C  C     . VAL C 3  100 ? -8.414  -16.503 46.809 1.00 43.63  ? 100  VAL C C     1 
ATOM   2132  O  O     . VAL C 3  100 ? -8.566  -15.966 47.912 1.00 46.79  ? 100  VAL C O     1 
ATOM   2133  C  CB    . VAL C 3  100 ? -9.340  -15.260 44.888 1.00 44.22  ? 100  VAL C CB    1 
ATOM   2134  C  CG1   . VAL C 3  100 ? -7.912  -15.100 44.398 1.00 45.60  ? 100  VAL C CG1   1 
ATOM   2135  C  CG2   . VAL C 3  100 ? -10.293 -15.310 43.711 1.00 46.51  ? 100  VAL C CG2   1 
ATOM   2136  N  N     . THR C 3  101 ? -7.300  -17.127 46.474 1.00 44.54  ? 101  THR C N     1 
ATOM   2137  C  CA    . THR C 3  101 ? -6.201  -17.275 47.412 1.00 47.27  ? 101  THR C CA    1 
ATOM   2138  C  C     . THR C 3  101 ? -4.951  -16.736 46.771 1.00 51.81  ? 101  THR C C     1 
ATOM   2139  O  O     . THR C 3  101 ? -4.627  -17.080 45.596 1.00 54.68  ? 101  THR C O     1 
ATOM   2140  C  CB    . THR C 3  101 ? -5.987  -18.762 47.802 1.00 49.86  ? 101  THR C CB    1 
ATOM   2141  O  OG1   . THR C 3  101 ? -7.143  -19.253 48.508 1.00 49.68  ? 101  THR C OG1   1 
ATOM   2142  C  CG2   . THR C 3  101 ? -4.724  -18.947 48.642 1.00 40.17  ? 101  THR C CG2   1 
ATOM   2143  N  N     . ILE C 3  102 ? -4.265  -15.890 47.544 1.00 46.95  ? 102  ILE C N     1 
ATOM   2144  C  CA    . ILE C 3  102 ? -3.054  -15.223 47.097 1.00 44.23  ? 102  ILE C CA    1 
ATOM   2145  C  C     . ILE C 3  102 ? -1.919  -16.025 47.683 1.00 46.23  ? 102  ILE C C     1 
ATOM   2146  O  O     . ILE C 3  102 ? -1.672  -16.060 48.914 1.00 45.99  ? 102  ILE C O     1 
ATOM   2147  C  CB    . ILE C 3  102 ? -3.011  -13.719 47.521 1.00 45.60  ? 102  ILE C CB    1 
ATOM   2148  C  CG1   . ILE C 3  102 ? -4.034  -12.890 46.711 1.00 43.24  ? 102  ILE C CG1   1 
ATOM   2149  C  CG2   . ILE C 3  102 ? -1.616  -13.128 47.351 1.00 40.09  ? 102  ILE C CG2   1 
ATOM   2150  C  CD1   . ILE C 3  102 ? -4.410  -11.586 47.355 1.00 41.72  ? 102  ILE C CD1   1 
ATOM   2151  N  N     . ALA C 3  103 ? -1.238  -16.728 46.797 1.00 47.78  ? 103  ALA C N     1 
ATOM   2152  C  CA    . ALA C 3  103 ? -0.093  -17.484 47.228 1.00 46.72  ? 103  ALA C CA    1 
ATOM   2153  C  C     . ALA C 3  103 ? 0.776   -16.542 48.040 1.00 46.14  ? 103  ALA C C     1 
ATOM   2154  O  O     . ALA C 3  103 ? 0.936   -15.389 47.677 1.00 52.27  ? 103  ALA C O     1 
ATOM   2155  C  CB    . ALA C 3  103 ? 0.646   -18.010 46.022 1.00 47.25  ? 103  ALA C CB    1 
ATOM   2156  N  N     . GLN C 3  104 ? 1.317   -17.016 49.149 1.00 49.63  ? 104  GLN C N     1 
ATOM   2157  C  CA    . GLN C 3  104 ? 2.296   -16.251 49.966 1.00 49.78  ? 104  GLN C CA    1 
ATOM   2158  C  C     . GLN C 3  104 ? 1.762   -14.953 50.626 1.00 48.61  ? 104  GLN C C     1 
ATOM   2159  O  O     . GLN C 3  104 ? 2.528   -14.057 50.998 1.00 50.76  ? 104  GLN C O     1 
ATOM   2160  C  CB    . GLN C 3  104 ? 3.623   -16.058 49.215 1.00 48.38  ? 104  GLN C CB    1 
ATOM   2161  C  CG    . GLN C 3  104 ? 4.495   -17.296 49.236 1.00 54.89  ? 104  GLN C CG    1 
ATOM   2162  C  CD    . GLN C 3  104 ? 4.822   -17.722 50.673 1.00 63.17  ? 104  GLN C CD    1 
ATOM   2163  O  OE1   . GLN C 3  104 ? 5.430   -16.957 51.433 1.00 65.58  ? 104  GLN C OE1   1 
ATOM   2164  N  NE2   . GLN C 3  104 ? 4.382   -18.932 51.066 1.00 60.33  ? 104  GLN C NE2   1 
ATOM   2165  N  N     . GLY C 3  105 ? 0.448   -14.902 50.806 1.00 46.09  ? 105  GLY C N     1 
ATOM   2166  C  CA    . GLY C 3  105 ? -0.216  -13.744 51.358 1.00 46.68  ? 105  GLY C CA    1 
ATOM   2167  C  C     . GLY C 3  105 ? -0.421  -13.733 52.863 1.00 50.16  ? 105  GLY C C     1 
ATOM   2168  O  O     . GLY C 3  105 ? -0.595  -12.657 53.471 1.00 49.51  ? 105  GLY C O     1 
ATOM   2169  N  N     . GLY C 3  106 ? -0.382  -14.917 53.478 1.00 48.10  ? 106  GLY C N     1 
ATOM   2170  C  CA    . GLY C 3  106 ? -0.623  -15.026 54.913 1.00 43.94  ? 106  GLY C CA    1 
ATOM   2171  C  C     . GLY C 3  106 ? -2.052  -14.661 55.218 1.00 47.34  ? 106  GLY C C     1 
ATOM   2172  O  O     . GLY C 3  106 ? -2.913  -14.642 54.316 1.00 48.29  ? 106  GLY C O     1 
ATOM   2173  N  N     . VAL C 3  107 ? -2.307  -14.358 56.488 1.00 51.10  ? 107  VAL C N     1 
ATOM   2174  C  CA    . VAL C 3  107 ? -3.644  -13.925 56.955 1.00 45.99  ? 107  VAL C CA    1 
ATOM   2175  C  C     . VAL C 3  107 ? -3.565  -12.568 57.660 1.00 43.27  ? 107  VAL C C     1 
ATOM   2176  O  O     . VAL C 3  107 ? -2.480  -12.092 57.922 1.00 48.45  ? 107  VAL C O     1 
ATOM   2177  C  CB    . VAL C 3  107 ? -4.254  -14.984 57.897 1.00 46.21  ? 107  VAL C CB    1 
ATOM   2178  C  CG1   . VAL C 3  107 ? -4.410  -16.294 57.169 1.00 47.02  ? 107  VAL C CG1   1 
ATOM   2179  C  CG2   . VAL C 3  107 ? -3.404  -15.198 59.136 1.00 45.21  ? 107  VAL C CG2   1 
ATOM   2180  N  N     . LEU C 3  108 ? -4.694  -11.938 57.971 1.00 49.12  ? 108  LEU C N     1 
ATOM   2181  C  CA    . LEU C 3  108 ? -4.701  -10.699 58.814 1.00 51.46  ? 108  LEU C CA    1 
ATOM   2182  C  C     . LEU C 3  108 ? -4.471  -11.007 60.284 1.00 53.92  ? 108  LEU C C     1 
ATOM   2183  O  O     . LEU C 3  108 ? -5.062  -11.945 60.808 1.00 58.90  ? 108  LEU C O     1 
ATOM   2184  C  CB    . LEU C 3  108 ? -6.040  -9.963  58.709 1.00 47.54  ? 108  LEU C CB    1 
ATOM   2185  C  CG    . LEU C 3  108 ? -6.359  -9.313  57.362 1.00 48.39  ? 108  LEU C CG    1 
ATOM   2186  C  CD1   . LEU C 3  108 ? -7.614  -8.467  57.414 1.00 44.39  ? 108  LEU C CD1   1 
ATOM   2187  C  CD2   . LEU C 3  108 ? -5.165  -8.509  56.866 1.00 48.88  ? 108  LEU C CD2   1 
ATOM   2188  N  N     . PRO C 3  109 ? -3.618  -10.226 60.974 1.00 58.06  ? 109  PRO C N     1 
ATOM   2189  C  CA    . PRO C 3  109 ? -3.534  -10.490 62.420 1.00 56.27  ? 109  PRO C CA    1 
ATOM   2190  C  C     . PRO C 3  109 ? -4.918  -10.342 63.021 1.00 56.69  ? 109  PRO C C     1 
ATOM   2191  O  O     . PRO C 3  109 ? -5.587  -9.353  62.778 1.00 60.75  ? 109  PRO C O     1 
ATOM   2192  C  CB    . PRO C 3  109 ? -2.588  -9.410  62.915 1.00 51.54  ? 109  PRO C CB    1 
ATOM   2193  C  CG    . PRO C 3  109 ? -1.675  -9.203  61.753 1.00 54.82  ? 109  PRO C CG    1 
ATOM   2194  C  CD    . PRO C 3  109 ? -2.580  -9.278  60.541 1.00 56.63  ? 109  PRO C CD    1 
ATOM   2195  N  N     . ASN C 3  110 ? -5.378  -11.367 63.717 1.00 58.25  ? 110  ASN C N     1 
ATOM   2196  C  CA    . ASN C 3  110 ? -6.676  -11.320 64.353 1.00 61.15  ? 110  ASN C CA    1 
ATOM   2197  C  C     . ASN C 3  110 ? -6.849  -12.480 65.325 1.00 67.22  ? 110  ASN C C     1 
ATOM   2198  O  O     . ASN C 3  110 ? -6.975  -13.643 64.915 1.00 66.78  ? 110  ASN C O     1 
ATOM   2199  C  CB    . ASN C 3  110 ? -7.807  -11.314 63.320 1.00 66.92  ? 110  ASN C CB    1 
ATOM   2200  C  CG    . ASN C 3  110 ? -9.174  -11.125 63.963 1.00 71.80  ? 110  ASN C CG    1 
ATOM   2201  O  OD1   . ASN C 3  110 ? -9.267  -10.866 65.161 1.00 74.73  ? 110  ASN C OD1   1 
ATOM   2202  N  ND2   . ASN C 3  110 ? -10.242 -11.260 63.176 1.00 68.65  ? 110  ASN C ND2   1 
ATOM   2203  N  N     . ILE C 3  111 ? -6.853  -12.118 66.611 1.00 66.62  ? 111  ILE C N     1 
ATOM   2204  C  CA    . ILE C 3  111 ? -7.071  -13.003 67.758 1.00 59.41  ? 111  ILE C CA    1 
ATOM   2205  C  C     . ILE C 3  111 ? -8.413  -12.661 68.383 1.00 61.05  ? 111  ILE C C     1 
ATOM   2206  O  O     . ILE C 3  111 ? -8.672  -11.513 68.687 1.00 69.30  ? 111  ILE C O     1 
ATOM   2207  C  CB    . ILE C 3  111 ? -6.013  -12.725 68.818 1.00 55.36  ? 111  ILE C CB    1 
ATOM   2208  C  CG1   . ILE C 3  111 ? -4.634  -12.888 68.197 1.00 57.78  ? 111  ILE C CG1   1 
ATOM   2209  C  CG2   . ILE C 3  111 ? -6.249  -13.577 70.053 1.00 56.22  ? 111  ILE C CG2   1 
ATOM   2210  C  CD1   . ILE C 3  111 ? -3.494  -12.660 69.161 1.00 59.29  ? 111  ILE C CD1   1 
ATOM   2211  N  N     . GLN C 3  112 ? -9.270  -13.650 68.562 1.00 64.03  ? 112  GLN C N     1 
ATOM   2212  C  CA    . GLN C 3  112 ? -10.587 -13.431 69.143 1.00 63.13  ? 112  GLN C CA    1 
ATOM   2213  C  C     . GLN C 3  112 ? -10.463 -13.021 70.587 1.00 61.24  ? 112  GLN C C     1 
ATOM   2214  O  O     . GLN C 3  112 ? -9.681  -13.622 71.308 1.00 64.73  ? 112  GLN C O     1 
ATOM   2215  C  CB    . GLN C 3  112 ? -11.370 -14.732 69.086 1.00 63.58  ? 112  GLN C CB    1 
ATOM   2216  C  CG    . GLN C 3  112 ? -11.569 -15.199 67.673 1.00 59.83  ? 112  GLN C CG    1 
ATOM   2217  C  CD    . GLN C 3  112 ? -12.697 -14.458 67.009 1.00 63.85  ? 112  GLN C CD    1 
ATOM   2218  O  OE1   . GLN C 3  112 ? -13.771 -14.260 67.612 1.00 59.02  ? 112  GLN C OE1   1 
ATOM   2219  N  NE2   . GLN C 3  112 ? -12.477 -14.041 65.757 1.00 64.73  ? 112  GLN C NE2   1 
ATOM   2220  N  N     . SER C 3  113 ? -11.257 -12.031 71.006 1.00 64.69  ? 113  SER C N     1 
ATOM   2221  C  CA    . SER C 3  113 ? -11.287 -11.519 72.405 1.00 63.58  ? 113  SER C CA    1 
ATOM   2222  C  C     . SER C 3  113 ? -11.072 -12.512 73.534 1.00 63.87  ? 113  SER C C     1 
ATOM   2223  O  O     . SER C 3  113 ? -10.101 -12.393 74.268 1.00 63.96  ? 113  SER C O     1 
ATOM   2224  C  CB    . SER C 3  113 ? -12.587 -10.781 72.690 1.00 59.69  ? 113  SER C CB    1 
ATOM   2225  O  OG    . SER C 3  113 ? -12.606 -9.609  71.922 1.00 71.10  ? 113  SER C OG    1 
ATOM   2226  N  N     . VAL C 3  114 ? -11.985 -13.477 73.676 1.00 66.99  ? 114  VAL C N     1 
ATOM   2227  C  CA    . VAL C 3  114 ? -11.977 -14.426 74.811 1.00 65.98  ? 114  VAL C CA    1 
ATOM   2228  C  C     . VAL C 3  114 ? -10.670 -15.175 74.993 1.00 66.11  ? 114  VAL C C     1 
ATOM   2229  O  O     . VAL C 3  114 ? -10.437 -15.782 76.039 1.00 69.32  ? 114  VAL C O     1 
ATOM   2230  C  CB    . VAL C 3  114 ? -13.102 -15.485 74.730 1.00 61.64  ? 114  VAL C CB    1 
ATOM   2231  C  CG1   . VAL C 3  114 ? -14.469 -14.824 74.657 1.00 62.89  ? 114  VAL C CG1   1 
ATOM   2232  C  CG2   . VAL C 3  114 ? -12.878 -16.423 73.555 1.00 63.60  ? 114  VAL C CG2   1 
ATOM   2233  N  N     . LEU C 3  115 ? -9.833  -15.146 73.966 1.00 66.97  ? 115  LEU C N     1 
ATOM   2234  C  CA    . LEU C 3  115 ? -8.564  -15.853 73.993 1.00 68.01  ? 115  LEU C CA    1 
ATOM   2235  C  C     . LEU C 3  115 ? -7.474  -15.110 74.758 1.00 69.93  ? 115  LEU C C     1 
ATOM   2236  O  O     . LEU C 3  115 ? -6.482  -15.723 75.149 1.00 65.91  ? 115  LEU C O     1 
ATOM   2237  C  CB    . LEU C 3  115 ? -8.082  -16.134 72.567 1.00 70.70  ? 115  LEU C CB    1 
ATOM   2238  C  CG    . LEU C 3  115 ? -8.896  -17.074 71.680 1.00 67.57  ? 115  LEU C CG    1 
ATOM   2239  C  CD1   . LEU C 3  115 ? -8.069  -17.446 70.468 1.00 58.56  ? 115  LEU C CD1   1 
ATOM   2240  C  CD2   . LEU C 3  115 ? -9.346  -18.313 72.439 1.00 64.66  ? 115  LEU C CD2   1 
ATOM   2241  N  N     . LEU C 3  116 ? -7.655  -13.800 74.953 1.00 74.86  ? 116  LEU C N     1 
ATOM   2242  C  CA    . LEU C 3  116 ? -6.646  -12.940 75.597 1.00 73.71  ? 116  LEU C CA    1 
ATOM   2243  C  C     . LEU C 3  116 ? -6.612  -13.152 77.112 1.00 75.82  ? 116  LEU C C     1 
ATOM   2244  O  O     . LEU C 3  116 ? -7.578  -13.643 77.678 1.00 78.31  ? 116  LEU C O     1 
ATOM   2245  C  CB    . LEU C 3  116 ? -6.869  -11.464 75.244 1.00 67.38  ? 116  LEU C CB    1 
ATOM   2246  C  CG    . LEU C 3  116 ? -6.783  -11.038 73.770 1.00 66.66  ? 116  LEU C CG    1 
ATOM   2247  C  CD1   . LEU C 3  116 ? -7.062  -9.547  73.641 1.00 64.30  ? 116  LEU C CD1   1 
ATOM   2248  C  CD2   . LEU C 3  116 ? -5.451  -11.385 73.134 1.00 61.88  ? 116  LEU C CD2   1 
ATOM   2249  N  N     . PRO C 3  117 ? -5.495  -12.792 77.776 1.00 82.01  ? 117  PRO C N     1 
ATOM   2250  C  CA    . PRO C 3  117 ? -5.338  -13.066 79.220 1.00 82.07  ? 117  PRO C CA    1 
ATOM   2251  C  C     . PRO C 3  117 ? -6.240  -12.248 80.166 1.00 92.49  ? 117  PRO C C     1 
ATOM   2252  O  O     . PRO C 3  117 ? -6.830  -11.243 79.751 1.00 89.85  ? 117  PRO C O     1 
ATOM   2253  C  CB    . PRO C 3  117 ? -3.863  -12.733 79.488 1.00 78.96  ? 117  PRO C CB    1 
ATOM   2254  C  CG    . PRO C 3  117 ? -3.204  -12.661 78.143 1.00 84.45  ? 117  PRO C CG    1 
ATOM   2255  C  CD    . PRO C 3  117 ? -4.273  -12.201 77.197 1.00 82.88  ? 117  PRO C CD    1 
ATOM   2256  N  N     . LYS C 3  118 ? -6.302  -12.698 81.433 1.00 108.58 ? 118  LYS C N     1 
ATOM   2257  C  CA    . LYS C 3  118 ? -7.086  -12.116 82.570 1.00 110.23 ? 118  LYS C CA    1 
ATOM   2258  C  C     . LYS C 3  118 ? -8.609  -12.075 82.351 1.00 128.50 ? 118  LYS C C     1 
ATOM   2259  O  O     . LYS C 3  118 ? -9.230  -13.085 81.983 1.00 123.84 ? 118  LYS C O     1 
ATOM   2260  C  CB    . LYS C 3  118 ? -6.615  -10.706 82.995 1.00 112.29 ? 118  LYS C CB    1 
ATOM   2261  C  CG    . LYS C 3  118 ? -5.126  -10.391 82.996 1.00 110.16 ? 118  LYS C CG    1 
ATOM   2262  C  CD    . LYS C 3  118 ? -4.927  -8.875  82.898 1.00 109.79 ? 118  LYS C CD    1 
ATOM   2263  C  CE    . LYS C 3  118 ? -5.450  -8.306  81.579 1.00 103.01 ? 118  LYS C CE    1 
ATOM   2264  N  NZ    . LYS C 3  118 ? -5.190  -6.849  81.434 1.00 100.47 ? 118  LYS C NZ    1 
ATOM   2265  N  N     . LYS C 3  119 ? -9.195  -10.897 82.610 1.00 142.70 ? 119  LYS C N     1 
ATOM   2266  C  CA    . LYS C 3  119 ? -10.623 -10.611 82.362 1.00 144.65 ? 119  LYS C CA    1 
ATOM   2267  C  C     . LYS C 3  119 ? -10.819 -9.298  81.598 1.00 134.68 ? 119  LYS C C     1 
ATOM   2268  O  O     . LYS C 3  119 ? -10.043 -8.356  81.758 1.00 128.35 ? 119  LYS C O     1 
ATOM   2269  C  CB    . LYS C 3  119 ? -11.450 -10.600 83.667 1.00 144.63 ? 119  LYS C CB    1 
ATOM   2270  C  CG    . LYS C 3  119 ? -11.032 -9.584  84.726 1.00 141.44 ? 119  LYS C CG    1 
ATOM   2271  C  CD    . LYS C 3  119 ? -10.272 -10.243 85.869 1.00 141.56 ? 119  LYS C CD    1 
ATOM   2272  C  CE    . LYS C 3  119 ? -10.409 -9.431  87.150 1.00 140.56 ? 119  LYS C CE    1 
ATOM   2273  N  NZ    . LYS C 3  119 ? -9.994  -10.219 88.341 1.00 134.82 ? 119  LYS C NZ    1 
ATOM   2274  N  N     . LYS D 4  31  ? 11.090  -21.849 21.989 1.00 137.76 ? 28   LYS D N     1 
ATOM   2275  C  CA    . LYS D 4  31  ? 11.194  -20.725 22.970 1.00 123.83 ? 28   LYS D CA    1 
ATOM   2276  C  C     . LYS D 4  31  ? 9.924   -19.868 22.865 1.00 118.34 ? 28   LYS D C     1 
ATOM   2277  O  O     . LYS D 4  31  ? 9.996   -18.655 22.631 1.00 106.99 ? 28   LYS D O     1 
ATOM   2278  C  CB    . LYS D 4  31  ? 12.460  -19.886 22.706 1.00 120.68 ? 28   LYS D CB    1 
ATOM   2279  C  CG    . LYS D 4  31  ? 13.545  -20.573 21.873 1.00 123.81 ? 28   LYS D CG    1 
ATOM   2280  C  CD    . LYS D 4  31  ? 13.550  -20.118 20.408 1.00 117.77 ? 28   LYS D CD    1 
ATOM   2281  C  CE    . LYS D 4  31  ? 13.759  -21.276 19.429 1.00 114.36 ? 28   LYS D CE    1 
ATOM   2282  N  NZ    . LYS D 4  31  ? 14.784  -22.281 19.842 1.00 107.96 ? 28   LYS D NZ    1 
ATOM   2283  N  N     . THR D 4  32  ? 8.768   -20.513 23.042 1.00 112.71 ? 29   THR D N     1 
ATOM   2284  C  CA    . THR D 4  32  ? 7.470   -19.904 22.732 1.00 114.61 ? 29   THR D CA    1 
ATOM   2285  C  C     . THR D 4  32  ? 7.129   -18.695 23.614 1.00 121.03 ? 29   THR D C     1 
ATOM   2286  O  O     . THR D 4  32  ? 7.370   -18.707 24.831 1.00 123.65 ? 29   THR D O     1 
ATOM   2287  C  CB    . THR D 4  32  ? 6.327   -20.944 22.743 1.00 114.39 ? 29   THR D CB    1 
ATOM   2288  O  OG1   . THR D 4  32  ? 5.273   -20.506 21.874 1.00 111.84 ? 29   THR D OG1   1 
ATOM   2289  C  CG2   . THR D 4  32  ? 5.791   -21.195 24.178 1.00 113.85 ? 29   THR D CG2   1 
ATOM   2290  N  N     . ARG D 4  33  ? 6.561   -17.666 22.978 1.00 120.93 ? 30   ARG D N     1 
ATOM   2291  C  CA    . ARG D 4  33  ? 6.347   -16.352 23.595 1.00 115.77 ? 30   ARG D CA    1 
ATOM   2292  C  C     . ARG D 4  33  ? 5.176   -16.335 24.593 1.00 113.48 ? 30   ARG D C     1 
ATOM   2293  O  O     . ARG D 4  33  ? 4.001   -16.384 24.197 1.00 103.99 ? 30   ARG D O     1 
ATOM   2294  C  CB    . ARG D 4  33  ? 6.191   -15.260 22.515 1.00 112.31 ? 30   ARG D CB    1 
ATOM   2295  C  CG    . ARG D 4  33  ? 4.962   -15.403 21.614 1.00 111.75 ? 30   ARG D CG    1 
ATOM   2296  C  CD    . ARG D 4  33  ? 4.543   -14.085 20.962 1.00 113.37 ? 30   ARG D CD    1 
ATOM   2297  N  NE    . ARG D 4  33  ? 5.206   -12.900 21.521 1.00 115.03 ? 30   ARG D NE    1 
ATOM   2298  C  CZ    . ARG D 4  33  ? 4.736   -11.652 21.465 1.00 117.94 ? 30   ARG D CZ    1 
ATOM   2299  N  NH1   . ARG D 4  33  ? 3.564   -11.386 20.896 1.00 119.29 ? 30   ARG D NH1   1 
ATOM   2300  N  NH2   . ARG D 4  33  ? 5.441   -10.660 21.998 1.00 118.65 ? 30   ARG D NH2   1 
ATOM   2301  N  N     . LYS D 4  34  ? 5.508   -16.276 25.883 1.00 101.61 ? 31   LYS D N     1 
ATOM   2302  C  CA    . LYS D 4  34  ? 4.489   -16.212 26.931 1.00 96.85  ? 31   LYS D CA    1 
ATOM   2303  C  C     . LYS D 4  34  ? 4.147   -14.766 27.321 1.00 94.17  ? 31   LYS D C     1 
ATOM   2304  O  O     . LYS D 4  34  ? 4.935   -14.071 27.975 1.00 98.78  ? 31   LYS D O     1 
ATOM   2305  C  CB    . LYS D 4  34  ? 4.861   -17.078 28.146 1.00 97.95  ? 31   LYS D CB    1 
ATOM   2306  C  CG    . LYS D 4  34  ? 6.339   -17.437 28.250 1.00 108.41 ? 31   LYS D CG    1 
ATOM   2307  C  CD    . LYS D 4  34  ? 6.661   -18.137 29.564 1.00 110.73 ? 31   LYS D CD    1 
ATOM   2308  C  CE    . LYS D 4  34  ? 8.127   -17.973 29.947 1.00 101.66 ? 31   LYS D CE    1 
ATOM   2309  N  NZ    . LYS D 4  34  ? 8.285   -17.981 31.429 1.00 96.03  ? 31   LYS D NZ    1 
ATOM   2310  N  N     . GLU D 4  35  ? 2.965   -14.328 26.887 1.00 86.46  ? 32   GLU D N     1 
ATOM   2311  C  CA    . GLU D 4  35  ? 2.442   -12.980 27.135 1.00 82.32  ? 32   GLU D CA    1 
ATOM   2312  C  C     . GLU D 4  35  ? 1.887   -12.790 28.531 1.00 79.65  ? 32   GLU D C     1 
ATOM   2313  O  O     . GLU D 4  35  ? 1.366   -13.729 29.120 1.00 89.38  ? 32   GLU D O     1 
ATOM   2314  C  CB    . GLU D 4  35  ? 1.288   -12.708 26.196 1.00 85.75  ? 32   GLU D CB    1 
ATOM   2315  C  CG    . GLU D 4  35  ? 1.677   -12.429 24.764 1.00 97.86  ? 32   GLU D CG    1 
ATOM   2316  C  CD    . GLU D 4  35  ? 0.479   -11.935 23.983 1.00 106.26 ? 32   GLU D CD    1 
ATOM   2317  O  OE1   . GLU D 4  35  ? -0.656  -12.182 24.473 1.00 94.54  ? 32   GLU D OE1   1 
ATOM   2318  O  OE2   . GLU D 4  35  ? 0.672   -11.296 22.913 1.00 104.04 ? 32   GLU D OE2   1 
ATOM   2319  N  N     . SER D 4  36  ? 1.972   -11.563 29.045 1.00 76.81  ? 33   SER D N     1 
ATOM   2320  C  CA    . SER D 4  36  ? 1.334   -11.193 30.317 1.00 71.94  ? 33   SER D CA    1 
ATOM   2321  C  C     . SER D 4  36  ? 0.936   -9.732  30.322 1.00 67.43  ? 33   SER D C     1 
ATOM   2322  O  O     . SER D 4  36  ? 1.246   -9.007  29.401 1.00 72.02  ? 33   SER D O     1 
ATOM   2323  C  CB    . SER D 4  36  ? 2.199   -11.556 31.549 1.00 66.24  ? 33   SER D CB    1 
ATOM   2324  O  OG    . SER D 4  36  ? 3.295   -10.690 31.747 1.00 67.45  ? 33   SER D OG    1 
ATOM   2325  N  N     . TYR D 4  37  ? 0.241   -9.310  31.366 1.00 63.65  ? 34   TYR D N     1 
ATOM   2326  C  CA    . TYR D 4  37  ? -0.063  -7.913  31.550 1.00 62.46  ? 34   TYR D CA    1 
ATOM   2327  C  C     . TYR D 4  37  ? 1.011   -7.109  32.314 1.00 66.21  ? 34   TYR D C     1 
ATOM   2328  O  O     . TYR D 4  37  ? 0.776   -5.940  32.663 1.00 68.49  ? 34   TYR D O     1 
ATOM   2329  C  CB    . TYR D 4  37  ? -1.373  -7.789  32.276 1.00 60.70  ? 34   TYR D CB    1 
ATOM   2330  C  CG    . TYR D 4  37  ? -2.567  -8.224  31.485 1.00 62.42  ? 34   TYR D CG    1 
ATOM   2331  C  CD1   . TYR D 4  37  ? -3.128  -9.468  31.680 1.00 63.31  ? 34   TYR D CD1   1 
ATOM   2332  C  CD2   . TYR D 4  37  ? -3.176  -7.367  30.571 1.00 67.16  ? 34   TYR D CD2   1 
ATOM   2333  C  CE1   . TYR D 4  37  ? -4.253  -9.865  30.977 1.00 69.10  ? 34   TYR D CE1   1 
ATOM   2334  C  CE2   . TYR D 4  37  ? -4.306  -7.756  29.854 1.00 61.47  ? 34   TYR D CE2   1 
ATOM   2335  C  CZ    . TYR D 4  37  ? -4.839  -9.001  30.070 1.00 66.26  ? 34   TYR D CZ    1 
ATOM   2336  O  OH    . TYR D 4  37  ? -5.950  -9.414  29.372 1.00 74.97  ? 34   TYR D OH    1 
ATOM   2337  N  N     . ALA D 4  38  ? 2.186   -7.710  32.530 1.00 66.31  ? 35   ALA D N     1 
ATOM   2338  C  CA    . ALA D 4  38  ? 3.219   -7.161  33.427 1.00 66.04  ? 35   ALA D CA    1 
ATOM   2339  C  C     . ALA D 4  38  ? 3.674   -5.713  33.163 1.00 70.15  ? 35   ALA D C     1 
ATOM   2340  O  O     . ALA D 4  38  ? 3.912   -4.954  34.105 1.00 73.47  ? 35   ALA D O     1 
ATOM   2341  C  CB    . ALA D 4  38  ? 4.420   -8.104  33.508 1.00 65.27  ? 35   ALA D CB    1 
ATOM   2342  N  N     . ILE D 4  39  ? 3.791   -5.306  31.906 1.00 71.01  ? 36   ILE D N     1 
ATOM   2343  C  CA    . ILE D 4  39  ? 4.354   -3.983  31.664 1.00 69.90  ? 36   ILE D CA    1 
ATOM   2344  C  C     . ILE D 4  39  ? 3.303   -2.919  31.899 1.00 72.14  ? 36   ILE D C     1 
ATOM   2345  O  O     . ILE D 4  39  ? 3.607   -1.803  32.326 1.00 70.50  ? 36   ILE D O     1 
ATOM   2346  C  CB    . ILE D 4  39  ? 5.015   -3.852  30.275 1.00 71.36  ? 36   ILE D CB    1 
ATOM   2347  C  CG1   . ILE D 4  39  ? 4.044   -4.226  29.161 1.00 66.52  ? 36   ILE D CG1   1 
ATOM   2348  C  CG2   . ILE D 4  39  ? 6.308   -4.677  30.216 1.00 74.56  ? 36   ILE D CG2   1 
ATOM   2349  C  CD1   . ILE D 4  39  ? 4.742   -4.370  27.832 1.00 65.65  ? 36   ILE D CD1   1 
ATOM   2350  N  N     . TYR D 4  40  ? 2.059   -3.288  31.631 1.00 72.46  ? 37   TYR D N     1 
ATOM   2351  C  CA    . TYR D 4  40  ? 0.945   -2.406  31.881 1.00 67.58  ? 37   TYR D CA    1 
ATOM   2352  C  C     . TYR D 4  40  ? 0.720   -2.261  33.366 1.00 64.41  ? 37   TYR D C     1 
ATOM   2353  O  O     . TYR D 4  40  ? 0.396   -1.179  33.828 1.00 67.47  ? 37   TYR D O     1 
ATOM   2354  C  CB    . TYR D 4  40  ? -0.303  -2.941  31.201 1.00 67.88  ? 37   TYR D CB    1 
ATOM   2355  C  CG    . TYR D 4  40  ? -0.020  -3.427  29.812 1.00 74.76  ? 37   TYR D CG    1 
ATOM   2356  C  CD1   . TYR D 4  40  ? 0.099   -4.791  29.541 1.00 79.98  ? 37   TYR D CD1   1 
ATOM   2357  C  CD2   . TYR D 4  40  ? 0.154   -2.524  28.764 1.00 76.73  ? 37   TYR D CD2   1 
ATOM   2358  C  CE1   . TYR D 4  40  ? 0.368   -5.240  28.258 1.00 80.39  ? 37   TYR D CE1   1 
ATOM   2359  C  CE2   . TYR D 4  40  ? 0.427   -2.953  27.482 1.00 78.34  ? 37   TYR D CE2   1 
ATOM   2360  C  CZ    . TYR D 4  40  ? 0.540   -4.302  27.236 1.00 86.61  ? 37   TYR D CZ    1 
ATOM   2361  O  OH    . TYR D 4  40  ? 0.814   -4.679  25.947 1.00 96.47  ? 37   TYR D OH    1 
ATOM   2362  N  N     . VAL D 4  41  ? 0.878   -3.349  34.118 1.00 65.39  ? 38   VAL D N     1 
ATOM   2363  C  CA    . VAL D 4  41  ? 0.725   -3.282  35.576 1.00 61.09  ? 38   VAL D CA    1 
ATOM   2364  C  C     . VAL D 4  41  ? 1.820   -2.377  36.097 1.00 59.01  ? 38   VAL D C     1 
ATOM   2365  O  O     . VAL D 4  41  ? 1.578   -1.528  36.955 1.00 57.98  ? 38   VAL D O     1 
ATOM   2366  C  CB    . VAL D 4  41  ? 0.774   -4.662  36.261 1.00 56.43  ? 38   VAL D CB    1 
ATOM   2367  C  CG1   . VAL D 4  41  ? 0.953   -4.498  37.759 1.00 55.07  ? 38   VAL D CG1   1 
ATOM   2368  C  CG2   . VAL D 4  41  ? -0.501  -5.441  35.961 1.00 55.05  ? 38   VAL D CG2   1 
ATOM   2369  N  N     . TYR D 4  42  ? 3.013   -2.534  35.530 1.00 58.14  ? 39   TYR D N     1 
ATOM   2370  C  CA    . TYR D 4  42  ? 4.154   -1.680  35.884 1.00 62.34  ? 39   TYR D CA    1 
ATOM   2371  C  C     . TYR D 4  42  ? 3.936   -0.169  35.576 1.00 62.56  ? 39   TYR D C     1 
ATOM   2372  O  O     . TYR D 4  42  ? 4.212   0.686   36.426 1.00 65.35  ? 39   TYR D O     1 
ATOM   2373  C  CB    . TYR D 4  42  ? 5.448   -2.230  35.276 1.00 65.66  ? 39   TYR D CB    1 
ATOM   2374  C  CG    . TYR D 4  42  ? 6.681   -1.686  35.922 1.00 71.76  ? 39   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D 4  42  ? 7.040   -2.080  37.212 1.00 74.93  ? 39   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D 4  42  ? 7.487   -0.752  35.255 1.00 82.16  ? 39   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D 4  42  ? 8.165   -1.559  37.836 1.00 81.59  ? 39   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D 4  42  ? 8.622   -0.225  35.859 1.00 88.65  ? 39   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D 4  42  ? 8.959   -0.632  37.154 1.00 87.89  ? 39   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D 4  42  ? 10.078  -0.117  37.778 1.00 84.94  ? 39   TYR D OH    1 
ATOM   2381  N  N     . LYS D 4  43  ? 3.408   0.151   34.391 1.00 64.78  ? 40   LYS D N     1 
ATOM   2382  C  CA    . LYS D 4  43  ? 3.067   1.541   34.031 1.00 62.03  ? 40   LYS D CA    1 
ATOM   2383  C  C     . LYS D 4  43  ? 2.136   2.124   35.075 1.00 64.39  ? 40   LYS D C     1 
ATOM   2384  O  O     . LYS D 4  43  ? 2.406   3.187   35.660 1.00 70.30  ? 40   LYS D O     1 
ATOM   2385  C  CB    . LYS D 4  43  ? 2.410   1.635   32.651 1.00 56.74  ? 40   LYS D CB    1 
ATOM   2386  C  CG    . LYS D 4  43  ? 3.381   1.446   31.509 1.00 62.98  ? 40   LYS D CG    1 
ATOM   2387  C  CD    . LYS D 4  43  ? 2.698   1.363   30.150 1.00 65.75  ? 40   LYS D CD    1 
ATOM   2388  C  CE    . LYS D 4  43  ? 3.758   1.340   29.048 1.00 72.09  ? 40   LYS D CE    1 
ATOM   2389  N  NZ    . LYS D 4  43  ? 3.229   1.042   27.678 1.00 74.33  ? 40   LYS D NZ    1 
ATOM   2390  N  N     . VAL D 4  44  ? 1.047   1.407   35.319 1.00 59.92  ? 41   VAL D N     1 
ATOM   2391  C  CA    . VAL D 4  44  ? 0.037   1.863   36.248 1.00 60.49  ? 41   VAL D CA    1 
ATOM   2392  C  C     . VAL D 4  44  ? 0.634   1.993   37.667 1.00 65.17  ? 41   VAL D C     1 
ATOM   2393  O  O     . VAL D 4  44  ? 0.278   2.892   38.445 1.00 61.06  ? 41   VAL D O     1 
ATOM   2394  C  CB    . VAL D 4  44  ? -1.158  0.907   36.245 1.00 56.99  ? 41   VAL D CB    1 
ATOM   2395  C  CG1   . VAL D 4  44  ? -2.198  1.379   37.240 1.00 60.25  ? 41   VAL D CG1   1 
ATOM   2396  C  CG2   . VAL D 4  44  ? -1.770  0.778   34.849 1.00 56.31  ? 41   VAL D CG2   1 
ATOM   2397  N  N     . LEU D 4  45  ? 1.570   1.102   37.982 1.00 66.63  ? 42   LEU D N     1 
ATOM   2398  C  CA    . LEU D 4  45  ? 2.261   1.146   39.262 1.00 65.16  ? 42   LEU D CA    1 
ATOM   2399  C  C     . LEU D 4  45  ? 3.043   2.450   39.394 1.00 65.77  ? 42   LEU D C     1 
ATOM   2400  O  O     . LEU D 4  45  ? 3.089   3.070   40.486 1.00 61.19  ? 42   LEU D O     1 
ATOM   2401  C  CB    . LEU D 4  45  ? 3.190   -0.064  39.416 1.00 58.98  ? 42   LEU D CB    1 
ATOM   2402  C  CG    . LEU D 4  45  ? 4.044   -0.074  40.686 1.00 63.09  ? 42   LEU D CG    1 
ATOM   2403  C  CD1   . LEU D 4  45  ? 3.172   -0.004  41.936 1.00 58.28  ? 42   LEU D CD1   1 
ATOM   2404  C  CD2   . LEU D 4  45  ? 4.991   -1.272  40.732 1.00 63.60  ? 42   LEU D CD2   1 
ATOM   2405  N  N     . LYS D 4  46  ? 3.642   2.869   38.278 1.00 61.34  ? 43   LYS D N     1 
ATOM   2406  C  CA    . LYS D 4  46  ? 4.494   4.050   38.301 1.00 60.56  ? 43   LYS D CA    1 
ATOM   2407  C  C     . LYS D 4  46  ? 3.656   5.289   38.490 1.00 60.53  ? 43   LYS D C     1 
ATOM   2408  O  O     . LYS D 4  46  ? 4.014   6.162   39.266 1.00 63.20  ? 43   LYS D O     1 
ATOM   2409  C  CB    . LYS D 4  46  ? 5.371   4.117   37.059 1.00 59.08  ? 43   LYS D CB    1 
ATOM   2410  C  CG    . LYS D 4  46  ? 6.579   3.193   37.168 1.00 62.67  ? 43   LYS D CG    1 
ATOM   2411  C  CD    . LYS D 4  46  ? 6.973   3.070   38.638 1.00 63.29  ? 43   LYS D CD    1 
ATOM   2412  C  CE    . LYS D 4  46  ? 8.183   2.192   38.852 1.00 65.99  ? 43   LYS D CE    1 
ATOM   2413  N  NZ    . LYS D 4  46  ? 8.597   2.311   40.279 1.00 70.47  ? 43   LYS D NZ    1 
ATOM   2414  N  N     . GLN D 4  47  ? 2.512   5.305   37.814 1.00 58.39  ? 44   GLN D N     1 
ATOM   2415  C  CA    . GLN D 4  47  ? 1.514   6.333   37.961 1.00 55.25  ? 44   GLN D CA    1 
ATOM   2416  C  C     . GLN D 4  47  ? 1.100   6.606   39.404 1.00 56.01  ? 44   GLN D C     1 
ATOM   2417  O  O     . GLN D 4  47  ? 0.986   7.777   39.803 1.00 61.75  ? 44   GLN D O     1 
ATOM   2418  C  CB    . GLN D 4  47  ? 0.291   5.968   37.133 1.00 56.68  ? 44   GLN D CB    1 
ATOM   2419  C  CG    . GLN D 4  47  ? 0.501   6.019   35.624 1.00 56.56  ? 44   GLN D CG    1 
ATOM   2420  C  CD    . GLN D 4  47  ? -0.828  6.041   34.873 1.00 64.15  ? 44   GLN D CD    1 
ATOM   2421  O  OE1   . GLN D 4  47  ? -1.734  5.240   35.164 1.00 69.53  ? 44   GLN D OE1   1 
ATOM   2422  N  NE2   . GLN D 4  47  ? -0.962  6.956   33.916 1.00 59.82  ? 44   GLN D NE2   1 
ATOM   2423  N  N     . VAL D 4  48  ? 0.887   5.547   40.183 1.00 53.98  ? 45   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4  48  ? 0.307   5.691   41.530 1.00 56.33  ? 45   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4  48  ? 1.340   5.761   42.648 1.00 55.74  ? 45   VAL D C     1 
ATOM   2426  O  O     . VAL D 4  48  ? 1.125   6.430   43.666 1.00 64.46  ? 45   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4  48  ? -0.779  4.621   41.845 1.00 54.34  ? 45   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4  48  ? -1.820  4.580   40.733 1.00 57.72  ? 45   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4  48  ? -0.162  3.247   42.078 1.00 50.36  ? 45   VAL D CG2   1 
ATOM   2430  N  N     . HIS D 4  49  ? 2.462   5.094   42.453 1.00 53.09  ? 46   HIS D N     1 
ATOM   2431  C  CA    . HIS D 4  49  ? 3.492   5.054   43.486 1.00 59.85  ? 46   HIS D CA    1 
ATOM   2432  C  C     . HIS D 4  49  ? 4.858   5.061   42.869 1.00 63.39  ? 46   HIS D C     1 
ATOM   2433  O  O     . HIS D 4  49  ? 5.476   4.001   42.726 1.00 61.41  ? 46   HIS D O     1 
ATOM   2434  C  CB    . HIS D 4  49  ? 3.353   3.803   44.315 1.00 55.37  ? 46   HIS D CB    1 
ATOM   2435  C  CG    . HIS D 4  49  ? 2.260   3.862   45.310 1.00 53.25  ? 46   HIS D CG    1 
ATOM   2436  N  ND1   . HIS D 4  49  ? 2.374   4.549   46.452 1.00 57.25  ? 46   HIS D ND1   1 
ATOM   2437  C  CD2   . HIS D 4  49  ? 1.017   3.248   45.339 1.00 56.40  ? 46   HIS D CD2   1 
ATOM   2438  C  CE1   . HIS D 4  49  ? 1.260   4.394   47.184 1.00 55.46  ? 46   HIS D CE1   1 
ATOM   2439  N  NE2   . HIS D 4  49  ? 0.423   3.603   46.499 1.00 58.99  ? 46   HIS D NE2   1 
ATOM   2440  N  N     . PRO D 4  50  ? 5.362   6.258   42.517 1.00 66.50  ? 47   PRO D N     1 
ATOM   2441  C  CA    . PRO D 4  50  ? 6.459   6.370   41.551 1.00 64.77  ? 47   PRO D CA    1 
ATOM   2442  C  C     . PRO D 4  50  ? 7.792   5.823   42.082 1.00 62.28  ? 47   PRO D C     1 
ATOM   2443  O  O     . PRO D 4  50  ? 8.672   5.475   41.308 1.00 58.63  ? 47   PRO D O     1 
ATOM   2444  C  CB    . PRO D 4  50  ? 6.521   7.886   41.263 1.00 68.65  ? 47   PRO D CB    1 
ATOM   2445  C  CG    . PRO D 4  50  ? 5.261   8.465   41.828 1.00 63.05  ? 47   PRO D CG    1 
ATOM   2446  C  CD    . PRO D 4  50  ? 4.936   7.584   43.003 1.00 66.31  ? 47   PRO D CD    1 
ATOM   2447  N  N     . ASP D 4  51  ? 7.913   5.691   43.393 1.00 63.20  ? 48   ASP D N     1 
ATOM   2448  C  CA    . ASP D 4  51  ? 9.141   5.132   43.954 1.00 69.89  ? 48   ASP D CA    1 
ATOM   2449  C  C     . ASP D 4  51  ? 9.030   3.689   44.476 1.00 70.53  ? 48   ASP D C     1 
ATOM   2450  O  O     . ASP D 4  51  ? 9.914   3.232   45.220 1.00 67.90  ? 48   ASP D O     1 
ATOM   2451  C  CB    . ASP D 4  51  ? 9.678   6.035   45.076 1.00 79.24  ? 48   ASP D CB    1 
ATOM   2452  C  CG    . ASP D 4  51  ? 10.018  7.443   44.598 1.00 82.98  ? 48   ASP D CG    1 
ATOM   2453  O  OD1   . ASP D 4  51  ? 10.375  7.622   43.393 1.00 72.91  ? 48   ASP D OD1   1 
ATOM   2454  O  OD2   . ASP D 4  51  ? 9.916   8.363   45.456 1.00 79.35  ? 48   ASP D OD2   1 
ATOM   2455  N  N     . THR D 4  52  ? 7.966   2.983   44.083 1.00 66.20  ? 49   THR D N     1 
ATOM   2456  C  CA    . THR D 4  52  ? 7.695   1.634   44.565 1.00 58.45  ? 49   THR D CA    1 
ATOM   2457  C  C     . THR D 4  52  ? 7.907   0.571   43.479 1.00 60.03  ? 49   THR D C     1 
ATOM   2458  O  O     . THR D 4  52  ? 7.461   0.740   42.340 1.00 61.08  ? 49   THR D O     1 
ATOM   2459  C  CB    . THR D 4  52  ? 6.256   1.536   45.066 1.00 60.41  ? 49   THR D CB    1 
ATOM   2460  O  OG1   . THR D 4  52  ? 6.071   2.440   46.151 1.00 61.44  ? 49   THR D OG1   1 
ATOM   2461  C  CG2   . THR D 4  52  ? 5.925   0.124   45.531 1.00 61.61  ? 49   THR D CG2   1 
ATOM   2462  N  N     . GLY D 4  53  ? 8.585   -0.518  43.844 1.00 55.98  ? 50   GLY D N     1 
ATOM   2463  C  CA    . GLY D 4  53  ? 8.773   -1.660  42.959 1.00 58.66  ? 50   GLY D CA    1 
ATOM   2464  C  C     . GLY D 4  53  ? 7.859   -2.848  43.276 1.00 64.22  ? 50   GLY D C     1 
ATOM   2465  O  O     . GLY D 4  53  ? 7.153   -2.866  44.283 1.00 64.88  ? 50   GLY D O     1 
ATOM   2466  N  N     . ILE D 4  54  ? 7.873   -3.858  42.415 1.00 61.11  ? 51   ILE D N     1 
ATOM   2467  C  CA    . ILE D 4  54  ? 7.027   -5.012  42.618 1.00 57.90  ? 51   ILE D CA    1 
ATOM   2468  C  C     . ILE D 4  54  ? 7.835   -6.276  42.374 1.00 61.36  ? 51   ILE D C     1 
ATOM   2469  O  O     . ILE D 4  54  ? 8.526   -6.370  41.371 1.00 64.65  ? 51   ILE D O     1 
ATOM   2470  C  CB    . ILE D 4  54  ? 5.793   -4.948  41.701 1.00 55.84  ? 51   ILE D CB    1 
ATOM   2471  C  CG1   . ILE D 4  54  ? 4.763   -5.986  42.148 1.00 55.87  ? 51   ILE D CG1   1 
ATOM   2472  C  CG2   . ILE D 4  54  ? 6.185   -5.081  40.231 1.00 50.83  ? 51   ILE D CG2   1 
ATOM   2473  C  CD1   . ILE D 4  54  ? 3.389   -5.837  41.532 1.00 52.59  ? 51   ILE D CD1   1 
ATOM   2474  N  N     . SER D 4  55  ? 7.757   -7.231  43.302 1.00 63.47  ? 52   SER D N     1 
ATOM   2475  C  CA    . SER D 4  55  ? 8.473   -8.513  43.199 1.00 59.80  ? 52   SER D CA    1 
ATOM   2476  C  C     . SER D 4  55  ? 7.829   -9.342  42.098 1.00 57.77  ? 52   SER D C     1 
ATOM   2477  O  O     . SER D 4  55  ? 6.678   -9.108  41.764 1.00 57.96  ? 52   SER D O     1 
ATOM   2478  C  CB    . SER D 4  55  ? 8.371   -9.274  44.516 1.00 61.23  ? 52   SER D CB    1 
ATOM   2479  O  OG    . SER D 4  55  ? 7.130   -9.965  44.569 1.00 61.52  ? 52   SER D OG    1 
ATOM   2480  N  N     . SER D 4  56  ? 8.544   -10.320 41.548 1.00 56.58  ? 53   SER D N     1 
ATOM   2481  C  CA    . SER D 4  56  ? 8.017   -11.040 40.399 1.00 58.50  ? 53   SER D CA    1 
ATOM   2482  C  C     . SER D 4  56  ? 6.861   -11.937 40.808 1.00 62.72  ? 53   SER D C     1 
ATOM   2483  O  O     . SER D 4  56  ? 5.970   -12.202 39.974 1.00 62.33  ? 53   SER D O     1 
ATOM   2484  C  CB    . SER D 4  56  ? 9.095   -11.870 39.728 1.00 59.51  ? 53   SER D CB    1 
ATOM   2485  O  OG    . SER D 4  56  ? 9.542   -12.831 40.643 1.00 65.63  ? 53   SER D OG    1 
ATOM   2486  N  N     . LYS D 4  57  ? 6.881   -12.423 42.061 1.00 56.63  ? 54   LYS D N     1 
ATOM   2487  C  CA    . LYS D 4  57  ? 5.748   -13.188 42.564 1.00 56.97  ? 54   LYS D CA    1 
ATOM   2488  C  C     . LYS D 4  57  ? 4.535   -12.260 42.683 1.00 61.70  ? 54   LYS D C     1 
ATOM   2489  O  O     . LYS D 4  57  ? 3.433   -12.593 42.216 1.00 61.49  ? 54   LYS D O     1 
ATOM   2490  C  CB    . LYS D 4  57  ? 6.046   -13.864 43.894 1.00 65.48  ? 54   LYS D CB    1 
ATOM   2491  C  CG    . LYS D 4  57  ? 6.981   -15.073 43.848 1.00 75.44  ? 54   LYS D CG    1 
ATOM   2492  C  CD    . LYS D 4  57  ? 7.138   -15.679 45.261 1.00 85.66  ? 54   LYS D CD    1 
ATOM   2493  C  CE    . LYS D 4  57  ? 8.199   -16.789 45.375 1.00 81.69  ? 54   LYS D CE    1 
ATOM   2494  N  NZ    . LYS D 4  57  ? 9.443   -16.370 46.106 1.00 90.27  ? 54   LYS D NZ    1 
ATOM   2495  N  N     . ALA D 4  58  ? 4.737   -11.076 43.271 1.00 61.08  ? 55   ALA D N     1 
ATOM   2496  C  CA    . ALA D 4  58  ? 3.658   -10.095 43.349 1.00 52.40  ? 55   ALA D CA    1 
ATOM   2497  C  C     . ALA D 4  58  ? 3.141   -9.769  41.963 1.00 50.32  ? 55   ALA D C     1 
ATOM   2498  O  O     . ALA D 4  58  ? 1.950   -9.641  41.778 1.00 55.88  ? 55   ALA D O     1 
ATOM   2499  C  CB    . ALA D 4  58  ? 4.081   -8.850  44.090 1.00 47.28  ? 55   ALA D CB    1 
ATOM   2500  N  N     . MET D 4  59  ? 4.018   -9.674  40.974 1.00 52.79  ? 56   MET D N     1 
ATOM   2501  C  CA    . MET D 4  59  ? 3.564   -9.432  39.606 1.00 52.76  ? 56   MET D CA    1 
ATOM   2502  C  C     . MET D 4  59  ? 2.797   -10.645 39.109 1.00 52.25  ? 56   MET D C     1 
ATOM   2503  O  O     . MET D 4  59  ? 1.797   -10.506 38.429 1.00 58.43  ? 56   MET D O     1 
ATOM   2504  C  CB    . MET D 4  59  ? 4.733   -9.117  38.671 1.00 56.91  ? 56   MET D CB    1 
ATOM   2505  C  CG    . MET D 4  59  ? 4.332   -8.839  37.223 1.00 56.36  ? 56   MET D CG    1 
ATOM   2506  S  SD    . MET D 4  59  ? 3.325   -7.336  37.127 1.00 63.79  ? 56   MET D SD    1 
ATOM   2507  C  CE    . MET D 4  59  ? 4.560   -6.024  37.220 1.00 54.26  ? 56   MET D CE    1 
ATOM   2508  N  N     . SER D 4  60  ? 3.223   -11.842 39.473 1.00 51.86  ? 57   SER D N     1 
ATOM   2509  C  CA    . SER D 4  60  ? 2.483   -13.001 39.002 1.00 56.46  ? 57   SER D CA    1 
ATOM   2510  C  C     . SER D 4  60  ? 0.988   -12.979 39.432 1.00 59.25  ? 57   SER D C     1 
ATOM   2511  O  O     . SER D 4  60  ? 0.065   -13.180 38.599 1.00 54.40  ? 57   SER D O     1 
ATOM   2512  C  CB    . SER D 4  60  ? 3.160   -14.283 39.442 1.00 54.32  ? 57   SER D CB    1 
ATOM   2513  O  OG    . SER D 4  60  ? 2.619   -15.331 38.666 1.00 61.61  ? 57   SER D OG    1 
ATOM   2514  N  N     . ILE D 4  61  ? 0.784   -12.725 40.731 1.00 52.32  ? 58   ILE D N     1 
ATOM   2515  C  CA    . ILE D 4  61  ? -0.536  -12.531 41.326 1.00 52.10  ? 58   ILE D CA    1 
ATOM   2516  C  C     . ILE D 4  61  ? -1.291  -11.391 40.641 1.00 53.87  ? 58   ILE D C     1 
ATOM   2517  O  O     . ILE D 4  61  ? -2.483  -11.529 40.321 1.00 51.94  ? 58   ILE D O     1 
ATOM   2518  C  CB    . ILE D 4  61  ? -0.421  -12.254 42.842 1.00 53.78  ? 58   ILE D CB    1 
ATOM   2519  C  CG1   . ILE D 4  61  ? 0.064   -13.511 43.555 1.00 54.83  ? 58   ILE D CG1   1 
ATOM   2520  C  CG2   . ILE D 4  61  ? -1.738  -11.781 43.433 1.00 47.93  ? 58   ILE D CG2   1 
ATOM   2521  C  CD1   . ILE D 4  61  ? 0.815   -13.211 44.827 1.00 53.47  ? 58   ILE D CD1   1 
ATOM   2522  N  N     . MET D 4  62  ? -0.603  -10.277 40.392 1.00 52.60  ? 59   MET D N     1 
ATOM   2523  C  CA    . MET D 4  62  ? -1.230  -9.208  39.615 1.00 54.74  ? 59   MET D CA    1 
ATOM   2524  C  C     . MET D 4  62  ? -1.643  -9.711  38.256 1.00 51.44  ? 59   MET D C     1 
ATOM   2525  O  O     . MET D 4  62  ? -2.772  -9.464  37.824 1.00 47.77  ? 59   MET D O     1 
ATOM   2526  C  CB    . MET D 4  62  ? -0.354  -7.969  39.479 1.00 55.15  ? 59   MET D CB    1 
ATOM   2527  C  CG    . MET D 4  62  ? -0.226  -7.133  40.754 1.00 50.69  ? 59   MET D CG    1 
ATOM   2528  S  SD    . MET D 4  62  ? -1.747  -6.760  41.611 1.00 51.25  ? 59   MET D SD    1 
ATOM   2529  C  CE    . MET D 4  62  ? -2.862  -6.166  40.356 1.00 47.22  ? 59   MET D CE    1 
ATOM   2530  N  N     . ASN D 4  63  ? -0.760  -10.469 37.610 1.00 53.02  ? 60   ASN D N     1 
ATOM   2531  C  CA    . ASN D 4  63  ? -1.129  -11.037 36.330 1.00 58.91  ? 60   ASN D CA    1 
ATOM   2532  C  C     . ASN D 4  63  ? -2.345  -11.972 36.383 1.00 59.84  ? 60   ASN D C     1 
ATOM   2533  O  O     . ASN D 4  63  ? -3.230  -11.902 35.509 1.00 54.02  ? 60   ASN D O     1 
ATOM   2534  C  CB    . ASN D 4  63  ? 0.037   -11.690 35.622 1.00 60.23  ? 60   ASN D CB    1 
ATOM   2535  C  CG    . ASN D 4  63  ? -0.251  -11.869 34.143 1.00 66.95  ? 60   ASN D CG    1 
ATOM   2536  O  OD1   . ASN D 4  63  ? -0.569  -10.909 33.455 1.00 65.07  ? 60   ASN D OD1   1 
ATOM   2537  N  ND2   . ASN D 4  63  ? -0.177  -13.103 33.656 1.00 75.58  ? 60   ASN D ND2   1 
ATOM   2538  N  N     . SER D 4  64  ? -2.381  -12.823 37.418 1.00 58.92  ? 61   SER D N     1 
ATOM   2539  C  CA    . SER D 4  64  ? -3.506  -13.731 37.643 1.00 58.47  ? 61   SER D CA    1 
ATOM   2540  C  C     . SER D 4  64  ? -4.819  -12.981 37.844 1.00 60.52  ? 61   SER D C     1 
ATOM   2541  O  O     . SER D 4  64  ? -5.864  -13.358 37.269 1.00 59.06  ? 61   SER D O     1 
ATOM   2542  C  CB    . SER D 4  64  ? -3.251  -14.609 38.859 1.00 59.74  ? 61   SER D CB    1 
ATOM   2543  O  OG    . SER D 4  64  ? -2.308  -15.624 38.583 1.00 64.91  ? 61   SER D OG    1 
ATOM   2544  N  N     . PHE D 4  65  ? -4.749  -11.920 38.660 1.00 58.05  ? 62   PHE D N     1 
ATOM   2545  C  CA    . PHE D 4  65  ? -5.914  -11.092 38.997 1.00 52.56  ? 62   PHE D CA    1 
ATOM   2546  C  C     . PHE D 4  65  ? -6.559  -10.458 37.773 1.00 54.30  ? 62   PHE D C     1 
ATOM   2547  O  O     . PHE D 4  65  ? -7.777  -10.473 37.672 1.00 59.44  ? 62   PHE D O     1 
ATOM   2548  C  CB    . PHE D 4  65  ? -5.526  -10.032 40.017 1.00 51.62  ? 62   PHE D CB    1 
ATOM   2549  C  CG    . PHE D 4  65  ? -6.525  -8.943  40.180 1.00 51.00  ? 62   PHE D CG    1 
ATOM   2550  C  CD1   . PHE D 4  65  ? -7.748  -9.175  40.793 1.00 53.85  ? 62   PHE D CD1   1 
ATOM   2551  C  CD2   . PHE D 4  65  ? -6.231  -7.666  39.749 1.00 51.54  ? 62   PHE D CD2   1 
ATOM   2552  C  CE1   . PHE D 4  65  ? -8.668  -8.153  40.948 1.00 53.27  ? 62   PHE D CE1   1 
ATOM   2553  C  CE2   . PHE D 4  65  ? -7.149  -6.641  39.898 1.00 51.54  ? 62   PHE D CE2   1 
ATOM   2554  C  CZ    . PHE D 4  65  ? -8.364  -6.880  40.503 1.00 51.98  ? 62   PHE D CZ    1 
ATOM   2555  N  N     . VAL D 4  66  ? -5.761  -9.937  36.836 1.00 52.23  ? 63   VAL D N     1 
ATOM   2556  C  CA    . VAL D 4  66  ? -6.311  -9.363  35.591 1.00 52.80  ? 63   VAL D CA    1 
ATOM   2557  C  C     . VAL D 4  66  ? -6.976  -10.417 34.699 1.00 54.08  ? 63   VAL D C     1 
ATOM   2558  O  O     . VAL D 4  66  ? -8.108  -10.231 34.249 1.00 54.19  ? 63   VAL D O     1 
ATOM   2559  C  CB    . VAL D 4  66  ? -5.253  -8.613  34.757 1.00 54.84  ? 63   VAL D CB    1 
ATOM   2560  C  CG1   . VAL D 4  66  ? -5.910  -7.905  33.589 1.00 52.52  ? 63   VAL D CG1   1 
ATOM   2561  C  CG2   . VAL D 4  66  ? -4.507  -7.607  35.616 1.00 55.85  ? 63   VAL D CG2   1 
ATOM   2562  N  N     . ASN D 4  67  ? -6.271  -11.521 34.456 1.00 53.06  ? 64   ASN D N     1 
ATOM   2563  C  CA    . ASN D 4  67  ? -6.836  -12.666 33.767 1.00 50.08  ? 64   ASN D CA    1 
ATOM   2564  C  C     . ASN D 4  67  ? -8.114  -13.146 34.391 1.00 50.48  ? 64   ASN D C     1 
ATOM   2565  O  O     . ASN D 4  67  ? -9.082  -13.415 33.674 1.00 49.90  ? 64   ASN D O     1 
ATOM   2566  C  CB    . ASN D 4  67  ? -5.845  -13.790 33.786 1.00 53.18  ? 64   ASN D CB    1 
ATOM   2567  C  CG    . ASN D 4  67  ? -4.666  -13.507 32.913 1.00 57.57  ? 64   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D 4  67  ? -4.832  -13.133 31.752 1.00 62.35  ? 64   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D 4  67  ? -3.461  -13.657 33.461 1.00 64.89  ? 64   ASN D ND2   1 
ATOM   2570  N  N     . ASP D 4  68  ? -8.122  -13.238 35.724 1.00 49.25  ? 65   ASP D N     1 
ATOM   2571  C  CA    . ASP D 4  68  ? -9.319  -13.618 36.445 1.00 50.41  ? 65   ASP D CA    1 
ATOM   2572  C  C     . ASP D 4  68  ? -10.522 -12.671 36.165 1.00 56.14  ? 65   ASP D C     1 
ATOM   2573  O  O     . ASP D 4  68  ? -11.521 -13.066 35.550 1.00 56.77  ? 65   ASP D O     1 
ATOM   2574  C  CB    . ASP D 4  68  ? -9.019  -13.760 37.931 1.00 52.44  ? 65   ASP D CB    1 
ATOM   2575  C  CG    . ASP D 4  68  ? -10.171 -14.369 38.685 1.00 54.75  ? 65   ASP D CG    1 
ATOM   2576  O  OD1   . ASP D 4  68  ? -10.859 -15.219 38.073 1.00 56.18  ? 65   ASP D OD1   1 
ATOM   2577  O  OD2   . ASP D 4  68  ? -10.403 -13.986 39.861 1.00 54.53  ? 65   ASP D OD2   1 
ATOM   2578  N  N     . VAL D 4  69  ? -10.406 -11.416 36.579 1.00 55.90  ? 66   VAL D N     1 
ATOM   2579  C  CA    . VAL D 4  69  ? -11.441 -10.426 36.323 1.00 55.73  ? 66   VAL D CA    1 
ATOM   2580  C  C     . VAL D 4  69  ? -11.871 -10.340 34.830 1.00 54.94  ? 66   VAL D C     1 
ATOM   2581  O  O     . VAL D 4  69  ? -13.066 -10.203 34.532 1.00 48.98  ? 66   VAL D O     1 
ATOM   2582  C  CB    . VAL D 4  69  ? -10.985 -9.056  36.867 1.00 55.12  ? 66   VAL D CB    1 
ATOM   2583  C  CG1   . VAL D 4  69  ? -12.043 -7.987  36.642 1.00 55.87  ? 66   VAL D CG1   1 
ATOM   2584  C  CG2   . VAL D 4  69  ? -10.690 -9.173  38.350 1.00 53.71  ? 66   VAL D CG2   1 
ATOM   2585  N  N     . PHE D 4  70  ? -10.903 -10.408 33.909 1.00 53.09  ? 67   PHE D N     1 
ATOM   2586  C  CA    . PHE D 4  70  ? -11.200 -10.495 32.472 1.00 54.81  ? 67   PHE D CA    1 
ATOM   2587  C  C     . PHE D 4  70  ? -12.153 -11.653 32.180 1.00 60.83  ? 67   PHE D C     1 
ATOM   2588  O  O     . PHE D 4  70  ? -13.227 -11.447 31.612 1.00 61.12  ? 67   PHE D O     1 
ATOM   2589  C  CB    . PHE D 4  70  ? -9.923  -10.667 31.634 1.00 58.70  ? 67   PHE D CB    1 
ATOM   2590  C  CG    . PHE D 4  70  ? -10.178 -10.781 30.144 1.00 62.95  ? 67   PHE D CG    1 
ATOM   2591  C  CD1   . PHE D 4  70  ? -9.886  -9.722  29.290 1.00 64.48  ? 67   PHE D CD1   1 
ATOM   2592  C  CD2   . PHE D 4  70  ? -10.709 -11.951 29.585 1.00 65.63  ? 67   PHE D CD2   1 
ATOM   2593  C  CE1   . PHE D 4  70  ? -10.130 -9.819  27.924 1.00 63.52  ? 67   PHE D CE1   1 
ATOM   2594  C  CE2   . PHE D 4  70  ? -10.944 -12.058 28.216 1.00 62.86  ? 67   PHE D CE2   1 
ATOM   2595  C  CZ    . PHE D 4  70  ? -10.658 -10.988 27.389 1.00 65.55  ? 67   PHE D CZ    1 
ATOM   2596  N  N     . GLU D 4  71  ? -11.753 -12.869 32.568 1.00 60.72  ? 68   GLU D N     1 
ATOM   2597  C  CA    . GLU D 4  71  ? -12.575 -14.048 32.341 1.00 61.45  ? 68   GLU D CA    1 
ATOM   2598  C  C     . GLU D 4  71  ? -13.957 -13.933 32.972 1.00 55.42  ? 68   GLU D C     1 
ATOM   2599  O  O     . GLU D 4  71  ? -14.949 -14.211 32.306 1.00 54.85  ? 68   GLU D O     1 
ATOM   2600  C  CB    . GLU D 4  71  ? -11.851 -15.316 32.790 1.00 72.27  ? 68   GLU D CB    1 
ATOM   2601  C  CG    . GLU D 4  71  ? -10.917 -15.882 31.717 1.00 85.14  ? 68   GLU D CG    1 
ATOM   2602  C  CD    . GLU D 4  71  ? -9.534  -16.286 32.252 1.00 98.78  ? 68   GLU D CD    1 
ATOM   2603  O  OE1   . GLU D 4  71  ? -9.457  -17.067 33.245 1.00 89.26  ? 68   GLU D OE1   1 
ATOM   2604  O  OE2   . GLU D 4  71  ? -8.514  -15.820 31.668 1.00 98.60  ? 68   GLU D OE2   1 
ATOM   2605  N  N     . ARG D 4  72  ? -14.020 -13.490 34.228 1.00 50.39  ? 69   ARG D N     1 
ATOM   2606  C  CA    . ARG D 4  72  ? -15.297 -13.263 34.899 1.00 49.13  ? 69   ARG D CA    1 
ATOM   2607  C  C     . ARG D 4  72  ? -16.231 -12.220 34.248 1.00 58.16  ? 69   ARG D C     1 
ATOM   2608  O  O     . ARG D 4  72  ? -17.444 -12.437 34.201 1.00 65.07  ? 69   ARG D O     1 
ATOM   2609  C  CB    . ARG D 4  72  ? -15.076 -12.894 36.339 1.00 51.56  ? 69   ARG D CB    1 
ATOM   2610  C  CG    . ARG D 4  72  ? -14.328 -13.935 37.167 1.00 54.85  ? 69   ARG D CG    1 
ATOM   2611  C  CD    . ARG D 4  72  ? -14.770 -13.789 38.608 1.00 52.16  ? 69   ARG D CD    1 
ATOM   2612  N  NE    . ARG D 4  72  ? -13.634 -13.537 39.460 1.00 50.05  ? 69   ARG D NE    1 
ATOM   2613  C  CZ    . ARG D 4  72  ? -13.711 -13.047 40.688 1.00 48.16  ? 69   ARG D CZ    1 
ATOM   2614  N  NH1   . ARG D 4  72  ? -14.870 -12.724 41.236 1.00 44.08  ? 69   ARG D NH1   1 
ATOM   2615  N  NH2   . ARG D 4  72  ? -12.594 -12.862 41.360 1.00 53.62  ? 69   ARG D NH2   1 
ATOM   2616  N  N     . ILE D 4  73  ? -15.694 -11.103 33.748 1.00 57.73  ? 70   ILE D N     1 
ATOM   2617  C  CA    . ILE D 4  73  ? -16.524 -10.113 33.042 1.00 58.74  ? 70   ILE D CA    1 
ATOM   2618  C  C     . ILE D 4  73  ? -16.973 -10.641 31.672 1.00 60.00  ? 70   ILE D C     1 
ATOM   2619  O  O     . ILE D 4  73  ? -18.170 -10.574 31.322 1.00 59.69  ? 70   ILE D O     1 
ATOM   2620  C  CB    . ILE D 4  73  ? -15.822 -8.730  32.916 1.00 62.08  ? 70   ILE D CB    1 
ATOM   2621  C  CG1   . ILE D 4  73  ? -15.805 -8.019  34.275 1.00 55.97  ? 70   ILE D CG1   1 
ATOM   2622  C  CG2   . ILE D 4  73  ? -16.511 -7.848  31.881 1.00 57.83  ? 70   ILE D CG2   1 
ATOM   2623  C  CD1   . ILE D 4  73  ? -14.764 -6.945  34.382 1.00 53.69  ? 70   ILE D CD1   1 
ATOM   2624  N  N     . ALA D 4  74  ? -16.012 -11.176 30.917 1.00 59.19  ? 71   ALA D N     1 
ATOM   2625  C  CA    . ALA D 4  74  ? -16.275 -11.772 29.600 1.00 59.03  ? 71   ALA D CA    1 
ATOM   2626  C  C     . ALA D 4  74  ? -17.326 -12.896 29.678 1.00 61.35  ? 71   ALA D C     1 
ATOM   2627  O  O     . ALA D 4  74  ? -18.175 -13.017 28.793 1.00 63.53  ? 71   ALA D O     1 
ATOM   2628  C  CB    . ALA D 4  74  ? -14.979 -12.266 28.975 1.00 53.58  ? 71   ALA D CB    1 
ATOM   2629  N  N     . GLY D 4  75  ? -17.284 -13.693 30.748 1.00 58.06  ? 72   GLY D N     1 
ATOM   2630  C  CA    . GLY D 4  75  ? -18.272 -14.737 30.954 1.00 55.73  ? 72   GLY D CA    1 
ATOM   2631  C  C     . GLY D 4  75  ? -19.661 -14.160 31.167 1.00 60.06  ? 72   GLY D C     1 
ATOM   2632  O  O     . GLY D 4  75  ? -20.602 -14.546 30.487 1.00 56.36  ? 72   GLY D O     1 
ATOM   2633  N  N     . GLU D 4  76  ? -19.790 -13.228 32.109 1.00 61.41  ? 73   GLU D N     1 
ATOM   2634  C  CA    . GLU D 4  76  ? -21.077 -12.626 32.392 1.00 62.53  ? 73   GLU D CA    1 
ATOM   2635  C  C     . GLU D 4  76  ? -21.619 -11.984 31.124 1.00 67.72  ? 73   GLU D C     1 
ATOM   2636  O  O     . GLU D 4  76  ? -22.810 -12.116 30.813 1.00 67.73  ? 73   GLU D O     1 
ATOM   2637  C  CB    . GLU D 4  76  ? -20.963 -11.585 33.507 1.00 66.05  ? 73   GLU D CB    1 
ATOM   2638  C  CG    . GLU D 4  76  ? -20.678 -12.165 34.880 1.00 70.52  ? 73   GLU D CG    1 
ATOM   2639  C  CD    . GLU D 4  76  ? -21.911 -12.742 35.554 1.00 77.25  ? 73   GLU D CD    1 
ATOM   2640  O  OE1   . GLU D 4  76  ? -23.030 -12.699 34.954 1.00 81.35  ? 73   GLU D OE1   1 
ATOM   2641  O  OE2   . GLU D 4  76  ? -21.744 -13.233 36.699 1.00 72.97  ? 73   GLU D OE2   1 
ATOM   2642  N  N     . ALA D 4  77  ? -20.741 -11.300 30.385 1.00 64.92  ? 74   ALA D N     1 
ATOM   2643  C  CA    . ALA D 4  77  ? -21.130 -10.661 29.131 1.00 63.62  ? 74   ALA D CA    1 
ATOM   2644  C  C     . ALA D 4  77  ? -21.674 -11.695 28.164 1.00 64.32  ? 74   ALA D C     1 
ATOM   2645  O  O     . ALA D 4  77  ? -22.723 -11.509 27.552 1.00 64.07  ? 74   ALA D O     1 
ATOM   2646  C  CB    . ALA D 4  77  ? -19.940 -9.961  28.513 1.00 66.09  ? 74   ALA D CB    1 
ATOM   2647  N  N     . SER D 4  78  ? -20.938 -12.792 28.050 1.00 67.73  ? 75   SER D N     1 
ATOM   2648  C  CA    . SER D 4  78  ? -21.305 -13.915 27.213 1.00 68.21  ? 75   SER D CA    1 
ATOM   2649  C  C     . SER D 4  78  ? -22.720 -14.425 27.487 1.00 68.52  ? 75   SER D C     1 
ATOM   2650  O  O     . SER D 4  78  ? -23.540 -14.491 26.559 1.00 74.28  ? 75   SER D O     1 
ATOM   2651  C  CB    . SER D 4  78  ? -20.290 -15.027 27.410 1.00 68.52  ? 75   SER D CB    1 
ATOM   2652  O  OG    . SER D 4  78  ? -20.497 -16.060 26.481 1.00 76.19  ? 75   SER D OG    1 
ATOM   2653  N  N     . ARG D 4  79  ? -22.998 -14.777 28.747 1.00 66.15  ? 76   ARG D N     1 
ATOM   2654  C  CA    . ARG D 4  79  ? -24.317 -15.262 29.174 1.00 64.04  ? 76   ARG D CA    1 
ATOM   2655  C  C     . ARG D 4  79  ? -25.387 -14.225 28.869 1.00 67.21  ? 76   ARG D C     1 
ATOM   2656  O  O     . ARG D 4  79  ? -26.427 -14.539 28.296 1.00 76.74  ? 76   ARG D O     1 
ATOM   2657  C  CB    . ARG D 4  79  ? -24.331 -15.565 30.671 1.00 63.82  ? 76   ARG D CB    1 
ATOM   2658  C  CG    . ARG D 4  79  ? -24.024 -16.993 31.069 1.00 59.88  ? 76   ARG D CG    1 
ATOM   2659  C  CD    . ARG D 4  79  ? -23.527 -17.064 32.512 1.00 58.52  ? 76   ARG D CD    1 
ATOM   2660  N  NE    . ARG D 4  79  ? -22.073 -17.247 32.497 1.00 67.93  ? 76   ARG D NE    1 
ATOM   2661  C  CZ    . ARG D 4  79  ? -21.207 -16.666 33.330 1.00 65.00  ? 76   ARG D CZ    1 
ATOM   2662  N  NH1   . ARG D 4  79  ? -21.631 -15.847 34.288 1.00 63.22  ? 76   ARG D NH1   1 
ATOM   2663  N  NH2   . ARG D 4  79  ? -19.906 -16.901 33.194 1.00 58.71  ? 76   ARG D NH2   1 
ATOM   2664  N  N     . LEU D 4  80  ? -25.110 -12.980 29.237 1.00 69.52  ? 77   LEU D N     1 
ATOM   2665  C  CA    . LEU D 4  80  ? -26.045 -11.861 29.057 1.00 68.13  ? 77   LEU D CA    1 
ATOM   2666  C  C     . LEU D 4  80  ? -26.510 -11.686 27.621 1.00 65.69  ? 77   LEU D C     1 
ATOM   2667  O  O     . LEU D 4  80  ? -27.710 -11.533 27.360 1.00 69.72  ? 77   LEU D O     1 
ATOM   2668  C  CB    . LEU D 4  80  ? -25.381 -10.577 29.529 1.00 68.70  ? 77   LEU D CB    1 
ATOM   2669  C  CG    . LEU D 4  80  ? -26.182 -9.296  29.738 1.00 71.25  ? 77   LEU D CG    1 
ATOM   2670  C  CD1   . LEU D 4  80  ? -27.227 -9.432  30.837 1.00 68.35  ? 77   LEU D CD1   1 
ATOM   2671  C  CD2   . LEU D 4  80  ? -25.188 -8.198  30.079 1.00 79.04  ? 77   LEU D CD2   1 
ATOM   2672  N  N     . ALA D 4  81  ? -25.551 -11.691 26.703 1.00 62.17  ? 78   ALA D N     1 
ATOM   2673  C  CA    . ALA D 4  81  ? -25.839 -11.703 25.279 1.00 66.66  ? 78   ALA D CA    1 
ATOM   2674  C  C     . ALA D 4  81  ? -26.781 -12.846 24.953 1.00 71.75  ? 78   ALA D C     1 
ATOM   2675  O  O     . ALA D 4  81  ? -27.862 -12.629 24.402 1.00 71.72  ? 78   ALA D O     1 
ATOM   2676  C  CB    . ALA D 4  81  ? -24.554 -11.844 24.480 1.00 68.58  ? 78   ALA D CB    1 
ATOM   2677  N  N     . HIS D 4  82  ? -26.381 -14.068 25.310 1.00 76.85  ? 79   HIS D N     1 
ATOM   2678  C  CA    . HIS D 4  82  ? -27.204 -15.220 24.992 1.00 79.57  ? 79   HIS D CA    1 
ATOM   2679  C  C     . HIS D 4  82  ? -28.593 -14.995 25.512 1.00 77.45  ? 79   HIS D C     1 
ATOM   2680  O  O     . HIS D 4  82  ? -29.530 -15.001 24.734 1.00 78.92  ? 79   HIS D O     1 
ATOM   2681  C  CB    . HIS D 4  82  ? -26.585 -16.536 25.462 1.00 87.64  ? 79   HIS D CB    1 
ATOM   2682  C  CG    . HIS D 4  82  ? -25.465 -17.049 24.560 1.00 104.52 ? 79   HIS D CG    1 
ATOM   2683  N  ND1   . HIS D 4  82  ? -25.667 -17.390 23.260 1.00 107.58 ? 79   HIS D ND1   1 
ATOM   2684  C  CD2   . HIS D 4  82  ? -24.105 -17.283 24.821 1.00 101.59 ? 79   HIS D CD2   1 
ATOM   2685  C  CE1   . HIS D 4  82  ? -24.501 -17.813 22.720 1.00 102.36 ? 79   HIS D CE1   1 
ATOM   2686  N  NE2   . HIS D 4  82  ? -23.545 -17.747 23.675 1.00 96.68  ? 79   HIS D NE2   1 
ATOM   2687  N  N     . TYR D 4  83  ? -28.738 -14.708 26.804 1.00 75.03  ? 80   TYR D N     1 
ATOM   2688  C  CA    . TYR D 4  83  ? -30.062 -14.519 27.395 1.00 77.33  ? 80   TYR D CA    1 
ATOM   2689  C  C     . TYR D 4  83  ? -30.918 -13.556 26.591 1.00 79.01  ? 80   TYR D C     1 
ATOM   2690  O  O     . TYR D 4  83  ? -32.144 -13.666 26.594 1.00 79.66  ? 80   TYR D O     1 
ATOM   2691  C  CB    . TYR D 4  83  ? -29.974 -14.005 28.827 1.00 79.50  ? 80   TYR D CB    1 
ATOM   2692  C  CG    . TYR D 4  83  ? -29.187 -14.870 29.774 1.00 88.24  ? 80   TYR D CG    1 
ATOM   2693  C  CD1   . TYR D 4  83  ? -28.561 -14.305 30.883 1.00 89.75  ? 80   TYR D CD1   1 
ATOM   2694  C  CD2   . TYR D 4  83  ? -29.043 -16.247 29.565 1.00 89.24  ? 80   TYR D CD2   1 
ATOM   2695  C  CE1   . TYR D 4  83  ? -27.825 -15.079 31.767 1.00 87.52  ? 80   TYR D CE1   1 
ATOM   2696  C  CE2   . TYR D 4  83  ? -28.302 -17.025 30.444 1.00 86.76  ? 80   TYR D CE2   1 
ATOM   2697  C  CZ    . TYR D 4  83  ? -27.701 -16.435 31.545 1.00 86.05  ? 80   TYR D CZ    1 
ATOM   2698  O  OH    . TYR D 4  83  ? -26.971 -17.192 32.432 1.00 89.52  ? 80   TYR D OH    1 
ATOM   2699  N  N     . ASN D 4  84  ? -30.268 -12.607 25.918 1.00 82.13  ? 81   ASN D N     1 
ATOM   2700  C  CA    . ASN D 4  84  ? -30.965 -11.612 25.099 1.00 82.44  ? 81   ASN D CA    1 
ATOM   2701  C  C     . ASN D 4  84  ? -30.882 -11.886 23.596 1.00 80.88  ? 81   ASN D C     1 
ATOM   2702  O  O     . ASN D 4  84  ? -31.103 -10.988 22.788 1.00 84.32  ? 81   ASN D O     1 
ATOM   2703  C  CB    . ASN D 4  84  ? -30.452 -10.204 25.409 1.00 79.54  ? 81   ASN D CB    1 
ATOM   2704  C  CG    . ASN D 4  84  ? -30.928 -9.702  26.741 1.00 81.02  ? 81   ASN D CG    1 
ATOM   2705  O  OD1   . ASN D 4  84  ? -32.073 -9.256  26.877 1.00 79.93  ? 81   ASN D OD1   1 
ATOM   2706  N  ND2   . ASN D 4  84  ? -30.054 -9.776  27.749 1.00 83.56  ? 81   ASN D ND2   1 
ATOM   2707  N  N     . LYS D 4  85  ? -30.551 -13.122 23.229 1.00 83.65  ? 82   LYS D N     1 
ATOM   2708  C  CA    . LYS D 4  85  ? -30.514 -13.553 21.822 1.00 81.24  ? 82   LYS D CA    1 
ATOM   2709  C  C     . LYS D 4  85  ? -29.748 -12.521 20.988 1.00 78.25  ? 82   LYS D C     1 
ATOM   2710  O  O     . LYS D 4  85  ? -30.225 -12.040 19.967 1.00 81.41  ? 82   LYS D O     1 
ATOM   2711  C  CB    . LYS D 4  85  ? -31.936 -13.796 21.280 1.00 79.64  ? 82   LYS D CB    1 
ATOM   2712  C  CG    . LYS D 4  85  ? -32.691 -14.944 21.936 1.00 79.98  ? 82   LYS D CG    1 
ATOM   2713  C  CD    . LYS D 4  85  ? -34.078 -14.491 22.389 1.00 90.59  ? 82   LYS D CD    1 
ATOM   2714  C  CE    . LYS D 4  85  ? -34.750 -15.496 23.324 1.00 93.32  ? 82   LYS D CE    1 
ATOM   2715  N  NZ    . LYS D 4  85  ? -35.480 -16.561 22.575 1.00 99.85  ? 82   LYS D NZ    1 
ATOM   2716  N  N     . ARG D 4  86  ? -28.562 -12.174 21.469 1.00 79.73  ? 83   ARG D N     1 
ATOM   2717  C  CA    . ARG D 4  86  ? -27.666 -11.255 20.795 1.00 81.50  ? 83   ARG D CA    1 
ATOM   2718  C  C     . ARG D 4  86  ? -26.437 -12.030 20.408 1.00 79.65  ? 83   ARG D C     1 
ATOM   2719  O  O     . ARG D 4  86  ? -25.979 -12.891 21.160 1.00 83.58  ? 83   ARG D O     1 
ATOM   2720  C  CB    . ARG D 4  86  ? -27.230 -10.127 21.736 1.00 89.37  ? 83   ARG D CB    1 
ATOM   2721  C  CG    . ARG D 4  86  ? -28.336 -9.188  22.191 1.00 93.26  ? 83   ARG D CG    1 
ATOM   2722  C  CD    . ARG D 4  86  ? -28.645 -8.122  21.146 1.00 104.78 ? 83   ARG D CD    1 
ATOM   2723  N  NE    . ARG D 4  86  ? -29.988 -7.569  21.339 1.00 110.89 ? 83   ARG D NE    1 
ATOM   2724  C  CZ    . ARG D 4  86  ? -31.076 -7.949  20.667 1.00 104.25 ? 83   ARG D CZ    1 
ATOM   2725  N  NH1   . ARG D 4  86  ? -31.014 -8.885  19.722 1.00 113.49 ? 83   ARG D NH1   1 
ATOM   2726  N  NH2   . ARG D 4  86  ? -32.235 -7.380  20.942 1.00 97.93  ? 83   ARG D NH2   1 
ATOM   2727  N  N     . SER D 4  87  ? -25.890 -11.719 19.247 1.00 75.67  ? 84   SER D N     1 
ATOM   2728  C  CA    . SER D 4  87  ? -24.685 -12.379 18.817 1.00 74.28  ? 84   SER D CA    1 
ATOM   2729  C  C     . SER D 4  87  ? -23.456 -11.487 19.036 1.00 73.58  ? 84   SER D C     1 
ATOM   2730  O  O     . SER D 4  87  ? -22.314 -11.902 18.803 1.00 75.12  ? 84   SER D O     1 
ATOM   2731  C  CB    . SER D 4  87  ? -24.840 -12.837 17.365 1.00 75.32  ? 84   SER D CB    1 
ATOM   2732  O  OG    . SER D 4  87  ? -25.124 -11.754 16.506 1.00 80.98  ? 84   SER D OG    1 
ATOM   2733  N  N     . THR D 4  88  ? -23.687 -10.269 19.517 1.00 75.29  ? 85   THR D N     1 
ATOM   2734  C  CA    . THR D 4  88  ? -22.596 -9.288  19.640 1.00 81.51  ? 85   THR D CA    1 
ATOM   2735  C  C     . THR D 4  88  ? -22.376 -8.867  21.093 1.00 79.15  ? 85   THR D C     1 
ATOM   2736  O  O     . THR D 4  88  ? -23.335 -8.586  21.816 1.00 86.32  ? 85   THR D O     1 
ATOM   2737  C  CB    . THR D 4  88  ? -22.852 -8.009  18.795 1.00 79.49  ? 85   THR D CB    1 
ATOM   2738  O  OG1   . THR D 4  88  ? -23.446 -8.348  17.539 1.00 79.63  ? 85   THR D OG1   1 
ATOM   2739  C  CG2   . THR D 4  88  ? -21.558 -7.262  18.536 1.00 80.12  ? 85   THR D CG2   1 
ATOM   2740  N  N     . ILE D 4  89  ? -21.118 -8.828  21.519 1.00 74.30  ? 86   ILE D N     1 
ATOM   2741  C  CA    . ILE D 4  89  ? -20.786 -8.277  22.831 1.00 72.69  ? 86   ILE D CA    1 
ATOM   2742  C  C     . ILE D 4  89  ? -20.275 -6.863  22.641 1.00 74.79  ? 86   ILE D C     1 
ATOM   2743  O  O     . ILE D 4  89  ? -19.174 -6.644  22.105 1.00 77.49  ? 86   ILE D O     1 
ATOM   2744  C  CB    . ILE D 4  89  ? -19.738 -9.108  23.596 1.00 68.30  ? 86   ILE D CB    1 
ATOM   2745  C  CG1   . ILE D 4  89  ? -20.389 -10.353 24.184 1.00 68.66  ? 86   ILE D CG1   1 
ATOM   2746  C  CG2   . ILE D 4  89  ? -19.168 -8.293  24.742 1.00 71.93  ? 86   ILE D CG2   1 
ATOM   2747  C  CD1   . ILE D 4  89  ? -19.391 -11.366 24.686 1.00 66.61  ? 86   ILE D CD1   1 
ATOM   2748  N  N     . THR D 4  90  ? -21.088 -5.911  23.079 1.00 71.15  ? 87   THR D N     1 
ATOM   2749  C  CA    . THR D 4  90  ? -20.764 -4.502  22.967 1.00 69.95  ? 87   THR D CA    1 
ATOM   2750  C  C     . THR D 4  90  ? -20.312 -3.976  24.319 1.00 69.69  ? 87   THR D C     1 
ATOM   2751  O  O     . THR D 4  90  ? -20.312 -4.709  25.303 1.00 74.36  ? 87   THR D O     1 
ATOM   2752  C  CB    . THR D 4  90  ? -21.983 -3.686  22.494 1.00 73.09  ? 87   THR D CB    1 
ATOM   2753  O  OG1   . THR D 4  90  ? -22.979 -3.655  23.526 1.00 70.14  ? 87   THR D OG1   1 
ATOM   2754  C  CG2   . THR D 4  90  ? -22.582 -4.268  21.213 1.00 73.68  ? 87   THR D CG2   1 
ATOM   2755  N  N     . SER D 4  91  ? -19.932 -2.703  24.365 1.00 69.39  ? 88   SER D N     1 
ATOM   2756  C  CA    . SER D 4  91  ? -19.594 -2.044  25.620 1.00 68.29  ? 88   SER D CA    1 
ATOM   2757  C  C     . SER D 4  91  ? -20.804 -1.961  26.548 1.00 66.02  ? 88   SER D C     1 
ATOM   2758  O  O     . SER D 4  91  ? -20.648 -1.775  27.748 1.00 68.72  ? 88   SER D O     1 
ATOM   2759  C  CB    . SER D 4  91  ? -19.019 -0.651  25.368 1.00 69.46  ? 88   SER D CB    1 
ATOM   2760  O  OG    . SER D 4  91  ? -20.069 0.277   25.162 1.00 73.59  ? 88   SER D OG    1 
ATOM   2761  N  N     . ARG D 4  92  ? -22.006 -2.111  25.999 1.00 64.88  ? 89   ARG D N     1 
ATOM   2762  C  CA    . ARG D 4  92  ? -23.185 -2.168  26.843 1.00 67.85  ? 89   ARG D CA    1 
ATOM   2763  C  C     . ARG D 4  92  ? -23.226 -3.489  27.650 1.00 70.28  ? 89   ARG D C     1 
ATOM   2764  O  O     . ARG D 4  92  ? -23.550 -3.502  28.841 1.00 67.01  ? 89   ARG D O     1 
ATOM   2765  C  CB    . ARG D 4  92  ? -24.449 -1.946  26.014 1.00 68.07  ? 89   ARG D CB    1 
ATOM   2766  C  CG    . ARG D 4  92  ? -25.675 -1.698  26.873 1.00 69.49  ? 89   ARG D CG    1 
ATOM   2767  C  CD    . ARG D 4  92  ? -26.861 -1.244  26.050 1.00 76.00  ? 89   ARG D CD    1 
ATOM   2768  N  NE    . ARG D 4  92  ? -27.995 -1.009  26.931 1.00 78.57  ? 89   ARG D NE    1 
ATOM   2769  C  CZ    . ARG D 4  92  ? -28.921 -1.917  27.212 1.00 78.98  ? 89   ARG D CZ    1 
ATOM   2770  N  NH1   . ARG D 4  92  ? -28.856 -3.130  26.665 1.00 78.00  ? 89   ARG D NH1   1 
ATOM   2771  N  NH2   . ARG D 4  92  ? -29.918 -1.608  28.034 1.00 81.13  ? 89   ARG D NH2   1 
ATOM   2772  N  N     . GLU D 4  93  ? -22.873 -4.591  26.994 1.00 71.77  ? 90   GLU D N     1 
ATOM   2773  C  CA    . GLU D 4  93  ? -22.784 -5.881  27.657 1.00 70.30  ? 90   GLU D CA    1 
ATOM   2774  C  C     . GLU D 4  93  ? -21.708 -5.856  28.752 1.00 69.16  ? 90   GLU D C     1 
ATOM   2775  O  O     . GLU D 4  93  ? -21.967 -6.264  29.892 1.00 71.70  ? 90   GLU D O     1 
ATOM   2776  C  CB    . GLU D 4  93  ? -22.526 -6.997  26.641 1.00 69.98  ? 90   GLU D CB    1 
ATOM   2777  C  CG    . GLU D 4  93  ? -23.784 -7.505  25.941 1.00 76.63  ? 90   GLU D CG    1 
ATOM   2778  C  CD    . GLU D 4  93  ? -24.490 -6.452  25.104 1.00 74.58  ? 90   GLU D CD    1 
ATOM   2779  O  OE1   . GLU D 4  93  ? -25.729 -6.336  25.188 1.00 75.22  ? 90   GLU D OE1   1 
ATOM   2780  O  OE2   . GLU D 4  93  ? -23.800 -5.730  24.368 1.00 75.76  ? 90   GLU D OE2   1 
ATOM   2781  N  N     . ILE D 4  94  ? -20.522 -5.351  28.426 1.00 57.35  ? 91   ILE D N     1 
ATOM   2782  C  CA    . ILE D 4  94  ? -19.468 -5.273  29.410 1.00 59.00  ? 91   ILE D CA    1 
ATOM   2783  C  C     . ILE D 4  94  ? -19.958 -4.486  30.632 1.00 65.55  ? 91   ILE D C     1 
ATOM   2784  O  O     . ILE D 4  94  ? -19.649 -4.818  31.794 1.00 61.88  ? 91   ILE D O     1 
ATOM   2785  C  CB    . ILE D 4  94  ? -18.220 -4.591  28.832 1.00 59.23  ? 91   ILE D CB    1 
ATOM   2786  C  CG1   . ILE D 4  94  ? -17.701 -5.360  27.612 1.00 61.14  ? 91   ILE D CG1   1 
ATOM   2787  C  CG2   . ILE D 4  94  ? -17.140 -4.432  29.901 1.00 61.50  ? 91   ILE D CG2   1 
ATOM   2788  C  CD1   . ILE D 4  94  ? -16.992 -6.651  27.937 1.00 59.57  ? 91   ILE D CD1   1 
ATOM   2789  N  N     . GLN D 4  95  ? -20.735 -3.442  30.352 1.00 68.46  ? 92   GLN D N     1 
ATOM   2790  C  CA    . GLN D 4  95  ? -21.198 -2.540  31.383 1.00 65.40  ? 92   GLN D CA    1 
ATOM   2791  C  C     . GLN D 4  95  ? -22.072 -3.271  32.375 1.00 61.52  ? 92   GLN D C     1 
ATOM   2792  O  O     . GLN D 4  95  ? -21.809 -3.213  33.570 1.00 68.02  ? 92   GLN D O     1 
ATOM   2793  C  CB    . GLN D 4  95  ? -21.932 -1.323  30.799 1.00 69.12  ? 92   GLN D CB    1 
ATOM   2794  C  CG    . GLN D 4  95  ? -22.655 -0.524  31.865 1.00 66.63  ? 92   GLN D CG    1 
ATOM   2795  C  CD    . GLN D 4  95  ? -22.716 0.938   31.580 1.00 69.69  ? 92   GLN D CD    1 
ATOM   2796  O  OE1   . GLN D 4  95  ? -23.802 1.496   31.556 1.00 79.65  ? 92   GLN D OE1   1 
ATOM   2797  N  NE2   . GLN D 4  95  ? -21.559 1.582   31.383 1.00 68.67  ? 92   GLN D NE2   1 
ATOM   2798  N  N     . THR D 4  96  ? -23.093 -3.966  31.893 1.00 57.77  ? 93   THR D N     1 
ATOM   2799  C  CA    . THR D 4  96  ? -23.933 -4.760  32.784 1.00 62.19  ? 93   THR D CA    1 
ATOM   2800  C  C     . THR D 4  96  ? -23.156 -5.854  33.527 1.00 61.01  ? 93   THR D C     1 
ATOM   2801  O  O     . THR D 4  96  ? -23.400 -6.088  34.703 1.00 59.05  ? 93   THR D O     1 
ATOM   2802  C  CB    . THR D 4  96  ? -25.082 -5.413  32.030 1.00 67.74  ? 93   THR D CB    1 
ATOM   2803  O  OG1   . THR D 4  96  ? -25.685 -4.444  31.171 1.00 76.52  ? 93   THR D OG1   1 
ATOM   2804  C  CG2   . THR D 4  96  ? -26.126 -5.931  33.007 1.00 66.45  ? 93   THR D CG2   1 
ATOM   2805  N  N     . ALA D 4  97  ? -22.210 -6.494  32.841 1.00 60.70  ? 94   ALA D N     1 
ATOM   2806  C  CA    . ALA D 4  97  ? -21.362 -7.507  33.447 1.00 56.42  ? 94   ALA D CA    1 
ATOM   2807  C  C     . ALA D 4  97  ? -20.645 -6.927  34.638 1.00 57.01  ? 94   ALA D C     1 
ATOM   2808  O  O     . ALA D 4  97  ? -20.464 -7.613  35.639 1.00 62.02  ? 94   ALA D O     1 
ATOM   2809  C  CB    . ALA D 4  97  ? -20.347 -8.041  32.437 1.00 56.78  ? 94   ALA D CB    1 
ATOM   2810  N  N     . VAL D 4  98  ? -20.225 -5.669  34.522 1.00 54.95  ? 95   VAL D N     1 
ATOM   2811  C  CA    . VAL D 4  98  ? -19.472 -5.020  35.581 1.00 56.63  ? 95   VAL D CA    1 
ATOM   2812  C  C     . VAL D 4  98  ? -20.365 -4.735  36.787 1.00 58.76  ? 95   VAL D C     1 
ATOM   2813  O  O     . VAL D 4  98  ? -19.930 -4.838  37.938 1.00 54.80  ? 95   VAL D O     1 
ATOM   2814  C  CB    . VAL D 4  98  ? -18.799 -3.742  35.070 1.00 57.43  ? 95   VAL D CB    1 
ATOM   2815  C  CG1   . VAL D 4  98  ? -18.499 -2.801  36.221 1.00 59.53  ? 95   VAL D CG1   1 
ATOM   2816  C  CG2   . VAL D 4  98  ? -17.519 -4.081  34.313 1.00 56.56  ? 95   VAL D CG2   1 
ATOM   2817  N  N     . ARG D 4  99  ? -21.623 -4.411  36.501 1.00 60.87  ? 96   ARG D N     1 
ATOM   2818  C  CA    . ARG D 4  99  ? -22.591 -4.075  37.524 1.00 62.99  ? 96   ARG D CA    1 
ATOM   2819  C  C     . ARG D 4  99  ? -23.048 -5.330  38.227 1.00 61.10  ? 96   ARG D C     1 
ATOM   2820  O  O     . ARG D 4  99  ? -23.371 -5.290  39.423 1.00 60.92  ? 96   ARG D O     1 
ATOM   2821  C  CB    . ARG D 4  99  ? -23.783 -3.317  36.926 1.00 66.74  ? 96   ARG D CB    1 
ATOM   2822  C  CG    . ARG D 4  99  ? -23.528 -1.829  36.774 1.00 72.21  ? 96   ARG D CG    1 
ATOM   2823  C  CD    . ARG D 4  99  ? -24.807 -1.076  36.437 1.00 88.42  ? 96   ARG D CD    1 
ATOM   2824  N  NE    . ARG D 4  99  ? -24.558 0.364   36.265 1.00 103.43 ? 96   ARG D NE    1 
ATOM   2825  C  CZ    . ARG D 4  99  ? -24.883 1.090   35.188 1.00 102.21 ? 96   ARG D CZ    1 
ATOM   2826  N  NH1   . ARG D 4  99  ? -25.510 0.550   34.142 1.00 95.25  ? 96   ARG D NH1   1 
ATOM   2827  N  NH2   . ARG D 4  99  ? -24.590 2.383   35.168 1.00 107.34 ? 96   ARG D NH2   1 
ATOM   2828  N  N     . LEU D 4  100 ? -23.088 -6.428  37.469 1.00 59.96  ? 97   LEU D N     1 
ATOM   2829  C  CA    . LEU D 4  100 ? -23.397 -7.758  38.001 1.00 58.40  ? 97   LEU D CA    1 
ATOM   2830  C  C     . LEU D 4  100 ? -22.259 -8.329  38.837 1.00 60.29  ? 97   LEU D C     1 
ATOM   2831  O  O     . LEU D 4  100 ? -22.494 -8.807  39.946 1.00 66.40  ? 97   LEU D O     1 
ATOM   2832  C  CB    . LEU D 4  100 ? -23.766 -8.723  36.889 1.00 49.40  ? 97   LEU D CB    1 
ATOM   2833  C  CG    . LEU D 4  100 ? -25.196 -8.499  36.390 1.00 50.84  ? 97   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D 4  100 ? -25.389 -9.220  35.059 1.00 52.27  ? 97   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D 4  100 ? -26.256 -8.929  37.411 1.00 49.95  ? 97   LEU D CD2   1 
ATOM   2836  N  N     . LEU D 4  101 ? -21.038 -8.219  38.331 1.00 58.24  ? 98   LEU D N     1 
ATOM   2837  C  CA    . LEU D 4  101 ? -19.877 -8.805  38.967 1.00 58.28  ? 98   LEU D CA    1 
ATOM   2838  C  C     . LEU D 4  101 ? -19.305 -8.041  40.177 1.00 55.08  ? 98   LEU D C     1 
ATOM   2839  O  O     . LEU D 4  101 ? -18.974 -8.659  41.195 1.00 54.30  ? 98   LEU D O     1 
ATOM   2840  C  CB    . LEU D 4  101 ? -18.797 -9.043  37.917 1.00 62.16  ? 98   LEU D CB    1 
ATOM   2841  C  CG    . LEU D 4  101 ? -17.545 -9.762  38.410 1.00 71.71  ? 98   LEU D CG    1 
ATOM   2842  C  CD1   . LEU D 4  101 ? -17.807 -11.258 38.502 1.00 74.83  ? 98   LEU D CD1   1 
ATOM   2843  C  CD2   . LEU D 4  101 ? -16.346 -9.488  37.514 1.00 73.86  ? 98   LEU D CD2   1 
ATOM   2844  N  N     . LEU D 4  102 ? -19.178 -6.720  40.081 1.00 53.11  ? 99   LEU D N     1 
ATOM   2845  C  CA    . LEU D 4  102 ? -18.448 -5.969  41.104 1.00 51.14  ? 99   LEU D CA    1 
ATOM   2846  C  C     . LEU D 4  102 ? -19.365 -5.487  42.229 1.00 55.25  ? 99   LEU D C     1 
ATOM   2847  O  O     . LEU D 4  102 ? -20.566 -5.364  42.036 1.00 60.44  ? 99   LEU D O     1 
ATOM   2848  C  CB    . LEU D 4  102 ? -17.695 -4.796  40.479 1.00 53.32  ? 99   LEU D CB    1 
ATOM   2849  C  CG    . LEU D 4  102 ? -16.720 -5.004  39.307 1.00 51.37  ? 99   LEU D CG    1 
ATOM   2850  C  CD1   . LEU D 4  102 ? -15.861 -3.775  39.078 1.00 53.87  ? 99   LEU D CD1   1 
ATOM   2851  C  CD2   . LEU D 4  102 ? -15.817 -6.170  39.579 1.00 48.93  ? 99   LEU D CD2   1 
ATOM   2852  N  N     . PRO D 4  103 ? -18.811 -5.249  43.426 1.00 55.52  ? 100  PRO D N     1 
ATOM   2853  C  CA    . PRO D 4  103 ? -19.627 -4.683  44.486 1.00 55.92  ? 100  PRO D CA    1 
ATOM   2854  C  C     . PRO D 4  103 ? -19.715 -3.157  44.420 1.00 62.68  ? 100  PRO D C     1 
ATOM   2855  O  O     . PRO D 4  103 ? -18.752 -2.487  43.996 1.00 58.56  ? 100  PRO D O     1 
ATOM   2856  C  CB    . PRO D 4  103 ? -18.904 -5.116  45.772 1.00 56.39  ? 100  PRO D CB    1 
ATOM   2857  C  CG    . PRO D 4  103 ? -17.500 -5.415  45.381 1.00 54.89  ? 100  PRO D CG    1 
ATOM   2858  C  CD    . PRO D 4  103 ? -17.459 -5.621  43.889 1.00 57.79  ? 100  PRO D CD    1 
ATOM   2859  N  N     . GLY D 4  104 ? -20.866 -2.643  44.871 1.00 65.45  ? 101  GLY D N     1 
ATOM   2860  C  CA    . GLY D 4  104 ? -21.207 -1.216  44.914 1.00 64.43  ? 101  GLY D CA    1 
ATOM   2861  C  C     . GLY D 4  104 ? -20.235 -0.164  44.409 1.00 64.94  ? 101  GLY D C     1 
ATOM   2862  O  O     . GLY D 4  104 ? -20.271 0.233   43.237 1.00 68.81  ? 101  GLY D O     1 
ATOM   2863  N  N     . GLU D 4  105 ? -19.371 0.307   45.294 1.00 62.46  ? 102  GLU D N     1 
ATOM   2864  C  CA    . GLU D 4  105 ? -18.530 1.431   44.953 1.00 65.34  ? 102  GLU D CA    1 
ATOM   2865  C  C     . GLU D 4  105 ? -17.517 1.123   43.844 1.00 67.83  ? 102  GLU D C     1 
ATOM   2866  O  O     . GLU D 4  105 ? -17.255 1.988   43.024 1.00 80.70  ? 102  GLU D O     1 
ATOM   2867  C  CB    . GLU D 4  105 ? -17.856 2.001   46.205 1.00 72.46  ? 102  GLU D CB    1 
ATOM   2868  C  CG    . GLU D 4  105 ? -17.709 3.525   46.219 1.00 80.23  ? 102  GLU D CG    1 
ATOM   2869  C  CD    . GLU D 4  105 ? -19.045 4.256   46.120 1.00 86.10  ? 102  GLU D CD    1 
ATOM   2870  O  OE1   . GLU D 4  105 ? -19.999 3.901   46.850 1.00 83.86  ? 102  GLU D OE1   1 
ATOM   2871  O  OE2   . GLU D 4  105 ? -19.140 5.197   45.303 1.00 93.25  ? 102  GLU D OE2   1 
ATOM   2872  N  N     . LEU D 4  106 ? -16.962 -0.091  43.796 1.00 65.73  ? 103  LEU D N     1 
ATOM   2873  C  CA    . LEU D 4  106 ? -16.051 -0.453  42.705 1.00 63.22  ? 103  LEU D CA    1 
ATOM   2874  C  C     . LEU D 4  106 ? -16.784 -0.437  41.362 1.00 69.18  ? 103  LEU D C     1 
ATOM   2875  O  O     . LEU D 4  106 ? -16.229 -0.007  40.343 1.00 70.28  ? 103  LEU D O     1 
ATOM   2876  C  CB    . LEU D 4  106 ? -15.394 -1.822  42.925 1.00 61.26  ? 103  LEU D CB    1 
ATOM   2877  C  CG    . LEU D 4  106 ? -14.228 -1.993  43.914 1.00 58.86  ? 103  LEU D CG    1 
ATOM   2878  C  CD1   . LEU D 4  106 ? -13.900 -3.468  44.119 1.00 55.66  ? 103  LEU D CD1   1 
ATOM   2879  C  CD2   . LEU D 4  106 ? -12.984 -1.225  43.492 1.00 50.94  ? 103  LEU D CD2   1 
ATOM   2880  N  N     . ALA D 4  107 ? -18.037 -0.889  41.374 1.00 67.81  ? 104  ALA D N     1 
ATOM   2881  C  CA    . ALA D 4  107 ? -18.869 -0.901  40.184 1.00 65.17  ? 104  ALA D CA    1 
ATOM   2882  C  C     . ALA D 4  107 ? -19.144 0.525   39.672 1.00 73.45  ? 104  ALA D C     1 
ATOM   2883  O  O     . ALA D 4  107 ? -18.946 0.827   38.479 1.00 73.99  ? 104  ALA D O     1 
ATOM   2884  C  CB    . ALA D 4  107 ? -20.153 -1.635  40.479 1.00 59.09  ? 104  ALA D CB    1 
ATOM   2885  N  N     . LYS D 4  108 ? -19.570 1.399   40.587 1.00 75.61  ? 105  LYS D N     1 
ATOM   2886  C  CA    . LYS D 4  108 ? -19.823 2.804   40.272 1.00 72.24  ? 105  LYS D CA    1 
ATOM   2887  C  C     . LYS D 4  108 ? -18.619 3.405   39.569 1.00 67.96  ? 105  LYS D C     1 
ATOM   2888  O  O     . LYS D 4  108 ? -18.750 3.933   38.465 1.00 73.10  ? 105  LYS D O     1 
ATOM   2889  C  CB    . LYS D 4  108 ? -20.148 3.600   41.538 1.00 79.24  ? 105  LYS D CB    1 
ATOM   2890  C  CG    . LYS D 4  108 ? -21.228 4.674   41.367 1.00 91.43  ? 105  LYS D CG    1 
ATOM   2891  C  CD    . LYS D 4  108 ? -21.393 5.558   42.611 1.00 97.67  ? 105  LYS D CD    1 
ATOM   2892  C  CE    . LYS D 4  108 ? -22.099 4.820   43.752 1.00 105.85 ? 105  LYS D CE    1 
ATOM   2893  N  NZ    . LYS D 4  108 ? -22.014 5.516   45.071 1.00 100.48 ? 105  LYS D NZ    1 
ATOM   2894  N  N     . HIS D 4  109 ? -17.450 3.289   40.186 1.00 62.70  ? 106  HIS D N     1 
ATOM   2895  C  CA    . HIS D 4  109 ? -16.248 3.898   39.643 1.00 64.77  ? 106  HIS D CA    1 
ATOM   2896  C  C     . HIS D 4  109 ? -15.733 3.249   38.387 1.00 64.16  ? 106  HIS D C     1 
ATOM   2897  O  O     . HIS D 4  109 ? -15.213 3.941   37.514 1.00 65.85  ? 106  HIS D O     1 
ATOM   2898  C  CB    . HIS D 4  109 ? -15.162 3.951   40.695 1.00 70.85  ? 106  HIS D CB    1 
ATOM   2899  C  CG    . HIS D 4  109 ? -15.400 4.985   41.767 1.00 78.57  ? 106  HIS D CG    1 
ATOM   2900  N  ND1   . HIS D 4  109 ? -16.448 4.924   42.615 1.00 81.65  ? 106  HIS D ND1   1 
ATOM   2901  C  CD2   . HIS D 4  109 ? -14.672 6.120   42.120 1.00 83.02  ? 106  HIS D CD2   1 
ATOM   2902  C  CE1   . HIS D 4  109 ? -16.401 5.969   43.470 1.00 86.46  ? 106  HIS D CE1   1 
ATOM   2903  N  NE2   . HIS D 4  109 ? -15.313 6.701   43.166 1.00 93.68  ? 106  HIS D NE2   1 
ATOM   2904  N  N     . ALA D 4  110 ? -15.874 1.927   38.271 1.00 61.72  ? 107  ALA D N     1 
ATOM   2905  C  CA    . ALA D 4  110 ? -15.393 1.203   37.089 1.00 57.31  ? 107  ALA D CA    1 
ATOM   2906  C  C     . ALA D 4  110 ? -16.239 1.604   35.904 1.00 58.90  ? 107  ALA D C     1 
ATOM   2907  O  O     . ALA D 4  110 ? -15.738 1.767   34.792 1.00 59.75  ? 107  ALA D O     1 
ATOM   2908  C  CB    . ALA D 4  110 ? -15.467 -0.304  37.302 1.00 54.26  ? 107  ALA D CB    1 
ATOM   2909  N  N     . VAL D 4  111 ? -17.533 1.778   36.159 1.00 58.65  ? 108  VAL D N     1 
ATOM   2910  C  CA    . VAL D 4  111 ? -18.458 2.248   35.140 1.00 64.43  ? 108  VAL D CA    1 
ATOM   2911  C  C     . VAL D 4  111 ? -18.143 3.652   34.614 1.00 68.27  ? 108  VAL D C     1 
ATOM   2912  O  O     . VAL D 4  111 ? -18.201 3.884   33.407 1.00 71.43  ? 108  VAL D O     1 
ATOM   2913  C  CB    . VAL D 4  111 ? -19.905 2.152   35.604 1.00 64.66  ? 108  VAL D CB    1 
ATOM   2914  C  CG1   . VAL D 4  111 ? -20.829 2.758   34.563 1.00 64.55  ? 108  VAL D CG1   1 
ATOM   2915  C  CG2   . VAL D 4  111 ? -20.260 0.692   35.812 1.00 66.68  ? 108  VAL D CG2   1 
ATOM   2916  N  N     . SER D 4  112 ? -17.788 4.580   35.500 1.00 68.54  ? 109  SER D N     1 
ATOM   2917  C  CA    . SER D 4  112 ? -17.234 5.859   35.050 1.00 69.21  ? 109  SER D CA    1 
ATOM   2918  C  C     . SER D 4  112 ? -16.104 5.662   34.045 1.00 69.22  ? 109  SER D C     1 
ATOM   2919  O  O     . SER D 4  112 ? -16.176 6.160   32.912 1.00 69.30  ? 109  SER D O     1 
ATOM   2920  C  CB    . SER D 4  112 ? -16.713 6.686   36.216 1.00 65.80  ? 109  SER D CB    1 
ATOM   2921  O  OG    . SER D 4  112 ? -17.744 6.937   37.139 1.00 75.94  ? 109  SER D OG    1 
ATOM   2922  N  N     . GLU D 4  113 ? -15.083 4.914   34.458 1.00 65.84  ? 110  GLU D N     1 
ATOM   2923  C  CA    . GLU D 4  113 ? -13.807 4.911   33.757 1.00 69.64  ? 110  GLU D CA    1 
ATOM   2924  C  C     . GLU D 4  113 ? -13.932 4.259   32.383 1.00 72.14  ? 110  GLU D C     1 
ATOM   2925  O  O     . GLU D 4  113 ? -13.238 4.631   31.434 1.00 74.51  ? 110  GLU D O     1 
ATOM   2926  C  CB    . GLU D 4  113 ? -12.746 4.230   34.614 1.00 70.88  ? 110  GLU D CB    1 
ATOM   2927  C  CG    . GLU D 4  113 ? -12.421 4.968   35.906 1.00 70.18  ? 110  GLU D CG    1 
ATOM   2928  C  CD    . GLU D 4  113 ? -11.079 5.663   35.850 1.00 77.31  ? 110  GLU D CD    1 
ATOM   2929  O  OE1   . GLU D 4  113 ? -10.983 6.718   35.190 1.00 86.12  ? 110  GLU D OE1   1 
ATOM   2930  O  OE2   . GLU D 4  113 ? -10.110 5.156   36.460 1.00 81.11  ? 110  GLU D OE2   1 
ATOM   2931  N  N     . GLY D 4  114 ? -14.850 3.310   32.280 1.00 67.34  ? 111  GLY D N     1 
ATOM   2932  C  CA    . GLY D 4  114 ? -15.090 2.629   31.032 1.00 69.18  ? 111  GLY D CA    1 
ATOM   2933  C  C     . GLY D 4  114 ? -15.937 3.477   30.118 1.00 72.55  ? 111  GLY D C     1 
ATOM   2934  O  O     . GLY D 4  114 ? -15.691 3.541   28.914 1.00 77.70  ? 111  GLY D O     1 
ATOM   2935  N  N     . THR D 4  115 ? -16.952 4.119   30.685 1.00 72.34  ? 112  THR D N     1 
ATOM   2936  C  CA    . THR D 4  115 ? -17.764 5.065   29.921 1.00 77.50  ? 112  THR D CA    1 
ATOM   2937  C  C     . THR D 4  115 ? -16.865 6.190   29.375 1.00 79.56  ? 112  THR D C     1 
ATOM   2938  O  O     . THR D 4  115 ? -16.878 6.502   28.176 1.00 76.44  ? 112  THR D O     1 
ATOM   2939  C  CB    . THR D 4  115 ? -18.886 5.685   30.778 1.00 71.23  ? 112  THR D CB    1 
ATOM   2940  O  OG1   . THR D 4  115 ? -19.544 4.658   31.520 1.00 77.71  ? 112  THR D OG1   1 
ATOM   2941  C  CG2   . THR D 4  115 ? -19.911 6.355   29.899 1.00 71.40  ? 112  THR D CG2   1 
ATOM   2942  N  N     . LYS D 4  116 ? -16.082 6.772   30.276 1.00 75.03  ? 113  LYS D N     1 
ATOM   2943  C  CA    . LYS D 4  116 ? -15.111 7.791   29.941 1.00 76.63  ? 113  LYS D CA    1 
ATOM   2944  C  C     . LYS D 4  116 ? -14.216 7.366   28.780 1.00 72.77  ? 113  LYS D C     1 
ATOM   2945  O  O     . LYS D 4  116 ? -13.964 8.161   27.876 1.00 80.15  ? 113  LYS D O     1 
ATOM   2946  C  CB    . LYS D 4  116 ? -14.279 8.103   31.187 1.00 81.28  ? 113  LYS D CB    1 
ATOM   2947  C  CG    . LYS D 4  116 ? -13.203 9.169   31.067 1.00 74.67  ? 113  LYS D CG    1 
ATOM   2948  C  CD    . LYS D 4  116 ? -13.028 9.776   32.451 1.00 80.90  ? 113  LYS D CD    1 
ATOM   2949  C  CE    . LYS D 4  116 ? -11.629 10.318  32.664 1.00 93.67  ? 113  LYS D CE    1 
ATOM   2950  N  NZ    . LYS D 4  116 ? -10.597 9.248   32.576 1.00 90.36  ? 113  LYS D NZ    1 
ATOM   2951  N  N     . ALA D 4  117 ? -13.752 6.123   28.801 1.00 65.28  ? 114  ALA D N     1 
ATOM   2952  C  CA    . ALA D 4  117 ? -12.818 5.659   27.795 1.00 71.36  ? 114  ALA D CA    1 
ATOM   2953  C  C     . ALA D 4  117 ? -13.498 5.456   26.438 1.00 76.82  ? 114  ALA D C     1 
ATOM   2954  O  O     . ALA D 4  117 ? -12.873 5.650   25.384 1.00 75.39  ? 114  ALA D O     1 
ATOM   2955  C  CB    . ALA D 4  117 ? -12.140 4.381   28.255 1.00 71.63  ? 114  ALA D CB    1 
ATOM   2956  N  N     . VAL D 4  118 ? -14.770 5.062   26.467 1.00 76.64  ? 115  VAL D N     1 
ATOM   2957  C  CA    . VAL D 4  118 ? -15.502 4.812   25.229 1.00 79.09  ? 115  VAL D CA    1 
ATOM   2958  C  C     . VAL D 4  118 ? -15.862 6.130   24.563 1.00 80.22  ? 115  VAL D C     1 
ATOM   2959  O  O     . VAL D 4  118 ? -15.552 6.327   23.389 1.00 89.82  ? 115  VAL D O     1 
ATOM   2960  C  CB    . VAL D 4  118 ? -16.726 3.897   25.440 1.00 80.46  ? 115  VAL D CB    1 
ATOM   2961  C  CG1   . VAL D 4  118 ? -17.574 3.801   24.178 1.00 73.30  ? 115  VAL D CG1   1 
ATOM   2962  C  CG2   . VAL D 4  118 ? -16.255 2.508   25.835 1.00 79.67  ? 115  VAL D CG2   1 
ATOM   2963  N  N     . THR D 4  119 ? -16.494 7.027   25.318 1.00 78.45  ? 116  THR D N     1 
ATOM   2964  C  CA    . THR D 4  119 ? -16.726 8.404   24.881 1.00 73.93  ? 116  THR D CA    1 
ATOM   2965  C  C     . THR D 4  119 ? -15.481 9.036   24.265 1.00 75.78  ? 116  THR D C     1 
ATOM   2966  O  O     . THR D 4  119 ? -15.510 9.525   23.134 1.00 82.78  ? 116  THR D O     1 
ATOM   2967  C  CB    . THR D 4  119 ? -17.136 9.284   26.049 1.00 72.26  ? 116  THR D CB    1 
ATOM   2968  O  OG1   . THR D 4  119 ? -18.226 8.672   26.750 1.00 81.94  ? 116  THR D OG1   1 
ATOM   2969  C  CG2   . THR D 4  119 ? -17.580 10.614  25.529 1.00 82.11  ? 116  THR D CG2   1 
ATOM   2970  N  N     . LYS D 4  120 ? -14.385 9.018   25.011 1.00 73.78  ? 117  LYS D N     1 
ATOM   2971  C  CA    . LYS D 4  120 ? -13.113 9.515   24.502 1.00 73.60  ? 117  LYS D CA    1 
ATOM   2972  C  C     . LYS D 4  120 ? -12.562 8.677   23.330 1.00 75.38  ? 117  LYS D C     1 
ATOM   2973  O  O     . LYS D 4  120 ? -11.732 9.150   22.565 1.00 84.23  ? 117  LYS D O     1 
ATOM   2974  C  CB    . LYS D 4  120 ? -12.082 9.692   25.645 1.00 67.52  ? 117  LYS D CB    1 
ATOM   2975  C  CG    . LYS D 4  120 ? -10.630 9.607   25.201 1.00 71.24  ? 117  LYS D CG    1 
ATOM   2976  C  CD    . LYS D 4  120 ? -9.717  10.610  25.901 1.00 75.65  ? 117  LYS D CD    1 
ATOM   2977  C  CE    . LYS D 4  120 ? -8.271  10.423  25.427 1.00 83.51  ? 117  LYS D CE    1 
ATOM   2978  N  NZ    . LYS D 4  120 ? -7.393  11.633  25.494 1.00 81.04  ? 117  LYS D NZ    1 
ATOM   2979  N  N     . TYR D 4  121 ? -13.012 7.439   23.183 1.00 79.07  ? 118  TYR D N     1 
ATOM   2980  C  CA    . TYR D 4  121 ? -12.551 6.630   22.060 1.00 82.88  ? 118  TYR D CA    1 
ATOM   2981  C  C     . TYR D 4  121 ? -13.309 6.999   20.783 1.00 88.79  ? 118  TYR D C     1 
ATOM   2982  O  O     . TYR D 4  121 ? -12.711 7.097   19.705 1.00 80.15  ? 118  TYR D O     1 
ATOM   2983  C  CB    . TYR D 4  121 ? -12.737 5.149   22.357 1.00 79.94  ? 118  TYR D CB    1 
ATOM   2984  C  CG    . TYR D 4  121 ? -12.235 4.246   21.259 1.00 80.17  ? 118  TYR D CG    1 
ATOM   2985  C  CD1   . TYR D 4  121 ? -10.866 4.014   21.104 1.00 79.46  ? 118  TYR D CD1   1 
ATOM   2986  C  CD2   . TYR D 4  121 ? -13.123 3.607   20.385 1.00 74.02  ? 118  TYR D CD2   1 
ATOM   2987  C  CE1   . TYR D 4  121 ? -10.391 3.173   20.108 1.00 80.40  ? 118  TYR D CE1   1 
ATOM   2988  C  CE2   . TYR D 4  121 ? -12.656 2.765   19.387 1.00 73.11  ? 118  TYR D CE2   1 
ATOM   2989  C  CZ    . TYR D 4  121 ? -11.290 2.557   19.256 1.00 77.64  ? 118  TYR D CZ    1 
ATOM   2990  O  OH    . TYR D 4  121 ? -10.788 1.731   18.285 1.00 84.27  ? 118  TYR D OH    1 
ATOM   2991  N  N     . THR D 4  122 ? -14.624 7.187   20.930 1.00 91.44  ? 119  THR D N     1 
ATOM   2992  C  CA    . THR D 4  122 ? -15.533 7.539   19.840 1.00 96.89  ? 119  THR D CA    1 
ATOM   2993  C  C     . THR D 4  122 ? -15.159 8.877   19.209 1.00 102.01 ? 119  THR D C     1 
ATOM   2994  O  O     . THR D 4  122 ? -15.045 8.985   17.980 1.00 114.02 ? 119  THR D O     1 
ATOM   2995  C  CB    . THR D 4  122 ? -16.993 7.630   20.333 1.00 100.45 ? 119  THR D CB    1 
ATOM   2996  O  OG1   . THR D 4  122 ? -17.255 6.577   21.270 1.00 97.77  ? 119  THR D OG1   1 
ATOM   2997  C  CG2   . THR D 4  122 ? -17.966 7.519   19.155 1.00 102.81 ? 119  THR D CG2   1 
ATOM   2998  N  N     . SER D 4  123 ? -14.966 9.893   20.049 1.00 97.40  ? 120  SER D N     1 
ATOM   2999  C  CA    . SER D 4  123 ? -14.589 11.227  19.573 1.00 100.83 ? 120  SER D CA    1 
ATOM   3000  C  C     . SER D 4  123 ? -13.153 11.302  19.011 1.00 103.76 ? 120  SER D C     1 
ATOM   3001  O  O     . SER D 4  123 ? -12.806 12.268  18.322 1.00 101.81 ? 120  SER D O     1 
ATOM   3002  C  CB    . SER D 4  123 ? -14.781 12.271  20.677 1.00 93.42  ? 120  SER D CB    1 
ATOM   3003  O  OG    . SER D 4  123 ? -13.557 12.518  21.348 1.00 91.77  ? 120  SER D OG    1 
ATOM   3004  N  N     . ALA D 4  124 ? -12.332 10.289  19.295 1.00 99.54  ? 121  ALA D N     1 
ATOM   3005  C  CA    . ALA D 4  124 ? -10.935 10.307  18.867 1.00 108.78 ? 121  ALA D CA    1 
ATOM   3006  C  C     . ALA D 4  124 ? -10.659 9.619   17.511 1.00 121.92 ? 121  ALA D C     1 
ATOM   3007  O  O     . ALA D 4  124 ? -9.799  8.727   17.406 1.00 127.15 ? 121  ALA D O     1 
ATOM   3008  C  CB    . ALA D 4  124 ? -10.021 9.780   19.969 1.00 100.74 ? 121  ALA D CB    1 
ATOM   3009  N  N     . LYS D 4  125 ? -11.406 10.040  16.486 1.00 127.36 ? 122  LYS D N     1 
ATOM   3010  C  CA    . LYS D 4  125 ? -11.052 9.797   15.072 1.00 136.76 ? 122  LYS D CA    1 
ATOM   3011  C  C     . LYS D 4  125 ? -11.847 10.718  14.136 1.00 148.53 ? 122  LYS D C     1 
ATOM   3012  O  O     . LYS D 4  125 ? -11.317 11.252  13.153 1.00 143.57 ? 122  LYS D O     1 
ATOM   3013  C  CB    . LYS D 4  125 ? -11.225 8.326   14.659 1.00 131.02 ? 122  LYS D CB    1 
ATOM   3014  C  CG    . LYS D 4  125 ? -10.465 7.944   13.389 1.00 122.64 ? 122  LYS D CG    1 
ATOM   3015  C  CD    . LYS D 4  125 ? -10.490 6.442   13.168 1.00 119.89 ? 122  LYS D CD    1 
ATOM   3016  C  CE    . LYS D 4  125 ? -9.542  6.021   12.059 1.00 118.80 ? 122  LYS D CE    1 
ATOM   3017  N  NZ    . LYS D 4  125 ? -9.327  4.544   12.100 1.00 123.43 ? 122  LYS D NZ    1 
ATOM   3018  O  OXT   . LYS D 4  125 ? -13.044 10.944  14.346 1.00 151.76 ? 122  LYS D OXT   1 
ATOM   3019  N  N     . PRO E 1  38  ? 15.068  -22.013 87.522 1.00 129.75 ? 38   PRO E N     1 
ATOM   3020  C  CA    . PRO E 1  38  ? 13.909  -22.714 86.972 1.00 122.81 ? 38   PRO E CA    1 
ATOM   3021  C  C     . PRO E 1  38  ? 12.779  -21.731 86.644 1.00 120.31 ? 38   PRO E C     1 
ATOM   3022  O  O     . PRO E 1  38  ? 12.289  -21.034 87.535 1.00 126.93 ? 38   PRO E O     1 
ATOM   3023  C  CB    . PRO E 1  38  ? 13.503  -23.654 88.119 1.00 114.96 ? 38   PRO E CB    1 
ATOM   3024  C  CG    . PRO E 1  38  ? 14.023  -23.003 89.376 1.00 118.00 ? 38   PRO E CG    1 
ATOM   3025  C  CD    . PRO E 1  38  ? 15.018  -21.930 88.996 1.00 127.38 ? 38   PRO E CD    1 
ATOM   3026  N  N     . HIS E 1  39  ? 12.372  -21.661 85.382 1.00 113.71 ? 39   HIS E N     1 
ATOM   3027  C  CA    . HIS E 1  39  ? 11.366  -20.666 84.973 1.00 121.63 ? 39   HIS E CA    1 
ATOM   3028  C  C     . HIS E 1  39  ? 10.358  -21.186 83.964 1.00 124.98 ? 39   HIS E C     1 
ATOM   3029  O  O     . HIS E 1  39  ? 10.707  -22.006 83.094 1.00 123.96 ? 39   HIS E O     1 
ATOM   3030  C  CB    . HIS E 1  39  ? 12.063  -19.410 84.460 1.00 125.54 ? 39   HIS E CB    1 
ATOM   3031  C  CG    . HIS E 1  39  ? 11.133  -18.419 83.812 1.00 127.52 ? 39   HIS E CG    1 
ATOM   3032  N  ND1   . HIS E 1  39  ? 10.809  -18.478 82.503 1.00 131.24 ? 39   HIS E ND1   1 
ATOM   3033  C  CD2   . HIS E 1  39  ? 10.454  -17.325 84.341 1.00 131.63 ? 39   HIS E CD2   1 
ATOM   3034  C  CE1   . HIS E 1  39  ? 9.968   -17.470 82.207 1.00 139.47 ? 39   HIS E CE1   1 
ATOM   3035  N  NE2   . HIS E 1  39  ? 9.750   -16.764 83.333 1.00 139.71 ? 39   HIS E NE2   1 
ATOM   3036  N  N     . ARG E 1  40  ? 9.109   -20.699 84.066 1.00 109.38 ? 40   ARG E N     1 
ATOM   3037  C  CA    . ARG E 1  40  ? 7.975   -21.207 83.264 1.00 96.87  ? 40   ARG E CA    1 
ATOM   3038  C  C     . ARG E 1  40  ? 6.948   -20.164 82.832 1.00 90.18  ? 40   ARG E C     1 
ATOM   3039  O  O     . ARG E 1  40  ? 6.462   -19.387 83.652 1.00 93.18  ? 40   ARG E O     1 
ATOM   3040  C  CB    . ARG E 1  40  ? 7.221   -22.306 84.032 1.00 91.93  ? 40   ARG E CB    1 
ATOM   3041  C  CG    . ARG E 1  40  ? 7.812   -23.684 83.844 1.00 92.50  ? 40   ARG E CG    1 
ATOM   3042  C  CD    . ARG E 1  40  ? 6.833   -24.827 84.057 1.00 84.16  ? 40   ARG E CD    1 
ATOM   3043  N  NE    . ARG E 1  40  ? 7.507   -26.033 83.592 1.00 88.73  ? 40   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E 1  40  ? 7.082   -26.806 82.608 1.00 84.71  ? 40   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E 1  40  ? 5.934   -26.536 82.015 1.00 77.23  ? 40   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E 1  40  ? 7.794   -27.874 82.258 1.00 91.07  ? 40   ARG E NH2   1 
ATOM   3047  N  N     . TYR E 1  41  ? 6.575   -20.178 81.555 1.00 82.10  ? 41   TYR E N     1 
ATOM   3048  C  CA    . TYR E 1  41  ? 5.368   -19.452 81.146 1.00 76.72  ? 41   TYR E CA    1 
ATOM   3049  C  C     . TYR E 1  41  ? 4.097   -20.242 81.473 1.00 71.93  ? 41   TYR E C     1 
ATOM   3050  O  O     . TYR E 1  41  ? 4.082   -21.469 81.388 1.00 70.54  ? 41   TYR E O     1 
ATOM   3051  C  CB    . TYR E 1  41  ? 5.426   -19.087 79.664 1.00 68.91  ? 41   TYR E CB    1 
ATOM   3052  C  CG    . TYR E 1  41  ? 6.505   -18.083 79.370 1.00 67.48  ? 41   TYR E CG    1 
ATOM   3053  C  CD1   . TYR E 1  41  ? 7.644   -18.443 78.663 1.00 65.56  ? 41   TYR E CD1   1 
ATOM   3054  C  CD2   . TYR E 1  41  ? 6.400   -16.771 79.836 1.00 68.75  ? 41   TYR E CD2   1 
ATOM   3055  C  CE1   . TYR E 1  41  ? 8.646   -17.522 78.422 1.00 68.44  ? 41   TYR E CE1   1 
ATOM   3056  C  CE2   . TYR E 1  41  ? 7.393   -15.842 79.596 1.00 67.63  ? 41   TYR E CE2   1 
ATOM   3057  C  CZ    . TYR E 1  41  ? 8.511   -16.218 78.887 1.00 69.44  ? 41   TYR E CZ    1 
ATOM   3058  O  OH    . TYR E 1  41  ? 9.494   -15.282 78.642 1.00 76.85  ? 41   TYR E OH    1 
ATOM   3059  N  N     . ARG E 1  42  ? 3.042   -19.535 81.857 1.00 69.05  ? 42   ARG E N     1 
ATOM   3060  C  CA    . ARG E 1  42  ? 1.749   -20.170 82.095 1.00 71.66  ? 42   ARG E CA    1 
ATOM   3061  C  C     . ARG E 1  42  ? 1.133   -20.708 80.798 1.00 74.00  ? 42   ARG E C     1 
ATOM   3062  O  O     . ARG E 1  42  ? 1.257   -20.077 79.745 1.00 77.84  ? 42   ARG E O     1 
ATOM   3063  C  CB    . ARG E 1  42  ? 0.805   -19.183 82.756 1.00 74.95  ? 42   ARG E CB    1 
ATOM   3064  C  CG    . ARG E 1  42  ? 1.301   -18.709 84.111 1.00 83.11  ? 42   ARG E CG    1 
ATOM   3065  C  CD    . ARG E 1  42  ? 0.768   -17.318 84.414 1.00 96.35  ? 42   ARG E CD    1 
ATOM   3066  N  NE    . ARG E 1  42  ? -0.315  -17.320 85.397 1.00 97.79  ? 42   ARG E NE    1 
ATOM   3067  C  CZ    . ARG E 1  42  ? -0.124  -17.313 86.716 1.00 105.73 ? 42   ARG E CZ    1 
ATOM   3068  N  NH1   . ARG E 1  42  ? 1.110   -17.316 87.226 1.00 96.21  ? 42   ARG E NH1   1 
ATOM   3069  N  NH2   . ARG E 1  42  ? -1.175  -17.309 87.529 1.00 108.06 ? 42   ARG E NH2   1 
ATOM   3070  N  N     . PRO E 1  43  ? 0.478   -21.886 80.857 1.00 72.70  ? 43   PRO E N     1 
ATOM   3071  C  CA    . PRO E 1  43  ? -0.127  -22.380 79.637 1.00 70.36  ? 43   PRO E CA    1 
ATOM   3072  C  C     . PRO E 1  43  ? -0.987  -21.303 78.977 1.00 69.59  ? 43   PRO E C     1 
ATOM   3073  O  O     . PRO E 1  43  ? -1.815  -20.658 79.639 1.00 67.61  ? 43   PRO E O     1 
ATOM   3074  C  CB    . PRO E 1  43  ? -0.999  -23.549 80.131 1.00 73.34  ? 43   PRO E CB    1 
ATOM   3075  C  CG    . PRO E 1  43  ? -1.045  -23.446 81.619 1.00 66.37  ? 43   PRO E CG    1 
ATOM   3076  C  CD    . PRO E 1  43  ? 0.262   -22.823 81.973 1.00 70.44  ? 43   PRO E CD    1 
ATOM   3077  N  N     . GLY E 1  44  ? -0.778  -21.110 77.681 1.00 68.63  ? 44   GLY E N     1 
ATOM   3078  C  CA    . GLY E 1  44  ? -1.555  -20.131 76.927 1.00 65.94  ? 44   GLY E CA    1 
ATOM   3079  C  C     . GLY E 1  44  ? -0.723  -18.937 76.520 1.00 67.21  ? 44   GLY E C     1 
ATOM   3080  O  O     . GLY E 1  44  ? -1.113  -18.176 75.631 1.00 66.74  ? 44   GLY E O     1 
ATOM   3081  N  N     . THR E 1  45  ? 0.418   -18.762 77.184 1.00 66.95  ? 45   THR E N     1 
ATOM   3082  C  CA    . THR E 1  45  ? 1.255   -17.595 76.953 1.00 63.51  ? 45   THR E CA    1 
ATOM   3083  C  C     . THR E 1  45  ? 2.126   -17.840 75.732 1.00 63.52  ? 45   THR E C     1 
ATOM   3084  O  O     . THR E 1  45  ? 2.237   -16.966 74.869 1.00 64.76  ? 45   THR E O     1 
ATOM   3085  C  CB    . THR E 1  45  ? 2.073   -17.207 78.208 1.00 62.19  ? 45   THR E CB    1 
ATOM   3086  O  OG1   . THR E 1  45  ? 1.168   -16.921 79.269 1.00 61.47  ? 45   THR E OG1   1 
ATOM   3087  C  CG2   . THR E 1  45  ? 2.900   -15.957 77.976 1.00 58.82  ? 45   THR E CG2   1 
ATOM   3088  N  N     . VAL E 1  46  ? 2.732   -19.021 75.633 1.00 61.76  ? 46   VAL E N     1 
ATOM   3089  C  CA    . VAL E 1  46  ? 3.482   -19.319 74.416 1.00 61.70  ? 46   VAL E CA    1 
ATOM   3090  C  C     . VAL E 1  46  ? 2.485   -19.432 73.266 1.00 63.84  ? 46   VAL E C     1 
ATOM   3091  O  O     . VAL E 1  46  ? 2.781   -18.985 72.156 1.00 62.73  ? 46   VAL E O     1 
ATOM   3092  C  CB    . VAL E 1  46  ? 4.351   -20.588 74.513 1.00 60.08  ? 46   VAL E CB    1 
ATOM   3093  C  CG1   . VAL E 1  46  ? 5.320   -20.675 73.328 1.00 52.85  ? 46   VAL E CG1   1 
ATOM   3094  C  CG2   . VAL E 1  46  ? 5.118   -20.592 75.822 1.00 60.17  ? 46   VAL E CG2   1 
ATOM   3095  N  N     . ALA E 1  47  ? 1.293   -19.980 73.538 1.00 60.97  ? 47   ALA E N     1 
ATOM   3096  C  CA    . ALA E 1  47  ? 0.312   -20.202 72.464 1.00 59.53  ? 47   ALA E CA    1 
ATOM   3097  C  C     . ALA E 1  47  ? -0.018  -18.889 71.758 1.00 63.98  ? 47   ALA E C     1 
ATOM   3098  O  O     . ALA E 1  47  ? 0.099   -18.809 70.519 1.00 67.43  ? 47   ALA E O     1 
ATOM   3099  C  CB    . ALA E 1  47  ? -0.945  -20.915 72.951 1.00 50.44  ? 47   ALA E CB    1 
ATOM   3100  N  N     . LEU E 1  48  ? -0.387  -17.864 72.539 1.00 61.95  ? 48   LEU E N     1 
ATOM   3101  C  CA    . LEU E 1  48  ? -0.623  -16.499 72.014 1.00 58.28  ? 48   LEU E CA    1 
ATOM   3102  C  C     . LEU E 1  48  ? 0.619   -15.903 71.345 1.00 61.07  ? 48   LEU E C     1 
ATOM   3103  O  O     . LEU E 1  48  ? 0.516   -15.250 70.303 1.00 60.38  ? 48   LEU E O     1 
ATOM   3104  C  CB    . LEU E 1  48  ? -1.094  -15.564 73.105 1.00 52.41  ? 48   LEU E CB    1 
ATOM   3105  C  CG    . LEU E 1  48  ? -2.477  -15.825 73.660 1.00 57.59  ? 48   LEU E CG    1 
ATOM   3106  C  CD1   . LEU E 1  48  ? -2.602  -15.128 74.999 1.00 56.58  ? 48   LEU E CD1   1 
ATOM   3107  C  CD2   . LEU E 1  48  ? -3.546  -15.313 72.704 1.00 60.88  ? 48   LEU E CD2   1 
ATOM   3108  N  N     . ARG E 1  49  ? 1.791   -16.142 71.934 1.00 58.95  ? 49   ARG E N     1 
ATOM   3109  C  CA    . ARG E 1  49  ? 3.040   -15.738 71.316 1.00 60.17  ? 49   ARG E CA    1 
ATOM   3110  C  C     . ARG E 1  49  ? 3.088   -16.294 69.893 1.00 59.28  ? 49   ARG E C     1 
ATOM   3111  O  O     . ARG E 1  49  ? 3.449   -15.595 68.946 1.00 61.36  ? 49   ARG E O     1 
ATOM   3112  C  CB    . ARG E 1  49  ? 4.228   -16.262 72.133 1.00 61.78  ? 49   ARG E CB    1 
ATOM   3113  C  CG    . ARG E 1  49  ? 5.484   -15.408 72.020 1.00 65.92  ? 49   ARG E CG    1 
ATOM   3114  C  CD    . ARG E 1  49  ? 6.792   -16.197 72.073 1.00 69.25  ? 49   ARG E CD    1 
ATOM   3115  N  NE    . ARG E 1  49  ? 7.260   -16.670 73.392 1.00 65.95  ? 49   ARG E NE    1 
ATOM   3116  C  CZ    . ARG E 1  49  ? 6.806   -16.275 74.585 1.00 70.28  ? 49   ARG E CZ    1 
ATOM   3117  N  NH1   . ARG E 1  49  ? 5.839   -15.354 74.712 1.00 72.60  ? 49   ARG E NH1   1 
ATOM   3118  N  NH2   . ARG E 1  49  ? 7.343   -16.804 75.672 1.00 64.01  ? 49   ARG E NH2   1 
ATOM   3119  N  N     . GLU E 1  50  ? 2.688   -17.555 69.752 1.00 60.62  ? 50   GLU E N     1 
ATOM   3120  C  CA    . GLU E 1  50  ? 2.808   -18.263 68.483 1.00 61.50  ? 50   GLU E CA    1 
ATOM   3121  C  C     . GLU E 1  50  ? 1.813   -17.733 67.461 1.00 59.60  ? 50   GLU E C     1 
ATOM   3122  O  O     . GLU E 1  50  ? 2.175   -17.504 66.298 1.00 53.96  ? 50   GLU E O     1 
ATOM   3123  C  CB    . GLU E 1  50  ? 2.667   -19.765 68.694 1.00 60.63  ? 50   GLU E CB    1 
ATOM   3124  C  CG    . GLU E 1  50  ? 3.948   -20.408 69.191 1.00 63.74  ? 50   GLU E CG    1 
ATOM   3125  C  CD    . GLU E 1  50  ? 3.752   -21.834 69.667 1.00 75.23  ? 50   GLU E CD    1 
ATOM   3126  O  OE1   . GLU E 1  50  ? 4.711   -22.370 70.264 1.00 80.43  ? 50   GLU E OE1   1 
ATOM   3127  O  OE2   . GLU E 1  50  ? 2.658   -22.424 69.454 1.00 78.88  ? 50   GLU E OE2   1 
ATOM   3128  N  N     . ILE E 1  51  ? 0.571   -17.527 67.914 1.00 56.72  ? 51   ILE E N     1 
ATOM   3129  C  CA    . ILE E 1  51  ? -0.464  -16.921 67.089 1.00 53.04  ? 51   ILE E CA    1 
ATOM   3130  C  C     . ILE E 1  51  ? 0.052   -15.604 66.489 1.00 55.72  ? 51   ILE E C     1 
ATOM   3131  O  O     . ILE E 1  51  ? -0.079  -15.397 65.284 1.00 57.55  ? 51   ILE E O     1 
ATOM   3132  C  CB    . ILE E 1  51  ? -1.766  -16.689 67.873 1.00 51.88  ? 51   ILE E CB    1 
ATOM   3133  C  CG1   . ILE E 1  51  ? -2.310  -18.004 68.431 1.00 52.20  ? 51   ILE E CG1   1 
ATOM   3134  C  CG2   . ILE E 1  51  ? -2.821  -16.020 67.004 1.00 50.04  ? 51   ILE E CG2   1 
ATOM   3135  C  CD1   . ILE E 1  51  ? -3.727  -17.905 68.991 1.00 49.90  ? 51   ILE E CD1   1 
ATOM   3136  N  N     . ARG E 1  52  ? 0.674   -14.739 67.302 1.00 54.74  ? 52   ARG E N     1 
ATOM   3137  C  CA    . ARG E 1  52  ? 1.162   -13.437 66.799 1.00 54.71  ? 52   ARG E CA    1 
ATOM   3138  C  C     . ARG E 1  52  ? 2.266   -13.645 65.783 1.00 57.59  ? 52   ARG E C     1 
ATOM   3139  O  O     . ARG E 1  52  ? 2.313   -12.983 64.745 1.00 57.85  ? 52   ARG E O     1 
ATOM   3140  C  CB    . ARG E 1  52  ? 1.615   -12.508 67.936 1.00 53.62  ? 52   ARG E CB    1 
ATOM   3141  C  CG    . ARG E 1  52  ? 0.485   -12.167 68.918 1.00 56.40  ? 52   ARG E CG    1 
ATOM   3142  C  CD    . ARG E 1  52  ? 0.887   -11.215 70.016 1.00 56.98  ? 52   ARG E CD    1 
ATOM   3143  N  NE    . ARG E 1  52  ? 0.525   -11.755 71.333 1.00 63.39  ? 52   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E 1  52  ? -0.639  -11.550 71.967 1.00 63.40  ? 52   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E 1  52  ? -1.605  -10.813 71.437 1.00 65.02  ? 52   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E 1  52  ? -0.842  -12.076 73.158 1.00 61.81  ? 52   ARG E NH2   1 
ATOM   3147  N  N     . ARG E 1  53  ? 3.129   -14.605 66.081 1.00 60.28  ? 53   ARG E N     1 
ATOM   3148  C  CA    . ARG E 1  53  ? 4.231   -14.947 65.214 1.00 58.76  ? 53   ARG E CA    1 
ATOM   3149  C  C     . ARG E 1  53  ? 3.735   -15.448 63.858 1.00 64.03  ? 53   ARG E C     1 
ATOM   3150  O  O     . ARG E 1  53  ? 4.131   -14.931 62.802 1.00 66.28  ? 53   ARG E O     1 
ATOM   3151  C  CB    . ARG E 1  53  ? 5.114   -16.008 65.879 1.00 54.40  ? 53   ARG E CB    1 
ATOM   3152  C  CG    . ARG E 1  53  ? 6.316   -16.358 65.026 1.00 57.54  ? 53   ARG E CG    1 
ATOM   3153  C  CD    . ARG E 1  53  ? 7.086   -17.573 65.512 1.00 63.21  ? 53   ARG E CD    1 
ATOM   3154  N  NE    . ARG E 1  53  ? 7.997   -17.985 64.440 1.00 74.58  ? 53   ARG E NE    1 
ATOM   3155  C  CZ    . ARG E 1  53  ? 8.889   -18.973 64.518 1.00 76.48  ? 53   ARG E CZ    1 
ATOM   3156  N  NH1   . ARG E 1  53  ? 9.008   -19.699 65.634 1.00 68.13  ? 53   ARG E NH1   1 
ATOM   3157  N  NH2   . ARG E 1  53  ? 9.661   -19.232 63.466 1.00 71.98  ? 53   ARG E NH2   1 
ATOM   3158  N  N     . TYR E 1  54  ? 2.858   -16.448 63.887 1.00 59.17  ? 54   TYR E N     1 
ATOM   3159  C  CA    . TYR E 1  54  ? 2.448   -17.085 62.652 1.00 55.84  ? 54   TYR E CA    1 
ATOM   3160  C  C     . TYR E 1  54  ? 1.483   -16.225 61.821 1.00 55.16  ? 54   TYR E C     1 
ATOM   3161  O  O     . TYR E 1  54  ? 1.501   -16.296 60.571 1.00 54.60  ? 54   TYR E O     1 
ATOM   3162  C  CB    . TYR E 1  54  ? 1.969   -18.522 62.910 1.00 53.94  ? 54   TYR E CB    1 
ATOM   3163  C  CG    . TYR E 1  54  ? 3.141   -19.382 63.278 1.00 52.23  ? 54   TYR E CG    1 
ATOM   3164  C  CD1   . TYR E 1  54  ? 3.247   -19.985 64.547 1.00 55.14  ? 54   TYR E CD1   1 
ATOM   3165  C  CD2   . TYR E 1  54  ? 4.179   -19.543 62.385 1.00 49.54  ? 54   TYR E CD2   1 
ATOM   3166  C  CE1   . TYR E 1  54  ? 4.361   -20.746 64.886 1.00 53.87  ? 54   TYR E CE1   1 
ATOM   3167  C  CE2   . TYR E 1  54  ? 5.294   -20.287 62.709 1.00 54.57  ? 54   TYR E CE2   1 
ATOM   3168  C  CZ    . TYR E 1  54  ? 5.388   -20.886 63.952 1.00 55.45  ? 54   TYR E CZ    1 
ATOM   3169  O  OH    . TYR E 1  54  ? 6.523   -21.620 64.218 1.00 56.04  ? 54   TYR E OH    1 
ATOM   3170  N  N     . GLN E 1  55  ? 0.690   -15.393 62.506 1.00 49.28  ? 55   GLN E N     1 
ATOM   3171  C  CA    . GLN E 1  55  ? -0.204  -14.461 61.812 1.00 52.15  ? 55   GLN E CA    1 
ATOM   3172  C  C     . GLN E 1  55  ? 0.547   -13.307 61.140 1.00 57.17  ? 55   GLN E C     1 
ATOM   3173  O  O     . GLN E 1  55  ? 0.016   -12.627 60.266 1.00 58.91  ? 55   GLN E O     1 
ATOM   3174  C  CB    . GLN E 1  55  ? -1.290  -13.945 62.732 1.00 48.49  ? 55   GLN E CB    1 
ATOM   3175  C  CG    . GLN E 1  55  ? -2.395  -14.949 62.938 1.00 50.25  ? 55   GLN E CG    1 
ATOM   3176  C  CD    . GLN E 1  55  ? -3.547  -14.397 63.733 1.00 53.28  ? 55   GLN E CD    1 
ATOM   3177  O  OE1   . GLN E 1  55  ? -3.449  -13.323 64.335 1.00 55.34  ? 55   GLN E OE1   1 
ATOM   3178  N  NE2   . GLN E 1  55  ? -4.655  -15.127 63.744 1.00 52.44  ? 55   GLN E NE2   1 
ATOM   3179  N  N     . LYS E 1  56  ? 1.805   -13.129 61.531 1.00 58.92  ? 56   LYS E N     1 
ATOM   3180  C  CA    . LYS E 1  56  ? 2.646   -12.061 61.043 1.00 56.55  ? 56   LYS E CA    1 
ATOM   3181  C  C     . LYS E 1  56  ? 3.397   -12.517 59.820 1.00 59.69  ? 56   LYS E C     1 
ATOM   3182  O  O     . LYS E 1  56  ? 3.745   -11.691 58.974 1.00 59.32  ? 56   LYS E O     1 
ATOM   3183  C  CB    . LYS E 1  56  ? 3.651   -11.740 62.128 1.00 65.50  ? 56   LYS E CB    1 
ATOM   3184  C  CG    . LYS E 1  56  ? 4.430   -10.447 62.032 1.00 65.97  ? 56   LYS E CG    1 
ATOM   3185  C  CD    . LYS E 1  56  ? 4.877   -10.136 63.457 1.00 75.92  ? 56   LYS E CD    1 
ATOM   3186  C  CE    . LYS E 1  56  ? 6.073   -9.202  63.581 1.00 81.71  ? 56   LYS E CE    1 
ATOM   3187  N  NZ    . LYS E 1  56  ? 6.120   -8.778  65.021 1.00 85.80  ? 56   LYS E NZ    1 
ATOM   3188  N  N     . SER E 1  57  ? 3.675   -13.819 59.717 1.00 57.84  ? 57   SER E N     1 
ATOM   3189  C  CA    . SER E 1  57  ? 4.463   -14.288 58.581 1.00 57.78  ? 57   SER E CA    1 
ATOM   3190  C  C     . SER E 1  57  ? 3.632   -14.946 57.482 1.00 60.11  ? 57   SER E C     1 
ATOM   3191  O  O     . SER E 1  57  ? 2.409   -15.154 57.641 1.00 60.60  ? 57   SER E O     1 
ATOM   3192  C  CB    . SER E 1  57  ? 5.565   -15.214 59.054 1.00 59.45  ? 57   SER E CB    1 
ATOM   3193  O  OG    . SER E 1  57  ? 4.994   -16.251 59.830 1.00 63.24  ? 57   SER E OG    1 
ATOM   3194  N  N     . THR E 1  58  ? 4.305   -15.286 56.381 1.00 56.58  ? 58   THR E N     1 
ATOM   3195  C  CA    . THR E 1  58  ? 3.656   -15.987 55.289 1.00 53.00  ? 58   THR E CA    1 
ATOM   3196  C  C     . THR E 1  58  ? 4.337   -17.298 54.837 1.00 56.08  ? 58   THR E C     1 
ATOM   3197  O  O     . THR E 1  58  ? 3.971   -17.822 53.771 1.00 55.51  ? 58   THR E O     1 
ATOM   3198  C  CB    . THR E 1  58  ? 3.556   -15.096 54.039 1.00 50.84  ? 58   THR E CB    1 
ATOM   3199  O  OG1   . THR E 1  58  ? 4.854   -14.918 53.495 1.00 50.16  ? 58   THR E OG1   1 
ATOM   3200  C  CG2   . THR E 1  58  ? 2.946   -13.745 54.359 1.00 52.01  ? 58   THR E CG2   1 
ATOM   3201  N  N     . GLU E 1  59  ? 5.313   -17.839 55.582 1.00 53.01  ? 59   GLU E N     1 
ATOM   3202  C  CA    . GLU E 1  59  ? 5.988   -19.036 55.050 1.00 53.72  ? 59   GLU E CA    1 
ATOM   3203  C  C     . GLU E 1  59  ? 5.084   -20.224 55.195 1.00 57.01  ? 59   GLU E C     1 
ATOM   3204  O  O     . GLU E 1  59  ? 4.274   -20.251 56.126 1.00 58.37  ? 59   GLU E O     1 
ATOM   3205  C  CB    . GLU E 1  59  ? 7.347   -19.355 55.654 1.00 51.05  ? 59   GLU E CB    1 
ATOM   3206  C  CG    . GLU E 1  59  ? 7.785   -18.525 56.812 1.00 63.81  ? 59   GLU E CG    1 
ATOM   3207  C  CD    . GLU E 1  59  ? 7.120   -18.900 58.100 1.00 69.08  ? 59   GLU E CD    1 
ATOM   3208  O  OE1   . GLU E 1  59  ? 7.653   -19.773 58.798 1.00 72.38  ? 59   GLU E OE1   1 
ATOM   3209  O  OE2   . GLU E 1  59  ? 6.084   -18.291 58.430 1.00 79.64  ? 59   GLU E OE2   1 
ATOM   3210  N  N     . LEU E 1  60  ? 5.209   -21.190 54.276 1.00 53.38  ? 60   LEU E N     1 
ATOM   3211  C  CA    . LEU E 1  60  ? 4.516   -22.469 54.442 1.00 54.28  ? 60   LEU E CA    1 
ATOM   3212  C  C     . LEU E 1  60  ? 4.893   -23.145 55.775 1.00 53.16  ? 60   LEU E C     1 
ATOM   3213  O  O     . LEU E 1  60  ? 6.038   -23.083 56.221 1.00 53.00  ? 60   LEU E O     1 
ATOM   3214  C  CB    . LEU E 1  60  ? 4.757   -23.399 53.258 1.00 52.68  ? 60   LEU E CB    1 
ATOM   3215  C  CG    . LEU E 1  60  ? 4.215   -22.814 51.961 1.00 54.67  ? 60   LEU E CG    1 
ATOM   3216  C  CD1   . LEU E 1  60  ? 4.655   -23.678 50.800 1.00 53.77  ? 60   LEU E CD1   1 
ATOM   3217  C  CD2   . LEU E 1  60  ? 2.698   -22.589 51.987 1.00 53.02  ? 60   LEU E CD2   1 
ATOM   3218  N  N     . LEU E 1  61  ? 3.917   -23.764 56.422 1.00 50.54  ? 61   LEU E N     1 
ATOM   3219  C  CA    . LEU E 1  61  ? 4.136   -24.289 57.755 1.00 51.90  ? 61   LEU E CA    1 
ATOM   3220  C  C     . LEU E 1  61  ? 4.301   -25.838 57.782 1.00 56.30  ? 61   LEU E C     1 
ATOM   3221  O  O     . LEU E 1  61  ? 4.792   -26.419 58.750 1.00 56.70  ? 61   LEU E O     1 
ATOM   3222  C  CB    . LEU E 1  61  ? 3.024   -23.791 58.674 1.00 54.98  ? 61   LEU E CB    1 
ATOM   3223  C  CG    . LEU E 1  61  ? 2.824   -22.261 58.776 1.00 52.77  ? 61   LEU E CG    1 
ATOM   3224  C  CD1   . LEU E 1  61  ? 1.521   -21.912 59.477 1.00 46.48  ? 61   LEU E CD1   1 
ATOM   3225  C  CD2   . LEU E 1  61  ? 4.005   -21.621 59.492 1.00 51.25  ? 61   LEU E CD2   1 
ATOM   3226  N  N     . ILE E 1  62  ? 3.914   -26.505 56.702 1.00 53.45  ? 62   ILE E N     1 
ATOM   3227  C  CA    . ILE E 1  62  ? 4.196   -27.910 56.543 1.00 51.72  ? 62   ILE E CA    1 
ATOM   3228  C  C     . ILE E 1  62  ? 5.553   -28.069 55.830 1.00 56.87  ? 62   ILE E C     1 
ATOM   3229  O  O     . ILE E 1  62  ? 5.808   -27.348 54.869 1.00 56.22  ? 62   ILE E O     1 
ATOM   3230  C  CB    . ILE E 1  62  ? 3.083   -28.590 55.729 1.00 49.79  ? 62   ILE E CB    1 
ATOM   3231  C  CG1   . ILE E 1  62  ? 1.730   -28.415 56.427 1.00 49.45  ? 62   ILE E CG1   1 
ATOM   3232  C  CG2   . ILE E 1  62  ? 3.413   -30.064 55.472 1.00 49.84  ? 62   ILE E CG2   1 
ATOM   3233  C  CD1   . ILE E 1  62  ? 0.539   -28.908 55.634 1.00 47.05  ? 62   ILE E CD1   1 
ATOM   3234  N  N     . ARG E 1  63  ? 6.400   -29.004 56.304 1.00 57.18  ? 63   ARG E N     1 
ATOM   3235  C  CA    . ARG E 1  63  ? 7.709   -29.315 55.711 1.00 52.30  ? 63   ARG E CA    1 
ATOM   3236  C  C     . ARG E 1  63  ? 7.537   -29.767 54.262 1.00 51.49  ? 63   ARG E C     1 
ATOM   3237  O  O     . ARG E 1  63  ? 6.603   -30.484 53.946 1.00 50.61  ? 63   ARG E O     1 
ATOM   3238  C  CB    . ARG E 1  63  ? 8.420   -30.425 56.497 1.00 57.29  ? 63   ARG E CB    1 
ATOM   3239  C  CG    . ARG E 1  63  ? 8.713   -30.198 57.980 1.00 61.01  ? 63   ARG E CG    1 
ATOM   3240  C  CD    . ARG E 1  63  ? 9.956   -29.359 58.232 1.00 65.46  ? 63   ARG E CD    1 
ATOM   3241  N  NE    . ARG E 1  63  ? 9.564   -27.993 58.613 1.00 79.36  ? 63   ARG E NE    1 
ATOM   3242  C  CZ    . ARG E 1  63  ? 9.857   -26.873 57.939 1.00 74.82  ? 63   ARG E CZ    1 
ATOM   3243  N  NH1   . ARG E 1  63  ? 10.590  -26.929 56.834 1.00 81.27  ? 63   ARG E NH1   1 
ATOM   3244  N  NH2   . ARG E 1  63  ? 9.428   -25.683 58.381 1.00 65.57  ? 63   ARG E NH2   1 
ATOM   3245  N  N     . LYS E 1  64  ? 8.446   -29.352 53.384 1.00 52.69  ? 64   LYS E N     1 
ATOM   3246  C  CA    . LYS E 1  64  ? 8.266   -29.543 51.941 1.00 55.31  ? 64   LYS E CA    1 
ATOM   3247  C  C     . LYS E 1  64  ? 8.193   -30.998 51.521 1.00 55.32  ? 64   LYS E C     1 
ATOM   3248  O  O     . LYS E 1  64  ? 7.177   -31.420 50.979 1.00 58.69  ? 64   LYS E O     1 
ATOM   3249  C  CB    . LYS E 1  64  ? 9.353   -28.838 51.133 1.00 58.71  ? 64   LYS E CB    1 
ATOM   3250  C  CG    . LYS E 1  64  ? 9.120   -27.363 50.948 1.00 64.65  ? 64   LYS E CG    1 
ATOM   3251  C  CD    . LYS E 1  64  ? 10.149  -26.786 49.980 1.00 75.49  ? 64   LYS E CD    1 
ATOM   3252  C  CE    . LYS E 1  64  ? 10.216  -25.250 50.070 1.00 80.29  ? 64   LYS E CE    1 
ATOM   3253  N  NZ    . LYS E 1  64  ? 8.905   -24.573 50.358 1.00 72.57  ? 64   LYS E NZ    1 
ATOM   3254  N  N     . LEU E 1  65  ? 9.264   -31.745 51.784 1.00 57.20  ? 65   LEU E N     1 
ATOM   3255  C  CA    . LEU E 1  65  ? 9.390   -33.143 51.376 1.00 57.12  ? 65   LEU E CA    1 
ATOM   3256  C  C     . LEU E 1  65  ? 8.257   -34.027 51.878 1.00 54.32  ? 65   LEU E C     1 
ATOM   3257  O  O     . LEU E 1  65  ? 7.651   -34.718 51.075 1.00 57.51  ? 65   LEU E O     1 
ATOM   3258  C  CB    . LEU E 1  65  ? 10.751  -33.735 51.787 1.00 57.65  ? 65   LEU E CB    1 
ATOM   3259  C  CG    . LEU E 1  65  ? 11.102  -35.155 51.334 1.00 54.46  ? 65   LEU E CG    1 
ATOM   3260  C  CD1   . LEU E 1  65  ? 11.028  -35.323 49.811 1.00 53.61  ? 65   LEU E CD1   1 
ATOM   3261  C  CD2   . LEU E 1  65  ? 12.491  -35.424 51.873 1.00 54.67  ? 65   LEU E CD2   1 
ATOM   3262  N  N     . PRO E 1  66  ? 7.970   -34.014 53.195 1.00 50.63  ? 66   PRO E N     1 
ATOM   3263  C  CA    . PRO E 1  66  ? 6.853   -34.833 53.654 1.00 51.04  ? 66   PRO E CA    1 
ATOM   3264  C  C     . PRO E 1  66  ? 5.627   -34.560 52.823 1.00 50.78  ? 66   PRO E C     1 
ATOM   3265  O  O     . PRO E 1  66  ? 5.039   -35.490 52.293 1.00 54.81  ? 66   PRO E O     1 
ATOM   3266  C  CB    . PRO E 1  66  ? 6.622   -34.364 55.095 1.00 52.84  ? 66   PRO E CB    1 
ATOM   3267  C  CG    . PRO E 1  66  ? 7.964   -33.868 55.512 1.00 54.24  ? 66   PRO E CG    1 
ATOM   3268  C  CD    . PRO E 1  66  ? 8.539   -33.212 54.285 1.00 49.57  ? 66   PRO E CD    1 
ATOM   3269  N  N     . PHE E 1  67  ? 5.279   -33.287 52.663 1.00 54.89  ? 67   PHE E N     1 
ATOM   3270  C  CA    . PHE E 1  67  ? 4.104   -32.909 51.890 1.00 51.52  ? 67   PHE E CA    1 
ATOM   3271  C  C     . PHE E 1  67  ? 4.225   -33.463 50.471 1.00 50.43  ? 67   PHE E C     1 
ATOM   3272  O  O     . PHE E 1  67  ? 3.238   -33.940 49.903 1.00 52.40  ? 67   PHE E O     1 
ATOM   3273  C  CB    . PHE E 1  67  ? 3.877   -31.381 51.879 1.00 47.46  ? 67   PHE E CB    1 
ATOM   3274  C  CG    . PHE E 1  67  ? 2.645   -30.970 51.110 1.00 43.16  ? 67   PHE E CG    1 
ATOM   3275  C  CD1   . PHE E 1  67  ? 1.433   -30.838 51.757 1.00 43.65  ? 67   PHE E CD1   1 
ATOM   3276  C  CD2   . PHE E 1  67  ? 2.689   -30.777 49.737 1.00 39.15  ? 67   PHE E CD2   1 
ATOM   3277  C  CE1   . PHE E 1  67  ? 0.277   -30.501 51.064 1.00 39.55  ? 67   PHE E CE1   1 
ATOM   3278  C  CE2   . PHE E 1  67  ? 1.553   -30.455 49.050 1.00 40.66  ? 67   PHE E CE2   1 
ATOM   3279  C  CZ    . PHE E 1  67  ? 0.336   -30.301 49.719 1.00 40.27  ? 67   PHE E CZ    1 
ATOM   3280  N  N     . GLN E 1  68  ? 5.426   -33.399 49.905 1.00 50.52  ? 68   GLN E N     1 
ATOM   3281  C  CA    . GLN E 1  68  ? 5.655   -33.883 48.536 1.00 56.18  ? 68   GLN E CA    1 
ATOM   3282  C  C     . GLN E 1  68  ? 5.383   -35.395 48.383 1.00 57.67  ? 68   GLN E C     1 
ATOM   3283  O  O     . GLN E 1  68  ? 4.775   -35.828 47.395 1.00 56.48  ? 68   GLN E O     1 
ATOM   3284  C  CB    . GLN E 1  68  ? 7.062   -33.543 48.063 1.00 54.52  ? 68   GLN E CB    1 
ATOM   3285  C  CG    . GLN E 1  68  ? 7.143   -33.427 46.559 1.00 65.93  ? 68   GLN E CG    1 
ATOM   3286  C  CD    . GLN E 1  68  ? 8.562   -33.228 46.047 1.00 79.05  ? 68   GLN E CD    1 
ATOM   3287  O  OE1   . GLN E 1  68  ? 9.549   -33.575 46.724 1.00 82.76  ? 68   GLN E OE1   1 
ATOM   3288  N  NE2   . GLN E 1  68  ? 8.675   -32.667 44.837 1.00 73.87  ? 68   GLN E NE2   1 
ATOM   3289  N  N     . ARG E 1  69  ? 5.816   -36.186 49.370 1.00 56.17  ? 69   ARG E N     1 
ATOM   3290  C  CA    . ARG E 1  69  ? 5.585   -37.623 49.354 1.00 55.42  ? 69   ARG E CA    1 
ATOM   3291  C  C     . ARG E 1  69  ? 4.098   -37.895 49.379 1.00 54.97  ? 69   ARG E C     1 
ATOM   3292  O  O     . ARG E 1  69  ? 3.589   -38.680 48.578 1.00 55.93  ? 69   ARG E O     1 
ATOM   3293  C  CB    . ARG E 1  69  ? 6.204   -38.284 50.556 1.00 55.13  ? 69   ARG E CB    1 
ATOM   3294  C  CG    . ARG E 1  69  ? 7.680   -38.560 50.472 1.00 52.24  ? 69   ARG E CG    1 
ATOM   3295  C  CD    . ARG E 1  69  ? 8.057   -39.247 51.777 1.00 52.90  ? 69   ARG E CD    1 
ATOM   3296  N  NE    . ARG E 1  69  ? 9.247   -38.649 52.367 1.00 56.91  ? 69   ARG E NE    1 
ATOM   3297  C  CZ    . ARG E 1  69  ? 9.333   -38.230 53.627 1.00 56.03  ? 69   ARG E CZ    1 
ATOM   3298  N  NH1   . ARG E 1  69  ? 8.298   -38.344 54.454 1.00 48.22  ? 69   ARG E NH1   1 
ATOM   3299  N  NH2   . ARG E 1  69  ? 10.476  -37.701 54.052 1.00 61.80  ? 69   ARG E NH2   1 
ATOM   3300  N  N     . LEU E 1  70  ? 3.412   -37.213 50.291 1.00 52.99  ? 70   LEU E N     1 
ATOM   3301  C  CA    . LEU E 1  70  ? 1.952   -37.310 50.423 1.00 51.48  ? 70   LEU E CA    1 
ATOM   3302  C  C     . LEU E 1  70  ? 1.209   -37.041 49.135 1.00 48.05  ? 70   LEU E C     1 
ATOM   3303  O  O     . LEU E 1  70  ? 0.223   -37.701 48.862 1.00 48.98  ? 70   LEU E O     1 
ATOM   3304  C  CB    . LEU E 1  70  ? 1.414   -36.390 51.534 1.00 48.15  ? 70   LEU E CB    1 
ATOM   3305  C  CG    . LEU E 1  70  ? -0.086  -36.532 51.838 1.00 50.29  ? 70   LEU E CG    1 
ATOM   3306  C  CD1   . LEU E 1  70  ? -0.518  -37.971 52.155 1.00 50.15  ? 70   LEU E CD1   1 
ATOM   3307  C  CD2   . LEU E 1  70  ? -0.468  -35.589 52.963 1.00 49.40  ? 70   LEU E CD2   1 
ATOM   3308  N  N     . VAL E 1  71  ? 1.663   -36.061 48.366 1.00 47.98  ? 71   VAL E N     1 
ATOM   3309  C  CA    . VAL E 1  71  ? 1.032   -35.756 47.095 1.00 49.57  ? 71   VAL E CA    1 
ATOM   3310  C  C     . VAL E 1  71  ? 1.280   -36.943 46.172 1.00 49.70  ? 71   VAL E C     1 
ATOM   3311  O  O     . VAL E 1  71  ? 0.335   -37.520 45.625 1.00 49.99  ? 71   VAL E O     1 
ATOM   3312  C  CB    . VAL E 1  71  ? 1.559   -34.418 46.509 1.00 48.07  ? 71   VAL E CB    1 
ATOM   3313  C  CG1   . VAL E 1  71  ? 1.169   -34.230 45.053 1.00 46.10  ? 71   VAL E CG1   1 
ATOM   3314  C  CG2   . VAL E 1  71  ? 1.051   -33.259 47.344 1.00 47.94  ? 71   VAL E CG2   1 
ATOM   3315  N  N     . ARG E 1  72  ? 2.544   -37.334 46.057 1.00 49.54  ? 72   ARG E N     1 
ATOM   3316  C  CA    . ARG E 1  72  ? 2.943   -38.355 45.090 1.00 54.55  ? 72   ARG E CA    1 
ATOM   3317  C  C     . ARG E 1  72  ? 2.241   -39.695 45.358 1.00 53.56  ? 72   ARG E C     1 
ATOM   3318  O  O     . ARG E 1  72  ? 1.840   -40.393 44.412 1.00 54.80  ? 72   ARG E O     1 
ATOM   3319  C  CB    . ARG E 1  72  ? 4.460   -38.508 45.080 1.00 55.00  ? 72   ARG E CB    1 
ATOM   3320  C  CG    . ARG E 1  72  ? 5.194   -37.324 44.469 1.00 54.43  ? 72   ARG E CG    1 
ATOM   3321  C  CD    . ARG E 1  72  ? 6.675   -37.600 44.497 1.00 56.38  ? 72   ARG E CD    1 
ATOM   3322  N  NE    . ARG E 1  72  ? 7.478   -36.447 44.122 1.00 65.85  ? 72   ARG E NE    1 
ATOM   3323  C  CZ    . ARG E 1  72  ? 7.601   -35.996 42.874 1.00 71.33  ? 72   ARG E CZ    1 
ATOM   3324  N  NH1   . ARG E 1  72  ? 6.936   -36.573 41.873 1.00 67.41  ? 72   ARG E NH1   1 
ATOM   3325  N  NH2   . ARG E 1  72  ? 8.386   -34.957 42.624 1.00 75.74  ? 72   ARG E NH2   1 
ATOM   3326  N  N     . GLU E 1  73  ? 2.073   -40.000 46.645 1.00 47.65  ? 73   GLU E N     1 
ATOM   3327  C  CA    . GLU E 1  73  ? 1.341   -41.153 47.118 1.00 49.49  ? 73   GLU E CA    1 
ATOM   3328  C  C     . GLU E 1  73  ? -0.116  -41.152 46.651 1.00 51.94  ? 73   GLU E C     1 
ATOM   3329  O  O     . GLU E 1  73  ? -0.550  -42.060 45.955 1.00 55.86  ? 73   GLU E O     1 
ATOM   3330  C  CB    . GLU E 1  73  ? 1.410   -41.240 48.654 1.00 46.06  ? 73   GLU E CB    1 
ATOM   3331  C  CG    . GLU E 1  73  ? 0.610   -42.408 49.216 1.00 46.00  ? 73   GLU E CG    1 
ATOM   3332  C  CD    . GLU E 1  73  ? 0.676   -42.560 50.741 1.00 49.36  ? 73   GLU E CD    1 
ATOM   3333  O  OE1   . GLU E 1  73  ? 1.775   -42.494 51.355 1.00 50.14  ? 73   GLU E OE1   1 
ATOM   3334  O  OE2   . GLU E 1  73  ? -0.403  -42.801 51.346 1.00 50.57  ? 73   GLU E OE2   1 
ATOM   3335  N  N     . ILE E 1  74  ? -0.868  -40.137 47.055 1.00 55.49  ? 74   ILE E N     1 
ATOM   3336  C  CA    . ILE E 1  74  ? -2.262  -39.986 46.671 1.00 53.21  ? 74   ILE E CA    1 
ATOM   3337  C  C     . ILE E 1  74  ? -2.395  -40.050 45.140 1.00 55.38  ? 74   ILE E C     1 
ATOM   3338  O  O     . ILE E 1  74  ? -3.266  -40.747 44.613 1.00 53.50  ? 74   ILE E O     1 
ATOM   3339  C  CB    . ILE E 1  74  ? -2.832  -38.676 47.247 1.00 50.00  ? 74   ILE E CB    1 
ATOM   3340  C  CG1   . ILE E 1  74  ? -2.991  -38.790 48.763 1.00 52.77  ? 74   ILE E CG1   1 
ATOM   3341  C  CG2   . ILE E 1  74  ? -4.157  -38.310 46.611 1.00 51.20  ? 74   ILE E CG2   1 
ATOM   3342  C  CD1   . ILE E 1  74  ? -3.140  -37.457 49.492 1.00 51.99  ? 74   ILE E CD1   1 
ATOM   3343  N  N     . ALA E 1  75  ? -1.514  -39.353 44.430 1.00 54.16  ? 75   ALA E N     1 
ATOM   3344  C  CA    . ALA E 1  75  ? -1.587  -39.333 42.964 1.00 60.10  ? 75   ALA E CA    1 
ATOM   3345  C  C     . ALA E 1  75  ? -1.371  -40.712 42.377 1.00 59.30  ? 75   ALA E C     1 
ATOM   3346  O  O     . ALA E 1  75  ? -2.076  -41.117 41.450 1.00 54.57  ? 75   ALA E O     1 
ATOM   3347  C  CB    . ALA E 1  75  ? -0.577  -38.356 42.374 1.00 59.88  ? 75   ALA E CB    1 
ATOM   3348  N  N     . GLN E 1  76  ? -0.379  -41.412 42.925 1.00 59.94  ? 76   GLN E N     1 
ATOM   3349  C  CA    . GLN E 1  76  ? -0.026  -42.735 42.451 1.00 60.68  ? 76   GLN E CA    1 
ATOM   3350  C  C     . GLN E 1  76  ? -1.230  -43.645 42.582 1.00 59.08  ? 76   GLN E C     1 
ATOM   3351  O  O     . GLN E 1  76  ? -1.572  -44.335 41.627 1.00 62.91  ? 76   GLN E O     1 
ATOM   3352  C  CB    . GLN E 1  76  ? 1.143   -43.287 43.236 1.00 61.83  ? 76   GLN E CB    1 
ATOM   3353  C  CG    . GLN E 1  76  ? 1.926   -44.364 42.534 1.00 60.39  ? 76   GLN E CG    1 
ATOM   3354  C  CD    . GLN E 1  76  ? 3.127   -44.723 43.352 1.00 65.71  ? 76   GLN E CD    1 
ATOM   3355  O  OE1   . GLN E 1  76  ? 3.018   -44.980 44.557 1.00 67.54  ? 76   GLN E OE1   1 
ATOM   3356  N  NE2   . GLN E 1  76  ? 4.291   -44.712 42.718 1.00 77.09  ? 76   GLN E NE2   1 
ATOM   3357  N  N     . ASP E 1  77  ? -1.887  -43.615 43.742 1.00 53.18  ? 77   ASP E N     1 
ATOM   3358  C  CA    . ASP E 1  77  ? -3.157  -44.308 43.919 1.00 53.37  ? 77   ASP E CA    1 
ATOM   3359  C  C     . ASP E 1  77  ? -4.259  -43.957 42.861 1.00 57.44  ? 77   ASP E C     1 
ATOM   3360  O  O     . ASP E 1  77  ? -5.172  -44.733 42.654 1.00 64.87  ? 77   ASP E O     1 
ATOM   3361  C  CB    . ASP E 1  77  ? -3.676  -44.155 45.352 1.00 49.66  ? 77   ASP E CB    1 
ATOM   3362  C  CG    . ASP E 1  77  ? -2.811  -44.875 46.394 1.00 58.54  ? 77   ASP E CG    1 
ATOM   3363  O  OD1   . ASP E 1  77  ? -1.980  -45.762 46.084 1.00 71.62  ? 77   ASP E OD1   1 
ATOM   3364  O  OD2   . ASP E 1  77  ? -2.967  -44.563 47.579 1.00 62.35  ? 77   ASP E OD2   1 
ATOM   3365  N  N     . PHE E 1  78  ? -4.185  -42.812 42.193 1.00 59.52  ? 78   PHE E N     1 
ATOM   3366  C  CA    . PHE E 1  78  ? -5.110  -42.541 41.093 1.00 60.66  ? 78   PHE E CA    1 
ATOM   3367  C  C     . PHE E 1  78  ? -4.521  -42.976 39.754 1.00 63.05  ? 78   PHE E C     1 
ATOM   3368  O  O     . PHE E 1  78  ? -5.264  -43.292 38.833 1.00 62.53  ? 78   PHE E O     1 
ATOM   3369  C  CB    . PHE E 1  78  ? -5.433  -41.047 40.965 1.00 65.98  ? 78   PHE E CB    1 
ATOM   3370  C  CG    . PHE E 1  78  ? -6.372  -40.524 42.006 1.00 74.19  ? 78   PHE E CG    1 
ATOM   3371  C  CD1   . PHE E 1  78  ? -5.920  -39.624 42.981 1.00 78.80  ? 78   PHE E CD1   1 
ATOM   3372  C  CD2   . PHE E 1  78  ? -7.715  -40.902 42.024 1.00 79.82  ? 78   PHE E CD2   1 
ATOM   3373  C  CE1   . PHE E 1  78  ? -6.783  -39.138 43.972 1.00 74.68  ? 78   PHE E CE1   1 
ATOM   3374  C  CE2   . PHE E 1  78  ? -8.582  -40.406 43.011 1.00 84.11  ? 78   PHE E CE2   1 
ATOM   3375  C  CZ    . PHE E 1  78  ? -8.114  -39.518 43.982 1.00 74.28  ? 78   PHE E CZ    1 
ATOM   3376  N  N     . LYS E 1  79  ? -3.195  -42.947 39.638 1.00 61.22  ? 79   LYS E N     1 
ATOM   3377  C  CA    . LYS E 1  79  ? -2.519  -43.164 38.370 1.00 66.96  ? 79   LYS E CA    1 
ATOM   3378  C  C     . LYS E 1  79  ? -1.010  -43.365 38.576 1.00 71.80  ? 79   LYS E C     1 
ATOM   3379  O  O     . LYS E 1  79  ? -0.335  -42.559 39.242 1.00 70.56  ? 79   LYS E O     1 
ATOM   3380  C  CB    . LYS E 1  79  ? -2.777  -41.977 37.439 1.00 64.82  ? 79   LYS E CB    1 
ATOM   3381  C  CG    . LYS E 1  79  ? -3.122  -42.351 36.007 1.00 69.02  ? 79   LYS E CG    1 
ATOM   3382  C  CD    . LYS E 1  79  ? -1.861  -42.518 35.177 1.00 71.73  ? 79   LYS E CD    1 
ATOM   3383  C  CE    . LYS E 1  79  ? -2.143  -43.247 33.881 1.00 68.11  ? 79   LYS E CE    1 
ATOM   3384  N  NZ    . LYS E 1  79  ? -0.969  -44.103 33.559 1.00 65.05  ? 79   LYS E NZ    1 
ATOM   3385  N  N     . THR E 1  80  ? -0.480  -44.447 38.016 1.00 73.22  ? 80   THR E N     1 
ATOM   3386  C  CA    . THR E 1  80  ? 0.946   -44.737 38.181 1.00 78.89  ? 80   THR E CA    1 
ATOM   3387  C  C     . THR E 1  80  ? 1.793   -44.013 37.148 1.00 76.18  ? 80   THR E C     1 
ATOM   3388  O  O     . THR E 1  80  ? 1.272   -43.556 36.109 1.00 66.31  ? 80   THR E O     1 
ATOM   3389  C  CB    . THR E 1  80  ? 1.251   -46.234 38.051 1.00 79.64  ? 80   THR E CB    1 
ATOM   3390  O  OG1   . THR E 1  80  ? 0.709   -46.705 36.808 1.00 86.14  ? 80   THR E OG1   1 
ATOM   3391  C  CG2   . THR E 1  80  ? 0.654   -47.003 39.220 1.00 77.23  ? 80   THR E CG2   1 
ATOM   3392  N  N     . ASP E 1  81  ? 3.096   -43.927 37.453 1.00 76.36  ? 81   ASP E N     1 
ATOM   3393  C  CA    . ASP E 1  81  ? 4.121   -43.373 36.550 1.00 80.89  ? 81   ASP E CA    1 
ATOM   3394  C  C     . ASP E 1  81  ? 3.797   -41.934 36.168 1.00 79.91  ? 81   ASP E C     1 
ATOM   3395  O  O     . ASP E 1  81  ? 3.852   -41.576 34.989 1.00 80.71  ? 81   ASP E O     1 
ATOM   3396  C  CB    . ASP E 1  81  ? 4.281   -44.237 35.276 1.00 90.26  ? 81   ASP E CB    1 
ATOM   3397  C  CG    . ASP E 1  81  ? 4.264   -45.739 35.566 1.00 100.36 ? 81   ASP E CG    1 
ATOM   3398  O  OD1   . ASP E 1  81  ? 3.288   -46.419 35.123 1.00 93.10  ? 81   ASP E OD1   1 
ATOM   3399  O  OD2   . ASP E 1  81  ? 5.218   -46.221 36.244 1.00 93.36  ? 81   ASP E OD2   1 
ATOM   3400  N  N     . LEU E 1  82  ? 3.426   -41.129 37.170 1.00 78.90  ? 82   LEU E N     1 
ATOM   3401  C  CA    . LEU E 1  82  ? 3.191   -39.684 36.997 1.00 74.42  ? 82   LEU E CA    1 
ATOM   3402  C  C     . LEU E 1  82  ? 4.368   -38.852 37.509 1.00 71.71  ? 82   LEU E C     1 
ATOM   3403  O  O     . LEU E 1  82  ? 5.015   -39.200 38.489 1.00 70.61  ? 82   LEU E O     1 
ATOM   3404  C  CB    . LEU E 1  82  ? 1.924   -39.234 37.734 1.00 73.63  ? 82   LEU E CB    1 
ATOM   3405  C  CG    . LEU E 1  82  ? 0.518   -39.531 37.210 1.00 71.34  ? 82   LEU E CG    1 
ATOM   3406  C  CD1   . LEU E 1  82  ? -0.536  -39.166 38.249 1.00 62.40  ? 82   LEU E CD1   1 
ATOM   3407  C  CD2   . LEU E 1  82  ? 0.274   -38.793 35.899 1.00 70.29  ? 82   LEU E CD2   1 
ATOM   3408  N  N     . ARG E 1  83  ? 4.629   -37.734 36.858 1.00 72.58  ? 83   ARG E N     1 
ATOM   3409  C  CA    . ARG E 1  83  ? 5.636   -36.813 37.355 1.00 73.30  ? 83   ARG E CA    1 
ATOM   3410  C  C     . ARG E 1  83  ? 4.932   -35.517 37.735 1.00 69.65  ? 83   ARG E C     1 
ATOM   3411  O  O     . ARG E 1  83  ? 3.847   -35.238 37.248 1.00 66.87  ? 83   ARG E O     1 
ATOM   3412  C  CB    . ARG E 1  83  ? 6.684   -36.542 36.272 1.00 81.09  ? 83   ARG E CB    1 
ATOM   3413  C  CG    . ARG E 1  83  ? 7.480   -37.747 35.801 1.00 79.25  ? 83   ARG E CG    1 
ATOM   3414  C  CD    . ARG E 1  83  ? 8.000   -37.477 34.403 1.00 92.47  ? 83   ARG E CD    1 
ATOM   3415  N  NE    . ARG E 1  83  ? 9.242   -38.188 34.104 1.00 100.74 ? 83   ARG E NE    1 
ATOM   3416  C  CZ    . ARG E 1  83  ? 10.467  -37.680 34.261 1.00 107.46 ? 83   ARG E CZ    1 
ATOM   3417  N  NH1   . ARG E 1  83  ? 10.644  -36.446 34.725 1.00 91.21  ? 83   ARG E NH1   1 
ATOM   3418  N  NH2   . ARG E 1  83  ? 11.530  -38.416 33.951 1.00 114.54 ? 83   ARG E NH2   1 
ATOM   3419  N  N     . PHE E 1  84  ? 5.555   -34.721 38.596 1.00 68.60  ? 84   PHE E N     1 
ATOM   3420  C  CA    . PHE E 1  84  ? 5.011   -33.422 38.981 1.00 63.91  ? 84   PHE E CA    1 
ATOM   3421  C  C     . PHE E 1  84  ? 6.001   -32.312 38.748 1.00 62.53  ? 84   PHE E C     1 
ATOM   3422  O  O     . PHE E 1  84  ? 7.127   -32.396 39.245 1.00 65.82  ? 84   PHE E O     1 
ATOM   3423  C  CB    . PHE E 1  84  ? 4.700   -33.416 40.461 1.00 63.42  ? 84   PHE E CB    1 
ATOM   3424  C  CG    . PHE E 1  84  ? 3.440   -34.131 40.812 1.00 71.65  ? 84   PHE E CG    1 
ATOM   3425  C  CD1   . PHE E 1  84  ? 3.417   -35.521 40.907 1.00 67.73  ? 84   PHE E CD1   1 
ATOM   3426  C  CD2   . PHE E 1  84  ? 2.262   -33.413 41.063 1.00 65.97  ? 84   PHE E CD2   1 
ATOM   3427  C  CE1   . PHE E 1  84  ? 2.235   -36.185 41.244 1.00 67.93  ? 84   PHE E CE1   1 
ATOM   3428  C  CE2   . PHE E 1  84  ? 1.092   -34.071 41.393 1.00 60.41  ? 84   PHE E CE2   1 
ATOM   3429  C  CZ    . PHE E 1  84  ? 1.079   -35.459 41.486 1.00 63.96  ? 84   PHE E CZ    1 
ATOM   3430  N  N     . GLN E 1  85  ? 5.587   -31.261 38.031 1.00 60.71  ? 85   GLN E N     1 
ATOM   3431  C  CA    . GLN E 1  85  ? 6.355   -30.008 38.006 1.00 57.24  ? 85   GLN E CA    1 
ATOM   3432  C  C     . GLN E 1  85  ? 6.479   -29.512 39.425 1.00 54.99  ? 85   GLN E C     1 
ATOM   3433  O  O     . GLN E 1  85  ? 5.537   -29.626 40.207 1.00 59.38  ? 85   GLN E O     1 
ATOM   3434  C  CB    . GLN E 1  85  ? 5.677   -28.962 37.142 1.00 59.05  ? 85   GLN E CB    1 
ATOM   3435  C  CG    . GLN E 1  85  ? 5.740   -29.261 35.652 1.00 65.37  ? 85   GLN E CG    1 
ATOM   3436  C  CD    . GLN E 1  85  ? 5.058   -28.197 34.813 1.00 72.06  ? 85   GLN E CD    1 
ATOM   3437  O  OE1   . GLN E 1  85  ? 4.292   -27.375 35.326 1.00 78.44  ? 85   GLN E OE1   1 
ATOM   3438  N  NE2   . GLN E 1  85  ? 5.318   -28.216 33.512 1.00 72.11  ? 85   GLN E NE2   1 
ATOM   3439  N  N     . SER E 1  86  ? 7.631   -28.999 39.814 1.00 56.67  ? 86   SER E N     1 
ATOM   3440  C  CA    . SER E 1  86  ? 7.763   -28.689 41.240 1.00 58.38  ? 86   SER E CA    1 
ATOM   3441  C  C     . SER E 1  86  ? 6.767   -27.619 41.664 1.00 61.64  ? 86   SER E C     1 
ATOM   3442  O  O     . SER E 1  86  ? 6.281   -27.655 42.782 1.00 69.08  ? 86   SER E O     1 
ATOM   3443  C  CB    . SER E 1  86  ? 9.179   -28.303 41.638 1.00 56.22  ? 86   SER E CB    1 
ATOM   3444  O  OG    . SER E 1  86  ? 9.574   -27.171 40.902 1.00 66.83  ? 86   SER E OG    1 
ATOM   3445  N  N     . SER E 1  87  ? 6.440   -26.688 40.772 1.00 58.27  ? 87   SER E N     1 
ATOM   3446  C  CA    . SER E 1  87  ? 5.506   -25.648 41.121 1.00 55.16  ? 87   SER E CA    1 
ATOM   3447  C  C     . SER E 1  87  ? 4.119   -26.225 41.309 1.00 58.75  ? 87   SER E C     1 
ATOM   3448  O  O     . SER E 1  87  ? 3.331   -25.700 42.101 1.00 64.67  ? 87   SER E O     1 
ATOM   3449  C  CB    . SER E 1  87  ? 5.488   -24.540 40.082 1.00 55.94  ? 87   SER E CB    1 
ATOM   3450  O  OG    . SER E 1  87  ? 5.256   -25.077 38.798 1.00 63.07  ? 87   SER E OG    1 
ATOM   3451  N  N     . ALA E 1  88  ? 3.807   -27.313 40.615 1.00 58.13  ? 88   ALA E N     1 
ATOM   3452  C  CA    . ALA E 1  88  ? 2.519   -27.968 40.847 1.00 55.43  ? 88   ALA E CA    1 
ATOM   3453  C  C     . ALA E 1  88  ? 2.415   -28.465 42.277 1.00 55.27  ? 88   ALA E C     1 
ATOM   3454  O  O     . ALA E 1  88  ? 1.366   -28.398 42.887 1.00 64.84  ? 88   ALA E O     1 
ATOM   3455  C  CB    . ALA E 1  88  ? 2.260   -29.084 39.876 1.00 49.72  ? 88   ALA E CB    1 
ATOM   3456  N  N     . VAL E 1  89  ? 3.508   -28.915 42.845 1.00 56.01  ? 89   VAL E N     1 
ATOM   3457  C  CA    . VAL E 1  89  ? 3.458   -29.349 44.243 1.00 55.90  ? 89   VAL E CA    1 
ATOM   3458  C  C     . VAL E 1  89  ? 3.282   -28.115 45.119 1.00 56.74  ? 89   VAL E C     1 
ATOM   3459  O  O     . VAL E 1  89  ? 2.521   -28.138 46.090 1.00 60.19  ? 89   VAL E O     1 
ATOM   3460  C  CB    . VAL E 1  89  ? 4.721   -30.155 44.674 1.00 50.83  ? 89   VAL E CB    1 
ATOM   3461  C  CG1   . VAL E 1  89  ? 4.609   -30.605 46.110 1.00 49.50  ? 89   VAL E CG1   1 
ATOM   3462  C  CG2   . VAL E 1  89  ? 4.916   -31.376 43.801 1.00 51.07  ? 89   VAL E CG2   1 
ATOM   3463  N  N     . MET E 1  90  ? 3.992   -27.042 44.768 1.00 60.52  ? 90   MET E N     1 
ATOM   3464  C  CA    . MET E 1  90  ? 3.934   -25.783 45.514 1.00 57.47  ? 90   MET E CA    1 
ATOM   3465  C  C     . MET E 1  90  ? 2.510   -25.205 45.467 1.00 57.42  ? 90   MET E C     1 
ATOM   3466  O  O     . MET E 1  90  ? 1.954   -24.797 46.498 1.00 55.28  ? 90   MET E O     1 
ATOM   3467  C  CB    . MET E 1  90  ? 4.954   -24.796 44.963 1.00 59.21  ? 90   MET E CB    1 
ATOM   3468  C  CG    . MET E 1  90  ? 6.396   -25.165 45.256 1.00 65.64  ? 90   MET E CG    1 
ATOM   3469  S  SD    . MET E 1  90  ? 6.606   -25.674 46.980 1.00 80.83  ? 90   MET E SD    1 
ATOM   3470  C  CE    . MET E 1  90  ? 6.466   -24.112 47.856 1.00 78.07  ? 90   MET E CE    1 
ATOM   3471  N  N     . ALA E 1  91  ? 1.909   -25.226 44.278 1.00 51.91  ? 91   ALA E N     1 
ATOM   3472  C  CA    . ALA E 1  91  ? 0.541   -24.793 44.110 1.00 50.61  ? 91   ALA E CA    1 
ATOM   3473  C  C     . ALA E 1  91  ? -0.367  -25.498 45.089 1.00 50.98  ? 91   ALA E C     1 
ATOM   3474  O  O     . ALA E 1  91  ? -1.113  -24.847 45.823 1.00 53.49  ? 91   ALA E O     1 
ATOM   3475  C  CB    . ALA E 1  91  ? 0.079   -25.049 42.702 1.00 48.51  ? 91   ALA E CB    1 
ATOM   3476  N  N     . LEU E 1  92  ? -0.301  -26.829 45.091 1.00 53.39  ? 92   LEU E N     1 
ATOM   3477  C  CA    . LEU E 1  92  ? -1.085  -27.671 46.020 1.00 52.43  ? 92   LEU E CA    1 
ATOM   3478  C  C     . LEU E 1  92  ? -0.794  -27.327 47.467 1.00 51.20  ? 92   LEU E C     1 
ATOM   3479  O  O     . LEU E 1  92  ? -1.717  -27.208 48.263 1.00 53.34  ? 92   LEU E O     1 
ATOM   3480  C  CB    . LEU E 1  92  ? -0.817  -29.162 45.780 1.00 54.86  ? 92   LEU E CB    1 
ATOM   3481  C  CG    . LEU E 1  92  ? -1.426  -29.821 44.529 1.00 54.94  ? 92   LEU E CG    1 
ATOM   3482  C  CD1   . LEU E 1  92  ? -0.668  -31.080 44.149 1.00 50.48  ? 92   LEU E CD1   1 
ATOM   3483  C  CD2   . LEU E 1  92  ? -2.882  -30.167 44.764 1.00 56.59  ? 92   LEU E CD2   1 
ATOM   3484  N  N     . GLN E 1  93  ? 0.481   -27.146 47.807 1.00 48.16  ? 93   GLN E N     1 
ATOM   3485  C  CA    . GLN E 1  93  ? 0.822   -26.839 49.187 1.00 47.42  ? 93   GLN E CA    1 
ATOM   3486  C  C     . GLN E 1  93  ? 0.232   -25.503 49.630 1.00 49.67  ? 93   GLN E C     1 
ATOM   3487  O  O     . GLN E 1  93  ? -0.372  -25.436 50.699 1.00 53.75  ? 93   GLN E O     1 
ATOM   3488  C  CB    . GLN E 1  93  ? 2.332   -26.902 49.455 1.00 43.47  ? 93   GLN E CB    1 
ATOM   3489  C  CG    . GLN E 1  93  ? 2.593   -26.999 50.954 1.00 45.93  ? 93   GLN E CG    1 
ATOM   3490  C  CD    . GLN E 1  93  ? 4.038   -27.211 51.345 1.00 46.03  ? 93   GLN E CD    1 
ATOM   3491  O  OE1   . GLN E 1  93  ? 4.919   -27.407 50.503 1.00 50.74  ? 93   GLN E OE1   1 
ATOM   3492  N  NE2   . GLN E 1  93  ? 4.294   -27.169 52.639 1.00 42.55  ? 93   GLN E NE2   1 
ATOM   3493  N  N     . GLU E 1  94  ? 0.410   -24.459 48.808 1.00 47.83  ? 94   GLU E N     1 
ATOM   3494  C  CA    . GLU E 1  94  ? -0.200  -23.148 49.023 1.00 45.48  ? 94   GLU E CA    1 
ATOM   3495  C  C     . GLU E 1  94  ? -1.724  -23.255 49.168 1.00 48.05  ? 94   GLU E C     1 
ATOM   3496  O  O     . GLU E 1  94  ? -2.318  -22.709 50.109 1.00 53.92  ? 94   GLU E O     1 
ATOM   3497  C  CB    . GLU E 1  94  ? 0.135   -22.178 47.886 1.00 46.64  ? 94   GLU E CB    1 
ATOM   3498  C  CG    . GLU E 1  94  ? 1.562   -21.626 47.837 1.00 48.94  ? 94   GLU E CG    1 
ATOM   3499  C  CD    . GLU E 1  94  ? 1.888   -20.674 48.975 1.00 54.26  ? 94   GLU E CD    1 
ATOM   3500  O  OE1   . GLU E 1  94  ? 0.959   -20.182 49.665 1.00 58.15  ? 94   GLU E OE1   1 
ATOM   3501  O  OE2   . GLU E 1  94  ? 3.090   -20.431 49.205 1.00 56.06  ? 94   GLU E OE2   1 
ATOM   3502  N  N     . ALA E 1  95  ? -2.375  -23.959 48.253 1.00 43.66  ? 95   ALA E N     1 
ATOM   3503  C  CA    . ALA E 1  95  ? -3.806  -24.157 48.399 1.00 40.88  ? 95   ALA E CA    1 
ATOM   3504  C  C     . ALA E 1  95  ? -4.147  -24.869 49.707 1.00 41.81  ? 95   ALA E C     1 
ATOM   3505  O  O     . ALA E 1  95  ? -5.052  -24.450 50.384 1.00 45.68  ? 95   ALA E O     1 
ATOM   3506  C  CB    . ALA E 1  95  ? -4.383  -24.909 47.205 1.00 37.40  ? 95   ALA E CB    1 
ATOM   3507  N  N     . SER E 1  96  ? -3.422  -25.932 50.051 1.00 41.73  ? 96   SER E N     1 
ATOM   3508  C  CA    . SER E 1  96  ? -3.774  -26.803 51.156 1.00 44.99  ? 96   SER E CA    1 
ATOM   3509  C  C     . SER E 1  96  ? -3.648  -26.105 52.500 1.00 48.30  ? 96   SER E C     1 
ATOM   3510  O  O     . SER E 1  96  ? -4.572  -26.141 53.328 1.00 46.57  ? 96   SER E O     1 
ATOM   3511  C  CB    . SER E 1  96  ? -2.876  -28.050 51.159 1.00 51.47  ? 96   SER E CB    1 
ATOM   3512  O  OG    . SER E 1  96  ? -3.141  -28.927 50.066 1.00 50.82  ? 96   SER E OG    1 
ATOM   3513  N  N     . GLU E 1  97  ? -2.494  -25.475 52.720 1.00 53.46  ? 97   GLU E N     1 
ATOM   3514  C  CA    . GLU E 1  97  ? -2.301  -24.620 53.893 1.00 51.34  ? 97   GLU E CA    1 
ATOM   3515  C  C     . GLU E 1  97  ? -3.335  -23.478 53.961 1.00 45.64  ? 97   GLU E C     1 
ATOM   3516  O  O     . GLU E 1  97  ? -3.861  -23.175 55.026 1.00 46.63  ? 97   GLU E O     1 
ATOM   3517  C  CB    . GLU E 1  97  ? -0.861  -24.117 53.982 1.00 51.83  ? 97   GLU E CB    1 
ATOM   3518  C  CG    . GLU E 1  97  ? 0.179   -25.236 53.995 1.00 55.41  ? 97   GLU E CG    1 
ATOM   3519  C  CD    . GLU E 1  97  ? 1.549   -24.833 54.568 1.00 61.19  ? 97   GLU E CD    1 
ATOM   3520  O  OE1   . GLU E 1  97  ? 1.722   -23.701 55.063 1.00 64.00  ? 97   GLU E OE1   1 
ATOM   3521  O  OE2   . GLU E 1  97  ? 2.481   -25.658 54.526 1.00 63.63  ? 97   GLU E OE2   1 
ATOM   3522  N  N     . ALA E 1  98  ? -3.662  -22.863 52.837 1.00 43.75  ? 98   ALA E N     1 
ATOM   3523  C  CA    . ALA E 1  98  ? -4.642  -21.781 52.884 1.00 41.76  ? 98   ALA E CA    1 
ATOM   3524  C  C     . ALA E 1  98  ? -5.991  -22.333 53.288 1.00 44.14  ? 98   ALA E C     1 
ATOM   3525  O  O     . ALA E 1  98  ? -6.702  -21.721 54.094 1.00 50.09  ? 98   ALA E O     1 
ATOM   3526  C  CB    . ALA E 1  98  ? -4.732  -21.066 51.571 1.00 34.83  ? 98   ALA E CB    1 
ATOM   3527  N  N     . TYR E 1  99  ? -6.320  -23.505 52.761 1.00 43.36  ? 99   TYR E N     1 
ATOM   3528  C  CA    . TYR E 1  99  ? -7.558  -24.175 53.099 1.00 43.11  ? 99   TYR E CA    1 
ATOM   3529  C  C     . TYR E 1  99  ? -7.591  -24.539 54.590 1.00 45.21  ? 99   TYR E C     1 
ATOM   3530  O  O     . TYR E 1  99  ? -8.623  -24.369 55.259 1.00 48.02  ? 99   TYR E O     1 
ATOM   3531  C  CB    . TYR E 1  99  ? -7.783  -25.408 52.214 1.00 42.54  ? 99   TYR E CB    1 
ATOM   3532  C  CG    . TYR E 1  99  ? -8.904  -26.295 52.691 1.00 44.89  ? 99   TYR E CG    1 
ATOM   3533  C  CD1   . TYR E 1  99  ? -10.228 -26.036 52.348 1.00 45.95  ? 99   TYR E CD1   1 
ATOM   3534  C  CD2   . TYR E 1  99  ? -8.642  -27.389 53.520 1.00 46.16  ? 99   TYR E CD2   1 
ATOM   3535  C  CE1   . TYR E 1  99  ? -11.252 -26.856 52.816 1.00 47.20  ? 99   TYR E CE1   1 
ATOM   3536  C  CE2   . TYR E 1  99  ? -9.652  -28.201 53.988 1.00 44.08  ? 99   TYR E CE2   1 
ATOM   3537  C  CZ    . TYR E 1  99  ? -10.957 -27.940 53.637 1.00 45.84  ? 99   TYR E CZ    1 
ATOM   3538  O  OH    . TYR E 1  99  ? -11.964 -28.783 54.103 1.00 47.94  ? 99   TYR E OH    1 
ATOM   3539  N  N     . LEU E 1  100 ? -6.471  -25.014 55.115 1.00 43.35  ? 100  LEU E N     1 
ATOM   3540  C  CA    . LEU E 1  100 ? -6.493  -25.543 56.458 1.00 44.33  ? 100  LEU E CA    1 
ATOM   3541  C  C     . LEU E 1  100 ? -6.547  -24.436 57.509 1.00 47.85  ? 100  LEU E C     1 
ATOM   3542  O  O     . LEU E 1  100 ? -7.262  -24.561 58.518 1.00 49.02  ? 100  LEU E O     1 
ATOM   3543  C  CB    . LEU E 1  100 ? -5.350  -26.542 56.691 1.00 44.39  ? 100  LEU E CB    1 
ATOM   3544  C  CG    . LEU E 1  100 ? -5.423  -27.991 56.127 1.00 42.34  ? 100  LEU E CG    1 
ATOM   3545  C  CD1   . LEU E 1  100 ? -4.086  -28.688 56.367 1.00 38.04  ? 100  LEU E CD1   1 
ATOM   3546  C  CD2   . LEU E 1  100 ? -6.557  -28.841 56.703 1.00 37.26  ? 100  LEU E CD2   1 
ATOM   3547  N  N     . VAL E 1  101 ? -5.834  -23.336 57.236 1.00 49.60  ? 101  VAL E N     1 
ATOM   3548  C  CA    . VAL E 1  101 ? -5.819  -22.152 58.106 1.00 44.06  ? 101  VAL E CA    1 
ATOM   3549  C  C     . VAL E 1  101 ? -7.202  -21.523 58.179 1.00 43.28  ? 101  VAL E C     1 
ATOM   3550  O  O     . VAL E 1  101 ? -7.656  -21.162 59.251 1.00 43.72  ? 101  VAL E O     1 
ATOM   3551  C  CB    . VAL E 1  101 ? -4.776  -21.126 57.638 1.00 45.21  ? 101  VAL E CB    1 
ATOM   3552  C  CG1   . VAL E 1  101 ? -4.963  -19.786 58.348 1.00 40.76  ? 101  VAL E CG1   1 
ATOM   3553  C  CG2   . VAL E 1  101 ? -3.355  -21.673 57.843 1.00 43.62  ? 101  VAL E CG2   1 
ATOM   3554  N  N     . ALA E 1  102 ? -7.896  -21.430 57.050 1.00 42.51  ? 102  ALA E N     1 
ATOM   3555  C  CA    . ALA E 1  102 ? -9.255  -20.906 57.072 1.00 42.20  ? 102  ALA E CA    1 
ATOM   3556  C  C     . ALA E 1  102 ? -10.199 -21.830 57.857 1.00 47.87  ? 102  ALA E C     1 
ATOM   3557  O  O     . ALA E 1  102 ? -11.087 -21.359 58.596 1.00 50.15  ? 102  ALA E O     1 
ATOM   3558  C  CB    . ALA E 1  102 ? -9.755  -20.698 55.673 1.00 38.24  ? 102  ALA E CB    1 
ATOM   3559  N  N     . LEU E 1  103 ? -9.990  -23.141 57.717 1.00 46.84  ? 103  LEU E N     1 
ATOM   3560  C  CA    . LEU E 1  103 ? -10.845 -24.120 58.363 1.00 43.58  ? 103  LEU E CA    1 
ATOM   3561  C  C     . LEU E 1  103 ? -10.712 -24.018 59.875 1.00 47.82  ? 103  LEU E C     1 
ATOM   3562  O  O     . LEU E 1  103 ? -11.700 -24.121 60.624 1.00 46.48  ? 103  LEU E O     1 
ATOM   3563  C  CB    . LEU E 1  103 ? -10.483 -25.513 57.888 1.00 41.03  ? 103  LEU E CB    1 
ATOM   3564  C  CG    . LEU E 1  103 ? -11.344 -26.615 58.476 1.00 41.64  ? 103  LEU E CG    1 
ATOM   3565  C  CD1   . LEU E 1  103 ? -12.818 -26.379 58.233 1.00 39.92  ? 103  LEU E CD1   1 
ATOM   3566  C  CD2   . LEU E 1  103 ? -10.898 -27.968 57.972 1.00 39.94  ? 103  LEU E CD2   1 
ATOM   3567  N  N     . PHE E 1  104 ? -9.479  -23.813 60.328 1.00 49.69  ? 104  PHE E N     1 
ATOM   3568  C  CA    . PHE E 1  104 ? -9.229  -23.598 61.745 1.00 47.08  ? 104  PHE E CA    1 
ATOM   3569  C  C     . PHE E 1  104 ? -9.859  -22.311 62.299 1.00 49.58  ? 104  PHE E C     1 
ATOM   3570  O  O     . PHE E 1  104 ? -10.312 -22.319 63.438 1.00 51.73  ? 104  PHE E O     1 
ATOM   3571  C  CB    . PHE E 1  104 ? -7.747  -23.608 62.031 1.00 46.71  ? 104  PHE E CB    1 
ATOM   3572  C  CG    . PHE E 1  104 ? -7.137  -24.966 62.056 1.00 49.22  ? 104  PHE E CG    1 
ATOM   3573  C  CD1   . PHE E 1  104 ? -6.030  -25.256 61.269 1.00 52.46  ? 104  PHE E CD1   1 
ATOM   3574  C  CD2   . PHE E 1  104 ? -7.618  -25.949 62.913 1.00 49.55  ? 104  PHE E CD2   1 
ATOM   3575  C  CE1   . PHE E 1  104 ? -5.435  -26.513 61.317 1.00 52.10  ? 104  PHE E CE1   1 
ATOM   3576  C  CE2   . PHE E 1  104 ? -7.024  -27.206 62.964 1.00 47.02  ? 104  PHE E CE2   1 
ATOM   3577  C  CZ    . PHE E 1  104 ? -5.940  -27.491 62.163 1.00 48.22  ? 104  PHE E CZ    1 
ATOM   3578  N  N     . GLU E 1  105 ? -9.894  -21.203 61.549 1.00 49.16  ? 105  GLU E N     1 
ATOM   3579  C  CA    . GLU E 1  105 ? -10.618 -20.024 62.079 1.00 49.26  ? 105  GLU E CA    1 
ATOM   3580  C  C     . GLU E 1  105 ? -12.048 -20.438 62.294 1.00 52.96  ? 105  GLU E C     1 
ATOM   3581  O  O     . GLU E 1  105 ? -12.589 -20.232 63.372 1.00 61.27  ? 105  GLU E O     1 
ATOM   3582  C  CB    . GLU E 1  105 ? -10.593 -18.807 61.165 1.00 49.49  ? 105  GLU E CB    1 
ATOM   3583  C  CG    . GLU E 1  105 ? -9.198  -18.310 60.811 1.00 57.43  ? 105  GLU E CG    1 
ATOM   3584  C  CD    . GLU E 1  105 ? -9.123  -17.702 59.421 1.00 59.76  ? 105  GLU E CD    1 
ATOM   3585  O  OE1   . GLU E 1  105 ? -10.203 -17.450 58.829 1.00 63.86  ? 105  GLU E OE1   1 
ATOM   3586  O  OE2   . GLU E 1  105 ? -7.988  -17.490 58.921 1.00 59.94  ? 105  GLU E OE2   1 
ATOM   3587  N  N     . ASP E 1  106 ? -12.658 -21.055 61.283 1.00 51.90  ? 106  ASP E N     1 
ATOM   3588  C  CA    . ASP E 1  106 ? -14.055 -21.446 61.382 1.00 51.58  ? 106  ASP E CA    1 
ATOM   3589  C  C     . ASP E 1  106 ? -14.256 -22.397 62.547 1.00 50.30  ? 106  ASP E C     1 
ATOM   3590  O  O     . ASP E 1  106 ? -15.248 -22.281 63.280 1.00 51.51  ? 106  ASP E O     1 
ATOM   3591  C  CB    . ASP E 1  106 ? -14.532 -22.086 60.079 1.00 52.06  ? 106  ASP E CB    1 
ATOM   3592  C  CG    . ASP E 1  106 ? -14.729 -21.090 58.984 1.00 51.14  ? 106  ASP E CG    1 
ATOM   3593  O  OD1   . ASP E 1  106 ? -14.589 -19.885 59.257 1.00 56.50  ? 106  ASP E OD1   1 
ATOM   3594  O  OD2   . ASP E 1  106 ? -15.030 -21.505 57.842 1.00 54.73  ? 106  ASP E OD2   1 
ATOM   3595  N  N     . THR E 1  107 ? -13.296 -23.314 62.711 1.00 49.72  ? 107  THR E N     1 
ATOM   3596  C  CA    . THR E 1  107 ? -13.302 -24.315 63.794 1.00 50.33  ? 107  THR E CA    1 
ATOM   3597  C  C     . THR E 1  107 ? -13.239 -23.625 65.143 1.00 51.95  ? 107  THR E C     1 
ATOM   3598  O  O     . THR E 1  107 ? -14.081 -23.855 65.999 1.00 54.19  ? 107  THR E O     1 
ATOM   3599  C  CB    . THR E 1  107 ? -12.128 -25.276 63.652 1.00 45.37  ? 107  THR E CB    1 
ATOM   3600  O  OG1   . THR E 1  107 ? -12.296 -26.027 62.448 1.00 44.20  ? 107  THR E OG1   1 
ATOM   3601  C  CG2   . THR E 1  107 ? -12.079 -26.203 64.781 1.00 46.97  ? 107  THR E CG2   1 
ATOM   3602  N  N     . ASN E 1  108 ? -12.260 -22.735 65.286 1.00 54.08  ? 108  ASN E N     1 
ATOM   3603  C  CA    . ASN E 1  108 ? -12.110 -21.877 66.453 1.00 52.69  ? 108  ASN E CA    1 
ATOM   3604  C  C     . ASN E 1  108 ? -13.382 -21.138 66.842 1.00 54.68  ? 108  ASN E C     1 
ATOM   3605  O  O     . ASN E 1  108 ? -13.698 -21.031 68.037 1.00 54.09  ? 108  ASN E O     1 
ATOM   3606  C  CB    . ASN E 1  108 ? -11.024 -20.856 66.190 1.00 50.93  ? 108  ASN E CB    1 
ATOM   3607  C  CG    . ASN E 1  108 ? -10.400 -20.368 67.450 1.00 51.41  ? 108  ASN E CG    1 
ATOM   3608  O  OD1   . ASN E 1  108 ? -10.434 -21.046 68.477 1.00 56.71  ? 108  ASN E OD1   1 
ATOM   3609  N  ND2   . ASN E 1  108 ? -9.793  -19.208 67.383 1.00 48.66  ? 108  ASN E ND2   1 
ATOM   3610  N  N     . LEU E 1  109 ? -14.104 -20.631 65.837 1.00 50.79  ? 109  LEU E N     1 
ATOM   3611  C  CA    . LEU E 1  109 ? -15.364 -19.945 66.091 1.00 51.03  ? 109  LEU E CA    1 
ATOM   3612  C  C     . LEU E 1  109 ? -16.361 -20.910 66.672 1.00 51.16  ? 109  LEU E C     1 
ATOM   3613  O  O     . LEU E 1  109 ? -17.081 -20.551 67.588 1.00 53.26  ? 109  LEU E O     1 
ATOM   3614  C  CB    . LEU E 1  109 ? -15.920 -19.317 64.822 1.00 49.22  ? 109  LEU E CB    1 
ATOM   3615  C  CG    . LEU E 1  109 ? -15.208 -18.072 64.334 1.00 47.51  ? 109  LEU E CG    1 
ATOM   3616  C  CD1   . LEU E 1  109 ? -15.806 -17.646 62.997 1.00 43.52  ? 109  LEU E CD1   1 
ATOM   3617  C  CD2   . LEU E 1  109 ? -15.336 -16.988 65.387 1.00 42.54  ? 109  LEU E CD2   1 
ATOM   3618  N  N     . CYS E 1  110 ? -16.367 -22.145 66.156 1.00 51.08  ? 110  CYS E N     1 
ATOM   3619  C  CA    . CYS E 1  110 ? -17.281 -23.178 66.635 1.00 52.36  ? 110  CYS E CA    1 
ATOM   3620  C  C     . CYS E 1  110 ? -17.059 -23.576 68.114 1.00 53.08  ? 110  CYS E C     1 
ATOM   3621  O  O     . CYS E 1  110 ? -18.008 -23.623 68.908 1.00 51.46  ? 110  CYS E O     1 
ATOM   3622  C  CB    . CYS E 1  110 ? -17.247 -24.378 65.703 1.00 51.91  ? 110  CYS E CB    1 
ATOM   3623  S  SG    . CYS E 1  110 ? -18.065 -24.070 64.112 1.00 53.81  ? 110  CYS E SG    1 
ATOM   3624  N  N     . ALA E 1  111 ? -15.808 -23.832 68.482 1.00 47.83  ? 111  ALA E N     1 
ATOM   3625  C  CA    . ALA E 1  111 ? -15.439 -23.932 69.874 1.00 47.94  ? 111  ALA E CA    1 
ATOM   3626  C  C     . ALA E 1  111 ? -15.972 -22.742 70.700 1.00 53.21  ? 111  ALA E C     1 
ATOM   3627  O  O     . ALA E 1  111 ? -16.681 -22.927 71.696 1.00 52.80  ? 111  ALA E O     1 
ATOM   3628  C  CB    . ALA E 1  111 ? -13.936 -24.039 69.999 1.00 46.05  ? 111  ALA E CB    1 
ATOM   3629  N  N     . ILE E 1  112 ? -15.637 -21.518 70.294 1.00 56.85  ? 112  ILE E N     1 
ATOM   3630  C  CA    . ILE E 1  112 ? -15.979 -20.347 71.106 1.00 54.35  ? 112  ILE E CA    1 
ATOM   3631  C  C     . ILE E 1  112 ? -17.491 -20.299 71.257 1.00 51.33  ? 112  ILE E C     1 
ATOM   3632  O  O     . ILE E 1  112 ? -18.005 -19.972 72.320 1.00 52.53  ? 112  ILE E O     1 
ATOM   3633  C  CB    . ILE E 1  112 ? -15.370 -19.024 70.547 1.00 53.64  ? 112  ILE E CB    1 
ATOM   3634  C  CG1   . ILE E 1  112 ? -13.855 -19.021 70.754 1.00 50.91  ? 112  ILE E CG1   1 
ATOM   3635  C  CG2   . ILE E 1  112 ? -15.966 -17.784 71.205 1.00 45.43  ? 112  ILE E CG2   1 
ATOM   3636  C  CD1   . ILE E 1  112 ? -13.107 -18.140 69.767 1.00 54.83  ? 112  ILE E CD1   1 
ATOM   3637  N  N     . HIS E 1  113 ? -18.206 -20.666 70.203 1.00 53.95  ? 113  HIS E N     1 
ATOM   3638  C  CA    . HIS E 1  113 ? -19.678 -20.653 70.247 1.00 57.71  ? 113  HIS E CA    1 
ATOM   3639  C  C     . HIS E 1  113 ? -20.177 -21.557 71.351 1.00 58.76  ? 113  HIS E C     1 
ATOM   3640  O  O     . HIS E 1  113 ? -21.234 -21.332 71.926 1.00 58.78  ? 113  HIS E O     1 
ATOM   3641  C  CB    . HIS E 1  113 ? -20.223 -21.095 68.906 1.00 55.12  ? 113  HIS E CB    1 
ATOM   3642  C  CG    . HIS E 1  113 ? -21.708 -21.043 68.806 1.00 53.66  ? 113  HIS E CG    1 
ATOM   3643  N  ND1   . HIS E 1  113 ? -22.377 -19.891 68.627 1.00 52.16  ? 113  HIS E ND1   1 
ATOM   3644  C  CD2   . HIS E 1  113 ? -22.656 -22.062 68.808 1.00 55.99  ? 113  HIS E CD2   1 
ATOM   3645  C  CE1   . HIS E 1  113 ? -23.693 -20.149 68.556 1.00 57.03  ? 113  HIS E CE1   1 
ATOM   3646  N  NE2   . HIS E 1  113 ? -23.865 -21.486 68.659 1.00 58.71  ? 113  HIS E NE2   1 
ATOM   3647  N  N     . ALA E 1  114 ? -19.378 -22.580 71.657 1.00 63.28  ? 114  ALA E N     1 
ATOM   3648  C  CA    . ALA E 1  114 ? -19.708 -23.623 72.620 1.00 59.72  ? 114  ALA E CA    1 
ATOM   3649  C  C     . ALA E 1  114 ? -19.214 -23.233 73.993 1.00 63.72  ? 114  ALA E C     1 
ATOM   3650  O  O     . ALA E 1  114 ? -19.199 -24.047 74.915 1.00 62.17  ? 114  ALA E O     1 
ATOM   3651  C  CB    . ALA E 1  114 ? -19.062 -24.928 72.196 1.00 54.78  ? 114  ALA E CB    1 
ATOM   3652  N  N     . LYS E 1  115 ? -18.780 -21.985 74.115 1.00 67.44  ? 115  LYS E N     1 
ATOM   3653  C  CA    . LYS E 1  115 ? -18.170 -21.481 75.346 1.00 62.76  ? 115  LYS E CA    1 
ATOM   3654  C  C     . LYS E 1  115 ? -16.891 -22.226 75.749 1.00 59.95  ? 115  LYS E C     1 
ATOM   3655  O  O     . LYS E 1  115 ? -16.562 -22.308 76.924 1.00 63.78  ? 115  LYS E O     1 
ATOM   3656  C  CB    . LYS E 1  115 ? -19.211 -21.448 76.456 1.00 60.29  ? 115  LYS E CB    1 
ATOM   3657  C  CG    . LYS E 1  115 ? -20.445 -20.700 76.002 1.00 64.67  ? 115  LYS E CG    1 
ATOM   3658  C  CD    . LYS E 1  115 ? -21.438 -20.453 77.116 1.00 70.09  ? 115  LYS E CD    1 
ATOM   3659  C  CE    . LYS E 1  115 ? -22.303 -19.255 76.757 1.00 78.75  ? 115  LYS E CE    1 
ATOM   3660  N  NZ    . LYS E 1  115 ? -23.260 -18.943 77.855 1.00 90.31  ? 115  LYS E NZ    1 
ATOM   3661  N  N     . ARG E 1  116 ? -16.162 -22.751 74.768 1.00 54.91  ? 116  ARG E N     1 
ATOM   3662  C  CA    . ARG E 1  116 ? -14.845 -23.329 75.023 1.00 54.94  ? 116  ARG E CA    1 
ATOM   3663  C  C     . ARG E 1  116 ? -13.744 -22.481 74.370 1.00 55.53  ? 116  ARG E C     1 
ATOM   3664  O  O     . ARG E 1  116 ? -14.023 -21.585 73.561 1.00 59.22  ? 116  ARG E O     1 
ATOM   3665  C  CB    . ARG E 1  116 ? -14.778 -24.759 74.472 1.00 57.37  ? 116  ARG E CB    1 
ATOM   3666  C  CG    . ARG E 1  116 ? -15.746 -25.756 75.094 1.00 51.65  ? 116  ARG E CG    1 
ATOM   3667  C  CD    . ARG E 1  116 ? -15.558 -27.098 74.413 1.00 51.36  ? 116  ARG E CD    1 
ATOM   3668  N  NE    . ARG E 1  116 ? -16.465 -27.290 73.270 1.00 55.81  ? 116  ARG E NE    1 
ATOM   3669  C  CZ    . ARG E 1  116 ? -16.124 -27.307 71.973 1.00 49.03  ? 116  ARG E CZ    1 
ATOM   3670  N  NH1   . ARG E 1  116 ? -14.879 -27.147 71.560 1.00 46.59  ? 116  ARG E NH1   1 
ATOM   3671  N  NH2   . ARG E 1  116 ? -17.052 -27.519 71.072 1.00 48.45  ? 116  ARG E NH2   1 
ATOM   3672  N  N     . VAL E 1  117 ? -12.494 -22.772 74.710 1.00 55.18  ? 117  VAL E N     1 
ATOM   3673  C  CA    . VAL E 1  117 ? -11.345 -22.184 74.013 1.00 54.14  ? 117  VAL E CA    1 
ATOM   3674  C  C     . VAL E 1  117 ? -10.509 -23.288 73.343 1.00 53.23  ? 117  VAL E C     1 
ATOM   3675  O  O     . VAL E 1  117 ? -9.507  -23.023 72.662 1.00 57.05  ? 117  VAL E O     1 
ATOM   3676  C  CB    . VAL E 1  117 ? -10.490 -21.317 74.962 1.00 51.24  ? 117  VAL E CB    1 
ATOM   3677  C  CG1   . VAL E 1  117 ? -11.358 -20.259 75.590 1.00 54.21  ? 117  VAL E CG1   1 
ATOM   3678  C  CG2   . VAL E 1  117 ? -9.846  -22.169 76.056 1.00 54.19  ? 117  VAL E CG2   1 
ATOM   3679  N  N     . THR E 1  118 ? -10.936 -24.527 73.536 1.00 52.33  ? 118  THR E N     1 
ATOM   3680  C  CA    . THR E 1  118 ? -10.246 -25.675 72.960 1.00 57.83  ? 118  THR E CA    1 
ATOM   3681  C  C     . THR E 1  118 ? -10.925 -26.248 71.705 1.00 52.82  ? 118  THR E C     1 
ATOM   3682  O  O     . THR E 1  118 ? -12.031 -26.775 71.781 1.00 51.81  ? 118  THR E O     1 
ATOM   3683  C  CB    . THR E 1  118 ? -10.150 -26.800 74.007 1.00 59.80  ? 118  THR E CB    1 
ATOM   3684  O  OG1   . THR E 1  118 ? -9.789  -26.231 75.267 1.00 64.04  ? 118  THR E OG1   1 
ATOM   3685  C  CG2   . THR E 1  118 ? -9.107  -27.845 73.600 1.00 60.76  ? 118  THR E CG2   1 
ATOM   3686  N  N     . ILE E 1  119 ? -10.261 -26.198 70.563 1.00 49.14  ? 119  ILE E N     1 
ATOM   3687  C  CA    . ILE E 1  119 ? -10.851 -26.834 69.371 1.00 51.52  ? 119  ILE E CA    1 
ATOM   3688  C  C     . ILE E 1  119 ? -10.923 -28.385 69.473 1.00 51.63  ? 119  ILE E C     1 
ATOM   3689  O  O     . ILE E 1  119 ? -9.987  -29.031 69.925 1.00 50.29  ? 119  ILE E O     1 
ATOM   3690  C  CB    . ILE E 1  119 ? -10.205 -26.351 68.062 1.00 43.59  ? 119  ILE E CB    1 
ATOM   3691  C  CG1   . ILE E 1  119 ? -8.733  -26.723 67.993 1.00 44.93  ? 119  ILE E CG1   1 
ATOM   3692  C  CG2   . ILE E 1  119 ? -10.279 -24.862 67.995 1.00 43.38  ? 119  ILE E CG2   1 
ATOM   3693  C  CD1   . ILE E 1  119 ? -8.185  -26.759 66.585 1.00 45.29  ? 119  ILE E CD1   1 
ATOM   3694  N  N     . MET E 1  120 ? -12.056 -28.963 69.086 1.00 52.27  ? 120  MET E N     1 
ATOM   3695  C  CA    . MET E 1  120 ? -12.247 -30.418 69.146 1.00 51.93  ? 120  MET E CA    1 
ATOM   3696  C  C     . MET E 1  120 ? -12.764 -30.932 67.804 1.00 54.38  ? 120  MET E C     1 
ATOM   3697  O  O     . MET E 1  120 ? -13.262 -30.149 66.988 1.00 58.92  ? 120  MET E O     1 
ATOM   3698  C  CB    . MET E 1  120 ? -13.222 -30.782 70.257 1.00 50.87  ? 120  MET E CB    1 
ATOM   3699  C  CG    . MET E 1  120 ? -12.911 -30.096 71.563 1.00 54.77  ? 120  MET E CG    1 
ATOM   3700  S  SD    . MET E 1  120 ? -13.803 -30.729 72.984 1.00 60.87  ? 120  MET E SD    1 
ATOM   3701  C  CE    . MET E 1  120 ? -15.524 -30.576 72.530 1.00 68.58  ? 120  MET E CE    1 
ATOM   3702  N  N     . PRO E 1  121 ? -12.663 -32.249 67.560 1.00 54.04  ? 121  PRO E N     1 
ATOM   3703  C  CA    . PRO E 1  121 ? -13.097 -32.733 66.264 1.00 54.11  ? 121  PRO E CA    1 
ATOM   3704  C  C     . PRO E 1  121 ? -14.531 -32.321 65.940 1.00 56.17  ? 121  PRO E C     1 
ATOM   3705  O  O     . PRO E 1  121 ? -14.841 -31.993 64.782 1.00 58.87  ? 121  PRO E O     1 
ATOM   3706  C  CB    . PRO E 1  121 ? -12.944 -34.243 66.405 1.00 52.64  ? 121  PRO E CB    1 
ATOM   3707  C  CG    . PRO E 1  121 ? -11.740 -34.360 67.270 1.00 52.61  ? 121  PRO E CG    1 
ATOM   3708  C  CD    . PRO E 1  121 ? -12.050 -33.340 68.338 1.00 55.38  ? 121  PRO E CD    1 
ATOM   3709  N  N     . LYS E 1  122 ? -15.387 -32.295 66.953 1.00 53.16  ? 122  LYS E N     1 
ATOM   3710  C  CA    . LYS E 1  122 ? -16.749 -31.880 66.721 1.00 52.75  ? 122  LYS E CA    1 
ATOM   3711  C  C     . LYS E 1  122 ? -16.813 -30.481 66.129 1.00 52.00  ? 122  LYS E C     1 
ATOM   3712  O  O     . LYS E 1  122 ? -17.733 -30.188 65.382 1.00 54.23  ? 122  LYS E O     1 
ATOM   3713  C  CB    . LYS E 1  122 ? -17.618 -32.013 67.995 1.00 57.07  ? 122  LYS E CB    1 
ATOM   3714  C  CG    . LYS E 1  122 ? -17.326 -31.062 69.147 1.00 55.15  ? 122  LYS E CG    1 
ATOM   3715  C  CD    . LYS E 1  122 ? -17.672 -31.683 70.495 1.00 56.79  ? 122  LYS E CD    1 
ATOM   3716  C  CE    . LYS E 1  122 ? -19.139 -31.540 70.870 1.00 68.06  ? 122  LYS E CE    1 
ATOM   3717  N  NZ    . LYS E 1  122 ? -19.548 -32.523 71.922 1.00 70.81  ? 122  LYS E NZ    1 
ATOM   3718  N  N     . ASP E 1  123 ? -15.843 -29.624 66.455 1.00 49.36  ? 123  ASP E N     1 
ATOM   3719  C  CA    . ASP E 1  123 ? -15.878 -28.250 65.966 1.00 48.83  ? 123  ASP E CA    1 
ATOM   3720  C  C     . ASP E 1  123 ? -15.566 -28.271 64.479 1.00 51.75  ? 123  ASP E C     1 
ATOM   3721  O  O     . ASP E 1  123 ? -16.263 -27.657 63.675 1.00 54.01  ? 123  ASP E O     1 
ATOM   3722  C  CB    . ASP E 1  123 ? -14.918 -27.348 66.719 1.00 46.03  ? 123  ASP E CB    1 
ATOM   3723  C  CG    . ASP E 1  123 ? -15.261 -27.226 68.202 1.00 50.73  ? 123  ASP E CG    1 
ATOM   3724  O  OD1   . ASP E 1  123 ? -16.439 -27.016 68.510 1.00 49.06  ? 123  ASP E OD1   1 
ATOM   3725  O  OD2   . ASP E 1  123 ? -14.351 -27.333 69.066 1.00 50.83  ? 123  ASP E OD2   1 
ATOM   3726  N  N     . ILE E 1  124 ? -14.543 -29.024 64.104 1.00 51.64  ? 124  ILE E N     1 
ATOM   3727  C  CA    . ILE E 1  124 ? -14.189 -29.158 62.703 1.00 49.43  ? 124  ILE E CA    1 
ATOM   3728  C  C     . ILE E 1  124 ? -15.367 -29.698 61.912 1.00 53.94  ? 124  ILE E C     1 
ATOM   3729  O  O     . ILE E 1  124 ? -15.696 -29.181 60.841 1.00 55.13  ? 124  ILE E O     1 
ATOM   3730  C  CB    . ILE E 1  124 ? -13.006 -30.108 62.508 1.00 48.93  ? 124  ILE E CB    1 
ATOM   3731  C  CG1   . ILE E 1  124 ? -11.752 -29.562 63.189 1.00 48.16  ? 124  ILE E CG1   1 
ATOM   3732  C  CG2   . ILE E 1  124 ? -12.689 -30.271 61.032 1.00 48.60  ? 124  ILE E CG2   1 
ATOM   3733  C  CD1   . ILE E 1  124 ? -10.510 -30.349 62.807 1.00 43.82  ? 124  ILE E CD1   1 
ATOM   3734  N  N     . GLN E 1  125 ? -15.993 -30.741 62.451 1.00 54.53  ? 125  GLN E N     1 
ATOM   3735  C  CA    . GLN E 1  125 ? -17.188 -31.309 61.864 1.00 51.01  ? 125  GLN E CA    1 
ATOM   3736  C  C     . GLN E 1  125 ? -18.332 -30.320 61.717 1.00 49.50  ? 125  GLN E C     1 
ATOM   3737  O  O     . GLN E 1  125 ? -19.024 -30.343 60.724 1.00 56.28  ? 125  GLN E O     1 
ATOM   3738  C  CB    . GLN E 1  125 ? -17.613 -32.530 62.653 1.00 52.89  ? 125  GLN E CB    1 
ATOM   3739  C  CG    . GLN E 1  125 ? -16.747 -33.721 62.315 1.00 55.20  ? 125  GLN E CG    1 
ATOM   3740  C  CD    . GLN E 1  125 ? -16.548 -34.670 63.469 1.00 56.97  ? 125  GLN E CD    1 
ATOM   3741  O  OE1   . GLN E 1  125 ? -17.400 -34.807 64.348 1.00 56.45  ? 125  GLN E OE1   1 
ATOM   3742  N  NE2   . GLN E 1  125 ? -15.401 -35.345 63.469 1.00 58.17  ? 125  GLN E NE2   1 
ATOM   3743  N  N     . LEU E 1  126 ? -18.533 -29.427 62.675 1.00 51.24  ? 126  LEU E N     1 
ATOM   3744  C  CA    . LEU E 1  126 ? -19.670 -28.515 62.546 1.00 47.77  ? 126  LEU E CA    1 
ATOM   3745  C  C     . LEU E 1  126 ? -19.355 -27.564 61.419 1.00 47.56  ? 126  LEU E C     1 
ATOM   3746  O  O     . LEU E 1  126 ? -20.214 -27.285 60.614 1.00 53.01  ? 126  LEU E O     1 
ATOM   3747  C  CB    . LEU E 1  126 ? -20.017 -27.798 63.856 1.00 44.42  ? 126  LEU E CB    1 
ATOM   3748  C  CG    . LEU E 1  126 ? -21.181 -26.824 63.700 1.00 45.76  ? 126  LEU E CG    1 
ATOM   3749  C  CD1   . LEU E 1  126 ? -22.453 -27.533 63.331 1.00 47.56  ? 126  LEU E CD1   1 
ATOM   3750  C  CD2   . LEU E 1  126 ? -21.428 -25.962 64.931 1.00 48.05  ? 126  LEU E CD2   1 
ATOM   3751  N  N     . ALA E 1  127 ? -18.097 -27.129 61.343 1.00 47.35  ? 127  ALA E N     1 
ATOM   3752  C  CA    . ALA E 1  127 ? -17.634 -26.183 60.341 1.00 47.10  ? 127  ALA E CA    1 
ATOM   3753  C  C     . ALA E 1  127 ? -17.848 -26.738 58.961 1.00 51.86  ? 127  ALA E C     1 
ATOM   3754  O  O     . ALA E 1  127 ? -18.345 -26.041 58.072 1.00 53.94  ? 127  ALA E O     1 
ATOM   3755  C  CB    . ALA E 1  127 ? -16.165 -25.874 60.534 1.00 44.38  ? 127  ALA E CB    1 
ATOM   3756  N  N     . ARG E 1  128 ? -17.468 -27.997 58.781 1.00 52.49  ? 128  ARG E N     1 
ATOM   3757  C  CA    . ARG E 1  128 ? -17.493 -28.584 57.470 1.00 48.69  ? 128  ARG E CA    1 
ATOM   3758  C  C     . ARG E 1  128 ? -18.913 -28.882 57.039 1.00 52.83  ? 128  ARG E C     1 
ATOM   3759  O  O     . ARG E 1  128 ? -19.200 -28.783 55.845 1.00 58.52  ? 128  ARG E O     1 
ATOM   3760  C  CB    . ARG E 1  128 ? -16.611 -29.805 57.403 1.00 48.99  ? 128  ARG E CB    1 
ATOM   3761  C  CG    . ARG E 1  128 ? -15.143 -29.538 57.696 1.00 49.87  ? 128  ARG E CG    1 
ATOM   3762  C  CD    . ARG E 1  128 ? -14.250 -30.353 56.772 1.00 53.86  ? 128  ARG E CD    1 
ATOM   3763  N  NE    . ARG E 1  128 ? -14.664 -31.755 56.735 1.00 59.51  ? 128  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E 1  128 ? -14.688 -32.517 55.649 1.00 62.75  ? 128  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E 1  128 ? -14.317 -32.045 54.457 1.00 64.51  ? 128  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E 1  128 ? -15.096 -33.770 55.767 1.00 73.28  ? 128  ARG E NH2   1 
ATOM   3767  N  N     . ARG E 1  129 ? -19.811 -29.216 57.980 1.00 51.64  ? 129  ARG E N     1 
ATOM   3768  C  CA    . ARG E 1  129 ? -21.218 -29.406 57.611 1.00 53.36  ? 129  ARG E CA    1 
ATOM   3769  C  C     . ARG E 1  129 ? -21.774 -28.085 57.142 1.00 53.08  ? 129  ARG E C     1 
ATOM   3770  O  O     . ARG E 1  129 ? -22.235 -27.979 56.022 1.00 54.68  ? 129  ARG E O     1 
ATOM   3771  C  CB    . ARG E 1  129 ? -22.085 -29.984 58.735 1.00 55.69  ? 129  ARG E CB    1 
ATOM   3772  C  CG    . ARG E 1  129 ? -23.551 -30.245 58.336 1.00 59.97  ? 129  ARG E CG    1 
ATOM   3773  C  CD    . ARG E 1  129 ? -24.081 -31.412 59.159 1.00 71.15  ? 129  ARG E CD    1 
ATOM   3774  N  NE    . ARG E 1  129 ? -25.492 -31.756 58.910 1.00 86.47  ? 129  ARG E NE    1 
ATOM   3775  C  CZ    . ARG E 1  129 ? -26.253 -32.539 59.701 1.00 84.98  ? 129  ARG E CZ    1 
ATOM   3776  N  NH1   . ARG E 1  129 ? -25.773 -33.079 60.825 1.00 75.89  ? 129  ARG E NH1   1 
ATOM   3777  N  NH2   . ARG E 1  129 ? -27.528 -32.769 59.380 1.00 89.13  ? 129  ARG E NH2   1 
ATOM   3778  N  N     . ILE E 1  130 ? -21.686 -27.070 57.988 1.00 53.23  ? 130  ILE E N     1 
ATOM   3779  C  CA    . ILE E 1  130 ? -22.205 -25.767 57.638 1.00 55.44  ? 130  ILE E CA    1 
ATOM   3780  C  C     . ILE E 1  130 ? -21.617 -25.233 56.341 1.00 54.48  ? 130  ILE E C     1 
ATOM   3781  O  O     . ILE E 1  130 ? -22.341 -24.675 55.546 1.00 58.60  ? 130  ILE E O     1 
ATOM   3782  C  CB    . ILE E 1  130 ? -22.041 -24.767 58.778 1.00 57.79  ? 130  ILE E CB    1 
ATOM   3783  C  CG1   . ILE E 1  130 ? -22.794 -25.300 60.004 1.00 59.79  ? 130  ILE E CG1   1 
ATOM   3784  C  CG2   . ILE E 1  130 ? -22.561 -23.400 58.357 1.00 53.91  ? 130  ILE E CG2   1 
ATOM   3785  C  CD1   . ILE E 1  130 ? -22.331 -24.656 61.282 1.00 65.91  ? 130  ILE E CD1   1 
ATOM   3786  N  N     . ARG E 1  131 ? -20.322 -25.431 56.118 1.00 55.94  ? 131  ARG E N     1 
ATOM   3787  C  CA    . ARG E 1  131 ? -19.663 -25.030 54.866 1.00 53.91  ? 131  ARG E CA    1 
ATOM   3788  C  C     . ARG E 1  131 ? -20.209 -25.774 53.629 1.00 57.08  ? 131  ARG E C     1 
ATOM   3789  O  O     . ARG E 1  131 ? -19.851 -25.462 52.492 1.00 60.27  ? 131  ARG E O     1 
ATOM   3790  C  CB    . ARG E 1  131 ? -18.167 -25.302 54.963 1.00 48.74  ? 131  ARG E CB    1 
ATOM   3791  C  CG    . ARG E 1  131 ? -17.345 -24.202 55.574 1.00 48.54  ? 131  ARG E CG    1 
ATOM   3792  C  CD    . ARG E 1  131 ? -15.946 -24.753 55.781 1.00 48.26  ? 131  ARG E CD    1 
ATOM   3793  N  NE    . ARG E 1  131 ? -14.922 -23.748 56.044 1.00 46.11  ? 131  ARG E NE    1 
ATOM   3794  C  CZ    . ARG E 1  131 ? -13.682 -23.847 55.574 1.00 52.57  ? 131  ARG E CZ    1 
ATOM   3795  N  NH1   . ARG E 1  131 ? -13.343 -24.883 54.815 1.00 52.75  ? 131  ARG E NH1   1 
ATOM   3796  N  NH2   . ARG E 1  131 ? -12.769 -22.922 55.836 1.00 55.44  ? 131  ARG E NH2   1 
ATOM   3797  N  N     . GLY E 1  132 ? -21.043 -26.779 53.842 1.00 51.78  ? 132  GLY E N     1 
ATOM   3798  C  CA    . GLY E 1  132 ? -21.498 -27.569 52.736 1.00 54.48  ? 132  GLY E CA    1 
ATOM   3799  C  C     . GLY E 1  132 ? -20.445 -28.499 52.182 1.00 60.68  ? 132  GLY E C     1 
ATOM   3800  O  O     . GLY E 1  132 ? -20.537 -28.921 51.047 1.00 70.13  ? 132  GLY E O     1 
ATOM   3801  N  N     . GLU E 1  133 ? -19.439 -28.842 52.973 1.00 68.33  ? 133  GLU E N     1 
ATOM   3802  C  CA    . GLU E 1  133 ? -18.506 -29.903 52.577 1.00 68.97  ? 133  GLU E CA    1 
ATOM   3803  C  C     . GLU E 1  133 ? -19.097 -31.286 52.886 1.00 76.24  ? 133  GLU E C     1 
ATOM   3804  O  O     . GLU E 1  133 ? -18.539 -32.320 52.527 1.00 81.83  ? 133  GLU E O     1 
ATOM   3805  C  CB    . GLU E 1  133 ? -17.127 -29.676 53.212 1.00 64.21  ? 133  GLU E CB    1 
ATOM   3806  C  CG    . GLU E 1  133 ? -16.331 -28.584 52.508 1.00 62.28  ? 133  GLU E CG    1 
ATOM   3807  C  CD    . GLU E 1  133 ? -15.133 -28.053 53.291 1.00 66.57  ? 133  GLU E CD    1 
ATOM   3808  O  OE1   . GLU E 1  133 ? -14.319 -28.866 53.796 1.00 63.57  ? 133  GLU E OE1   1 
ATOM   3809  O  OE2   . GLU E 1  133 ? -14.995 -26.803 53.379 1.00 66.11  ? 133  GLU E OE2   1 
ATOM   3810  N  N     . ARG E 1  134 ? -20.236 -31.283 53.573 1.00 91.32  ? 134  ARG E N     1 
ATOM   3811  C  CA    . ARG E 1  134 ? -21.131 -32.441 53.659 1.00 97.81  ? 134  ARG E CA    1 
ATOM   3812  C  C     . ARG E 1  134 ? -22.592 -31.981 53.662 1.00 96.24  ? 134  ARG E C     1 
ATOM   3813  O  O     . ARG E 1  134 ? -22.928 -30.927 54.216 1.00 79.61  ? 134  ARG E O     1 
ATOM   3814  C  CB    . ARG E 1  134 ? -20.847 -33.267 54.907 1.00 102.27 ? 134  ARG E CB    1 
ATOM   3815  C  CG    . ARG E 1  134 ? -19.605 -34.140 54.818 1.00 107.24 ? 134  ARG E CG    1 
ATOM   3816  C  CD    . ARG E 1  134 ? -19.172 -34.495 56.220 1.00 108.45 ? 134  ARG E CD    1 
ATOM   3817  N  NE    . ARG E 1  134 ? -19.208 -33.285 57.042 1.00 117.50 ? 134  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E 1  134 ? -19.270 -33.257 58.375 1.00 114.91 ? 134  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E 1  134 ? -19.311 -34.386 59.089 1.00 107.64 ? 134  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E 1  134 ? -19.291 -32.086 58.996 1.00 96.41  ? 134  ARG E NH2   1 
ATOM   3821  N  N     . LYS F 2  16  ? 14.323  -47.469 33.918 1.00 146.61 ? 16   LYS F N     1 
ATOM   3822  C  CA    . LYS F 2  16  ? 14.448  -47.277 35.399 1.00 148.71 ? 16   LYS F CA    1 
ATOM   3823  C  C     . LYS F 2  16  ? 14.451  -48.606 36.157 1.00 143.58 ? 16   LYS F C     1 
ATOM   3824  O  O     . LYS F 2  16  ? 13.587  -49.464 35.932 1.00 139.24 ? 16   LYS F O     1 
ATOM   3825  C  CB    . LYS F 2  16  ? 13.332  -46.362 35.939 1.00 149.11 ? 16   LYS F CB    1 
ATOM   3826  C  CG    . LYS F 2  16  ? 11.922  -46.917 35.771 1.00 151.28 ? 16   LYS F CG    1 
ATOM   3827  C  CD    . LYS F 2  16  ? 10.942  -46.290 36.744 1.00 149.53 ? 16   LYS F CD    1 
ATOM   3828  C  CE    . LYS F 2  16  ? 9.633   -47.062 36.758 1.00 144.50 ? 16   LYS F CE    1 
ATOM   3829  N  NZ    . LYS F 2  16  ? 8.559   -46.303 37.457 1.00 150.38 ? 16   LYS F NZ    1 
ATOM   3830  N  N     . ARG F 2  17  ? 15.430  -48.763 37.048 1.00 144.32 ? 17   ARG F N     1 
ATOM   3831  C  CA    . ARG F 2  17  ? 15.492  -49.912 37.955 1.00 140.08 ? 17   ARG F CA    1 
ATOM   3832  C  C     . ARG F 2  17  ? 15.002  -49.594 39.371 1.00 141.12 ? 17   ARG F C     1 
ATOM   3833  O  O     . ARG F 2  17  ? 15.638  -48.818 40.100 1.00 143.65 ? 17   ARG F O     1 
ATOM   3834  C  CB    . ARG F 2  17  ? 16.898  -50.509 38.004 1.00 133.48 ? 17   ARG F CB    1 
ATOM   3835  C  CG    . ARG F 2  17  ? 16.997  -51.838 37.280 1.00 147.91 ? 17   ARG F CG    1 
ATOM   3836  C  CD    . ARG F 2  17  ? 18.000  -52.763 37.951 1.00 156.77 ? 17   ARG F CD    1 
ATOM   3837  N  NE    . ARG F 2  17  ? 18.540  -53.731 36.996 1.00 156.37 ? 17   ARG F NE    1 
ATOM   3838  C  CZ    . ARG F 2  17  ? 19.605  -54.502 37.210 1.00 147.77 ? 17   ARG F CZ    1 
ATOM   3839  N  NH1   . ARG F 2  17  ? 20.265  -54.440 38.363 1.00 147.53 ? 17   ARG F NH1   1 
ATOM   3840  N  NH2   . ARG F 2  17  ? 20.011  -55.338 36.262 1.00 134.62 ? 17   ARG F NH2   1 
ATOM   3841  N  N     . HIS F 2  18  ? 13.873  -50.212 39.738 1.00 137.99 ? 18   HIS F N     1 
ATOM   3842  C  CA    . HIS F 2  18  ? 13.265  -50.158 41.088 1.00 136.72 ? 18   HIS F CA    1 
ATOM   3843  C  C     . HIS F 2  18  ? 12.589  -48.843 41.329 1.00 127.47 ? 18   HIS F C     1 
ATOM   3844  O  O     . HIS F 2  18  ? 12.979  -47.825 40.756 1.00 130.83 ? 18   HIS F O     1 
ATOM   3845  C  CB    . HIS F 2  18  ? 14.266  -50.536 42.199 1.00 143.69 ? 18   HIS F CB    1 
ATOM   3846  C  CG    . HIS F 2  18  ? 15.164  -51.712 41.833 1.00 155.44 ? 18   HIS F CG    1 
ATOM   3847  N  ND1   . HIS F 2  18  ? 14.727  -52.994 41.841 1.00 156.47 ? 18   HIS F ND1   1 
ATOM   3848  C  CD2   . HIS F 2  18  ? 16.500  -51.756 41.405 1.00 156.03 ? 18   HIS F CD2   1 
ATOM   3849  C  CE1   . HIS F 2  18  ? 15.730  -53.817 41.452 1.00 156.35 ? 18   HIS F CE1   1 
ATOM   3850  N  NE2   . HIS F 2  18  ? 16.813  -53.059 41.185 1.00 156.10 ? 18   HIS F NE2   1 
ATOM   3851  N  N     . ARG F 2  19  ? 11.545  -48.855 42.154 1.00 122.27 ? 19   ARG F N     1 
ATOM   3852  C  CA    . ARG F 2  19  ? 10.700  -47.673 42.331 1.00 115.92 ? 19   ARG F CA    1 
ATOM   3853  C  C     . ARG F 2  19  ? 10.068  -47.632 43.733 1.00 112.89 ? 19   ARG F C     1 
ATOM   3854  O  O     . ARG F 2  19  ? 8.945   -48.113 43.912 1.00 117.63 ? 19   ARG F O     1 
ATOM   3855  C  CB    . ARG F 2  19  ? 9.625   -47.634 41.223 1.00 112.30 ? 19   ARG F CB    1 
ATOM   3856  C  CG    . ARG F 2  19  ? 9.205   -46.234 40.778 1.00 122.60 ? 19   ARG F CG    1 
ATOM   3857  C  CD    . ARG F 2  19  ? 8.144   -45.626 41.692 1.00 127.55 ? 19   ARG F CD    1 
ATOM   3858  N  NE    . ARG F 2  19  ? 8.396   -44.211 41.999 1.00 131.69 ? 19   ARG F NE    1 
ATOM   3859  C  CZ    . ARG F 2  19  ? 7.909   -43.564 43.062 1.00 132.74 ? 19   ARG F CZ    1 
ATOM   3860  N  NH1   . ARG F 2  19  ? 7.137   -44.195 43.940 1.00 125.04 ? 19   ARG F NH1   1 
ATOM   3861  N  NH2   . ARG F 2  19  ? 8.194   -42.277 43.256 1.00 131.92 ? 19   ARG F NH2   1 
ATOM   3862  N  N     . LYS F 2  20  ? 10.788  -47.043 44.702 1.00 105.45 ? 20   LYS F N     1 
ATOM   3863  C  CA    . LYS F 2  20  ? 10.431  -47.040 46.147 1.00 100.28 ? 20   LYS F CA    1 
ATOM   3864  C  C     . LYS F 2  20  ? 8.929   -46.950 46.508 1.00 94.22  ? 20   LYS F C     1 
ATOM   3865  O  O     . LYS F 2  20  ? 8.217   -46.112 45.965 1.00 96.95  ? 20   LYS F O     1 
ATOM   3866  C  CB    . LYS F 2  20  ? 11.203  -45.926 46.873 1.00 102.58 ? 20   LYS F CB    1 
ATOM   3867  C  CG    . LYS F 2  20  ? 11.013  -45.903 48.390 1.00 112.41 ? 20   LYS F CG    1 
ATOM   3868  C  CD    . LYS F 2  20  ? 11.277  -47.262 49.048 1.00 116.41 ? 20   LYS F CD    1 
ATOM   3869  C  CE    . LYS F 2  20  ? 10.947  -47.222 50.539 1.00 126.64 ? 20   LYS F CE    1 
ATOM   3870  N  NZ    . LYS F 2  20  ? 11.934  -47.993 51.346 1.00 130.33 ? 20   LYS F NZ    1 
ATOM   3871  N  N     . VAL F 2  21  ? 8.476   -47.794 47.443 1.00 79.35  ? 21   VAL F N     1 
ATOM   3872  C  CA    . VAL F 2  21  ? 7.053   -47.893 47.811 1.00 70.91  ? 21   VAL F CA    1 
ATOM   3873  C  C     . VAL F 2  21  ? 6.656   -46.772 48.755 1.00 72.64  ? 21   VAL F C     1 
ATOM   3874  O  O     . VAL F 2  21  ? 7.293   -46.588 49.797 1.00 77.83  ? 21   VAL F O     1 
ATOM   3875  C  CB    . VAL F 2  21  ? 6.712   -49.255 48.483 1.00 65.58  ? 21   VAL F CB    1 
ATOM   3876  C  CG1   . VAL F 2  21  ? 5.318   -49.270 49.065 1.00 64.29  ? 21   VAL F CG1   1 
ATOM   3877  C  CG2   . VAL F 2  21  ? 6.809   -50.379 47.486 1.00 70.34  ? 21   VAL F CG2   1 
ATOM   3878  N  N     . LEU F 2  22  ? 5.594   -46.046 48.391 1.00 65.61  ? 22   LEU F N     1 
ATOM   3879  C  CA    . LEU F 2  22  ? 5.067   -44.958 49.206 1.00 59.42  ? 22   LEU F CA    1 
ATOM   3880  C  C     . LEU F 2  22  ? 3.954   -45.471 50.090 1.00 59.24  ? 22   LEU F C     1 
ATOM   3881  O  O     . LEU F 2  22  ? 2.953   -45.993 49.596 1.00 60.62  ? 22   LEU F O     1 
ATOM   3882  C  CB    . LEU F 2  22  ? 4.537   -43.812 48.330 1.00 57.44  ? 22   LEU F CB    1 
ATOM   3883  C  CG    . LEU F 2  22  ? 5.529   -43.113 47.391 1.00 61.83  ? 22   LEU F CG    1 
ATOM   3884  C  CD1   . LEU F 2  22  ? 4.847   -42.364 46.252 1.00 66.37  ? 22   LEU F CD1   1 
ATOM   3885  C  CD2   . LEU F 2  22  ? 6.441   -42.184 48.158 1.00 69.06  ? 22   LEU F CD2   1 
ATOM   3886  N  N     . ARG F 2  23  ? 4.107   -45.317 51.401 1.00 57.97  ? 23   ARG F N     1 
ATOM   3887  C  CA    . ARG F 2  23  ? 3.023   -45.673 52.314 1.00 56.68  ? 23   ARG F CA    1 
ATOM   3888  C  C     . ARG F 2  23  ? 3.063   -44.851 53.570 1.00 59.23  ? 23   ARG F C     1 
ATOM   3889  O  O     . ARG F 2  23  ? 4.137   -44.527 54.049 1.00 64.03  ? 23   ARG F O     1 
ATOM   3890  C  CB    . ARG F 2  23  ? 3.057   -47.163 52.674 1.00 56.98  ? 23   ARG F CB    1 
ATOM   3891  C  CG    . ARG F 2  23  ? 4.437   -47.696 52.984 1.00 61.64  ? 23   ARG F CG    1 
ATOM   3892  C  CD    . ARG F 2  23  ? 4.484   -49.207 52.870 1.00 58.50  ? 23   ARG F CD    1 
ATOM   3893  N  NE    . ARG F 2  23  ? 4.145   -49.796 54.155 1.00 56.50  ? 23   ARG F NE    1 
ATOM   3894  C  CZ    . ARG F 2  23  ? 5.024   -50.163 55.085 1.00 49.64  ? 23   ARG F CZ    1 
ATOM   3895  N  NH1   . ARG F 2  23  ? 6.338   -50.036 54.899 1.00 44.41  ? 23   ARG F NH1   1 
ATOM   3896  N  NH2   . ARG F 2  23  ? 4.561   -50.664 56.215 1.00 49.81  ? 23   ARG F NH2   1 
ATOM   3897  N  N     . ASP F 2  24  ? 1.882   -44.511 54.093 1.00 63.04  ? 24   ASP F N     1 
ATOM   3898  C  CA    . ASP F 2  24  ? 1.732   -43.829 55.388 1.00 58.03  ? 24   ASP F CA    1 
ATOM   3899  C  C     . ASP F 2  24  ? 2.241   -42.382 55.431 1.00 61.45  ? 24   ASP F C     1 
ATOM   3900  O  O     . ASP F 2  24  ? 2.383   -41.781 56.498 1.00 58.86  ? 24   ASP F O     1 
ATOM   3901  C  CB    . ASP F 2  24  ? 2.417   -44.633 56.472 1.00 57.56  ? 24   ASP F CB    1 
ATOM   3902  C  CG    . ASP F 2  24  ? 1.808   -44.409 57.811 1.00 61.46  ? 24   ASP F CG    1 
ATOM   3903  O  OD1   . ASP F 2  24  ? 0.584   -44.190 57.852 1.00 63.77  ? 24   ASP F OD1   1 
ATOM   3904  O  OD2   . ASP F 2  24  ? 2.538   -44.469 58.825 1.00 65.87  ? 24   ASP F OD2   1 
ATOM   3905  N  N     . ASN F 2  25  ? 2.513   -41.812 54.270 1.00 60.56  ? 25   ASN F N     1 
ATOM   3906  C  CA    . ASN F 2  25  ? 3.006   -40.461 54.213 1.00 57.26  ? 25   ASN F CA    1 
ATOM   3907  C  C     . ASN F 2  25  ? 2.157   -39.371 54.906 1.00 60.02  ? 25   ASN F C     1 
ATOM   3908  O  O     . ASN F 2  25  ? 2.704   -38.379 55.358 1.00 63.04  ? 25   ASN F O     1 
ATOM   3909  C  CB    . ASN F 2  25  ? 3.281   -40.120 52.779 1.00 56.49  ? 25   ASN F CB    1 
ATOM   3910  C  CG    . ASN F 2  25  ? 4.492   -40.838 52.268 1.00 59.98  ? 25   ASN F CG    1 
ATOM   3911  O  OD1   . ASN F 2  25  ? 5.609   -40.548 52.690 1.00 67.82  ? 25   ASN F OD1   1 
ATOM   3912  N  ND2   . ASN F 2  25  ? 4.289   -41.792 51.378 1.00 60.85  ? 25   ASN F ND2   1 
ATOM   3913  N  N     . ILE F 2  26  ? 0.845   -39.565 55.003 1.00 60.51  ? 26   ILE F N     1 
ATOM   3914  C  CA    . ILE F 2  26  ? -0.031  -38.718 55.808 1.00 57.76  ? 26   ILE F CA    1 
ATOM   3915  C  C     . ILE F 2  26  ? 0.622   -38.371 57.141 1.00 60.40  ? 26   ILE F C     1 
ATOM   3916  O  O     . ILE F 2  26  ? 0.203   -37.427 57.812 1.00 65.85  ? 26   ILE F O     1 
ATOM   3917  C  CB    . ILE F 2  26  ? -1.391  -39.427 56.121 1.00 58.23  ? 26   ILE F CB    1 
ATOM   3918  C  CG1   . ILE F 2  26  ? -2.521  -38.455 56.475 1.00 58.01  ? 26   ILE F CG1   1 
ATOM   3919  C  CG2   . ILE F 2  26  ? -1.266  -40.320 57.337 1.00 57.12  ? 26   ILE F CG2   1 
ATOM   3920  C  CD1   . ILE F 2  26  ? -2.642  -37.231 55.594 1.00 63.30  ? 26   ILE F CD1   1 
ATOM   3921  N  N     . GLN F 2  27  ? 1.628   -39.130 57.553 1.00 56.84  ? 27   GLN F N     1 
ATOM   3922  C  CA    . GLN F 2  27  ? 2.143   -38.960 58.912 1.00 58.27  ? 27   GLN F CA    1 
ATOM   3923  C  C     . GLN F 2  27  ? 3.282   -37.976 58.934 1.00 58.32  ? 27   GLN F C     1 
ATOM   3924  O  O     . GLN F 2  27  ? 3.808   -37.630 59.998 1.00 61.10  ? 27   GLN F O     1 
ATOM   3925  C  CB    . GLN F 2  27  ? 2.530   -40.307 59.548 1.00 57.08  ? 27   GLN F CB    1 
ATOM   3926  C  CG    . GLN F 2  27  ? 1.319   -41.165 59.899 1.00 56.36  ? 27   GLN F CG    1 
ATOM   3927  C  CD    . GLN F 2  27  ? 0.572   -40.620 61.097 1.00 60.24  ? 27   GLN F CD    1 
ATOM   3928  O  OE1   . GLN F 2  27  ? 1.188   -40.037 61.982 1.00 71.32  ? 27   GLN F OE1   1 
ATOM   3929  N  NE2   . GLN F 2  27  ? -0.753  -40.803 61.142 1.00 53.73  ? 27   GLN F NE2   1 
ATOM   3930  N  N     . GLY F 2  28  ? 3.649   -37.513 57.748 1.00 59.29  ? 28   GLY F N     1 
ATOM   3931  C  CA    . GLY F 2  28  ? 4.645   -36.457 57.602 1.00 65.09  ? 28   GLY F CA    1 
ATOM   3932  C  C     . GLY F 2  28  ? 4.037   -35.097 57.903 1.00 70.96  ? 28   GLY F C     1 
ATOM   3933  O  O     . GLY F 2  28  ? 4.765   -34.116 58.051 1.00 80.38  ? 28   GLY F O     1 
ATOM   3934  N  N     . ILE F 2  29  ? 2.701   -35.046 57.945 1.00 59.25  ? 29   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2  29  ? 1.947   -33.917 58.438 1.00 52.11  ? 29   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2  29  ? 1.969   -34.056 59.948 1.00 53.34  ? 29   ILE F C     1 
ATOM   3937  O  O     . ILE F 2  29  ? 1.034   -34.587 60.594 1.00 52.67  ? 29   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2  29  ? 0.498   -33.992 57.945 1.00 54.72  ? 29   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2  29  ? 0.448   -34.252 56.438 1.00 53.88  ? 29   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2  29  ? -0.285  -32.749 58.319 1.00 56.99  ? 29   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2  29  ? 1.331   -33.366 55.622 1.00 55.75  ? 29   ILE F CD1   1 
ATOM   3942  N  N     . THR F 2  30  ? 3.063   -33.581 60.517 1.00 52.13  ? 30   THR F N     1 
ATOM   3943  C  CA    . THR F 2  30  ? 3.331   -33.789 61.932 1.00 55.77  ? 30   THR F CA    1 
ATOM   3944  C  C     . THR F 2  30  ? 2.460   -32.967 62.851 1.00 51.51  ? 30   THR F C     1 
ATOM   3945  O  O     . THR F 2  30  ? 1.871   -31.990 62.430 1.00 54.26  ? 30   THR F O     1 
ATOM   3946  C  CB    . THR F 2  30  ? 4.806   -33.515 62.256 1.00 55.85  ? 30   THR F CB    1 
ATOM   3947  O  OG1   . THR F 2  30  ? 5.095   -32.149 61.975 1.00 65.13  ? 30   THR F OG1   1 
ATOM   3948  C  CG2   . THR F 2  30  ? 5.707   -34.362 61.395 1.00 53.37  ? 30   THR F CG2   1 
ATOM   3949  N  N     . LYS F 2  31  ? 2.398   -33.379 64.114 1.00 56.46  ? 31   LYS F N     1 
ATOM   3950  C  CA    . LYS F 2  31  ? 1.716   -32.635 65.185 1.00 51.91  ? 31   LYS F CA    1 
ATOM   3951  C  C     . LYS F 2  31  ? 2.170   -31.169 65.263 1.00 54.26  ? 31   LYS F C     1 
ATOM   3952  O  O     . LYS F 2  31  ? 1.338   -30.282 65.308 1.00 62.51  ? 31   LYS F O     1 
ATOM   3953  C  CB    . LYS F 2  31  ? 1.964   -33.325 66.512 1.00 51.72  ? 31   LYS F CB    1 
ATOM   3954  C  CG    . LYS F 2  31  ? 1.097   -32.842 67.640 1.00 58.97  ? 31   LYS F CG    1 
ATOM   3955  C  CD    . LYS F 2  31  ? 1.703   -33.214 68.969 1.00 63.22  ? 31   LYS F CD    1 
ATOM   3956  C  CE    . LYS F 2  31  ? 1.029   -32.446 70.085 1.00 67.47  ? 31   LYS F CE    1 
ATOM   3957  N  NZ    . LYS F 2  31  ? 1.654   -32.824 71.389 1.00 82.80  ? 31   LYS F NZ    1 
ATOM   3958  N  N     . PRO F 2  32  ? 3.486   -30.899 65.259 1.00 53.94  ? 32   PRO F N     1 
ATOM   3959  C  CA    . PRO F 2  32  ? 3.883   -29.486 65.269 1.00 54.32  ? 32   PRO F CA    1 
ATOM   3960  C  C     . PRO F 2  32  ? 3.458   -28.696 64.013 1.00 57.44  ? 32   PRO F C     1 
ATOM   3961  O  O     . PRO F 2  32  ? 3.127   -27.515 64.132 1.00 62.27  ? 32   PRO F O     1 
ATOM   3962  C  CB    . PRO F 2  32  ? 5.417   -29.552 65.352 1.00 56.21  ? 32   PRO F CB    1 
ATOM   3963  C  CG    . PRO F 2  32  ? 5.710   -30.915 65.907 1.00 55.82  ? 32   PRO F CG    1 
ATOM   3964  C  CD    . PRO F 2  32  ? 4.653   -31.800 65.331 1.00 51.19  ? 32   PRO F CD    1 
ATOM   3965  N  N     . ALA F 2  33  ? 3.477   -29.314 62.830 1.00 50.90  ? 33   ALA F N     1 
ATOM   3966  C  CA    . ALA F 2  33  ? 3.118   -28.577 61.644 1.00 50.75  ? 33   ALA F CA    1 
ATOM   3967  C  C     . ALA F 2  33  ? 1.623   -28.194 61.708 1.00 57.07  ? 33   ALA F C     1 
ATOM   3968  O  O     . ALA F 2  33  ? 1.220   -27.116 61.243 1.00 56.73  ? 33   ALA F O     1 
ATOM   3969  C  CB    . ALA F 2  33  ? 3.444   -29.367 60.399 1.00 44.15  ? 33   ALA F CB    1 
ATOM   3970  N  N     . ILE F 2  34  ? 0.818   -29.067 62.317 1.00 54.02  ? 34   ILE F N     1 
ATOM   3971  C  CA    . ILE F 2  34  ? -0.624  -28.875 62.375 1.00 52.96  ? 34   ILE F CA    1 
ATOM   3972  C  C     . ILE F 2  34  ? -0.905  -27.831 63.427 1.00 57.74  ? 34   ILE F C     1 
ATOM   3973  O  O     . ILE F 2  34  ? -1.853  -27.072 63.316 1.00 65.18  ? 34   ILE F O     1 
ATOM   3974  C  CB    . ILE F 2  34  ? -1.371  -30.171 62.760 1.00 52.52  ? 34   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F 2  34  ? -1.148  -31.265 61.711 1.00 51.05  ? 34   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F 2  34  ? -2.861  -29.903 62.931 1.00 49.66  ? 34   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F 2  34  ? -1.779  -32.592 62.090 1.00 47.13  ? 34   ILE F CD1   1 
ATOM   3978  N  N     . ARG F 2  35  ? -0.074  -27.786 64.456 1.00 57.58  ? 35   ARG F N     1 
ATOM   3979  C  CA    . ARG F 2  35  ? -0.219  -26.780 65.471 1.00 54.51  ? 35   ARG F CA    1 
ATOM   3980  C  C     . ARG F 2  35  ? 0.105   -25.406 64.853 1.00 53.43  ? 35   ARG F C     1 
ATOM   3981  O  O     . ARG F 2  35  ? -0.651  -24.442 65.019 1.00 53.30  ? 35   ARG F O     1 
ATOM   3982  C  CB    . ARG F 2  35  ? 0.670   -27.141 66.638 1.00 57.95  ? 35   ARG F CB    1 
ATOM   3983  C  CG    . ARG F 2  35  ? 0.752   -26.108 67.743 1.00 73.45  ? 35   ARG F CG    1 
ATOM   3984  C  CD    . ARG F 2  35  ? 1.660   -26.656 68.820 1.00 72.64  ? 35   ARG F CD    1 
ATOM   3985  N  NE    . ARG F 2  35  ? 1.126   -27.959 69.125 1.00 67.59  ? 35   ARG F NE    1 
ATOM   3986  C  CZ    . ARG F 2  35  ? 0.421   -28.222 70.211 1.00 78.84  ? 35   ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F 2  35  ? 0.208   -27.294 71.137 1.00 73.51  ? 35   ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F 2  35  ? -0.033  -29.440 70.400 1.00 97.25  ? 35   ARG F NH2   1 
ATOM   3989  N  N     . ARG F 2  36  ? 1.181   -25.317 64.082 1.00 51.38  ? 36   ARG F N     1 
ATOM   3990  C  CA    . ARG F 2  36  ? 1.470   -24.048 63.439 1.00 52.57  ? 36   ARG F CA    1 
ATOM   3991  C  C     . ARG F 2  36  ? 0.270   -23.538 62.631 1.00 52.64  ? 36   ARG F C     1 
ATOM   3992  O  O     . ARG F 2  36  ? -0.110  -22.381 62.799 1.00 54.99  ? 36   ARG F O     1 
ATOM   3993  C  CB    . ARG F 2  36  ? 2.727   -24.100 62.586 1.00 53.53  ? 36   ARG F CB    1 
ATOM   3994  C  CG    . ARG F 2  36  ? 3.963   -24.332 63.408 1.00 53.06  ? 36   ARG F CG    1 
ATOM   3995  C  CD    . ARG F 2  36  ? 5.224   -24.160 62.584 1.00 54.94  ? 36   ARG F CD    1 
ATOM   3996  N  NE    . ARG F 2  36  ? 5.510   -25.207 61.592 1.00 56.42  ? 36   ARG F NE    1 
ATOM   3997  C  CZ    . ARG F 2  36  ? 6.202   -26.330 61.833 1.00 57.56  ? 36   ARG F CZ    1 
ATOM   3998  N  NH1   . ARG F 2  36  ? 6.644   -26.602 63.071 1.00 57.89  ? 36   ARG F NH1   1 
ATOM   3999  N  NH2   . ARG F 2  36  ? 6.455   -27.185 60.832 1.00 49.47  ? 36   ARG F NH2   1 
ATOM   4000  N  N     . LEU F 2  37  ? -0.343  -24.388 61.799 1.00 48.45  ? 37   LEU F N     1 
ATOM   4001  C  CA    . LEU F 2  37  ? -1.488  -23.952 60.967 1.00 47.71  ? 37   LEU F CA    1 
ATOM   4002  C  C     . LEU F 2  37  ? -2.674  -23.464 61.824 1.00 47.45  ? 37   LEU F C     1 
ATOM   4003  O  O     . LEU F 2  37  ? -3.252  -22.417 61.536 1.00 43.32  ? 37   LEU F O     1 
ATOM   4004  C  CB    . LEU F 2  37  ? -1.940  -25.030 59.991 1.00 45.14  ? 37   LEU F CB    1 
ATOM   4005  C  CG    . LEU F 2  37  ? -0.950  -25.529 58.967 1.00 45.74  ? 37   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F 2  37  ? -1.232  -26.994 58.674 1.00 49.58  ? 37   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F 2  37  ? -1.014  -24.700 57.709 1.00 49.15  ? 37   LEU F CD2   1 
ATOM   4008  N  N     . ALA F 2  38  ? -3.010  -24.206 62.882 1.00 46.95  ? 38   ALA F N     1 
ATOM   4009  C  CA    . ALA F 2  38  ? -3.975  -23.720 63.887 1.00 49.98  ? 38   ALA F CA    1 
ATOM   4010  C  C     . ALA F 2  38  ? -3.648  -22.306 64.402 1.00 52.48  ? 38   ALA F C     1 
ATOM   4011  O  O     . ALA F 2  38  ? -4.547  -21.462 64.589 1.00 47.28  ? 38   ALA F O     1 
ATOM   4012  C  CB    . ALA F 2  38  ? -4.069  -24.678 65.059 1.00 45.64  ? 38   ALA F CB    1 
ATOM   4013  N  N     . ARG F 2  39  ? -2.359  -22.066 64.642 1.00 54.22  ? 39   ARG F N     1 
ATOM   4014  C  CA    . ARG F 2  39  ? -1.892  -20.782 65.158 1.00 52.62  ? 39   ARG F CA    1 
ATOM   4015  C  C     . ARG F 2  39  ? -2.153  -19.671 64.147 1.00 48.05  ? 39   ARG F C     1 
ATOM   4016  O  O     . ARG F 2  39  ? -2.787  -18.676 64.455 1.00 47.77  ? 39   ARG F O     1 
ATOM   4017  C  CB    . ARG F 2  39  ? -0.406  -20.869 65.490 1.00 50.70  ? 39   ARG F CB    1 
ATOM   4018  C  CG    . ARG F 2  39  ? -0.111  -21.817 66.618 1.00 46.70  ? 39   ARG F CG    1 
ATOM   4019  C  CD    . ARG F 2  39  ? -0.698  -21.343 67.919 1.00 48.47  ? 39   ARG F CD    1 
ATOM   4020  N  NE    . ARG F 2  39  ? -0.088  -22.117 68.979 1.00 53.45  ? 39   ARG F NE    1 
ATOM   4021  C  CZ    . ARG F 2  39  ? -0.754  -22.866 69.839 1.00 54.75  ? 39   ARG F CZ    1 
ATOM   4022  N  NH1   . ARG F 2  39  ? -2.072  -22.903 69.811 1.00 55.57  ? 39   ARG F NH1   1 
ATOM   4023  N  NH2   . ARG F 2  39  ? -0.089  -23.558 70.742 1.00 57.07  ? 39   ARG F NH2   1 
ATOM   4024  N  N     . ARG F 2  40  ? -1.679  -19.861 62.932 1.00 45.70  ? 40   ARG F N     1 
ATOM   4025  C  CA    . ARG F 2  40  ? -1.966  -18.918 61.882 1.00 47.06  ? 40   ARG F CA    1 
ATOM   4026  C  C     . ARG F 2  40  ? -3.456  -18.706 61.794 1.00 46.73  ? 40   ARG F C     1 
ATOM   4027  O  O     . ARG F 2  40  ? -3.901  -17.635 61.401 1.00 49.89  ? 40   ARG F O     1 
ATOM   4028  C  CB    . ARG F 2  40  ? -1.443  -19.421 60.550 1.00 47.23  ? 40   ARG F CB    1 
ATOM   4029  C  CG    . ARG F 2  40  ? -1.635  -18.439 59.407 1.00 47.17  ? 40   ARG F CG    1 
ATOM   4030  C  CD    . ARG F 2  40  ? -0.585  -18.650 58.330 1.00 42.55  ? 40   ARG F CD    1 
ATOM   4031  N  NE    . ARG F 2  40  ? 0.752   -18.295 58.778 1.00 40.40  ? 40   ARG F NE    1 
ATOM   4032  C  CZ    . ARG F 2  40  ? 1.848   -18.565 58.075 1.00 46.51  ? 40   ARG F CZ    1 
ATOM   4033  N  NH1   . ARG F 2  40  ? 1.747   -19.228 56.917 1.00 44.95  ? 40   ARG F NH1   1 
ATOM   4034  N  NH2   . ARG F 2  40  ? 3.053   -18.181 58.526 1.00 44.80  ? 40   ARG F NH2   1 
ATOM   4035  N  N     . GLY F 2  41  ? -4.221  -19.725 62.175 1.00 45.19  ? 41   GLY F N     1 
ATOM   4036  C  CA    . GLY F 2  41  ? -5.680  -19.653 62.149 1.00 42.65  ? 41   GLY F CA    1 
ATOM   4037  C  C     . GLY F 2  41  ? -6.257  -19.143 63.465 1.00 45.17  ? 41   GLY F C     1 
ATOM   4038  O  O     . GLY F 2  41  ? -7.470  -19.099 63.654 1.00 44.53  ? 41   GLY F O     1 
ATOM   4039  N  N     . GLY F 2  42  ? -5.388  -18.765 64.393 1.00 44.96  ? 42   GLY F N     1 
ATOM   4040  C  CA    . GLY F 2  42  ? -5.827  -18.071 65.593 1.00 46.45  ? 42   GLY F CA    1 
ATOM   4041  C  C     . GLY F 2  42  ? -6.318  -18.960 66.721 1.00 52.14  ? 42   GLY F C     1 
ATOM   4042  O  O     . GLY F 2  42  ? -7.075  -18.515 67.576 1.00 54.50  ? 42   GLY F O     1 
ATOM   4043  N  N     . VAL F 2  43  ? -5.864  -20.207 66.733 1.00 51.36  ? 43   VAL F N     1 
ATOM   4044  C  CA    . VAL F 2  43  ? -6.323  -21.189 67.680 1.00 49.31  ? 43   VAL F CA    1 
ATOM   4045  C  C     . VAL F 2  43  ? -5.361  -21.218 68.853 1.00 52.06  ? 43   VAL F C     1 
ATOM   4046  O  O     . VAL F 2  43  ? -4.161  -21.353 68.666 1.00 53.72  ? 43   VAL F O     1 
ATOM   4047  C  CB    . VAL F 2  43  ? -6.344  -22.573 67.015 1.00 48.81  ? 43   VAL F CB    1 
ATOM   4048  C  CG1   . VAL F 2  43  ? -6.481  -23.672 68.061 1.00 48.79  ? 43   VAL F CG1   1 
ATOM   4049  C  CG2   . VAL F 2  43  ? -7.430  -22.635 65.941 1.00 45.52  ? 43   VAL F CG2   1 
ATOM   4050  N  N     . LYS F 2  44  ? -5.897  -21.124 70.064 1.00 56.72  ? 44   LYS F N     1 
ATOM   4051  C  CA    . LYS F 2  44  ? -5.084  -21.117 71.278 1.00 52.88  ? 44   LYS F CA    1 
ATOM   4052  C  C     . LYS F 2  44  ? -4.889  -22.489 71.882 1.00 55.32  ? 44   LYS F C     1 
ATOM   4053  O  O     . LYS F 2  44  ? -3.796  -22.802 72.347 1.00 62.10  ? 44   LYS F O     1 
ATOM   4054  C  CB    . LYS F 2  44  ? -5.732  -20.226 72.323 1.00 56.26  ? 44   LYS F CB    1 
ATOM   4055  C  CG    . LYS F 2  44  ? -4.791  -19.755 73.417 1.00 58.43  ? 44   LYS F CG    1 
ATOM   4056  C  CD    . LYS F 2  44  ? -5.573  -18.897 74.401 1.00 62.41  ? 44   LYS F CD    1 
ATOM   4057  C  CE    . LYS F 2  44  ? -4.768  -18.536 75.638 1.00 60.83  ? 44   LYS F CE    1 
ATOM   4058  N  NZ    . LYS F 2  44  ? -5.729  -18.264 76.749 1.00 60.57  ? 44   LYS F NZ    1 
ATOM   4059  N  N     . ARG F 2  45  ? -5.942  -23.302 71.906 1.00 53.14  ? 45   ARG F N     1 
ATOM   4060  C  CA    . ARG F 2  45  ? -5.871  -24.578 72.585 1.00 52.95  ? 45   ARG F CA    1 
ATOM   4061  C  C     . ARG F 2  45  ? -6.355  -25.713 71.667 1.00 56.74  ? 45   ARG F C     1 
ATOM   4062  O  O     . ARG F 2  45  ? -7.414  -25.610 71.041 1.00 55.38  ? 45   ARG F O     1 
ATOM   4063  C  CB    . ARG F 2  45  ? -6.687  -24.512 73.880 1.00 53.25  ? 45   ARG F CB    1 
ATOM   4064  C  CG    . ARG F 2  45  ? -6.139  -25.352 75.016 1.00 54.76  ? 45   ARG F CG    1 
ATOM   4065  C  CD    . ARG F 2  45  ? -6.843  -25.082 76.351 1.00 57.74  ? 45   ARG F CD    1 
ATOM   4066  N  NE    . ARG F 2  45  ? -6.369  -26.043 77.348 1.00 64.11  ? 45   ARG F NE    1 
ATOM   4067  C  CZ    . ARG F 2  45  ? -6.963  -27.214 77.613 1.00 64.74  ? 45   ARG F CZ    1 
ATOM   4068  N  NH1   . ARG F 2  45  ? -8.090  -27.539 76.996 1.00 59.75  ? 45   ARG F NH1   1 
ATOM   4069  N  NH2   . ARG F 2  45  ? -6.448  -28.059 78.510 1.00 63.20  ? 45   ARG F NH2   1 
ATOM   4070  N  N     . ILE F 2  46  ? -5.581  -26.800 71.614 1.00 55.14  ? 46   ILE F N     1 
ATOM   4071  C  CA    . ILE F 2  46  ? -5.849  -27.904 70.703 1.00 54.09  ? 46   ILE F CA    1 
ATOM   4072  C  C     . ILE F 2  46  ? -5.960  -29.259 71.414 1.00 57.97  ? 46   ILE F C     1 
ATOM   4073  O  O     . ILE F 2  46  ? -4.950  -29.786 71.933 1.00 60.61  ? 46   ILE F O     1 
ATOM   4074  C  CB    . ILE F 2  46  ? -4.735  -28.022 69.651 1.00 53.98  ? 46   ILE F CB    1 
ATOM   4075  C  CG1   . ILE F 2  46  ? -4.587  -26.734 68.860 1.00 53.94  ? 46   ILE F CG1   1 
ATOM   4076  C  CG2   . ILE F 2  46  ? -5.044  -29.157 68.688 1.00 54.15  ? 46   ILE F CG2   1 
ATOM   4077  C  CD1   . ILE F 2  46  ? -3.217  -26.563 68.243 1.00 50.11  ? 46   ILE F CD1   1 
ATOM   4078  N  N     . SER F 2  47  ? -7.170  -29.827 71.415 1.00 56.80  ? 47   SER F N     1 
ATOM   4079  C  CA    . SER F 2  47  ? -7.423  -31.176 71.935 1.00 53.40  ? 47   SER F CA    1 
ATOM   4080  C  C     . SER F 2  47  ? -6.656  -32.226 71.160 1.00 52.76  ? 47   SER F C     1 
ATOM   4081  O  O     . SER F 2  47  ? -6.447  -32.092 69.947 1.00 58.36  ? 47   SER F O     1 
ATOM   4082  C  CB    . SER F 2  47  ? -8.908  -31.490 71.852 1.00 57.14  ? 47   SER F CB    1 
ATOM   4083  O  OG    . SER F 2  47  ? -9.088  -32.799 71.355 1.00 65.42  ? 47   SER F OG    1 
ATOM   4084  N  N     . GLY F 2  48  ? -6.267  -33.289 71.851 1.00 52.62  ? 48   GLY F N     1 
ATOM   4085  C  CA    . GLY F 2  48  ? -5.348  -34.297 71.280 1.00 54.85  ? 48   GLY F CA    1 
ATOM   4086  C  C     . GLY F 2  48  ? -5.852  -35.007 70.036 1.00 58.10  ? 48   GLY F C     1 
ATOM   4087  O  O     . GLY F 2  48  ? -5.059  -35.505 69.214 1.00 59.59  ? 48   GLY F O     1 
ATOM   4088  N  N     . LEU F 2  49  ? -7.173  -35.036 69.888 1.00 53.28  ? 49   LEU F N     1 
ATOM   4089  C  CA    . LEU F 2  49  ? -7.798  -35.708 68.782 1.00 52.59  ? 49   LEU F CA    1 
ATOM   4090  C  C     . LEU F 2  49  ? -7.800  -34.898 67.455 1.00 56.97  ? 49   LEU F C     1 
ATOM   4091  O  O     . LEU F 2  49  ? -8.197  -35.418 66.397 1.00 54.55  ? 49   LEU F O     1 
ATOM   4092  C  CB    . LEU F 2  49  ? -9.205  -36.094 69.201 1.00 50.76  ? 49   LEU F CB    1 
ATOM   4093  C  CG    . LEU F 2  49  ? -9.302  -37.216 70.227 1.00 51.20  ? 49   LEU F CG    1 
ATOM   4094  C  CD1   . LEU F 2  49  ? -10.744 -37.300 70.704 1.00 57.16  ? 49   LEU F CD1   1 
ATOM   4095  C  CD2   . LEU F 2  49  ? -8.827  -38.548 69.658 1.00 50.52  ? 49   LEU F CD2   1 
ATOM   4096  N  N     . ILE F 2  50  ? -7.352  -33.637 67.509 1.00 52.40  ? 50   ILE F N     1 
ATOM   4097  C  CA    . ILE F 2  50  ? -7.456  -32.760 66.353 1.00 50.03  ? 50   ILE F CA    1 
ATOM   4098  C  C     . ILE F 2  50  ? -6.545  -33.286 65.243 1.00 52.31  ? 50   ILE F C     1 
ATOM   4099  O  O     . ILE F 2  50  ? -6.925  -33.316 64.048 1.00 56.19  ? 50   ILE F O     1 
ATOM   4100  C  CB    . ILE F 2  50  ? -7.182  -31.276 66.727 1.00 49.86  ? 50   ILE F CB    1 
ATOM   4101  C  CG1   . ILE F 2  50  ? -8.403  -30.627 67.393 1.00 49.35  ? 50   ILE F CG1   1 
ATOM   4102  C  CG2   . ILE F 2  50  ? -6.765  -30.440 65.527 1.00 47.58  ? 50   ILE F CG2   1 
ATOM   4103  C  CD1   . ILE F 2  50  ? -9.566  -30.305 66.472 1.00 48.72  ? 50   ILE F CD1   1 
ATOM   4104  N  N     . TYR F 2  51  ? -5.359  -33.742 65.635 1.00 47.53  ? 51   TYR F N     1 
ATOM   4105  C  CA    . TYR F 2  51  ? -4.356  -34.141 64.646 1.00 46.43  ? 51   TYR F CA    1 
ATOM   4106  C  C     . TYR F 2  51  ? -4.800  -35.234 63.678 1.00 49.40  ? 51   TYR F C     1 
ATOM   4107  O  O     . TYR F 2  51  ? -4.628  -35.078 62.480 1.00 53.37  ? 51   TYR F O     1 
ATOM   4108  C  CB    . TYR F 2  51  ? -3.019  -34.447 65.292 1.00 44.83  ? 51   TYR F CB    1 
ATOM   4109  C  CG    . TYR F 2  51  ? -2.665  -33.420 66.295 1.00 45.44  ? 51   TYR F CG    1 
ATOM   4110  C  CD1   . TYR F 2  51  ? -2.776  -33.683 67.664 1.00 48.08  ? 51   TYR F CD1   1 
ATOM   4111  C  CD2   . TYR F 2  51  ? -2.256  -32.152 65.886 1.00 48.97  ? 51   TYR F CD2   1 
ATOM   4112  C  CE1   . TYR F 2  51  ? -2.481  -32.709 68.598 1.00 52.34  ? 51   TYR F CE1   1 
ATOM   4113  C  CE2   . TYR F 2  51  ? -1.948  -31.171 66.814 1.00 52.18  ? 51   TYR F CE2   1 
ATOM   4114  C  CZ    . TYR F 2  51  ? -2.062  -31.469 68.164 1.00 53.17  ? 51   TYR F CZ    1 
ATOM   4115  O  OH    . TYR F 2  51  ? -1.775  -30.519 69.086 1.00 64.37  ? 51   TYR F OH    1 
ATOM   4116  N  N     . GLU F 2  52  ? -5.399  -36.317 64.170 1.00 54.12  ? 52   GLU F N     1 
ATOM   4117  C  CA    . GLU F 2  52  ? -5.908  -37.334 63.252 1.00 55.28  ? 52   GLU F CA    1 
ATOM   4118  C  C     . GLU F 2  52  ? -7.011  -36.753 62.381 1.00 52.48  ? 52   GLU F C     1 
ATOM   4119  O  O     . GLU F 2  52  ? -7.002  -36.962 61.154 1.00 48.94  ? 52   GLU F O     1 
ATOM   4120  C  CB    . GLU F 2  52  ? -6.361  -38.627 63.966 1.00 58.22  ? 52   GLU F CB    1 
ATOM   4121  C  CG    . GLU F 2  52  ? -5.240  -39.655 64.173 1.00 64.60  ? 52   GLU F CG    1 
ATOM   4122  C  CD    . GLU F 2  52  ? -4.374  -39.919 62.923 1.00 73.31  ? 52   GLU F CD    1 
ATOM   4123  O  OE1   . GLU F 2  52  ? -4.936  -40.316 61.870 1.00 80.75  ? 52   GLU F OE1   1 
ATOM   4124  O  OE2   . GLU F 2  52  ? -3.123  -39.746 62.986 1.00 70.27  ? 52   GLU F OE2   1 
ATOM   4125  N  N     . GLU F 2  53  ? -7.913  -35.986 63.005 1.00 48.82  ? 53   GLU F N     1 
ATOM   4126  C  CA    . GLU F 2  53  ? -9.024  -35.383 62.284 1.00 48.55  ? 53   GLU F CA    1 
ATOM   4127  C  C     . GLU F 2  53  ? -8.517  -34.498 61.167 1.00 51.98  ? 53   GLU F C     1 
ATOM   4128  O  O     . GLU F 2  53  ? -9.040  -34.544 60.032 1.00 52.48  ? 53   GLU F O     1 
ATOM   4129  C  CB    . GLU F 2  53  ? -9.910  -34.579 63.198 1.00 48.61  ? 53   GLU F CB    1 
ATOM   4130  C  CG    . GLU F 2  53  ? -11.245 -34.233 62.579 1.00 54.93  ? 53   GLU F CG    1 
ATOM   4131  C  CD    . GLU F 2  53  ? -12.294 -35.319 62.721 1.00 58.47  ? 53   GLU F CD    1 
ATOM   4132  O  OE1   . GLU F 2  53  ? -12.004 -36.364 63.350 1.00 58.65  ? 53   GLU F OE1   1 
ATOM   4133  O  OE2   . GLU F 2  53  ? -13.422 -35.122 62.203 1.00 60.98  ? 53   GLU F OE2   1 
ATOM   4134  N  N     . THR F 2  54  ? -7.478  -33.719 61.467 1.00 50.21  ? 54   THR F N     1 
ATOM   4135  C  CA    . THR F 2  54  ? -6.932  -32.833 60.460 1.00 48.59  ? 54   THR F CA    1 
ATOM   4136  C  C     . THR F 2  54  ? -6.298  -33.616 59.322 1.00 50.02  ? 54   THR F C     1 
ATOM   4137  O  O     . THR F 2  54  ? -6.485  -33.260 58.147 1.00 52.72  ? 54   THR F O     1 
ATOM   4138  C  CB    . THR F 2  54  ? -5.926  -31.833 61.027 1.00 51.76  ? 54   THR F CB    1 
ATOM   4139  O  OG1   . THR F 2  54  ? -6.501  -31.139 62.144 1.00 48.56  ? 54   THR F OG1   1 
ATOM   4140  C  CG2   . THR F 2  54  ? -5.564  -30.824 59.932 1.00 50.59  ? 54   THR F CG2   1 
ATOM   4141  N  N     . ARG F 2  55  ? -5.572  -34.683 59.657 1.00 46.45  ? 55   ARG F N     1 
ATOM   4142  C  CA    . ARG F 2  55  ? -4.991  -35.543 58.637 1.00 47.66  ? 55   ARG F CA    1 
ATOM   4143  C  C     . ARG F 2  55  ? -6.067  -36.071 57.678 1.00 49.66  ? 55   ARG F C     1 
ATOM   4144  O  O     . ARG F 2  55  ? -5.900  -36.036 56.465 1.00 50.18  ? 55   ARG F O     1 
ATOM   4145  C  CB    . ARG F 2  55  ? -4.201  -36.663 59.298 1.00 48.18  ? 55   ARG F CB    1 
ATOM   4146  C  CG    . ARG F 2  55  ? -2.877  -36.145 59.802 1.00 49.06  ? 55   ARG F CG    1 
ATOM   4147  C  CD    . ARG F 2  55  ? -1.927  -37.220 60.297 1.00 50.85  ? 55   ARG F CD    1 
ATOM   4148  N  NE    . ARG F 2  55  ? -0.933  -36.630 61.203 1.00 48.80  ? 55   ARG F NE    1 
ATOM   4149  C  CZ    . ARG F 2  55  ? -1.005  -36.672 62.532 1.00 47.74  ? 55   ARG F CZ    1 
ATOM   4150  N  NH1   . ARG F 2  55  ? -2.002  -37.304 63.154 1.00 46.09  ? 55   ARG F NH1   1 
ATOM   4151  N  NH2   . ARG F 2  55  ? -0.075  -36.075 63.242 1.00 49.52  ? 55   ARG F NH2   1 
ATOM   4152  N  N     . GLY F 2  56  ? -7.189  -36.521 58.232 1.00 49.60  ? 56   GLY F N     1 
ATOM   4153  C  CA    . GLY F 2  56  ? -8.293  -36.986 57.420 1.00 47.80  ? 56   GLY F CA    1 
ATOM   4154  C  C     . GLY F 2  56  ? -8.766  -35.918 56.453 1.00 51.50  ? 56   GLY F C     1 
ATOM   4155  O  O     . GLY F 2  56  ? -8.754  -36.153 55.226 1.00 49.01  ? 56   GLY F O     1 
ATOM   4156  N  N     . VAL F 2  57  ? -9.145  -34.752 57.012 1.00 45.98  ? 57   VAL F N     1 
ATOM   4157  C  CA    . VAL F 2  57  ? -9.630  -33.614 56.253 1.00 42.37  ? 57   VAL F CA    1 
ATOM   4158  C  C     . VAL F 2  57  ? -8.642  -33.227 55.153 1.00 44.78  ? 57   VAL F C     1 
ATOM   4159  O  O     . VAL F 2  57  ? -9.039  -33.001 53.991 1.00 42.67  ? 57   VAL F O     1 
ATOM   4160  C  CB    . VAL F 2  57  ? -9.874  -32.409 57.166 1.00 44.44  ? 57   VAL F CB    1 
ATOM   4161  C  CG1   . VAL F 2  57  ? -10.112 -31.154 56.346 1.00 48.05  ? 57   VAL F CG1   1 
ATOM   4162  C  CG2   . VAL F 2  57  ? -11.058 -32.657 58.091 1.00 45.83  ? 57   VAL F CG2   1 
ATOM   4163  N  N     . LEU F 2  58  ? -7.354  -33.164 55.494 1.00 42.64  ? 58   LEU F N     1 
ATOM   4164  C  CA    . LEU F 2  58  ? -6.368  -32.826 54.480 1.00 43.04  ? 58   LEU F CA    1 
ATOM   4165  C  C     . LEU F 2  58  ? -6.374  -33.875 53.359 1.00 48.37  ? 58   LEU F C     1 
ATOM   4166  O  O     . LEU F 2  58  ? -6.420  -33.534 52.167 1.00 54.37  ? 58   LEU F O     1 
ATOM   4167  C  CB    . LEU F 2  58  ? -4.982  -32.614 55.103 1.00 44.66  ? 58   LEU F CB    1 
ATOM   4168  C  CG    . LEU F 2  58  ? -3.744  -32.469 54.210 1.00 45.41  ? 58   LEU F CG    1 
ATOM   4169  C  CD1   . LEU F 2  58  ? -3.914  -31.327 53.214 1.00 48.81  ? 58   LEU F CD1   1 
ATOM   4170  C  CD2   . LEU F 2  58  ? -2.470  -32.339 55.044 1.00 38.98  ? 58   LEU F CD2   1 
ATOM   4171  N  N     . LYS F 2  59  ? -6.383  -35.153 53.732 1.00 49.77  ? 59   LYS F N     1 
ATOM   4172  C  CA    . LYS F 2  59  ? -6.424  -36.238 52.751 1.00 50.98  ? 59   LYS F CA    1 
ATOM   4173  C  C     . LYS F 2  59  ? -7.597  -36.114 51.758 1.00 49.92  ? 59   LYS F C     1 
ATOM   4174  O  O     . LYS F 2  59  ? -7.401  -36.232 50.550 1.00 49.35  ? 59   LYS F O     1 
ATOM   4175  C  CB    . LYS F 2  59  ? -6.436  -37.588 53.467 1.00 55.85  ? 59   LYS F CB    1 
ATOM   4176  C  CG    . LYS F 2  59  ? -6.217  -38.769 52.531 1.00 62.41  ? 59   LYS F CG    1 
ATOM   4177  C  CD    . LYS F 2  59  ? -5.809  -40.034 53.272 1.00 65.38  ? 59   LYS F CD    1 
ATOM   4178  C  CE    . LYS F 2  59  ? -6.414  -41.288 52.626 1.00 70.54  ? 59   LYS F CE    1 
ATOM   4179  N  NZ    . LYS F 2  59  ? -7.911  -41.367 52.737 1.00 65.30  ? 59   LYS F NZ    1 
ATOM   4180  N  N     . VAL F 2  60  ? -8.800  -35.856 52.269 1.00 46.41  ? 60   VAL F N     1 
ATOM   4181  C  CA    . VAL F 2  60  ? -9.964  -35.625 51.411 1.00 45.49  ? 60   VAL F CA    1 
ATOM   4182  C  C     . VAL F 2  60  ? -9.733  -34.399 50.521 1.00 48.38  ? 60   VAL F C     1 
ATOM   4183  O  O     . VAL F 2  60  ? -10.098 -34.394 49.348 1.00 49.21  ? 60   VAL F O     1 
ATOM   4184  C  CB    . VAL F 2  60  ? -11.253 -35.359 52.218 1.00 41.90  ? 60   VAL F CB    1 
ATOM   4185  C  CG1   . VAL F 2  60  ? -12.329 -34.851 51.305 1.00 43.35  ? 60   VAL F CG1   1 
ATOM   4186  C  CG2   . VAL F 2  60  ? -11.758 -36.593 52.908 1.00 45.47  ? 60   VAL F CG2   1 
ATOM   4187  N  N     . PHE F 2  61  ? -9.146  -33.348 51.082 1.00 46.43  ? 61   PHE F N     1 
ATOM   4188  C  CA    . PHE F 2  61  ? -8.967  -32.160 50.300 1.00 45.85  ? 61   PHE F CA    1 
ATOM   4189  C  C     . PHE F 2  61  ? -8.047  -32.479 49.131 1.00 46.49  ? 61   PHE F C     1 
ATOM   4190  O  O     . PHE F 2  61  ? -8.408  -32.220 47.971 1.00 46.68  ? 61   PHE F O     1 
ATOM   4191  C  CB    . PHE F 2  61  ? -8.451  -30.999 51.148 1.00 45.26  ? 61   PHE F CB    1 
ATOM   4192  C  CG    . PHE F 2  61  ? -8.082  -29.785 50.352 1.00 44.72  ? 61   PHE F CG    1 
ATOM   4193  C  CD1   . PHE F 2  61  ? -8.990  -28.761 50.153 1.00 42.55  ? 61   PHE F CD1   1 
ATOM   4194  C  CD2   . PHE F 2  61  ? -6.810  -29.662 49.801 1.00 43.74  ? 61   PHE F CD2   1 
ATOM   4195  C  CE1   . PHE F 2  61  ? -8.630  -27.633 49.404 1.00 43.37  ? 61   PHE F CE1   1 
ATOM   4196  C  CE2   . PHE F 2  61  ? -6.454  -28.542 49.062 1.00 44.00  ? 61   PHE F CE2   1 
ATOM   4197  C  CZ    . PHE F 2  61  ? -7.367  -27.526 48.860 1.00 41.30  ? 61   PHE F CZ    1 
ATOM   4198  N  N     . LEU F 2  62  ? -6.894  -33.082 49.429 1.00 47.45  ? 62   LEU F N     1 
ATOM   4199  C  CA    . LEU F 2  62  ? -5.910  -33.441 48.390 1.00 47.38  ? 62   LEU F CA    1 
ATOM   4200  C  C     . LEU F 2  62  ? -6.409  -34.420 47.311 1.00 52.68  ? 62   LEU F C     1 
ATOM   4201  O  O     . LEU F 2  62  ? -6.131  -34.232 46.113 1.00 50.44  ? 62   LEU F O     1 
ATOM   4202  C  CB    . LEU F 2  62  ? -4.636  -33.969 49.027 1.00 48.51  ? 62   LEU F CB    1 
ATOM   4203  C  CG    . LEU F 2  62  ? -3.654  -32.909 49.526 1.00 46.85  ? 62   LEU F CG    1 
ATOM   4204  C  CD1   . LEU F 2  62  ? -2.420  -33.532 50.162 1.00 45.35  ? 62   LEU F CD1   1 
ATOM   4205  C  CD2   . LEU F 2  62  ? -3.239  -32.010 48.367 1.00 48.21  ? 62   LEU F CD2   1 
ATOM   4206  N  N     . GLU F 2  63  ? -7.151  -35.455 47.734 1.00 52.41  ? 63   GLU F N     1 
ATOM   4207  C  CA    . GLU F 2  63  ? -7.733  -36.398 46.808 1.00 50.70  ? 63   GLU F CA    1 
ATOM   4208  C  C     . GLU F 2  63  ? -8.576  -35.700 45.759 1.00 53.10  ? 63   GLU F C     1 
ATOM   4209  O  O     . GLU F 2  63  ? -8.415  -35.958 44.564 1.00 53.86  ? 63   GLU F O     1 
ATOM   4210  C  CB    . GLU F 2  63  ? -8.601  -37.372 47.555 1.00 57.37  ? 63   GLU F CB    1 
ATOM   4211  C  CG    . GLU F 2  63  ? -7.847  -38.507 48.215 1.00 65.57  ? 63   GLU F CG    1 
ATOM   4212  C  CD    . GLU F 2  63  ? -8.691  -39.200 49.273 1.00 66.99  ? 63   GLU F CD    1 
ATOM   4213  O  OE1   . GLU F 2  63  ? -9.933  -39.006 49.263 1.00 64.80  ? 63   GLU F OE1   1 
ATOM   4214  O  OE2   . GLU F 2  63  ? -8.103  -39.919 50.118 1.00 64.44  ? 63   GLU F OE2   1 
ATOM   4215  N  N     . ASN F 2  64  ? -9.480  -34.827 46.213 1.00 52.93  ? 64   ASN F N     1 
ATOM   4216  C  CA    . ASN F 2  64  ? -10.363 -34.094 45.319 1.00 48.99  ? 64   ASN F CA    1 
ATOM   4217  C  C     . ASN F 2  64  ? -9.586  -33.222 44.354 1.00 51.50  ? 64   ASN F C     1 
ATOM   4218  O  O     . ASN F 2  64  ? -9.865  -33.229 43.135 1.00 49.76  ? 64   ASN F O     1 
ATOM   4219  C  CB    . ASN F 2  64  ? -11.392 -33.314 46.103 1.00 48.68  ? 64   ASN F CB    1 
ATOM   4220  C  CG    . ASN F 2  64  ? -12.420 -34.222 46.740 1.00 52.94  ? 64   ASN F CG    1 
ATOM   4221  O  OD1   . ASN F 2  64  ? -12.692 -35.284 46.224 1.00 60.16  ? 64   ASN F OD1   1 
ATOM   4222  N  ND2   . ASN F 2  64  ? -12.981 -33.820 47.868 1.00 59.42  ? 64   ASN F ND2   1 
ATOM   4223  N  N     . VAL F 2  65  ? -8.575  -32.523 44.867 1.00 47.77  ? 65   VAL F N     1 
ATOM   4224  C  CA    . VAL F 2  65  ? -7.845  -31.653 43.984 1.00 51.00  ? 65   VAL F CA    1 
ATOM   4225  C  C     . VAL F 2  65  ? -6.963  -32.487 43.059 1.00 53.35  ? 65   VAL F C     1 
ATOM   4226  O  O     . VAL F 2  65  ? -6.955  -32.245 41.855 1.00 52.98  ? 65   VAL F O     1 
ATOM   4227  C  CB    . VAL F 2  65  ? -7.067  -30.535 44.714 1.00 53.95  ? 65   VAL F CB    1 
ATOM   4228  C  CG1   . VAL F 2  65  ? -6.364  -29.630 43.707 1.00 55.56  ? 65   VAL F CG1   1 
ATOM   4229  C  CG2   . VAL F 2  65  ? -8.013  -29.696 45.556 1.00 52.59  ? 65   VAL F CG2   1 
ATOM   4230  N  N     . ILE F 2  66  ? -6.259  -33.487 43.596 1.00 53.06  ? 66   ILE F N     1 
ATOM   4231  C  CA    . ILE F 2  66  ? -5.372  -34.285 42.747 1.00 49.46  ? 66   ILE F CA    1 
ATOM   4232  C  C     . ILE F 2  66  ? -6.132  -35.060 41.656 1.00 49.49  ? 66   ILE F C     1 
ATOM   4233  O  O     . ILE F 2  66  ? -5.665  -35.105 40.524 1.00 48.68  ? 66   ILE F O     1 
ATOM   4234  C  CB    . ILE F 2  66  ? -4.423  -35.188 43.549 1.00 51.85  ? 66   ILE F CB    1 
ATOM   4235  C  CG1   . ILE F 2  66  ? -3.355  -34.345 44.253 1.00 50.41  ? 66   ILE F CG1   1 
ATOM   4236  C  CG2   . ILE F 2  66  ? -3.715  -36.166 42.619 1.00 51.96  ? 66   ILE F CG2   1 
ATOM   4237  C  CD1   . ILE F 2  66  ? -2.968  -34.794 45.650 1.00 47.47  ? 66   ILE F CD1   1 
ATOM   4238  N  N     . ARG F 2  67  ? -7.299  -35.629 41.977 1.00 47.45  ? 67   ARG F N     1 
ATOM   4239  C  CA    . ARG F 2  67  ? -8.131  -36.324 40.987 1.00 48.21  ? 67   ARG F CA    1 
ATOM   4240  C  C     . ARG F 2  67  ? -8.343  -35.419 39.773 1.00 51.12  ? 67   ARG F C     1 
ATOM   4241  O  O     . ARG F 2  67  ? -7.940  -35.760 38.661 1.00 50.93  ? 67   ARG F O     1 
ATOM   4242  C  CB    . ARG F 2  67  ? -9.467  -36.780 41.596 1.00 54.88  ? 67   ARG F CB    1 
ATOM   4243  C  CG    . ARG F 2  67  ? -10.416 -37.555 40.663 1.00 59.68  ? 67   ARG F CG    1 
ATOM   4244  C  CD    . ARG F 2  67  ? -11.785 -37.870 41.317 1.00 68.29  ? 67   ARG F CD    1 
ATOM   4245  N  NE    . ARG F 2  67  ? -11.656 -38.592 42.609 1.00 86.47  ? 67   ARG F NE    1 
ATOM   4246  C  CZ    . ARG F 2  67  ? -12.065 -38.150 43.808 1.00 88.16  ? 67   ARG F CZ    1 
ATOM   4247  N  NH1   . ARG F 2  67  ? -12.681 -36.967 43.937 1.00 80.45  ? 67   ARG F NH1   1 
ATOM   4248  N  NH2   . ARG F 2  67  ? -11.873 -38.915 44.885 1.00 85.96  ? 67   ARG F NH2   1 
ATOM   4249  N  N     . ASP F 2  68  ? -8.921  -34.239 40.000 1.00 57.33  ? 68   ASP F N     1 
ATOM   4250  C  CA    . ASP F 2  68  ? -9.158  -33.241 38.933 1.00 52.40  ? 68   ASP F CA    1 
ATOM   4251  C  C     . ASP F 2  68  ? -7.882  -32.806 38.243 1.00 50.68  ? 68   ASP F C     1 
ATOM   4252  O  O     . ASP F 2  68  ? -7.837  -32.713 37.017 1.00 50.08  ? 68   ASP F O     1 
ATOM   4253  C  CB    . ASP F 2  68  ? -9.863  -32.016 39.488 1.00 51.80  ? 68   ASP F CB    1 
ATOM   4254  C  CG    . ASP F 2  68  ? -11.312 -32.280 39.795 1.00 54.48  ? 68   ASP F CG    1 
ATOM   4255  O  OD1   . ASP F 2  68  ? -11.746 -33.460 39.723 1.00 57.44  ? 68   ASP F OD1   1 
ATOM   4256  O  OD2   . ASP F 2  68  ? -12.012 -31.294 40.092 1.00 54.04  ? 68   ASP F OD2   1 
ATOM   4257  N  N     . ALA F 2  69  ? -6.838  -32.553 39.019 1.00 47.52  ? 69   ALA F N     1 
ATOM   4258  C  CA    . ALA F 2  69  ? -5.577  -32.177 38.415 1.00 47.74  ? 69   ALA F CA    1 
ATOM   4259  C  C     . ALA F 2  69  ? -5.138  -33.263 37.450 1.00 51.20  ? 69   ALA F C     1 
ATOM   4260  O  O     . ALA F 2  69  ? -4.909  -32.974 36.285 1.00 51.85  ? 69   ALA F O     1 
ATOM   4261  C  CB    . ALA F 2  69  ? -4.515  -31.912 39.472 1.00 46.34  ? 69   ALA F CB    1 
ATOM   4262  N  N     . VAL F 2  70  ? -5.065  -34.510 37.939 1.00 55.42  ? 70   VAL F N     1 
ATOM   4263  C  CA    . VAL F 2  70  ? -4.637  -35.664 37.144 1.00 52.40  ? 70   VAL F CA    1 
ATOM   4264  C  C     . VAL F 2  70  ? -5.573  -35.893 35.930 1.00 52.89  ? 70   VAL F C     1 
ATOM   4265  O  O     . VAL F 2  70  ? -5.105  -36.181 34.816 1.00 49.82  ? 70   VAL F O     1 
ATOM   4266  C  CB    . VAL F 2  70  ? -4.483  -36.926 38.017 1.00 48.53  ? 70   VAL F CB    1 
ATOM   4267  C  CG1   . VAL F 2  70  ? -4.276  -38.143 37.143 1.00 52.89  ? 70   VAL F CG1   1 
ATOM   4268  C  CG2   . VAL F 2  70  ? -3.293  -36.767 38.942 1.00 48.57  ? 70   VAL F CG2   1 
ATOM   4269  N  N     . THR F 2  71  ? -6.877  -35.733 36.127 1.00 44.89  ? 71   THR F N     1 
ATOM   4270  C  CA    . THR F 2  71  ? -7.777  -35.783 34.990 1.00 49.10  ? 71   THR F CA    1 
ATOM   4271  C  C     . THR F 2  71  ? -7.348  -34.821 33.843 1.00 56.28  ? 71   THR F C     1 
ATOM   4272  O  O     . THR F 2  71  ? -7.268  -35.239 32.676 1.00 60.17  ? 71   THR F O     1 
ATOM   4273  C  CB    . THR F 2  71  ? -9.237  -35.551 35.411 1.00 48.68  ? 71   THR F CB    1 
ATOM   4274  O  OG1   . THR F 2  71  ? -9.580  -36.445 36.478 1.00 48.29  ? 71   THR F OG1   1 
ATOM   4275  C  CG2   . THR F 2  71  ? -10.174 -35.777 34.260 1.00 44.67  ? 71   THR F CG2   1 
ATOM   4276  N  N     . TYR F 2  72  ? -7.069  -33.553 34.174 1.00 57.91  ? 72   TYR F N     1 
ATOM   4277  C  CA    . TYR F 2  72  ? -6.509  -32.574 33.207 1.00 59.57  ? 72   TYR F CA    1 
ATOM   4278  C  C     . TYR F 2  72  ? -5.201  -33.066 32.570 1.00 63.03  ? 72   TYR F C     1 
ATOM   4279  O  O     . TYR F 2  72  ? -5.020  -32.976 31.345 1.00 63.56  ? 72   TYR F O     1 
ATOM   4280  C  CB    . TYR F 2  72  ? -6.289  -31.171 33.837 1.00 56.48  ? 72   TYR F CB    1 
ATOM   4281  C  CG    . TYR F 2  72  ? -7.567  -30.363 34.051 1.00 54.22  ? 72   TYR F CG    1 
ATOM   4282  C  CD1   . TYR F 2  72  ? -7.960  -29.935 35.336 1.00 52.20  ? 72   TYR F CD1   1 
ATOM   4283  C  CD2   . TYR F 2  72  ? -8.385  -30.036 32.973 1.00 53.37  ? 72   TYR F CD2   1 
ATOM   4284  C  CE1   . TYR F 2  72  ? -9.132  -29.208 35.521 1.00 53.21  ? 72   TYR F CE1   1 
ATOM   4285  C  CE2   . TYR F 2  72  ? -9.550  -29.315 33.146 1.00 58.13  ? 72   TYR F CE2   1 
ATOM   4286  C  CZ    . TYR F 2  72  ? -9.925  -28.900 34.406 1.00 56.05  ? 72   TYR F CZ    1 
ATOM   4287  O  OH    . TYR F 2  72  ? -11.100 -28.189 34.484 1.00 53.78  ? 72   TYR F OH    1 
ATOM   4288  N  N     . THR F 2  73  ? -4.295  -33.582 33.399 1.00 59.82  ? 73   THR F N     1 
ATOM   4289  C  CA    . THR F 2  73  ? -3.079  -34.189 32.891 1.00 60.79  ? 73   THR F CA    1 
ATOM   4290  C  C     . THR F 2  73  ? -3.383  -35.235 31.818 1.00 62.51  ? 73   THR F C     1 
ATOM   4291  O  O     . THR F 2  73  ? -2.910  -35.115 30.703 1.00 58.72  ? 73   THR F O     1 
ATOM   4292  C  CB    . THR F 2  73  ? -2.309  -34.861 34.011 1.00 56.73  ? 73   THR F CB    1 
ATOM   4293  O  OG1   . THR F 2  73  ? -2.202  -33.945 35.098 1.00 62.87  ? 73   THR F OG1   1 
ATOM   4294  C  CG2   . THR F 2  73  ? -0.943  -35.245 33.526 1.00 56.51  ? 73   THR F CG2   1 
ATOM   4295  N  N     . GLU F 2  74  ? -4.191  -36.240 32.159 1.00 65.21  ? 74   GLU F N     1 
ATOM   4296  C  CA    . GLU F 2  74  ? -4.495  -37.330 31.232 1.00 68.40  ? 74   GLU F CA    1 
ATOM   4297  C  C     . GLU F 2  74  ? -5.180  -36.812 29.985 1.00 69.83  ? 74   GLU F C     1 
ATOM   4298  O  O     . GLU F 2  74  ? -4.878  -37.268 28.884 1.00 69.44  ? 74   GLU F O     1 
ATOM   4299  C  CB    . GLU F 2  74  ? -5.375  -38.412 31.860 1.00 69.37  ? 74   GLU F CB    1 
ATOM   4300  C  CG    . GLU F 2  74  ? -4.755  -39.186 33.018 1.00 77.05  ? 74   GLU F CG    1 
ATOM   4301  C  CD    . GLU F 2  74  ? -5.750  -40.167 33.641 1.00 88.76  ? 74   GLU F CD    1 
ATOM   4302  O  OE1   . GLU F 2  74  ? -6.532  -40.757 32.872 1.00 91.57  ? 74   GLU F OE1   1 
ATOM   4303  O  OE2   . GLU F 2  74  ? -5.772  -40.356 34.884 1.00 85.50  ? 74   GLU F OE2   1 
ATOM   4304  N  N     . HIS F 2  75  ? -6.093  -35.855 30.136 1.00 69.90  ? 75   HIS F N     1 
ATOM   4305  C  CA    . HIS F 2  75  ? -6.796  -35.376 28.950 1.00 67.88  ? 75   HIS F CA    1 
ATOM   4306  C  C     . HIS F 2  75  ? -5.849  -34.766 27.953 1.00 69.58  ? 75   HIS F C     1 
ATOM   4307  O  O     . HIS F 2  75  ? -6.070  -34.830 26.741 1.00 72.12  ? 75   HIS F O     1 
ATOM   4308  C  CB    . HIS F 2  75  ? -7.895  -34.405 29.284 1.00 64.80  ? 75   HIS F CB    1 
ATOM   4309  C  CG    . HIS F 2  75  ? -8.650  -33.946 28.073 1.00 67.90  ? 75   HIS F CG    1 
ATOM   4310  N  ND1   . HIS F 2  75  ? -9.874  -34.416 27.770 1.00 70.28  ? 75   HIS F ND1   1 
ATOM   4311  C  CD2   . HIS F 2  75  ? -8.299  -33.057 27.052 1.00 65.32  ? 75   HIS F CD2   1 
ATOM   4312  C  CE1   . HIS F 2  75  ? -10.303 -33.846 26.627 1.00 74.43  ? 75   HIS F CE1   1 
ATOM   4313  N  NE2   . HIS F 2  75  ? -9.334  -33.012 26.187 1.00 72.30  ? 75   HIS F NE2   1 
ATOM   4314  N  N     . ALA F 2  76  ? -4.779  -34.172 28.470 1.00 66.75  ? 76   ALA F N     1 
ATOM   4315  C  CA    . ALA F 2  76  ? -3.764  -33.556 27.653 1.00 61.95  ? 76   ALA F CA    1 
ATOM   4316  C  C     . ALA F 2  76  ? -2.774  -34.585 27.107 1.00 66.51  ? 76   ALA F C     1 
ATOM   4317  O  O     . ALA F 2  76  ? -1.884  -34.202 26.355 1.00 71.42  ? 76   ALA F O     1 
ATOM   4318  C  CB    . ALA F 2  76  ? -3.031  -32.502 28.461 1.00 59.74  ? 76   ALA F CB    1 
ATOM   4319  N  N     . LYS F 2  77  ? -2.922  -35.865 27.482 1.00 65.39  ? 77   LYS F N     1 
ATOM   4320  C  CA    . LYS F 2  77  ? -1.985  -36.957 27.086 1.00 67.32  ? 77   LYS F CA    1 
ATOM   4321  C  C     . LYS F 2  77  ? -0.553  -36.746 27.598 1.00 66.03  ? 77   LYS F C     1 
ATOM   4322  O  O     . LYS F 2  77  ? 0.412   -36.997 26.877 1.00 70.72  ? 77   LYS F O     1 
ATOM   4323  C  CB    . LYS F 2  77  ? -1.978  -37.174 25.558 1.00 65.99  ? 77   LYS F CB    1 
ATOM   4324  C  CG    . LYS F 2  77  ? -3.274  -37.733 24.990 1.00 75.26  ? 77   LYS F CG    1 
ATOM   4325  C  CD    . LYS F 2  77  ? -3.377  -37.486 23.489 1.00 84.81  ? 77   LYS F CD    1 
ATOM   4326  C  CE    . LYS F 2  77  ? -4.697  -38.018 22.921 1.00 91.13  ? 77   LYS F CE    1 
ATOM   4327  N  NZ    . LYS F 2  77  ? -4.868  -37.686 21.470 1.00 92.66  ? 77   LYS F NZ    1 
ATOM   4328  N  N     . ARG F 2  78  ? -0.429  -36.256 28.828 1.00 62.33  ? 78   ARG F N     1 
ATOM   4329  C  CA    . ARG F 2  78  ? 0.864   -35.982 29.443 1.00 60.61  ? 78   ARG F CA    1 
ATOM   4330  C  C     . ARG F 2  78  ? 1.119   -36.960 30.581 1.00 62.44  ? 78   ARG F C     1 
ATOM   4331  O  O     . ARG F 2  78  ? 0.209   -37.685 30.988 1.00 65.95  ? 78   ARG F O     1 
ATOM   4332  C  CB    . ARG F 2  78  ? 0.924   -34.549 29.958 1.00 58.99  ? 78   ARG F CB    1 
ATOM   4333  C  CG    . ARG F 2  78  ? 1.315   -33.540 28.902 1.00 60.14  ? 78   ARG F CG    1 
ATOM   4334  C  CD    . ARG F 2  78  ? 1.447   -32.135 29.466 1.00 62.95  ? 78   ARG F CD    1 
ATOM   4335  N  NE    . ARG F 2  78  ? 0.137   -31.499 29.713 1.00 69.94  ? 78   ARG F NE    1 
ATOM   4336  C  CZ    . ARG F 2  78  ? -0.399  -31.301 30.923 1.00 64.21  ? 78   ARG F CZ    1 
ATOM   4337  N  NH1   . ARG F 2  78  ? 0.247   -31.675 32.020 1.00 60.46  ? 78   ARG F NH1   1 
ATOM   4338  N  NH2   . ARG F 2  78  ? -1.580  -30.721 31.035 1.00 57.33  ? 78   ARG F NH2   1 
ATOM   4339  N  N     . LYS F 2  79  ? 2.355   -36.993 31.075 1.00 64.03  ? 79   LYS F N     1 
ATOM   4340  C  CA    . LYS F 2  79  ? 2.724   -37.864 32.192 1.00 68.45  ? 79   LYS F CA    1 
ATOM   4341  C  C     . LYS F 2  79  ? 3.109   -37.001 33.384 1.00 68.45  ? 79   LYS F C     1 
ATOM   4342  O  O     . LYS F 2  79  ? 3.252   -37.481 34.526 1.00 65.97  ? 79   LYS F O     1 
ATOM   4343  C  CB    . LYS F 2  79  ? 3.876   -38.792 31.807 1.00 74.79  ? 79   LYS F CB    1 
ATOM   4344  C  CG    . LYS F 2  79  ? 3.559   -39.768 30.679 1.00 84.11  ? 79   LYS F CG    1 
ATOM   4345  C  CD    . LYS F 2  79  ? 4.161   -41.128 31.004 1.00 101.12 ? 79   LYS F CD    1 
ATOM   4346  C  CE    . LYS F 2  79  ? 4.783   -41.791 29.781 1.00 111.41 ? 79   LYS F CE    1 
ATOM   4347  N  NZ    . LYS F 2  79  ? 5.878   -42.723 30.193 1.00 109.01 ? 79   LYS F NZ    1 
ATOM   4348  N  N     . THR F 2  80  ? 3.255   -35.711 33.099 1.00 66.14  ? 80   THR F N     1 
ATOM   4349  C  CA    . THR F 2  80  ? 3.627   -34.744 34.105 1.00 69.12  ? 80   THR F CA    1 
ATOM   4350  C  C     . THR F 2  80  ? 2.453   -33.850 34.459 1.00 67.47  ? 80   THR F C     1 
ATOM   4351  O  O     . THR F 2  80  ? 1.818   -33.267 33.587 1.00 69.96  ? 80   THR F O     1 
ATOM   4352  C  CB    . THR F 2  80  ? 4.805   -33.893 33.634 1.00 69.81  ? 80   THR F CB    1 
ATOM   4353  O  OG1   . THR F 2  80  ? 5.778   -34.753 33.031 1.00 75.24  ? 80   THR F OG1   1 
ATOM   4354  C  CG2   . THR F 2  80  ? 5.439   -33.183 34.822 1.00 73.26  ? 80   THR F CG2   1 
ATOM   4355  N  N     . VAL F 2  81  ? 2.169   -33.762 35.748 1.00 65.78  ? 81   VAL F N     1 
ATOM   4356  C  CA    . VAL F 2  81  ? 1.155   -32.865 36.257 1.00 63.16  ? 81   VAL F CA    1 
ATOM   4357  C  C     . VAL F 2  81  ? 1.727   -31.447 36.344 1.00 63.88  ? 81   VAL F C     1 
ATOM   4358  O  O     . VAL F 2  81  ? 2.740   -31.204 37.018 1.00 63.99  ? 81   VAL F O     1 
ATOM   4359  C  CB    . VAL F 2  81  ? 0.732   -33.301 37.653 1.00 63.91  ? 81   VAL F CB    1 
ATOM   4360  C  CG1   . VAL F 2  81  ? -0.298  -32.310 38.190 1.00 62.31  ? 81   VAL F CG1   1 
ATOM   4361  C  CG2   . VAL F 2  81  ? 0.238   -34.756 37.624 1.00 55.30  ? 81   VAL F CG2   1 
ATOM   4362  N  N     . THR F 2  82  ? 1.092   -30.505 35.660 1.00 60.69  ? 82   THR F N     1 
ATOM   4363  C  CA    . THR F 2  82  ? 1.612   -29.126 35.631 1.00 59.93  ? 82   THR F CA    1 
ATOM   4364  C  C     . THR F 2  82  ? 1.002   -28.268 36.723 1.00 58.80  ? 82   THR F C     1 
ATOM   4365  O  O     . THR F 2  82  ? -0.125  -28.510 37.171 1.00 60.96  ? 82   THR F O     1 
ATOM   4366  C  CB    . THR F 2  82  ? 1.314   -28.414 34.294 1.00 57.15  ? 82   THR F CB    1 
ATOM   4367  O  OG1   . THR F 2  82  ? -0.098  -28.458 34.054 1.00 56.45  ? 82   THR F OG1   1 
ATOM   4368  C  CG2   . THR F 2  82  ? 2.020   -29.089 33.129 1.00 58.34  ? 82   THR F CG2   1 
ATOM   4369  N  N     . ALA F 2  83  ? 1.744   -27.242 37.124 1.00 58.21  ? 83   ALA F N     1 
ATOM   4370  C  CA    . ALA F 2  83  ? 1.193   -26.124 37.885 1.00 53.21  ? 83   ALA F CA    1 
ATOM   4371  C  C     . ALA F 2  83  ? -0.186  -25.713 37.353 1.00 53.19  ? 83   ALA F C     1 
ATOM   4372  O  O     . ALA F 2  83  ? -1.123  -25.516 38.138 1.00 55.72  ? 83   ALA F O     1 
ATOM   4373  C  CB    . ALA F 2  83  ? 2.147   -24.964 37.828 1.00 51.29  ? 83   ALA F CB    1 
ATOM   4374  N  N     . MET F 2  84  ? -0.318  -25.625 36.026 1.00 51.86  ? 84   MET F N     1 
ATOM   4375  C  CA    . MET F 2  84  ? -1.601  -25.333 35.394 1.00 51.29  ? 84   MET F CA    1 
ATOM   4376  C  C     . MET F 2  84  ? -2.681  -26.380 35.644 1.00 52.94  ? 84   MET F C     1 
ATOM   4377  O  O     . MET F 2  84  ? -3.835  -26.029 35.821 1.00 56.01  ? 84   MET F O     1 
ATOM   4378  C  CB    . MET F 2  84  ? -1.441  -25.048 33.895 1.00 53.48  ? 84   MET F CB    1 
ATOM   4379  C  CG    . MET F 2  84  ? -0.695  -23.738 33.618 1.00 65.17  ? 84   MET F CG    1 
ATOM   4380  S  SD    . MET F 2  84  ? -1.115  -22.351 34.743 1.00 68.43  ? 84   MET F SD    1 
ATOM   4381  C  CE    . MET F 2  84  ? -2.787  -22.004 34.146 1.00 61.54  ? 84   MET F CE    1 
ATOM   4382  N  N     . ASP F 2  85  ? -2.327  -27.661 35.681 1.00 53.70  ? 85   ASP F N     1 
ATOM   4383  C  CA    . ASP F 2  85  ? -3.351  -28.696 35.932 1.00 54.58  ? 85   ASP F CA    1 
ATOM   4384  C  C     . ASP F 2  85  ? -3.971  -28.489 37.302 1.00 52.07  ? 85   ASP F C     1 
ATOM   4385  O  O     . ASP F 2  85  ? -5.202  -28.542 37.461 1.00 49.13  ? 85   ASP F O     1 
ATOM   4386  C  CB    . ASP F 2  85  ? -2.778  -30.125 35.842 1.00 59.35  ? 85   ASP F CB    1 
ATOM   4387  C  CG    . ASP F 2  85  ? -2.325  -30.504 34.435 1.00 60.33  ? 85   ASP F CG    1 
ATOM   4388  O  OD1   . ASP F 2  85  ? -3.051  -30.177 33.462 1.00 63.50  ? 85   ASP F OD1   1 
ATOM   4389  O  OD2   . ASP F 2  85  ? -1.249  -31.135 34.324 1.00 55.46  ? 85   ASP F OD2   1 
ATOM   4390  N  N     . VAL F 2  86  ? -3.104  -28.278 38.293 1.00 50.29  ? 86   VAL F N     1 
ATOM   4391  C  CA    . VAL F 2  86  ? -3.530  -27.939 39.648 1.00 49.66  ? 86   VAL F CA    1 
ATOM   4392  C  C     . VAL F 2  86  ? -4.299  -26.614 39.703 1.00 53.59  ? 86   VAL F C     1 
ATOM   4393  O  O     . VAL F 2  86  ? -5.335  -26.522 40.375 1.00 54.00  ? 86   VAL F O     1 
ATOM   4394  C  CB    . VAL F 2  86  ? -2.322  -27.799 40.548 1.00 49.45  ? 86   VAL F CB    1 
ATOM   4395  C  CG1   . VAL F 2  86  ? -2.780  -27.451 41.938 1.00 50.90  ? 86   VAL F CG1   1 
ATOM   4396  C  CG2   . VAL F 2  86  ? -1.521  -29.090 40.549 1.00 51.90  ? 86   VAL F CG2   1 
ATOM   4397  N  N     . VAL F 2  87  ? -3.809  -25.591 38.985 1.00 51.73  ? 87   VAL F N     1 
ATOM   4398  C  CA    . VAL F 2  87  ? -4.503  -24.310 39.002 1.00 53.38  ? 87   VAL F CA    1 
ATOM   4399  C  C     . VAL F 2  87  ? -5.934  -24.471 38.488 1.00 54.51  ? 87   VAL F C     1 
ATOM   4400  O  O     . VAL F 2  87  ? -6.869  -24.039 39.139 1.00 68.76  ? 87   VAL F O     1 
ATOM   4401  C  CB    . VAL F 2  87  ? -3.736  -23.158 38.312 1.00 50.78  ? 87   VAL F CB    1 
ATOM   4402  C  CG1   . VAL F 2  87  ? -4.603  -21.915 38.254 1.00 47.62  ? 87   VAL F CG1   1 
ATOM   4403  C  CG2   . VAL F 2  87  ? -2.475  -22.813 39.085 1.00 46.69  ? 87   VAL F CG2   1 
ATOM   4404  N  N     . TYR F 2  88  ? -6.105  -25.147 37.367 1.00 54.66  ? 88   TYR F N     1 
ATOM   4405  C  CA    . TYR F 2  88  ? -7.437  -25.421 36.829 1.00 55.89  ? 88   TYR F CA    1 
ATOM   4406  C  C     . TYR F 2  88  ? -8.289  -26.289 37.712 1.00 55.15  ? 88   TYR F C     1 
ATOM   4407  O  O     . TYR F 2  88  ? -9.509  -26.182 37.681 1.00 57.76  ? 88   TYR F O     1 
ATOM   4408  C  CB    . TYR F 2  88  ? -7.357  -26.075 35.450 1.00 57.34  ? 88   TYR F CB    1 
ATOM   4409  C  CG    . TYR F 2  88  ? -6.679  -25.219 34.415 1.00 62.52  ? 88   TYR F CG    1 
ATOM   4410  C  CD1   . TYR F 2  88  ? -5.695  -25.751 33.600 1.00 67.00  ? 88   TYR F CD1   1 
ATOM   4411  C  CD2   . TYR F 2  88  ? -7.003  -23.869 34.266 1.00 63.95  ? 88   TYR F CD2   1 
ATOM   4412  C  CE1   . TYR F 2  88  ? -5.055  -24.981 32.648 1.00 70.25  ? 88   TYR F CE1   1 
ATOM   4413  C  CE2   . TYR F 2  88  ? -6.376  -23.094 33.324 1.00 69.42  ? 88   TYR F CE2   1 
ATOM   4414  C  CZ    . TYR F 2  88  ? -5.406  -23.666 32.512 1.00 73.78  ? 88   TYR F CZ    1 
ATOM   4415  O  OH    . TYR F 2  88  ? -4.765  -22.927 31.563 1.00 76.77  ? 88   TYR F OH    1 
ATOM   4416  N  N     . ALA F 2  89  ? -7.657  -27.170 38.478 1.00 58.72  ? 89   ALA F N     1 
ATOM   4417  C  CA    . ALA F 2  89  ? -8.421  -28.079 39.318 1.00 58.52  ? 89   ALA F CA    1 
ATOM   4418  C  C     . ALA F 2  89  ? -8.924  -27.222 40.433 1.00 55.41  ? 89   ALA F C     1 
ATOM   4419  O  O     . ALA F 2  89  ? -10.114 -27.263 40.752 1.00 59.00  ? 89   ALA F O     1 
ATOM   4420  C  CB    . ALA F 2  89  ? -7.564  -29.216 39.850 1.00 56.73  ? 89   ALA F CB    1 
ATOM   4421  N  N     . LEU F 2  90  ? -8.025  -26.416 40.994 1.00 50.46  ? 90   LEU F N     1 
ATOM   4422  C  CA    . LEU F 2  90  ? -8.380  -25.536 42.083 1.00 49.82  ? 90   LEU F CA    1 
ATOM   4423  C  C     . LEU F 2  90  ? -9.557  -24.615 41.708 1.00 53.87  ? 90   LEU F C     1 
ATOM   4424  O  O     . LEU F 2  90  ? -10.492 -24.431 42.505 1.00 52.02  ? 90   LEU F O     1 
ATOM   4425  C  CB    . LEU F 2  90  ? -7.158  -24.760 42.525 1.00 48.73  ? 90   LEU F CB    1 
ATOM   4426  C  CG    . LEU F 2  90  ? -6.227  -25.516 43.470 1.00 49.87  ? 90   LEU F CG    1 
ATOM   4427  C  CD1   . LEU F 2  90  ? -4.927  -24.762 43.709 1.00 44.97  ? 90   LEU F CD1   1 
ATOM   4428  C  CD2   . LEU F 2  90  ? -6.935  -25.834 44.786 1.00 48.64  ? 90   LEU F CD2   1 
ATOM   4429  N  N     . LYS F 2  91  ? -9.534  -24.075 40.489 1.00 50.45  ? 91   LYS F N     1 
ATOM   4430  C  CA    . LYS F 2  91  ? -10.616 -23.221 40.034 1.00 53.37  ? 91   LYS F CA    1 
ATOM   4431  C  C     . LYS F 2  91  ? -11.975 -23.945 40.001 1.00 53.18  ? 91   LYS F C     1 
ATOM   4432  O  O     . LYS F 2  91  ? -12.945 -23.457 40.562 1.00 54.92  ? 91   LYS F O     1 
ATOM   4433  C  CB    . LYS F 2  91  ? -10.257 -22.572 38.695 1.00 56.02  ? 91   LYS F CB    1 
ATOM   4434  C  CG    . LYS F 2  91  ? -11.319 -21.683 38.054 1.00 56.71  ? 91   LYS F CG    1 
ATOM   4435  C  CD    . LYS F 2  91  ? -10.695 -20.795 36.982 1.00 56.41  ? 91   LYS F CD    1 
ATOM   4436  C  CE    . LYS F 2  91  ? -10.631 -19.358 37.457 1.00 70.45  ? 91   LYS F CE    1 
ATOM   4437  N  NZ    . LYS F 2  91  ? -9.307  -18.694 37.259 1.00 76.41  ? 91   LYS F NZ    1 
ATOM   4438  N  N     . ARG F 2  92  ? -12.041 -25.104 39.356 1.00 56.71  ? 92   ARG F N     1 
ATOM   4439  C  CA    . ARG F 2  92  ? -13.265 -25.926 39.309 1.00 54.89  ? 92   ARG F CA    1 
ATOM   4440  C  C     . ARG F 2  92  ? -13.887 -26.105 40.673 1.00 55.33  ? 92   ARG F C     1 
ATOM   4441  O  O     . ARG F 2  92  ? -15.081 -26.137 40.807 1.00 58.59  ? 92   ARG F O     1 
ATOM   4442  C  CB    . ARG F 2  92  ? -12.927 -27.337 38.851 1.00 59.79  ? 92   ARG F CB    1 
ATOM   4443  C  CG    . ARG F 2  92  ? -12.959 -27.572 37.370 1.00 61.36  ? 92   ARG F CG    1 
ATOM   4444  C  CD    . ARG F 2  92  ? -13.167 -29.047 37.110 1.00 58.86  ? 92   ARG F CD    1 
ATOM   4445  N  NE    . ARG F 2  92  ? -14.573 -29.374 37.300 1.00 58.89  ? 92   ARG F NE    1 
ATOM   4446  C  CZ    . ARG F 2  92  ? -15.043 -29.913 38.411 1.00 59.20  ? 92   ARG F CZ    1 
ATOM   4447  N  NH1   . ARG F 2  92  ? -14.209 -30.188 39.394 1.00 58.62  ? 92   ARG F NH1   1 
ATOM   4448  N  NH2   . ARG F 2  92  ? -16.329 -30.199 38.535 1.00 66.93  ? 92   ARG F NH2   1 
ATOM   4449  N  N     . GLN F 2  93  ? -13.063 -26.277 41.689 1.00 58.15  ? 93   GLN F N     1 
ATOM   4450  C  CA    . GLN F 2  93  ? -13.566 -26.569 42.993 1.00 56.53  ? 93   GLN F CA    1 
ATOM   4451  C  C     . GLN F 2  93  ? -13.826 -25.372 43.840 1.00 52.90  ? 93   GLN F C     1 
ATOM   4452  O  O     . GLN F 2  93  ? -13.929 -25.510 45.043 1.00 55.16  ? 93   GLN F O     1 
ATOM   4453  C  CB    . GLN F 2  93  ? -12.573 -27.473 43.690 1.00 70.87  ? 93   GLN F CB    1 
ATOM   4454  C  CG    . GLN F 2  93  ? -13.009 -28.928 43.592 1.00 82.10  ? 93   GLN F CG    1 
ATOM   4455  C  CD    . GLN F 2  93  ? -11.836 -29.843 43.553 1.00 82.99  ? 93   GLN F CD    1 
ATOM   4456  O  OE1   . GLN F 2  93  ? -10.865 -29.667 44.310 1.00 90.39  ? 93   GLN F OE1   1 
ATOM   4457  N  NE2   . GLN F 2  93  ? -11.892 -30.819 42.655 1.00 74.02  ? 93   GLN F NE2   1 
ATOM   4458  N  N     . GLY F 2  94  ? -13.907 -24.194 43.220 1.00 53.84  ? 94   GLY F N     1 
ATOM   4459  C  CA    . GLY F 2  94  ? -14.108 -22.934 43.928 1.00 47.33  ? 94   GLY F CA    1 
ATOM   4460  C  C     . GLY F 2  94  ? -13.016 -22.537 44.904 1.00 51.87  ? 94   GLY F C     1 
ATOM   4461  O  O     . GLY F 2  94  ? -13.310 -21.853 45.869 1.00 56.80  ? 94   GLY F O     1 
ATOM   4462  N  N     . ARG F 2  95  ? -11.769 -22.954 44.665 1.00 51.99  ? 95   ARG F N     1 
ATOM   4463  C  CA    . ARG F 2  95  ? -10.629 -22.502 45.450 1.00 48.63  ? 95   ARG F CA    1 
ATOM   4464  C  C     . ARG F 2  95  ? -9.536  -21.897 44.519 1.00 53.54  ? 95   ARG F C     1 
ATOM   4465  O  O     . ARG F 2  95  ? -8.349  -22.285 44.592 1.00 57.37  ? 95   ARG F O     1 
ATOM   4466  C  CB    . ARG F 2  95  ? -10.009 -23.638 46.258 1.00 45.84  ? 95   ARG F CB    1 
ATOM   4467  C  CG    . ARG F 2  95  ? -10.937 -24.652 46.861 1.00 51.48  ? 95   ARG F CG    1 
ATOM   4468  C  CD    . ARG F 2  95  ? -11.228 -24.460 48.336 1.00 58.85  ? 95   ARG F CD    1 
ATOM   4469  N  NE    . ARG F 2  95  ? -10.197 -23.681 49.022 1.00 64.33  ? 95   ARG F NE    1 
ATOM   4470  C  CZ    . ARG F 2  95  ? -10.417 -22.965 50.126 1.00 59.15  ? 95   ARG F CZ    1 
ATOM   4471  N  NH1   . ARG F 2  95  ? -11.621 -22.960 50.672 1.00 62.01  ? 95   ARG F NH1   1 
ATOM   4472  N  NH2   . ARG F 2  95  ? -9.434  -22.271 50.691 1.00 55.78  ? 95   ARG F NH2   1 
ATOM   4473  N  N     . THR F 2  96  ? -9.919  -20.943 43.670 1.00 51.08  ? 96   THR F N     1 
ATOM   4474  C  CA    . THR F 2  96  ? -8.953  -20.229 42.806 1.00 51.61  ? 96   THR F CA    1 
ATOM   4475  C  C     . THR F 2  96  ? -7.685  -19.768 43.471 1.00 44.31  ? 96   THR F C     1 
ATOM   4476  O  O     . THR F 2  96  ? -7.730  -19.184 44.544 1.00 48.45  ? 96   THR F O     1 
ATOM   4477  C  CB    . THR F 2  96  ? -9.589  -18.984 42.216 1.00 49.87  ? 96   THR F CB    1 
ATOM   4478  O  OG1   . THR F 2  96  ? -10.769 -19.375 41.518 1.00 51.55  ? 96   THR F OG1   1 
ATOM   4479  C  CG2   . THR F 2  96  ? -8.644  -18.355 41.266 1.00 45.33  ? 96   THR F CG2   1 
ATOM   4480  N  N     . LEU F 2  97  ? -6.566  -20.014 42.809 1.00 44.83  ? 97   LEU F N     1 
ATOM   4481  C  CA    . LEU F 2  97  ? -5.239  -19.680 43.349 1.00 48.89  ? 97   LEU F CA    1 
ATOM   4482  C  C     . LEU F 2  97  ? -4.545  -18.679 42.425 1.00 53.24  ? 97   LEU F C     1 
ATOM   4483  O  O     . LEU F 2  97  ? -4.552  -18.868 41.198 1.00 52.82  ? 97   LEU F O     1 
ATOM   4484  C  CB    . LEU F 2  97  ? -4.370  -20.944 43.479 1.00 43.38  ? 97   LEU F CB    1 
ATOM   4485  C  CG    . LEU F 2  97  ? -2.916  -20.798 43.932 1.00 41.76  ? 97   LEU F CG    1 
ATOM   4486  C  CD1   . LEU F 2  97  ? -2.795  -20.399 45.389 1.00 42.29  ? 97   LEU F CD1   1 
ATOM   4487  C  CD2   . LEU F 2  97  ? -2.153  -22.077 43.712 1.00 45.48  ? 97   LEU F CD2   1 
ATOM   4488  N  N     . TYR F 2  98  ? -3.967  -17.622 43.001 1.00 48.81  ? 98   TYR F N     1 
ATOM   4489  C  CA    . TYR F 2  98  ? -3.124  -16.741 42.225 1.00 47.80  ? 98   TYR F CA    1 
ATOM   4490  C  C     . TYR F 2  98  ? -1.691  -17.019 42.591 1.00 51.91  ? 98   TYR F C     1 
ATOM   4491  O  O     . TYR F 2  98  ? -1.391  -17.314 43.764 1.00 54.46  ? 98   TYR F O     1 
ATOM   4492  C  CB    . TYR F 2  98  ? -3.421  -15.301 42.575 1.00 53.71  ? 98   TYR F CB    1 
ATOM   4493  C  CG    . TYR F 2  98  ? -4.766  -14.733 42.139 1.00 53.74  ? 98   TYR F CG    1 
ATOM   4494  C  CD1   . TYR F 2  98  ? -5.630  -15.434 41.290 1.00 50.58  ? 98   TYR F CD1   1 
ATOM   4495  C  CD2   . TYR F 2  98  ? -5.132  -13.448 42.537 1.00 49.81  ? 98   TYR F CD2   1 
ATOM   4496  C  CE1   . TYR F 2  98  ? -6.832  -14.874 40.877 1.00 51.41  ? 98   TYR F CE1   1 
ATOM   4497  C  CE2   . TYR F 2  98  ? -6.334  -12.899 42.145 1.00 53.66  ? 98   TYR F CE2   1 
ATOM   4498  C  CZ    . TYR F 2  98  ? -7.169  -13.614 41.304 1.00 53.54  ? 98   TYR F CZ    1 
ATOM   4499  O  OH    . TYR F 2  98  ? -8.353  -13.055 40.926 1.00 58.85  ? 98   TYR F OH    1 
ATOM   4500  N  N     . GLY F 2  99  ? -0.796  -16.928 41.606 1.00 52.67  ? 99   GLY F N     1 
ATOM   4501  C  CA    . GLY F 2  99  ? 0.645   -16.954 41.879 1.00 48.91  ? 99   GLY F CA    1 
ATOM   4502  C  C     . GLY F 2  99  ? 1.418   -18.013 41.133 1.00 54.02  ? 99   GLY F C     1 
ATOM   4503  O  O     . GLY F 2  99  ? 2.651   -18.119 41.295 1.00 59.62  ? 99   GLY F O     1 
ATOM   4504  N  N     . PHE F 2  100 ? 0.705   -18.796 40.317 1.00 55.83  ? 100  PHE F N     1 
ATOM   4505  C  CA    . PHE F 2  100 ? 1.275   -19.976 39.647 1.00 52.58  ? 100  PHE F CA    1 
ATOM   4506  C  C     . PHE F 2  100 ? 0.887   -20.087 38.175 1.00 53.22  ? 100  PHE F C     1 
ATOM   4507  O  O     . PHE F 2  100 ? 1.085   -21.124 37.564 1.00 60.96  ? 100  PHE F O     1 
ATOM   4508  C  CB    . PHE F 2  100 ? 0.923   -21.280 40.409 1.00 47.80  ? 100  PHE F CB    1 
ATOM   4509  C  CG    . PHE F 2  100 ? 1.610   -21.415 41.746 1.00 44.90  ? 100  PHE F CG    1 
ATOM   4510  C  CD1   . PHE F 2  100 ? 0.988   -20.984 42.921 1.00 47.22  ? 100  PHE F CD1   1 
ATOM   4511  C  CD2   . PHE F 2  100 ? 2.883   -21.963 41.836 1.00 46.04  ? 100  PHE F CD2   1 
ATOM   4512  C  CE1   . PHE F 2  100 ? 1.617   -21.094 44.166 1.00 47.06  ? 100  PHE F CE1   1 
ATOM   4513  C  CE2   . PHE F 2  100 ? 3.532   -22.076 43.074 1.00 49.08  ? 100  PHE F CE2   1 
ATOM   4514  C  CZ    . PHE F 2  100 ? 2.899   -21.636 44.240 1.00 50.58  ? 100  PHE F CZ    1 
ATOM   4515  N  N     . GLY F 2  101 ? 0.337   -19.031 37.599 1.00 52.54  ? 101  GLY F N     1 
ATOM   4516  C  CA    . GLY F 2  101 ? 0.091   -19.005 36.166 1.00 52.06  ? 101  GLY F CA    1 
ATOM   4517  C  C     . GLY F 2  101 ? -1.386  -18.943 35.857 1.00 56.27  ? 101  GLY F C     1 
ATOM   4518  O  O     . GLY F 2  101 ? -1.830  -19.061 34.698 1.00 57.27  ? 101  GLY F O     1 
ATOM   4519  N  N     . GLY F 2  102 ? -2.178  -18.729 36.887 1.00 57.47  ? 102  GLY F N     1 
ATOM   4520  C  CA    . GLY F 2  102 ? -3.617  -18.652 36.646 1.00 74.35  ? 102  GLY F CA    1 
ATOM   4521  C  C     . GLY F 2  102 ? -4.411  -17.685 37.521 1.00 87.17  ? 102  GLY F C     1 
ATOM   4522  O  O     . GLY F 2  102 ? -4.992  -16.710 36.993 1.00 93.18  ? 102  GLY F O     1 
ATOM   4523  O  OXT   . GLY F 2  102 ? -4.512  -17.859 38.752 1.00 78.69  ? 102  GLY F OXT   1 
ATOM   4524  N  N     . ALA G 3  14  ? -34.744 -40.823 4.885  1.00 116.75 ? 14   ALA G N     1 
ATOM   4525  C  CA    . ALA G 3  14  ? -34.204 -40.050 6.050  1.00 122.87 ? 14   ALA G CA    1 
ATOM   4526  C  C     . ALA G 3  14  ? -34.412 -40.804 7.370  1.00 127.52 ? 14   ALA G C     1 
ATOM   4527  O  O     . ALA G 3  14  ? -35.511 -41.299 7.639  1.00 131.76 ? 14   ALA G O     1 
ATOM   4528  C  CB    . ALA G 3  14  ? -34.857 -38.672 6.118  1.00 113.00 ? 14   ALA G CB    1 
ATOM   4529  N  N     . LYS G 3  15  ? -33.357 -40.900 8.182  1.00 136.92 ? 15   LYS G N     1 
ATOM   4530  C  CA    . LYS G 3  15  ? -33.444 -41.519 9.518  1.00 137.13 ? 15   LYS G CA    1 
ATOM   4531  C  C     . LYS G 3  15  ? -32.670 -40.725 10.572 1.00 131.50 ? 15   LYS G C     1 
ATOM   4532  O  O     . LYS G 3  15  ? -31.448 -40.533 10.449 1.00 135.99 ? 15   LYS G O     1 
ATOM   4533  C  CB    . LYS G 3  15  ? -32.968 -42.980 9.499  1.00 134.97 ? 15   LYS G CB    1 
ATOM   4534  C  CG    . LYS G 3  15  ? -33.638 -43.852 10.550 1.00 131.38 ? 15   LYS G CG    1 
ATOM   4535  C  CD    . LYS G 3  15  ? -35.086 -44.144 10.163 1.00 129.56 ? 15   LYS G CD    1 
ATOM   4536  C  CE    . LYS G 3  15  ? -35.930 -44.564 11.358 1.00 126.63 ? 15   LYS G CE    1 
ATOM   4537  N  NZ    . LYS G 3  15  ? -35.426 -45.804 12.015 1.00 122.12 ? 15   LYS G NZ    1 
ATOM   4538  N  N     . THR G 3  16  ? -33.387 -40.285 11.608 1.00 111.23 ? 16   THR G N     1 
ATOM   4539  C  CA    . THR G 3  16  ? -32.816 -39.425 12.649 1.00 103.38 ? 16   THR G CA    1 
ATOM   4540  C  C     . THR G 3  16  ? -31.542 -40.012 13.246 1.00 107.38 ? 16   THR G C     1 
ATOM   4541  O  O     . THR G 3  16  ? -31.428 -41.232 13.425 1.00 114.64 ? 16   THR G O     1 
ATOM   4542  C  CB    . THR G 3  16  ? -33.805 -39.147 13.805 1.00 100.45 ? 16   THR G CB    1 
ATOM   4543  O  OG1   . THR G 3  16  ? -34.057 -40.357 14.541 1.00 95.75  ? 16   THR G OG1   1 
ATOM   4544  C  CG2   . THR G 3  16  ? -35.118 -38.533 13.295 1.00 96.96  ? 16   THR G CG2   1 
ATOM   4545  N  N     . ARG G 3  17  ? -30.592 -39.132 13.552 1.00 102.45 ? 17   ARG G N     1 
ATOM   4546  C  CA    . ARG G 3  17  ? -29.358 -39.521 14.228 1.00 98.62  ? 17   ARG G CA    1 
ATOM   4547  C  C     . ARG G 3  17  ? -29.601 -40.131 15.618 1.00 100.48 ? 17   ARG G C     1 
ATOM   4548  O  O     . ARG G 3  17  ? -28.787 -40.940 16.089 1.00 99.96  ? 17   ARG G O     1 
ATOM   4549  C  CB    . ARG G 3  17  ? -28.410 -38.331 14.318 1.00 95.00  ? 17   ARG G CB    1 
ATOM   4550  C  CG    . ARG G 3  17  ? -27.990 -37.792 12.964 1.00 96.46  ? 17   ARG G CG    1 
ATOM   4551  C  CD    . ARG G 3  17  ? -26.709 -36.980 13.070 1.00 95.51  ? 17   ARG G CD    1 
ATOM   4552  N  NE    . ARG G 3  17  ? -26.966 -35.567 13.336 1.00 88.48  ? 17   ARG G NE    1 
ATOM   4553  C  CZ    . ARG G 3  17  ? -26.037 -34.694 13.717 1.00 86.13  ? 17   ARG G CZ    1 
ATOM   4554  N  NH1   . ARG G 3  17  ? -24.781 -35.094 13.891 1.00 75.66  ? 17   ARG G NH1   1 
ATOM   4555  N  NH2   . ARG G 3  17  ? -26.373 -33.424 13.937 1.00 86.42  ? 17   ARG G NH2   1 
ATOM   4556  N  N     . SER G 3  18  ? -30.713 -39.754 16.258 1.00 92.70  ? 18   SER G N     1 
ATOM   4557  C  CA    . SER G 3  18  ? -31.099 -40.342 17.544 1.00 93.62  ? 18   SER G CA    1 
ATOM   4558  C  C     . SER G 3  18  ? -31.394 -41.834 17.421 1.00 99.38  ? 18   SER G C     1 
ATOM   4559  O  O     . SER G 3  18  ? -30.828 -42.642 18.163 1.00 106.11 ? 18   SER G O     1 
ATOM   4560  C  CB    . SER G 3  18  ? -32.281 -39.597 18.158 1.00 89.38  ? 18   SER G CB    1 
ATOM   4561  O  OG    . SER G 3  18  ? -31.946 -38.240 18.385 1.00 87.06  ? 18   SER G OG    1 
ATOM   4562  N  N     . SER G 3  19  ? -32.255 -42.195 16.469 1.00 99.00  ? 19   SER G N     1 
ATOM   4563  C  CA    . SER G 3  19  ? -32.564 -43.598 16.175 1.00 93.71  ? 19   SER G CA    1 
ATOM   4564  C  C     . SER G 3  19  ? -31.335 -44.396 15.711 1.00 89.06  ? 19   SER G C     1 
ATOM   4565  O  O     . SER G 3  19  ? -31.242 -45.584 15.992 1.00 86.17  ? 19   SER G O     1 
ATOM   4566  C  CB    . SER G 3  19  ? -33.669 -43.684 15.132 1.00 92.45  ? 19   SER G CB    1 
ATOM   4567  O  OG    . SER G 3  19  ? -33.340 -42.886 14.009 1.00 94.89  ? 19   SER G OG    1 
ATOM   4568  N  N     . ARG G 3  20  ? -30.408 -43.747 15.004 1.00 86.24  ? 20   ARG G N     1 
ATOM   4569  C  CA    . ARG G 3  20  ? -29.116 -44.359 14.651 1.00 90.33  ? 20   ARG G CA    1 
ATOM   4570  C  C     . ARG G 3  20  ? -28.288 -44.693 15.894 1.00 92.78  ? 20   ARG G C     1 
ATOM   4571  O  O     . ARG G 3  20  ? -27.567 -45.696 15.921 1.00 94.01  ? 20   ARG G O     1 
ATOM   4572  C  CB    . ARG G 3  20  ? -28.265 -43.427 13.775 1.00 94.65  ? 20   ARG G CB    1 
ATOM   4573  C  CG    . ARG G 3  20  ? -28.822 -43.048 12.416 1.00 91.24  ? 20   ARG G CG    1 
ATOM   4574  C  CD    . ARG G 3  20  ? -27.682 -42.615 11.502 1.00 99.30  ? 20   ARG G CD    1 
ATOM   4575  N  NE    . ARG G 3  20  ? -28.157 -41.902 10.317 1.00 107.15 ? 20   ARG G NE    1 
ATOM   4576  C  CZ    . ARG G 3  20  ? -28.674 -42.484 9.232  1.00 118.56 ? 20   ARG G CZ    1 
ATOM   4577  N  NH1   . ARG G 3  20  ? -28.810 -43.805 9.154  1.00 123.41 ? 20   ARG G NH1   1 
ATOM   4578  N  NH2   . ARG G 3  20  ? -29.070 -41.734 8.214  1.00 119.33 ? 20   ARG G NH2   1 
ATOM   4579  N  N     . ALA G 3  21  ? -28.372 -43.822 16.904 1.00 96.30  ? 21   ALA G N     1 
ATOM   4580  C  CA    . ALA G 3  21  ? -27.601 -43.966 18.150 1.00 93.90  ? 21   ALA G CA    1 
ATOM   4581  C  C     . ALA G 3  21  ? -28.411 -44.665 19.241 1.00 89.03  ? 21   ALA G C     1 
ATOM   4582  O  O     . ALA G 3  21  ? -27.908 -44.949 20.335 1.00 81.92  ? 21   ALA G O     1 
ATOM   4583  C  CB    . ALA G 3  21  ? -27.115 -42.609 18.629 1.00 91.65  ? 21   ALA G CB    1 
ATOM   4584  N  N     . GLY G 3  22  ? -29.675 -44.930 18.926 1.00 87.05  ? 22   GLY G N     1 
ATOM   4585  C  CA    . GLY G 3  22  ? -30.545 -45.735 19.774 1.00 91.67  ? 22   GLY G CA    1 
ATOM   4586  C  C     . GLY G 3  22  ? -31.031 -44.938 20.950 1.00 92.11  ? 22   GLY G C     1 
ATOM   4587  O  O     . GLY G 3  22  ? -31.236 -45.478 22.041 1.00 92.93  ? 22   GLY G O     1 
ATOM   4588  N  N     . LEU G 3  23  ? -31.234 -43.646 20.707 1.00 89.46  ? 23   LEU G N     1 
ATOM   4589  C  CA    . LEU G 3  23  ? -31.497 -42.692 21.768 1.00 82.00  ? 23   LEU G CA    1 
ATOM   4590  C  C     . LEU G 3  23  ? -32.816 -41.976 21.586 1.00 81.81  ? 23   LEU G C     1 
ATOM   4591  O  O     . LEU G 3  23  ? -33.172 -41.592 20.474 1.00 86.48  ? 23   LEU G O     1 
ATOM   4592  C  CB    . LEU G 3  23  ? -30.359 -41.677 21.847 1.00 79.89  ? 23   LEU G CB    1 
ATOM   4593  C  CG    . LEU G 3  23  ? -28.971 -42.181 22.268 1.00 80.21  ? 23   LEU G CG    1 
ATOM   4594  C  CD1   . LEU G 3  23  ? -27.910 -41.112 22.017 1.00 74.71  ? 23   LEU G CD1   1 
ATOM   4595  C  CD2   . LEU G 3  23  ? -28.968 -42.633 23.727 1.00 79.84  ? 23   LEU G CD2   1 
ATOM   4596  N  N     . GLN G 3  24  ? -33.529 -41.804 22.693 1.00 83.30  ? 24   GLN G N     1 
ATOM   4597  C  CA    . GLN G 3  24  ? -34.755 -41.034 22.722 1.00 83.64  ? 24   GLN G CA    1 
ATOM   4598  C  C     . GLN G 3  24  ? -34.502 -39.523 22.712 1.00 86.68  ? 24   GLN G C     1 
ATOM   4599  O  O     . GLN G 3  24  ? -35.434 -38.747 22.534 1.00 88.66  ? 24   GLN G O     1 
ATOM   4600  C  CB    . GLN G 3  24  ? -35.557 -41.402 23.964 1.00 92.99  ? 24   GLN G CB    1 
ATOM   4601  C  CG    . GLN G 3  24  ? -36.006 -42.850 24.008 1.00 96.51  ? 24   GLN G CG    1 
ATOM   4602  C  CD    . GLN G 3  24  ? -36.935 -43.203 22.863 1.00 97.99  ? 24   GLN G CD    1 
ATOM   4603  O  OE1   . GLN G 3  24  ? -37.940 -42.524 22.620 1.00 93.28  ? 24   GLN G OE1   1 
ATOM   4604  N  NE2   . GLN G 3  24  ? -36.604 -44.275 22.149 1.00 99.91  ? 24   GLN G NE2   1 
ATOM   4605  N  N     . PHE G 3  25  ? -33.251 -39.112 22.896 1.00 83.00  ? 25   PHE G N     1 
ATOM   4606  C  CA    . PHE G 3  25  ? -32.924 -37.706 23.120 1.00 81.10  ? 25   PHE G CA    1 
ATOM   4607  C  C     . PHE G 3  25  ? -32.303 -37.132 21.867 1.00 83.86  ? 25   PHE G C     1 
ATOM   4608  O  O     . PHE G 3  25  ? -31.450 -37.780 21.258 1.00 87.03  ? 25   PHE G O     1 
ATOM   4609  C  CB    . PHE G 3  25  ? -31.953 -37.558 24.298 1.00 83.25  ? 25   PHE G CB    1 
ATOM   4610  C  CG    . PHE G 3  25  ? -32.610 -37.176 25.599 1.00 75.59  ? 25   PHE G CG    1 
ATOM   4611  C  CD1   . PHE G 3  25  ? -33.614 -37.958 26.155 1.00 79.49  ? 25   PHE G CD1   1 
ATOM   4612  C  CD2   . PHE G 3  25  ? -32.194 -36.044 26.283 1.00 77.76  ? 25   PHE G CD2   1 
ATOM   4613  C  CE1   . PHE G 3  25  ? -34.206 -37.607 27.357 1.00 76.26  ? 25   PHE G CE1   1 
ATOM   4614  C  CE2   . PHE G 3  25  ? -32.785 -35.682 27.480 1.00 79.26  ? 25   PHE G CE2   1 
ATOM   4615  C  CZ    . PHE G 3  25  ? -33.793 -36.466 28.018 1.00 79.00  ? 25   PHE G CZ    1 
ATOM   4616  N  N     . PRO G 3  26  ? -32.705 -35.898 21.494 1.00 85.63  ? 26   PRO G N     1 
ATOM   4617  C  CA    . PRO G 3  26  ? -32.431 -35.351 20.160 1.00 79.79  ? 26   PRO G CA    1 
ATOM   4618  C  C     . PRO G 3  26  ? -30.969 -35.009 19.891 1.00 73.74  ? 26   PRO G C     1 
ATOM   4619  O  O     . PRO G 3  26  ? -30.495 -33.922 20.232 1.00 76.09  ? 26   PRO G O     1 
ATOM   4620  C  CB    . PRO G 3  26  ? -33.325 -34.104 20.096 1.00 80.01  ? 26   PRO G CB    1 
ATOM   4621  C  CG    . PRO G 3  26  ? -33.452 -33.676 21.512 1.00 82.31  ? 26   PRO G CG    1 
ATOM   4622  C  CD    . PRO G 3  26  ? -33.432 -34.931 22.342 1.00 84.95  ? 26   PRO G CD    1 
ATOM   4623  N  N     . VAL G 3  27  ? -30.270 -35.942 19.263 1.00 68.25  ? 27   VAL G N     1 
ATOM   4624  C  CA    . VAL G 3  27  ? -28.918 -35.697 18.794 1.00 66.55  ? 27   VAL G CA    1 
ATOM   4625  C  C     . VAL G 3  27  ? -28.845 -34.446 17.926 1.00 72.01  ? 27   VAL G C     1 
ATOM   4626  O  O     . VAL G 3  27  ? -27.901 -33.671 18.042 1.00 85.72  ? 27   VAL G O     1 
ATOM   4627  C  CB    . VAL G 3  27  ? -28.400 -36.890 17.995 1.00 64.04  ? 27   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G 3  27  ? -26.911 -36.746 17.730 1.00 65.41  ? 27   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G 3  27  ? -28.721 -38.180 18.741 1.00 64.02  ? 27   VAL G CG2   1 
ATOM   4630  N  N     . GLY G 3  28  ? -29.839 -34.247 17.065 1.00 73.52  ? 28   GLY G N     1 
ATOM   4631  C  CA    . GLY G 3  28  ? -29.875 -33.075 16.208 1.00 72.38  ? 28   GLY G CA    1 
ATOM   4632  C  C     . GLY G 3  28  ? -29.878 -31.786 17.006 1.00 73.13  ? 28   GLY G C     1 
ATOM   4633  O  O     . GLY G 3  28  ? -29.014 -30.921 16.817 1.00 77.05  ? 28   GLY G O     1 
ATOM   4634  N  N     . ARG G 3  29  ? -30.848 -31.664 17.907 1.00 69.49  ? 29   ARG G N     1 
ATOM   4635  C  CA    . ARG G 3  29  ? -31.001 -30.449 18.697 1.00 68.09  ? 29   ARG G CA    1 
ATOM   4636  C  C     . ARG G 3  29  ? -29.776 -30.203 19.550 1.00 69.83  ? 29   ARG G C     1 
ATOM   4637  O  O     . ARG G 3  29  ? -29.269 -29.079 19.599 1.00 72.17  ? 29   ARG G O     1 
ATOM   4638  C  CB    . ARG G 3  29  ? -32.234 -30.525 19.569 1.00 65.15  ? 29   ARG G CB    1 
ATOM   4639  C  CG    . ARG G 3  29  ? -32.585 -29.234 20.264 1.00 63.36  ? 29   ARG G CG    1 
ATOM   4640  C  CD    . ARG G 3  29  ? -33.866 -29.437 21.065 1.00 70.85  ? 29   ARG G CD    1 
ATOM   4641  N  NE    . ARG G 3  29  ? -35.070 -29.427 20.237 1.00 72.04  ? 29   ARG G NE    1 
ATOM   4642  C  CZ    . ARG G 3  29  ? -36.318 -29.468 20.714 1.00 81.13  ? 29   ARG G CZ    1 
ATOM   4643  N  NH1   . ARG G 3  29  ? -36.529 -29.529 22.019 1.00 86.71  ? 29   ARG G NH1   1 
ATOM   4644  N  NH2   . ARG G 3  29  ? -37.369 -29.447 19.893 1.00 84.91  ? 29   ARG G NH2   1 
ATOM   4645  N  N     . VAL G 3  30  ? -29.290 -31.259 20.197 1.00 66.09  ? 30   VAL G N     1 
ATOM   4646  C  CA    . VAL G 3  30  ? -28.094 -31.159 21.007 1.00 65.49  ? 30   VAL G CA    1 
ATOM   4647  C  C     . VAL G 3  30  ? -26.938 -30.625 20.148 1.00 73.02  ? 30   VAL G C     1 
ATOM   4648  O  O     . VAL G 3  30  ? -26.161 -29.774 20.603 1.00 77.06  ? 30   VAL G O     1 
ATOM   4649  C  CB    . VAL G 3  30  ? -27.736 -32.508 21.665 1.00 64.23  ? 30   VAL G CB    1 
ATOM   4650  C  CG1   . VAL G 3  30  ? -26.302 -32.499 22.178 1.00 68.94  ? 30   VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G 3  30  ? -28.690 -32.821 22.798 1.00 60.57  ? 30   VAL G CG2   1 
ATOM   4652  N  N     . HIS G 3  31  ? -26.840 -31.093 18.901 1.00 72.78  ? 31   HIS G N     1 
ATOM   4653  C  CA    . HIS G 3  31  ? -25.771 -30.637 18.018 1.00 73.63  ? 31   HIS G CA    1 
ATOM   4654  C  C     . HIS G 3  31  ? -25.843 -29.153 17.817 1.00 72.54  ? 31   HIS G C     1 
ATOM   4655  O  O     . HIS G 3  31  ? -24.846 -28.437 17.983 1.00 70.56  ? 31   HIS G O     1 
ATOM   4656  C  CB    . HIS G 3  31  ? -25.816 -31.338 16.669 1.00 76.11  ? 31   HIS G CB    1 
ATOM   4657  C  CG    . HIS G 3  31  ? -24.502 -31.286 15.922 1.00 82.37  ? 31   HIS G CG    1 
ATOM   4658  N  ND1   . HIS G 3  31  ? -23.593 -30.311 16.117 1.00 80.58  ? 31   HIS G ND1   1 
ATOM   4659  C  CD2   . HIS G 3  31  ? -23.963 -32.133 14.955 1.00 87.22  ? 31   HIS G CD2   1 
ATOM   4660  C  CE1   . HIS G 3  31  ? -22.521 -30.532 15.330 1.00 83.17  ? 31   HIS G CE1   1 
ATOM   4661  N  NE2   . HIS G 3  31  ? -22.750 -31.640 14.615 1.00 81.80  ? 31   HIS G NE2   1 
ATOM   4662  N  N     . ARG G 3  32  ? -27.043 -28.696 17.469 1.00 69.92  ? 32   ARG G N     1 
ATOM   4663  C  CA    . ARG G 3  32  ? -27.319 -27.302 17.170 1.00 72.99  ? 32   ARG G CA    1 
ATOM   4664  C  C     . ARG G 3  32  ? -26.985 -26.405 18.360 1.00 77.10  ? 32   ARG G C     1 
ATOM   4665  O  O     . ARG G 3  32  ? -26.159 -25.481 18.249 1.00 75.68  ? 32   ARG G O     1 
ATOM   4666  C  CB    . ARG G 3  32  ? -28.796 -27.165 16.794 1.00 72.65  ? 32   ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3  32  ? -29.222 -25.788 16.331 1.00 68.36  ? 32   ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3  32  ? -30.724 -25.704 16.431 1.00 72.77  ? 32   ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3  32  ? -31.150 -25.355 17.784 1.00 78.93  ? 32   ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3  32  ? -32.274 -25.768 18.377 1.00 78.45  ? 32   ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3  32  ? -33.127 -26.585 17.761 1.00 73.51  ? 32   ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3  32  ? -32.539 -25.374 19.616 1.00 78.75  ? 32   ARG G NH2   1 
ATOM   4673  N  N     . LEU G 3  33  ? -27.626 -26.702 19.493 1.00 73.69  ? 33   LEU G N     1 
ATOM   4674  C  CA    . LEU G 3  33  ? -27.424 -25.970 20.728 1.00 69.79  ? 33   LEU G CA    1 
ATOM   4675  C  C     . LEU G 3  33  ? -25.948 -25.811 21.085 1.00 74.42  ? 33   LEU G C     1 
ATOM   4676  O  O     . LEU G 3  33  ? -25.564 -24.768 21.602 1.00 84.75  ? 33   LEU G O     1 
ATOM   4677  C  CB    . LEU G 3  33  ? -28.190 -26.629 21.871 1.00 67.79  ? 33   LEU G CB    1 
ATOM   4678  C  CG    . LEU G 3  33  ? -29.727 -26.529 21.852 1.00 63.23  ? 33   LEU G CG    1 
ATOM   4679  C  CD1   . LEU G 3  33  ? -30.341 -27.420 22.916 1.00 57.56  ? 33   LEU G CD1   1 
ATOM   4680  C  CD2   . LEU G 3  33  ? -30.234 -25.106 22.025 1.00 60.42  ? 33   LEU G CD2   1 
ATOM   4681  N  N     . LEU G 3  34  ? -25.125 -26.817 20.788 1.00 73.89  ? 34   LEU G N     1 
ATOM   4682  C  CA    . LEU G 3  34  ? -23.679 -26.714 20.996 1.00 75.34  ? 34   LEU G CA    1 
ATOM   4683  C  C     . LEU G 3  34  ? -23.002 -25.683 20.099 1.00 83.05  ? 34   LEU G C     1 
ATOM   4684  O  O     . LEU G 3  34  ? -22.060 -25.014 20.542 1.00 86.80  ? 34   LEU G O     1 
ATOM   4685  C  CB    . LEU G 3  34  ? -22.969 -28.068 20.825 1.00 77.56  ? 34   LEU G CB    1 
ATOM   4686  C  CG    . LEU G 3  34  ? -22.961 -29.083 21.981 1.00 77.99  ? 34   LEU G CG    1 
ATOM   4687  C  CD1   . LEU G 3  34  ? -22.471 -30.433 21.487 1.00 77.07  ? 34   LEU G CD1   1 
ATOM   4688  C  CD2   . LEU G 3  34  ? -22.122 -28.646 23.174 1.00 77.04  ? 34   LEU G CD2   1 
ATOM   4689  N  N     . ARG G 3  35  ? -23.446 -25.563 18.843 1.00 86.15  ? 35   ARG G N     1 
ATOM   4690  C  CA    . ARG G 3  35  ? -22.832 -24.595 17.920 1.00 84.41  ? 35   ARG G CA    1 
ATOM   4691  C  C     . ARG G 3  35  ? -23.200 -23.193 18.361 1.00 84.21  ? 35   ARG G C     1 
ATOM   4692  O  O     . ARG G 3  35  ? -22.349 -22.311 18.508 1.00 87.29  ? 35   ARG G O     1 
ATOM   4693  C  CB    . ARG G 3  35  ? -23.327 -24.763 16.492 1.00 87.65  ? 35   ARG G CB    1 
ATOM   4694  C  CG    . ARG G 3  35  ? -23.464 -26.181 16.020 1.00 99.18  ? 35   ARG G CG    1 
ATOM   4695  C  CD    . ARG G 3  35  ? -23.712 -26.195 14.523 1.00 103.42 ? 35   ARG G CD    1 
ATOM   4696  N  NE    . ARG G 3  35  ? -23.041 -27.347 13.931 1.00 111.65 ? 35   ARG G NE    1 
ATOM   4697  C  CZ    . ARG G 3  35  ? -21.716 -27.508 13.894 1.00 118.75 ? 35   ARG G CZ    1 
ATOM   4698  N  NH1   . ARG G 3  35  ? -20.898 -26.592 14.420 1.00 116.30 ? 35   ARG G NH1   1 
ATOM   4699  N  NH2   . ARG G 3  35  ? -21.206 -28.595 13.328 1.00 122.65 ? 35   ARG G NH2   1 
ATOM   4700  N  N     . LYS G 3  36  ? -24.489 -22.990 18.584 1.00 81.64  ? 36   LYS G N     1 
ATOM   4701  C  CA    . LYS G 3  36  ? -24.971 -21.658 18.862 1.00 88.52  ? 36   LYS G CA    1 
ATOM   4702  C  C     . LYS G 3  36  ? -24.813 -21.374 20.349 1.00 86.29  ? 36   LYS G C     1 
ATOM   4703  O  O     . LYS G 3  36  ? -25.589 -20.636 20.947 1.00 94.38  ? 36   LYS G O     1 
ATOM   4704  C  CB    . LYS G 3  36  ? -26.400 -21.476 18.309 1.00 99.79  ? 36   LYS G CB    1 
ATOM   4705  C  CG    . LYS G 3  36  ? -26.553 -22.107 16.920 1.00 108.33 ? 36   LYS G CG    1 
ATOM   4706  C  CD    . LYS G 3  36  ? -27.187 -21.225 15.839 1.00 116.40 ? 36   LYS G CD    1 
ATOM   4707  C  CE    . LYS G 3  36  ? -26.802 -21.752 14.450 1.00 118.98 ? 36   LYS G CE    1 
ATOM   4708  N  NZ    . LYS G 3  36  ? -27.867 -21.656 13.404 1.00 121.01 ? 36   LYS G NZ    1 
ATOM   4709  N  N     . GLY G 3  37  ? -23.770 -21.962 20.929 1.00 83.85  ? 37   GLY G N     1 
ATOM   4710  C  CA    . GLY G 3  37  ? -23.476 -21.823 22.346 1.00 76.68  ? 37   GLY G CA    1 
ATOM   4711  C  C     . GLY G 3  37  ? -22.096 -21.240 22.549 1.00 75.04  ? 37   GLY G C     1 
ATOM   4712  O  O     . GLY G 3  37  ? -21.686 -21.001 23.681 1.00 72.72  ? 37   GLY G O     1 
ATOM   4713  N  N     . ASN G 3  38  ? -21.380 -21.005 21.451 1.00 73.51  ? 38   ASN G N     1 
ATOM   4714  C  CA    . ASN G 3  38  ? -20.018 -20.459 21.515 1.00 81.11  ? 38   ASN G CA    1 
ATOM   4715  C  C     . ASN G 3  38  ? -19.171 -21.257 22.498 1.00 75.18  ? 38   ASN G C     1 
ATOM   4716  O  O     . ASN G 3  38  ? -18.423 -20.702 23.292 1.00 87.33  ? 38   ASN G O     1 
ATOM   4717  C  CB    . ASN G 3  38  ? -20.022 -18.982 21.947 1.00 87.68  ? 38   ASN G CB    1 
ATOM   4718  C  CG    . ASN G 3  38  ? -20.733 -18.077 20.968 1.00 87.13  ? 38   ASN G CG    1 
ATOM   4719  O  OD1   . ASN G 3  38  ? -21.898 -17.740 21.156 1.00 90.27  ? 38   ASN G OD1   1 
ATOM   4720  N  ND2   . ASN G 3  38  ? -20.029 -17.665 19.927 1.00 89.56  ? 38   ASN G ND2   1 
ATOM   4721  N  N     . TYR G 3  39  ? -19.323 -22.566 22.474 1.00 71.50  ? 39   TYR G N     1 
ATOM   4722  C  CA    . TYR G 3  39  ? -18.525 -23.423 23.337 1.00 68.93  ? 39   TYR G CA    1 
ATOM   4723  C  C     . TYR G 3  39  ? -17.142 -23.645 22.712 1.00 72.85  ? 39   TYR G C     1 
ATOM   4724  O  O     . TYR G 3  39  ? -16.138 -23.628 23.423 1.00 73.16  ? 39   TYR G O     1 
ATOM   4725  C  CB    . TYR G 3  39  ? -19.281 -24.723 23.650 1.00 61.69  ? 39   TYR G CB    1 
ATOM   4726  C  CG    . TYR G 3  39  ? -20.532 -24.505 24.492 1.00 58.67  ? 39   TYR G CG    1 
ATOM   4727  C  CD1   . TYR G 3  39  ? -21.790 -24.618 23.953 1.00 56.83  ? 39   TYR G CD1   1 
ATOM   4728  C  CD2   . TYR G 3  39  ? -20.438 -24.158 25.843 1.00 63.85  ? 39   TYR G CD2   1 
ATOM   4729  C  CE1   . TYR G 3  39  ? -22.924 -24.402 24.728 1.00 60.07  ? 39   TYR G CE1   1 
ATOM   4730  C  CE2   . TYR G 3  39  ? -21.559 -23.943 26.626 1.00 57.95  ? 39   TYR G CE2   1 
ATOM   4731  C  CZ    . TYR G 3  39  ? -22.801 -24.070 26.070 1.00 61.83  ? 39   TYR G CZ    1 
ATOM   4732  O  OH    . TYR G 3  39  ? -23.916 -23.874 26.863 1.00 65.65  ? 39   TYR G OH    1 
ATOM   4733  N  N     . ALA G 3  40  ? -17.095 -23.819 21.383 1.00 77.82  ? 40   ALA G N     1 
ATOM   4734  C  CA    . ALA G 3  40  ? -15.836 -23.733 20.604 1.00 79.59  ? 40   ALA G CA    1 
ATOM   4735  C  C     . ALA G 3  40  ? -16.109 -23.397 19.146 1.00 82.35  ? 40   ALA G C     1 
ATOM   4736  O  O     . ALA G 3  40  ? -17.267 -23.410 18.719 1.00 85.11  ? 40   ALA G O     1 
ATOM   4737  C  CB    . ALA G 3  40  ? -15.042 -25.020 20.699 1.00 79.18  ? 40   ALA G CB    1 
ATOM   4738  N  N     . GLU G 3  41  ? -15.046 -23.099 18.393 1.00 84.87  ? 41   GLU G N     1 
ATOM   4739  C  CA    . GLU G 3  41  ? -15.135 -22.837 16.934 1.00 91.51  ? 41   GLU G CA    1 
ATOM   4740  C  C     . GLU G 3  41  ? -15.869 -23.953 16.189 1.00 89.04  ? 41   GLU G C     1 
ATOM   4741  O  O     . GLU G 3  41  ? -16.664 -23.691 15.290 1.00 84.15  ? 41   GLU G O     1 
ATOM   4742  C  CB    . GLU G 3  41  ? -13.738 -22.684 16.289 1.00 94.79  ? 41   GLU G CB    1 
ATOM   4743  C  CG    . GLU G 3  41  ? -12.835 -21.590 16.859 1.00 108.66 ? 41   GLU G CG    1 
ATOM   4744  C  CD    . GLU G 3  41  ? -13.215 -20.181 16.410 1.00 118.15 ? 41   GLU G CD    1 
ATOM   4745  O  OE1   . GLU G 3  41  ? -13.739 -20.025 15.281 1.00 122.88 ? 41   GLU G OE1   1 
ATOM   4746  O  OE2   . GLU G 3  41  ? -12.978 -19.219 17.185 1.00 124.33 ? 41   GLU G OE2   1 
ATOM   4747  N  N     . ARG G 3  42  ? -15.589 -25.193 16.591 1.00 93.05  ? 42   ARG G N     1 
ATOM   4748  C  CA    . ARG G 3  42  ? -15.947 -26.392 15.843 1.00 89.77  ? 42   ARG G CA    1 
ATOM   4749  C  C     . ARG G 3  42  ? -16.519 -27.455 16.771 1.00 88.15  ? 42   ARG G C     1 
ATOM   4750  O  O     . ARG G 3  42  ? -16.267 -27.419 17.971 1.00 91.27  ? 42   ARG G O     1 
ATOM   4751  C  CB    . ARG G 3  42  ? -14.695 -26.962 15.188 1.00 92.66  ? 42   ARG G CB    1 
ATOM   4752  C  CG    . ARG G 3  42  ? -14.037 -26.078 14.141 1.00 97.32  ? 42   ARG G CG    1 
ATOM   4753  C  CD    . ARG G 3  42  ? -13.103 -26.932 13.305 1.00 107.81 ? 42   ARG G CD    1 
ATOM   4754  N  NE    . ARG G 3  42  ? -13.029 -26.492 11.915 1.00 117.11 ? 42   ARG G NE    1 
ATOM   4755  C  CZ    . ARG G 3  42  ? -13.011 -27.319 10.871 1.00 122.07 ? 42   ARG G CZ    1 
ATOM   4756  N  NH1   . ARG G 3  42  ? -13.084 -28.636 11.050 1.00 112.05 ? 42   ARG G NH1   1 
ATOM   4757  N  NH2   . ARG G 3  42  ? -12.946 -26.828 9.642  1.00 133.30 ? 42   ARG G NH2   1 
ATOM   4758  N  N     . VAL G 3  43  ? -17.263 -28.408 16.209 1.00 80.24  ? 43   VAL G N     1 
ATOM   4759  C  CA    . VAL G 3  43  ? -17.946 -29.439 16.983 1.00 79.00  ? 43   VAL G CA    1 
ATOM   4760  C  C     . VAL G 3  43  ? -17.921 -30.769 16.252 1.00 83.85  ? 43   VAL G C     1 
ATOM   4761  O  O     . VAL G 3  43  ? -18.603 -30.936 15.237 1.00 90.27  ? 43   VAL G O     1 
ATOM   4762  C  CB    . VAL G 3  43  ? -19.430 -29.083 17.210 1.00 77.77  ? 43   VAL G CB    1 
ATOM   4763  C  CG1   . VAL G 3  43  ? -20.176 -30.246 17.857 1.00 75.51  ? 43   VAL G CG1   1 
ATOM   4764  C  CG2   . VAL G 3  43  ? -19.571 -27.814 18.042 1.00 78.11  ? 43   VAL G CG2   1 
ATOM   4765  N  N     . GLY G 3  44  ? -17.166 -31.725 16.783 1.00 85.76  ? 44   GLY G N     1 
ATOM   4766  C  CA    . GLY G 3  44  ? -17.092 -33.073 16.198 1.00 82.31  ? 44   GLY G CA    1 
ATOM   4767  C  C     . GLY G 3  44  ? -18.443 -33.777 16.132 1.00 81.79  ? 44   GLY G C     1 
ATOM   4768  O  O     . GLY G 3  44  ? -19.391 -33.390 16.815 1.00 77.11  ? 44   GLY G O     1 
ATOM   4769  N  N     . ALA G 3  45  ? -18.526 -34.821 15.311 1.00 82.89  ? 45   ALA G N     1 
ATOM   4770  C  CA    . ALA G 3  45  ? -19.792 -35.494 15.049 1.00 75.11  ? 45   ALA G CA    1 
ATOM   4771  C  C     . ALA G 3  45  ? -20.318 -36.337 16.209 1.00 74.06  ? 45   ALA G C     1 
ATOM   4772  O  O     . ALA G 3  45  ? -21.526 -36.506 16.328 1.00 82.03  ? 45   ALA G O     1 
ATOM   4773  C  CB    . ALA G 3  45  ? -19.696 -36.325 13.786 1.00 75.46  ? 45   ALA G CB    1 
ATOM   4774  N  N     . GLY G 3  46  ? -19.431 -36.865 17.051 1.00 71.84  ? 46   GLY G N     1 
ATOM   4775  C  CA    . GLY G 3  46  ? -19.838 -37.754 18.149 1.00 77.26  ? 46   GLY G CA    1 
ATOM   4776  C  C     . GLY G 3  46  ? -20.299 -37.032 19.404 1.00 81.17  ? 46   GLY G C     1 
ATOM   4777  O  O     . GLY G 3  46  ? -21.196 -37.496 20.129 1.00 79.11  ? 46   GLY G O     1 
ATOM   4778  N  N     . ALA G 3  47  ? -19.681 -35.881 19.646 1.00 78.41  ? 47   ALA G N     1 
ATOM   4779  C  CA    . ALA G 3  47  ? -19.976 -35.061 20.807 1.00 74.66  ? 47   ALA G CA    1 
ATOM   4780  C  C     . ALA G 3  47  ? -21.475 -34.925 21.111 1.00 76.96  ? 47   ALA G C     1 
ATOM   4781  O  O     . ALA G 3  47  ? -21.871 -35.125 22.257 1.00 82.60  ? 47   ALA G O     1 
ATOM   4782  C  CB    . ALA G 3  47  ? -19.307 -33.696 20.681 1.00 73.24  ? 47   ALA G CB    1 
ATOM   4783  N  N     . PRO G 3  48  ? -22.319 -34.606 20.102 1.00 77.13  ? 48   PRO G N     1 
ATOM   4784  C  CA    . PRO G 3  48  ? -23.733 -34.482 20.484 1.00 75.76  ? 48   PRO G CA    1 
ATOM   4785  C  C     . PRO G 3  48  ? -24.354 -35.824 20.833 1.00 78.53  ? 48   PRO G C     1 
ATOM   4786  O  O     . PRO G 3  48  ? -25.261 -35.878 21.674 1.00 79.50  ? 48   PRO G O     1 
ATOM   4787  C  CB    . PRO G 3  48  ? -24.403 -33.881 19.238 1.00 80.76  ? 48   PRO G CB    1 
ATOM   4788  C  CG    . PRO G 3  48  ? -23.445 -34.100 18.116 1.00 81.26  ? 48   PRO G CG    1 
ATOM   4789  C  CD    . PRO G 3  48  ? -22.074 -34.144 18.720 1.00 77.12  ? 48   PRO G CD    1 
ATOM   4790  N  N     . VAL G 3  49  ? -23.861 -36.895 20.204 1.00 80.21  ? 49   VAL G N     1 
ATOM   4791  C  CA    . VAL G 3  49  ? -24.368 -38.253 20.463 1.00 79.13  ? 49   VAL G CA    1 
ATOM   4792  C  C     . VAL G 3  49  ? -24.039 -38.607 21.915 1.00 78.86  ? 49   VAL G C     1 
ATOM   4793  O  O     . VAL G 3  49  ? -24.946 -38.915 22.726 1.00 74.80  ? 49   VAL G O     1 
ATOM   4794  C  CB    . VAL G 3  49  ? -23.774 -39.306 19.493 1.00 77.83  ? 49   VAL G CB    1 
ATOM   4795  C  CG1   . VAL G 3  49  ? -24.319 -40.690 19.800 1.00 74.13  ? 49   VAL G CG1   1 
ATOM   4796  C  CG2   . VAL G 3  49  ? -24.098 -38.949 18.050 1.00 79.33  ? 49   VAL G CG2   1 
ATOM   4797  N  N     . TYR G 3  50  ? -22.744 -38.523 22.229 1.00 69.41  ? 50   TYR G N     1 
ATOM   4798  C  CA    . TYR G 3  50  ? -22.246 -38.700 23.588 1.00 74.73  ? 50   TYR G CA    1 
ATOM   4799  C  C     . TYR G 3  50  ? -23.042 -37.855 24.612 1.00 77.12  ? 50   TYR G C     1 
ATOM   4800  O  O     . TYR G 3  50  ? -23.626 -38.382 25.582 1.00 73.14  ? 50   TYR G O     1 
ATOM   4801  C  CB    . TYR G 3  50  ? -20.756 -38.345 23.625 1.00 70.65  ? 50   TYR G CB    1 
ATOM   4802  C  CG    . TYR G 3  50  ? -19.991 -38.991 24.758 1.00 72.02  ? 50   TYR G CG    1 
ATOM   4803  C  CD1   . TYR G 3  50  ? -18.826 -39.712 24.502 1.00 65.70  ? 50   TYR G CD1   1 
ATOM   4804  C  CD2   . TYR G 3  50  ? -20.434 -38.884 26.087 1.00 71.42  ? 50   TYR G CD2   1 
ATOM   4805  C  CE1   . TYR G 3  50  ? -18.122 -40.308 25.530 1.00 67.94  ? 50   TYR G CE1   1 
ATOM   4806  C  CE2   . TYR G 3  50  ? -19.732 -39.474 27.130 1.00 73.44  ? 50   TYR G CE2   1 
ATOM   4807  C  CZ    . TYR G 3  50  ? -18.574 -40.187 26.848 1.00 76.03  ? 50   TYR G CZ    1 
ATOM   4808  O  OH    . TYR G 3  50  ? -17.858 -40.781 27.882 1.00 79.28  ? 50   TYR G OH    1 
ATOM   4809  N  N     . LEU G 3  51  ? -23.090 -36.548 24.357 1.00 73.51  ? 51   LEU G N     1 
ATOM   4810  C  CA    . LEU G 3  51  ? -23.749 -35.625 25.248 1.00 70.22  ? 51   LEU G CA    1 
ATOM   4811  C  C     . LEU G 3  51  ? -25.203 -36.003 25.441 1.00 72.99  ? 51   LEU G C     1 
ATOM   4812  O  O     . LEU G 3  51  ? -25.683 -36.017 26.577 1.00 84.45  ? 51   LEU G O     1 
ATOM   4813  C  CB    . LEU G 3  51  ? -23.612 -34.189 24.749 1.00 70.53  ? 51   LEU G CB    1 
ATOM   4814  C  CG    . LEU G 3  51  ? -24.186 -33.037 25.591 1.00 72.85  ? 51   LEU G CG    1 
ATOM   4815  C  CD1   . LEU G 3  51  ? -23.951 -33.203 27.090 1.00 69.54  ? 51   LEU G CD1   1 
ATOM   4816  C  CD2   . LEU G 3  51  ? -23.604 -31.727 25.093 1.00 68.85  ? 51   LEU G CD2   1 
ATOM   4817  N  N     . ALA G 3  52  ? -25.887 -36.337 24.350 1.00 65.79  ? 52   ALA G N     1 
ATOM   4818  C  CA    . ALA G 3  52  ? -27.306 -36.668 24.415 1.00 64.16  ? 52   ALA G CA    1 
ATOM   4819  C  C     . ALA G 3  52  ? -27.590 -37.953 25.206 1.00 67.33  ? 52   ALA G C     1 
ATOM   4820  O  O     . ALA G 3  52  ? -28.633 -38.071 25.866 1.00 64.46  ? 52   ALA G O     1 
ATOM   4821  C  CB    . ALA G 3  52  ? -27.876 -36.769 23.020 1.00 66.01  ? 52   ALA G CB    1 
ATOM   4822  N  N     . ALA G 3  53  ? -26.661 -38.909 25.127 1.00 65.26  ? 53   ALA G N     1 
ATOM   4823  C  CA    . ALA G 3  53  ? -26.782 -40.186 25.820 1.00 61.62  ? 53   ALA G CA    1 
ATOM   4824  C  C     . ALA G 3  53  ? -26.757 -39.937 27.306 1.00 69.63  ? 53   ALA G C     1 
ATOM   4825  O  O     . ALA G 3  53  ? -27.600 -40.447 28.064 1.00 65.49  ? 53   ALA G O     1 
ATOM   4826  C  CB    . ALA G 3  53  ? -25.602 -41.066 25.458 1.00 66.22  ? 53   ALA G CB    1 
ATOM   4827  N  N     . VAL G 3  54  ? -25.744 -39.159 27.698 1.00 69.59  ? 54   VAL G N     1 
ATOM   4828  C  CA    . VAL G 3  54  ? -25.497 -38.793 29.074 1.00 66.27  ? 54   VAL G CA    1 
ATOM   4829  C  C     . VAL G 3  54  ? -26.730 -38.110 29.682 1.00 68.37  ? 54   VAL G C     1 
ATOM   4830  O  O     . VAL G 3  54  ? -27.131 -38.414 30.817 1.00 73.19  ? 54   VAL G O     1 
ATOM   4831  C  CB    . VAL G 3  54  ? -24.245 -37.910 29.150 1.00 66.21  ? 54   VAL G CB    1 
ATOM   4832  C  CG1   . VAL G 3  54  ? -24.052 -37.323 30.545 1.00 66.68  ? 54   VAL G CG1   1 
ATOM   4833  C  CG2   . VAL G 3  54  ? -23.036 -38.733 28.737 1.00 65.37  ? 54   VAL G CG2   1 
ATOM   4834  N  N     . LEU G 3  55  ? -27.349 -37.220 28.918 1.00 58.35  ? 55   LEU G N     1 
ATOM   4835  C  CA    . LEU G 3  55  ? -28.527 -36.535 29.407 1.00 62.72  ? 55   LEU G CA    1 
ATOM   4836  C  C     . LEU G 3  55  ? -29.691 -37.515 29.540 1.00 67.08  ? 55   LEU G C     1 
ATOM   4837  O  O     . LEU G 3  55  ? -30.499 -37.417 30.476 1.00 64.69  ? 55   LEU G O     1 
ATOM   4838  C  CB    . LEU G 3  55  ? -28.885 -35.354 28.488 1.00 61.15  ? 55   LEU G CB    1 
ATOM   4839  C  CG    . LEU G 3  55  ? -27.852 -34.221 28.414 1.00 58.90  ? 55   LEU G CG    1 
ATOM   4840  C  CD1   . LEU G 3  55  ? -28.112 -33.326 27.232 1.00 55.62  ? 55   LEU G CD1   1 
ATOM   4841  C  CD2   . LEU G 3  55  ? -27.799 -33.397 29.693 1.00 61.35  ? 55   LEU G CD2   1 
ATOM   4842  N  N     . GLU G 3  56  ? -29.767 -38.469 28.606 1.00 71.07  ? 56   GLU G N     1 
ATOM   4843  C  CA    . GLU G 3  56  ? -30.862 -39.435 28.611 1.00 69.38  ? 56   GLU G CA    1 
ATOM   4844  C  C     . GLU G 3  56  ? -30.687 -40.283 29.850 1.00 62.39  ? 56   GLU G C     1 
ATOM   4845  O  O     . GLU G 3  56  ? -31.602 -40.436 30.674 1.00 59.01  ? 56   GLU G O     1 
ATOM   4846  C  CB    . GLU G 3  56  ? -30.858 -40.299 27.351 1.00 69.88  ? 56   GLU G CB    1 
ATOM   4847  C  CG    . GLU G 3  56  ? -32.191 -41.007 27.102 1.00 78.03  ? 56   GLU G CG    1 
ATOM   4848  C  CD    . GLU G 3  56  ? -32.231 -41.819 25.807 1.00 87.32  ? 56   GLU G CD    1 
ATOM   4849  O  OE1   . GLU G 3  56  ? -31.627 -41.387 24.784 1.00 77.28  ? 56   GLU G OE1   1 
ATOM   4850  O  OE2   . GLU G 3  56  ? -32.890 -42.893 25.818 1.00 88.88  ? 56   GLU G OE2   1 
ATOM   4851  N  N     . TYR G 3  57  ? -29.469 -40.780 29.981 1.00 60.06  ? 57   TYR G N     1 
ATOM   4852  C  CA    . TYR G 3  57  ? -29.084 -41.586 31.102 1.00 63.37  ? 57   TYR G CA    1 
ATOM   4853  C  C     . TYR G 3  57  ? -29.539 -40.981 32.445 1.00 68.11  ? 57   TYR G C     1 
ATOM   4854  O  O     . TYR G 3  57  ? -30.277 -41.623 33.231 1.00 65.76  ? 57   TYR G O     1 
ATOM   4855  C  CB    . TYR G 3  57  ? -27.566 -41.806 31.099 1.00 61.31  ? 57   TYR G CB    1 
ATOM   4856  C  CG    . TYR G 3  57  ? -27.133 -42.420 32.393 1.00 65.83  ? 57   TYR G CG    1 
ATOM   4857  C  CD1   . TYR G 3  57  ? -27.641 -43.654 32.804 1.00 69.04  ? 57   TYR G CD1   1 
ATOM   4858  C  CD2   . TYR G 3  57  ? -26.278 -41.744 33.247 1.00 69.69  ? 57   TYR G CD2   1 
ATOM   4859  C  CE1   . TYR G 3  57  ? -27.280 -44.208 34.012 1.00 72.01  ? 57   TYR G CE1   1 
ATOM   4860  C  CE2   . TYR G 3  57  ? -25.901 -42.293 34.460 1.00 69.97  ? 57   TYR G CE2   1 
ATOM   4861  C  CZ    . TYR G 3  57  ? -26.407 -43.518 34.829 1.00 74.14  ? 57   TYR G CZ    1 
ATOM   4862  O  OH    . TYR G 3  57  ? -26.040 -44.038 36.035 1.00 84.84  ? 57   TYR G OH    1 
ATOM   4863  N  N     . LEU G 3  58  ? -29.094 -39.748 32.684 1.00 63.91  ? 58   LEU G N     1 
ATOM   4864  C  CA    . LEU G 3  58  ? -29.335 -39.072 33.933 1.00 61.26  ? 58   LEU G CA    1 
ATOM   4865  C  C     . LEU G 3  58  ? -30.824 -38.807 34.120 1.00 64.95  ? 58   LEU G C     1 
ATOM   4866  O  O     . LEU G 3  58  ? -31.327 -38.812 35.252 1.00 72.54  ? 58   LEU G O     1 
ATOM   4867  C  CB    . LEU G 3  58  ? -28.524 -37.777 33.999 1.00 62.65  ? 58   LEU G CB    1 
ATOM   4868  C  CG    . LEU G 3  58  ? -26.987 -37.864 34.083 1.00 63.41  ? 58   LEU G CG    1 
ATOM   4869  C  CD1   . LEU G 3  58  ? -26.319 -36.549 33.705 1.00 61.06  ? 58   LEU G CD1   1 
ATOM   4870  C  CD2   . LEU G 3  58  ? -26.525 -38.300 35.464 1.00 57.28  ? 58   LEU G CD2   1 
ATOM   4871  N  N     . THR G 3  59  ? -31.532 -38.594 33.017 1.00 61.82  ? 59   THR G N     1 
ATOM   4872  C  CA    . THR G 3  59  ? -32.976 -38.386 33.080 1.00 68.78  ? 59   THR G CA    1 
ATOM   4873  C  C     . THR G 3  59  ? -33.665 -39.652 33.588 1.00 70.15  ? 59   THR G C     1 
ATOM   4874  O  O     . THR G 3  59  ? -34.551 -39.604 34.455 1.00 68.74  ? 59   THR G O     1 
ATOM   4875  C  CB    . THR G 3  59  ? -33.542 -37.986 31.699 1.00 65.37  ? 59   THR G CB    1 
ATOM   4876  O  OG1   . THR G 3  59  ? -32.992 -36.728 31.321 1.00 61.12  ? 59   THR G OG1   1 
ATOM   4877  C  CG2   . THR G 3  59  ? -35.050 -37.842 31.742 1.00 62.37  ? 59   THR G CG2   1 
ATOM   4878  N  N     . ALA G 3  60  ? -33.229 -40.783 33.043 1.00 69.93  ? 60   ALA G N     1 
ATOM   4879  C  CA    . ALA G 3  60  ? -33.800 -42.068 33.391 1.00 70.27  ? 60   ALA G CA    1 
ATOM   4880  C  C     . ALA G 3  60  ? -33.641 -42.338 34.886 1.00 70.16  ? 60   ALA G C     1 
ATOM   4881  O  O     . ALA G 3  60  ? -34.630 -42.608 35.593 1.00 67.50  ? 60   ALA G O     1 
ATOM   4882  C  CB    . ALA G 3  60  ? -33.163 -43.172 32.563 1.00 63.68  ? 60   ALA G CB    1 
ATOM   4883  N  N     . GLU G 3  61  ? -32.403 -42.228 35.365 1.00 68.92  ? 61   GLU G N     1 
ATOM   4884  C  CA    . GLU G 3  61  ? -32.099 -42.486 36.775 1.00 71.26  ? 61   GLU G CA    1 
ATOM   4885  C  C     . GLU G 3  61  ? -33.082 -41.747 37.693 1.00 69.07  ? 61   GLU G C     1 
ATOM   4886  O  O     . GLU G 3  61  ? -33.711 -42.352 38.565 1.00 73.01  ? 61   GLU G O     1 
ATOM   4887  C  CB    . GLU G 3  61  ? -30.649 -42.105 37.102 1.00 74.87  ? 61   GLU G CB    1 
ATOM   4888  C  CG    . GLU G 3  61  ? -30.011 -42.905 38.232 1.00 84.40  ? 61   GLU G CG    1 
ATOM   4889  C  CD    . GLU G 3  61  ? -29.657 -44.312 37.809 1.00 99.57  ? 61   GLU G CD    1 
ATOM   4890  O  OE1   . GLU G 3  61  ? -28.468 -44.599 37.522 1.00 100.99 ? 61   GLU G OE1   1 
ATOM   4891  O  OE2   . GLU G 3  61  ? -30.589 -45.133 37.752 1.00 113.38 ? 61   GLU G OE2   1 
ATOM   4892  N  N     . ILE G 3  62  ? -33.229 -40.448 37.461 1.00 63.55  ? 62   ILE G N     1 
ATOM   4893  C  CA    . ILE G 3  62  ? -34.075 -39.599 38.272 1.00 62.49  ? 62   ILE G CA    1 
ATOM   4894  C  C     . ILE G 3  62  ? -35.525 -39.990 38.116 1.00 69.76  ? 62   ILE G C     1 
ATOM   4895  O  O     . ILE G 3  62  ? -36.257 -40.068 39.110 1.00 76.44  ? 62   ILE G O     1 
ATOM   4896  C  CB    . ILE G 3  62  ? -33.929 -38.118 37.890 1.00 65.23  ? 62   ILE G CB    1 
ATOM   4897  C  CG1   . ILE G 3  62  ? -32.561 -37.593 38.298 1.00 64.08  ? 62   ILE G CG1   1 
ATOM   4898  C  CG2   . ILE G 3  62  ? -35.022 -37.271 38.537 1.00 64.04  ? 62   ILE G CG2   1 
ATOM   4899  C  CD1   . ILE G 3  62  ? -32.300 -36.193 37.806 1.00 65.85  ? 62   ILE G CD1   1 
ATOM   4900  N  N     . LEU G 3  63  ? -35.954 -40.225 36.875 1.00 69.53  ? 63   LEU G N     1 
ATOM   4901  C  CA    . LEU G 3  63  ? -37.335 -40.632 36.645 1.00 64.64  ? 63   LEU G CA    1 
ATOM   4902  C  C     . LEU G 3  63  ? -37.613 -41.973 37.318 1.00 64.33  ? 63   LEU G C     1 
ATOM   4903  O  O     . LEU G 3  63  ? -38.661 -42.131 37.935 1.00 62.61  ? 63   LEU G O     1 
ATOM   4904  C  CB    . LEU G 3  63  ? -37.658 -40.679 35.160 1.00 67.97  ? 63   LEU G CB    1 
ATOM   4905  C  CG    . LEU G 3  63  ? -37.686 -39.321 34.473 1.00 67.78  ? 63   LEU G CG    1 
ATOM   4906  C  CD1   . LEU G 3  63  ? -37.876 -39.538 32.993 1.00 72.51  ? 63   LEU G CD1   1 
ATOM   4907  C  CD2   . LEU G 3  63  ? -38.766 -38.410 35.028 1.00 65.71  ? 63   LEU G CD2   1 
ATOM   4908  N  N     . GLU G 3  64  ? -36.668 -42.914 37.232 1.00 60.93  ? 64   GLU G N     1 
ATOM   4909  C  CA    . GLU G 3  64  ? -36.816 -44.171 37.936 1.00 72.01  ? 64   GLU G CA    1 
ATOM   4910  C  C     . GLU G 3  64  ? -37.074 -43.967 39.410 1.00 77.52  ? 64   GLU G C     1 
ATOM   4911  O  O     . GLU G 3  64  ? -38.068 -44.468 39.944 1.00 86.85  ? 64   GLU G O     1 
ATOM   4912  C  CB    . GLU G 3  64  ? -35.597 -45.065 37.781 1.00 77.87  ? 64   GLU G CB    1 
ATOM   4913  C  CG    . GLU G 3  64  ? -35.811 -46.423 38.441 1.00 86.99  ? 64   GLU G CG    1 
ATOM   4914  C  CD    . GLU G 3  64  ? -34.611 -47.333 38.295 1.00 105.00 ? 64   GLU G CD    1 
ATOM   4915  O  OE1   . GLU G 3  64  ? -33.648 -46.924 37.608 1.00 108.75 ? 64   GLU G OE1   1 
ATOM   4916  O  OE2   . GLU G 3  64  ? -34.633 -48.451 38.870 1.00 109.16 ? 64   GLU G OE2   1 
ATOM   4917  N  N     . LEU G 3  65  ? -36.183 -43.228 40.065 1.00 72.14  ? 65   LEU G N     1 
ATOM   4918  C  CA    . LEU G 3  65  ? -36.260 -43.082 41.512 1.00 69.21  ? 65   LEU G CA    1 
ATOM   4919  C  C     . LEU G 3  65  ? -37.459 -42.238 41.919 1.00 69.66  ? 65   LEU G C     1 
ATOM   4920  O  O     . LEU G 3  65  ? -38.026 -42.447 42.996 1.00 70.52  ? 65   LEU G O     1 
ATOM   4921  C  CB    . LEU G 3  65  ? -34.940 -42.553 42.089 1.00 65.94  ? 65   LEU G CB    1 
ATOM   4922  C  CG    . LEU G 3  65  ? -33.714 -43.429 41.743 1.00 67.11  ? 65   LEU G CG    1 
ATOM   4923  C  CD1   . LEU G 3  65  ? -32.428 -42.621 41.737 1.00 67.74  ? 65   LEU G CD1   1 
ATOM   4924  C  CD2   . LEU G 3  65  ? -33.548 -44.674 42.607 1.00 61.45  ? 65   LEU G CD2   1 
ATOM   4925  N  N     . ALA G 3  66  ? -37.856 -41.310 41.048 1.00 67.37  ? 66   ALA G N     1 
ATOM   4926  C  CA    . ALA G 3  66  ? -38.993 -40.439 41.332 1.00 72.20  ? 66   ALA G CA    1 
ATOM   4927  C  C     . ALA G 3  66  ? -40.286 -41.211 41.159 1.00 79.97  ? 66   ALA G C     1 
ATOM   4928  O  O     . ALA G 3  66  ? -41.256 -40.996 41.895 1.00 85.69  ? 66   ALA G O     1 
ATOM   4929  C  CB    . ALA G 3  66  ? -38.973 -39.203 40.454 1.00 66.98  ? 66   ALA G CB    1 
ATOM   4930  N  N     . GLY G 3  67  ? -40.287 -42.118 40.185 1.00 84.21  ? 67   GLY G N     1 
ATOM   4931  C  CA    . GLY G 3  67  ? -41.370 -43.071 40.022 1.00 82.84  ? 67   GLY G CA    1 
ATOM   4932  C  C     . GLY G 3  67  ? -41.510 -43.894 41.290 1.00 84.46  ? 67   GLY G C     1 
ATOM   4933  O  O     . GLY G 3  67  ? -42.597 -43.966 41.870 1.00 85.83  ? 67   GLY G O     1 
ATOM   4934  N  N     . ASN G 3  68  ? -40.406 -44.494 41.741 1.00 77.36  ? 68   ASN G N     1 
ATOM   4935  C  CA    . ASN G 3  68  ? -40.424 -45.288 42.968 1.00 74.37  ? 68   ASN G CA    1 
ATOM   4936  C  C     . ASN G 3  68  ? -40.990 -44.495 44.121 1.00 76.16  ? 68   ASN G C     1 
ATOM   4937  O  O     . ASN G 3  68  ? -41.770 -45.022 44.914 1.00 79.29  ? 68   ASN G O     1 
ATOM   4938  C  CB    . ASN G 3  68  ? -39.027 -45.788 43.325 1.00 77.42  ? 68   ASN G CB    1 
ATOM   4939  C  CG    . ASN G 3  68  ? -38.403 -46.622 42.218 1.00 82.16  ? 68   ASN G CG    1 
ATOM   4940  O  OD1   . ASN G 3  68  ? -39.098 -47.099 41.300 1.00 82.76  ? 68   ASN G OD1   1 
ATOM   4941  N  ND2   . ASN G 3  68  ? -37.080 -46.806 42.296 1.00 71.79  ? 68   ASN G ND2   1 
ATOM   4942  N  N     . ALA G 3  69  ? -40.605 -43.220 44.180 1.00 76.53  ? 69   ALA G N     1 
ATOM   4943  C  CA    . ALA G 3  69  ? -41.059 -42.301 45.202 1.00 75.92  ? 69   ALA G CA    1 
ATOM   4944  C  C     . ALA G 3  69  ? -42.552 -42.057 45.085 1.00 75.04  ? 69   ALA G C     1 
ATOM   4945  O  O     . ALA G 3  69  ? -43.233 -41.944 46.098 1.00 79.11  ? 69   ALA G O     1 
ATOM   4946  C  CB    . ALA G 3  69  ? -40.293 -41.000 45.094 1.00 79.97  ? 69   ALA G CB    1 
ATOM   4947  N  N     . ALA G 3  70  ? -43.048 -41.978 43.848 1.00 79.07  ? 70   ALA G N     1 
ATOM   4948  C  CA    . ALA G 3  70  ? -44.495 -41.899 43.562 1.00 83.43  ? 70   ALA G CA    1 
ATOM   4949  C  C     . ALA G 3  70  ? -45.227 -43.139 44.080 1.00 81.95  ? 70   ALA G C     1 
ATOM   4950  O  O     . ALA G 3  70  ? -46.208 -43.029 44.826 1.00 82.04  ? 70   ALA G O     1 
ATOM   4951  C  CB    . ALA G 3  70  ? -44.742 -41.721 42.068 1.00 74.31  ? 70   ALA G CB    1 
ATOM   4952  N  N     . ARG G 3  71  ? -44.722 -44.310 43.696 1.00 83.91  ? 71   ARG G N     1 
ATOM   4953  C  CA    . ARG G 3  71  ? -45.253 -45.577 44.165 1.00 87.72  ? 71   ARG G CA    1 
ATOM   4954  C  C     . ARG G 3  71  ? -45.382 -45.571 45.699 1.00 89.63  ? 71   ARG G C     1 
ATOM   4955  O  O     . ARG G 3  71  ? -46.485 -45.723 46.224 1.00 93.89  ? 71   ARG G O     1 
ATOM   4956  C  CB    . ARG G 3  71  ? -44.380 -46.728 43.665 1.00 90.46  ? 71   ARG G CB    1 
ATOM   4957  C  CG    . ARG G 3  71  ? -45.034 -48.093 43.741 1.00 95.20  ? 71   ARG G CG    1 
ATOM   4958  C  CD    . ARG G 3  71  ? -43.978 -49.173 43.870 1.00 101.98 ? 71   ARG G CD    1 
ATOM   4959  N  NE    . ARG G 3  71  ? -44.562 -50.478 44.186 1.00 107.57 ? 71   ARG G NE    1 
ATOM   4960  C  CZ    . ARG G 3  71  ? -43.859 -51.589 44.425 1.00 117.07 ? 71   ARG G CZ    1 
ATOM   4961  N  NH1   . ARG G 3  71  ? -42.523 -51.571 44.400 1.00 116.81 ? 71   ARG G NH1   1 
ATOM   4962  N  NH2   . ARG G 3  71  ? -44.495 -52.725 44.698 1.00 115.35 ? 71   ARG G NH2   1 
ATOM   4963  N  N     . ASP G 3  72  ? -44.275 -45.346 46.407 1.00 85.67  ? 72   ASP G N     1 
ATOM   4964  C  CA    . ASP G 3  72  ? -44.298 -45.318 47.872 1.00 87.41  ? 72   ASP G CA    1 
ATOM   4965  C  C     . ASP G 3  72  ? -45.479 -44.531 48.396 1.00 85.77  ? 72   ASP G C     1 
ATOM   4966  O  O     . ASP G 3  72  ? -46.152 -44.973 49.322 1.00 90.80  ? 72   ASP G O     1 
ATOM   4967  C  CB    . ASP G 3  72  ? -43.026 -44.700 48.461 1.00 90.86  ? 72   ASP G CB    1 
ATOM   4968  C  CG    . ASP G 3  72  ? -41.775 -45.380 47.994 1.00 98.36  ? 72   ASP G CG    1 
ATOM   4969  O  OD1   . ASP G 3  72  ? -41.746 -46.625 47.932 1.00 112.03 ? 72   ASP G OD1   1 
ATOM   4970  O  OD2   . ASP G 3  72  ? -40.806 -44.658 47.690 1.00 106.62 ? 72   ASP G OD2   1 
ATOM   4971  N  N     . ASN G 3  73  ? -45.729 -43.365 47.811 1.00 87.13  ? 73   ASN G N     1 
ATOM   4972  C  CA    . ASN G 3  73  ? -46.752 -42.476 48.349 1.00 99.53  ? 73   ASN G CA    1 
ATOM   4973  C  C     . ASN G 3  73  ? -48.125 -42.733 47.740 1.00 100.34 ? 73   ASN G C     1 
ATOM   4974  O  O     . ASN G 3  73  ? -49.047 -41.933 47.917 1.00 97.05  ? 73   ASN G O     1 
ATOM   4975  C  CB    . ASN G 3  73  ? -46.314 -41.014 48.247 1.00 102.69 ? 73   ASN G CB    1 
ATOM   4976  C  CG    . ASN G 3  73  ? -45.018 -40.753 48.998 1.00 112.45 ? 73   ASN G CG    1 
ATOM   4977  O  OD1   . ASN G 3  73  ? -45.043 -40.376 50.169 1.00 126.60 ? 73   ASN G OD1   1 
ATOM   4978  N  ND2   . ASN G 3  73  ? -43.881 -40.996 48.346 1.00 98.25  ? 73   ASN G ND2   1 
ATOM   4979  N  N     . LYS G 3  74  ? -48.243 -43.879 47.060 1.00 91.79  ? 74   LYS G N     1 
ATOM   4980  C  CA    . LYS G 3  74  ? -49.503 -44.373 46.508 1.00 96.18  ? 74   LYS G CA    1 
ATOM   4981  C  C     . LYS G 3  74  ? -49.989 -43.433 45.413 1.00 92.23  ? 74   LYS G C     1 
ATOM   4982  O  O     . LYS G 3  74  ? -51.141 -42.998 45.424 1.00 99.24  ? 74   LYS G O     1 
ATOM   4983  C  CB    . LYS G 3  74  ? -50.581 -44.528 47.609 1.00 109.09 ? 74   LYS G CB    1 
ATOM   4984  C  CG    . LYS G 3  74  ? -50.318 -45.578 48.692 1.00 108.83 ? 74   LYS G CG    1 
ATOM   4985  C  CD    . LYS G 3  74  ? -50.829 -46.966 48.293 1.00 114.16 ? 74   LYS G CD    1 
ATOM   4986  C  CE    . LYS G 3  74  ? -50.855 -47.946 49.469 1.00 109.07 ? 74   LYS G CE    1 
ATOM   4987  N  NZ    . LYS G 3  74  ? -49.503 -48.322 49.979 1.00 96.27  ? 74   LYS G NZ    1 
ATOM   4988  N  N     . LYS G 3  75  ? -49.097 -43.110 44.481 1.00 88.66  ? 75   LYS G N     1 
ATOM   4989  C  CA    . LYS G 3  75  ? -49.402 -42.206 43.366 1.00 80.93  ? 75   LYS G CA    1 
ATOM   4990  C  C     . LYS G 3  75  ? -48.845 -42.713 42.031 1.00 84.62  ? 75   LYS G C     1 
ATOM   4991  O  O     . LYS G 3  75  ? -47.881 -43.492 41.984 1.00 84.06  ? 75   LYS G O     1 
ATOM   4992  C  CB    . LYS G 3  75  ? -48.861 -40.806 43.659 1.00 79.35  ? 75   LYS G CB    1 
ATOM   4993  C  CG    . LYS G 3  75  ? -49.875 -39.861 44.285 1.00 86.85  ? 75   LYS G CG    1 
ATOM   4994  C  CD    . LYS G 3  75  ? -49.690 -39.693 45.787 1.00 85.51  ? 75   LYS G CD    1 
ATOM   4995  C  CE    . LYS G 3  75  ? -51.022 -39.545 46.523 1.00 88.83  ? 75   LYS G CE    1 
ATOM   4996  N  NZ    . LYS G 3  75  ? -51.818 -38.343 46.150 1.00 97.11  ? 75   LYS G NZ    1 
ATOM   4997  N  N     . THR G 3  76  ? -49.453 -42.273 40.937 1.00 87.91  ? 76   THR G N     1 
ATOM   4998  C  CA    . THR G 3  76  ? -48.968 -42.653 39.601 1.00 88.69  ? 76   THR G CA    1 
ATOM   4999  C  C     . THR G 3  76  ? -48.495 -41.442 38.814 1.00 85.09  ? 76   THR G C     1 
ATOM   5000  O  O     . THR G 3  76  ? -47.808 -41.582 37.801 1.00 79.27  ? 76   THR G O     1 
ATOM   5001  C  CB    . THR G 3  76  ? -50.037 -43.393 38.767 1.00 98.39  ? 76   THR G CB    1 
ATOM   5002  O  OG1   . THR G 3  76  ? -51.287 -42.671 38.817 1.00 94.62  ? 76   THR G OG1   1 
ATOM   5003  C  CG2   . THR G 3  76  ? -50.188 -44.851 39.255 1.00 95.12  ? 76   THR G CG2   1 
ATOM   5004  N  N     . ARG G 3  77  ? -48.878 -40.255 39.283 1.00 81.86  ? 77   ARG G N     1 
ATOM   5005  C  CA    . ARG G 3  77  ? -48.415 -38.995 38.706 1.00 81.74  ? 77   ARG G CA    1 
ATOM   5006  C  C     . ARG G 3  77  ? -47.241 -38.437 39.524 1.00 80.36  ? 77   ARG G C     1 
ATOM   5007  O  O     . ARG G 3  77  ? -47.410 -38.138 40.716 1.00 83.99  ? 77   ARG G O     1 
ATOM   5008  C  CB    . ARG G 3  77  ? -49.575 -38.004 38.687 1.00 84.35  ? 77   ARG G CB    1 
ATOM   5009  C  CG    . ARG G 3  77  ? -49.194 -36.547 38.477 1.00 92.07  ? 77   ARG G CG    1 
ATOM   5010  C  CD    . ARG G 3  77  ? -50.370 -35.731 37.964 1.00 87.70  ? 77   ARG G CD    1 
ATOM   5011  N  NE    . ARG G 3  77  ? -50.954 -36.428 36.825 1.00 89.84  ? 77   ARG G NE    1 
ATOM   5012  C  CZ    . ARG G 3  77  ? -52.246 -36.705 36.684 1.00 90.89  ? 77   ARG G CZ    1 
ATOM   5013  N  NH1   . ARG G 3  77  ? -53.141 -36.293 37.585 1.00 85.03  ? 77   ARG G NH1   1 
ATOM   5014  N  NH2   . ARG G 3  77  ? -52.636 -37.386 35.615 1.00 91.61  ? 77   ARG G NH2   1 
ATOM   5015  N  N     . ILE G 3  78  ? -46.066 -38.321 38.893 1.00 69.79  ? 78   ILE G N     1 
ATOM   5016  C  CA    . ILE G 3  78  ? -44.872 -37.714 39.515 1.00 67.84  ? 78   ILE G CA    1 
ATOM   5017  C  C     . ILE G 3  78  ? -45.057 -36.198 39.698 1.00 70.61  ? 78   ILE G C     1 
ATOM   5018  O  O     . ILE G 3  78  ? -45.370 -35.473 38.741 1.00 71.68  ? 78   ILE G O     1 
ATOM   5019  C  CB    . ILE G 3  78  ? -43.580 -37.963 38.694 1.00 62.64  ? 78   ILE G CB    1 
ATOM   5020  C  CG1   . ILE G 3  78  ? -43.089 -39.403 38.868 1.00 66.92  ? 78   ILE G CG1   1 
ATOM   5021  C  CG2   . ILE G 3  78  ? -42.500 -36.976 39.103 1.00 59.90  ? 78   ILE G CG2   1 
ATOM   5022  C  CD1   . ILE G 3  78  ? -42.041 -39.862 37.873 1.00 61.53  ? 78   ILE G CD1   1 
ATOM   5023  N  N     . ILE G 3  79  ? -44.881 -35.736 40.933 1.00 66.67  ? 79   ILE G N     1 
ATOM   5024  C  CA    . ILE G 3  79  ? -44.870 -34.309 41.239 1.00 67.57  ? 79   ILE G CA    1 
ATOM   5025  C  C     . ILE G 3  79  ? -43.483 -33.837 41.748 1.00 72.14  ? 79   ILE G C     1 
ATOM   5026  O  O     . ILE G 3  79  ? -42.601 -34.668 42.018 1.00 76.45  ? 79   ILE G O     1 
ATOM   5027  C  CB    . ILE G 3  79  ? -46.022 -33.906 42.202 1.00 63.13  ? 79   ILE G CB    1 
ATOM   5028  C  CG1   . ILE G 3  79  ? -45.975 -34.693 43.513 1.00 63.90  ? 79   ILE G CG1   1 
ATOM   5029  C  CG2   . ILE G 3  79  ? -47.368 -34.042 41.514 1.00 62.55  ? 79   ILE G CG2   1 
ATOM   5030  C  CD1   . ILE G 3  79  ? -46.819 -34.077 44.614 1.00 63.44  ? 79   ILE G CD1   1 
ATOM   5031  N  N     . PRO G 3  80  ? -43.267 -32.506 41.852 1.00 71.88  ? 80   PRO G N     1 
ATOM   5032  C  CA    . PRO G 3  80  ? -42.005 -32.012 42.394 1.00 70.45  ? 80   PRO G CA    1 
ATOM   5033  C  C     . PRO G 3  80  ? -41.552 -32.728 43.680 1.00 67.15  ? 80   PRO G C     1 
ATOM   5034  O  O     . PRO G 3  80  ? -40.384 -33.096 43.811 1.00 70.90  ? 80   PRO G O     1 
ATOM   5035  C  CB    . PRO G 3  80  ? -42.320 -30.538 42.643 1.00 70.07  ? 80   PRO G CB    1 
ATOM   5036  C  CG    . PRO G 3  80  ? -43.163 -30.185 41.465 1.00 65.77  ? 80   PRO G CG    1 
ATOM   5037  C  CD    . PRO G 3  80  ? -44.061 -31.391 41.289 1.00 73.60  ? 80   PRO G CD    1 
ATOM   5038  N  N     . ARG G 3  81  ? -42.475 -32.980 44.591 1.00 63.35  ? 81   ARG G N     1 
ATOM   5039  C  CA    . ARG G 3  81  ? -42.120 -33.637 45.841 1.00 63.54  ? 81   ARG G CA    1 
ATOM   5040  C  C     . ARG G 3  81  ? -41.461 -34.954 45.579 1.00 64.31  ? 81   ARG G C     1 
ATOM   5041  O  O     . ARG G 3  81  ? -40.601 -35.382 46.346 1.00 62.33  ? 81   ARG G O     1 
ATOM   5042  C  CB    . ARG G 3  81  ? -43.349 -33.866 46.715 1.00 64.29  ? 81   ARG G CB    1 
ATOM   5043  C  CG    . ARG G 3  81  ? -43.093 -34.645 47.987 1.00 61.56  ? 81   ARG G CG    1 
ATOM   5044  C  CD    . ARG G 3  81  ? -41.999 -34.024 48.811 1.00 63.42  ? 81   ARG G CD    1 
ATOM   5045  N  NE    . ARG G 3  81  ? -42.073 -34.420 50.209 1.00 64.82  ? 81   ARG G NE    1 
ATOM   5046  C  CZ    . ARG G 3  81  ? -41.263 -33.944 51.150 1.00 65.07  ? 81   ARG G CZ    1 
ATOM   5047  N  NH1   . ARG G 3  81  ? -40.316 -33.058 50.826 1.00 64.21  ? 81   ARG G NH1   1 
ATOM   5048  N  NH2   . ARG G 3  81  ? -41.396 -34.342 52.410 1.00 60.87  ? 81   ARG G NH2   1 
ATOM   5049  N  N     . HIS G 3  82  ? -41.866 -35.611 44.499 1.00 65.07  ? 82   HIS G N     1 
ATOM   5050  C  CA    . HIS G 3  82  ? -41.283 -36.914 44.199 1.00 68.27  ? 82   HIS G CA    1 
ATOM   5051  C  C     . HIS G 3  82  ? -39.879 -36.771 43.668 1.00 69.75  ? 82   HIS G C     1 
ATOM   5052  O  O     . HIS G 3  82  ? -39.034 -37.638 43.936 1.00 67.39  ? 82   HIS G O     1 
ATOM   5053  C  CB    . HIS G 3  82  ? -42.176 -37.787 43.301 1.00 66.21  ? 82   HIS G CB    1 
ATOM   5054  C  CG    . HIS G 3  82  ? -43.599 -37.925 43.800 1.00 69.01  ? 82   HIS G CG    1 
ATOM   5055  N  ND1   . HIS G 3  82  ? -44.668 -37.780 42.986 1.00 68.78  ? 82   HIS G ND1   1 
ATOM   5056  C  CD2   . HIS G 3  82  ? -44.110 -38.162 45.086 1.00 68.05  ? 82   HIS G CD2   1 
ATOM   5057  C  CE1   . HIS G 3  82  ? -45.805 -37.923 43.703 1.00 64.96  ? 82   HIS G CE1   1 
ATOM   5058  N  NE2   . HIS G 3  82  ? -45.465 -38.151 44.989 1.00 68.10  ? 82   HIS G NE2   1 
ATOM   5059  N  N     . LEU G 3  83  ? -39.607 -35.678 42.941 1.00 71.36  ? 83   LEU G N     1 
ATOM   5060  C  CA    . LEU G 3  83  ? -38.243 -35.408 42.421 1.00 65.57  ? 83   LEU G CA    1 
ATOM   5061  C  C     . LEU G 3  83  ? -37.292 -35.057 43.553 1.00 62.94  ? 83   LEU G C     1 
ATOM   5062  O  O     . LEU G 3  83  ? -36.156 -35.569 43.589 1.00 56.95  ? 83   LEU G O     1 
ATOM   5063  C  CB    . LEU G 3  83  ? -38.236 -34.307 41.374 1.00 58.77  ? 83   LEU G CB    1 
ATOM   5064  C  CG    . LEU G 3  83  ? -38.953 -34.629 40.067 1.00 60.36  ? 83   LEU G CG    1 
ATOM   5065  C  CD1   . LEU G 3  83  ? -39.294 -33.348 39.338 1.00 63.13  ? 83   LEU G CD1   1 
ATOM   5066  C  CD2   . LEU G 3  83  ? -38.093 -35.498 39.180 1.00 57.92  ? 83   LEU G CD2   1 
ATOM   5067  N  N     . GLN G 3  84  ? -37.779 -34.226 44.481 1.00 54.16  ? 84   GLN G N     1 
ATOM   5068  C  CA    . GLN G 3  84  ? -37.038 -33.912 45.695 1.00 56.97  ? 84   GLN G CA    1 
ATOM   5069  C  C     . GLN G 3  84  ? -36.686 -35.156 46.526 1.00 62.82  ? 84   GLN G C     1 
ATOM   5070  O  O     . GLN G 3  84  ? -35.509 -35.398 46.799 1.00 70.47  ? 84   GLN G O     1 
ATOM   5071  C  CB    . GLN G 3  84  ? -37.796 -32.907 46.532 1.00 54.66  ? 84   GLN G CB    1 
ATOM   5072  C  CG    . GLN G 3  84  ? -37.158 -32.574 47.856 1.00 54.38  ? 84   GLN G CG    1 
ATOM   5073  C  CD    . GLN G 3  84  ? -35.938 -31.672 47.744 1.00 56.07  ? 84   GLN G CD    1 
ATOM   5074  O  OE1   . GLN G 3  84  ? -35.245 -31.617 46.702 1.00 54.22  ? 84   GLN G OE1   1 
ATOM   5075  N  NE2   . GLN G 3  84  ? -35.641 -30.979 48.845 1.00 50.14  ? 84   GLN G NE2   1 
ATOM   5076  N  N     . LEU G 3  85  ? -37.672 -35.975 46.888 1.00 62.77  ? 85   LEU G N     1 
ATOM   5077  C  CA    . LEU G 3  85  ? -37.375 -37.207 47.639 1.00 60.54  ? 85   LEU G CA    1 
ATOM   5078  C  C     . LEU G 3  85  ? -36.391 -38.098 46.896 1.00 60.66  ? 85   LEU G C     1 
ATOM   5079  O  O     . LEU G 3  85  ? -35.520 -38.720 47.511 1.00 61.93  ? 85   LEU G O     1 
ATOM   5080  C  CB    . LEU G 3  85  ? -38.635 -37.997 47.974 1.00 59.05  ? 85   LEU G CB    1 
ATOM   5081  C  CG    . LEU G 3  85  ? -39.733 -37.301 48.795 1.00 63.29  ? 85   LEU G CG    1 
ATOM   5082  C  CD1   . LEU G 3  85  ? -40.816 -38.320 49.096 1.00 64.21  ? 85   LEU G CD1   1 
ATOM   5083  C  CD2   . LEU G 3  85  ? -39.232 -36.666 50.085 1.00 60.79  ? 85   LEU G CD2   1 
ATOM   5084  N  N     . ALA G 3  86  ? -36.509 -38.145 45.574 1.00 59.64  ? 86   ALA G N     1 
ATOM   5085  C  CA    . ALA G 3  86  ? -35.636 -39.014 44.789 1.00 60.15  ? 86   ALA G CA    1 
ATOM   5086  C  C     . ALA G 3  86  ? -34.194 -38.546 44.885 1.00 64.73  ? 86   ALA G C     1 
ATOM   5087  O  O     . ALA G 3  86  ? -33.307 -39.325 45.209 1.00 60.92  ? 86   ALA G O     1 
ATOM   5088  C  CB    . ALA G 3  86  ? -36.086 -39.072 43.340 1.00 56.53  ? 86   ALA G CB    1 
ATOM   5089  N  N     . VAL G 3  87  ? -33.988 -37.254 44.634 1.00 69.80  ? 87   VAL G N     1 
ATOM   5090  C  CA    . VAL G 3  87  ? -32.656 -36.646 44.554 1.00 63.63  ? 87   VAL G CA    1 
ATOM   5091  C  C     . VAL G 3  87  ? -31.950 -36.586 45.940 1.00 59.91  ? 87   VAL G C     1 
ATOM   5092  O  O     . VAL G 3  87  ? -30.764 -36.902 46.055 1.00 58.78  ? 87   VAL G O     1 
ATOM   5093  C  CB    . VAL G 3  87  ? -32.741 -35.268 43.811 1.00 58.89  ? 87   VAL G CB    1 
ATOM   5094  C  CG1   . VAL G 3  87  ? -31.595 -34.332 44.138 1.00 63.00  ? 87   VAL G CG1   1 
ATOM   5095  C  CG2   . VAL G 3  87  ? -32.803 -35.468 42.314 1.00 57.52  ? 87   VAL G CG2   1 
ATOM   5096  N  N     . ARG G 3  88  ? -32.659 -36.209 46.989 1.00 53.78  ? 88   ARG G N     1 
ATOM   5097  C  CA    . ARG G 3  88  ? -31.959 -36.036 48.255 1.00 62.39  ? 88   ARG G CA    1 
ATOM   5098  C  C     . ARG G 3  88  ? -31.843 -37.342 49.041 1.00 61.74  ? 88   ARG G C     1 
ATOM   5099  O  O     . ARG G 3  88  ? -31.246 -37.371 50.100 1.00 64.19  ? 88   ARG G O     1 
ATOM   5100  C  CB    . ARG G 3  88  ? -32.564 -34.918 49.143 1.00 62.98  ? 88   ARG G CB    1 
ATOM   5101  C  CG    . ARG G 3  88  ? -33.433 -33.913 48.415 1.00 62.44  ? 88   ARG G CG    1 
ATOM   5102  C  CD    . ARG G 3  88  ? -32.812 -32.573 47.997 1.00 61.83  ? 88   ARG G CD    1 
ATOM   5103  N  NE    . ARG G 3  88  ? -31.447 -32.553 47.446 1.00 59.56  ? 88   ARG G NE    1 
ATOM   5104  C  CZ    . ARG G 3  88  ? -30.985 -31.649 46.563 1.00 52.24  ? 88   ARG G CZ    1 
ATOM   5105  N  NH1   . ARG G 3  88  ? -31.744 -30.690 46.040 1.00 43.63  ? 88   ARG G NH1   1 
ATOM   5106  N  NH2   . ARG G 3  88  ? -29.731 -31.713 46.183 1.00 60.28  ? 88   ARG G NH2   1 
ATOM   5107  N  N     . ASN G 3  89  ? -32.428 -38.421 48.543 1.00 63.45  ? 89   ASN G N     1 
ATOM   5108  C  CA    . ASN G 3  89  ? -32.259 -39.715 49.197 1.00 59.82  ? 89   ASN G CA    1 
ATOM   5109  C  C     . ASN G 3  89  ? -31.204 -40.537 48.516 1.00 61.19  ? 89   ASN G C     1 
ATOM   5110  O  O     . ASN G 3  89  ? -30.921 -41.630 48.965 1.00 69.16  ? 89   ASN G O     1 
ATOM   5111  C  CB    . ASN G 3  89  ? -33.563 -40.495 49.255 1.00 57.86  ? 89   ASN G CB    1 
ATOM   5112  C  CG    . ASN G 3  89  ? -34.412 -40.111 50.447 1.00 64.57  ? 89   ASN G CG    1 
ATOM   5113  O  OD1   . ASN G 3  89  ? -33.970 -40.205 51.599 1.00 63.77  ? 89   ASN G OD1   1 
ATOM   5114  N  ND2   . ASN G 3  89  ? -35.639 -39.672 50.184 1.00 64.05  ? 89   ASN G ND2   1 
ATOM   5115  N  N     . ASP G 3  90  ? -30.649 -40.015 47.421 1.00 60.63  ? 90   ASP G N     1 
ATOM   5116  C  CA    . ASP G 3  90  ? -29.534 -40.631 46.726 1.00 59.71  ? 90   ASP G CA    1 
ATOM   5117  C  C     . ASP G 3  90  ? -28.290 -39.760 46.826 1.00 64.73  ? 90   ASP G C     1 
ATOM   5118  O  O     . ASP G 3  90  ? -28.226 -38.663 46.252 1.00 63.07  ? 90   ASP G O     1 
ATOM   5119  C  CB    . ASP G 3  90  ? -29.843 -40.902 45.252 1.00 64.66  ? 90   ASP G CB    1 
ATOM   5120  C  CG    . ASP G 3  90  ? -28.616 -41.442 44.486 1.00 72.16  ? 90   ASP G CG    1 
ATOM   5121  O  OD1   . ASP G 3  90  ? -28.498 -42.669 44.319 1.00 82.90  ? 90   ASP G OD1   1 
ATOM   5122  O  OD2   . ASP G 3  90  ? -27.741 -40.660 44.077 1.00 71.97  ? 90   ASP G OD2   1 
ATOM   5123  N  N     . GLU G 3  91  ? -27.294 -40.296 47.527 1.00 70.12  ? 91   GLU G N     1 
ATOM   5124  C  CA    . GLU G 3  91  ? -26.019 -39.645 47.769 1.00 66.25  ? 91   GLU G CA    1 
ATOM   5125  C  C     . GLU G 3  91  ? -25.471 -38.920 46.546 1.00 67.24  ? 91   GLU G C     1 
ATOM   5126  O  O     . GLU G 3  91  ? -25.120 -37.743 46.646 1.00 71.86  ? 91   GLU G O     1 
ATOM   5127  C  CB    . GLU G 3  91  ? -25.001 -40.670 48.276 1.00 70.77  ? 91   GLU G CB    1 
ATOM   5128  C  CG    . GLU G 3  91  ? -23.908 -40.035 49.111 1.00 86.00  ? 91   GLU G CG    1 
ATOM   5129  C  CD    . GLU G 3  91  ? -22.635 -40.847 49.129 1.00 96.88  ? 91   GLU G CD    1 
ATOM   5130  O  OE1   . GLU G 3  91  ? -21.715 -40.519 48.336 1.00 104.54 ? 91   GLU G OE1   1 
ATOM   5131  O  OE2   . GLU G 3  91  ? -22.559 -41.811 49.932 1.00 100.16 ? 91   GLU G OE2   1 
ATOM   5132  N  N     . GLU G 3  92  ? -25.422 -39.613 45.404 1.00 64.84  ? 92   GLU G N     1 
ATOM   5133  C  CA    . GLU G 3  92  ? -24.766 -39.108 44.201 1.00 61.76  ? 92   GLU G CA    1 
ATOM   5134  C  C     . GLU G 3  92  ? -25.567 -38.040 43.442 1.00 61.86  ? 92   GLU G C     1 
ATOM   5135  O  O     . GLU G 3  92  ? -25.014 -37.023 43.020 1.00 61.26  ? 92   GLU G O     1 
ATOM   5136  C  CB    . GLU G 3  92  ? -24.386 -40.254 43.278 1.00 69.49  ? 92   GLU G CB    1 
ATOM   5137  C  CG    . GLU G 3  92  ? -23.269 -41.136 43.815 1.00 75.01  ? 92   GLU G CG    1 
ATOM   5138  C  CD    . GLU G 3  92  ? -22.394 -41.748 42.721 1.00 85.66  ? 92   GLU G CD    1 
ATOM   5139  O  OE1   . GLU G 3  92  ? -22.845 -41.877 41.555 1.00 87.36  ? 92   GLU G OE1   1 
ATOM   5140  O  OE2   . GLU G 3  92  ? -21.237 -42.114 43.033 1.00 89.16  ? 92   GLU G OE2   1 
ATOM   5141  N  N     . LEU G 3  93  ? -26.866 -38.263 43.277 1.00 61.38  ? 93   LEU G N     1 
ATOM   5142  C  CA    . LEU G 3  93  ? -27.759 -37.221 42.759 1.00 61.35  ? 93   LEU G CA    1 
ATOM   5143  C  C     . LEU G 3  93  ? -27.783 -35.976 43.644 1.00 67.63  ? 93   LEU G C     1 
ATOM   5144  O  O     . LEU G 3  93  ? -27.824 -34.854 43.116 1.00 68.28  ? 93   LEU G O     1 
ATOM   5145  C  CB    . LEU G 3  93  ? -29.187 -37.742 42.565 1.00 57.26  ? 93   LEU G CB    1 
ATOM   5146  C  CG    . LEU G 3  93  ? -29.397 -38.659 41.353 1.00 58.17  ? 93   LEU G CG    1 
ATOM   5147  C  CD1   . LEU G 3  93  ? -30.834 -39.145 41.272 1.00 57.65  ? 93   LEU G CD1   1 
ATOM   5148  C  CD2   . LEU G 3  93  ? -28.995 -37.987 40.046 1.00 52.81  ? 93   LEU G CD2   1 
ATOM   5149  N  N     . ASN G 3  94  ? -27.774 -36.177 44.973 1.00 62.16  ? 94   ASN G N     1 
ATOM   5150  C  CA    . ASN G 3  94  ? -27.793 -35.079 45.925 1.00 55.14  ? 94   ASN G CA    1 
ATOM   5151  C  C     . ASN G 3  94  ? -26.571 -34.228 45.799 1.00 59.80  ? 94   ASN G C     1 
ATOM   5152  O  O     . ASN G 3  94  ? -26.643 -33.000 45.963 1.00 61.33  ? 94   ASN G O     1 
ATOM   5153  C  CB    . ASN G 3  94  ? -27.863 -35.594 47.353 1.00 59.88  ? 94   ASN G CB    1 
ATOM   5154  C  CG    . ASN G 3  94  ? -27.953 -34.483 48.373 1.00 54.96  ? 94   ASN G CG    1 
ATOM   5155  O  OD1   . ASN G 3  94  ? -28.721 -33.544 48.230 1.00 62.87  ? 94   ASN G OD1   1 
ATOM   5156  N  ND2   . ASN G 3  94  ? -27.185 -34.597 49.409 1.00 55.64  ? 94   ASN G ND2   1 
ATOM   5157  N  N     . LYS G 3  95  ? -25.437 -34.871 45.522 1.00 60.74  ? 95   LYS G N     1 
ATOM   5158  C  CA    . LYS G 3  95  ? -24.189 -34.128 45.437 1.00 59.52  ? 95   LYS G CA    1 
ATOM   5159  C  C     . LYS G 3  95  ? -24.167 -33.322 44.137 1.00 62.02  ? 95   LYS G C     1 
ATOM   5160  O  O     . LYS G 3  95  ? -23.844 -32.143 44.141 1.00 62.56  ? 95   LYS G O     1 
ATOM   5161  C  CB    . LYS G 3  95  ? -22.995 -35.048 45.609 1.00 58.78  ? 95   LYS G CB    1 
ATOM   5162  C  CG    . LYS G 3  95  ? -21.644 -34.356 45.579 1.00 72.10  ? 95   LYS G CG    1 
ATOM   5163  C  CD    . LYS G 3  95  ? -20.541 -35.356 45.909 1.00 87.43  ? 95   LYS G CD    1 
ATOM   5164  C  CE    . LYS G 3  95  ? -19.246 -35.076 45.156 1.00 87.25  ? 95   LYS G CE    1 
ATOM   5165  N  NZ    . LYS G 3  95  ? -18.162 -35.964 45.663 1.00 89.46  ? 95   LYS G NZ    1 
ATOM   5166  N  N     . LEU G 3  96  ? -24.565 -33.947 43.037 1.00 63.13  ? 96   LEU G N     1 
ATOM   5167  C  CA    . LEU G 3  96  ? -24.672 -33.247 41.762 1.00 58.85  ? 96   LEU G CA    1 
ATOM   5168  C  C     . LEU G 3  96  ? -25.624 -32.068 41.803 1.00 58.43  ? 96   LEU G C     1 
ATOM   5169  O  O     . LEU G 3  96  ? -25.401 -31.084 41.125 1.00 69.44  ? 96   LEU G O     1 
ATOM   5170  C  CB    . LEU G 3  96  ? -25.130 -34.210 40.679 1.00 56.22  ? 96   LEU G CB    1 
ATOM   5171  C  CG    . LEU G 3  96  ? -25.206 -33.713 39.253 1.00 54.84  ? 96   LEU G CG    1 
ATOM   5172  C  CD1   . LEU G 3  96  ? -23.816 -33.543 38.670 1.00 52.77  ? 96   LEU G CD1   1 
ATOM   5173  C  CD2   . LEU G 3  96  ? -26.016 -34.724 38.453 1.00 55.49  ? 96   LEU G CD2   1 
ATOM   5174  N  N     . LEU G 3  97  ? -26.690 -32.173 42.581 1.00 57.54  ? 97   LEU G N     1 
ATOM   5175  C  CA    . LEU G 3  97  ? -27.698 -31.124 42.655 1.00 57.63  ? 97   LEU G CA    1 
ATOM   5176  C  C     . LEU G 3  97  ? -27.633 -30.385 43.988 1.00 60.67  ? 97   LEU G C     1 
ATOM   5177  O  O     . LEU G 3  97  ? -28.641 -29.844 44.470 1.00 61.05  ? 97   LEU G O     1 
ATOM   5178  C  CB    . LEU G 3  97  ? -29.094 -31.735 42.456 1.00 57.90  ? 97   LEU G CB    1 
ATOM   5179  C  CG    . LEU G 3  97  ? -29.378 -32.276 41.050 1.00 58.53  ? 97   LEU G CG    1 
ATOM   5180  C  CD1   . LEU G 3  97  ? -30.871 -32.403 40.795 1.00 55.64  ? 97   LEU G CD1   1 
ATOM   5181  C  CD2   . LEU G 3  97  ? -28.738 -31.384 39.996 1.00 55.28  ? 97   LEU G CD2   1 
ATOM   5182  N  N     . GLY G 3  98  ? -26.452 -30.379 44.592 1.00 59.62  ? 98   GLY G N     1 
ATOM   5183  C  CA    . GLY G 3  98  ? -26.291 -29.861 45.939 1.00 59.08  ? 98   GLY G CA    1 
ATOM   5184  C  C     . GLY G 3  98  ? -26.354 -28.354 46.090 1.00 60.45  ? 98   GLY G C     1 
ATOM   5185  O  O     . GLY G 3  98  ? -26.440 -27.852 47.214 1.00 58.81  ? 98   GLY G O     1 
ATOM   5186  N  N     . ARG G 3  99  ? -26.285 -27.635 44.969 1.00 60.95  ? 99   ARG G N     1 
ATOM   5187  C  CA    . ARG G 3  99  ? -26.522 -26.199 44.970 1.00 59.09  ? 99   ARG G CA    1 
ATOM   5188  C  C     . ARG G 3  99  ? -27.716 -25.877 44.067 1.00 55.78  ? 99   ARG G C     1 
ATOM   5189  O  O     . ARG G 3  99  ? -27.732 -24.868 43.365 1.00 57.95  ? 99   ARG G O     1 
ATOM   5190  C  CB    . ARG G 3  99  ? -25.253 -25.421 44.588 1.00 59.74  ? 99   ARG G CB    1 
ATOM   5191  C  CG    . ARG G 3  99  ? -24.133 -25.501 45.617 1.00 63.82  ? 99   ARG G CG    1 
ATOM   5192  C  CD    . ARG G 3  99  ? -22.883 -24.795 45.086 1.00 86.09  ? 99   ARG G CD    1 
ATOM   5193  N  NE    . ARG G 3  99  ? -21.626 -25.334 45.640 1.00 102.48 ? 99   ARG G NE    1 
ATOM   5194  C  CZ    . ARG G 3  99  ? -20.419 -25.291 45.054 1.00 109.37 ? 99   ARG G CZ    1 
ATOM   5195  N  NH1   . ARG G 3  99  ? -20.229 -24.730 43.858 1.00 106.21 ? 99   ARG G NH1   1 
ATOM   5196  N  NH2   . ARG G 3  99  ? -19.377 -25.831 45.679 1.00 112.05 ? 99   ARG G NH2   1 
ATOM   5197  N  N     . VAL G 3  100 ? -28.722 -26.748 44.116 1.00 53.09  ? 100  VAL G N     1 
ATOM   5198  C  CA    . VAL G 3  100 ? -29.934 -26.600 43.327 1.00 48.48  ? 100  VAL G CA    1 
ATOM   5199  C  C     . VAL G 3  100 ? -31.161 -26.704 44.207 1.00 50.81  ? 100  VAL G C     1 
ATOM   5200  O  O     . VAL G 3  100 ? -31.182 -27.495 45.147 1.00 52.65  ? 100  VAL G O     1 
ATOM   5201  C  CB    . VAL G 3  100 ? -30.021 -27.665 42.226 1.00 47.18  ? 100  VAL G CB    1 
ATOM   5202  C  CG1   . VAL G 3  100 ? -31.424 -27.758 41.650 1.00 46.54  ? 100  VAL G CG1   1 
ATOM   5203  C  CG2   . VAL G 3  100 ? -29.048 -27.351 41.114 1.00 47.68  ? 100  VAL G CG2   1 
ATOM   5204  N  N     . THR G 3  101 ? -32.168 -25.883 43.905 1.00 54.11  ? 101  THR G N     1 
ATOM   5205  C  CA    . THR G 3  101 ? -33.438 -25.916 44.601 1.00 55.29  ? 101  THR G CA    1 
ATOM   5206  C  C     . THR G 3  101 ? -34.503 -26.318 43.621 1.00 61.50  ? 101  THR G C     1 
ATOM   5207  O  O     . THR G 3  101 ? -34.626 -25.712 42.550 1.00 65.05  ? 101  THR G O     1 
ATOM   5208  C  CB    . THR G 3  101 ? -33.765 -24.553 45.216 1.00 56.49  ? 101  THR G CB    1 
ATOM   5209  O  OG1   . THR G 3  101 ? -32.813 -24.292 46.242 1.00 58.32  ? 101  THR G OG1   1 
ATOM   5210  C  CG2   . THR G 3  101 ? -35.129 -24.549 45.852 1.00 51.43  ? 101  THR G CG2   1 
ATOM   5211  N  N     . ILE G 3  102 ? -35.242 -27.365 43.988 1.00 60.14  ? 102  ILE G N     1 
ATOM   5212  C  CA    . ILE G 3  102 ? -36.357 -27.869 43.202 1.00 57.05  ? 102  ILE G CA    1 
ATOM   5213  C  C     . ILE G 3  102 ? -37.575 -27.178 43.741 1.00 58.63  ? 102  ILE G C     1 
ATOM   5214  O  O     . ILE G 3  102 ? -37.951 -27.368 44.905 1.00 65.93  ? 102  ILE G O     1 
ATOM   5215  C  CB    . ILE G 3  102 ? -36.542 -29.398 43.378 1.00 58.41  ? 102  ILE G CB    1 
ATOM   5216  C  CG1   . ILE G 3  102 ? -35.391 -30.163 42.718 1.00 58.22  ? 102  ILE G CG1   1 
ATOM   5217  C  CG2   . ILE G 3  102 ? -37.864 -29.863 42.784 1.00 51.72  ? 102  ILE G CG2   1 
ATOM   5218  C  CD1   . ILE G 3  102 ? -35.145 -31.531 43.316 1.00 55.45  ? 102  ILE G CD1   1 
ATOM   5219  N  N     . ALA G 3  103 ? -38.203 -26.359 42.913 1.00 60.96  ? 103  ALA G N     1 
ATOM   5220  C  CA    . ALA G 3  103 ? -39.377 -25.643 43.369 1.00 59.37  ? 103  ALA G CA    1 
ATOM   5221  C  C     . ALA G 3  103 ? -40.446 -26.640 43.830 1.00 63.16  ? 103  ALA G C     1 
ATOM   5222  O  O     . ALA G 3  103 ? -40.684 -27.651 43.164 1.00 61.49  ? 103  ALA G O     1 
ATOM   5223  C  CB    . ALA G 3  103 ? -39.897 -24.753 42.277 1.00 56.45  ? 103  ALA G CB    1 
ATOM   5224  N  N     . GLN G 3  104 ? -41.057 -26.365 44.984 1.00 63.40  ? 104  GLN G N     1 
ATOM   5225  C  CA    . GLN G 3  104 ? -42.186 -27.152 45.482 1.00 63.40  ? 104  GLN G CA    1 
ATOM   5226  C  C     . GLN G 3  104 ? -41.774 -28.567 45.871 1.00 64.10  ? 104  GLN G C     1 
ATOM   5227  O  O     . GLN G 3  104 ? -42.573 -29.493 45.763 1.00 69.57  ? 104  GLN G O     1 
ATOM   5228  C  CB    . GLN G 3  104 ? -43.349 -27.190 44.470 1.00 64.10  ? 104  GLN G CB    1 
ATOM   5229  C  CG    . GLN G 3  104 ? -44.339 -26.050 44.618 1.00 72.59  ? 104  GLN G CG    1 
ATOM   5230  C  CD    . GLN G 3  104 ? -44.836 -25.864 46.056 1.00 83.12  ? 104  GLN G CD    1 
ATOM   5231  O  OE1   . GLN G 3  104 ? -45.555 -26.721 46.609 1.00 79.22  ? 104  GLN G OE1   1 
ATOM   5232  N  NE2   . GLN G 3  104 ? -44.452 -24.737 46.673 1.00 81.61  ? 104  GLN G NE2   1 
ATOM   5233  N  N     . GLY G 3  105 ? -40.531 -28.723 46.323 1.00 60.10  ? 105  GLY G N     1 
ATOM   5234  C  CA    . GLY G 3  105 ? -40.013 -30.014 46.754 1.00 56.69  ? 105  GLY G CA    1 
ATOM   5235  C  C     . GLY G 3  105 ? -40.040 -30.307 48.256 1.00 60.06  ? 105  GLY G C     1 
ATOM   5236  O  O     . GLY G 3  105 ? -39.917 -31.474 48.668 1.00 61.69  ? 105  GLY G O     1 
ATOM   5237  N  N     . GLY G 3  106 ? -40.200 -29.270 49.085 1.00 53.89  ? 106  GLY G N     1 
ATOM   5238  C  CA    . GLY G 3  106 ? -40.064 -29.418 50.537 1.00 50.66  ? 106  GLY G CA    1 
ATOM   5239  C  C     . GLY G 3  106 ? -38.732 -30.032 50.941 1.00 57.50  ? 106  GLY G C     1 
ATOM   5240  O  O     . GLY G 3  106 ? -37.732 -29.965 50.204 1.00 57.23  ? 106  GLY G O     1 
ATOM   5241  N  N     . VAL G 3  107 ? -38.715 -30.645 52.118 1.00 59.52  ? 107  VAL G N     1 
ATOM   5242  C  CA    . VAL G 3  107 ? -37.496 -31.254 52.638 1.00 57.60  ? 107  VAL G CA    1 
ATOM   5243  C  C     . VAL G 3  107 ? -37.720 -32.708 53.059 1.00 61.06  ? 107  VAL G C     1 
ATOM   5244  O  O     . VAL G 3  107 ? -38.865 -33.115 53.225 1.00 68.18  ? 107  VAL G O     1 
ATOM   5245  C  CB    . VAL G 3  107 ? -36.984 -30.458 53.832 1.00 54.72  ? 107  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G 3  107 ? -36.597 -29.070 53.383 1.00 53.11  ? 107  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G 3  107 ? -38.037 -30.401 54.933 1.00 58.48  ? 107  VAL G CG2   1 
ATOM   5248  N  N     . LEU G 3  108 ? -36.640 -33.479 53.224 1.00 61.59  ? 108  LEU G N     1 
ATOM   5249  C  CA    . LEU G 3  108 ? -36.687 -34.818 53.850 1.00 60.82  ? 108  LEU G CA    1 
ATOM   5250  C  C     . LEU G 3  108 ? -37.113 -34.763 55.310 1.00 66.20  ? 108  LEU G C     1 
ATOM   5251  O  O     . LEU G 3  108 ? -36.548 -33.990 56.076 1.00 71.00  ? 108  LEU G O     1 
ATOM   5252  C  CB    . LEU G 3  108 ? -35.305 -35.448 53.849 1.00 55.84  ? 108  LEU G CB    1 
ATOM   5253  C  CG    . LEU G 3  108 ? -34.688 -35.756 52.514 1.00 54.93  ? 108  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G 3  108 ? -33.584 -36.767 52.746 1.00 51.61  ? 108  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G 3  108 ? -35.751 -36.280 51.554 1.00 56.65  ? 108  LEU G CD2   1 
ATOM   5256  N  N     . PRO G 3  109 ? -38.089 -35.603 55.721 1.00 76.18  ? 109  PRO G N     1 
ATOM   5257  C  CA    . PRO G 3  109 ? -38.414 -35.637 57.147 1.00 72.81  ? 109  PRO G CA    1 
ATOM   5258  C  C     . PRO G 3  109 ? -37.163 -35.987 57.914 1.00 71.54  ? 109  PRO G C     1 
ATOM   5259  O  O     . PRO G 3  109 ? -36.534 -36.996 57.614 1.00 73.28  ? 109  PRO G O     1 
ATOM   5260  C  CB    . PRO G 3  109 ? -39.431 -36.775 57.237 1.00 69.64  ? 109  PRO G CB    1 
ATOM   5261  C  CG    . PRO G 3  109 ? -40.146 -36.696 55.928 1.00 75.30  ? 109  PRO G CG    1 
ATOM   5262  C  CD    . PRO G 3  109 ? -39.012 -36.461 54.951 1.00 79.74  ? 109  PRO G CD    1 
ATOM   5263  N  N     . ASN G 3  110 ? -36.791 -35.137 58.863 1.00 67.43  ? 110  ASN G N     1 
ATOM   5264  C  CA    . ASN G 3  110 ? -35.588 -35.332 59.651 1.00 67.36  ? 110  ASN G CA    1 
ATOM   5265  C  C     . ASN G 3  110 ? -35.627 -34.431 60.881 1.00 67.75  ? 110  ASN G C     1 
ATOM   5266  O  O     . ASN G 3  110 ? -35.757 -33.211 60.764 1.00 67.21  ? 110  ASN G O     1 
ATOM   5267  C  CB    . ASN G 3  110 ? -34.350 -35.041 58.789 1.00 74.48  ? 110  ASN G CB    1 
ATOM   5268  C  CG    . ASN G 3  110 ? -33.036 -35.129 59.562 1.00 76.34  ? 110  ASN G CG    1 
ATOM   5269  O  OD1   . ASN G 3  110 ? -33.002 -35.482 60.748 1.00 77.73  ? 110  ASN G OD1   1 
ATOM   5270  N  ND2   . ASN G 3  110 ? -31.938 -34.815 58.879 1.00 73.62  ? 110  ASN G ND2   1 
ATOM   5271  N  N     . ILE G 3  111 ? -35.534 -35.054 62.056 1.00 68.51  ? 111  ILE G N     1 
ATOM   5272  C  CA    . ILE G 3  111 ? -35.545 -34.352 63.344 1.00 65.20  ? 111  ILE G CA    1 
ATOM   5273  C  C     . ILE G 3  111 ? -34.334 -34.775 64.126 1.00 65.78  ? 111  ILE G C     1 
ATOM   5274  O  O     . ILE G 3  111 ? -34.085 -35.961 64.268 1.00 69.56  ? 111  ILE G O     1 
ATOM   5275  C  CB    . ILE G 3  111 ? -36.771 -34.706 64.202 1.00 66.76  ? 111  ILE G CB    1 
ATOM   5276  C  CG1   . ILE G 3  111 ? -38.080 -34.433 63.442 1.00 73.41  ? 111  ILE G CG1   1 
ATOM   5277  C  CG2   . ILE G 3  111 ? -36.715 -33.946 65.518 1.00 68.89  ? 111  ILE G CG2   1 
ATOM   5278  C  CD1   . ILE G 3  111 ? -39.339 -34.906 64.147 1.00 70.63  ? 111  ILE G CD1   1 
ATOM   5279  N  N     . GLN G 3  112 ? -33.570 -33.807 64.619 1.00 72.29  ? 112  GLN G N     1 
ATOM   5280  C  CA    . GLN G 3  112 ? -32.416 -34.100 65.475 1.00 75.91  ? 112  GLN G CA    1 
ATOM   5281  C  C     . GLN G 3  112 ? -32.873 -34.810 66.730 1.00 72.57  ? 112  GLN G C     1 
ATOM   5282  O  O     . GLN G 3  112 ? -33.820 -34.378 67.385 1.00 70.16  ? 112  GLN G O     1 
ATOM   5283  C  CB    . GLN G 3  112 ? -31.678 -32.824 65.866 1.00 76.78  ? 112  GLN G CB    1 
ATOM   5284  C  CG    . GLN G 3  112 ? -31.163 -32.054 64.679 1.00 75.28  ? 112  GLN G CG    1 
ATOM   5285  C  CD    . GLN G 3  112 ? -30.246 -32.891 63.837 1.00 72.33  ? 112  GLN G CD    1 
ATOM   5286  O  OE1   . GLN G 3  112 ? -29.158 -33.257 64.272 1.00 68.05  ? 112  GLN G OE1   1 
ATOM   5287  N  NE2   . GLN G 3  112 ? -30.678 -33.207 62.623 1.00 83.91  ? 112  GLN G NE2   1 
ATOM   5288  N  N     . SER G 3  113 ? -32.180 -35.890 67.063 1.00 72.06  ? 113  SER G N     1 
ATOM   5289  C  CA    . SER G 3  113 ? -32.644 -36.801 68.091 1.00 74.01  ? 113  SER G CA    1 
ATOM   5290  C  C     . SER G 3  113 ? -32.715 -36.192 69.473 1.00 75.99  ? 113  SER G C     1 
ATOM   5291  O  O     . SER G 3  113 ? -33.641 -36.500 70.217 1.00 82.78  ? 113  SER G O     1 
ATOM   5292  C  CB    . SER G 3  113 ? -31.781 -38.040 68.131 1.00 75.68  ? 113  SER G CB    1 
ATOM   5293  O  OG    . SER G 3  113 ? -30.436 -37.667 68.307 1.00 82.46  ? 113  SER G OG    1 
ATOM   5294  N  N     . VAL G 3  114 ? -31.763 -35.326 69.814 1.00 73.81  ? 114  VAL G N     1 
ATOM   5295  C  CA    . VAL G 3  114 ? -31.829 -34.585 71.082 1.00 74.61  ? 114  VAL G CA    1 
ATOM   5296  C  C     . VAL G 3  114 ? -33.121 -33.770 71.250 1.00 73.28  ? 114  VAL G C     1 
ATOM   5297  O  O     . VAL G 3  114 ? -33.430 -33.310 72.351 1.00 70.98  ? 114  VAL G O     1 
ATOM   5298  C  CB    . VAL G 3  114 ? -30.615 -33.655 71.279 1.00 75.07  ? 114  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3  114 ? -30.715 -32.438 70.370 1.00 79.06  ? 114  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3  114 ? -30.521 -33.218 72.736 1.00 67.85  ? 114  VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3  115 ? -33.865 -33.589 70.161 1.00 75.19  ? 115  LEU G N     1 
ATOM   5302  C  CA    . LEU G 3  115 ? -35.123 -32.837 70.212 1.00 79.31  ? 115  LEU G CA    1 
ATOM   5303  C  C     . LEU G 3  115 ? -36.332 -33.730 70.512 1.00 80.80  ? 115  LEU G C     1 
ATOM   5304  O  O     . LEU G 3  115 ? -37.418 -33.223 70.778 1.00 82.03  ? 115  LEU G O     1 
ATOM   5305  C  CB    . LEU G 3  115 ? -35.327 -31.990 68.935 1.00 75.31  ? 115  LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3  115 ? -34.233 -30.937 68.644 1.00 73.05  ? 115  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3  115 ? -34.399 -30.287 67.273 1.00 77.35  ? 115  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3  115 ? -34.159 -29.864 69.721 1.00 65.53  ? 115  LEU G CD2   1 
ATOM   5309  N  N     . LEU G 3  116 ? -36.132 -35.053 70.476 1.00 84.94  ? 116  LEU G N     1 
ATOM   5310  C  CA    . LEU G 3  116 ? -37.180 -36.036 70.799 1.00 80.43  ? 116  LEU G CA    1 
ATOM   5311  C  C     . LEU G 3  116 ? -37.449 -36.102 72.298 1.00 87.64  ? 116  LEU G C     1 
ATOM   5312  O  O     . LEU G 3  116 ? -36.507 -36.066 73.106 1.00 83.63  ? 116  LEU G O     1 
ATOM   5313  C  CB    . LEU G 3  116 ? -36.794 -37.425 70.306 1.00 74.29  ? 116  LEU G CB    1 
ATOM   5314  C  CG    . LEU G 3  116 ? -36.647 -37.617 68.800 1.00 80.99  ? 116  LEU G CG    1 
ATOM   5315  C  CD1   . LEU G 3  116 ? -35.964 -38.954 68.513 1.00 79.60  ? 116  LEU G CD1   1 
ATOM   5316  C  CD2   . LEU G 3  116 ? -37.992 -37.485 68.084 1.00 71.89  ? 116  LEU G CD2   1 
ATOM   5317  N  N     . PRO G 3  117 ? -38.740 -36.213 72.682 1.00 95.82  ? 117  PRO G N     1 
ATOM   5318  C  CA    . PRO G 3  117 ? -39.126 -36.293 74.099 1.00 95.53  ? 117  PRO G CA    1 
ATOM   5319  C  C     . PRO G 3  117 ? -38.581 -37.563 74.730 1.00 102.24 ? 117  PRO G C     1 
ATOM   5320  O  O     . PRO G 3  117 ? -38.365 -38.544 74.008 1.00 110.68 ? 117  PRO G O     1 
ATOM   5321  C  CB    . PRO G 3  117 ? -40.652 -36.364 74.043 1.00 91.53  ? 117  PRO G CB    1 
ATOM   5322  C  CG    . PRO G 3  117 ? -40.968 -36.926 72.696 1.00 93.87  ? 117  PRO G CG    1 
ATOM   5323  C  CD    . PRO G 3  117 ? -39.903 -36.383 71.786 1.00 98.20  ? 117  PRO G CD    1 
ATOM   5324  N  N     . LYS G 3  118 ? -38.374 -37.557 76.051 1.00 106.26 ? 118  LYS G N     1 
ATOM   5325  C  CA    . LYS G 3  118 ? -37.738 -38.705 76.742 1.00 117.84 ? 118  LYS G CA    1 
ATOM   5326  C  C     . LYS G 3  118 ? -38.647 -39.931 77.030 1.00 121.97 ? 118  LYS G C     1 
ATOM   5327  O  O     . LYS G 3  118 ? -39.822 -39.781 77.376 1.00 124.71 ? 118  LYS G O     1 
ATOM   5328  C  CB    . LYS G 3  118 ? -36.979 -38.233 77.990 1.00 118.35 ? 118  LYS G CB    1 
ATOM   5329  C  CG    . LYS G 3  118 ? -35.582 -37.725 77.649 1.00 124.29 ? 118  LYS G CG    1 
ATOM   5330  C  CD    . LYS G 3  118 ? -35.321 -36.322 78.181 1.00 130.64 ? 118  LYS G CD    1 
ATOM   5331  C  CE    . LYS G 3  118 ? -34.248 -35.607 77.359 1.00 121.82 ? 118  LYS G CE    1 
ATOM   5332  N  NZ    . LYS G 3  118 ? -34.006 -34.209 77.826 1.00 114.63 ? 118  LYS G NZ    1 
ATOM   5333  N  N     . LYS G 3  119 ? -38.089 -41.136 76.859 1.00 126.10 ? 119  LYS G N     1 
ATOM   5334  C  CA    . LYS G 3  119 ? -38.827 -42.404 77.040 1.00 124.81 ? 119  LYS G CA    1 
ATOM   5335  C  C     . LYS G 3  119 ? -39.043 -42.717 78.529 1.00 118.11 ? 119  LYS G C     1 
ATOM   5336  O  O     . LYS G 3  119 ? -40.158 -42.636 79.048 1.00 111.40 ? 119  LYS G O     1 
ATOM   5337  C  CB    . LYS G 3  119 ? -38.108 -43.601 76.367 1.00 123.44 ? 119  LYS G CB    1 
ATOM   5338  C  CG    . LYS G 3  119 ? -37.191 -43.285 75.182 1.00 120.05 ? 119  LYS G CG    1 
ATOM   5339  C  CD    . LYS G 3  119 ? -37.512 -44.140 73.956 1.00 117.73 ? 119  LYS G CD    1 
ATOM   5340  C  CE    . LYS G 3  119 ? -38.679 -43.533 73.182 1.00 112.93 ? 119  LYS G CE    1 
ATOM   5341  N  NZ    . LYS G 3  119 ? -38.979 -44.213 71.897 1.00 108.54 ? 119  LYS G NZ    1 
ATOM   5342  N  N     . LYS H 4  31  ? -46.630 -16.653 20.156 1.00 114.77 ? 28   LYS H N     1 
ATOM   5343  C  CA    . LYS H 4  31  ? -46.570 -17.104 18.729 1.00 115.57 ? 28   LYS H CA    1 
ATOM   5344  C  C     . LYS H 4  31  ? -45.269 -17.854 18.435 1.00 112.68 ? 28   LYS H C     1 
ATOM   5345  O  O     . LYS H 4  31  ? -45.301 -18.946 17.856 1.00 102.71 ? 28   LYS H O     1 
ATOM   5346  C  CB    . LYS H 4  31  ? -46.739 -15.916 17.770 1.00 110.44 ? 28   LYS H CB    1 
ATOM   5347  C  CG    . LYS H 4  31  ? -46.650 -16.260 16.289 1.00 111.79 ? 28   LYS H CG    1 
ATOM   5348  C  CD    . LYS H 4  31  ? -47.068 -15.082 15.418 1.00 118.46 ? 28   LYS H CD    1 
ATOM   5349  C  CE    . LYS H 4  31  ? -48.563 -14.785 15.532 1.00 113.61 ? 28   LYS H CE    1 
ATOM   5350  N  NZ    . LYS H 4  31  ? -48.973 -13.537 14.834 1.00 99.08  ? 28   LYS H NZ    1 
ATOM   5351  N  N     . THR H 4  32  ? -44.136 -17.268 18.834 1.00 106.76 ? 29   THR H N     1 
ATOM   5352  C  CA    . THR H 4  32  ? -42.836 -17.873 18.562 1.00 112.95 ? 29   THR H CA    1 
ATOM   5353  C  C     . THR H 4  32  ? -42.728 -19.219 19.278 1.00 118.06 ? 29   THR H C     1 
ATOM   5354  O  O     . THR H 4  32  ? -43.127 -19.351 20.439 1.00 114.71 ? 29   THR H O     1 
ATOM   5355  C  CB    . THR H 4  32  ? -41.644 -16.932 18.885 1.00 112.21 ? 29   THR H CB    1 
ATOM   5356  O  OG1   . THR H 4  32  ? -40.518 -17.292 18.072 1.00 103.05 ? 29   THR H OG1   1 
ATOM   5357  C  CG2   . THR H 4  32  ? -41.237 -16.998 20.362 1.00 112.83 ? 29   THR H CG2   1 
ATOM   5358  N  N     . ARG H 4  33  ? -42.220 -20.215 18.554 1.00 124.97 ? 30   ARG H N     1 
ATOM   5359  C  CA    . ARG H 4  33  ? -42.117 -21.587 19.048 1.00 122.19 ? 30   ARG H CA    1 
ATOM   5360  C  C     . ARG H 4  33  ? -41.179 -21.670 20.244 1.00 119.75 ? 30   ARG H C     1 
ATOM   5361  O  O     . ARG H 4  33  ? -40.002 -21.299 20.143 1.00 117.71 ? 30   ARG H O     1 
ATOM   5362  C  CB    . ARG H 4  33  ? -41.628 -22.512 17.933 1.00 115.60 ? 30   ARG H CB    1 
ATOM   5363  C  CG    . ARG H 4  33  ? -42.734 -23.025 17.028 1.00 122.73 ? 30   ARG H CG    1 
ATOM   5364  C  CD    . ARG H 4  33  ? -42.172 -23.625 15.750 1.00 133.58 ? 30   ARG H CD    1 
ATOM   5365  N  NE    . ARG H 4  33  ? -40.876 -24.279 15.958 1.00 141.44 ? 30   ARG H NE    1 
ATOM   5366  C  CZ    . ARG H 4  33  ? -40.707 -25.553 16.317 1.00 141.92 ? 30   ARG H CZ    1 
ATOM   5367  N  NH1   . ARG H 4  33  ? -41.752 -26.349 16.528 1.00 145.87 ? 30   ARG H NH1   1 
ATOM   5368  N  NH2   . ARG H 4  33  ? -39.482 -26.036 16.474 1.00 132.41 ? 30   ARG H NH2   1 
ATOM   5369  N  N     . LYS H 4  34  ? -41.705 -22.144 21.375 1.00 110.04 ? 31   LYS H N     1 
ATOM   5370  C  CA    . LYS H 4  34  ? -40.898 -22.284 22.589 1.00 108.48 ? 31   LYS H CA    1 
ATOM   5371  C  C     . LYS H 4  34  ? -40.468 -23.746 22.802 1.00 100.22 ? 31   LYS H C     1 
ATOM   5372  O  O     . LYS H 4  34  ? -41.255 -24.564 23.277 1.00 97.91  ? 31   LYS H O     1 
ATOM   5373  C  CB    . LYS H 4  34  ? -41.642 -21.717 23.816 1.00 107.85 ? 31   LYS H CB    1 
ATOM   5374  C  CG    . LYS H 4  34  ? -40.764 -20.938 24.804 1.00 119.24 ? 31   LYS H CG    1 
ATOM   5375  C  CD    . LYS H 4  34  ? -39.865 -21.831 25.670 1.00 123.54 ? 31   LYS H CD    1 
ATOM   5376  C  CE    . LYS H 4  34  ? -38.887 -21.037 26.538 1.00 121.51 ? 31   LYS H CE    1 
ATOM   5377  N  NZ    . LYS H 4  34  ? -37.654 -20.583 25.824 1.00 117.85 ? 31   LYS H NZ    1 
ATOM   5378  N  N     . GLU H 4  35  ? -39.223 -24.056 22.437 1.00 91.17  ? 32   GLU H N     1 
ATOM   5379  C  CA    . GLU H 4  35  ? -38.651 -25.397 22.572 1.00 92.39  ? 32   GLU H CA    1 
ATOM   5380  C  C     . GLU H 4  35  ? -38.519 -25.880 24.019 1.00 94.81  ? 32   GLU H C     1 
ATOM   5381  O  O     . GLU H 4  35  ? -38.528 -25.082 24.957 1.00 102.64 ? 32   GLU H O     1 
ATOM   5382  C  CB    . GLU H 4  35  ? -37.264 -25.423 21.972 1.00 94.98  ? 32   GLU H CB    1 
ATOM   5383  C  CG    . GLU H 4  35  ? -37.188 -25.770 20.505 1.00 99.27  ? 32   GLU H CG    1 
ATOM   5384  C  CD    . GLU H 4  35  ? -35.740 -25.948 20.093 1.00 107.77 ? 32   GLU H CD    1 
ATOM   5385  O  OE1   . GLU H 4  35  ? -35.480 -26.533 19.020 1.00 102.93 ? 32   GLU H OE1   1 
ATOM   5386  O  OE2   . GLU H 4  35  ? -34.854 -25.508 20.868 1.00 108.00 ? 32   GLU H OE2   1 
ATOM   5387  N  N     . SER H 4  36  ? -38.340 -27.191 24.173 1.00 88.80  ? 33   SER H N     1 
ATOM   5388  C  CA    . SER H 4  36  ? -38.347 -27.863 25.463 1.00 80.61  ? 33   SER H CA    1 
ATOM   5389  C  C     . SER H 4  36  ? -37.815 -29.266 25.244 1.00 83.12  ? 33   SER H C     1 
ATOM   5390  O  O     . SER H 4  36  ? -37.892 -29.780 24.131 1.00 84.63  ? 33   SER H O     1 
ATOM   5391  C  CB    . SER H 4  36  ? -39.780 -27.950 25.986 1.00 80.49  ? 33   SER H CB    1 
ATOM   5392  O  OG    . SER H 4  36  ? -39.847 -28.695 27.186 1.00 80.64  ? 33   SER H OG    1 
ATOM   5393  N  N     . TYR H 4  37  ? -37.276 -29.888 26.294 1.00 82.21  ? 34   TYR H N     1 
ATOM   5394  C  CA    . TYR H 4  37  ? -36.919 -31.320 26.245 1.00 73.04  ? 34   TYR H CA    1 
ATOM   5395  C  C     . TYR H 4  37  ? -38.102 -32.191 26.653 1.00 68.15  ? 34   TYR H C     1 
ATOM   5396  O  O     . TYR H 4  37  ? -37.983 -33.418 26.662 1.00 69.11  ? 34   TYR H O     1 
ATOM   5397  C  CB    . TYR H 4  37  ? -35.737 -31.638 27.159 1.00 68.38  ? 34   TYR H CB    1 
ATOM   5398  C  CG    . TYR H 4  37  ? -34.401 -31.113 26.704 1.00 70.37  ? 34   TYR H CG    1 
ATOM   5399  C  CD1   . TYR H 4  37  ? -33.903 -29.910 27.184 1.00 69.86  ? 34   TYR H CD1   1 
ATOM   5400  C  CD2   . TYR H 4  37  ? -33.612 -31.841 25.811 1.00 70.11  ? 34   TYR H CD2   1 
ATOM   5401  C  CE1   . TYR H 4  37  ? -32.662 -29.435 26.769 1.00 71.43  ? 34   TYR H CE1   1 
ATOM   5402  C  CE2   . TYR H 4  37  ? -32.379 -31.372 25.390 1.00 63.63  ? 34   TYR H CE2   1 
ATOM   5403  C  CZ    . TYR H 4  37  ? -31.911 -30.174 25.869 1.00 67.04  ? 34   TYR H CZ    1 
ATOM   5404  O  OH    . TYR H 4  37  ? -30.680 -29.718 25.458 1.00 74.37  ? 34   TYR H OH    1 
ATOM   5405  N  N     . ALA H 4  38  ? -39.237 -31.548 26.962 1.00 70.08  ? 35   ALA H N     1 
ATOM   5406  C  CA    . ALA H 4  38  ? -40.409 -32.203 27.580 1.00 73.68  ? 35   ALA H CA    1 
ATOM   5407  C  C     . ALA H 4  38  ? -40.852 -33.549 26.977 1.00 78.24  ? 35   ALA H C     1 
ATOM   5408  O  O     . ALA H 4  38  ? -41.134 -34.494 27.725 1.00 79.39  ? 35   ALA H O     1 
ATOM   5409  C  CB    . ALA H 4  38  ? -41.586 -31.240 27.691 1.00 64.57  ? 35   ALA H CB    1 
ATOM   5410  N  N     . ILE H 4  39  ? -40.898 -33.650 25.648 1.00 80.54  ? 36   ILE H N     1 
ATOM   5411  C  CA    . ILE H 4  39  ? -41.350 -34.899 24.992 1.00 88.75  ? 36   ILE H CA    1 
ATOM   5412  C  C     . ILE H 4  39  ? -40.353 -36.055 25.065 1.00 87.24  ? 36   ILE H C     1 
ATOM   5413  O  O     . ILE H 4  39  ? -40.758 -37.217 25.193 1.00 87.33  ? 36   ILE H O     1 
ATOM   5414  C  CB    . ILE H 4  39  ? -41.806 -34.708 23.519 1.00 89.37  ? 36   ILE H CB    1 
ATOM   5415  C  CG1   . ILE H 4  39  ? -40.961 -33.639 22.828 1.00 83.25  ? 36   ILE H CG1   1 
ATOM   5416  C  CG2   . ILE H 4  39  ? -43.304 -34.393 23.456 1.00 89.66  ? 36   ILE H CG2   1 
ATOM   5417  C  CD1   . ILE H 4  39  ? -40.664 -33.969 21.392 1.00 82.88  ? 36   ILE H CD1   1 
ATOM   5418  N  N     . TYR H 4  40  ? -39.063 -35.736 24.977 1.00 81.92  ? 37   TYR H N     1 
ATOM   5419  C  CA    . TYR H 4  40  ? -38.010 -36.727 25.168 1.00 80.18  ? 37   TYR H CA    1 
ATOM   5420  C  C     . TYR H 4  40  ? -37.963 -37.219 26.612 1.00 82.50  ? 37   TYR H C     1 
ATOM   5421  O  O     . TYR H 4  40  ? -37.803 -38.419 26.869 1.00 79.81  ? 37   TYR H O     1 
ATOM   5422  C  CB    . TYR H 4  40  ? -36.672 -36.144 24.793 1.00 81.76  ? 37   TYR H CB    1 
ATOM   5423  C  CG    . TYR H 4  40  ? -36.723 -35.349 23.527 1.00 93.95  ? 37   TYR H CG    1 
ATOM   5424  C  CD1   . TYR H 4  40  ? -36.785 -33.964 23.562 1.00 99.55  ? 37   TYR H CD1   1 
ATOM   5425  C  CD2   . TYR H 4  40  ? -36.723 -35.982 22.283 1.00 102.49 ? 37   TYR H CD2   1 
ATOM   5426  C  CE1   . TYR H 4  40  ? -36.837 -33.227 22.393 1.00 108.16 ? 37   TYR H CE1   1 
ATOM   5427  C  CE2   . TYR H 4  40  ? -36.768 -35.257 21.105 1.00 103.40 ? 37   TYR H CE2   1 
ATOM   5428  C  CZ    . TYR H 4  40  ? -36.828 -33.880 21.164 1.00 105.42 ? 37   TYR H CZ    1 
ATOM   5429  O  OH    . TYR H 4  40  ? -36.875 -33.156 19.994 1.00 105.43 ? 37   TYR H OH    1 
ATOM   5430  N  N     . VAL H 4  41  ? -38.116 -36.295 27.558 1.00 75.84  ? 38   VAL H N     1 
ATOM   5431  C  CA    . VAL H 4  41  ? -38.251 -36.680 28.954 1.00 75.72  ? 38   VAL H CA    1 
ATOM   5432  C  C     . VAL H 4  41  ? -39.422 -37.660 29.077 1.00 84.12  ? 38   VAL H C     1 
ATOM   5433  O  O     . VAL H 4  41  ? -39.308 -38.698 29.747 1.00 80.88  ? 38   VAL H O     1 
ATOM   5434  C  CB    . VAL H 4  41  ? -38.451 -35.452 29.865 1.00 74.11  ? 38   VAL H CB    1 
ATOM   5435  C  CG1   . VAL H 4  41  ? -38.969 -35.852 31.242 1.00 68.66  ? 38   VAL H CG1   1 
ATOM   5436  C  CG2   . VAL H 4  41  ? -37.146 -34.682 29.992 1.00 77.78  ? 38   VAL H CG2   1 
ATOM   5437  N  N     . TYR H 4  42  ? -40.526 -37.331 28.398 1.00 86.47  ? 39   TYR H N     1 
ATOM   5438  C  CA    . TYR H 4  42  ? -41.755 -38.115 28.455 1.00 80.85  ? 39   TYR H CA    1 
ATOM   5439  C  C     . TYR H 4  42  ? -41.573 -39.489 27.813 1.00 79.26  ? 39   TYR H C     1 
ATOM   5440  O  O     . TYR H 4  42  ? -42.080 -40.488 28.318 1.00 77.03  ? 39   TYR H O     1 
ATOM   5441  C  CB    . TYR H 4  42  ? -42.928 -37.352 27.823 1.00 86.56  ? 39   TYR H CB    1 
ATOM   5442  C  CG    . TYR H 4  42  ? -44.283 -37.905 28.220 1.00 91.80  ? 39   TYR H CG    1 
ATOM   5443  C  CD1   . TYR H 4  42  ? -44.897 -37.520 29.424 1.00 90.20  ? 39   TYR H CD1   1 
ATOM   5444  C  CD2   . TYR H 4  42  ? -44.947 -38.824 27.397 1.00 95.06  ? 39   TYR H CD2   1 
ATOM   5445  C  CE1   . TYR H 4  42  ? -46.126 -38.040 29.801 1.00 97.14  ? 39   TYR H CE1   1 
ATOM   5446  C  CE2   . TYR H 4  42  ? -46.174 -39.349 27.760 1.00 98.17  ? 39   TYR H CE2   1 
ATOM   5447  C  CZ    . TYR H 4  42  ? -46.760 -38.956 28.961 1.00 104.71 ? 39   TYR H CZ    1 
ATOM   5448  O  OH    . TYR H 4  42  ? -47.985 -39.475 29.320 1.00 109.44 ? 39   TYR H OH    1 
ATOM   5449  N  N     . LYS H 4  43  ? -40.830 -39.550 26.716 1.00 79.74  ? 40   LYS H N     1 
ATOM   5450  C  CA    . LYS H 4  43  ? -40.568 -40.838 26.090 1.00 78.49  ? 40   LYS H CA    1 
ATOM   5451  C  C     . LYS H 4  43  ? -39.801 -41.705 27.056 1.00 77.38  ? 40   LYS H C     1 
ATOM   5452  O  O     . LYS H 4  43  ? -40.152 -42.863 27.261 1.00 89.21  ? 40   LYS H O     1 
ATOM   5453  C  CB    . LYS H 4  43  ? -39.798 -40.696 24.781 1.00 79.46  ? 40   LYS H CB    1 
ATOM   5454  C  CG    . LYS H 4  43  ? -40.608 -40.106 23.642 1.00 81.84  ? 40   LYS H CG    1 
ATOM   5455  C  CD    . LYS H 4  43  ? -39.729 -39.948 22.412 1.00 84.73  ? 40   LYS H CD    1 
ATOM   5456  C  CE    . LYS H 4  43  ? -40.483 -39.356 21.231 1.00 87.19  ? 40   LYS H CE    1 
ATOM   5457  N  NZ    . LYS H 4  43  ? -39.516 -38.820 20.225 1.00 88.31  ? 40   LYS H NZ    1 
ATOM   5458  N  N     . VAL H 4  44  ? -38.771 -41.134 27.671 1.00 84.00  ? 41   VAL H N     1 
ATOM   5459  C  CA    . VAL H 4  44  ? -37.935 -41.877 28.625 1.00 82.61  ? 41   VAL H CA    1 
ATOM   5460  C  C     . VAL H 4  44  ? -38.712 -42.312 29.886 1.00 84.00  ? 41   VAL H C     1 
ATOM   5461  O  O     . VAL H 4  44  ? -38.488 -43.404 30.418 1.00 80.17  ? 41   VAL H O     1 
ATOM   5462  C  CB    . VAL H 4  44  ? -36.669 -41.093 29.020 1.00 77.85  ? 41   VAL H CB    1 
ATOM   5463  C  CG1   . VAL H 4  44  ? -35.682 -42.027 29.694 1.00 78.71  ? 41   VAL H CG1   1 
ATOM   5464  C  CG2   . VAL H 4  44  ? -36.009 -40.466 27.800 1.00 77.40  ? 41   VAL H CG2   1 
ATOM   5465  N  N     . LEU H 4  45  ? -39.630 -41.463 30.349 1.00 82.80  ? 42   LEU H N     1 
ATOM   5466  C  CA    . LEU H 4  45  ? -40.506 -41.809 31.459 1.00 79.99  ? 42   LEU H CA    1 
ATOM   5467  C  C     . LEU H 4  45  ? -41.202 -43.133 31.183 1.00 91.71  ? 42   LEU H C     1 
ATOM   5468  O  O     . LEU H 4  45  ? -41.186 -44.036 32.020 1.00 101.02 ? 42   LEU H O     1 
ATOM   5469  C  CB    . LEU H 4  45  ? -41.535 -40.700 31.710 1.00 75.38  ? 42   LEU H CB    1 
ATOM   5470  C  CG    . LEU H 4  45  ? -42.622 -40.915 32.782 1.00 79.60  ? 42   LEU H CG    1 
ATOM   5471  C  CD1   . LEU H 4  45  ? -42.076 -41.365 34.134 1.00 73.76  ? 42   LEU H CD1   1 
ATOM   5472  C  CD2   . LEU H 4  45  ? -43.518 -39.689 32.964 1.00 82.47  ? 42   LEU H CD2   1 
ATOM   5473  N  N     . LYS H 4  46  ? -41.790 -43.245 29.995 1.00 97.91  ? 43   LYS H N     1 
ATOM   5474  C  CA    . LYS H 4  46  ? -42.570 -44.416 29.626 1.00 91.69  ? 43   LYS H CA    1 
ATOM   5475  C  C     . LYS H 4  46  ? -41.752 -45.713 29.608 1.00 89.93  ? 43   LYS H C     1 
ATOM   5476  O  O     . LYS H 4  46  ? -42.211 -46.731 30.124 1.00 88.00  ? 43   LYS H O     1 
ATOM   5477  C  CB    . LYS H 4  46  ? -43.305 -44.157 28.312 1.00 93.59  ? 43   LYS H CB    1 
ATOM   5478  C  CG    . LYS H 4  46  ? -44.452 -43.162 28.468 1.00 87.97  ? 43   LYS H CG    1 
ATOM   5479  C  CD    . LYS H 4  46  ? -45.469 -43.696 29.459 1.00 86.09  ? 43   LYS H CD    1 
ATOM   5480  C  CE    . LYS H 4  46  ? -45.978 -42.597 30.364 1.00 85.85  ? 43   LYS H CE    1 
ATOM   5481  N  NZ    . LYS H 4  46  ? -46.886 -43.132 31.421 1.00 86.22  ? 43   LYS H NZ    1 
ATOM   5482  N  N     . GLN H 4  47  ? -40.538 -45.662 29.058 1.00 87.23  ? 44   GLN H N     1 
ATOM   5483  C  CA    . GLN H 4  47  ? -39.622 -46.805 29.105 1.00 89.45  ? 44   GLN H CA    1 
ATOM   5484  C  C     . GLN H 4  47  ? -39.369 -47.232 30.547 1.00 90.75  ? 44   GLN H C     1 
ATOM   5485  O  O     . GLN H 4  47  ? -39.285 -48.413 30.866 1.00 100.73 ? 44   GLN H O     1 
ATOM   5486  C  CB    . GLN H 4  47  ? -38.283 -46.457 28.468 1.00 91.38  ? 44   GLN H CB    1 
ATOM   5487  C  CG    . GLN H 4  47  ? -38.277 -46.388 26.951 1.00 103.69 ? 44   GLN H CG    1 
ATOM   5488  C  CD    . GLN H 4  47  ? -36.856 -46.334 26.379 1.00 116.51 ? 44   GLN H CD    1 
ATOM   5489  O  OE1   . GLN H 4  47  ? -35.878 -46.718 27.038 1.00 108.49 ? 44   GLN H OE1   1 
ATOM   5490  N  NE2   . GLN H 4  47  ? -36.740 -45.862 25.143 1.00 120.35 ? 44   GLN H NE2   1 
ATOM   5491  N  N     . VAL H 4  48  ? -39.264 -46.252 31.424 1.00 87.85  ? 45   VAL H N     1 
ATOM   5492  C  CA    . VAL H 4  48  ? -38.840 -46.506 32.785 1.00 85.00  ? 45   VAL H CA    1 
ATOM   5493  C  C     . VAL H 4  48  ? -40.020 -46.866 33.685 1.00 80.88  ? 45   VAL H C     1 
ATOM   5494  O  O     . VAL H 4  48  ? -39.897 -47.715 34.553 1.00 84.34  ? 45   VAL H O     1 
ATOM   5495  C  CB    . VAL H 4  48  ? -38.049 -45.296 33.333 1.00 81.10  ? 45   VAL H CB    1 
ATOM   5496  C  CG1   . VAL H 4  48  ? -37.808 -45.438 34.812 1.00 80.45  ? 45   VAL H CG1   1 
ATOM   5497  C  CG2   . VAL H 4  48  ? -36.716 -45.166 32.618 1.00 75.62  ? 45   VAL H CG2   1 
ATOM   5498  N  N     . HIS H 4  49  ? -41.154 -46.215 33.470 1.00 81.81  ? 46   HIS H N     1 
ATOM   5499  C  CA    . HIS H 4  49  ? -42.349 -46.435 34.275 1.00 92.74  ? 46   HIS H CA    1 
ATOM   5500  C  C     . HIS H 4  49  ? -43.566 -46.238 33.398 1.00 97.87  ? 46   HIS H C     1 
ATOM   5501  O  O     . HIS H 4  49  ? -44.180 -45.161 33.438 1.00 102.15 ? 46   HIS H O     1 
ATOM   5502  C  CB    . HIS H 4  49  ? -42.400 -45.426 35.423 1.00 96.78  ? 46   HIS H CB    1 
ATOM   5503  C  CG    . HIS H 4  49  ? -41.607 -45.817 36.652 1.00 96.09  ? 46   HIS H CG    1 
ATOM   5504  N  ND1   . HIS H 4  49  ? -42.195 -46.283 37.772 1.00 100.65 ? 46   HIS H ND1   1 
ATOM   5505  C  CD2   . HIS H 4  49  ? -40.244 -45.734 36.931 1.00 90.71  ? 46   HIS H CD2   1 
ATOM   5506  C  CE1   . HIS H 4  49  ? -41.257 -46.522 38.706 1.00 96.12  ? 46   HIS H CE1   1 
ATOM   5507  N  NE2   . HIS H 4  49  ? -40.061 -46.186 38.187 1.00 94.30  ? 46   HIS H NE2   1 
ATOM   5508  N  N     . PRO H 4  50  ? -43.953 -47.265 32.601 1.00 94.58  ? 47   PRO H N     1 
ATOM   5509  C  CA    . PRO H 4  50  ? -44.987 -47.048 31.569 1.00 90.91  ? 47   PRO H CA    1 
ATOM   5510  C  C     . PRO H 4  50  ? -46.368 -46.638 32.114 1.00 88.77  ? 47   PRO H C     1 
ATOM   5511  O  O     . PRO H 4  50  ? -47.113 -45.969 31.407 1.00 88.17  ? 47   PRO H O     1 
ATOM   5512  C  CB    . PRO H 4  50  ? -45.044 -48.387 30.829 1.00 85.91  ? 47   PRO H CB    1 
ATOM   5513  C  CG    . PRO H 4  50  ? -43.801 -49.117 31.241 1.00 88.31  ? 47   PRO H CG    1 
ATOM   5514  C  CD    . PRO H 4  50  ? -43.519 -48.669 32.636 1.00 87.72  ? 47   PRO H CD    1 
ATOM   5515  N  N     . ASP H 4  51  ? -46.679 -46.996 33.360 1.00 89.93  ? 48   ASP H N     1 
ATOM   5516  C  CA    . ASP H 4  51  ? -47.953 -46.611 34.006 1.00 101.21 ? 48   ASP H CA    1 
ATOM   5517  C  C     . ASP H 4  51  ? -47.917 -45.282 34.801 1.00 100.30 ? 48   ASP H C     1 
ATOM   5518  O  O     . ASP H 4  51  ? -48.912 -44.920 35.460 1.00 89.83  ? 48   ASP H O     1 
ATOM   5519  C  CB    . ASP H 4  51  ? -48.443 -47.720 34.960 1.00 110.99 ? 48   ASP H CB    1 
ATOM   5520  C  CG    . ASP H 4  51  ? -48.467 -49.096 34.320 1.00 115.93 ? 48   ASP H CG    1 
ATOM   5521  O  OD1   . ASP H 4  51  ? -49.101 -49.261 33.254 1.00 119.61 ? 48   ASP H OD1   1 
ATOM   5522  O  OD2   . ASP H 4  51  ? -47.865 -50.023 34.907 1.00 117.67 ? 48   ASP H OD2   1 
ATOM   5523  N  N     . THR H 4  52  ? -46.781 -44.578 34.764 1.00 94.75  ? 49   THR H N     1 
ATOM   5524  C  CA    . THR H 4  52  ? -46.596 -43.387 35.603 1.00 89.01  ? 49   THR H CA    1 
ATOM   5525  C  C     . THR H 4  52  ? -46.599 -42.099 34.776 1.00 87.15  ? 49   THR H C     1 
ATOM   5526  O  O     . THR H 4  52  ? -46.008 -42.062 33.701 1.00 79.95  ? 49   THR H O     1 
ATOM   5527  C  CB    . THR H 4  52  ? -45.313 -43.473 36.458 1.00 89.32  ? 49   THR H CB    1 
ATOM   5528  O  OG1   . THR H 4  52  ? -45.297 -44.696 37.198 1.00 88.32  ? 49   THR H OG1   1 
ATOM   5529  C  CG2   . THR H 4  52  ? -45.247 -42.332 37.443 1.00 88.15  ? 49   THR H CG2   1 
ATOM   5530  N  N     . GLY H 4  53  ? -47.283 -41.068 35.293 1.00 87.70  ? 50   GLY H N     1 
ATOM   5531  C  CA    . GLY H 4  53  ? -47.437 -39.756 34.641 1.00 84.06  ? 50   GLY H CA    1 
ATOM   5532  C  C     . GLY H 4  53  ? -46.587 -38.696 35.320 1.00 85.09  ? 50   GLY H C     1 
ATOM   5533  O  O     . GLY H 4  53  ? -45.810 -38.995 36.218 1.00 91.48  ? 50   GLY H O     1 
ATOM   5534  N  N     . ILE H 4  54  ? -46.728 -37.453 34.895 1.00 79.15  ? 51   ILE H N     1 
ATOM   5535  C  CA    . ILE H 4  54  ? -45.882 -36.389 35.404 1.00 78.74  ? 51   ILE H CA    1 
ATOM   5536  C  C     . ILE H 4  54  ? -46.607 -35.056 35.357 1.00 77.48  ? 51   ILE H C     1 
ATOM   5537  O  O     . ILE H 4  54  ? -47.202 -34.709 34.338 1.00 77.93  ? 51   ILE H O     1 
ATOM   5538  C  CB    . ILE H 4  54  ? -44.539 -36.320 34.625 1.00 83.49  ? 51   ILE H CB    1 
ATOM   5539  C  CG1   . ILE H 4  54  ? -43.574 -35.321 35.281 1.00 79.04  ? 51   ILE H CG1   1 
ATOM   5540  C  CG2   . ILE H 4  54  ? -44.760 -36.037 33.138 1.00 80.29  ? 51   ILE H CG2   1 
ATOM   5541  C  CD1   . ILE H 4  54  ? -42.134 -35.490 34.842 1.00 70.88  ? 51   ILE H CD1   1 
ATOM   5542  N  N     . SER H 4  55  ? -46.551 -34.317 36.464 1.00 76.25  ? 52   SER H N     1 
ATOM   5543  C  CA    . SER H 4  55  ? -47.196 -33.005 36.553 1.00 72.98  ? 52   SER H CA    1 
ATOM   5544  C  C     . SER H 4  55  ? -46.462 -31.976 35.687 1.00 72.47  ? 52   SER H C     1 
ATOM   5545  O  O     . SER H 4  55  ? -45.290 -32.172 35.331 1.00 67.00  ? 52   SER H O     1 
ATOM   5546  C  CB    . SER H 4  55  ? -47.277 -32.532 38.012 1.00 73.06  ? 52   SER H CB    1 
ATOM   5547  O  OG    . SER H 4  55  ? -46.105 -31.844 38.425 1.00 67.30  ? 52   SER H OG    1 
ATOM   5548  N  N     . SER H 4  56  ? -47.156 -30.896 35.331 1.00 71.54  ? 53   SER H N     1 
ATOM   5549  C  CA    . SER H 4  56  ? -46.518 -29.806 34.606 1.00 76.06  ? 53   SER H CA    1 
ATOM   5550  C  C     . SER H 4  56  ? -45.297 -29.319 35.349 1.00 75.98  ? 53   SER H C     1 
ATOM   5551  O  O     . SER H 4  56  ? -44.201 -29.315 34.789 1.00 76.01  ? 53   SER H O     1 
ATOM   5552  C  CB    . SER H 4  56  ? -47.475 -28.643 34.398 1.00 78.10  ? 53   SER H CB    1 
ATOM   5553  O  OG    . SER H 4  56  ? -47.765 -28.534 33.027 1.00 96.45  ? 53   SER H OG    1 
ATOM   5554  N  N     . LYS H 4  57  ? -45.495 -28.936 36.615 1.00 70.39  ? 54   LYS H N     1 
ATOM   5555  C  CA    . LYS H 4  57  ? -44.422 -28.408 37.437 1.00 69.68  ? 54   LYS H CA    1 
ATOM   5556  C  C     . LYS H 4  57  ? -43.236 -29.371 37.474 1.00 76.93  ? 54   LYS H C     1 
ATOM   5557  O  O     . LYS H 4  57  ? -42.087 -28.961 37.274 1.00 86.66  ? 54   LYS H O     1 
ATOM   5558  C  CB    . LYS H 4  57  ? -44.927 -28.037 38.835 1.00 74.94  ? 54   LYS H CB    1 
ATOM   5559  C  CG    . LYS H 4  57  ? -45.612 -26.671 38.884 1.00 90.26  ? 54   LYS H CG    1 
ATOM   5560  C  CD    . LYS H 4  57  ? -46.789 -26.591 39.862 1.00 95.47  ? 54   LYS H CD    1 
ATOM   5561  C  CE    . LYS H 4  57  ? -47.500 -25.243 39.741 1.00 100.44 ? 54   LYS H CE    1 
ATOM   5562  N  NZ    . LYS H 4  57  ? -48.959 -25.289 40.052 1.00 99.47  ? 54   LYS H NZ    1 
ATOM   5563  N  N     . ALA H 4  58  ? -43.506 -30.657 37.675 1.00 71.43  ? 55   ALA H N     1 
ATOM   5564  C  CA    . ALA H 4  58  ? -42.445 -31.644 37.616 1.00 64.52  ? 55   ALA H CA    1 
ATOM   5565  C  C     . ALA H 4  58  ? -41.714 -31.632 36.273 1.00 63.30  ? 55   ALA H C     1 
ATOM   5566  O  O     . ALA H 4  58  ? -40.498 -31.716 36.217 1.00 66.46  ? 55   ALA H O     1 
ATOM   5567  C  CB    . ALA H 4  58  ? -42.980 -33.021 37.930 1.00 63.78  ? 55   ALA H CB    1 
ATOM   5568  N  N     . MET H 4  59  ? -42.449 -31.509 35.184 1.00 67.07  ? 56   MET H N     1 
ATOM   5569  C  CA    . MET H 4  59  ? -41.814 -31.571 33.872 1.00 68.25  ? 56   MET H CA    1 
ATOM   5570  C  C     . MET H 4  59  ? -40.914 -30.354 33.628 1.00 68.60  ? 56   MET H C     1 
ATOM   5571  O  O     . MET H 4  59  ? -39.824 -30.458 33.036 1.00 64.86  ? 56   MET H O     1 
ATOM   5572  C  CB    . MET H 4  59  ? -42.865 -31.683 32.782 1.00 65.52  ? 56   MET H CB    1 
ATOM   5573  C  CG    . MET H 4  59  ? -42.272 -31.631 31.393 1.00 67.40  ? 56   MET H CG    1 
ATOM   5574  S  SD    . MET H 4  59  ? -41.241 -33.066 31.076 1.00 72.03  ? 56   MET H SD    1 
ATOM   5575  C  CE    . MET H 4  59  ? -42.498 -34.296 30.763 1.00 71.22  ? 56   MET H CE    1 
ATOM   5576  N  N     . SER H 4  60  ? -41.380 -29.202 34.098 1.00 64.70  ? 57   SER H N     1 
ATOM   5577  C  CA    . SER H 4  60  ? -40.597 -27.981 34.064 1.00 65.01  ? 57   SER H CA    1 
ATOM   5578  C  C     . SER H 4  60  ? -39.247 -28.212 34.777 1.00 67.29  ? 57   SER H C     1 
ATOM   5579  O  O     . SER H 4  60  ? -38.188 -27.938 34.215 1.00 64.72  ? 57   SER H O     1 
ATOM   5580  C  CB    . SER H 4  60  ? -41.395 -26.847 34.714 1.00 64.89  ? 57   SER H CB    1 
ATOM   5581  O  OG    . SER H 4  60  ? -41.023 -25.595 34.185 1.00 75.49  ? 57   SER H OG    1 
ATOM   5582  N  N     . ILE H 4  61  ? -39.296 -28.759 35.997 1.00 66.71  ? 58   ILE H N     1 
ATOM   5583  C  CA    . ILE H 4  61  ? -38.095 -29.100 36.769 1.00 61.26  ? 58   ILE H CA    1 
ATOM   5584  C  C     . ILE H 4  61  ? -37.152 -30.030 36.024 1.00 64.17  ? 58   ILE H C     1 
ATOM   5585  O  O     . ILE H 4  61  ? -35.942 -29.824 36.003 1.00 69.36  ? 58   ILE H O     1 
ATOM   5586  C  CB    . ILE H 4  61  ? -38.464 -29.734 38.114 1.00 61.32  ? 58   ILE H CB    1 
ATOM   5587  C  CG1   . ILE H 4  61  ? -38.938 -28.643 39.071 1.00 63.63  ? 58   ILE H CG1   1 
ATOM   5588  C  CG2   . ILE H 4  61  ? -37.251 -30.389 38.733 1.00 61.42  ? 58   ILE H CG2   1 
ATOM   5589  C  CD1   . ILE H 4  61  ? -40.006 -29.092 40.032 1.00 67.31  ? 58   ILE H CD1   1 
ATOM   5590  N  N     . MET H 4  62  ? -37.713 -31.062 35.411 1.00 68.49  ? 59   MET H N     1 
ATOM   5591  C  CA    . MET H 4  62  ? -36.939 -31.976 34.588 1.00 65.71  ? 59   MET H CA    1 
ATOM   5592  C  C     . MET H 4  62  ? -36.287 -31.246 33.433 1.00 62.20  ? 59   MET H C     1 
ATOM   5593  O  O     . MET H 4  62  ? -35.187 -31.575 33.004 1.00 61.82  ? 59   MET H O     1 
ATOM   5594  C  CB    . MET H 4  62  ? -37.835 -33.092 34.065 1.00 66.52  ? 59   MET H CB    1 
ATOM   5595  C  CG    . MET H 4  62  ? -38.240 -34.102 35.133 1.00 63.95  ? 59   MET H CG    1 
ATOM   5596  S  SD    . MET H 4  62  ? -36.829 -34.862 35.962 1.00 67.00  ? 59   MET H SD    1 
ATOM   5597  C  CE    . MET H 4  62  ? -35.884 -35.497 34.582 1.00 56.59  ? 59   MET H CE    1 
ATOM   5598  N  N     . ASN H 4  63  ? -36.969 -30.233 32.937 1.00 64.15  ? 60   ASN H N     1 
ATOM   5599  C  CA    . ASN H 4  63  ? -36.452 -29.505 31.810 1.00 65.43  ? 60   ASN H CA    1 
ATOM   5600  C  C     . ASN H 4  63  ? -35.260 -28.652 32.259 1.00 64.01  ? 60   ASN H C     1 
ATOM   5601  O  O     . ASN H 4  63  ? -34.193 -28.676 31.623 1.00 65.30  ? 60   ASN H O     1 
ATOM   5602  C  CB    . ASN H 4  63  ? -37.568 -28.678 31.174 1.00 66.08  ? 60   ASN H CB    1 
ATOM   5603  C  CG    . ASN H 4  63  ? -37.232 -28.256 29.776 1.00 65.49  ? 60   ASN H CG    1 
ATOM   5604  O  OD1   . ASN H 4  63  ? -36.725 -29.056 28.999 1.00 67.67  ? 60   ASN H OD1   1 
ATOM   5605  N  ND2   . ASN H 4  63  ? -37.486 -26.987 29.449 1.00 64.42  ? 60   ASN H ND2   1 
ATOM   5606  N  N     . SER H 4  64  ? -35.435 -27.941 33.377 1.00 61.82  ? 61   SER H N     1 
ATOM   5607  C  CA    . SER H 4  64  ? -34.344 -27.189 34.023 1.00 63.52  ? 61   SER H CA    1 
ATOM   5608  C  C     . SER H 4  64  ? -33.129 -28.083 34.168 1.00 64.34  ? 61   SER H C     1 
ATOM   5609  O  O     . SER H 4  64  ? -32.033 -27.765 33.660 1.00 66.00  ? 61   SER H O     1 
ATOM   5610  C  CB    . SER H 4  64  ? -34.750 -26.688 35.404 1.00 59.57  ? 61   SER H CB    1 
ATOM   5611  O  OG    . SER H 4  64  ? -35.887 -25.857 35.316 1.00 69.32  ? 61   SER H OG    1 
ATOM   5612  N  N     . PHE H 4  65  ? -33.347 -29.223 34.824 1.00 61.89  ? 62   PHE H N     1 
ATOM   5613  C  CA    . PHE H 4  65  ? -32.297 -30.200 35.029 1.00 60.90  ? 62   PHE H CA    1 
ATOM   5614  C  C     . PHE H 4  65  ? -31.463 -30.497 33.771 1.00 64.66  ? 62   PHE H C     1 
ATOM   5615  O  O     . PHE H 4  65  ? -30.216 -30.401 33.815 1.00 60.26  ? 62   PHE H O     1 
ATOM   5616  C  CB    . PHE H 4  65  ? -32.874 -31.483 35.573 1.00 60.16  ? 62   PHE H CB    1 
ATOM   5617  C  CG    . PHE H 4  65  ? -31.852 -32.552 35.734 1.00 64.83  ? 62   PHE H CG    1 
ATOM   5618  C  CD1   . PHE H 4  65  ? -30.964 -32.512 36.806 1.00 66.03  ? 62   PHE H CD1   1 
ATOM   5619  C  CD2   . PHE H 4  65  ? -31.752 -33.582 34.804 1.00 59.98  ? 62   PHE H CD2   1 
ATOM   5620  C  CE1   . PHE H 4  65  ? -30.003 -33.495 36.953 1.00 67.56  ? 62   PHE H CE1   1 
ATOM   5621  C  CE2   . PHE H 4  65  ? -30.794 -34.561 34.946 1.00 60.53  ? 62   PHE H CE2   1 
ATOM   5622  C  CZ    . PHE H 4  65  ? -29.918 -34.519 36.016 1.00 65.70  ? 62   PHE H CZ    1 
ATOM   5623  N  N     . VAL H 4  66  ? -32.144 -30.837 32.665 1.00 59.37  ? 63   VAL H N     1 
ATOM   5624  C  CA    . VAL H 4  66  ? -31.445 -31.153 31.426 1.00 59.91  ? 63   VAL H CA    1 
ATOM   5625  C  C     . VAL H 4  66  ? -30.627 -29.949 30.956 1.00 61.79  ? 63   VAL H C     1 
ATOM   5626  O  O     . VAL H 4  66  ? -29.415 -30.072 30.688 1.00 62.69  ? 63   VAL H O     1 
ATOM   5627  C  CB    . VAL H 4  66  ? -32.381 -31.698 30.319 1.00 60.54  ? 63   VAL H CB    1 
ATOM   5628  C  CG1   . VAL H 4  66  ? -31.588 -32.072 29.075 1.00 55.45  ? 63   VAL H CG1   1 
ATOM   5629  C  CG2   . VAL H 4  66  ? -33.138 -32.926 30.807 1.00 58.90  ? 63   VAL H CG2   1 
ATOM   5630  N  N     . ASN H 4  67  ? -31.268 -28.782 30.907 1.00 60.87  ? 64   ASN H N     1 
ATOM   5631  C  CA    . ASN H 4  67  ? -30.573 -27.548 30.513 1.00 61.47  ? 64   ASN H CA    1 
ATOM   5632  C  C     . ASN H 4  67  ? -29.368 -27.219 31.376 1.00 60.26  ? 64   ASN H C     1 
ATOM   5633  O  O     . ASN H 4  67  ? -28.311 -26.818 30.858 1.00 59.62  ? 64   ASN H O     1 
ATOM   5634  C  CB    . ASN H 4  67  ? -31.532 -26.372 30.519 1.00 64.55  ? 64   ASN H CB    1 
ATOM   5635  C  CG    . ASN H 4  67  ? -32.413 -26.358 29.299 1.00 67.31  ? 64   ASN H CG    1 
ATOM   5636  O  OD1   . ASN H 4  67  ? -31.927 -26.519 28.169 1.00 69.18  ? 64   ASN H OD1   1 
ATOM   5637  N  ND2   . ASN H 4  67  ? -33.720 -26.213 29.514 1.00 66.57  ? 64   ASN H ND2   1 
ATOM   5638  N  N     . ASP H 4  68  ? -29.537 -27.397 32.685 1.00 51.61  ? 65   ASP H N     1 
ATOM   5639  C  CA    . ASP H 4  68  ? -28.477 -27.164 33.625 1.00 51.95  ? 65   ASP H CA    1 
ATOM   5640  C  C     . ASP H 4  68  ? -27.304 -28.073 33.309 1.00 56.31  ? 65   ASP H C     1 
ATOM   5641  O  O     . ASP H 4  68  ? -26.195 -27.604 33.021 1.00 57.85  ? 65   ASP H O     1 
ATOM   5642  C  CB    . ASP H 4  68  ? -29.005 -27.422 35.028 1.00 58.41  ? 65   ASP H CB    1 
ATOM   5643  C  CG    . ASP H 4  68  ? -28.009 -27.073 36.125 1.00 58.18  ? 65   ASP H CG    1 
ATOM   5644  O  OD1   . ASP H 4  68  ? -26.903 -26.556 35.853 1.00 58.27  ? 65   ASP H OD1   1 
ATOM   5645  O  OD2   . ASP H 4  68  ? -28.356 -27.337 37.297 1.00 61.52  ? 65   ASP H OD2   1 
ATOM   5646  N  N     . VAL H 4  69  ? -27.544 -29.381 33.333 1.00 61.65  ? 66   VAL H N     1 
ATOM   5647  C  CA    . VAL H 4  69  ? -26.463 -30.333 33.117 1.00 56.76  ? 66   VAL H CA    1 
ATOM   5648  C  C     . VAL H 4  69  ? -25.865 -30.138 31.740 1.00 59.50  ? 66   VAL H C     1 
ATOM   5649  O  O     . VAL H 4  69  ? -24.638 -30.194 31.591 1.00 59.67  ? 66   VAL H O     1 
ATOM   5650  C  CB    . VAL H 4  69  ? -26.914 -31.778 33.320 1.00 59.35  ? 66   VAL H CB    1 
ATOM   5651  C  CG1   . VAL H 4  69  ? -25.851 -32.741 32.822 1.00 58.27  ? 66   VAL H CG1   1 
ATOM   5652  C  CG2   . VAL H 4  69  ? -27.189 -32.031 34.799 1.00 60.97  ? 66   VAL H CG2   1 
ATOM   5653  N  N     . PHE H 4  70  ? -26.709 -29.875 30.741 1.00 55.54  ? 67   PHE H N     1 
ATOM   5654  C  CA    . PHE H 4  70  ? -26.185 -29.506 29.431 1.00 57.97  ? 67   PHE H CA    1 
ATOM   5655  C  C     . PHE H 4  70  ? -25.101 -28.414 29.550 1.00 64.46  ? 67   PHE H C     1 
ATOM   5656  O  O     . PHE H 4  70  ? -23.944 -28.629 29.125 1.00 61.04  ? 67   PHE H O     1 
ATOM   5657  C  CB    . PHE H 4  70  ? -27.287 -29.045 28.480 1.00 57.51  ? 67   PHE H CB    1 
ATOM   5658  C  CG    . PHE H 4  70  ? -26.782 -28.744 27.093 1.00 62.39  ? 67   PHE H CG    1 
ATOM   5659  C  CD1   . PHE H 4  70  ? -26.902 -29.687 26.074 1.00 63.80  ? 67   PHE H CD1   1 
ATOM   5660  C  CD2   . PHE H 4  70  ? -26.149 -27.531 26.810 1.00 63.91  ? 67   PHE H CD2   1 
ATOM   5661  C  CE1   . PHE H 4  70  ? -26.404 -29.433 24.799 1.00 62.92  ? 67   PHE H CE1   1 
ATOM   5662  C  CE2   . PHE H 4  70  ? -25.662 -27.270 25.537 1.00 68.30  ? 67   PHE H CE2   1 
ATOM   5663  C  CZ    . PHE H 4  70  ? -25.790 -28.224 24.526 1.00 64.39  ? 67   PHE H CZ    1 
ATOM   5664  N  N     . GLU H 4  71  ? -25.476 -27.262 30.133 1.00 60.83  ? 68   GLU H N     1 
ATOM   5665  C  CA    . GLU H 4  71  ? -24.562 -26.123 30.285 1.00 60.93  ? 68   GLU H CA    1 
ATOM   5666  C  C     . GLU H 4  71  ? -23.302 -26.484 31.072 1.00 62.86  ? 68   GLU H C     1 
ATOM   5667  O  O     . GLU H 4  71  ? -22.184 -26.108 30.660 1.00 59.87  ? 68   GLU H O     1 
ATOM   5668  C  CB    . GLU H 4  71  ? -25.265 -24.895 30.889 1.00 64.67  ? 68   GLU H CB    1 
ATOM   5669  C  CG    . GLU H 4  71  ? -25.874 -23.961 29.836 1.00 74.97  ? 68   GLU H CG    1 
ATOM   5670  C  CD    . GLU H 4  71  ? -27.201 -23.281 30.253 1.00 84.31  ? 68   GLU H CD    1 
ATOM   5671  O  OE1   . GLU H 4  71  ? -27.599 -23.300 31.448 1.00 81.93  ? 68   GLU H OE1   1 
ATOM   5672  O  OE2   . GLU H 4  71  ? -27.859 -22.699 29.362 1.00 86.04  ? 68   GLU H OE2   1 
ATOM   5673  N  N     . ARG H 4  72  ? -23.467 -27.224 32.176 1.00 57.04  ? 69   ARG H N     1 
ATOM   5674  C  CA    . ARG H 4  72  ? -22.309 -27.610 32.976 1.00 57.18  ? 69   ARG H CA    1 
ATOM   5675  C  C     . ARG H 4  72  ? -21.330 -28.465 32.163 1.00 57.17  ? 69   ARG H C     1 
ATOM   5676  O  O     . ARG H 4  72  ? -20.118 -28.244 32.154 1.00 54.65  ? 69   ARG H O     1 
ATOM   5677  C  CB    . ARG H 4  72  ? -22.733 -28.342 34.244 1.00 59.36  ? 69   ARG H CB    1 
ATOM   5678  C  CG    . ARG H 4  72  ? -23.609 -27.573 35.217 1.00 56.11  ? 69   ARG H CG    1 
ATOM   5679  C  CD    . ARG H 4  72  ? -23.488 -28.276 36.544 1.00 54.01  ? 69   ARG H CD    1 
ATOM   5680  N  NE    . ARG H 4  72  ? -24.735 -28.313 37.266 1.00 56.91  ? 69   ARG H NE    1 
ATOM   5681  C  CZ    . ARG H 4  72  ? -24.894 -28.973 38.405 1.00 63.91  ? 69   ARG H CZ    1 
ATOM   5682  N  NH1   . ARG H 4  72  ? -23.880 -29.649 38.946 1.00 65.52  ? 69   ARG H NH1   1 
ATOM   5683  N  NH2   . ARG H 4  72  ? -26.066 -28.954 39.005 1.00 63.91  ? 69   ARG H NH2   1 
ATOM   5684  N  N     . ILE H 4  73  ? -21.860 -29.445 31.457 1.00 61.99  ? 70   ILE H N     1 
ATOM   5685  C  CA    . ILE H 4  73  ? -20.984 -30.288 30.666 1.00 63.03  ? 70   ILE H CA    1 
ATOM   5686  C  C     . ILE H 4  73  ? -20.360 -29.523 29.500 1.00 59.81  ? 70   ILE H C     1 
ATOM   5687  O  O     . ILE H 4  73  ? -19.150 -29.531 29.375 1.00 63.95  ? 70   ILE H O     1 
ATOM   5688  C  CB    . ILE H 4  73  ? -21.667 -31.580 30.196 1.00 60.40  ? 70   ILE H CB    1 
ATOM   5689  C  CG1   . ILE H 4  73  ? -22.085 -32.415 31.397 1.00 53.37  ? 70   ILE H CG1   1 
ATOM   5690  C  CG2   . ILE H 4  73  ? -20.715 -32.369 29.322 1.00 58.11  ? 70   ILE H CG2   1 
ATOM   5691  C  CD1   . ILE H 4  73  ? -22.832 -33.662 31.012 1.00 49.76  ? 70   ILE H CD1   1 
ATOM   5692  N  N     . ALA H 4  74  ? -21.168 -28.862 28.673 1.00 56.72  ? 71   ALA H N     1 
ATOM   5693  C  CA    . ALA H 4  74  ? -20.629 -28.061 27.573 1.00 59.37  ? 71   ALA H CA    1 
ATOM   5694  C  C     . ALA H 4  74  ? -19.584 -27.066 28.077 1.00 62.26  ? 71   ALA H C     1 
ATOM   5695  O  O     . ALA H 4  74  ? -18.487 -26.951 27.485 1.00 63.18  ? 71   ALA H O     1 
ATOM   5696  C  CB    . ALA H 4  74  ? -21.742 -27.333 26.838 1.00 58.48  ? 71   ALA H CB    1 
ATOM   5697  N  N     . GLY H 4  75  ? -19.916 -26.377 29.177 1.00 59.09  ? 72   GLY H N     1 
ATOM   5698  C  CA    . GLY H 4  75  ? -19.045 -25.357 29.756 1.00 58.44  ? 72   GLY H CA    1 
ATOM   5699  C  C     . GLY H 4  75  ? -17.659 -25.886 30.093 1.00 62.86  ? 72   GLY H C     1 
ATOM   5700  O  O     . GLY H 4  75  ? -16.625 -25.282 29.735 1.00 61.63  ? 72   GLY H O     1 
ATOM   5701  N  N     . GLU H 4  76  ? -17.640 -27.025 30.780 1.00 64.12  ? 73   GLU H N     1 
ATOM   5702  C  CA    . GLU H 4  76  ? -16.395 -27.693 31.091 1.00 61.76  ? 73   GLU H CA    1 
ATOM   5703  C  C     . GLU H 4  76  ? -15.651 -28.126 29.823 1.00 61.41  ? 73   GLU H C     1 
ATOM   5704  O  O     . GLU H 4  76  ? -14.419 -27.995 29.741 1.00 68.77  ? 73   GLU H O     1 
ATOM   5705  C  CB    . GLU H 4  76  ? -16.638 -28.885 31.995 1.00 60.60  ? 73   GLU H CB    1 
ATOM   5706  C  CG    . GLU H 4  76  ? -15.341 -29.485 32.481 1.00 63.54  ? 73   GLU H CG    1 
ATOM   5707  C  CD    . GLU H 4  76  ? -14.623 -28.580 33.464 1.00 74.91  ? 73   GLU H CD    1 
ATOM   5708  O  OE1   . GLU H 4  76  ? -13.555 -28.026 33.064 1.00 75.04  ? 73   GLU H OE1   1 
ATOM   5709  O  OE2   . GLU H 4  76  ? -15.146 -28.422 34.618 1.00 74.01  ? 73   GLU H OE2   1 
ATOM   5710  N  N     . ALA H 4  77  ? -16.382 -28.620 28.832 1.00 53.41  ? 74   ALA H N     1 
ATOM   5711  C  CA    . ALA H 4  77  ? -15.737 -29.102 27.619 1.00 58.20  ? 74   ALA H CA    1 
ATOM   5712  C  C     . ALA H 4  77  ? -15.083 -27.958 26.887 1.00 59.73  ? 74   ALA H C     1 
ATOM   5713  O  O     . ALA H 4  77  ? -13.927 -28.081 26.459 1.00 58.48  ? 74   ALA H O     1 
ATOM   5714  C  CB    . ALA H 4  77  ? -16.717 -29.823 26.715 1.00 62.50  ? 74   ALA H CB    1 
ATOM   5715  N  N     . SER H 4  78  ? -15.816 -26.847 26.770 1.00 58.03  ? 75   SER H N     1 
ATOM   5716  C  CA    . SER H 4  78  ? -15.268 -25.600 26.236 1.00 60.76  ? 75   SER H CA    1 
ATOM   5717  C  C     . SER H 4  78  ? -13.932 -25.269 26.913 1.00 66.82  ? 75   SER H C     1 
ATOM   5718  O  O     . SER H 4  78  ? -12.880 -25.178 26.246 1.00 67.83  ? 75   SER H O     1 
ATOM   5719  C  CB    . SER H 4  78  ? -16.266 -24.454 26.442 1.00 64.92  ? 75   SER H CB    1 
ATOM   5720  O  OG    . SER H 4  78  ? -15.635 -23.200 26.208 1.00 70.54  ? 75   SER H OG    1 
ATOM   5721  N  N     . ARG H 4  79  ? -13.979 -25.119 28.243 1.00 61.29  ? 76   ARG H N     1 
ATOM   5722  C  CA    . ARG H 4  79  ? -12.792 -24.880 29.011 1.00 57.27  ? 76   ARG H CA    1 
ATOM   5723  C  C     . ARG H 4  79  ? -11.667 -25.858 28.612 1.00 57.58  ? 76   ARG H C     1 
ATOM   5724  O  O     . ARG H 4  79  ? -10.568 -25.422 28.274 1.00 58.96  ? 76   ARG H O     1 
ATOM   5725  C  CB    . ARG H 4  79  ? -13.129 -24.911 30.496 1.00 64.96  ? 76   ARG H CB    1 
ATOM   5726  C  CG    . ARG H 4  79  ? -13.233 -23.542 31.165 1.00 59.36  ? 76   ARG H CG    1 
ATOM   5727  C  CD    . ARG H 4  79  ? -14.049 -23.636 32.452 1.00 59.61  ? 76   ARG H CD    1 
ATOM   5728  N  NE    . ARG H 4  79  ? -15.422 -23.119 32.304 1.00 62.55  ? 76   ARG H NE    1 
ATOM   5729  C  CZ    . ARG H 4  79  ? -16.539 -23.745 32.701 1.00 68.05  ? 76   ARG H CZ    1 
ATOM   5730  N  NH1   . ARG H 4  79  ? -16.478 -24.944 33.285 1.00 73.01  ? 76   ARG H NH1   1 
ATOM   5731  N  NH2   . ARG H 4  79  ? -17.733 -23.168 32.526 1.00 62.70  ? 76   ARG H NH2   1 
ATOM   5732  N  N     . LEU H 4  80  ? -11.951 -27.160 28.595 1.00 61.81  ? 77   LEU H N     1 
ATOM   5733  C  CA    . LEU H 4  80  ? -10.942 -28.168 28.227 1.00 62.84  ? 77   LEU H CA    1 
ATOM   5734  C  C     . LEU H 4  80  ? -10.288 -27.909 26.892 1.00 61.70  ? 77   LEU H C     1 
ATOM   5735  O  O     . LEU H 4  80  ? -9.048  -27.947 26.777 1.00 62.69  ? 77   LEU H O     1 
ATOM   5736  C  CB    . LEU H 4  80  ? -11.555 -29.553 28.178 1.00 63.36  ? 77   LEU H CB    1 
ATOM   5737  C  CG    . LEU H 4  80  ? -11.534 -30.350 29.470 1.00 64.89  ? 77   LEU H CG    1 
ATOM   5738  C  CD1   . LEU H 4  80  ? -12.494 -31.523 29.355 1.00 59.93  ? 77   LEU H CD1   1 
ATOM   5739  C  CD2   . LEU H 4  80  ? -10.113 -30.810 29.755 1.00 66.50  ? 77   LEU H CD2   1 
ATOM   5740  N  N     . ALA H 4  81  ? -11.126 -27.650 25.885 1.00 59.72  ? 78   ALA H N     1 
ATOM   5741  C  CA    . ALA H 4  81  ? -10.629 -27.358 24.547 1.00 58.98  ? 78   ALA H CA    1 
ATOM   5742  C  C     . ALA H 4  81  ? -9.658  -26.198 24.612 1.00 62.65  ? 78   ALA H C     1 
ATOM   5743  O  O     . ALA H 4  81  ? -8.490  -26.340 24.241 1.00 64.23  ? 78   ALA H O     1 
ATOM   5744  C  CB    . ALA H 4  81  ? -11.761 -27.065 23.599 1.00 58.30  ? 78   ALA H CB    1 
ATOM   5745  N  N     . HIS H 4  82  ? -10.125 -25.075 25.156 1.00 66.67  ? 79   HIS H N     1 
ATOM   5746  C  CA    . HIS H 4  82  ? -9.267  -23.912 25.354 1.00 68.72  ? 79   HIS H CA    1 
ATOM   5747  C  C     . HIS H 4  82  ? -7.956  -24.230 26.057 1.00 70.75  ? 79   HIS H C     1 
ATOM   5748  O  O     . HIS H 4  82  ? -6.884  -23.893 25.538 1.00 72.62  ? 79   HIS H O     1 
ATOM   5749  C  CB    . HIS H 4  82  ? -10.036 -22.769 26.018 1.00 72.18  ? 79   HIS H CB    1 
ATOM   5750  C  CG    . HIS H 4  82  ? -11.143 -22.172 25.144 1.00 89.58  ? 79   HIS H CG    1 
ATOM   5751  N  ND1   . HIS H 4  82  ? -10.926 -21.728 23.874 1.00 90.39  ? 79   HIS H ND1   1 
ATOM   5752  C  CD2   . HIS H 4  82  ? -12.506 -21.929 25.414 1.00 92.37  ? 79   HIS H CD2   1 
ATOM   5753  C  CE1   . HIS H 4  82  ? -12.086 -21.248 23.357 1.00 88.63  ? 79   HIS H CE1   1 
ATOM   5754  N  NE2   . HIS H 4  82  ? -13.051 -21.369 24.297 1.00 89.04  ? 79   HIS H NE2   1 
ATOM   5755  N  N     . TYR H 4  83  ? -7.999  -24.906 27.208 1.00 72.57  ? 80   TYR H N     1 
ATOM   5756  C  CA    . TYR H 4  83  ? -6.753  -25.230 27.923 1.00 75.39  ? 80   TYR H CA    1 
ATOM   5757  C  C     . TYR H 4  83  ? -5.762  -25.907 27.017 1.00 73.84  ? 80   TYR H C     1 
ATOM   5758  O  O     . TYR H 4  83  ? -4.563  -25.689 27.135 1.00 69.49  ? 80   TYR H O     1 
ATOM   5759  C  CB    . TYR H 4  83  ? -6.977  -26.126 29.141 1.00 77.53  ? 80   TYR H CB    1 
ATOM   5760  C  CG    . TYR H 4  83  ? -7.850  -25.512 30.197 1.00 89.42  ? 80   TYR H CG    1 
ATOM   5761  C  CD1   . TYR H 4  83  ? -8.011  -24.128 30.276 1.00 87.69  ? 80   TYR H CD1   1 
ATOM   5762  C  CD2   . TYR H 4  83  ? -8.511  -26.311 31.130 1.00 86.54  ? 80   TYR H CD2   1 
ATOM   5763  C  CE1   . TYR H 4  83  ? -8.824  -23.565 31.233 1.00 82.66  ? 80   TYR H CE1   1 
ATOM   5764  C  CE2   . TYR H 4  83  ? -9.318  -25.743 32.092 1.00 82.00  ? 80   TYR H CE2   1 
ATOM   5765  C  CZ    . TYR H 4  83  ? -9.463  -24.373 32.128 1.00 79.23  ? 80   TYR H CZ    1 
ATOM   5766  O  OH    . TYR H 4  83  ? -10.259 -23.789 33.064 1.00 94.99  ? 80   TYR H OH    1 
ATOM   5767  N  N     . ASN H 4  84  ? -6.276  -26.722 26.105 1.00 77.58  ? 81   ASN H N     1 
ATOM   5768  C  CA    . ASN H 4  84  ? -5.422  -27.504 25.239 1.00 80.39  ? 81   ASN H CA    1 
ATOM   5769  C  C     . ASN H 4  84  ? -5.297  -26.998 23.815 1.00 84.52  ? 81   ASN H C     1 
ATOM   5770  O  O     . ASN H 4  84  ? -5.006  -27.784 22.901 1.00 90.65  ? 81   ASN H O     1 
ATOM   5771  C  CB    . ASN H 4  84  ? -5.894  -28.937 25.263 1.00 82.40  ? 81   ASN H CB    1 
ATOM   5772  C  CG    . ASN H 4  84  ? -5.769  -29.532 26.635 1.00 81.54  ? 81   ASN H CG    1 
ATOM   5773  O  OD1   . ASN H 4  84  ? -4.656  -29.810 27.104 1.00 81.68  ? 81   ASN H OD1   1 
ATOM   5774  N  ND2   . ASN H 4  84  ? -6.903  -29.698 27.310 1.00 77.39  ? 81   ASN H ND2   1 
ATOM   5775  N  N     . LYS H 4  85  ? -5.505  -25.689 23.641 1.00 80.14  ? 82   LYS H N     1 
ATOM   5776  C  CA    . LYS H 4  85  ? -5.376  -25.029 22.351 1.00 76.11  ? 82   LYS H CA    1 
ATOM   5777  C  C     . LYS H 4  85  ? -5.971  -25.894 21.238 1.00 77.49  ? 82   LYS H C     1 
ATOM   5778  O  O     . LYS H 4  85  ? -5.263  -26.331 20.331 1.00 82.40  ? 82   LYS H O     1 
ATOM   5779  C  CB    . LYS H 4  85  ? -3.905  -24.731 22.072 1.00 82.95  ? 82   LYS H CB    1 
ATOM   5780  C  CG    . LYS H 4  85  ? -3.297  -23.730 23.034 1.00 92.75  ? 82   LYS H CG    1 
ATOM   5781  C  CD    . LYS H 4  85  ? -1.797  -23.563 22.816 1.00 101.27 ? 82   LYS H CD    1 
ATOM   5782  C  CE    . LYS H 4  85  ? -0.974  -24.260 23.896 1.00 105.93 ? 82   LYS H CE    1 
ATOM   5783  N  NZ    . LYS H 4  85  ? 0.482   -23.981 23.726 1.00 99.34  ? 82   LYS H NZ    1 
ATOM   5784  N  N     . ARG H 4  86  ? -7.267  -26.167 21.341 1.00 72.80  ? 83   ARG H N     1 
ATOM   5785  C  CA    . ARG H 4  86  ? -7.989  -26.932 20.334 1.00 73.87  ? 83   ARG H CA    1 
ATOM   5786  C  C     . ARG H 4  86  ? -9.271  -26.216 19.953 1.00 76.85  ? 83   ARG H C     1 
ATOM   5787  O  O     . ARG H 4  86  ? -9.914  -25.580 20.792 1.00 77.95  ? 83   ARG H O     1 
ATOM   5788  C  CB    . ARG H 4  86  ? -8.332  -28.321 20.851 1.00 77.67  ? 83   ARG H CB    1 
ATOM   5789  C  CG    . ARG H 4  86  ? -7.139  -29.155 21.259 1.00 84.91  ? 83   ARG H CG    1 
ATOM   5790  C  CD    . ARG H 4  86  ? -6.546  -29.899 20.082 1.00 89.36  ? 83   ARG H CD    1 
ATOM   5791  N  NE    . ARG H 4  86  ? -5.511  -30.838 20.515 1.00 101.95 ? 83   ARG H NE    1 
ATOM   5792  C  CZ    . ARG H 4  86  ? -4.214  -30.547 20.637 1.00 108.72 ? 83   ARG H CZ    1 
ATOM   5793  N  NH1   . ARG H 4  86  ? -3.757  -29.326 20.363 1.00 116.68 ? 83   ARG H NH1   1 
ATOM   5794  N  NH2   . ARG H 4  86  ? -3.366  -31.489 21.031 1.00 103.99 ? 83   ARG H NH2   1 
ATOM   5795  N  N     . SER H 4  87  ? -9.651  -26.340 18.687 1.00 79.64  ? 84   SER H N     1 
ATOM   5796  C  CA    . SER H 4  87  ? -10.774 -25.588 18.160 1.00 79.23  ? 84   SER H CA    1 
ATOM   5797  C  C     . SER H 4  87  ? -12.061 -26.391 18.214 1.00 83.55  ? 84   SER H C     1 
ATOM   5798  O  O     . SER H 4  87  ? -13.144 -25.854 17.956 1.00 89.98  ? 84   SER H O     1 
ATOM   5799  C  CB    . SER H 4  87  ? -10.469 -25.139 16.732 1.00 83.87  ? 84   SER H CB    1 
ATOM   5800  O  OG    . SER H 4  87  ? -9.268  -24.367 16.693 1.00 91.09  ? 84   SER H OG    1 
ATOM   5801  N  N     . THR H 4  88  ? -11.947 -27.667 18.574 1.00 79.09  ? 85   THR H N     1 
ATOM   5802  C  CA    . THR H 4  88  ? -13.069 -28.586 18.471 1.00 78.39  ? 85   THR H CA    1 
ATOM   5803  C  C     . THR H 4  88  ? -13.458 -29.235 19.808 1.00 82.62  ? 85   THR H C     1 
ATOM   5804  O  O     . THR H 4  88  ? -12.600 -29.629 20.602 1.00 82.96  ? 85   THR H O     1 
ATOM   5805  C  CB    . THR H 4  88  ? -12.751 -29.702 17.459 1.00 80.44  ? 85   THR H CB    1 
ATOM   5806  O  OG1   . THR H 4  88  ? -11.906 -29.184 16.428 1.00 90.98  ? 85   THR H OG1   1 
ATOM   5807  C  CG2   . THR H 4  88  ? -14.023 -30.268 16.832 1.00 76.71  ? 85   THR H CG2   1 
ATOM   5808  N  N     . ILE H 4  89  ? -14.768 -29.335 20.037 1.00 83.49  ? 86   ILE H N     1 
ATOM   5809  C  CA    . ILE H 4  89  ? -15.331 -30.149 21.103 1.00 79.10  ? 86   ILE H CA    1 
ATOM   5810  C  C     . ILE H 4  89  ? -15.743 -31.509 20.523 1.00 85.77  ? 86   ILE H C     1 
ATOM   5811  O  O     . ILE H 4  89  ? -16.718 -31.620 19.751 1.00 77.84  ? 86   ILE H O     1 
ATOM   5812  C  CB    . ILE H 4  89  ? -16.510 -29.443 21.808 1.00 78.94  ? 86   ILE H CB    1 
ATOM   5813  C  CG1   . ILE H 4  89  ? -15.985 -28.241 22.600 1.00 83.81  ? 86   ILE H CG1   1 
ATOM   5814  C  CG2   . ILE H 4  89  ? -17.227 -30.396 22.758 1.00 79.26  ? 86   ILE H CG2   1 
ATOM   5815  C  CD1   . ILE H 4  89  ? -17.055 -27.349 23.193 1.00 76.69  ? 86   ILE H CD1   1 
ATOM   5816  N  N     . THR H 4  90  ? -14.961 -32.521 20.904 1.00 86.04  ? 87   THR H N     1 
ATOM   5817  C  CA    . THR H 4  90  ? -15.127 -33.900 20.479 1.00 77.01  ? 87   THR H CA    1 
ATOM   5818  C  C     . THR H 4  90  ? -15.594 -34.666 21.684 1.00 75.85  ? 87   THR H C     1 
ATOM   5819  O  O     . THR H 4  90  ? -15.478 -34.169 22.799 1.00 84.73  ? 87   THR H O     1 
ATOM   5820  C  CB    . THR H 4  90  ? -13.775 -34.522 20.079 1.00 77.67  ? 87   THR H CB    1 
ATOM   5821  O  OG1   . THR H 4  90  ? -13.130 -35.044 21.244 1.00 73.29  ? 87   THR H OG1   1 
ATOM   5822  C  CG2   . THR H 4  90  ? -12.851 -33.494 19.431 1.00 73.86  ? 87   THR H CG2   1 
ATOM   5823  N  N     . SER H 4  91  ? -16.066 -35.889 21.468 1.00 71.12  ? 88   SER H N     1 
ATOM   5824  C  CA    . SER H 4  91  ? -16.575 -36.733 22.535 1.00 76.48  ? 88   SER H CA    1 
ATOM   5825  C  C     . SER H 4  91  ? -15.545 -36.944 23.664 1.00 75.99  ? 88   SER H C     1 
ATOM   5826  O  O     . SER H 4  91  ? -15.906 -37.139 24.824 1.00 78.98  ? 88   SER H O     1 
ATOM   5827  C  CB    . SER H 4  91  ? -17.003 -38.068 21.940 1.00 84.62  ? 88   SER H CB    1 
ATOM   5828  O  OG    . SER H 4  91  ? -15.905 -38.629 21.243 1.00 84.66  ? 88   SER H OG    1 
ATOM   5829  N  N     . ARG H 4  92  ? -14.265 -36.892 23.325 1.00 70.05  ? 89   ARG H N     1 
ATOM   5830  C  CA    . ARG H 4  92  ? -13.216 -36.945 24.328 1.00 70.93  ? 89   ARG H CA    1 
ATOM   5831  C  C     . ARG H 4  92  ? -13.349 -35.791 25.337 1.00 74.87  ? 89   ARG H C     1 
ATOM   5832  O  O     . ARG H 4  92  ? -13.137 -35.971 26.543 1.00 76.71  ? 89   ARG H O     1 
ATOM   5833  C  CB    . ARG H 4  92  ? -11.852 -36.896 23.645 1.00 77.51  ? 89   ARG H CB    1 
ATOM   5834  C  CG    . ARG H 4  92  ? -10.795 -37.709 24.344 1.00 78.46  ? 89   ARG H CG    1 
ATOM   5835  C  CD    . ARG H 4  92  ? -9.465  -37.521 23.674 1.00 81.71  ? 89   ARG H CD    1 
ATOM   5836  N  NE    . ARG H 4  92  ? -8.402  -37.982 24.557 1.00 86.81  ? 89   ARG H NE    1 
ATOM   5837  C  CZ    . ARG H 4  92  ? -7.682  -37.186 25.344 1.00 93.34  ? 89   ARG H CZ    1 
ATOM   5838  N  NH1   . ARG H 4  92  ? -7.913  -35.880 25.355 1.00 94.61  ? 89   ARG H NH1   1 
ATOM   5839  N  NH2   . ARG H 4  92  ? -6.722  -37.689 26.119 1.00 98.48  ? 89   ARG H NH2   1 
ATOM   5840  N  N     . GLU H 4  93  ? -13.712 -34.608 24.845 1.00 75.66  ? 90   GLU H N     1 
ATOM   5841  C  CA    . GLU H 4  93  ? -13.949 -33.474 25.734 1.00 71.90  ? 90   GLU H CA    1 
ATOM   5842  C  C     . GLU H 4  93  ? -15.196 -33.682 26.578 1.00 67.52  ? 90   GLU H C     1 
ATOM   5843  O  O     . GLU H 4  93  ? -15.146 -33.504 27.795 1.00 70.89  ? 90   GLU H O     1 
ATOM   5844  C  CB    . GLU H 4  93  ? -13.997 -32.147 24.973 1.00 74.77  ? 90   GLU H CB    1 
ATOM   5845  C  CG    . GLU H 4  93  ? -12.618 -31.609 24.603 1.00 75.79  ? 90   GLU H CG    1 
ATOM   5846  C  CD    . GLU H 4  93  ? -11.966 -32.391 23.479 1.00 76.60  ? 90   GLU H CD    1 
ATOM   5847  O  OE1   . GLU H 4  93  ? -12.696 -32.765 22.527 1.00 76.10  ? 90   GLU H OE1   1 
ATOM   5848  O  OE2   . GLU H 4  93  ? -10.735 -32.632 23.564 1.00 70.71  ? 90   GLU H OE2   1 
ATOM   5849  N  N     . ILE H 4  94  ? -16.299 -34.083 25.951 1.00 61.12  ? 91   ILE H N     1 
ATOM   5850  C  CA    . ILE H 4  94  ? -17.516 -34.393 26.720 1.00 68.25  ? 91   ILE H CA    1 
ATOM   5851  C  C     . ILE H 4  94  ? -17.252 -35.459 27.770 1.00 71.52  ? 91   ILE H C     1 
ATOM   5852  O  O     . ILE H 4  94  ? -17.803 -35.385 28.871 1.00 73.34  ? 91   ILE H O     1 
ATOM   5853  C  CB    . ILE H 4  94  ? -18.702 -34.867 25.843 1.00 70.01  ? 91   ILE H CB    1 
ATOM   5854  C  CG1   . ILE H 4  94  ? -19.068 -33.818 24.784 1.00 70.63  ? 91   ILE H CG1   1 
ATOM   5855  C  CG2   . ILE H 4  94  ? -19.914 -35.223 26.703 1.00 60.26  ? 91   ILE H CG2   1 
ATOM   5856  C  CD1   . ILE H 4  94  ? -19.488 -32.463 25.319 1.00 67.39  ? 91   ILE H CD1   1 
ATOM   5857  N  N     . GLN H 4  95  ? -16.402 -36.432 27.425 1.00 71.77  ? 92   GLN H N     1 
ATOM   5858  C  CA    . GLN H 4  95  ? -16.056 -37.525 28.329 1.00 68.82  ? 92   GLN H CA    1 
ATOM   5859  C  C     . GLN H 4  95  ? -15.344 -37.024 29.588 1.00 63.56  ? 92   GLN H C     1 
ATOM   5860  O  O     . GLN H 4  95  ? -15.834 -37.229 30.703 1.00 60.14  ? 92   GLN H O     1 
ATOM   5861  C  CB    . GLN H 4  95  ? -15.230 -38.598 27.612 1.00 67.90  ? 92   GLN H CB    1 
ATOM   5862  C  CG    . GLN H 4  95  ? -14.849 -39.727 28.548 1.00 73.00  ? 92   GLN H CG    1 
ATOM   5863  C  CD    . GLN H 4  95  ? -14.596 -41.023 27.840 1.00 66.24  ? 92   GLN H CD    1 
ATOM   5864  O  OE1   . GLN H 4  95  ? -13.445 -41.451 27.704 1.00 60.58  ? 92   GLN H OE1   1 
ATOM   5865  N  NE2   . GLN H 4  95  ? -15.666 -41.666 27.397 1.00 61.29  ? 92   GLN H NE2   1 
ATOM   5866  N  N     . THR H 4  96  ? -14.216 -36.343 29.387 1.00 58.93  ? 93   THR H N     1 
ATOM   5867  C  CA    . THR H 4  96  ? -13.459 -35.747 30.472 1.00 56.72  ? 93   THR H CA    1 
ATOM   5868  C  C     . THR H 4  96  ? -14.328 -34.775 31.263 1.00 62.28  ? 93   THR H C     1 
ATOM   5869  O  O     . THR H 4  96  ? -14.293 -34.768 32.504 1.00 60.95  ? 93   THR H O     1 
ATOM   5870  C  CB    . THR H 4  96  ? -12.276 -34.990 29.913 1.00 55.48  ? 93   THR H CB    1 
ATOM   5871  O  OG1   . THR H 4  96  ? -11.555 -35.850 29.035 1.00 62.84  ? 93   THR H OG1   1 
ATOM   5872  C  CG2   . THR H 4  96  ? -11.386 -34.546 31.005 1.00 57.18  ? 93   THR H CG2   1 
ATOM   5873  N  N     . ALA H 4  97  ? -15.111 -33.964 30.541 1.00 62.63  ? 94   ALA H N     1 
ATOM   5874  C  CA    . ALA H 4  97  ? -16.109 -33.104 31.161 1.00 62.39  ? 94   ALA H CA    1 
ATOM   5875  C  C     . ALA H 4  97  ? -16.989 -33.916 32.127 1.00 67.41  ? 94   ALA H C     1 
ATOM   5876  O  O     . ALA H 4  97  ? -17.164 -33.518 33.294 1.00 68.49  ? 94   ALA H O     1 
ATOM   5877  C  CB    . ALA H 4  97  ? -16.960 -32.412 30.108 1.00 61.46  ? 94   ALA H CB    1 
ATOM   5878  N  N     . VAL H 4  98  ? -17.516 -35.055 31.656 1.00 64.65  ? 95   VAL H N     1 
ATOM   5879  C  CA    . VAL H 4  98  ? -18.428 -35.869 32.479 1.00 64.25  ? 95   VAL H CA    1 
ATOM   5880  C  C     . VAL H 4  98  ? -17.715 -36.404 33.724 1.00 60.52  ? 95   VAL H C     1 
ATOM   5881  O  O     . VAL H 4  98  ? -18.283 -36.421 34.816 1.00 56.75  ? 95   VAL H O     1 
ATOM   5882  C  CB    . VAL H 4  98  ? -19.135 -36.996 31.676 1.00 63.16  ? 95   VAL H CB    1 
ATOM   5883  C  CG1   . VAL H 4  98  ? -19.747 -38.048 32.602 1.00 59.08  ? 95   VAL H CG1   1 
ATOM   5884  C  CG2   . VAL H 4  98  ? -20.241 -36.411 30.805 1.00 60.72  ? 95   VAL H CG2   1 
ATOM   5885  N  N     . ARG H 4  99  ? -16.465 -36.804 33.548 1.00 57.78  ? 96   ARG H N     1 
ATOM   5886  C  CA    . ARG H 4  99  ? -15.686 -37.315 34.645 1.00 62.88  ? 96   ARG H CA    1 
ATOM   5887  C  C     . ARG H 4  99  ? -15.508 -36.256 35.731 1.00 63.88  ? 96   ARG H C     1 
ATOM   5888  O  O     . ARG H 4  99  ? -15.787 -36.520 36.896 1.00 67.83  ? 96   ARG H O     1 
ATOM   5889  C  CB    . ARG H 4  99  ? -14.342 -37.858 34.153 1.00 63.49  ? 96   ARG H CB    1 
ATOM   5890  C  CG    . ARG H 4  99  ? -14.468 -39.223 33.504 1.00 67.55  ? 96   ARG H CG    1 
ATOM   5891  C  CD    . ARG H 4  99  ? -13.233 -40.099 33.681 1.00 75.88  ? 96   ARG H CD    1 
ATOM   5892  N  NE    . ARG H 4  99  ? -13.407 -41.331 32.913 1.00 86.37  ? 96   ARG H NE    1 
ATOM   5893  C  CZ    . ARG H 4  99  ? -12.811 -41.595 31.743 1.00 101.05 ? 96   ARG H CZ    1 
ATOM   5894  N  NH1   . ARG H 4  99  ? -11.940 -40.731 31.197 1.00 96.96  ? 96   ARG H NH1   1 
ATOM   5895  N  NH2   . ARG H 4  99  ? -13.073 -42.746 31.119 1.00 91.30  ? 96   ARG H NH2   1 
ATOM   5896  N  N     . LEU H 4  100 ? -15.075 -35.066 35.324 1.00 64.14  ? 97   LEU H N     1 
ATOM   5897  C  CA    . LEU H 4  100 ? -14.877 -33.913 36.207 1.00 59.25  ? 97   LEU H CA    1 
ATOM   5898  C  C     . LEU H 4  100 ? -16.142 -33.456 36.944 1.00 55.96  ? 97   LEU H C     1 
ATOM   5899  O  O     . LEU H 4  100 ? -16.064 -33.052 38.083 1.00 57.36  ? 97   LEU H O     1 
ATOM   5900  C  CB    . LEU H 4  100 ? -14.325 -32.741 35.386 1.00 54.71  ? 97   LEU H CB    1 
ATOM   5901  C  CG    . LEU H 4  100 ? -12.895 -32.845 34.875 1.00 53.07  ? 97   LEU H CG    1 
ATOM   5902  C  CD1   . LEU H 4  100 ? -12.620 -31.711 33.898 1.00 54.41  ? 97   LEU H CD1   1 
ATOM   5903  C  CD2   . LEU H 4  100 ? -11.884 -32.866 36.019 1.00 49.26  ? 97   LEU H CD2   1 
ATOM   5904  N  N     . LEU H 4  101 ? -17.295 -33.540 36.290 1.00 57.46  ? 98   LEU H N     1 
ATOM   5905  C  CA    . LEU H 4  101 ? -18.548 -33.032 36.843 1.00 62.41  ? 98   LEU H CA    1 
ATOM   5906  C  C     . LEU H 4  101 ? -19.378 -34.008 37.627 1.00 62.47  ? 98   LEU H C     1 
ATOM   5907  O  O     . LEU H 4  101 ? -20.034 -33.620 38.590 1.00 63.60  ? 98   LEU H O     1 
ATOM   5908  C  CB    . LEU H 4  101 ? -19.445 -32.509 35.737 1.00 66.31  ? 98   LEU H CB    1 
ATOM   5909  C  CG    . LEU H 4  101 ? -19.076 -31.144 35.198 1.00 70.45  ? 98   LEU H CG    1 
ATOM   5910  C  CD1   . LEU H 4  101 ? -19.889 -31.010 33.925 1.00 77.25  ? 98   LEU H CD1   1 
ATOM   5911  C  CD2   . LEU H 4  101 ? -19.403 -30.040 36.201 1.00 66.71  ? 98   LEU H CD2   1 
ATOM   5912  N  N     . LEU H 4  102 ? -19.409 -35.262 37.189 1.00 65.98  ? 99   LEU H N     1 
ATOM   5913  C  CA    . LEU H 4  102 ? -20.257 -36.259 37.845 1.00 60.97  ? 99   LEU H CA    1 
ATOM   5914  C  C     . LEU H 4  102 ? -19.544 -36.986 39.000 1.00 61.63  ? 99   LEU H C     1 
ATOM   5915  O  O     . LEU H 4  102 ? -18.314 -37.212 38.961 1.00 61.15  ? 99   LEU H O     1 
ATOM   5916  C  CB    . LEU H 4  102 ? -20.852 -37.239 36.834 1.00 55.14  ? 99   LEU H CB    1 
ATOM   5917  C  CG    . LEU H 4  102 ? -21.753 -36.780 35.668 1.00 55.61  ? 99   LEU H CG    1 
ATOM   5918  C  CD1   . LEU H 4  102 ? -22.878 -37.775 35.421 1.00 57.58  ? 99   LEU H CD1   1 
ATOM   5919  C  CD2   . LEU H 4  102 ? -22.398 -35.430 35.869 1.00 56.03  ? 99   LEU H CD2   1 
ATOM   5920  N  N     . PRO H 4  103 ? -20.307 -37.302 40.053 1.00 57.15  ? 100  PRO H N     1 
ATOM   5921  C  CA    . PRO H 4  103 ? -19.793 -38.103 41.147 1.00 62.07  ? 100  PRO H CA    1 
ATOM   5922  C  C     . PRO H 4  103 ? -19.511 -39.552 40.701 1.00 68.05  ? 100  PRO H C     1 
ATOM   5923  O  O     . PRO H 4  103 ? -20.293 -40.123 39.932 1.00 67.45  ? 100  PRO H O     1 
ATOM   5924  C  CB    . PRO H 4  103 ? -20.930 -38.083 42.184 1.00 61.78  ? 100  PRO H CB    1 
ATOM   5925  C  CG    . PRO H 4  103 ? -21.917 -37.069 41.737 1.00 60.11  ? 100  PRO H CG    1 
ATOM   5926  C  CD    . PRO H 4  103 ? -21.688 -36.841 40.274 1.00 60.49  ? 100  PRO H CD    1 
ATOM   5927  N  N     . GLY H 4  104 ? -18.406 -40.121 41.200 1.00 70.10  ? 101  GLY H N     1 
ATOM   5928  C  CA    . GLY H 4  104 ? -18.034 -41.532 41.009 1.00 69.11  ? 101  GLY H CA    1 
ATOM   5929  C  C     . GLY H 4  104 ? -18.929 -42.464 40.194 1.00 70.20  ? 101  GLY H C     1 
ATOM   5930  O  O     . GLY H 4  104 ? -18.707 -42.658 38.992 1.00 66.41  ? 101  GLY H O     1 
ATOM   5931  N  N     . GLU H 4  105 ? -19.928 -43.064 40.839 1.00 72.37  ? 102  GLU H N     1 
ATOM   5932  C  CA    . GLU H 4  105 ? -20.735 -44.094 40.163 1.00 75.95  ? 102  GLU H CA    1 
ATOM   5933  C  C     . GLU H 4  105 ? -21.521 -43.553 38.975 1.00 75.97  ? 102  GLU H C     1 
ATOM   5934  O  O     . GLU H 4  105 ? -21.554 -44.165 37.905 1.00 77.04  ? 102  GLU H O     1 
ATOM   5935  C  CB    . GLU H 4  105 ? -21.645 -44.842 41.140 1.00 82.90  ? 102  GLU H CB    1 
ATOM   5936  C  CG    . GLU H 4  105 ? -20.922 -45.937 41.929 1.00 96.97  ? 102  GLU H CG    1 
ATOM   5937  C  CD    . GLU H 4  105 ? -20.588 -47.152 41.078 1.00 99.03  ? 102  GLU H CD    1 
ATOM   5938  O  OE1   . GLU H 4  105 ? -21.515 -47.948 40.795 1.00 111.62 ? 102  GLU H OE1   1 
ATOM   5939  O  OE2   . GLU H 4  105 ? -19.404 -47.310 40.696 1.00 85.24  ? 102  GLU H OE2   1 
ATOM   5940  N  N     . LEU H 4  106 ? -22.128 -42.387 39.164 1.00 72.81  ? 103  LEU H N     1 
ATOM   5941  C  CA    . LEU H 4  106 ? -22.889 -41.717 38.119 1.00 68.55  ? 103  LEU H CA    1 
ATOM   5942  C  C     . LEU H 4  106 ? -22.010 -41.423 36.891 1.00 69.03  ? 103  LEU H C     1 
ATOM   5943  O  O     . LEU H 4  106 ? -22.434 -41.624 35.752 1.00 67.04  ? 103  LEU H O     1 
ATOM   5944  C  CB    . LEU H 4  106 ? -23.461 -40.426 38.690 1.00 64.30  ? 103  LEU H CB    1 
ATOM   5945  C  CG    . LEU H 4  106 ? -24.917 -40.012 38.511 1.00 67.45  ? 103  LEU H CG    1 
ATOM   5946  C  CD1   . LEU H 4  106 ? -25.898 -41.175 38.500 1.00 66.13  ? 103  LEU H CD1   1 
ATOM   5947  C  CD2   . LEU H 4  106 ? -25.264 -39.042 39.636 1.00 72.52  ? 103  LEU H CD2   1 
ATOM   5948  N  N     . ALA H 4  107 ? -20.779 -40.963 37.133 1.00 68.03  ? 104  ALA H N     1 
ATOM   5949  C  CA    . ALA H 4  107 ? -19.815 -40.704 36.064 1.00 65.94  ? 104  ALA H CA    1 
ATOM   5950  C  C     . ALA H 4  107 ? -19.562 -41.965 35.268 1.00 75.56  ? 104  ALA H C     1 
ATOM   5951  O  O     . ALA H 4  107 ? -19.628 -41.946 34.041 1.00 82.88  ? 104  ALA H O     1 
ATOM   5952  C  CB    . ALA H 4  107 ? -18.511 -40.178 36.626 1.00 59.95  ? 104  ALA H CB    1 
ATOM   5953  N  N     . LYS H 4  108 ? -19.298 -43.068 35.968 1.00 75.60  ? 105  LYS H N     1 
ATOM   5954  C  CA    . LYS H 4  108 ? -18.959 -44.305 35.297 1.00 73.17  ? 105  LYS H CA    1 
ATOM   5955  C  C     . LYS H 4  108 ? -20.083 -44.736 34.365 1.00 69.66  ? 105  LYS H C     1 
ATOM   5956  O  O     . LYS H 4  108 ? -19.860 -44.941 33.164 1.00 63.77  ? 105  LYS H O     1 
ATOM   5957  C  CB    . LYS H 4  108 ? -18.540 -45.387 36.297 1.00 77.65  ? 105  LYS H CB    1 
ATOM   5958  C  CG    . LYS H 4  108 ? -17.090 -45.189 36.757 1.00 91.80  ? 105  LYS H CG    1 
ATOM   5959  C  CD    . LYS H 4  108 ? -16.738 -45.971 38.016 1.00 99.36  ? 105  LYS H CD    1 
ATOM   5960  C  CE    . LYS H 4  108 ? -15.371 -45.567 38.562 1.00 105.80 ? 105  LYS H CE    1 
ATOM   5961  N  NZ    . LYS H 4  108 ? -14.995 -46.299 39.814 1.00 110.71 ? 105  LYS H NZ    1 
ATOM   5962  N  N     . HIS H 4  109 ? -21.297 -44.820 34.896 1.00 72.34  ? 106  HIS H N     1 
ATOM   5963  C  CA    . HIS H 4  109 ? -22.417 -45.298 34.095 1.00 74.90  ? 106  HIS H CA    1 
ATOM   5964  C  C     . HIS H 4  109 ? -22.660 -44.408 32.906 1.00 79.15  ? 106  HIS H C     1 
ATOM   5965  O  O     . HIS H 4  109 ? -22.792 -44.896 31.771 1.00 79.78  ? 106  HIS H O     1 
ATOM   5966  C  CB    . HIS H 4  109 ? -23.663 -45.438 34.935 1.00 80.15  ? 106  HIS H CB    1 
ATOM   5967  C  CG    . HIS H 4  109 ? -23.702 -46.701 35.762 1.00 88.47  ? 106  HIS H CG    1 
ATOM   5968  N  ND1   . HIS H 4  109 ? -24.496 -47.742 35.448 1.00 94.10  ? 106  HIS H ND1   1 
ATOM   5969  C  CD2   . HIS H 4  109 ? -23.018 -47.056 36.928 1.00 93.87  ? 106  HIS H CD2   1 
ATOM   5970  C  CE1   . HIS H 4  109 ? -24.330 -48.716 36.362 1.00 105.32 ? 106  HIS H CE1   1 
ATOM   5971  N  NE2   . HIS H 4  109 ? -23.417 -48.296 37.264 1.00 101.32 ? 106  HIS H NE2   1 
ATOM   5972  N  N     . ALA H 4  110 ? -22.673 -43.094 33.148 1.00 77.83  ? 107  ALA H N     1 
ATOM   5973  C  CA    . ALA H 4  110 ? -22.839 -42.086 32.091 1.00 66.26  ? 107  ALA H CA    1 
ATOM   5974  C  C     . ALA H 4  110 ? -21.793 -42.202 30.994 1.00 70.14  ? 107  ALA H C     1 
ATOM   5975  O  O     . ALA H 4  110 ? -22.122 -42.065 29.805 1.00 71.08  ? 107  ALA H O     1 
ATOM   5976  C  CB    . ALA H 4  110 ? -22.795 -40.693 32.676 1.00 66.43  ? 107  ALA H CB    1 
ATOM   5977  N  N     . VAL H 4  111 ? -20.536 -42.425 31.391 1.00 66.03  ? 108  VAL H N     1 
ATOM   5978  C  CA    . VAL H 4  111 ? -19.451 -42.632 30.433 1.00 67.13  ? 108  VAL H CA    1 
ATOM   5979  C  C     . VAL H 4  111 ? -19.703 -43.881 29.599 1.00 74.36  ? 108  VAL H C     1 
ATOM   5980  O  O     . VAL H 4  111 ? -19.478 -43.886 28.376 1.00 76.61  ? 108  VAL H O     1 
ATOM   5981  C  CB    . VAL H 4  111 ? -18.093 -42.737 31.126 1.00 63.74  ? 108  VAL H CB    1 
ATOM   5982  C  CG1   . VAL H 4  111 ? -17.059 -43.357 30.203 1.00 60.64  ? 108  VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H 4  111 ? -17.661 -41.361 31.568 1.00 60.35  ? 108  VAL H CG2   1 
ATOM   5984  N  N     . SER H 4  112 ? -20.190 -44.934 30.248 1.00 71.36  ? 109  SER H N     1 
ATOM   5985  C  CA    . SER H 4  112 ? -20.439 -46.132 29.498 1.00 73.85  ? 109  SER H CA    1 
ATOM   5986  C  C     . SER H 4  112 ? -21.615 -45.888 28.545 1.00 73.35  ? 109  SER H C     1 
ATOM   5987  O  O     . SER H 4  112 ? -21.501 -46.200 27.370 1.00 78.84  ? 109  SER H O     1 
ATOM   5988  C  CB    . SER H 4  112 ? -20.556 -47.375 30.393 1.00 76.41  ? 109  SER H CB    1 
ATOM   5989  O  OG    . SER H 4  112 ? -21.896 -47.741 30.678 1.00 78.55  ? 109  SER H OG    1 
ATOM   5990  N  N     . GLU H 4  113 ? -22.695 -45.260 29.006 1.00 73.99  ? 110  GLU H N     1 
ATOM   5991  C  CA    . GLU H 4  113 ? -23.827 -44.964 28.094 1.00 78.13  ? 110  GLU H CA    1 
ATOM   5992  C  C     . GLU H 4  113 ? -23.400 -44.088 26.933 1.00 76.24  ? 110  GLU H C     1 
ATOM   5993  O  O     . GLU H 4  113 ? -23.987 -44.138 25.860 1.00 75.58  ? 110  GLU H O     1 
ATOM   5994  C  CB    . GLU H 4  113 ? -25.007 -44.290 28.812 1.00 77.52  ? 110  GLU H CB    1 
ATOM   5995  C  CG    . GLU H 4  113 ? -25.691 -45.153 29.864 1.00 88.36  ? 110  GLU H CG    1 
ATOM   5996  C  CD    . GLU H 4  113 ? -26.458 -46.338 29.293 1.00 93.21  ? 110  GLU H CD    1 
ATOM   5997  O  OE1   . GLU H 4  113 ? -26.606 -46.420 28.054 1.00 97.80  ? 110  GLU H OE1   1 
ATOM   5998  O  OE2   . GLU H 4  113 ? -26.924 -47.194 30.089 1.00 97.39  ? 110  GLU H OE2   1 
ATOM   5999  N  N     . GLY H 4  114 ? -22.369 -43.290 27.178 1.00 80.10  ? 111  GLY H N     1 
ATOM   6000  C  CA    . GLY H 4  114 ? -21.884 -42.314 26.229 1.00 77.65  ? 111  GLY H CA    1 
ATOM   6001  C  C     . GLY H 4  114 ? -21.076 -42.977 25.157 1.00 74.05  ? 111  GLY H C     1 
ATOM   6002  O  O     . GLY H 4  114 ? -21.371 -42.797 23.987 1.00 77.00  ? 111  GLY H O     1 
ATOM   6003  N  N     . THR H 4  115 ? -20.061 -43.746 25.553 1.00 79.16  ? 112  THR H N     1 
ATOM   6004  C  CA    . THR H 4  115 ? -19.250 -44.531 24.593 1.00 85.76  ? 112  THR H CA    1 
ATOM   6005  C  C     . THR H 4  115 ? -20.105 -45.553 23.829 1.00 88.75  ? 112  THR H C     1 
ATOM   6006  O  O     . THR H 4  115 ? -19.848 -45.848 22.655 1.00 77.94  ? 112  THR H O     1 
ATOM   6007  C  CB    . THR H 4  115 ? -18.093 -45.269 25.285 1.00 82.11  ? 112  THR H CB    1 
ATOM   6008  O  OG1   . THR H 4  115 ? -17.215 -44.318 25.889 1.00 86.08  ? 112  THR H OG1   1 
ATOM   6009  C  CG2   . THR H 4  115 ? -17.299 -46.070 24.286 1.00 82.40  ? 112  THR H CG2   1 
ATOM   6010  N  N     . LYS H 4  116 ? -21.128 -46.074 24.505 1.00 90.85  ? 113  LYS H N     1 
ATOM   6011  C  CA    . LYS H 4  116 ? -22.037 -47.028 23.898 1.00 90.07  ? 113  LYS H CA    1 
ATOM   6012  C  C     . LYS H 4  116 ? -22.678 -46.361 22.711 1.00 94.80  ? 113  LYS H C     1 
ATOM   6013  O  O     . LYS H 4  116 ? -22.482 -46.794 21.574 1.00 103.45 ? 113  LYS H O     1 
ATOM   6014  C  CB    . LYS H 4  116 ? -23.118 -47.447 24.878 1.00 83.98  ? 113  LYS H CB    1 
ATOM   6015  C  CG    . LYS H 4  116 ? -23.476 -48.912 24.801 1.00 81.32  ? 113  LYS H CG    1 
ATOM   6016  C  CD    . LYS H 4  116 ? -24.554 -49.242 25.819 1.00 82.50  ? 113  LYS H CD    1 
ATOM   6017  C  CE    . LYS H 4  116 ? -25.934 -49.035 25.228 1.00 76.93  ? 113  LYS H CE    1 
ATOM   6018  N  NZ    . LYS H 4  116 ? -26.984 -49.275 26.255 1.00 80.19  ? 113  LYS H NZ    1 
ATOM   6019  N  N     . ALA H 4  117 ? -23.404 -45.279 22.989 1.00 91.03  ? 114  ALA H N     1 
ATOM   6020  C  CA    . ALA H 4  117 ? -24.168 -44.557 21.982 1.00 85.11  ? 114  ALA H CA    1 
ATOM   6021  C  C     . ALA H 4  117 ? -23.354 -44.155 20.754 1.00 86.70  ? 114  ALA H C     1 
ATOM   6022  O  O     . ALA H 4  117 ? -23.913 -44.085 19.657 1.00 86.71  ? 114  ALA H O     1 
ATOM   6023  C  CB    . ALA H 4  117 ? -24.829 -43.337 22.601 1.00 85.80  ? 114  ALA H CB    1 
ATOM   6024  N  N     . VAL H 4  118 ? -22.056 -43.890 20.936 1.00 86.06  ? 115  VAL H N     1 
ATOM   6025  C  CA    . VAL H 4  118 ? -21.187 -43.469 19.829 1.00 89.64  ? 115  VAL H CA    1 
ATOM   6026  C  C     . VAL H 4  118 ? -20.745 -44.662 18.977 1.00 96.00  ? 115  VAL H C     1 
ATOM   6027  O  O     . VAL H 4  118 ? -20.768 -44.593 17.743 1.00 97.40  ? 115  VAL H O     1 
ATOM   6028  C  CB    . VAL H 4  118 ? -20.006 -42.598 20.316 1.00 92.96  ? 115  VAL H CB    1 
ATOM   6029  C  CG1   . VAL H 4  118 ? -18.875 -42.548 19.295 1.00 97.47  ? 115  VAL H CG1   1 
ATOM   6030  C  CG2   . VAL H 4  118 ? -20.494 -41.187 20.592 1.00 91.01  ? 115  VAL H CG2   1 
ATOM   6031  N  N     . THR H 4  119 ? -20.366 -45.756 19.635 1.00 102.86 ? 116  THR H N     1 
ATOM   6032  C  CA    . THR H 4  119 ? -20.152 -47.022 18.946 1.00 97.87  ? 116  THR H CA    1 
ATOM   6033  C  C     . THR H 4  119 ? -21.370 -47.302 18.057 1.00 94.36  ? 116  THR H C     1 
ATOM   6034  O  O     . THR H 4  119 ? -21.260 -47.257 16.828 1.00 95.77  ? 116  THR H O     1 
ATOM   6035  C  CB    . THR H 4  119 ? -19.872 -48.160 19.952 1.00 98.20  ? 116  THR H CB    1 
ATOM   6036  O  OG1   . THR H 4  119 ? -18.527 -48.032 20.431 1.00 97.05  ? 116  THR H OG1   1 
ATOM   6037  C  CG2   . THR H 4  119 ? -20.026 -49.533 19.307 1.00 106.93 ? 116  THR H CG2   1 
ATOM   6038  N  N     . LYS H 4  120 ? -22.528 -47.522 18.685 1.00 91.01  ? 117  LYS H N     1 
ATOM   6039  C  CA    . LYS H 4  120 ? -23.772 -47.874 17.990 1.00 92.74  ? 117  LYS H CA    1 
ATOM   6040  C  C     . LYS H 4  120 ? -24.062 -46.957 16.803 1.00 95.80  ? 117  LYS H C     1 
ATOM   6041  O  O     . LYS H 4  120 ? -24.463 -47.415 15.738 1.00 105.90 ? 117  LYS H O     1 
ATOM   6042  C  CB    . LYS H 4  120 ? -24.960 -47.904 18.965 1.00 87.90  ? 117  LYS H CB    1 
ATOM   6043  C  CG    . LYS H 4  120 ? -26.233 -48.490 18.379 1.00 94.35  ? 117  LYS H CG    1 
ATOM   6044  C  CD    . LYS H 4  120 ? -27.140 -49.105 19.438 1.00 95.62  ? 117  LYS H CD    1 
ATOM   6045  C  CE    . LYS H 4  120 ? -28.164 -50.049 18.810 1.00 104.04 ? 117  LYS H CE    1 
ATOM   6046  N  NZ    . LYS H 4  120 ? -28.919 -49.470 17.656 1.00 102.41 ? 117  LYS H NZ    1 
ATOM   6047  N  N     . TYR H 4  121 ? -23.831 -45.667 16.993 1.00 97.02  ? 118  TYR H N     1 
ATOM   6048  C  CA    . TYR H 4  121 ? -24.045 -44.677 15.954 1.00 97.51  ? 118  TYR H CA    1 
ATOM   6049  C  C     . TYR H 4  121 ? -23.058 -44.815 14.791 1.00 105.36 ? 118  TYR H C     1 
ATOM   6050  O  O     . TYR H 4  121 ? -23.460 -44.641 13.637 1.00 121.81 ? 118  TYR H O     1 
ATOM   6051  C  CB    . TYR H 4  121 ? -23.968 -43.269 16.557 1.00 95.24  ? 118  TYR H CB    1 
ATOM   6052  C  CG    . TYR H 4  121 ? -24.040 -42.109 15.571 1.00 87.54  ? 118  TYR H CG    1 
ATOM   6053  C  CD1   . TYR H 4  121 ? -25.276 -41.589 15.172 1.00 86.32  ? 118  TYR H CD1   1 
ATOM   6054  C  CD2   . TYR H 4  121 ? -22.869 -41.513 15.061 1.00 79.38  ? 118  TYR H CD2   1 
ATOM   6055  C  CE1   . TYR H 4  121 ? -25.351 -40.525 14.282 1.00 85.30  ? 118  TYR H CE1   1 
ATOM   6056  C  CE2   . TYR H 4  121 ? -22.931 -40.447 14.175 1.00 76.60  ? 118  TYR H CE2   1 
ATOM   6057  C  CZ    . TYR H 4  121 ? -24.176 -39.957 13.790 1.00 86.41  ? 118  TYR H CZ    1 
ATOM   6058  O  OH    . TYR H 4  121 ? -24.269 -38.894 12.920 1.00 91.12  ? 118  TYR H OH    1 
ATOM   6059  N  N     . THR H 4  122 ? -21.784 -45.103 15.079 1.00 98.86  ? 119  THR H N     1 
ATOM   6060  C  CA    . THR H 4  122 ? -20.755 -45.224 14.026 1.00 102.98 ? 119  THR H CA    1 
ATOM   6061  C  C     . THR H 4  122 ? -21.023 -46.394 13.082 1.00 110.75 ? 119  THR H C     1 
ATOM   6062  O  O     . THR H 4  122 ? -21.110 -46.226 11.861 1.00 108.08 ? 119  THR H O     1 
ATOM   6063  C  CB    . THR H 4  122 ? -19.358 -45.431 14.623 1.00 99.94  ? 119  THR H CB    1 
ATOM   6064  O  OG1   . THR H 4  122 ? -19.100 -44.394 15.566 1.00 108.93 ? 119  THR H OG1   1 
ATOM   6065  C  CG2   . THR H 4  122 ? -18.287 -45.402 13.543 1.00 100.08 ? 119  THR H CG2   1 
ATOM   6066  N  N     . SER H 4  123 ? -21.143 -47.577 13.674 1.00 114.05 ? 120  SER H N     1 
ATOM   6067  C  CA    . SER H 4  123 ? -21.414 -48.808 12.951 1.00 119.80 ? 120  SER H CA    1 
ATOM   6068  C  C     . SER H 4  123 ? -22.699 -48.754 12.112 1.00 129.86 ? 120  SER H C     1 
ATOM   6069  O  O     . SER H 4  123 ? -22.720 -49.249 10.977 1.00 139.71 ? 120  SER H O     1 
ATOM   6070  C  CB    . SER H 4  123 ? -21.452 -49.964 13.941 1.00 114.31 ? 120  SER H CB    1 
ATOM   6071  O  OG    . SER H 4  123 ? -20.360 -49.839 14.831 1.00 108.80 ? 120  SER H OG    1 
ATOM   6072  N  N     . ALA H 4  124 ? -23.760 -48.159 12.661 1.00 126.62 ? 121  ALA H N     1 
ATOM   6073  C  CA    . ALA H 4  124 ? -24.983 -47.910 11.888 1.00 128.31 ? 121  ALA H CA    1 
ATOM   6074  C  C     . ALA H 4  124 ? -24.663 -47.041 10.666 1.00 131.20 ? 121  ALA H C     1 
ATOM   6075  O  O     . ALA H 4  124 ? -23.906 -46.067 10.759 1.00 121.00 ? 121  ALA H O     1 
ATOM   6076  C  CB    . ALA H 4  124 ? -26.064 -47.273 12.750 1.00 117.78 ? 121  ALA H CB    1 
ATOM   6077  N  N     . LYS H 4  125 ? -25.235 -47.422 9.525  1.00 137.53 ? 122  LYS H N     1 
ATOM   6078  C  CA    . LYS H 4  125 ? -24.877 -46.857 8.217  1.00 139.68 ? 122  LYS H CA    1 
ATOM   6079  C  C     . LYS H 4  125 ? -25.333 -45.400 8.000  1.00 137.29 ? 122  LYS H C     1 
ATOM   6080  O  O     . LYS H 4  125 ? -25.531 -44.627 8.943  1.00 132.27 ? 122  LYS H O     1 
ATOM   6081  C  CB    . LYS H 4  125 ? -25.361 -47.786 7.086  1.00 136.83 ? 122  LYS H CB    1 
ATOM   6082  C  CG    . LYS H 4  125 ? -26.762 -48.350 7.285  1.00 136.24 ? 122  LYS H CG    1 
ATOM   6083  C  CD    . LYS H 4  125 ? -26.966 -49.643 6.505  1.00 140.00 ? 122  LYS H CD    1 
ATOM   6084  C  CE    . LYS H 4  125 ? -28.333 -50.253 6.797  1.00 138.78 ? 122  LYS H CE    1 
ATOM   6085  N  NZ    . LYS H 4  125 ? -28.537 -51.584 6.152  1.00 128.46 ? 122  LYS H NZ    1 
ATOM   6086  O  OXT   . LYS H 4  125 ? -25.496 -44.946 6.865  1.00 126.84 ? 122  LYS H OXT   1 
ATOM   6087  O  "O5'" . DA  I 5  1   ? 3.234   0.042   90.873 1.00 158.53 ? -72  DA  I "O5'" 1 
ATOM   6088  C  "C5'" . DA  I 5  1   ? 4.392   -0.765  91.180 1.00 161.01 ? -72  DA  I "C5'" 1 
ATOM   6089  C  "C4'" . DA  I 5  1   ? 4.663   -0.770  92.670 1.00 163.61 ? -72  DA  I "C4'" 1 
ATOM   6090  O  "O4'" . DA  I 5  1   ? 3.573   -1.435  93.367 1.00 172.55 ? -72  DA  I "O4'" 1 
ATOM   6091  C  "C3'" . DA  I 5  1   ? 5.945   -1.494  93.074 1.00 163.05 ? -72  DA  I "C3'" 1 
ATOM   6092  O  "O3'" . DA  I 5  1   ? 6.988   -0.537  93.239 1.00 160.90 ? -72  DA  I "O3'" 1 
ATOM   6093  C  "C2'" . DA  I 5  1   ? 5.569   -2.193  94.381 1.00 163.34 ? -72  DA  I "C2'" 1 
ATOM   6094  C  "C1'" . DA  I 5  1   ? 4.081   -2.481  94.176 1.00 170.30 ? -72  DA  I "C1'" 1 
ATOM   6095  N  N9    . DA  I 5  1   ? 3.734   -3.764  93.547 1.00 178.79 ? -72  DA  I N9    1 
ATOM   6096  C  C8    . DA  I 5  1   ? 2.743   -3.957  92.616 1.00 180.11 ? -72  DA  I C8    1 
ATOM   6097  N  N7    . DA  I 5  1   ? 2.619   -5.203  92.225 1.00 175.05 ? -72  DA  I N7    1 
ATOM   6098  C  C5    . DA  I 5  1   ? 3.584   -5.880  92.957 1.00 170.76 ? -72  DA  I C5    1 
ATOM   6099  C  C6    . DA  I 5  1   ? 3.956   -7.235  93.003 1.00 160.53 ? -72  DA  I C6    1 
ATOM   6100  N  N6    . DA  I 5  1   ? 3.379   -8.187  92.267 1.00 149.18 ? -72  DA  I N6    1 
ATOM   6101  N  N1    . DA  I 5  1   ? 4.957   -7.583  93.841 1.00 160.50 ? -72  DA  I N1    1 
ATOM   6102  C  C2    . DA  I 5  1   ? 5.536   -6.627  94.579 1.00 168.52 ? -72  DA  I C2    1 
ATOM   6103  N  N3    . DA  I 5  1   ? 5.271   -5.322  94.629 1.00 174.60 ? -72  DA  I N3    1 
ATOM   6104  C  C4    . DA  I 5  1   ? 4.273   -5.008  93.783 1.00 176.36 ? -72  DA  I C4    1 
ATOM   6105  P  P     . DT  I 5  2   ? 8.536   -0.965  93.262 1.00 174.85 ? -71  DT  I P     1 
ATOM   6106  O  OP1   . DT  I 5  2   ? 9.345   0.244   93.567 1.00 181.24 ? -71  DT  I OP1   1 
ATOM   6107  O  OP2   . DT  I 5  2   ? 8.855   -1.763  92.049 1.00 173.72 ? -71  DT  I OP2   1 
ATOM   6108  O  "O5'" . DT  I 5  2   ? 8.566   -1.920  94.538 1.00 161.72 ? -71  DT  I "O5'" 1 
ATOM   6109  C  "C5'" . DT  I 5  2   ? 9.763   -2.099  95.310 1.00 155.34 ? -71  DT  I "C5'" 1 
ATOM   6110  C  "C4'" . DT  I 5  2   ? 10.379  -3.445  95.008 1.00 156.41 ? -71  DT  I "C4'" 1 
ATOM   6111  O  "O4'" . DT  I 5  2   ? 9.370   -4.367  94.524 1.00 159.90 ? -71  DT  I "O4'" 1 
ATOM   6112  C  "C3'" . DT  I 5  2   ? 11.490  -3.422  93.950 1.00 157.74 ? -71  DT  I "C3'" 1 
ATOM   6113  O  "O3'" . DT  I 5  2   ? 12.684  -4.009  94.491 1.00 162.62 ? -71  DT  I "O3'" 1 
ATOM   6114  C  "C2'" . DT  I 5  2   ? 10.930  -4.252  92.805 1.00 159.38 ? -71  DT  I "C2'" 1 
ATOM   6115  C  "C1'" . DT  I 5  2   ? 9.954   -5.171  93.515 1.00 166.60 ? -71  DT  I "C1'" 1 
ATOM   6116  N  N1    . DT  I 5  2   ? 8.870   -5.723  92.665 1.00 171.04 ? -71  DT  I N1    1 
ATOM   6117  C  C2    . DT  I 5  2   ? 8.843   -7.085  92.455 1.00 166.71 ? -71  DT  I C2    1 
ATOM   6118  O  O2    . DT  I 5  2   ? 9.656   -7.853  92.944 1.00 162.81 ? -71  DT  I O2    1 
ATOM   6119  N  N3    . DT  I 5  2   ? 7.819   -7.518  91.647 1.00 163.78 ? -71  DT  I N3    1 
ATOM   6120  C  C4    . DT  I 5  2   ? 6.847   -6.744  91.040 1.00 162.08 ? -71  DT  I C4    1 
ATOM   6121  O  O4    . DT  I 5  2   ? 5.992   -7.275  90.338 1.00 160.71 ? -71  DT  I O4    1 
ATOM   6122  C  C5    . DT  I 5  2   ? 6.941   -5.325  91.298 1.00 165.41 ? -71  DT  I C5    1 
ATOM   6123  C  C7    . DT  I 5  2   ? 5.935   -4.407  90.678 1.00 157.22 ? -71  DT  I C7    1 
ATOM   6124  C  C6    . DT  I 5  2   ? 7.935   -4.891  92.084 1.00 173.51 ? -71  DT  I C6    1 
ATOM   6125  P  P     . DC  I 5  3   ? 14.070  -4.170  93.687 1.00 170.93 ? -70  DC  I P     1 
ATOM   6126  O  OP1   . DC  I 5  3   ? 15.213  -4.151  94.640 1.00 165.15 ? -70  DC  I OP1   1 
ATOM   6127  O  OP2   . DC  I 5  3   ? 14.057  -3.227  92.536 1.00 169.15 ? -70  DC  I OP2   1 
ATOM   6128  O  "O5'" . DC  I 5  3   ? 13.973  -5.649  93.103 1.00 175.55 ? -70  DC  I "O5'" 1 
ATOM   6129  C  "C5'" . DC  I 5  3   ? 14.464  -6.795  93.829 1.00 161.25 ? -70  DC  I "C5'" 1 
ATOM   6130  C  "C4'" . DC  I 5  3   ? 14.438  -8.015  92.936 1.00 159.81 ? -70  DC  I "C4'" 1 
ATOM   6131  O  "O4'" . DC  I 5  3   ? 13.112  -8.162  92.345 1.00 167.49 ? -70  DC  I "O4'" 1 
ATOM   6132  C  "C3'" . DC  I 5  3   ? 15.423  -7.996  91.767 1.00 152.98 ? -70  DC  I "C3'" 1 
ATOM   6133  O  "O3'" . DC  I 5  3   ? 15.997  -9.289  91.594 1.00 144.30 ? -70  DC  I "O3'" 1 
ATOM   6134  C  "C2'" . DC  I 5  3   ? 14.540  -7.624  90.576 1.00 155.65 ? -70  DC  I "C2'" 1 
ATOM   6135  C  "C1'" . DC  I 5  3   ? 13.238  -8.330  90.946 1.00 160.81 ? -70  DC  I "C1'" 1 
ATOM   6136  N  N1    . DC  I 5  3   ? 12.021  -7.813  90.287 1.00 153.75 ? -70  DC  I N1    1 
ATOM   6137  C  C2    . DC  I 5  3   ? 11.158  -8.728  89.676 1.00 145.57 ? -70  DC  I C2    1 
ATOM   6138  O  O2    . DC  I 5  3   ? 11.446  -9.935  89.708 1.00 137.65 ? -70  DC  I O2    1 
ATOM   6139  N  N3    . DC  I 5  3   ? 10.033  -8.277  89.071 1.00 144.86 ? -70  DC  I N3    1 
ATOM   6140  C  C4    . DC  I 5  3   ? 9.761   -6.969  89.059 1.00 141.23 ? -70  DC  I C4    1 
ATOM   6141  N  N4    . DC  I 5  3   ? 8.644   -6.567  88.448 1.00 134.04 ? -70  DC  I N4    1 
ATOM   6142  C  C5    . DC  I 5  3   ? 10.625  -6.014  89.671 1.00 147.05 ? -70  DC  I C5    1 
ATOM   6143  C  C6    . DC  I 5  3   ? 11.733  -6.476  90.269 1.00 152.47 ? -70  DC  I C6    1 
ATOM   6144  P  P     . DA  I 5  4   ? 17.270  -9.523  90.643 1.00 151.83 ? -69  DA  I P     1 
ATOM   6145  O  OP1   . DA  I 5  4   ? 18.469  -9.323  91.492 1.00 156.89 ? -69  DA  I OP1   1 
ATOM   6146  O  OP2   . DA  I 5  4   ? 17.127  -8.743  89.381 1.00 152.19 ? -69  DA  I OP2   1 
ATOM   6147  O  "O5'" . DA  I 5  4   ? 17.244  -11.070 90.262 1.00 143.26 ? -69  DA  I "O5'" 1 
ATOM   6148  C  "C5'" . DA  I 5  4   ? 16.012  -11.814 90.235 1.00 131.05 ? -69  DA  I "C5'" 1 
ATOM   6149  C  "C4'" . DA  I 5  4   ? 15.567  -12.061 88.812 1.00 118.46 ? -69  DA  I "C4'" 1 
ATOM   6150  O  "O4'" . DA  I 5  4   ? 14.473  -11.167 88.477 1.00 122.46 ? -69  DA  I "O4'" 1 
ATOM   6151  C  "C3'" . DA  I 5  4   ? 16.619  -11.871 87.710 1.00 115.97 ? -69  DA  I "C3'" 1 
ATOM   6152  O  "O3'" . DA  I 5  4   ? 16.550  -12.990 86.838 1.00 118.02 ? -69  DA  I "O3'" 1 
ATOM   6153  C  "C2'" . DA  I 5  4   ? 16.117  -10.645 86.945 1.00 115.09 ? -69  DA  I "C2'" 1 
ATOM   6154  C  "C1'" . DA  I 5  4   ? 14.610  -10.796 87.128 1.00 120.39 ? -69  DA  I "C1'" 1 
ATOM   6155  N  N9    . DA  I 5  4   ? 13.781  -9.620  86.872 1.00 113.89 ? -69  DA  I N9    1 
ATOM   6156  C  C8    . DA  I 5  4   ? 14.055  -8.288  87.064 1.00 117.80 ? -69  DA  I C8    1 
ATOM   6157  N  N7    . DA  I 5  4   ? 13.071  -7.491  86.721 1.00 123.48 ? -69  DA  I N7    1 
ATOM   6158  C  C5    . DA  I 5  4   ? 12.083  -8.357  86.271 1.00 120.78 ? -69  DA  I C5    1 
ATOM   6159  C  C6    . DA  I 5  4   ? 10.788  -8.138  85.765 1.00 115.53 ? -69  DA  I C6    1 
ATOM   6160  N  N6    . DA  I 5  4   ? 10.241  -6.928  85.626 1.00 109.70 ? -69  DA  I N6    1 
ATOM   6161  N  N1    . DA  I 5  4   ? 10.061  -9.222  85.412 1.00 119.24 ? -69  DA  I N1    1 
ATOM   6162  C  C2    . DA  I 5  4   ? 10.607  -10.437 85.561 1.00 115.11 ? -69  DA  I C2    1 
ATOM   6163  N  N3    . DA  I 5  4   ? 11.813  -10.770 86.014 1.00 106.94 ? -69  DA  I N3    1 
ATOM   6164  C  C4    . DA  I 5  4   ? 12.508  -9.671  86.359 1.00 114.15 ? -69  DA  I C4    1 
ATOM   6165  P  P     . DA  I 5  5   ? 17.510  -14.256 86.986 1.00 121.27 ? -68  DA  I P     1 
ATOM   6166  O  OP1   . DA  I 5  5   ? 17.358  -14.874 88.332 1.00 109.22 ? -68  DA  I OP1   1 
ATOM   6167  O  OP2   . DA  I 5  5   ? 18.844  -13.812 86.509 1.00 110.72 ? -68  DA  I OP2   1 
ATOM   6168  O  "O5'" . DA  I 5  5   ? 16.942  -15.282 85.908 1.00 127.82 ? -68  DA  I "O5'" 1 
ATOM   6169  C  "C5'" . DA  I 5  5   ? 15.667  -15.935 86.088 1.00 123.52 ? -68  DA  I "C5'" 1 
ATOM   6170  C  "C4'" . DA  I 5  5   ? 14.841  -15.876 84.819 1.00 116.21 ? -68  DA  I "C4'" 1 
ATOM   6171  O  "O4'" . DA  I 5  5   ? 14.201  -14.578 84.707 1.00 110.20 ? -68  DA  I "O4'" 1 
ATOM   6172  C  "C3'" . DA  I 5  5   ? 15.584  -16.111 83.499 1.00 108.41 ? -68  DA  I "C3'" 1 
ATOM   6173  O  "O3'" . DA  I 5  5   ? 14.835  -17.039 82.729 1.00 116.01 ? -68  DA  I "O3'" 1 
ATOM   6174  C  "C2'" . DA  I 5  5   ? 15.580  -14.738 82.830 1.00 99.22  ? -68  DA  I "C2'" 1 
ATOM   6175  C  "C1'" . DA  I 5  5   ? 14.287  -14.137 83.375 1.00 107.62 ? -68  DA  I "C1'" 1 
ATOM   6176  N  N9    . DA  I 5  5   ? 14.267  -12.677 83.376 1.00 116.27 ? -68  DA  I N9    1 
ATOM   6177  C  C8    . DA  I 5  5   ? 15.281  -11.820 83.722 1.00 119.35 ? -68  DA  I C8    1 
ATOM   6178  N  N7    . DA  I 5  5   ? 14.965  -10.553 83.609 1.00 130.80 ? -68  DA  I N7    1 
ATOM   6179  C  C5    . DA  I 5  5   ? 13.651  -10.577 83.160 1.00 120.90 ? -68  DA  I C5    1 
ATOM   6180  C  C6    . DA  I 5  5   ? 12.740  -9.553  82.844 1.00 115.92 ? -68  DA  I C6    1 
ATOM   6181  N  N6    . DA  I 5  5   ? 13.026  -8.253  82.934 1.00 107.27 ? -68  DA  I N6    1 
ATOM   6182  N  N1    . DA  I 5  5   ? 11.510  -9.916  82.420 1.00 123.09 ? -68  DA  I N1    1 
ATOM   6183  C  C2    . DA  I 5  5   ? 11.225  -11.222 82.324 1.00 115.97 ? -68  DA  I C2    1 
ATOM   6184  N  N3    . DA  I 5  5   ? 11.995  -12.275 82.591 1.00 111.89 ? -68  DA  I N3    1 
ATOM   6185  C  C4    . DA  I 5  5   ? 13.209  -11.879 83.013 1.00 118.33 ? -68  DA  I C4    1 
ATOM   6186  P  P     . DT  I 5  6   ? 15.452  -17.884 81.514 1.00 123.33 ? -67  DT  I P     1 
ATOM   6187  O  OP1   . DT  I 5  6   ? 15.236  -19.314 81.856 1.00 109.99 ? -67  DT  I OP1   1 
ATOM   6188  O  OP2   . DT  I 5  6   ? 16.822  -17.384 81.197 1.00 111.91 ? -67  DT  I OP2   1 
ATOM   6189  O  "O5'" . DT  I 5  6   ? 14.524  -17.571 80.254 1.00 120.58 ? -67  DT  I "O5'" 1 
ATOM   6190  C  "C5'" . DT  I 5  6   ? 13.145  -17.166 80.406 1.00 105.65 ? -67  DT  I "C5'" 1 
ATOM   6191  C  "C4'" . DT  I 5  6   ? 12.777  -16.114 79.384 1.00 102.82 ? -67  DT  I "C4'" 1 
ATOM   6192  O  "O4'" . DT  I 5  6   ? 13.033  -14.780 79.882 1.00 99.53  ? -67  DT  I "O4'" 1 
ATOM   6193  C  "C3'" . DT  I 5  6   ? 13.515  -16.217 78.045 1.00 100.65 ? -67  DT  I "C3'" 1 
ATOM   6194  O  "O3'" . DT  I 5  6   ? 12.602  -16.740 77.073 1.00 105.46 ? -67  DT  I "O3'" 1 
ATOM   6195  C  "C2'" . DT  I 5  6   ? 13.976  -14.792 77.752 1.00 96.27  ? -67  DT  I "C2'" 1 
ATOM   6196  C  "C1'" . DT  I 5  6   ? 13.217  -13.943 78.758 1.00 97.66  ? -67  DT  I "C1'" 1 
ATOM   6197  N  N1    . DT  I 5  6   ? 13.889  -12.692 79.201 1.00 104.98 ? -67  DT  I N1    1 
ATOM   6198  C  C2    . DT  I 5  6   ? 13.179  -11.515 79.084 1.00 104.65 ? -67  DT  I C2    1 
ATOM   6199  O  O2    . DT  I 5  6   ? 12.039  -11.463 78.657 1.00 103.14 ? -67  DT  I O2    1 
ATOM   6200  N  N3    . DT  I 5  6   ? 13.855  -10.394 79.502 1.00 106.30 ? -67  DT  I N3    1 
ATOM   6201  C  C4    . DT  I 5  6   ? 15.140  -10.333 80.007 1.00 108.30 ? -67  DT  I C4    1 
ATOM   6202  O  O4    . DT  I 5  6   ? 15.613  -9.250  80.340 1.00 111.68 ? -67  DT  I O4    1 
ATOM   6203  C  C5    . DT  I 5  6   ? 15.831  -11.602 80.092 1.00 105.51 ? -67  DT  I C5    1 
ATOM   6204  C  C7    . DT  I 5  6   ? 17.231  -11.633 80.617 1.00 104.32 ? -67  DT  I C7    1 
ATOM   6205  C  C6    . DT  I 5  6   ? 15.181  -12.703 79.686 1.00 106.47 ? -67  DT  I C6    1 
ATOM   6206  P  P     . DA  I 5  7   ? 12.892  -16.851 75.494 1.00 107.94 ? -66  DA  I P     1 
ATOM   6207  O  OP1   . DA  I 5  7   ? 12.323  -18.150 75.062 1.00 103.66 ? -66  DA  I OP1   1 
ATOM   6208  O  OP2   . DA  I 5  7   ? 14.306  -16.532 75.176 1.00 110.05 ? -66  DA  I OP2   1 
ATOM   6209  O  "O5'" . DA  I 5  7   ? 11.993  -15.674 74.907 1.00 104.66 ? -66  DA  I "O5'" 1 
ATOM   6210  C  "C5'" . DA  I 5  7   ? 10.618  -15.534 75.317 1.00 99.80  ? -66  DA  I "C5'" 1 
ATOM   6211  C  "C4'" . DA  I 5  7   ? 10.076  -14.183 74.912 1.00 99.88  ? -66  DA  I "C4'" 1 
ATOM   6212  O  "O4'" . DA  I 5  7   ? 10.790  -13.137 75.622 1.00 101.08 ? -66  DA  I "O4'" 1 
ATOM   6213  C  "C3'" . DA  I 5  7   ? 10.161  -13.834 73.425 1.00 100.82 ? -66  DA  I "C3'" 1 
ATOM   6214  O  "O3'" . DA  I 5  7   ? 8.962   -13.166 73.066 1.00 96.89  ? -66  DA  I "O3'" 1 
ATOM   6215  C  "C2'" . DA  I 5  7   ? 11.347  -12.877 73.356 1.00 105.75 ? -66  DA  I "C2'" 1 
ATOM   6216  C  "C1'" . DA  I 5  7   ? 11.246  -12.166 74.704 1.00 106.52 ? -66  DA  I "C1'" 1 
ATOM   6217  N  N9    . DA  I 5  7   ? 12.535  -11.666 75.178 1.00 108.35 ? -66  DA  I N9    1 
ATOM   6218  C  C8    . DA  I 5  7   ? 13.674  -12.402 75.389 1.00 106.17 ? -66  DA  I C8    1 
ATOM   6219  N  N7    . DA  I 5  7   ? 14.692  -11.692 75.810 1.00 111.20 ? -66  DA  I N7    1 
ATOM   6220  C  C5    . DA  I 5  7   ? 14.193  -10.399 75.873 1.00 108.49 ? -66  DA  I C5    1 
ATOM   6221  C  C6    . DA  I 5  7   ? 14.780  -9.176  76.241 1.00 111.18 ? -66  DA  I C6    1 
ATOM   6222  N  N6    . DA  I 5  7   ? 16.047  -9.055  76.639 1.00 115.81 ? -66  DA  I N6    1 
ATOM   6223  N  N1    . DA  I 5  7   ? 14.009  -8.068  76.191 1.00 109.15 ? -66  DA  I N1    1 
ATOM   6224  C  C2    . DA  I 5  7   ? 12.737  -8.191  75.793 1.00 106.12 ? -66  DA  I C2    1 
ATOM   6225  N  N3    . DA  I 5  7   ? 12.071  -9.284  75.423 1.00 105.44 ? -66  DA  I N3    1 
ATOM   6226  C  C4    . DA  I 5  7   ? 12.866  -10.367 75.485 1.00 108.80 ? -66  DA  I C4    1 
ATOM   6227  P  P     . DT  I 5  8   ? 8.620   -12.917 71.541 1.00 101.12 ? -65  DT  I P     1 
ATOM   6228  O  OP1   . DT  I 5  8   ? 7.149   -13.039 71.436 1.00 107.84 ? -65  DT  I OP1   1 
ATOM   6229  O  OP2   . DT  I 5  8   ? 9.505   -13.764 70.689 1.00 94.95  ? -65  DT  I OP2   1 
ATOM   6230  O  "O5'" . DT  I 5  8   ? 8.970   -11.372 71.387 1.00 100.39 ? -65  DT  I "O5'" 1 
ATOM   6231  C  "C5'" . DT  I 5  8   ? 8.391   -10.398 72.278 1.00 102.68 ? -65  DT  I "C5'" 1 
ATOM   6232  C  "C4'" . DT  I 5  8   ? 8.927   -9.021  71.962 1.00 108.26 ? -65  DT  I "C4'" 1 
ATOM   6233  O  "O4'" . DT  I 5  8   ? 10.227  -8.854  72.571 1.00 112.75 ? -65  DT  I "O4'" 1 
ATOM   6234  C  "C3'" . DT  I 5  8   ? 9.113   -8.734  70.468 1.00 114.44 ? -65  DT  I "C3'" 1 
ATOM   6235  O  "O3'" . DT  I 5  8   ? 8.427   -7.516  70.162 1.00 115.13 ? -65  DT  I "O3'" 1 
ATOM   6236  C  "C2'" . DT  I 5  8   ? 10.625  -8.660  70.290 1.00 109.73 ? -65  DT  I "C2'" 1 
ATOM   6237  C  "C1'" . DT  I 5  8   ? 11.082  -8.194  71.658 1.00 110.19 ? -65  DT  I "C1'" 1 
ATOM   6238  N  N1    . DT  I 5  8   ? 12.471  -8.516  72.034 1.00 103.49 ? -65  DT  I N1    1 
ATOM   6239  C  C2    . DT  I 5  8   ? 13.247  -7.522  72.594 1.00 107.63 ? -65  DT  I C2    1 
ATOM   6240  O  O2    . DT  I 5  8   ? 12.851  -6.379  72.765 1.00 104.95 ? -65  DT  I O2    1 
ATOM   6241  N  N3    . DT  I 5  8   ? 14.515  -7.920  72.947 1.00 107.50 ? -65  DT  I N3    1 
ATOM   6242  C  C4    . DT  I 5  8   ? 15.067  -9.180  72.801 1.00 107.11 ? -65  DT  I C4    1 
ATOM   6243  O  O4    . DT  I 5  8   ? 16.222  -9.389  73.166 1.00 106.63 ? -65  DT  I O4    1 
ATOM   6244  C  C5    . DT  I 5  8   ? 14.193  -10.172 72.213 1.00 108.30 ? -65  DT  I C5    1 
ATOM   6245  C  C7    . DT  I 5  8   ? 14.702  -11.566 72.018 1.00 96.55  ? -65  DT  I C7    1 
ATOM   6246  C  C6    . DT  I 5  8   ? 12.952  -9.797  71.874 1.00 100.93 ? -65  DT  I C6    1 
ATOM   6247  P  P     . DC  I 5  9   ? 8.150   -7.017  68.670 1.00 114.89 ? -64  DC  I P     1 
ATOM   6248  O  OP1   . DC  I 5  9   ? 6.726   -6.607  68.604 1.00 118.67 ? -64  DC  I OP1   1 
ATOM   6249  O  OP2   . DC  I 5  9   ? 8.675   -8.012  67.699 1.00 111.91 ? -64  DC  I OP2   1 
ATOM   6250  O  "O5'" . DC  I 5  9   ? 9.041   -5.697  68.599 1.00 125.51 ? -64  DC  I "O5'" 1 
ATOM   6251  C  "C5'" . DC  I 5  9   ? 8.998   -4.715  69.657 1.00 126.61 ? -64  DC  I "C5'" 1 
ATOM   6252  C  "C4'" . DC  I 5  9   ? 10.238  -3.854  69.624 1.00 131.41 ? -64  DC  I "C4'" 1 
ATOM   6253  O  "O4'" . DC  I 5  9   ? 11.375  -4.604  70.131 1.00 126.55 ? -64  DC  I "O4'" 1 
ATOM   6254  C  "C3'" . DC  I 5  9   ? 10.636  -3.345  68.239 1.00 135.46 ? -64  DC  I "C3'" 1 
ATOM   6255  O  "O3'" . DC  I 5  9   ? 10.682  -1.921  68.186 1.00 143.31 ? -64  DC  I "O3'" 1 
ATOM   6256  C  "C2'" . DC  I 5  9   ? 11.984  -4.018  67.966 1.00 130.80 ? -64  DC  I "C2'" 1 
ATOM   6257  C  "C1'" . DC  I 5  9   ? 12.513  -4.266  69.378 1.00 126.95 ? -64  DC  I "C1'" 1 
ATOM   6258  N  N1    . DC  I 5  9   ? 13.463  -5.387  69.442 1.00 128.07 ? -64  DC  I N1    1 
ATOM   6259  C  C2    . DC  I 5  9   ? 14.709  -5.193  70.051 1.00 130.69 ? -64  DC  I C2    1 
ATOM   6260  O  O2    . DC  I 5  9   ? 14.974  -4.083  70.538 1.00 131.37 ? -64  DC  I O2    1 
ATOM   6261  N  N3    . DC  I 5  9   ? 15.590  -6.220  70.094 1.00 126.43 ? -64  DC  I N3    1 
ATOM   6262  C  C4    . DC  I 5  9   ? 15.267  -7.399  69.555 1.00 121.37 ? -64  DC  I C4    1 
ATOM   6263  N  N4    . DC  I 5  9   ? 16.164  -8.387  69.626 1.00 115.93 ? -64  DC  I N4    1 
ATOM   6264  C  C5    . DC  I 5  9   ? 14.008  -7.620  68.923 1.00 117.23 ? -64  DC  I C5    1 
ATOM   6265  C  C6    . DC  I 5  9   ? 13.147  -6.595  68.886 1.00 121.47 ? -64  DC  I C6    1 
ATOM   6266  P  P     . DC  I 5  10  ? 9.892   -1.132  67.033 1.00 135.62 ? -63  DC  I P     1 
ATOM   6267  O  OP1   . DC  I 5  10  ? 8.975   -0.172  67.705 1.00 127.43 ? -63  DC  I OP1   1 
ATOM   6268  O  OP2   . DC  I 5  10  ? 9.340   -2.131  66.075 1.00 127.63 ? -63  DC  I OP2   1 
ATOM   6269  O  "O5'" . DC  I 5  10  ? 11.041  -0.305  66.299 1.00 133.57 ? -63  DC  I "O5'" 1 
ATOM   6270  C  "C5'" . DC  I 5  10  ? 12.234  -0.946  65.802 1.00 125.84 ? -63  DC  I "C5'" 1 
ATOM   6271  C  "C4'" . DC  I 5  10  ? 13.456  -0.376  66.484 1.00 133.36 ? -63  DC  I "C4'" 1 
ATOM   6272  O  "O4'" . DC  I 5  10  ? 13.925  -1.322  67.476 1.00 128.40 ? -63  DC  I "O4'" 1 
ATOM   6273  C  "C3'" . DC  I 5  10  ? 14.638  -0.093  65.566 1.00 140.86 ? -63  DC  I "C3'" 1 
ATOM   6274  O  "O3'" . DC  I 5  10  ? 14.625  1.296   65.231 1.00 150.81 ? -63  DC  I "O3'" 1 
ATOM   6275  C  "C2'" . DC  I 5  10  ? 15.859  -0.366  66.444 1.00 138.37 ? -63  DC  I "C2'" 1 
ATOM   6276  C  "C1'" . DC  I 5  10  ? 15.335  -1.375  67.466 1.00 128.54 ? -63  DC  I "C1'" 1 
ATOM   6277  N  N1    . DC  I 5  10  ? 15.752  -2.767  67.222 1.00 136.59 ? -63  DC  I N1    1 
ATOM   6278  C  C2    . DC  I 5  10  ? 16.990  -3.196  67.719 1.00 143.14 ? -63  DC  I C2    1 
ATOM   6279  O  O2    . DC  I 5  10  ? 17.708  -2.384  68.323 1.00 143.91 ? -63  DC  I O2    1 
ATOM   6280  N  N3    . DC  I 5  10  ? 17.373  -4.480  67.520 1.00 141.90 ? -63  DC  I N3    1 
ATOM   6281  C  C4    . DC  I 5  10  ? 16.569  -5.323  66.865 1.00 135.45 ? -63  DC  I C4    1 
ATOM   6282  N  N4    . DC  I 5  10  ? 16.988  -6.578  66.690 1.00 125.35 ? -63  DC  I N4    1 
ATOM   6283  C  C5    . DC  I 5  10  ? 15.301  -4.913  66.355 1.00 129.35 ? -63  DC  I C5    1 
ATOM   6284  C  C6    . DC  I 5  10  ? 14.938  -3.639  66.552 1.00 133.45 ? -63  DC  I C6    1 
ATOM   6285  P  P     . DA  I 5  11  ? 15.470  1.970   64.038 1.00 140.70 ? -62  DA  I P     1 
ATOM   6286  O  OP1   . DA  I 5  11  ? 14.491  2.851   63.351 1.00 138.13 ? -62  DA  I OP1   1 
ATOM   6287  O  OP2   . DA  I 5  11  ? 16.169  0.918   63.257 1.00 133.87 ? -62  DA  I OP2   1 
ATOM   6288  O  "O5'" . DA  I 5  11  ? 16.580  2.879   64.741 1.00 146.18 ? -62  DA  I "O5'" 1 
ATOM   6289  C  "C5'" . DA  I 5  11  ? 17.274  2.466   65.945 1.00 148.23 ? -62  DA  I "C5'" 1 
ATOM   6290  C  "C4'" . DA  I 5  11  ? 18.672  1.953   65.642 1.00 154.42 ? -62  DA  I "C4'" 1 
ATOM   6291  O  "O4'" . DA  I 5  11  ? 18.710  0.507   65.793 1.00 158.37 ? -62  DA  I "O4'" 1 
ATOM   6292  C  "C3'" . DA  I 5  11  ? 19.243  2.263   64.253 1.00 161.04 ? -62  DA  I "C3'" 1 
ATOM   6293  O  "O3'" . DA  I 5  11  ? 20.521  2.891   64.325 1.00 170.59 ? -62  DA  I "O3'" 1 
ATOM   6294  C  "C2'" . DA  I 5  11  ? 19.358  0.894   63.580 1.00 153.19 ? -62  DA  I "C2'" 1 
ATOM   6295  C  "C1'" . DA  I 5  11  ? 19.518  -0.043  64.775 1.00 150.05 ? -62  DA  I "C1'" 1 
ATOM   6296  N  N9    . DA  I 5  11  ? 19.048  -1.399  64.482 1.00 139.21 ? -62  DA  I N9    1 
ATOM   6297  C  C8    . DA  I 5  11  ? 17.804  -1.767  64.033 1.00 131.30 ? -62  DA  I C8    1 
ATOM   6298  N  N7    . DA  I 5  11  ? 17.672  -3.055  63.835 1.00 128.92 ? -62  DA  I N7    1 
ATOM   6299  C  C5    . DA  I 5  11  ? 18.918  -3.572  64.160 1.00 138.00 ? -62  DA  I C5    1 
ATOM   6300  C  C6    . DA  I 5  11  ? 19.430  -4.883  64.155 1.00 142.26 ? -62  DA  I C6    1 
ATOM   6301  N  N6    . DA  I 5  11  ? 18.718  -5.955  63.797 1.00 137.03 ? -62  DA  I N6    1 
ATOM   6302  N  N1    . DA  I 5  11  ? 20.716  -5.057  64.535 1.00 138.81 ? -62  DA  I N1    1 
ATOM   6303  C  C2    . DA  I 5  11  ? 21.428  -3.982  64.894 1.00 138.03 ? -62  DA  I C2    1 
ATOM   6304  N  N3    . DA  I 5  11  ? 21.060  -2.702  64.938 1.00 144.96 ? -62  DA  I N3    1 
ATOM   6305  C  C4    . DA  I 5  11  ? 19.779  -2.562  64.554 1.00 139.85 ? -62  DA  I C4    1 
ATOM   6306  P  P     . DC  I 5  12  ? 21.203  3.520   63.012 1.00 172.09 ? -61  DC  I P     1 
ATOM   6307  O  OP1   . DC  I 5  12  ? 21.970  4.724   63.428 1.00 166.05 ? -61  DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I 5  12  ? 20.205  3.613   61.903 1.00 158.21 ? -61  DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I 5  12  ? 22.270  2.406   62.622 1.00 163.48 ? -61  DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I 5  12  ? 23.313  2.018   63.534 1.00 159.96 ? -61  DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I 5  12  ? 24.137  0.919   62.908 1.00 165.67 ? -61  DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I 5  12  ? 23.384  -0.327  62.950 1.00 163.52 ? -61  DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I 5  12  ? 24.516  1.146   61.444 1.00 165.05 ? -61  DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I 5  12  ? 25.880  0.821   61.192 1.00 170.56 ? -61  DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I 5  12  ? 23.567  0.223   60.684 1.00 157.06 ? -61  DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I 5  12  ? 23.401  -0.928  61.673 1.00 154.48 ? -61  DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I 5  12  ? 22.140  -1.663  61.478 1.00 151.63 ? -61  DC  I N1    1 
ATOM   6318  C  C2    . DC  I 5  12  ? 22.104  -3.041  61.728 1.00 142.04 ? -61  DC  I C2    1 
ATOM   6319  O  O2    . DC  I 5  12  ? 23.130  -3.604  62.141 1.00 142.30 ? -61  DC  I O2    1 
ATOM   6320  N  N3    . DC  I 5  12  ? 20.951  -3.720  61.523 1.00 136.21 ? -61  DC  I N3    1 
ATOM   6321  C  C4    . DC  I 5  12  ? 19.868  -3.076  61.079 1.00 132.14 ? -61  DC  I C4    1 
ATOM   6322  N  N4    . DC  I 5  12  ? 18.752  -3.784  60.892 1.00 124.38 ? -61  DC  I N4    1 
ATOM   6323  C  C5    . DC  I 5  12  ? 19.880  -1.677  60.807 1.00 137.58 ? -61  DC  I C5    1 
ATOM   6324  C  C6    . DC  I 5  12  ? 21.028  -1.017  61.012 1.00 148.70 ? -61  DC  I C6    1 
ATOM   6325  P  P     . DC  I 5  13  ? 26.486  0.816   59.703 1.00 163.30 ? -60  DC  I P     1 
ATOM   6326  O  OP1   . DC  I 5  13  ? 27.908  1.239   59.765 1.00 175.34 ? -60  DC  I OP1   1 
ATOM   6327  O  OP2   . DC  I 5  13  ? 25.545  1.535   58.803 1.00 155.07 ? -60  DC  I OP2   1 
ATOM   6328  O  "O5'" . DC  I 5  13  ? 26.503  -0.741  59.366 1.00 157.54 ? -60  DC  I "O5'" 1 
ATOM   6329  C  "C5'" . DC  I 5  13  ? 27.136  -1.682  60.262 1.00 163.61 ? -60  DC  I "C5'" 1 
ATOM   6330  C  "C4'" . DC  I 5  13  ? 27.376  -3.002  59.563 1.00 167.39 ? -60  DC  I "C4'" 1 
ATOM   6331  O  "O4'" . DC  I 5  13  ? 26.145  -3.779  59.551 1.00 168.71 ? -60  DC  I "O4'" 1 
ATOM   6332  C  "C3'" . DC  I 5  13  ? 27.841  -2.913  58.113 1.00 167.97 ? -60  DC  I "C3'" 1 
ATOM   6333  O  "O3'" . DC  I 5  13  ? 28.824  -3.902  57.812 1.00 167.93 ? -60  DC  I "O3'" 1 
ATOM   6334  C  "C2'" . DC  I 5  13  ? 26.546  -3.087  57.320 1.00 168.13 ? -60  DC  I "C2'" 1 
ATOM   6335  C  "C1'" . DC  I 5  13  ? 25.748  -4.038  58.215 1.00 158.08 ? -60  DC  I "C1'" 1 
ATOM   6336  N  N1    . DC  I 5  13  ? 24.285  -3.853  58.122 1.00 142.71 ? -60  DC  I N1    1 
ATOM   6337  C  C2    . DC  I 5  13  ? 23.446  -4.970  58.240 1.00 132.62 ? -60  DC  I C2    1 
ATOM   6338  O  O2    . DC  I 5  13  ? 23.956  -6.088  58.413 1.00 117.24 ? -60  DC  I O2    1 
ATOM   6339  N  N3    . DC  I 5  13  ? 22.104  -4.800  58.162 1.00 128.78 ? -60  DC  I N3    1 
ATOM   6340  C  C4    . DC  I 5  13  ? 21.596  -3.579  57.973 1.00 119.78 ? -60  DC  I C4    1 
ATOM   6341  N  N4    . DC  I 5  13  ? 20.269  -3.457  57.901 1.00 106.43 ? -60  DC  I N4    1 
ATOM   6342  C  C5    . DC  I 5  13  ? 22.427  -2.427  57.848 1.00 128.73 ? -60  DC  I C5    1 
ATOM   6343  C  C6    . DC  I 5  13  ? 23.752  -2.608  57.930 1.00 134.71 ? -60  DC  I C6    1 
ATOM   6344  P  P     . DT  I 5  14  ? 29.779  -3.827  56.511 1.00 174.32 ? -59  DT  I P     1 
ATOM   6345  O  OP1   . DT  I 5  14  ? 31.057  -3.181  56.906 1.00 176.52 ? -59  DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I 5  14  ? 29.032  -3.304  55.335 1.00 163.97 ? -59  DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I 5  14  ? 30.106  -5.360  56.218 1.00 172.08 ? -59  DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I 5  14  ? 29.293  -6.419  56.767 1.00 174.54 ? -59  DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I 5  14  ? 28.636  -7.221  55.666 1.00 175.43 ? -59  DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I 5  14  ? 27.209  -6.965  55.650 1.00 178.59 ? -59  DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I 5  14  ? 29.140  -6.933  54.248 1.00 181.23 ? -59  DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I 5  14  ? 29.343  -8.171  53.555 1.00 176.97 ? -59  DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I 5  14  ? 28.017  -6.117  53.627 1.00 183.94 ? -59  DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I 5  14  ? 26.791  -6.685  54.322 1.00 177.01 ? -59  DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I 5  14  ? 25.600  -5.797  54.386 1.00 167.92 ? -59  DT  I N1    1 
ATOM   6356  C  C2    . DT  I 5  14  ? 24.392  -6.368  54.723 1.00 156.40 ? -59  DT  I C2    1 
ATOM   6357  O  O2    . DT  I 5  14  ? 24.264  -7.553  54.984 1.00 160.33 ? -59  DT  I O2    1 
ATOM   6358  N  N3    . DT  I 5  14  ? 23.333  -5.494  54.748 1.00 148.14 ? -59  DT  I N3    1 
ATOM   6359  C  C4    . DT  I 5  14  ? 23.359  -4.139  54.473 1.00 151.17 ? -59  DT  I C4    1 
ATOM   6360  O  O4    . DT  I 5  14  ? 22.324  -3.481  54.542 1.00 142.45 ? -59  DT  I O4    1 
ATOM   6361  C  C5    . DT  I 5  14  ? 24.658  -3.607  54.120 1.00 156.06 ? -59  DT  I C5    1 
ATOM   6362  C  C7    . DT  I 5  14  ? 24.786  -2.150  53.805 1.00 150.11 ? -59  DT  I C7    1 
ATOM   6363  C  C6    . DT  I 5  14  ? 25.697  -4.453  54.090 1.00 162.05 ? -59  DT  I C6    1 
ATOM   6364  P  P     . DG  I 5  15  ? 30.354  -8.328  52.314 1.00 171.42 ? -58  DG  I P     1 
ATOM   6365  O  OP1   . DG  I 5  15  ? 31.706  -8.642  52.846 1.00 169.40 ? -58  DG  I OP1   1 
ATOM   6366  O  OP2   . DG  I 5  15  ? 30.176  -7.194  51.362 1.00 169.33 ? -58  DG  I OP2   1 
ATOM   6367  O  "O5'" . DG  I 5  15  ? 29.828  -9.648  51.597 1.00 162.30 ? -58  DG  I "O5'" 1 
ATOM   6368  C  "C5'" . DG  I 5  15  ? 29.543  -10.846 52.346 1.00 141.98 ? -58  DG  I "C5'" 1 
ATOM   6369  C  "C4'" . DG  I 5  15  ? 28.342  -11.554 51.757 1.00 140.68 ? -58  DG  I "C4'" 1 
ATOM   6370  O  "O4'" . DG  I 5  15  ? 27.152  -10.731 51.913 1.00 144.39 ? -58  DG  I "O4'" 1 
ATOM   6371  C  "C3'" . DG  I 5  15  ? 28.418  -11.900 50.276 1.00 141.77 ? -58  DG  I "C3'" 1 
ATOM   6372  O  "O3'" . DG  I 5  15  ? 27.741  -13.135 50.086 1.00 144.13 ? -58  DG  I "O3'" 1 
ATOM   6373  C  "C2'" . DG  I 5  15  ? 27.686  -10.736 49.611 1.00 144.16 ? -58  DG  I "C2'" 1 
ATOM   6374  C  "C1'" . DG  I 5  15  ? 26.600  -10.428 50.643 1.00 148.04 ? -58  DG  I "C1'" 1 
ATOM   6375  N  N9    . DG  I 5  15  ? 26.170  -9.031  50.659 1.00 150.00 ? -58  DG  I N9    1 
ATOM   6376  C  C8    . DG  I 5  15  ? 26.975  -7.921  50.560 1.00 148.05 ? -58  DG  I C8    1 
ATOM   6377  N  N7    . DG  I 5  15  ? 26.312  -6.799  50.632 1.00 141.65 ? -58  DG  I N7    1 
ATOM   6378  C  C5    . DG  I 5  15  ? 24.990  -7.189  50.795 1.00 138.03 ? -58  DG  I C5    1 
ATOM   6379  C  C6    . DG  I 5  15  ? 23.811  -6.409  50.935 1.00 129.97 ? -58  DG  I C6    1 
ATOM   6380  O  O6    . DG  I 5  15  ? 23.697  -5.178  50.942 1.00 126.42 ? -58  DG  I O6    1 
ATOM   6381  N  N1    . DG  I 5  15  ? 22.683  -7.210  51.078 1.00 130.88 ? -58  DG  I N1    1 
ATOM   6382  C  C2    . DG  I 5  15  ? 22.684  -8.583  51.087 1.00 132.70 ? -58  DG  I C2    1 
ATOM   6383  N  N2    . DG  I 5  15  ? 21.490  -9.174  51.237 1.00 126.21 ? -58  DG  I N2    1 
ATOM   6384  N  N3    . DG  I 5  15  ? 23.775  -9.322  50.959 1.00 142.87 ? -58  DG  I N3    1 
ATOM   6385  C  C4    . DG  I 5  15  ? 24.884  -8.564  50.817 1.00 145.73 ? -58  DG  I C4    1 
ATOM   6386  P  P     . DC  I 5  16  ? 27.958  -13.984 48.751 1.00 154.56 ? -57  DC  I P     1 
ATOM   6387  O  OP1   . DC  I 5  16  ? 28.807  -15.156 49.095 1.00 149.24 ? -57  DC  I OP1   1 
ATOM   6388  O  OP2   . DC  I 5  16  ? 28.386  -13.045 47.673 1.00 130.93 ? -57  DC  I OP2   1 
ATOM   6389  O  "O5'" . DC  I 5  16  ? 26.506  -14.551 48.408 1.00 155.29 ? -57  DC  I "O5'" 1 
ATOM   6390  C  "C5'" . DC  I 5  16  ? 25.316  -14.017 49.031 1.00 149.67 ? -57  DC  I "C5'" 1 
ATOM   6391  C  "C4'" . DC  I 5  16  ? 24.333  -13.514 47.991 1.00 145.17 ? -57  DC  I "C4'" 1 
ATOM   6392  O  "O4'" . DC  I 5  16  ? 24.116  -12.086 48.172 1.00 151.81 ? -57  DC  I "O4'" 1 
ATOM   6393  C  "C3'" . DC  I 5  16  ? 24.719  -13.706 46.520 1.00 142.23 ? -57  DC  I "C3'" 1 
ATOM   6394  O  "O3'" . DC  I 5  16  ? 23.605  -14.172 45.762 1.00 136.63 ? -57  DC  I "O3'" 1 
ATOM   6395  C  "C2'" . DC  I 5  16  ? 25.081  -12.293 46.062 1.00 143.05 ? -57  DC  I "C2'" 1 
ATOM   6396  C  "C1'" . DC  I 5  16  ? 24.119  -11.461 46.907 1.00 146.69 ? -57  DC  I "C1'" 1 
ATOM   6397  N  N1    . DC  I 5  16  ? 24.435  -10.027 47.071 1.00 143.28 ? -57  DC  I N1    1 
ATOM   6398  C  C2    . DC  I 5  16  ? 23.393  -9.167  47.426 1.00 132.14 ? -57  DC  I C2    1 
ATOM   6399  O  O2    . DC  I 5  16  ? 22.262  -9.641  47.606 1.00 124.30 ? -57  DC  I O2    1 
ATOM   6400  N  N3    . DC  I 5  16  ? 23.643  -7.845  47.569 1.00 128.81 ? -57  DC  I N3    1 
ATOM   6401  C  C4    . DC  I 5  16  ? 24.875  -7.374  47.363 1.00 134.80 ? -57  DC  I C4    1 
ATOM   6402  N  N4    . DC  I 5  16  ? 25.075  -6.062  47.514 1.00 132.72 ? -57  DC  I N4    1 
ATOM   6403  C  C5    . DC  I 5  16  ? 25.957  -8.227  46.996 1.00 136.49 ? -57  DC  I C5    1 
ATOM   6404  C  C6    . DC  I 5  16  ? 25.694  -9.535  46.857 1.00 141.79 ? -57  DC  I C6    1 
ATOM   6405  P  P     . DA  I 5  17  ? 23.115  -15.703 45.737 1.00 137.33 ? -56  DA  I P     1 
ATOM   6406  O  OP1   . DA  I 5  17  ? 23.421  -16.340 47.044 1.00 130.02 ? -56  DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I 5  17  ? 23.588  -16.325 44.474 1.00 133.82 ? -56  DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I 5  17  ? 21.527  -15.643 45.628 1.00 141.50 ? -56  DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I 5  17  ? 20.704  -15.413 46.789 1.00 140.63 ? -56  DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I 5  17  ? 19.526  -14.533 46.429 1.00 142.27 ? -56  DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I 5  17  ? 19.983  -13.173 46.186 1.00 139.26 ? -56  DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I 5  17  ? 18.737  -14.936 45.184 1.00 139.34 ? -56  DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I 5  17  ? 17.367  -14.616 45.412 1.00 135.55 ? -56  DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I 5  17  ? 19.388  -14.093 44.085 1.00 138.98 ? -56  DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I 5  17  ? 19.724  -12.806 44.841 1.00 137.52 ? -56  DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I 5  17  ? 20.899  -12.090 44.347 1.00 132.45 ? -56  DA  I N9    1 
ATOM   6417  C  C8    . DA  I 5  17  ? 22.012  -12.611 43.733 1.00 137.38 ? -56  DA  I C8    1 
ATOM   6418  N  N7    . DA  I 5  17  ? 22.926  -11.715 43.448 1.00 139.83 ? -56  DA  I N7    1 
ATOM   6419  C  C5    . DA  I 5  17  ? 22.384  -10.526 43.915 1.00 132.78 ? -56  DA  I C5    1 
ATOM   6420  C  C6    . DA  I 5  17  ? 22.861  -9.204  43.913 1.00 131.89 ? -56  DA  I C6    1 
ATOM   6421  N  N6    . DA  I 5  17  ? 24.040  -8.844  43.402 1.00 131.28 ? -56  DA  I N6    1 
ATOM   6422  N  N1    . DA  I 5  17  ? 22.072  -8.250  44.455 1.00 130.03 ? -56  DA  I N1    1 
ATOM   6423  C  C2    . DA  I 5  17  ? 20.887  -8.611  44.961 1.00 120.57 ? -56  DA  I C2    1 
ATOM   6424  N  N3    . DA  I 5  17  ? 20.331  -9.819  45.026 1.00 124.40 ? -56  DA  I N3    1 
ATOM   6425  C  C4    . DA  I 5  17  ? 21.140  -10.743 44.479 1.00 130.30 ? -56  DA  I C4    1 
ATOM   6426  P  P     . DG  I 5  18  ? 16.154  -15.177 44.530 1.00 136.56 ? -55  DG  I P     1 
ATOM   6427  O  OP1   . DG  I 5  18  ? 15.535  -16.293 45.288 1.00 134.88 ? -55  DG  I OP1   1 
ATOM   6428  O  OP2   . DG  I 5  18  ? 16.633  -15.405 43.137 1.00 133.15 ? -55  DG  I OP2   1 
ATOM   6429  O  "O5'" . DG  I 5  18  ? 15.088  -13.990 44.513 1.00 126.49 ? -55  DG  I "O5'" 1 
ATOM   6430  C  "C5'" . DG  I 5  18  ? 15.414  -12.680 45.016 1.00 122.03 ? -55  DG  I "C5'" 1 
ATOM   6431  C  "C4'" . DG  I 5  18  ? 15.453  -11.662 43.896 1.00 123.95 ? -55  DG  I "C4'" 1 
ATOM   6432  O  "O4'" . DG  I 5  18  ? 16.835  -11.322 43.571 1.00 132.45 ? -55  DG  I "O4'" 1 
ATOM   6433  C  "C3'" . DG  I 5  18  ? 14.795  -12.051 42.565 1.00 118.73 ? -55  DG  I "C3'" 1 
ATOM   6434  O  "O3'" . DG  I 5  18  ? 14.068  -10.938 42.040 1.00 112.80 ? -55  DG  I "O3'" 1 
ATOM   6435  C  "C2'" . DG  I 5  18  ? 15.993  -12.202 41.624 1.00 126.50 ? -55  DG  I "C2'" 1 
ATOM   6436  C  "C1'" . DG  I 5  18  ? 16.911  -11.120 42.180 1.00 133.83 ? -55  DG  I "C1'" 1 
ATOM   6437  N  N9    . DG  I 5  18  ? 18.307  -11.091 41.744 1.00 133.30 ? -55  DG  I N9    1 
ATOM   6438  C  C8    . DG  I 5  18  ? 19.071  -12.127 41.261 1.00 131.71 ? -55  DG  I C8    1 
ATOM   6439  N  N7    . DG  I 5  18  ? 20.274  -11.757 40.912 1.00 137.39 ? -55  DG  I N7    1 
ATOM   6440  C  C5    . DG  I 5  18  ? 20.295  -10.389 41.151 1.00 141.12 ? -55  DG  I C5    1 
ATOM   6441  C  C6    . DG  I 5  18  ? 21.331  -9.435  40.958 1.00 141.64 ? -55  DG  I C6    1 
ATOM   6442  O  O6    . DG  I 5  18  ? 22.476  -9.615  40.525 1.00 139.41 ? -55  DG  I O6    1 
ATOM   6443  N  N1    . DG  I 5  18  ? 20.926  -8.157  41.333 1.00 140.30 ? -55  DG  I N1    1 
ATOM   6444  C  C2    . DG  I 5  18  ? 19.687  -7.835  41.830 1.00 135.84 ? -55  DG  I C2    1 
ATOM   6445  N  N2    . DG  I 5  18  ? 19.489  -6.545  42.135 1.00 139.20 ? -55  DG  I N2    1 
ATOM   6446  N  N3    . DG  I 5  18  ? 18.714  -8.712  42.010 1.00 139.33 ? -55  DG  I N3    1 
ATOM   6447  C  C4    . DG  I 5  18  ? 19.086  -9.962  41.656 1.00 139.34 ? -55  DG  I C4    1 
ATOM   6448  P  P     . DA  I 5  19  ? 12.532  -10.475 42.200 1.00 98.09  ? -54  DA  I P     1 
ATOM   6449  O  OP1   . DA  I 5  19  ? 12.070  -10.519 43.616 1.00 84.31  ? -54  DA  I OP1   1 
ATOM   6450  O  OP2   . DA  I 5  19  ? 11.775  -11.192 41.150 1.00 91.00  ? -54  DA  I OP2   1 
ATOM   6451  O  "O5'" . DA  I 5  19  ? 12.660  -8.961  41.714 1.00 93.66  ? -54  DA  I "O5'" 1 
ATOM   6452  C  "C5'" . DA  I 5  19  ? 13.326  -7.972  42.526 1.00 104.87 ? -54  DA  I "C5'" 1 
ATOM   6453  C  "C4'" . DA  I 5  19  ? 14.027  -6.921  41.687 1.00 107.96 ? -54  DA  I "C4'" 1 
ATOM   6454  O  "O4'" . DA  I 5  19  ? 15.355  -7.380  41.326 1.00 115.42 ? -54  DA  I "O4'" 1 
ATOM   6455  C  "C3'" . DA  I 5  19  ? 13.351  -6.487  40.382 1.00 107.74 ? -54  DA  I "C3'" 1 
ATOM   6456  O  "O3'" . DA  I 5  19  ? 13.238  -5.072  40.361 1.00 104.73 ? -54  DA  I "O3'" 1 
ATOM   6457  C  "C2'" . DA  I 5  19  ? 14.318  -6.959  39.292 1.00 112.72 ? -54  DA  I "C2'" 1 
ATOM   6458  C  "C1'" . DA  I 5  19  ? 15.655  -6.925  40.028 1.00 121.41 ? -54  DA  I "C1'" 1 
ATOM   6459  N  N9    . DA  I 5  19  ? 16.676  -7.802  39.459 1.00 126.41 ? -54  DA  I N9    1 
ATOM   6460  C  C8    . DA  I 5  19  ? 16.572  -9.145  39.192 1.00 136.57 ? -54  DA  I C8    1 
ATOM   6461  N  N7    . DA  I 5  19  ? 17.660  -9.670  38.686 1.00 138.99 ? -54  DA  I N7    1 
ATOM   6462  C  C5    . DA  I 5  19  ? 18.542  -8.601  38.613 1.00 141.33 ? -54  DA  I C5    1 
ATOM   6463  C  C6    . DA  I 5  19  ? 19.869  -8.500  38.160 1.00 144.86 ? -54  DA  I C6    1 
ATOM   6464  N  N6    . DA  I 5  19  ? 20.567  -9.532  37.681 1.00 146.08 ? -54  DA  I N6    1 
ATOM   6465  N  N1    . DA  I 5  19  ? 20.464  -7.289  38.225 1.00 145.46 ? -54  DA  I N1    1 
ATOM   6466  C  C2    . DA  I 5  19  ? 19.764  -6.256  38.713 1.00 139.81 ? -54  DA  I C2    1 
ATOM   6467  N  N3    . DA  I 5  19  ? 18.512  -6.225  39.164 1.00 134.82 ? -54  DA  I N3    1 
ATOM   6468  C  C4    . DA  I 5  19  ? 17.950  -7.444  39.086 1.00 135.28 ? -54  DA  I C4    1 
ATOM   6469  P  P     . DT  I 5  20  ? 12.051  -4.386  39.538 1.00 111.58 ? -53  DT  I P     1 
ATOM   6470  O  OP1   . DT  I 5  20  ? 11.038  -3.916  40.520 1.00 120.58 ? -53  DT  I OP1   1 
ATOM   6471  O  OP2   . DT  I 5  20  ? 11.647  -5.279  38.419 1.00 99.26  ? -53  DT  I OP2   1 
ATOM   6472  O  "O5'" . DT  I 5  20  ? 12.709  -3.085  38.897 1.00 123.08 ? -53  DT  I "O5'" 1 
ATOM   6473  C  "C5'" . DT  I 5  20  ? 13.829  -2.434  39.523 1.00 125.26 ? -53  DT  I "C5'" 1 
ATOM   6474  C  "C4'" . DT  I 5  20  ? 14.954  -2.222  38.534 1.00 140.25 ? -53  DT  I "C4'" 1 
ATOM   6475  O  "O4'" . DT  I 5  20  ? 15.661  -3.456  38.254 1.00 133.79 ? -53  DT  I "O4'" 1 
ATOM   6476  C  "C3'" . DT  I 5  20  ? 14.568  -1.633  37.165 1.00 141.39 ? -53  DT  I "C3'" 1 
ATOM   6477  O  "O3'" . DT  I 5  20  ? 15.307  -0.419  36.960 1.00 147.18 ? -53  DT  I "O3'" 1 
ATOM   6478  C  "C2'" . DT  I 5  20  ? 15.033  -2.689  36.172 1.00 138.21 ? -53  DT  I "C2'" 1 
ATOM   6479  C  "C1'" . DT  I 5  20  ? 16.175  -3.305  36.947 1.00 140.54 ? -53  DT  I "C1'" 1 
ATOM   6480  N  N1    . DT  I 5  20  ? 16.698  -4.607  36.489 1.00 141.98 ? -53  DT  I N1    1 
ATOM   6481  C  C2    . DT  I 5  20  ? 18.037  -4.667  36.171 1.00 141.50 ? -53  DT  I C2    1 
ATOM   6482  O  O2    . DT  I 5  20  ? 18.785  -3.706  36.251 1.00 140.37 ? -53  DT  I O2    1 
ATOM   6483  N  N3    . DT  I 5  20  ? 18.471  -5.901  35.753 1.00 137.02 ? -53  DT  I N3    1 
ATOM   6484  C  C4    . DT  I 5  20  ? 17.718  -7.053  35.625 1.00 134.37 ? -53  DT  I C4    1 
ATOM   6485  O  O4    . DT  I 5  20  ? 18.248  -8.090  35.238 1.00 125.75 ? -53  DT  I O4    1 
ATOM   6486  C  C5    . DT  I 5  20  ? 16.319  -6.917  35.972 1.00 140.93 ? -53  DT  I C5    1 
ATOM   6487  C  C7    . DT  I 5  20  ? 15.425  -8.111  35.864 1.00 138.58 ? -53  DT  I C7    1 
ATOM   6488  C  C6    . DT  I 5  20  ? 15.886  -5.716  36.379 1.00 141.68 ? -53  DT  I C6    1 
ATOM   6489  P  P     . DA  I 5  21  ? 15.398  0.383   35.571 1.00 150.65 ? -52  DA  I P     1 
ATOM   6490  O  OP1   . DA  I 5  21  ? 15.940  1.729   35.891 1.00 156.05 ? -52  DA  I OP1   1 
ATOM   6491  O  OP2   . DA  I 5  21  ? 14.101  0.258   34.851 1.00 153.95 ? -52  DA  I OP2   1 
ATOM   6492  O  "O5'" . DA  I 5  21  ? 16.514  -0.366  34.717 1.00 142.45 ? -52  DA  I "O5'" 1 
ATOM   6493  C  "C5'" . DA  I 5  21  ? 17.896  -0.309  35.112 1.00 148.86 ? -52  DA  I "C5'" 1 
ATOM   6494  C  "C4'" . DA  I 5  21  ? 18.796  -0.595  33.933 1.00 158.04 ? -52  DA  I "C4'" 1 
ATOM   6495  O  "O4'" . DA  I 5  21  ? 19.029  -2.028  33.830 1.00 165.69 ? -52  DA  I "O4'" 1 
ATOM   6496  C  "C3'" . DA  I 5  21  ? 18.290  -0.148  32.555 1.00 158.55 ? -52  DA  I "C3'" 1 
ATOM   6497  O  "O3'" . DA  I 5  21  ? 19.383  0.440   31.853 1.00 163.12 ? -52  DA  I "O3'" 1 
ATOM   6498  C  "C2'" . DA  I 5  21  ? 17.904  -1.467  31.887 1.00 155.09 ? -52  DA  I "C2'" 1 
ATOM   6499  C  "C1'" . DA  I 5  21  ? 18.960  -2.398  32.472 1.00 159.43 ? -52  DA  I "C1'" 1 
ATOM   6500  N  N9    . DA  I 5  21  ? 18.665  -3.827  32.377 1.00 152.98 ? -52  DA  I N9    1 
ATOM   6501  C  C8    . DA  I 5  21  ? 17.547  -4.512  32.789 1.00 140.34 ? -52  DA  I C8    1 
ATOM   6502  N  N7    . DA  I 5  21  ? 17.595  -5.799  32.542 1.00 135.74 ? -52  DA  I N7    1 
ATOM   6503  C  C5    . DA  I 5  21  ? 18.828  -5.975  31.927 1.00 147.26 ? -52  DA  I C5    1 
ATOM   6504  C  C6    . DA  I 5  21  ? 19.482  -7.115  31.420 1.00 144.14 ? -52  DA  I C6    1 
ATOM   6505  N  N6    . DA  I 5  21  ? 18.968  -8.346  31.461 1.00 136.86 ? -52  DA  I N6    1 
ATOM   6506  N  N1    . DA  I 5  21  ? 20.703  -6.944  30.866 1.00 148.67 ? -52  DA  I N1    1 
ATOM   6507  C  C2    . DA  I 5  21  ? 21.220  -5.709  30.821 1.00 153.89 ? -52  DA  I C2    1 
ATOM   6508  N  N3    . DA  I 5  21  ? 20.707  -4.563  31.269 1.00 155.42 ? -52  DA  I N3    1 
ATOM   6509  C  C4    . DA  I 5  21  ? 19.496  -4.768  31.817 1.00 154.46 ? -52  DA  I C4    1 
ATOM   6510  P  P     . DC  I 5  22  ? 19.236  1.303   30.511 1.00 158.79 ? -51  DC  I P     1 
ATOM   6511  O  OP1   . DC  I 5  22  ? 19.012  2.714   30.922 1.00 148.64 ? -51  DC  I OP1   1 
ATOM   6512  O  OP2   . DC  I 5  22  ? 18.261  0.639   29.606 1.00 155.15 ? -51  DC  I OP2   1 
ATOM   6513  O  "O5'" . DC  I 5  22  ? 20.676  1.218   29.828 1.00 166.49 ? -51  DC  I "O5'" 1 
ATOM   6514  C  "C5'" . DC  I 5  22  ? 21.434  -0.012  29.787 1.00 158.65 ? -51  DC  I "C5'" 1 
ATOM   6515  C  "C4'" . DC  I 5  22  ? 21.403  -0.629  28.405 1.00 163.52 ? -51  DC  I "C4'" 1 
ATOM   6516  O  "O4'" . DC  I 5  22  ? 21.004  -2.010  28.540 1.00 163.94 ? -51  DC  I "O4'" 1 
ATOM   6517  C  "C3'" . DC  I 5  22  ? 20.451  0.017   27.394 1.00 168.36 ? -51  DC  I "C3'" 1 
ATOM   6518  O  "O3'" . DC  I 5  22  ? 21.112  0.748   26.355 1.00 174.46 ? -51  DC  I "O3'" 1 
ATOM   6519  C  "C2'" . DC  I 5  22  ? 19.528  -1.114  26.922 1.00 169.49 ? -51  DC  I "C2'" 1 
ATOM   6520  C  "C1'" . DC  I 5  22  ? 20.218  -2.380  27.436 1.00 172.29 ? -51  DC  I "C1'" 1 
ATOM   6521  N  N1    . DC  I 5  22  ? 19.255  -3.402  27.885 1.00 180.31 ? -51  DC  I N1    1 
ATOM   6522  C  C2    . DC  I 5  22  ? 19.641  -4.749  27.900 1.00 183.75 ? -51  DC  I C2    1 
ATOM   6523  O  O2    . DC  I 5  22  ? 20.789  -5.050  27.535 1.00 178.10 ? -51  DC  I O2    1 
ATOM   6524  N  N3    . DC  I 5  22  ? 18.755  -5.686  28.312 1.00 181.04 ? -51  DC  I N3    1 
ATOM   6525  C  C4    . DC  I 5  22  ? 17.529  -5.321  28.700 1.00 170.61 ? -51  DC  I C4    1 
ATOM   6526  N  N4    . DC  I 5  22  ? 16.689  -6.277  29.101 1.00 158.23 ? -51  DC  I N4    1 
ATOM   6527  C  C5    . DC  I 5  22  ? 17.110  -3.958  28.690 1.00 166.68 ? -51  DC  I C5    1 
ATOM   6528  C  C6    . DC  I 5  22  ? 17.997  -3.041  28.283 1.00 171.39 ? -51  DC  I C6    1 
ATOM   6529  P  P     . DT  I 5  23  ? 21.506  0.259   24.872 1.00 178.47 ? -50  DT  I P     1 
ATOM   6530  O  OP1   . DT  I 5  23  ? 22.507  1.240   24.385 1.00 183.10 ? -50  DT  I OP1   1 
ATOM   6531  O  OP2   . DT  I 5  23  ? 20.270  0.026   24.074 1.00 168.64 ? -50  DT  I OP2   1 
ATOM   6532  O  "O5'" . DT  I 5  23  ? 22.269  -1.121  25.108 1.00 184.03 ? -50  DT  I "O5'" 1 
ATOM   6533  C  "C5'" . DT  I 5  23  ? 23.526  -1.409  24.461 1.00 182.69 ? -50  DT  I "C5'" 1 
ATOM   6534  C  "C4'" . DT  I 5  23  ? 23.333  -2.445  23.377 1.00 184.37 ? -50  DT  I "C4'" 1 
ATOM   6535  O  "O4'" . DT  I 5  23  ? 22.381  -3.446  23.812 1.00 187.31 ? -50  DT  I "O4'" 1 
ATOM   6536  C  "C3'" . DT  I 5  23  ? 22.806  -1.898  22.049 1.00 185.47 ? -50  DT  I "C3'" 1 
ATOM   6537  O  "O3'" . DT  I 5  23  ? 23.543  -2.492  20.976 1.00 198.69 ? -50  DT  I "O3'" 1 
ATOM   6538  C  "C2'" . DT  I 5  23  ? 21.348  -2.324  22.037 1.00 182.76 ? -50  DT  I "C2'" 1 
ATOM   6539  C  "C1'" . DT  I 5  23  ? 21.376  -3.622  22.825 1.00 186.30 ? -50  DT  I "C1'" 1 
ATOM   6540  N  N1    . DT  I 5  23  ? 20.109  -3.945  23.517 1.00 186.07 ? -50  DT  I N1    1 
ATOM   6541  C  C2    . DT  I 5  23  ? 19.943  -5.207  24.047 1.00 182.04 ? -50  DT  I C2    1 
ATOM   6542  O  O2    . DT  I 5  23  ? 20.796  -6.077  23.982 1.00 180.75 ? -50  DT  I O2    1 
ATOM   6543  N  N3    . DT  I 5  23  ? 18.732  -5.412  24.665 1.00 177.93 ? -50  DT  I N3    1 
ATOM   6544  C  C4    . DT  I 5  23  ? 17.697  -4.504  24.801 1.00 169.48 ? -50  DT  I C4    1 
ATOM   6545  O  O4    . DT  I 5  23  ? 16.668  -4.832  25.387 1.00 146.24 ? -50  DT  I O4    1 
ATOM   6546  C  C5    . DT  I 5  23  ? 17.939  -3.203  24.216 1.00 175.77 ? -50  DT  I C5    1 
ATOM   6547  C  C7    . DT  I 5  23  ? 16.877  -2.154  24.312 1.00 172.92 ? -50  DT  I C7    1 
ATOM   6548  C  C6    . DT  I 5  23  ? 19.116  -2.993  23.612 1.00 181.66 ? -50  DT  I C6    1 
ATOM   6549  P  P     . DA  I 5  24  ? 23.141  -2.364  19.428 1.00 208.34 ? -49  DA  I P     1 
ATOM   6550  O  OP1   . DA  I 5  24  ? 24.416  -2.198  18.681 1.00 210.09 ? -49  DA  I OP1   1 
ATOM   6551  O  OP2   . DA  I 5  24  ? 22.061  -1.353  19.265 1.00 204.69 ? -49  DA  I OP2   1 
ATOM   6552  O  "O5'" . DA  I 5  24  ? 22.539  -3.804  19.097 1.00 203.20 ? -49  DA  I "O5'" 1 
ATOM   6553  C  "C5'" . DA  I 5  24  ? 23.334  -5.003  19.241 1.00 191.81 ? -49  DA  I "C5'" 1 
ATOM   6554  C  "C4'" . DA  I 5  24  ? 22.536  -6.231  18.854 1.00 190.73 ? -49  DA  I "C4'" 1 
ATOM   6555  O  "O4'" . DA  I 5  24  ? 21.559  -6.527  19.889 1.00 186.80 ? -49  DA  I "O4'" 1 
ATOM   6556  C  "C3'" . DA  I 5  24  ? 21.763  -6.146  17.534 1.00 196.19 ? -49  DA  I "C3'" 1 
ATOM   6557  O  "O3'" . DA  I 5  24  ? 21.979  -7.293  16.716 1.00 200.69 ? -49  DA  I "O3'" 1 
ATOM   6558  C  "C2'" . DA  I 5  24  ? 20.304  -6.039  17.974 1.00 192.41 ? -49  DA  I "C2'" 1 
ATOM   6559  C  "C1'" . DA  I 5  24  ? 20.314  -6.814  19.290 1.00 187.77 ? -49  DA  I "C1'" 1 
ATOM   6560  N  N9    . DA  I 5  24  ? 19.254  -6.383  20.201 1.00 185.56 ? -49  DA  I N9    1 
ATOM   6561  C  C8    . DA  I 5  24  ? 18.987  -5.099  20.609 1.00 181.19 ? -49  DA  I C8    1 
ATOM   6562  N  N7    . DA  I 5  24  ? 17.960  -5.002  21.417 1.00 175.16 ? -49  DA  I N7    1 
ATOM   6563  C  C5    . DA  I 5  24  ? 17.516  -6.310  21.549 1.00 177.67 ? -49  DA  I C5    1 
ATOM   6564  C  C6    . DA  I 5  24  ? 16.455  -6.880  22.275 1.00 173.66 ? -49  DA  I C6    1 
ATOM   6565  N  N6    . DA  I 5  24  ? 15.618  -6.174  23.038 1.00 166.09 ? -49  DA  I N6    1 
ATOM   6566  N  N1    . DA  I 5  24  ? 16.281  -8.217  22.187 1.00 176.02 ? -49  DA  I N1    1 
ATOM   6567  C  C2    . DA  I 5  24  ? 17.121  -8.924  21.419 1.00 176.44 ? -49  DA  I C2    1 
ATOM   6568  N  N3    . DA  I 5  24  ? 18.155  -8.504  20.692 1.00 179.11 ? -49  DA  I N3    1 
ATOM   6569  C  C4    . DA  I 5  24  ? 18.300  -7.171  20.800 1.00 181.59 ? -49  DA  I C4    1 
ATOM   6570  P  P     . DC  I 5  25  ? 21.540  -7.272  15.171 1.00 196.02 ? -48  DC  I P     1 
ATOM   6571  O  OP1   . DC  I 5  25  ? 22.416  -8.221  14.433 1.00 190.96 ? -48  DC  I OP1   1 
ATOM   6572  O  OP2   . DC  I 5  25  ? 21.441  -5.859  14.724 1.00 193.34 ? -48  DC  I OP2   1 
ATOM   6573  O  "O5'" . DC  I 5  25  ? 20.066  -7.875  15.196 1.00 184.79 ? -48  DC  I "O5'" 1 
ATOM   6574  C  "C5'" . DC  I 5  25  ? 19.850  -9.216  15.663 1.00 177.65 ? -48  DC  I "C5'" 1 
ATOM   6575  C  "C4'" . DC  I 5  25  ? 18.389  -9.462  15.949 1.00 172.20 ? -48  DC  I "C4'" 1 
ATOM   6576  O  "O4'" . DC  I 5  25  ? 17.915  -8.619  17.031 1.00 175.48 ? -48  DC  I "O4'" 1 
ATOM   6577  C  "C3'" . DC  I 5  25  ? 17.405  -9.244  14.794 1.00 170.30 ? -48  DC  I "C3'" 1 
ATOM   6578  O  "O3'" . DC  I 5  25  ? 16.737  -10.480 14.557 1.00 181.21 ? -48  DC  I "O3'" 1 
ATOM   6579  C  "C2'" . DC  I 5  25  ? 16.417  -8.207  15.345 1.00 170.74 ? -48  DC  I "C2'" 1 
ATOM   6580  C  "C1'" . DC  I 5  25  ? 16.532  -8.456  16.847 1.00 174.60 ? -48  DC  I "C1'" 1 
ATOM   6581  N  N1    . DC  I 5  25  ? 16.009  -7.412  17.755 1.00 169.05 ? -48  DC  I N1    1 
ATOM   6582  C  C2    . DC  I 5  25  ? 15.121  -7.805  18.765 1.00 161.94 ? -48  DC  I C2    1 
ATOM   6583  O  O2    . DC  I 5  25  ? 14.831  -9.007  18.876 1.00 152.56 ? -48  DC  I O2    1 
ATOM   6584  N  N3    . DC  I 5  25  ? 14.606  -6.868  19.595 1.00 161.11 ? -48  DC  I N3    1 
ATOM   6585  C  C4    . DC  I 5  25  ? 14.941  -5.584  19.442 1.00 163.15 ? -48  DC  I C4    1 
ATOM   6586  N  N4    . DC  I 5  25  ? 14.413  -4.696  20.288 1.00 154.03 ? -48  DC  I N4    1 
ATOM   6587  C  C5    . DC  I 5  25  ? 15.836  -5.155  18.417 1.00 170.03 ? -48  DC  I C5    1 
ATOM   6588  C  C6    . DC  I 5  25  ? 16.337  -6.093  17.600 1.00 170.95 ? -48  DC  I C6    1 
ATOM   6589  P  P     . DC  I 5  26  ? 16.096  -10.872 13.139 1.00 181.78 ? -47  DC  I P     1 
ATOM   6590  O  OP1   . DC  I 5  26  ? 17.237  -11.197 12.247 1.00 179.13 ? -47  DC  I OP1   1 
ATOM   6591  O  OP2   . DC  I 5  26  ? 15.148  -9.798  12.743 1.00 177.29 ? -47  DC  I OP2   1 
ATOM   6592  O  "O5'" . DC  I 5  26  ? 15.260  -12.215 13.357 1.00 176.00 ? -47  DC  I "O5'" 1 
ATOM   6593  C  "C5'" . DC  I 5  26  ? 14.812  -12.637 14.663 1.00 162.92 ? -47  DC  I "C5'" 1 
ATOM   6594  C  "C4'" . DC  I 5  26  ? 13.325  -12.402 14.838 1.00 159.78 ? -47  DC  I "C4'" 1 
ATOM   6595  O  "O4'" . DC  I 5  26  ? 13.115  -11.264 15.716 1.00 162.49 ? -47  DC  I "O4'" 1 
ATOM   6596  C  "C3'" . DC  I 5  26  ? 12.511  -12.126 13.571 1.00 159.25 ? -47  DC  I "C3'" 1 
ATOM   6597  O  "O3'" . DC  I 5  26  ? 11.355  -12.953 13.521 1.00 153.74 ? -47  DC  I "O3'" 1 
ATOM   6598  C  "C2'" . DC  I 5  26  ? 12.095  -10.661 13.712 1.00 158.47 ? -47  DC  I "C2'" 1 
ATOM   6599  C  "C1'" . DC  I 5  26  ? 12.032  -10.504 15.229 1.00 162.06 ? -47  DC  I "C1'" 1 
ATOM   6600  N  N1    . DC  I 5  26  ? 12.182  -9.120  15.706 1.00 158.07 ? -47  DC  I N1    1 
ATOM   6601  C  C2    . DC  I 5  26  ? 12.003  -8.853  17.067 1.00 156.84 ? -47  DC  I C2    1 
ATOM   6602  O  O2    . DC  I 5  26  ? 11.726  -9.790  17.831 1.00 160.35 ? -47  DC  I O2    1 
ATOM   6603  N  N3    . DC  I 5  26  ? 12.140  -7.583  17.516 1.00 150.64 ? -47  DC  I N3    1 
ATOM   6604  C  C4    . DC  I 5  26  ? 12.444  -6.603  16.662 1.00 146.62 ? -47  DC  I C4    1 
ATOM   6605  N  N4    . DC  I 5  26  ? 12.568  -5.367  17.149 1.00 137.11 ? -47  DC  I N4    1 
ATOM   6606  C  C5    . DC  I 5  26  ? 12.631  -6.847  15.269 1.00 152.99 ? -47  DC  I C5    1 
ATOM   6607  C  C6    . DC  I 5  26  ? 12.490  -8.108  14.838 1.00 153.50 ? -47  DC  I C6    1 
ATOM   6608  P  P     . DA  I 5  27  ? 11.364  -14.217 12.545 1.00 152.28 ? -46  DA  I P     1 
ATOM   6609  O  OP1   . DA  I 5  27  ? 12.686  -14.878 12.699 1.00 153.65 ? -46  DA  I OP1   1 
ATOM   6610  O  OP2   . DA  I 5  27  ? 10.905  -13.763 11.203 1.00 140.49 ? -46  DA  I OP2   1 
ATOM   6611  O  "O5'" . DA  I 5  27  ? 10.271  -15.214 13.135 1.00 157.66 ? -46  DA  I "O5'" 1 
ATOM   6612  C  "C5'" . DA  I 5  27  ? 10.166  -15.448 14.553 1.00 153.81 ? -46  DA  I "C5'" 1 
ATOM   6613  C  "C4'" . DA  I 5  27  ? 8.858   -14.900 15.071 1.00 140.89 ? -46  DA  I "C4'" 1 
ATOM   6614  O  "O4'" . DA  I 5  27  ? 8.972   -13.462 15.258 1.00 136.57 ? -46  DA  I "O4'" 1 
ATOM   6615  C  "C3'" . DA  I 5  27  ? 7.643   -15.115 14.164 1.00 143.31 ? -46  DA  I "C3'" 1 
ATOM   6616  O  "O3'" . DA  I 5  27  ? 6.543   -15.395 15.008 1.00 152.21 ? -46  DA  I "O3'" 1 
ATOM   6617  C  "C2'" . DA  I 5  27  ? 7.435   -13.743 13.531 1.00 141.86 ? -46  DA  I "C2'" 1 
ATOM   6618  C  "C1'" . DA  I 5  27  ? 7.849   -12.831 14.680 1.00 142.23 ? -46  DA  I "C1'" 1 
ATOM   6619  N  N9    . DA  I 5  27  ? 8.226   -11.475 14.283 1.00 146.66 ? -46  DA  I N9    1 
ATOM   6620  C  C8    . DA  I 5  27  ? 8.513   -11.001 13.026 1.00 150.16 ? -46  DA  I C8    1 
ATOM   6621  N  N7    . DA  I 5  27  ? 8.810   -9.725  12.997 1.00 147.04 ? -46  DA  I N7    1 
ATOM   6622  C  C5    . DA  I 5  27  ? 8.709   -9.330  14.323 1.00 139.44 ? -46  DA  I C5    1 
ATOM   6623  C  C6    . DA  I 5  27  ? 8.906   -8.093  14.958 1.00 138.36 ? -46  DA  I C6    1 
ATOM   6624  N  N6    . DA  I 5  27  ? 9.254   -6.977  14.314 1.00 138.69 ? -46  DA  I N6    1 
ATOM   6625  N  N1    . DA  I 5  27  ? 8.718   -8.036  16.295 1.00 144.66 ? -46  DA  I N1    1 
ATOM   6626  C  C2    . DA  I 5  27  ? 8.366   -9.155  16.941 1.00 142.47 ? -46  DA  I C2    1 
ATOM   6627  N  N3    . DA  I 5  27  ? 8.154   -10.376 16.456 1.00 142.47 ? -46  DA  I N3    1 
ATOM   6628  C  C4    . DA  I 5  27  ? 8.345   -10.396 15.125 1.00 142.53 ? -46  DA  I C4    1 
ATOM   6629  P  P     . DA  I 5  28  ? 5.317   -16.317 14.579 1.00 159.36 ? -45  DA  I P     1 
ATOM   6630  O  OP1   . DA  I 5  28  ? 5.767   -17.733 14.660 1.00 159.85 ? -45  DA  I OP1   1 
ATOM   6631  O  OP2   . DA  I 5  28  ? 4.725   -15.791 13.317 1.00 150.00 ? -45  DA  I OP2   1 
ATOM   6632  O  "O5'" . DA  I 5  28  ? 4.325   -16.019 15.790 1.00 161.94 ? -45  DA  I "O5'" 1 
ATOM   6633  C  "C5'" . DA  I 5  28  ? 4.799   -15.341 16.972 1.00 157.99 ? -45  DA  I "C5'" 1 
ATOM   6634  C  "C4'" . DA  I 5  28  ? 4.194   -13.957 17.083 1.00 151.45 ? -45  DA  I "C4'" 1 
ATOM   6635  O  "O4'" . DA  I 5  28  ? 4.881   -13.007 16.220 1.00 152.14 ? -45  DA  I "O4'" 1 
ATOM   6636  C  "C3'" . DA  I 5  28  ? 2.705   -13.833 16.731 1.00 143.51 ? -45  DA  I "C3'" 1 
ATOM   6637  O  "O3'" . DA  I 5  28  ? 2.010   -13.211 17.799 1.00 135.14 ? -45  DA  I "O3'" 1 
ATOM   6638  C  "C2'" . DA  I 5  28  ? 2.689   -12.860 15.553 1.00 145.77 ? -45  DA  I "C2'" 1 
ATOM   6639  C  "C1'" . DA  I 5  28  ? 3.941   -12.037 15.833 1.00 143.19 ? -45  DA  I "C1'" 1 
ATOM   6640  N  N9    . DA  I 5  28  ? 4.430   -11.279 14.682 1.00 137.42 ? -45  DA  I N9    1 
ATOM   6641  C  C8    . DA  I 5  28  ? 4.412   -11.620 13.352 1.00 137.11 ? -45  DA  I C8    1 
ATOM   6642  N  N7    . DA  I 5  28  ? 4.859   -10.676 12.559 1.00 140.56 ? -45  DA  I N7    1 
ATOM   6643  C  C5    . DA  I 5  28  ? 5.164   -9.633  13.422 1.00 138.91 ? -45  DA  I C5    1 
ATOM   6644  C  C6    . DA  I 5  28  ? 5.678   -8.341  13.204 1.00 135.95 ? -45  DA  I C6    1 
ATOM   6645  N  N6    . DA  I 5  28  ? 5.992   -7.863  11.998 1.00 125.73 ? -45  DA  I N6    1 
ATOM   6646  N  N1    . DA  I 5  28  ? 5.866   -7.549  14.283 1.00 135.50 ? -45  DA  I N1    1 
ATOM   6647  C  C2    . DA  I 5  28  ? 5.548   -8.028  15.492 1.00 136.27 ? -45  DA  I C2    1 
ATOM   6648  N  N3    . DA  I 5  28  ? 5.059   -9.221  15.825 1.00 140.76 ? -45  DA  I N3    1 
ATOM   6649  C  C4    . DA  I 5  28  ? 4.888   -9.985  14.731 1.00 139.19 ? -45  DA  I C4    1 
ATOM   6650  P  P     . DA  I 5  29  ? 0.503   -13.623 18.068 1.00 127.42 ? -44  DA  I P     1 
ATOM   6651  O  OP1   . DA  I 5  29  ? 0.554   -14.847 18.904 1.00 137.78 ? -44  DA  I OP1   1 
ATOM   6652  O  OP2   . DA  I 5  29  ? -0.257  -13.616 16.789 1.00 122.83 ? -44  DA  I OP2   1 
ATOM   6653  O  "O5'" . DA  I 5  29  ? -0.028  -12.415 18.950 1.00 119.36 ? -44  DA  I "O5'" 1 
ATOM   6654  C  "C5'" . DA  I 5  29  ? -0.700  -11.329 18.310 1.00 129.63 ? -44  DA  I "C5'" 1 
ATOM   6655  C  "C4'" . DA  I 5  29  ? 0.213   -10.136 18.223 1.00 130.58 ? -44  DA  I "C4'" 1 
ATOM   6656  O  "O4'" . DA  I 5  29  ? 1.125   -10.290 17.114 1.00 147.49 ? -44  DA  I "O4'" 1 
ATOM   6657  C  "C3'" . DA  I 5  29  ? -0.504  -8.832  17.913 1.00 129.59 ? -44  DA  I "C3'" 1 
ATOM   6658  O  "O3'" . DA  I 5  29  ? -0.950  -8.297  19.148 1.00 125.49 ? -44  DA  I "O3'" 1 
ATOM   6659  C  "C2'" . DA  I 5  29  ? 0.590   -7.969  17.282 1.00 139.42 ? -44  DA  I "C2'" 1 
ATOM   6660  C  "C1'" . DA  I 5  29  ? 1.549   -9.009  16.689 1.00 142.41 ? -44  DA  I "C1'" 1 
ATOM   6661  N  N9    . DA  I 5  29  ? 1.627   -8.995  15.225 1.00 142.31 ? -44  DA  I N9    1 
ATOM   6662  C  C8    . DA  I 5  29  ? 1.266   -9.987  14.345 1.00 137.68 ? -44  DA  I C8    1 
ATOM   6663  N  N7    . DA  I 5  29  ? 1.475   -9.681  13.088 1.00 138.24 ? -44  DA  I N7    1 
ATOM   6664  C  C5    . DA  I 5  29  ? 2.011   -8.401  13.142 1.00 139.87 ? -44  DA  I C5    1 
ATOM   6665  C  C6    . DA  I 5  29  ? 2.451   -7.518  12.142 1.00 140.89 ? -44  DA  I C6    1 
ATOM   6666  N  N6    . DA  I 5  29  ? 2.409   -7.796  10.837 1.00 143.87 ? -44  DA  I N6    1 
ATOM   6667  N  N1    . DA  I 5  29  ? 2.930   -6.316  12.532 1.00 140.41 ? -44  DA  I N1    1 
ATOM   6668  C  C2    . DA  I 5  29  ? 2.968   -6.035  13.840 1.00 136.04 ? -44  DA  I C2    1 
ATOM   6669  N  N3    . DA  I 5  29  ? 2.588   -6.783  14.874 1.00 134.89 ? -44  DA  I N3    1 
ATOM   6670  C  C4    . DA  I 5  29  ? 2.113   -7.968  14.452 1.00 139.43 ? -44  DA  I C4    1 
ATOM   6671  P  P     . DA  I 5  30  ? -2.505  -8.071  19.410 1.00 125.78 ? -43  DA  I P     1 
ATOM   6672  O  OP1   . DA  I 5  30  ? -2.734  -8.359  20.849 1.00 124.16 ? -43  DA  I OP1   1 
ATOM   6673  O  OP2   . DA  I 5  30  ? -3.276  -8.808  18.375 1.00 116.78 ? -43  DA  I OP2   1 
ATOM   6674  O  "O5'" . DA  I 5  30  ? -2.693  -6.505  19.174 1.00 116.87 ? -43  DA  I "O5'" 1 
ATOM   6675  C  "C5'" . DA  I 5  30  ? -1.650  -5.574  19.526 1.00 113.54 ? -43  DA  I "C5'" 1 
ATOM   6676  C  "C4'" . DA  I 5  30  ? -1.517  -4.500  18.469 1.00 112.55 ? -43  DA  I "C4'" 1 
ATOM   6677  O  "O4'" . DA  I 5  30  ? -0.931  -5.060  17.263 1.00 121.31 ? -43  DA  I "O4'" 1 
ATOM   6678  C  "C3'" . DA  I 5  30  ? -2.821  -3.820  18.034 1.00 106.75 ? -43  DA  I "C3'" 1 
ATOM   6679  O  "O3'" . DA  I 5  30  ? -2.746  -2.403  18.141 1.00 99.49  ? -43  DA  I "O3'" 1 
ATOM   6680  C  "C2'" . DA  I 5  30  ? -2.983  -4.236  16.573 1.00 111.79 ? -43  DA  I "C2'" 1 
ATOM   6681  C  "C1'" . DA  I 5  30  ? -1.535  -4.453  16.146 1.00 119.43 ? -43  DA  I "C1'" 1 
ATOM   6682  N  N9    . DA  I 5  30  ? -1.402  -5.335  14.983 1.00 123.43 ? -43  DA  I N9    1 
ATOM   6683  C  C8    . DA  I 5  30  ? -1.920  -6.596  14.809 1.00 118.08 ? -43  DA  I C8    1 
ATOM   6684  N  N7    . DA  I 5  30  ? -1.656  -7.119  13.636 1.00 121.70 ? -43  DA  I N7    1 
ATOM   6685  C  C5    . DA  I 5  30  ? -0.931  -6.131  12.986 1.00 123.54 ? -43  DA  I C5    1 
ATOM   6686  C  C6    . DA  I 5  30  ? -0.359  -6.066  11.703 1.00 120.23 ? -43  DA  I C6    1 
ATOM   6687  N  N6    . DA  I 5  30  ? -0.428  -7.056  10.811 1.00 123.83 ? -43  DA  I N6    1 
ATOM   6688  N  N1    . DA  I 5  30  ? 0.300   -4.935  11.365 1.00 116.90 ? -43  DA  I N1    1 
ATOM   6689  C  C2    . DA  I 5  30  ? 0.370   -3.942  12.260 1.00 112.49 ? -43  DA  I C2    1 
ATOM   6690  N  N3    . DA  I 5  30  ? -0.129  -3.883  13.493 1.00 118.81 ? -43  DA  I N3    1 
ATOM   6691  C  C4    . DA  I 5  30  ? -0.772  -5.024  13.800 1.00 125.59 ? -43  DA  I C4    1 
ATOM   6692  P  P     . DG  I 5  31  ? -3.997  -1.459  17.780 1.00 104.94 ? -42  DG  I P     1 
ATOM   6693  O  OP1   . DG  I 5  31  ? -4.039  -0.306  18.710 1.00 111.71 ? -42  DG  I OP1   1 
ATOM   6694  O  OP2   . DG  I 5  31  ? -5.245  -2.227  17.525 1.00 98.01  ? -42  DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  I 5  31  ? -3.504  -0.869  16.387 1.00 123.81 ? -42  DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  I 5  31  ? -2.156  -0.376  16.214 1.00 133.36 ? -42  DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  I 5  31  ? -1.967  0.147   14.806 1.00 132.25 ? -42  DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  I 5  31  ? -1.669  -0.959  13.914 1.00 126.19 ? -42  DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  I 5  31  ? -3.162  0.896   14.217 1.00 130.93 ? -42  DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  I 5  31  ? -2.782  2.146   13.655 1.00 131.68 ? -42  DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  I 5  31  ? -3.750  -0.077  13.193 1.00 129.42 ? -42  DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  I 5  31  ? -2.541  -0.929  12.804 1.00 127.18 ? -42  DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  I 5  31  ? -2.923  -2.302  12.490 1.00 125.08 ? -42  DG  I N9    1 
ATOM   6704  C  C8    . DG  I 5  31  ? -3.561  -3.189  13.323 1.00 130.67 ? -42  DG  I C8    1 
ATOM   6705  N  N7    . DG  I 5  31  ? -3.786  -4.347  12.765 1.00 133.31 ? -42  DG  I N7    1 
ATOM   6706  C  C5    . DG  I 5  31  ? -3.278  -4.213  11.480 1.00 136.17 ? -42  DG  I C5    1 
ATOM   6707  C  C6    . DG  I 5  31  ? -3.241  -5.139  10.403 1.00 133.70 ? -42  DG  I C6    1 
ATOM   6708  O  O6    . DG  I 5  31  ? -3.660  -6.303  10.371 1.00 129.68 ? -42  DG  I O6    1 
ATOM   6709  N  N1    . DG  I 5  31  ? -2.639  -4.589  9.276  1.00 140.20 ? -42  DG  I N1    1 
ATOM   6710  C  C2    . DG  I 5  31  ? -2.135  -3.313  9.192  1.00 138.95 ? -42  DG  I C2    1 
ATOM   6711  N  N2    . DG  I 5  31  ? -1.586  -2.968  8.017  1.00 133.75 ? -42  DG  I N2    1 
ATOM   6712  N  N3    . DG  I 5  31  ? -2.165  -2.440  10.187 1.00 135.16 ? -42  DG  I N3    1 
ATOM   6713  C  C4    . DG  I 5  31  ? -2.746  -2.954  11.293 1.00 133.29 ? -42  DG  I C4    1 
ATOM   6714  P  P     . DT  I 5  32  ? -3.885  3.193   13.155 1.00 126.86 ? -41  DT  I P     1 
ATOM   6715  O  OP1   . DT  I 5  32  ? -3.353  4.559   13.399 1.00 120.83 ? -41  DT  I OP1   1 
ATOM   6716  O  OP2   . DT  I 5  32  ? -5.232  2.815   13.656 1.00 119.33 ? -41  DT  I OP2   1 
ATOM   6717  O  "O5'" . DT  I 5  32  ? -3.899  2.943   11.584 1.00 135.80 ? -41  DT  I "O5'" 1 
ATOM   6718  C  "C5'" . DT  I 5  32  ? -2.678  2.733   10.851 1.00 140.87 ? -41  DT  I "C5'" 1 
ATOM   6719  C  "C4'" . DT  I 5  32  ? -2.976  2.547   9.380  1.00 147.25 ? -41  DT  I "C4'" 1 
ATOM   6720  O  "O4'" . DT  I 5  32  ? -3.142  1.141   9.084  1.00 143.33 ? -41  DT  I "O4'" 1 
ATOM   6721  C  "C3'" . DT  I 5  32  ? -4.240  3.248   8.876  1.00 149.37 ? -41  DT  I "C3'" 1 
ATOM   6722  O  "O3'" . DT  I 5  32  ? -3.939  3.954   7.668  1.00 155.28 ? -41  DT  I "O3'" 1 
ATOM   6723  C  "C2'" . DT  I 5  32  ? -5.226  2.115   8.642  1.00 141.24 ? -41  DT  I "C2'" 1 
ATOM   6724  C  "C1'" . DT  I 5  32  ? -4.322  0.938   8.326  1.00 137.20 ? -41  DT  I "C1'" 1 
ATOM   6725  N  N1    . DT  I 5  32  ? -4.871  -0.377  8.700  1.00 131.22 ? -41  DT  I N1    1 
ATOM   6726  C  C2    . DT  I 5  32  ? -4.713  -1.420  7.817  1.00 133.42 ? -41  DT  I C2    1 
ATOM   6727  O  O2    . DT  I 5  32  ? -4.158  -1.301  6.737  1.00 138.81 ? -41  DT  I O2    1 
ATOM   6728  N  N3    . DT  I 5  32  ? -5.243  -2.613  8.241  1.00 139.01 ? -41  DT  I N3    1 
ATOM   6729  C  C4    . DT  I 5  32  ? -5.893  -2.861  9.436  1.00 134.34 ? -41  DT  I C4    1 
ATOM   6730  O  O4    . DT  I 5  32  ? -6.317  -3.987  9.679  1.00 143.78 ? -41  DT  I O4    1 
ATOM   6731  C  C5    . DT  I 5  32  ? -6.018  -1.723  10.317 1.00 127.78 ? -41  DT  I C5    1 
ATOM   6732  C  C7    . DT  I 5  32  ? -6.711  -1.896  11.632 1.00 122.44 ? -41  DT  I C7    1 
ATOM   6733  C  C6    . DT  I 5  32  ? -5.506  -0.554  9.911  1.00 129.12 ? -41  DT  I C6    1 
ATOM   6734  P  P     . DG  I 5  33  ? -4.943  5.019   7.025  1.00 157.73 ? -40  DG  I P     1 
ATOM   6735  O  OP1   . DG  I 5  33  ? -4.089  6.076   6.423  1.00 156.11 ? -40  DG  I OP1   1 
ATOM   6736  O  OP2   . DG  I 5  33  ? -6.015  5.402   7.984  1.00 152.54 ? -40  DG  I OP2   1 
ATOM   6737  O  "O5'" . DG  I 5  33  ? -5.610  4.135   5.879  1.00 163.90 ? -40  DG  I "O5'" 1 
ATOM   6738  C  "C5'" . DG  I 5  33  ? -4.807  3.484   4.873  1.00 158.33 ? -40  DG  I "C5'" 1 
ATOM   6739  C  "C4'" . DG  I 5  33  ? -5.671  2.620   3.983  1.00 157.73 ? -40  DG  I "C4'" 1 
ATOM   6740  O  "O4'" . DG  I 5  33  ? -5.850  1.315   4.602  1.00 155.63 ? -40  DG  I "O4'" 1 
ATOM   6741  C  "C3'" . DG  I 5  33  ? -7.083  3.144   3.684  1.00 160.63 ? -40  DG  I "C3'" 1 
ATOM   6742  O  "O3'" . DG  I 5  33  ? -7.369  3.039   2.285  1.00 170.02 ? -40  DG  I "O3'" 1 
ATOM   6743  C  "C2'" . DG  I 5  33  ? -7.975  2.209   4.500  1.00 161.26 ? -40  DG  I "C2'" 1 
ATOM   6744  C  "C1'" . DG  I 5  33  ? -7.183  0.910   4.400  1.00 163.63 ? -40  DG  I "C1'" 1 
ATOM   6745  N  N9    . DG  I 5  33  ? -7.534  -0.136  5.358  1.00 166.04 ? -40  DG  I N9    1 
ATOM   6746  C  C8    . DG  I 5  33  ? -7.634  -0.040  6.726  1.00 155.59 ? -40  DG  I C8    1 
ATOM   6747  N  N7    . DG  I 5  33  ? -7.992  -1.160  7.293  1.00 150.12 ? -40  DG  I N7    1 
ATOM   6748  C  C5    . DG  I 5  33  ? -8.145  -2.048  6.236  1.00 161.38 ? -40  DG  I C5    1 
ATOM   6749  C  C6    . DG  I 5  33  ? -8.523  -3.417  6.229  1.00 162.11 ? -40  DG  I C6    1 
ATOM   6750  O  O6    . DG  I 5  33  ? -8.806  -4.144  7.189  1.00 152.19 ? -40  DG  I O6    1 
ATOM   6751  N  N1    . DG  I 5  33  ? -8.554  -3.933  4.936  1.00 161.78 ? -40  DG  I N1    1 
ATOM   6752  C  C2    . DG  I 5  33  ? -8.260  -3.226  3.796  1.00 162.14 ? -40  DG  I C2    1 
ATOM   6753  N  N2    . DG  I 5  33  ? -8.350  -3.901  2.641  1.00 164.50 ? -40  DG  I N2    1 
ATOM   6754  N  N3    . DG  I 5  33  ? -7.910  -1.950  3.788  1.00 164.14 ? -40  DG  I N3    1 
ATOM   6755  C  C4    . DG  I 5  33  ? -7.872  -1.429  5.034  1.00 166.79 ? -40  DG  I C4    1 
ATOM   6756  P  P     . DT  I 5  34  ? -8.750  3.491   1.565  1.00 177.40 ? -39  DT  I P     1 
ATOM   6757  O  OP1   . DT  I 5  34  ? -8.610  4.925   1.197  1.00 165.71 ? -39  DT  I OP1   1 
ATOM   6758  O  OP2   . DT  I 5  34  ? -9.927  3.062   2.369  1.00 178.73 ? -39  DT  I OP2   1 
ATOM   6759  O  "O5'" . DT  I 5  34  ? -8.810  2.662   0.202  1.00 175.40 ? -39  DT  I "O5'" 1 
ATOM   6760  C  "C5'" . DT  I 5  34  ? -8.199  1.358   0.076  1.00 168.95 ? -39  DT  I "C5'" 1 
ATOM   6761  C  "C4'" . DT  I 5  34  ? -9.232  0.279   -0.168 1.00 169.21 ? -39  DT  I "C4'" 1 
ATOM   6762  O  "O4'" . DT  I 5  34  ? -9.399  -0.520  1.029  1.00 173.53 ? -39  DT  I "O4'" 1 
ATOM   6763  C  "C3'" . DT  I 5  34  ? -10.637 0.749   -0.576 1.00 171.99 ? -39  DT  I "C3'" 1 
ATOM   6764  O  "O3'" . DT  I 5  34  ? -11.057 0.063   -1.768 1.00 177.11 ? -39  DT  I "O3'" 1 
ATOM   6765  C  "C2'" . DT  I 5  34  ? -11.506 0.384   0.618  1.00 167.40 ? -39  DT  I "C2'" 1 
ATOM   6766  C  "C1'" . DT  I 5  34  ? -10.775 -0.813  1.196  1.00 174.09 ? -39  DT  I "C1'" 1 
ATOM   6767  N  N1    . DT  I 5  34  ? -11.023 -1.071  2.635  1.00 173.25 ? -39  DT  I N1    1 
ATOM   6768  C  C2    . DT  I 5  34  ? -11.322 -2.359  3.026  1.00 170.17 ? -39  DT  I C2    1 
ATOM   6769  O  O2    . DT  I 5  34  ? -11.382 -3.297  2.247  1.00 181.03 ? -39  DT  I O2    1 
ATOM   6770  N  N3    . DT  I 5  34  ? -11.544 -2.510  4.373  1.00 162.58 ? -39  DT  I N3    1 
ATOM   6771  C  C4    . DT  I 5  34  ? -11.502 -1.526  5.343  1.00 164.47 ? -39  DT  I C4    1 
ATOM   6772  O  O4    . DT  I 5  34  ? -11.721 -1.814  6.516  1.00 167.93 ? -39  DT  I O4    1 
ATOM   6773  C  C5    . DT  I 5  34  ? -11.188 -0.199  4.862  1.00 165.77 ? -39  DT  I C5    1 
ATOM   6774  C  C7    . DT  I 5  34  ? -11.118 0.931   5.840  1.00 156.45 ? -39  DT  I C7    1 
ATOM   6775  C  C6    . DT  I 5  34  ? -10.969 -0.041  3.550  1.00 169.79 ? -39  DT  I C6    1 
ATOM   6776  P  P     . DA  I 5  35  ? -12.563 -0.029  -2.352 1.00 175.45 ? -38  DA  I P     1 
ATOM   6777  O  OP1   . DA  I 5  35  ? -12.455 -0.144  -3.829 1.00 165.96 ? -38  DA  I OP1   1 
ATOM   6778  O  OP2   . DA  I 5  35  ? -13.423 1.036   -1.763 1.00 158.73 ? -38  DA  I OP2   1 
ATOM   6779  O  "O5'" . DA  I 5  35  ? -13.082 -1.438  -1.815 1.00 175.92 ? -38  DA  I "O5'" 1 
ATOM   6780  C  "C5'" . DA  I 5  35  ? -12.369 -2.665  -2.092 1.00 167.20 ? -38  DA  I "C5'" 1 
ATOM   6781  C  "C4'" . DA  I 5  35  ? -13.235 -3.860  -1.763 1.00 163.92 ? -38  DA  I "C4'" 1 
ATOM   6782  O  "O4'" . DA  I 5  35  ? -13.243 -4.073  -0.321 1.00 153.50 ? -38  DA  I "O4'" 1 
ATOM   6783  C  "C3'" . DA  I 5  35  ? -14.704 -3.745  -2.191 1.00 167.36 ? -38  DA  I "C3'" 1 
ATOM   6784  O  "O3'" . DA  I 5  35  ? -15.193 -4.935  -2.811 1.00 169.31 ? -38  DA  I "O3'" 1 
ATOM   6785  C  "C2'" . DA  I 5  35  ? -15.429 -3.477  -0.875 1.00 165.71 ? -38  DA  I "C2'" 1 
ATOM   6786  C  "C1'" . DA  I 5  35  ? -14.573 -4.271  0.108  1.00 157.51 ? -38  DA  I "C1'" 1 
ATOM   6787  N  N9    . DA  I 5  35  ? -14.714 -3.798  1.486  1.00 151.54 ? -38  DA  I N9    1 
ATOM   6788  C  C8    . DA  I 5  35  ? -14.527 -2.528  1.974  1.00 153.41 ? -38  DA  I C8    1 
ATOM   6789  N  N7    . DA  I 5  35  ? -14.775 -2.411  3.256  1.00 148.77 ? -38  DA  I N7    1 
ATOM   6790  C  C5    . DA  I 5  35  ? -15.173 -3.686  3.635  1.00 146.62 ? -38  DA  I C5    1 
ATOM   6791  C  C6    . DA  I 5  35  ? -15.575 -4.224  4.870  1.00 147.03 ? -38  DA  I C6    1 
ATOM   6792  N  N6    . DA  I 5  35  ? -15.647 -3.515  5.998  1.00 148.56 ? -38  DA  I N6    1 
ATOM   6793  N  N1    . DA  I 5  35  ? -15.905 -5.534  4.908  1.00 151.98 ? -38  DA  I N1    1 
ATOM   6794  C  C2    . DA  I 5  35  ? -15.833 -6.246  3.775  1.00 151.36 ? -38  DA  I C2    1 
ATOM   6795  N  N3    . DA  I 5  35  ? -15.474 -5.853  2.554  1.00 146.57 ? -38  DA  I N3    1 
ATOM   6796  C  C4    . DA  I 5  35  ? -15.150 -4.548  2.552  1.00 146.17 ? -38  DA  I C4    1 
ATOM   6797  P  P     . DT  I 5  36  ? -16.758 -5.162  -3.134 1.00 173.31 ? -37  DT  I P     1 
ATOM   6798  O  OP1   . DT  I 5  36  ? -16.843 -6.139  -4.252 1.00 167.55 ? -37  DT  I OP1   1 
ATOM   6799  O  OP2   . DT  I 5  36  ? -17.447 -3.847  -3.253 1.00 167.97 ? -37  DT  I OP2   1 
ATOM   6800  O  "O5'" . DT  I 5  36  ? -17.339 -5.879  -1.834 1.00 171.21 ? -37  DT  I "O5'" 1 
ATOM   6801  C  "C5'" . DT  I 5  36  ? -16.956 -7.226  -1.494 1.00 167.78 ? -37  DT  I "C5'" 1 
ATOM   6802  C  "C4'" . DT  I 5  36  ? -17.778 -7.736  -0.333 1.00 165.43 ? -37  DT  I "C4'" 1 
ATOM   6803  O  "O4'" . DT  I 5  36  ? -17.568 -6.898  0.829  1.00 170.03 ? -37  DT  I "O4'" 1 
ATOM   6804  C  "C3'" . DT  I 5  36  ? -19.293 -7.778  -0.570 1.00 164.27 ? -37  DT  I "C3'" 1 
ATOM   6805  O  "O3'" . DT  I 5  36  ? -19.786 -9.087  -0.241 1.00 159.45 ? -37  DT  I "O3'" 1 
ATOM   6806  C  "C2'" . DT  I 5  36  ? -19.835 -6.682  0.334  1.00 168.99 ? -37  DT  I "C2'" 1 
ATOM   6807  C  "C1'" . DT  I 5  36  ? -18.815 -6.650  1.457  1.00 176.66 ? -37  DT  I "C1'" 1 
ATOM   6808  N  N1    . DT  I 5  36  ? -18.717 -5.364  2.186  1.00 175.14 ? -37  DT  I N1    1 
ATOM   6809  C  C2    . DT  I 5  36  ? -18.916 -5.363  3.550  1.00 169.84 ? -37  DT  I C2    1 
ATOM   6810  O  O2    . DT  I 5  36  ? -19.161 -6.374  4.190  1.00 165.76 ? -37  DT  I O2    1 
ATOM   6811  N  N3    . DT  I 5  36  ? -18.805 -4.129  4.144  1.00 167.72 ? -37  DT  I N3    1 
ATOM   6812  C  C4    . DT  I 5  36  ? -18.526 -2.925  3.523  1.00 167.09 ? -37  DT  I C4    1 
ATOM   6813  O  O4    . DT  I 5  36  ? -18.457 -1.896  4.188  1.00 165.10 ? -37  DT  I O4    1 
ATOM   6814  C  C5    . DT  I 5  36  ? -18.335 -2.999  2.092  1.00 166.96 ? -37  DT  I C5    1 
ATOM   6815  C  C7    . DT  I 5  36  ? -18.032 -1.746  1.333  1.00 162.57 ? -37  DT  I C7    1 
ATOM   6816  C  C6    . DT  I 5  36  ? -18.440 -4.198  1.503  1.00 170.57 ? -37  DT  I C6    1 
ATOM   6817  P  P     . DT  I 5  37  ? -21.311 -9.482  0.096  1.00 152.91 ? -36  DT  I P     1 
ATOM   6818  O  OP1   . DT  I 5  37  ? -21.501 -10.900 -0.299 1.00 146.98 ? -36  DT  I OP1   1 
ATOM   6819  O  OP2   . DT  I 5  37  ? -22.255 -8.450  -0.410 1.00 148.36 ? -36  DT  I OP2   1 
ATOM   6820  O  "O5'" . DT  I 5  37  ? -21.339 -9.412  1.689  1.00 165.10 ? -36  DT  I "O5'" 1 
ATOM   6821  C  "C5'" . DT  I 5  37  ? -20.608 -10.353 2.503  1.00 150.22 ? -36  DT  I "C5'" 1 
ATOM   6822  C  "C4'" . DT  I 5  37  ? -21.213 -10.424 3.886  1.00 139.44 ? -36  DT  I "C4'" 1 
ATOM   6823  O  "O4'" . DT  I 5  37  ? -21.025 -9.164  4.573  1.00 142.49 ? -36  DT  I "O4'" 1 
ATOM   6824  C  "C3'" . DT  I 5  37  ? -22.716 -10.706 3.925  1.00 131.54 ? -36  DT  I "C3'" 1 
ATOM   6825  O  "O3'" . DT  I 5  37  ? -22.970 -11.622 4.993  1.00 123.09 ? -36  DT  I "O3'" 1 
ATOM   6826  C  "C2'" . DT  I 5  37  ? -23.334 -9.341  4.179  1.00 130.38 ? -36  DT  I "C2'" 1 
ATOM   6827  C  "C1'" . DT  I 5  37  ? -22.274 -8.653  5.022  1.00 142.86 ? -36  DT  I "C1'" 1 
ATOM   6828  N  N1    . DT  I 5  37  ? -22.225 -7.181  4.901  1.00 146.17 ? -36  DT  I N1    1 
ATOM   6829  C  C2    . DT  I 5  37  ? -22.088 -6.429  6.047  1.00 152.66 ? -36  DT  I C2    1 
ATOM   6830  O  O2    . DT  I 5  37  ? -22.035 -6.917  7.165  1.00 156.02 ? -36  DT  I O2    1 
ATOM   6831  N  N3    . DT  I 5  37  ? -22.022 -5.073  5.836  1.00 145.89 ? -36  DT  I N3    1 
ATOM   6832  C  C4    . DT  I 5  37  ? -22.072 -4.413  4.622  1.00 136.98 ? -36  DT  I C4    1 
ATOM   6833  O  O4    . DT  I 5  37  ? -22.004 -3.188  4.589  1.00 131.73 ? -36  DT  I O4    1 
ATOM   6834  C  C5    . DT  I 5  37  ? -22.211 -5.264  3.463  1.00 139.48 ? -36  DT  I C5    1 
ATOM   6835  C  C7    . DT  I 5  37  ? -22.276 -4.637  2.106  1.00 141.23 ? -36  DT  I C7    1 
ATOM   6836  C  C6    . DT  I 5  37  ? -22.271 -6.587  3.658  1.00 142.71 ? -36  DT  I C6    1 
ATOM   6837  P  P     . DT  I 5  38  ? -24.439 -12.091 5.409  1.00 128.71 ? -35  DT  I P     1 
ATOM   6838  O  OP1   . DT  I 5  38  ? -24.280 -13.436 6.012  1.00 126.55 ? -35  DT  I OP1   1 
ATOM   6839  O  OP2   . DT  I 5  38  ? -25.377 -11.902 4.271  1.00 131.56 ? -35  DT  I OP2   1 
ATOM   6840  O  "O5'" . DT  I 5  38  ? -24.850 -11.077 6.568  1.00 130.91 ? -35  DT  I "O5'" 1 
ATOM   6841  C  "C5'" . DT  I 5  38  ? -24.088 -10.987 7.792  1.00 126.04 ? -35  DT  I "C5'" 1 
ATOM   6842  C  "C4'" . DT  I 5  38  ? -24.713 -9.987  8.740  1.00 124.02 ? -35  DT  I "C4'" 1 
ATOM   6843  O  "O4'" . DT  I 5  38  ? -24.529 -8.638  8.247  1.00 116.44 ? -35  DT  I "O4'" 1 
ATOM   6844  C  "C3'" . DT  I 5  38  ? -26.218 -10.156 8.983  1.00 120.04 ? -35  DT  I "C3'" 1 
ATOM   6845  O  "O3'" . DT  I 5  38  ? -26.511 -10.124 10.384 1.00 113.03 ? -35  DT  I "O3'" 1 
ATOM   6846  C  "C2'" . DT  I 5  38  ? -26.839 -8.930  8.335  1.00 116.89 ? -35  DT  I "C2'" 1 
ATOM   6847  C  "C1'" . DT  I 5  38  ? -25.727 -7.908  8.451  1.00 114.89 ? -35  DT  I "C1'" 1 
ATOM   6848  N  N1    . DT  I 5  38  ? -25.776 -6.833  7.447  1.00 118.39 ? -35  DT  I N1    1 
ATOM   6849  C  C2    . DT  I 5  38  ? -25.837 -5.529  7.884  1.00 117.89 ? -35  DT  I C2    1 
ATOM   6850  O  O2    . DT  I 5  38  ? -25.862 -5.220  9.063  1.00 119.25 ? -35  DT  I O2    1 
ATOM   6851  N  N3    . DT  I 5  38  ? -25.869 -4.592  6.880  1.00 116.82 ? -35  DT  I N3    1 
ATOM   6852  C  C4    . DT  I 5  38  ? -25.843 -4.825  5.518  1.00 119.56 ? -35  DT  I C4    1 
ATOM   6853  O  O4    . DT  I 5  38  ? -25.876 -3.880  4.734  1.00 121.14 ? -35  DT  I O4    1 
ATOM   6854  C  C5    . DT  I 5  38  ? -25.775 -6.217  5.132  1.00 120.73 ? -35  DT  I C5    1 
ATOM   6855  C  C7    . DT  I 5  38  ? -25.750 -6.570  3.678  1.00 117.57 ? -35  DT  I C7    1 
ATOM   6856  C  C6    . DT  I 5  38  ? -25.743 -7.138  6.103  1.00 123.76 ? -35  DT  I C6    1 
ATOM   6857  P  P     . DG  I 5  39  ? -26.536 -11.467 11.242 1.00 104.73 ? -34  DG  I P     1 
ATOM   6858  O  OP1   . DG  I 5  39  ? -25.320 -12.262 10.923 1.00 94.27  ? -34  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I 5  39  ? -27.886 -12.081 11.122 1.00 101.14 ? -34  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I 5  39  ? -26.396 -10.884 12.714 1.00 103.16 ? -34  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I 5  39  ? -25.201 -10.198 13.110 1.00 105.96 ? -34  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I 5  39  ? -25.547 -8.921  13.839 1.00 108.97 ? -34  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I 5  39  ? -25.982 -7.921  12.884 1.00 111.95 ? -34  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I 5  39  ? -26.638 -9.033  14.900 1.00 105.43 ? -34  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I 5  39  ? -26.227 -8.376  16.088 1.00 99.41  ? -34  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I 5  39  ? -27.854 -8.367  14.256 1.00 112.63 ? -34  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I 5  39  ? -27.212 -7.365  13.297 1.00 119.71 ? -34  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I 5  39  ? -28.024 -7.141  12.105 1.00 134.06 ? -34  DG  I N9    1 
ATOM   6869  C  C8    . DG  I 5  39  ? -28.779 -8.079  11.442 1.00 135.96 ? -34  DG  I C8    1 
ATOM   6870  N  N7    . DG  I 5  39  ? -29.397 -7.595  10.399 1.00 136.72 ? -34  DG  I N7    1 
ATOM   6871  C  C5    . DG  I 5  39  ? -29.019 -6.260  10.363 1.00 140.73 ? -34  DG  I C5    1 
ATOM   6872  C  C6    . DG  I 5  39  ? -29.372 -5.229  9.454  1.00 139.69 ? -34  DG  I C6    1 
ATOM   6873  O  O6    . DG  I 5  39  ? -30.116 -5.291  8.468  1.00 146.81 ? -34  DG  I O6    1 
ATOM   6874  N  N1    . DG  I 5  39  ? -28.766 -4.022  9.790  1.00 139.88 ? -34  DG  I N1    1 
ATOM   6875  C  C2    . DG  I 5  39  ? -27.929 -3.828  10.861 1.00 130.87 ? -34  DG  I C2    1 
ATOM   6876  N  N2    . DG  I 5  39  ? -27.445 -2.587  11.016 1.00 131.66 ? -34  DG  I N2    1 
ATOM   6877  N  N3    . DG  I 5  39  ? -27.590 -4.781  11.715 1.00 129.45 ? -34  DG  I N3    1 
ATOM   6878  C  C4    . DG  I 5  39  ? -28.170 -5.963  11.410 1.00 138.82 ? -34  DG  I C4    1 
ATOM   6879  P  P     . DG  I 5  40  ? -26.997 -8.626  17.464 1.00 101.33 ? -33  DG  I P     1 
ATOM   6880  O  OP1   . DG  I 5  40  ? -25.968 -8.643  18.531 1.00 110.16 ? -33  DG  I OP1   1 
ATOM   6881  O  OP2   . DG  I 5  40  ? -27.968 -9.746  17.357 1.00 99.18  ? -33  DG  I OP2   1 
ATOM   6882  O  "O5'" . DG  I 5  40  ? -27.828 -7.280  17.623 1.00 99.07  ? -33  DG  I "O5'" 1 
ATOM   6883  C  "C5'" . DG  I 5  40  ? -27.190 -6.000  17.478 1.00 96.02  ? -33  DG  I "C5'" 1 
ATOM   6884  C  "C4'" . DG  I 5  40  ? -28.234 -4.952  17.196 1.00 99.28  ? -33  DG  I "C4'" 1 
ATOM   6885  O  "O4'" . DG  I 5  40  ? -28.787 -5.169  15.870 1.00 107.50 ? -33  DG  I "O4'" 1 
ATOM   6886  C  "C3'" . DG  I 5  40  ? -29.424 -4.939  18.156 1.00 103.33 ? -33  DG  I "C3'" 1 
ATOM   6887  O  "O3'" . DG  I 5  40  ? -29.670 -3.603  18.571 1.00 105.31 ? -33  DG  I "O3'" 1 
ATOM   6888  C  "C2'" . DG  I 5  40  ? -30.575 -5.487  17.312 1.00 104.09 ? -33  DG  I "C2'" 1 
ATOM   6889  C  "C1'" . DG  I 5  40  ? -30.183 -4.989  15.926 1.00 111.54 ? -33  DG  I "C1'" 1 
ATOM   6890  N  N9    . DG  I 5  40  ? -30.797 -5.673  14.789 1.00 118.23 ? -33  DG  I N9    1 
ATOM   6891  C  C8    . DG  I 5  40  ? -31.253 -6.969  14.717 1.00 118.25 ? -33  DG  I C8    1 
ATOM   6892  N  N7    . DG  I 5  40  ? -31.763 -7.268  13.552 1.00 114.12 ? -33  DG  I N7    1 
ATOM   6893  C  C5    . DG  I 5  40  ? -31.641 -6.098  12.814 1.00 123.15 ? -33  DG  I C5    1 
ATOM   6894  C  C6    . DG  I 5  40  ? -32.021 -5.809  11.475 1.00 129.58 ? -33  DG  I C6    1 
ATOM   6895  O  O6    . DG  I 5  40  ? -32.549 -6.557  10.643 1.00 133.70 ? -33  DG  I O6    1 
ATOM   6896  N  N1    . DG  I 5  40  ? -31.712 -4.497  11.129 1.00 125.66 ? -33  DG  I N1    1 
ATOM   6897  C  C2    . DG  I 5  40  ? -31.119 -3.579  11.961 1.00 120.44 ? -33  DG  I C2    1 
ATOM   6898  N  N2    . DG  I 5  40  ? -30.905 -2.362  11.444 1.00 124.26 ? -33  DG  I N2    1 
ATOM   6899  N  N3    . DG  I 5  40  ? -30.763 -3.834  13.209 1.00 116.53 ? -33  DG  I N3    1 
ATOM   6900  C  C4    . DG  I 5  40  ? -31.049 -5.105  13.565 1.00 119.04 ? -33  DG  I C4    1 
ATOM   6901  P  P     . DA  I 5  41  ? -30.411 -3.257  19.952 1.00 110.83 ? -32  DA  I P     1 
ATOM   6902  O  OP1   . DA  I 5  41  ? -29.558 -3.707  21.083 1.00 109.25 ? -32  DA  I OP1   1 
ATOM   6903  O  OP2   . DA  I 5  41  ? -31.826 -3.705  19.877 1.00 104.42 ? -32  DA  I OP2   1 
ATOM   6904  O  "O5'" . DA  I 5  41  ? -30.415 -1.663  19.923 1.00 120.78 ? -32  DA  I "O5'" 1 
ATOM   6905  C  "C5'" . DA  I 5  41  ? -29.596 -0.919  18.985 1.00 120.30 ? -32  DA  I "C5'" 1 
ATOM   6906  C  "C4'" . DA  I 5  41  ? -30.434 0.044   18.166 1.00 116.96 ? -32  DA  I "C4'" 1 
ATOM   6907  O  "O4'" . DA  I 5  41  ? -30.929 -0.628  16.977 1.00 116.77 ? -32  DA  I "O4'" 1 
ATOM   6908  C  "C3'" . DA  I 5  41  ? -31.643 0.667   18.873 1.00 125.71 ? -32  DA  I "C3'" 1 
ATOM   6909  O  "O3'" . DA  I 5  41  ? -31.578 2.099   18.847 1.00 124.33 ? -32  DA  I "O3'" 1 
ATOM   6910  C  "C2'" . DA  I 5  41  ? -32.856 -0.010  18.223 1.00 122.48 ? -32  DA  I "C2'" 1 
ATOM   6911  C  "C1'" . DA  I 5  41  ? -32.322 -0.423  16.849 1.00 120.90 ? -32  DA  I "C1'" 1 
ATOM   6912  N  N9    . DA  I 5  41  ? -32.919 -1.666  16.353 1.00 121.86 ? -32  DA  I N9    1 
ATOM   6913  C  C8    . DA  I 5  41  ? -33.152 -2.816  17.069 1.00 123.12 ? -32  DA  I C8    1 
ATOM   6914  N  N7    . DA  I 5  41  ? -33.691 -3.779  16.362 1.00 119.56 ? -32  DA  I N7    1 
ATOM   6915  C  C5    . DA  I 5  41  ? -33.819 -3.231  15.094 1.00 116.30 ? -32  DA  I C5    1 
ATOM   6916  C  C6    . DA  I 5  41  ? -34.319 -3.748  13.887 1.00 108.36 ? -32  DA  I C6    1 
ATOM   6917  N  N6    . DA  I 5  41  ? -34.804 -4.985  13.757 1.00 109.17 ? -32  DA  I N6    1 
ATOM   6918  N  N1    . DA  I 5  41  ? -34.307 -2.941  12.805 1.00 106.52 ? -32  DA  I N1    1 
ATOM   6919  C  C2    . DA  I 5  41  ? -33.819 -1.700  12.936 1.00 116.66 ? -32  DA  I C2    1 
ATOM   6920  N  N3    . DA  I 5  41  ? -33.320 -1.099  14.015 1.00 121.43 ? -32  DA  I N3    1 
ATOM   6921  C  C4    . DA  I 5  41  ? -33.348 -1.929  15.074 1.00 122.68 ? -32  DA  I C4    1 
ATOM   6922  P  P     . DA  I 5  42  ? -32.748 3.129   18.467 1.00 121.79 ? -31  DA  I P     1 
ATOM   6923  O  OP1   . DA  I 5  42  ? -32.129 4.477   18.477 1.00 120.60 ? -31  DA  I OP1   1 
ATOM   6924  O  OP2   . DA  I 5  42  ? -33.952 2.866   19.304 1.00 121.02 ? -31  DA  I OP2   1 
ATOM   6925  O  "O5'" . DA  I 5  42  ? -33.037 2.689   16.960 1.00 135.74 ? -31  DA  I "O5'" 1 
ATOM   6926  C  "C5'" . DA  I 5  42  ? -33.355 3.640   15.928 1.00 139.18 ? -31  DA  I "C5'" 1 
ATOM   6927  C  "C4'" . DA  I 5  42  ? -34.753 3.399   15.406 1.00 136.76 ? -31  DA  I "C4'" 1 
ATOM   6928  O  "O4'" . DA  I 5  42  ? -34.973 1.977   15.178 1.00 135.61 ? -31  DA  I "O4'" 1 
ATOM   6929  C  "C3'" . DA  I 5  42  ? -35.899 3.866   16.313 1.00 139.41 ? -31  DA  I "C3'" 1 
ATOM   6930  O  "O3'" . DA  I 5  42  ? -36.835 4.597   15.520 1.00 153.27 ? -31  DA  I "O3'" 1 
ATOM   6931  C  "C2'" . DA  I 5  42  ? -36.513 2.553   16.800 1.00 140.59 ? -31  DA  I "C2'" 1 
ATOM   6932  C  "C1'" . DA  I 5  42  ? -36.286 1.664   15.583 1.00 139.33 ? -31  DA  I "C1'" 1 
ATOM   6933  N  N9    . DA  I 5  42  ? -36.400 0.223   15.814 1.00 139.53 ? -31  DA  I N9    1 
ATOM   6934  C  C8    . DA  I 5  42  ? -36.130 -0.502  16.950 1.00 137.77 ? -31  DA  I C8    1 
ATOM   6935  N  N7    . DA  I 5  42  ? -36.365 -1.786  16.825 1.00 136.09 ? -31  DA  I N7    1 
ATOM   6936  C  C5    . DA  I 5  42  ? -36.841 -1.913  15.527 1.00 131.40 ? -31  DA  I C5    1 
ATOM   6937  C  C6    . DA  I 5  42  ? -37.272 -3.024  14.781 1.00 128.26 ? -31  DA  I C6    1 
ATOM   6938  N  N6    . DA  I 5  42  ? -37.296 -4.270  15.257 1.00 123.50 ? -31  DA  I N6    1 
ATOM   6939  N  N1    . DA  I 5  42  ? -37.682 -2.808  13.511 1.00 135.80 ? -31  DA  I N1    1 
ATOM   6940  C  C2    . DA  I 5  42  ? -37.660 -1.557  13.035 1.00 141.83 ? -31  DA  I C2    1 
ATOM   6941  N  N3    . DA  I 5  42  ? -37.276 -0.432  13.637 1.00 142.60 ? -31  DA  I N3    1 
ATOM   6942  C  C4    . DA  I 5  42  ? -36.873 -0.683  14.895 1.00 137.25 ? -31  DA  I C4    1 
ATOM   6943  P  P     . DA  I 5  43  ? -38.025 5.544   16.066 1.00 150.23 ? -30  DA  I P     1 
ATOM   6944  O  OP1   . DA  I 5  43  ? -37.472 6.910   16.228 1.00 145.88 ? -30  DA  I OP1   1 
ATOM   6945  O  OP2   . DA  I 5  43  ? -38.728 4.896   17.206 1.00 147.55 ? -30  DA  I OP2   1 
ATOM   6946  O  "O5'" . DA  I 5  43  ? -39.048 5.611   14.844 1.00 149.12 ? -30  DA  I "O5'" 1 
ATOM   6947  C  "C5'" . DA  I 5  43  ? -38.956 4.684   13.743 1.00 145.82 ? -30  DA  I "C5'" 1 
ATOM   6948  C  "C4'" . DA  I 5  43  ? -40.237 3.894   13.600 1.00 147.06 ? -30  DA  I "C4'" 1 
ATOM   6949  O  "O4'" . DA  I 5  43  ? -39.984 2.494   13.897 1.00 148.57 ? -30  DA  I "O4'" 1 
ATOM   6950  C  "C3'" . DA  I 5  43  ? -41.412 4.313   14.492 1.00 146.60 ? -30  DA  I "C3'" 1 
ATOM   6951  O  "O3'" . DA  I 5  43  ? -42.593 4.325   13.698 1.00 156.12 ? -30  DA  I "O3'" 1 
ATOM   6952  C  "C2'" . DA  I 5  43  ? -41.497 3.182   15.514 1.00 141.25 ? -30  DA  I "C2'" 1 
ATOM   6953  C  "C1'" . DA  I 5  43  ? -41.050 1.992   14.672 1.00 149.32 ? -30  DA  I "C1'" 1 
ATOM   6954  N  N9    . DA  I 5  43  ? -40.566 0.849   15.446 1.00 153.43 ? -30  DA  I N9    1 
ATOM   6955  C  C8    . DA  I 5  43  ? -39.738 0.868   16.541 1.00 149.30 ? -30  DA  I C8    1 
ATOM   6956  N  N7    . DA  I 5  43  ? -39.476 -0.321  17.027 1.00 149.00 ? -30  DA  I N7    1 
ATOM   6957  C  C5    . DA  I 5  43  ? -40.177 -1.183  16.195 1.00 151.29 ? -30  DA  I C5    1 
ATOM   6958  C  C6    . DA  I 5  43  ? -40.310 -2.584  16.178 1.00 153.31 ? -30  DA  I C6    1 
ATOM   6959  N  N6    . DA  I 5  43  ? -39.717 -3.394  17.058 1.00 155.54 ? -30  DA  I N6    1 
ATOM   6960  N  N1    . DA  I 5  43  ? -41.085 -3.131  15.215 1.00 148.34 ? -30  DA  I N1    1 
ATOM   6961  C  C2    . DA  I 5  43  ? -41.679 -2.317  14.332 1.00 141.82 ? -30  DA  I C2    1 
ATOM   6962  N  N3    . DA  I 5  43  ? -41.631 -0.988  14.244 1.00 145.44 ? -30  DA  I N3    1 
ATOM   6963  C  C4    . DA  I 5  43  ? -40.853 -0.476  15.216 1.00 152.14 ? -30  DA  I C4    1 
ATOM   6964  P  P     . DC  I 5  44  ? -43.906 5.156   14.077 1.00 151.73 ? -29  DC  I P     1 
ATOM   6965  O  OP1   . DC  I 5  44  ? -44.081 6.175   13.009 1.00 152.44 ? -29  DC  I OP1   1 
ATOM   6966  O  OP2   . DC  I 5  44  ? -43.820 5.586   15.497 1.00 150.05 ? -29  DC  I OP2   1 
ATOM   6967  O  "O5'" . DC  I 5  44  ? -45.061 4.067   13.935 1.00 139.84 ? -29  DC  I "O5'" 1 
ATOM   6968  C  "C5'" . DC  I 5  44  ? -45.324 3.444   12.667 1.00 135.85 ? -29  DC  I "C5'" 1 
ATOM   6969  C  "C4'" . DC  I 5  44  ? -45.918 2.072   12.868 1.00 140.61 ? -29  DC  I "C4'" 1 
ATOM   6970  O  "O4'" . DC  I 5  44  ? -45.007 1.237   13.637 1.00 145.29 ? -29  DC  I "O4'" 1 
ATOM   6971  C  "C3'" . DC  I 5  44  ? -47.261 2.014   13.608 1.00 147.14 ? -29  DC  I "C3'" 1 
ATOM   6972  O  "O3'" . DC  I 5  44  ? -48.197 1.247   12.845 1.00 154.52 ? -29  DC  I "O3'" 1 
ATOM   6973  C  "C2'" . DC  I 5  44  ? -46.906 1.306   14.917 1.00 151.66 ? -29  DC  I "C2'" 1 
ATOM   6974  C  "C1'" . DC  I 5  44  ? -45.789 0.386   14.440 1.00 156.25 ? -29  DC  I "C1'" 1 
ATOM   6975  N  N1    . DC  I 5  44  ? -44.964 -0.249  15.486 1.00 157.86 ? -29  DC  I N1    1 
ATOM   6976  C  C2    . DC  I 5  44  ? -44.936 -1.648  15.542 1.00 155.08 ? -29  DC  I C2    1 
ATOM   6977  O  O2    . DC  I 5  44  ? -45.571 -2.295  14.694 1.00 154.84 ? -29  DC  I O2    1 
ATOM   6978  N  N3    . DC  I 5  44  ? -44.213 -2.258  16.509 1.00 152.87 ? -29  DC  I N3    1 
ATOM   6979  C  C4    . DC  I 5  44  ? -43.546 -1.527  17.404 1.00 153.81 ? -29  DC  I C4    1 
ATOM   6980  N  N4    . DC  I 5  44  ? -42.843 -2.171  18.338 1.00 151.64 ? -29  DC  I N4    1 
ATOM   6981  C  C5    . DC  I 5  44  ? -43.568 -0.100  17.380 1.00 153.47 ? -29  DC  I C5    1 
ATOM   6982  C  C6    . DC  I 5  44  ? -44.290 0.492   16.417 1.00 155.19 ? -29  DC  I C6    1 
ATOM   6983  P  P     . DT  I 5  45  ? -49.466 0.416   13.410 1.00 156.23 ? -28  DT  I P     1 
ATOM   6984  O  OP1   . DT  I 5  45  ? -50.373 0.222   12.247 1.00 153.33 ? -28  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I 5  45  ? -49.979 1.080   14.642 1.00 148.05 ? -28  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I 5  45  ? -48.877 -1.010  13.824 1.00 166.70 ? -28  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I 5  45  ? -49.571 -2.241  13.523 1.00 162.67 ? -28  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I 5  45  ? -49.939 -2.980  14.791 1.00 167.98 ? -28  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I 5  45  ? -48.835 -3.015  15.736 1.00 173.45 ? -28  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I 5  45  ? -51.133 -2.412  15.569 1.00 161.47 ? -28  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I 5  45  ? -51.855 -3.518  16.110 1.00 156.27 ? -28  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I 5  45  ? -50.485 -1.780  16.787 1.00 162.13 ? -28  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I 5  45  ? -49.397 -2.804  17.021 1.00 163.00 ? -28  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I 5  45  ? -48.316 -2.457  17.968 1.00 155.85 ? -28  DT  I N1    1 
ATOM   6995  C  C2    . DT  I 5  45  ? -47.575 -3.491  18.496 1.00 149.97 ? -28  DT  I C2    1 
ATOM   6996  O  O2    . DT  I 5  45  ? -47.741 -4.659  18.184 1.00 143.86 ? -28  DT  I O2    1 
ATOM   6997  N  N3    . DT  I 5  45  ? -46.613 -3.102  19.395 1.00 150.14 ? -28  DT  I N3    1 
ATOM   6998  C  C4    . DT  I 5  45  ? -46.338 -1.816  19.823 1.00 151.66 ? -28  DT  I C4    1 
ATOM   6999  O  O4    . DT  I 5  45  ? -45.437 -1.621  20.635 1.00 154.70 ? -28  DT  I O4    1 
ATOM   7000  C  C5    . DT  I 5  45  ? -47.170 -0.783  19.245 1.00 151.47 ? -28  DT  I C5    1 
ATOM   7001  C  C7    . DT  I 5  45  ? -46.944 0.641   19.645 1.00 146.20 ? -28  DT  I C7    1 
ATOM   7002  C  C6    . DT  I 5  45  ? -48.111 -1.152  18.366 1.00 154.09 ? -28  DT  I C6    1 
ATOM   7003  P  P     . DG  I 5  46  ? -53.214 -4.080  15.518 1.00 152.22 ? -27  DG  I P     1 
ATOM   7004  O  OP1   . DG  I 5  46  ? -53.494 -3.351  14.257 1.00 158.07 ? -27  DG  I OP1   1 
ATOM   7005  O  OP2   . DG  I 5  46  ? -54.185 -4.007  16.641 1.00 144.21 ? -27  DG  I OP2   1 
ATOM   7006  O  "O5'" . DG  I 5  46  ? -52.923 -5.609  15.166 1.00 148.38 ? -27  DG  I "O5'" 1 
ATOM   7007  C  "C5'" . DG  I 5  46  ? -51.651 -6.229  15.451 1.00 140.05 ? -27  DG  I "C5'" 1 
ATOM   7008  C  "C4'" . DG  I 5  46  ? -51.785 -7.348  16.470 1.00 140.15 ? -27  DG  I "C4'" 1 
ATOM   7009  O  "O4'" . DG  I 5  46  ? -50.963 -7.047  17.632 1.00 143.17 ? -27  DG  I "O4'" 1 
ATOM   7010  C  "C3'" . DG  I 5  46  ? -53.172 -7.654  17.029 1.00 139.48 ? -27  DG  I "C3'" 1 
ATOM   7011  O  "O3'" . DG  I 5  46  ? -53.196 -9.040  17.374 1.00 137.70 ? -27  DG  I "O3'" 1 
ATOM   7012  C  "C2'" . DG  I 5  46  ? -53.230 -6.772  18.274 1.00 136.39 ? -27  DG  I "C2'" 1 
ATOM   7013  C  "C1'" . DG  I 5  46  ? -51.787 -6.858  18.771 1.00 138.71 ? -27  DG  I "C1'" 1 
ATOM   7014  N  N9    . DG  I 5  46  ? -51.307 -5.677  19.480 1.00 141.86 ? -27  DG  I N9    1 
ATOM   7015  C  C8    . DG  I 5  46  ? -51.715 -4.374  19.319 1.00 147.96 ? -27  DG  I C8    1 
ATOM   7016  N  N7    . DG  I 5  46  ? -51.068 -3.536  20.082 1.00 145.68 ? -27  DG  I N7    1 
ATOM   7017  C  C5    . DG  I 5  46  ? -50.170 -4.331  20.780 1.00 143.70 ? -27  DG  I C5    1 
ATOM   7018  C  C6    . DG  I 5  46  ? -49.202 -3.985  21.761 1.00 139.88 ? -27  DG  I C6    1 
ATOM   7019  O  O6    . DG  I 5  46  ? -48.936 -2.869  22.224 1.00 129.69 ? -27  DG  I O6    1 
ATOM   7020  N  N1    . DG  I 5  46  ? -48.508 -5.104  22.210 1.00 146.45 ? -27  DG  I N1    1 
ATOM   7021  C  C2    . DG  I 5  46  ? -48.714 -6.390  21.774 1.00 150.40 ? -27  DG  I C2    1 
ATOM   7022  N  N2    . DG  I 5  46  ? -47.941 -7.335  22.327 1.00 152.18 ? -27  DG  I N2    1 
ATOM   7023  N  N3    . DG  I 5  46  ? -49.613 -6.725  20.863 1.00 147.69 ? -27  DG  I N3    1 
ATOM   7024  C  C4    . DG  I 5  46  ? -50.299 -5.654  20.413 1.00 143.90 ? -27  DG  I C4    1 
ATOM   7025  P  P     . DC  I 5  47  ? -54.477 -9.886  17.856 1.00 133.62 ? -26  DC  I P     1 
ATOM   7026  O  OP1   . DC  I 5  47  ? -54.497 -11.104 17.003 1.00 123.24 ? -26  DC  I OP1   1 
ATOM   7027  O  OP2   . DC  I 5  47  ? -55.667 -8.996  17.918 1.00 125.24 ? -26  DC  I OP2   1 
ATOM   7028  O  "O5'" . DC  I 5  47  ? -54.164 -10.333 19.357 1.00 141.93 ? -26  DC  I "O5'" 1 
ATOM   7029  C  "C5'" . DC  I 5  47  ? -53.060 -11.208 19.684 1.00 128.78 ? -26  DC  I "C5'" 1 
ATOM   7030  C  "C4'" . DC  I 5  47  ? -52.751 -11.126 21.162 1.00 119.42 ? -26  DC  I "C4'" 1 
ATOM   7031  O  "O4'" . DC  I 5  47  ? -52.305 -9.783  21.497 1.00 124.34 ? -26  DC  I "O4'" 1 
ATOM   7032  C  "C3'" . DC  I 5  47  ? -53.914 -11.440 22.103 1.00 122.55 ? -26  DC  I "C3'" 1 
ATOM   7033  O  "O3'" . DC  I 5  47  ? -53.471 -12.313 23.130 1.00 128.92 ? -26  DC  I "O3'" 1 
ATOM   7034  C  "C2'" . DC  I 5  47  ? -54.293 -10.079 22.683 1.00 122.10 ? -26  DC  I "C2'" 1 
ATOM   7035  C  "C1'" . DC  I 5  47  ? -52.946 -9.361  22.682 1.00 125.33 ? -26  DC  I "C1'" 1 
ATOM   7036  N  N1    . DC  I 5  47  ? -53.046 -7.889  22.671 1.00 120.45 ? -26  DC  I N1    1 
ATOM   7037  C  C2    . DC  I 5  47  ? -51.977 -7.132  23.162 1.00 120.72 ? -26  DC  I C2    1 
ATOM   7038  O  O2    . DC  I 5  47  ? -50.967 -7.718  23.577 1.00 115.25 ? -26  DC  I O2    1 
ATOM   7039  N  N3    . DC  I 5  47  ? -52.068 -5.782  23.161 1.00 125.13 ? -26  DC  I N3    1 
ATOM   7040  C  C4    . DC  I 5  47  ? -53.171 -5.188  22.700 1.00 122.47 ? -26  DC  I C4    1 
ATOM   7041  N  N4    . DC  I 5  47  ? -53.220 -3.854  22.722 1.00 121.51 ? -26  DC  I N4    1 
ATOM   7042  C  C5    . DC  I 5  47  ? -54.275 -5.935  22.198 1.00 124.17 ? -26  DC  I C5    1 
ATOM   7043  C  C6    . DC  I 5  47  ? -54.172 -7.270  22.204 1.00 123.47 ? -26  DC  I C6    1 
ATOM   7044  P  P     . DT  I 5  48  ? -53.884 -13.851 23.046 1.00 133.21 ? -25  DT  I P     1 
ATOM   7045  O  OP1   . DT  I 5  48  ? -53.283 -14.453 21.822 1.00 123.85 ? -25  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I 5  48  ? -55.348 -13.930 23.284 1.00 139.42 ? -25  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I 5  48  ? -53.180 -14.504 24.314 1.00 131.24 ? -25  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I 5  48  ? -53.122 -13.790 25.555 1.00 122.65 ? -25  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I 5  48  ? -51.696 -13.384 25.849 1.00 112.78 ? -25  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I 5  48  ? -51.532 -11.978 25.547 1.00 105.43 ? -25  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I 5  48  ? -51.313 -13.541 27.319 1.00 110.23 ? -25  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I 5  48  ? -49.942 -13.916 27.509 1.00 100.74 ? -25  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I 5  48  ? -51.641 -12.183 27.904 1.00 110.51 ? -25  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I 5  48  ? -51.380 -11.229 26.749 1.00 114.41 ? -25  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I 5  48  ? -52.315 -10.083 26.707 1.00 118.65 ? -25  DT  I N1    1 
ATOM   7056  C  C2    . DT  I 5  48  ? -51.813 -8.843  27.031 1.00 122.69 ? -25  DT  I C2    1 
ATOM   7057  O  O2    . DT  I 5  48  ? -50.644 -8.653  27.323 1.00 133.69 ? -25  DT  I O2    1 
ATOM   7058  N  N3    . DT  I 5  48  ? -52.731 -7.824  26.986 1.00 121.70 ? -25  DT  I N3    1 
ATOM   7059  C  C4    . DT  I 5  48  ? -54.072 -7.920  26.671 1.00 124.99 ? -25  DT  I C4    1 
ATOM   7060  O  O4    . DT  I 5  48  ? -54.774 -6.912  26.675 1.00 128.82 ? -25  DT  I O4    1 
ATOM   7061  C  C5    . DT  I 5  48  ? -54.536 -9.256  26.354 1.00 124.27 ? -25  DT  I C5    1 
ATOM   7062  C  C7    . DT  I 5  48  ? -55.974 -9.464  25.996 1.00 115.58 ? -25  DT  I C7    1 
ATOM   7063  C  C6    . DT  I 5  48  ? -53.646 -10.257 26.395 1.00 121.23 ? -25  DT  I C6    1 
ATOM   7064  P  P     . DC  I 5  49  ? -49.538 -14.926 28.705 1.00 95.16  ? -24  DC  I P     1 
ATOM   7065  O  OP1   . DC  I 5  49  ? -48.284 -15.571 28.237 1.00 83.51  ? -24  DC  I OP1   1 
ATOM   7066  O  OP2   . DC  I 5  49  ? -50.698 -15.777 29.079 1.00 91.51  ? -24  DC  I OP2   1 
ATOM   7067  O  "O5'" . DC  I 5  49  ? -49.277 -14.006 29.982 1.00 86.52  ? -24  DC  I "O5'" 1 
ATOM   7068  C  "C5'" . DC  I 5  49  ? -48.629 -12.727 29.863 1.00 87.82  ? -24  DC  I "C5'" 1 
ATOM   7069  C  "C4'" . DC  I 5  49  ? -49.147 -11.765 30.907 1.00 97.72  ? -24  DC  I "C4'" 1 
ATOM   7070  O  "O4'" . DC  I 5  49  ? -50.304 -11.040 30.398 1.00 110.49 ? -24  DC  I "O4'" 1 
ATOM   7071  C  "C3'" . DC  I 5  49  ? -49.598 -12.368 32.239 1.00 100.73 ? -24  DC  I "C3'" 1 
ATOM   7072  O  "O3'" . DC  I 5  49  ? -49.269 -11.415 33.239 1.00 98.23  ? -24  DC  I "O3'" 1 
ATOM   7073  C  "C2'" . DC  I 5  49  ? -51.118 -12.339 32.123 1.00 105.24 ? -24  DC  I "C2'" 1 
ATOM   7074  C  "C1'" . DC  I 5  49  ? -51.292 -11.004 31.409 1.00 111.50 ? -24  DC  I "C1'" 1 
ATOM   7075  N  N1    . DC  I 5  49  ? -52.610 -10.713 30.813 1.00 113.28 ? -24  DC  I N1    1 
ATOM   7076  C  C2    . DC  I 5  49  ? -53.012 -9.375  30.719 1.00 108.18 ? -24  DC  I C2    1 
ATOM   7077  O  O2    . DC  I 5  49  ? -52.242 -8.487  31.119 1.00 93.44  ? -24  DC  I O2    1 
ATOM   7078  N  N3    . DC  I 5  49  ? -54.224 -9.084  30.193 1.00 113.33 ? -24  DC  I N3    1 
ATOM   7079  C  C4    . DC  I 5  49  ? -55.024 -10.067 29.774 1.00 110.98 ? -24  DC  I C4    1 
ATOM   7080  N  N4    . DC  I 5  49  ? -56.209 -9.732  29.262 1.00 115.39 ? -24  DC  I N4    1 
ATOM   7081  C  C5    . DC  I 5  49  ? -54.644 -11.439 29.866 1.00 111.80 ? -24  DC  I C5    1 
ATOM   7082  C  C6    . DC  I 5  49  ? -53.445 -11.715 30.397 1.00 114.29 ? -24  DC  I C6    1 
ATOM   7083  P  P     . DC  I 5  50  ? -47.931 -11.558 34.076 1.00 93.76  ? -23  DC  I P     1 
ATOM   7084  O  OP1   . DC  I 5  50  ? -46.775 -11.631 33.145 1.00 89.10  ? -23  DC  I OP1   1 
ATOM   7085  O  OP2   . DC  I 5  50  ? -48.175 -12.645 35.057 1.00 94.75  ? -23  DC  I OP2   1 
ATOM   7086  O  "O5'" . DC  I 5  50  ? -47.834 -10.193 34.886 1.00 88.82  ? -23  DC  I "O5'" 1 
ATOM   7087  C  "C5'" . DC  I 5  50  ? -47.340 -8.998  34.266 1.00 83.72  ? -23  DC  I "C5'" 1 
ATOM   7088  C  "C4'" . DC  I 5  50  ? -48.177 -7.840  34.734 1.00 85.39  ? -23  DC  I "C4'" 1 
ATOM   7089  O  "O4'" . DC  I 5  50  ? -49.469 -7.908  34.076 1.00 95.29  ? -23  DC  I "O4'" 1 
ATOM   7090  C  "C3'" . DC  I 5  50  ? -48.454 -7.828  36.235 1.00 81.59  ? -23  DC  I "C3'" 1 
ATOM   7091  O  "O3'" . DC  I 5  50  ? -48.065 -6.571  36.770 1.00 85.02  ? -23  DC  I "O3'" 1 
ATOM   7092  C  "C2'" . DC  I 5  50  ? -49.955 -8.116  36.339 1.00 87.25  ? -23  DC  I "C2'" 1 
ATOM   7093  C  "C1'" . DC  I 5  50  ? -50.475 -7.581  35.005 1.00 99.30  ? -23  DC  I "C1'" 1 
ATOM   7094  N  N1    . DC  I 5  50  ? -51.746 -8.185  34.557 1.00 105.54 ? -23  DC  I N1    1 
ATOM   7095  C  C2    . DC  I 5  50  ? -52.776 -7.354  34.088 1.00 108.65 ? -23  DC  I C2    1 
ATOM   7096  O  O2    . DC  I 5  50  ? -52.591 -6.127  34.054 1.00 107.04 ? -23  DC  I O2    1 
ATOM   7097  N  N3    . DC  I 5  50  ? -53.939 -7.911  33.678 1.00 108.59 ? -23  DC  I N3    1 
ATOM   7098  C  C4    . DC  I 5  50  ? -54.099 -9.237  33.731 1.00 110.79 ? -23  DC  I C4    1 
ATOM   7099  N  N4    . DC  I 5  50  ? -55.264 -9.743  33.318 1.00 112.16 ? -23  DC  I N4    1 
ATOM   7100  C  C5    . DC  I 5  50  ? -53.070 -10.103 34.206 1.00 107.14 ? -23  DC  I C5    1 
ATOM   7101  C  C6    . DC  I 5  50  ? -51.921 -9.541  34.602 1.00 101.60 ? -23  DC  I C6    1 
ATOM   7102  P  P     . DA  I 5  51  ? -47.923 -6.325  38.352 1.00 85.10  ? -22  DA  I P     1 
ATOM   7103  O  OP1   . DA  I 5  51  ? -46.546 -5.827  38.572 1.00 86.13  ? -22  DA  I OP1   1 
ATOM   7104  O  OP2   . DA  I 5  51  ? -48.394 -7.534  39.066 1.00 82.48  ? -22  DA  I OP2   1 
ATOM   7105  O  "O5'" . DA  I 5  51  ? -48.908 -5.129  38.731 1.00 97.55  ? -22  DA  I "O5'" 1 
ATOM   7106  C  "C5'" . DA  I 5  51  ? -49.031 -3.971  37.875 1.00 105.35 ? -22  DA  I "C5'" 1 
ATOM   7107  C  "C4'" . DA  I 5  51  ? -50.192 -3.080  38.278 1.00 102.21 ? -22  DA  I "C4'" 1 
ATOM   7108  O  "O4'" . DA  I 5  51  ? -51.415 -3.523  37.642 1.00 98.34  ? -22  DA  I "O4'" 1 
ATOM   7109  C  "C3'" . DA  I 5  51  ? -50.498 -2.937  39.768 1.00 97.60  ? -22  DA  I "C3'" 1 
ATOM   7110  O  "O3'" . DA  I 5  51  ? -50.794 -1.566  40.001 1.00 107.70 ? -22  DA  I "O3'" 1 
ATOM   7111  C  "C2'" . DA  I 5  51  ? -51.684 -3.874  39.984 1.00 94.63  ? -22  DA  I "C2'" 1 
ATOM   7112  C  "C1'" . DA  I 5  51  ? -52.380 -3.852  38.621 1.00 106.16 ? -22  DA  I "C1'" 1 
ATOM   7113  N  N9    . DA  I 5  51  ? -52.927 -5.155  38.259 1.00 118.72 ? -22  DA  I N9    1 
ATOM   7114  C  C8    . DA  I 5  51  ? -52.285 -6.361  38.392 1.00 119.46 ? -22  DA  I C8    1 
ATOM   7115  N  N7    . DA  I 5  51  ? -52.980 -7.381  37.956 1.00 124.39 ? -22  DA  I N7    1 
ATOM   7116  C  C5    . DA  I 5  51  ? -54.153 -6.808  37.484 1.00 124.18 ? -22  DA  I C5    1 
ATOM   7117  C  C6    . DA  I 5  51  ? -55.303 -7.361  36.897 1.00 126.18 ? -22  DA  I C6    1 
ATOM   7118  N  N6    . DA  I 5  51  ? -55.463 -8.667  36.672 1.00 117.51 ? -22  DA  I N6    1 
ATOM   7119  N  N1    . DA  I 5  51  ? -56.299 -6.516  36.547 1.00 134.49 ? -22  DA  I N1    1 
ATOM   7120  C  C2    . DA  I 5  51  ? -56.136 -5.205  36.775 1.00 134.56 ? -22  DA  I C2    1 
ATOM   7121  N  N3    . DA  I 5  51  ? -55.104 -4.567  37.325 1.00 134.06 ? -22  DA  I N3    1 
ATOM   7122  C  C4    . DA  I 5  51  ? -54.133 -5.436  37.660 1.00 129.17 ? -22  DA  I C4    1 
ATOM   7123  P  P     . DT  I 5  52  ? -51.436 -0.971  41.341 1.00 119.15 ? -21  DT  I P     1 
ATOM   7124  O  OP1   . DT  I 5  52  ? -51.158 0.491   41.341 1.00 124.32 ? -21  DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I 5  52  ? -51.036 -1.788  42.515 1.00 106.25 ? -21  DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I 5  52  ? -52.991 -1.219  41.094 1.00 121.93 ? -21  DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I 5  52  ? -53.699 -0.621  39.988 1.00 120.54 ? -21  DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I 5  52  ? -55.183 -0.821  40.179 1.00 128.15 ? -21  DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I 5  52  ? -55.550 -2.136  39.701 1.00 127.46 ? -21  DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I 5  52  ? -55.637 -0.753  41.642 1.00 136.31 ? -21  DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I 5  52  ? -56.743 0.145   41.804 1.00 144.72 ? -21  DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I 5  52  ? -56.019 -2.184  41.982 1.00 123.75 ? -21  DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I 5  52  ? -56.423 -2.742  40.634 1.00 123.59 ? -21  DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I 5  52  ? -56.274 -4.200  40.511 1.00 122.88 ? -21  DT  I N1    1 
ATOM   7135  C  C2    . DT  I 5  52  ? -57.241 -4.901  39.825 1.00 126.50 ? -21  DT  I C2    1 
ATOM   7136  O  O2    . DT  I 5  52  ? -58.209 -4.369  39.307 1.00 130.77 ? -21  DT  I O2    1 
ATOM   7137  N  N3    . DT  I 5  52  ? -57.024 -6.256  39.757 1.00 125.27 ? -21  DT  I N3    1 
ATOM   7138  C  C4    . DT  I 5  52  ? -55.966 -6.962  40.300 1.00 127.56 ? -21  DT  I C4    1 
ATOM   7139  O  O4    . DT  I 5  52  ? -55.904 -8.181  40.154 1.00 119.73 ? -21  DT  I O4    1 
ATOM   7140  C  C5    . DT  I 5  52  ? -54.990 -6.162  41.008 1.00 126.37 ? -21  DT  I C5    1 
ATOM   7141  C  C7    . DT  I 5  52  ? -53.808 -6.837  41.629 1.00 116.98 ? -21  DT  I C7    1 
ATOM   7142  C  C6    . DT  I 5  52  ? -55.191 -4.839  41.076 1.00 122.98 ? -21  DT  I C6    1 
ATOM   7143  P  P     . DC  I 5  53  ? -57.249 0.647   43.246 1.00 137.99 ? -20  DC  I P     1 
ATOM   7144  O  OP1   . DC  I 5  53  ? -57.427 2.117   43.133 1.00 145.33 ? -20  DC  I OP1   1 
ATOM   7145  O  OP2   . DC  I 5  53  ? -56.399 0.103   44.340 1.00 137.24 ? -20  DC  I OP2   1 
ATOM   7146  O  "O5'" . DC  I 5  53  ? -58.675 -0.059  43.348 1.00 136.72 ? -20  DC  I "O5'" 1 
ATOM   7147  C  "C5'" . DC  I 5  53  ? -59.384 -0.502  42.170 1.00 135.68 ? -20  DC  I "C5'" 1 
ATOM   7148  C  "C4'" . DC  I 5  53  ? -60.490 -1.471  42.534 1.00 141.57 ? -20  DC  I "C4'" 1 
ATOM   7149  O  "O4'" . DC  I 5  53  ? -60.061 -2.835  42.263 1.00 137.58 ? -20  DC  I "O4'" 1 
ATOM   7150  C  "C3'" . DC  I 5  53  ? -60.954 -1.458  43.993 1.00 149.25 ? -20  DC  I "C3'" 1 
ATOM   7151  O  "O3'" . DC  I 5  53  ? -62.363 -1.648  44.060 1.00 157.35 ? -20  DC  I "O3'" 1 
ATOM   7152  C  "C2'" . DC  I 5  53  ? -60.280 -2.693  44.576 1.00 142.63 ? -20  DC  I "C2'" 1 
ATOM   7153  C  "C1'" . DC  I 5  53  ? -60.356 -3.642  43.385 1.00 139.38 ? -20  DC  I "C1'" 1 
ATOM   7154  N  N1    . DC  I 5  53  ? -59.409 -4.768  43.431 1.00 140.44 ? -20  DC  I N1    1 
ATOM   7155  C  C2    . DC  I 5  53  ? -59.637 -5.867  42.598 1.00 139.88 ? -20  DC  I C2    1 
ATOM   7156  O  O2    . DC  I 5  53  ? -60.610 -5.845  41.829 1.00 143.96 ? -20  DC  I O2    1 
ATOM   7157  N  N3    . DC  I 5  53  ? -58.788 -6.920  42.643 1.00 134.57 ? -20  DC  I N3    1 
ATOM   7158  C  C4    . DC  I 5  53  ? -57.752 -6.904  43.486 1.00 131.90 ? -20  DC  I C4    1 
ATOM   7159  N  N4    . DC  I 5  53  ? -56.937 -7.962  43.495 1.00 134.23 ? -20  DC  I N4    1 
ATOM   7160  C  C5    . DC  I 5  53  ? -57.502 -5.801  44.354 1.00 129.61 ? -20  DC  I C5    1 
ATOM   7161  C  C6    . DC  I 5  53  ? -58.350 -4.765  44.296 1.00 135.85 ? -20  DC  I C6    1 
ATOM   7162  P  P     . DA  I 5  54  ? -63.215 -0.927  45.201 1.00 154.57 ? -19  DA  I P     1 
ATOM   7163  O  OP1   . DA  I 5  54  ? -63.597 0.401   44.651 1.00 145.73 ? -19  DA  I OP1   1 
ATOM   7164  O  OP2   . DA  I 5  54  ? -62.452 -1.012  46.476 1.00 149.01 ? -19  DA  I OP2   1 
ATOM   7165  O  "O5'" . DA  I 5  54  ? -64.513 -1.838  45.350 1.00 152.83 ? -19  DA  I "O5'" 1 
ATOM   7166  C  "C5'" . DA  I 5  54  ? -65.333 -2.163  44.213 1.00 158.71 ? -19  DA  I "C5'" 1 
ATOM   7167  C  "C4'" . DA  I 5  54  ? -65.789 -3.599  44.304 1.00 166.99 ? -19  DA  I "C4'" 1 
ATOM   7168  O  "O4'" . DA  I 5  54  ? -64.632 -4.476  44.207 1.00 174.72 ? -19  DA  I "O4'" 1 
ATOM   7169  C  "C3'" . DA  I 5  54  ? -66.512 -3.981  45.600 1.00 172.00 ? -19  DA  I "C3'" 1 
ATOM   7170  O  "O3'" . DA  I 5  54  ? -67.670 -4.767  45.330 1.00 177.92 ? -19  DA  I "O3'" 1 
ATOM   7171  C  "C2'" . DA  I 5  54  ? -65.466 -4.794  46.358 1.00 179.77 ? -19  DA  I "C2'" 1 
ATOM   7172  C  "C1'" . DA  I 5  54  ? -64.717 -5.465  45.210 1.00 176.93 ? -19  DA  I "C1'" 1 
ATOM   7173  N  N9    . DA  I 5  54  ? -63.364 -5.897  45.566 1.00 172.56 ? -19  DA  I N9    1 
ATOM   7174  C  C8    . DA  I 5  54  ? -62.368 -5.163  46.163 1.00 157.65 ? -19  DA  I C8    1 
ATOM   7175  N  N7    . DA  I 5  54  ? -61.265 -5.839  46.371 1.00 145.78 ? -19  DA  I N7    1 
ATOM   7176  C  C5    . DA  I 5  54  ? -61.556 -7.107  45.888 1.00 157.95 ? -19  DA  I C5    1 
ATOM   7177  C  C6    . DA  I 5  54  ? -60.797 -8.289  45.816 1.00 159.57 ? -19  DA  I C6    1 
ATOM   7178  N  N6    . DA  I 5  54  ? -59.539 -8.388  46.251 1.00 160.77 ? -19  DA  I N6    1 
ATOM   7179  N  N1    . DA  I 5  54  ? -61.384 -9.381  45.278 1.00 164.64 ? -19  DA  I N1    1 
ATOM   7180  C  C2    . DA  I 5  54  ? -62.647 -9.281  44.842 1.00 165.49 ? -19  DA  I C2    1 
ATOM   7181  N  N3    . DA  I 5  54  ? -63.461 -8.226  44.851 1.00 169.61 ? -19  DA  I N3    1 
ATOM   7182  C  C4    . DA  I 5  54  ? -62.847 -7.159  45.393 1.00 169.00 ? -19  DA  I C4    1 
ATOM   7183  P  P     . DA  I 5  55  ? -68.636 -5.324  46.490 1.00 176.51 ? -18  DA  I P     1 
ATOM   7184  O  OP1   . DA  I 5  55  ? -70.015 -5.337  45.934 1.00 175.22 ? -18  DA  I OP1   1 
ATOM   7185  O  OP2   . DA  I 5  55  ? -68.363 -4.597  47.763 1.00 158.68 ? -18  DA  I OP2   1 
ATOM   7186  O  "O5'" . DA  I 5  55  ? -68.154 -6.834  46.666 1.00 180.08 ? -18  DA  I "O5'" 1 
ATOM   7187  C  "C5'" . DA  I 5  55  ? -68.760 -7.919  45.929 1.00 177.66 ? -18  DA  I "C5'" 1 
ATOM   7188  C  "C4'" . DA  I 5  55  ? -68.233 -9.251  46.422 1.00 178.23 ? -18  DA  I "C4'" 1 
ATOM   7189  O  "O4'" . DA  I 5  55  ? -66.793 -9.161  46.626 1.00 186.36 ? -18  DA  I "O4'" 1 
ATOM   7190  C  "C3'" . DA  I 5  55  ? -68.811 -9.755  47.747 1.00 176.84 ? -18  DA  I "C3'" 1 
ATOM   7191  O  "O3'" . DA  I 5  55  ? -68.924 -11.177 47.692 1.00 176.59 ? -18  DA  I "O3'" 1 
ATOM   7192  C  "C2'" . DA  I 5  55  ? -67.755 -9.319  48.758 1.00 175.27 ? -18  DA  I "C2'" 1 
ATOM   7193  C  "C1'" . DA  I 5  55  ? -66.477 -9.543  47.952 1.00 175.46 ? -18  DA  I "C1'" 1 
ATOM   7194  N  N9    . DA  I 5  55  ? -65.303 -8.783  48.392 1.00 165.63 ? -18  DA  I N9    1 
ATOM   7195  C  C8    . DA  I 5  55  ? -65.226 -7.469  48.788 1.00 157.63 ? -18  DA  I C8    1 
ATOM   7196  N  N7    . DA  I 5  55  ? -64.014 -7.085  49.112 1.00 147.22 ? -18  DA  I N7    1 
ATOM   7197  C  C5    . DA  I 5  55  ? -63.241 -8.221  48.915 1.00 146.31 ? -18  DA  I C5    1 
ATOM   7198  C  C6    . DA  I 5  55  ? -61.867 -8.470  49.080 1.00 131.99 ? -18  DA  I C6    1 
ATOM   7199  N  N6    . DA  I 5  55  ? -60.993 -7.553  49.498 1.00 121.56 ? -18  DA  I N6    1 
ATOM   7200  N  N1    . DA  I 5  55  ? -61.416 -9.711  48.794 1.00 137.23 ? -18  DA  I N1    1 
ATOM   7201  C  C2    . DA  I 5  55  ? -62.293 -10.631 48.371 1.00 146.82 ? -18  DA  I C2    1 
ATOM   7202  N  N3    . DA  I 5  55  ? -63.605 -10.518 48.176 1.00 149.81 ? -18  DA  I N3    1 
ATOM   7203  C  C4    . DA  I 5  55  ? -64.022 -9.273  48.469 1.00 154.88 ? -18  DA  I C4    1 
ATOM   7204  P  P     . DA  I 5  56  ? -69.839 -12.028 48.703 1.00 178.66 ? -17  DA  I P     1 
ATOM   7205  O  OP1   . DA  I 5  56  ? -71.233 -11.940 48.197 1.00 179.56 ? -17  DA  I OP1   1 
ATOM   7206  O  OP2   . DA  I 5  56  ? -69.537 -11.607 50.099 1.00 171.66 ? -17  DA  I OP2   1 
ATOM   7207  O  "O5'" . DA  I 5  56  ? -69.374 -13.547 48.544 1.00 169.20 ? -17  DA  I "O5'" 1 
ATOM   7208  C  "C5'" . DA  I 5  56  ? -68.222 -13.905 47.751 1.00 170.75 ? -17  DA  I "C5'" 1 
ATOM   7209  C  "C4'" . DA  I 5  56  ? -67.124 -14.510 48.606 1.00 165.27 ? -17  DA  I "C4'" 1 
ATOM   7210  O  "O4'" . DA  I 5  56  ? -66.119 -13.504 48.892 1.00 162.10 ? -17  DA  I "O4'" 1 
ATOM   7211  C  "C3'" . DA  I 5  56  ? -67.541 -15.110 49.956 1.00 167.19 ? -17  DA  I "C3'" 1 
ATOM   7212  O  "O3'" . DA  I 5  56  ? -67.202 -16.497 50.037 1.00 167.61 ? -17  DA  I "O3'" 1 
ATOM   7213  C  "C2'" . DA  I 5  56  ? -66.788 -14.271 50.993 1.00 165.74 ? -17  DA  I "C2'" 1 
ATOM   7214  C  "C1'" . DA  I 5  56  ? -65.613 -13.725 50.186 1.00 159.97 ? -17  DA  I "C1'" 1 
ATOM   7215  N  N9    . DA  I 5  56  ? -65.113 -12.456 50.715 1.00 152.06 ? -17  DA  I N9    1 
ATOM   7216  C  C8    . DA  I 5  56  ? -65.829 -11.318 50.995 1.00 148.68 ? -17  DA  I C8    1 
ATOM   7217  N  N7    . DA  I 5  56  ? -65.104 -10.344 51.486 1.00 142.28 ? -17  DA  I N7    1 
ATOM   7218  C  C5    . DA  I 5  56  ? -63.826 -10.879 51.549 1.00 144.10 ? -17  DA  I C5    1 
ATOM   7219  C  C6    . DA  I 5  56  ? -62.599 -10.350 51.986 1.00 135.84 ? -17  DA  I C6    1 
ATOM   7220  N  N6    . DA  I 5  56  ? -62.453 -9.111  52.460 1.00 132.05 ? -17  DA  I N6    1 
ATOM   7221  N  N1    . DA  I 5  56  ? -61.511 -11.148 51.918 1.00 138.95 ? -17  DA  I N1    1 
ATOM   7222  C  C2    . DA  I 5  56  ? -61.656 -12.391 51.438 1.00 141.29 ? -17  DA  I C2    1 
ATOM   7223  N  N3    . DA  I 5  56  ? -62.756 -13.003 51.003 1.00 139.43 ? -17  DA  I N3    1 
ATOM   7224  C  C4    . DA  I 5  56  ? -63.818 -12.183 51.084 1.00 147.02 ? -17  DA  I C4    1 
ATOM   7225  P  P     . DA  I 5  57  ? -67.112 -17.363 51.401 1.00 160.74 ? -16  DA  I P     1 
ATOM   7226  O  OP1   . DA  I 5  57  ? -67.384 -18.796 51.094 1.00 152.20 ? -16  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I 5  57  ? -67.813 -16.708 52.540 1.00 161.15 ? -16  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I 5  57  ? -65.554 -17.243 51.699 1.00 169.72 ? -16  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I 5  57  ? -64.574 -17.725 50.753 1.00 159.66 ? -16  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I 5  57  ? -63.212 -17.820 51.406 1.00 139.16 ? -16  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I 5  57  ? -62.758 -16.487 51.764 1.00 130.74 ? -16  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I 5  57  ? -63.136 -18.665 52.682 1.00 136.13 ? -16  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I 5  57  ? -61.980 -19.500 52.651 1.00 131.81 ? -16  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I 5  57  ? -63.106 -17.623 53.801 1.00 127.56 ? -16  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I 5  57  ? -62.380 -16.462 53.124 1.00 131.05 ? -16  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I 5  57  ? -62.720 -15.148 53.668 1.00 133.69 ? -16  DA  I N9    1 
ATOM   7237  C  C8    . DA  I 5  57  ? -63.962 -14.588 53.837 1.00 136.12 ? -16  DA  I C8    1 
ATOM   7238  N  N7    . DA  I 5  57  ? -63.932 -13.381 54.349 1.00 141.23 ? -16  DA  I N7    1 
ATOM   7239  C  C5    . DA  I 5  57  ? -62.579 -13.126 54.524 1.00 132.65 ? -16  DA  I C5    1 
ATOM   7240  C  C6    . DA  I 5  57  ? -61.880 -12.010 55.022 1.00 124.95 ? -16  DA  I C6    1 
ATOM   7241  N  N6    . DA  I 5  57  ? -62.473 -10.899 55.462 1.00 123.42 ? -16  DA  I N6    1 
ATOM   7242  N  N1    . DA  I 5  57  ? -60.532 -12.081 55.063 1.00 124.52 ? -16  DA  I N1    1 
ATOM   7243  C  C2    . DA  I 5  57  ? -59.935 -13.193 54.618 1.00 133.03 ? -16  DA  I C2    1 
ATOM   7244  N  N3    . DA  I 5  57  ? -60.480 -14.302 54.122 1.00 137.77 ? -16  DA  I N3    1 
ATOM   7245  C  C4    . DA  I 5  57  ? -61.821 -14.205 54.106 1.00 135.50 ? -16  DA  I C4    1 
ATOM   7246  P  P     . DG  I 5  58  ? -61.672 -20.635 53.749 1.00 131.86 ? -15  DG  I P     1 
ATOM   7247  O  OP1   . DG  I 5  58  ? -61.544 -21.921 53.017 1.00 113.65 ? -15  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I 5  58  ? -62.590 -20.536 54.921 1.00 127.60 ? -15  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I 5  58  ? -60.216 -20.238 54.263 1.00 135.19 ? -15  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I 5  58  ? -59.794 -18.860 54.342 1.00 128.45 ? -15  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I 5  58  ? -58.931 -18.613 55.564 1.00 132.69 ? -15  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I 5  58  ? -59.209 -17.281 56.078 1.00 133.02 ? -15  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I 5  58  ? -59.131 -19.540 56.760 1.00 130.41 ? -15  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I 5  58  ? -57.953 -19.554 57.578 1.00 120.04 ? -15  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I 5  58  ? -60.259 -18.841 57.509 1.00 133.28 ? -15  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I 5  58  ? -59.850 -17.379 57.338 1.00 135.02 ? -15  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I 5  58  ? -60.937 -16.405 57.370 1.00 140.32 ? -15  DG  I N9    1 
ATOM   7258  C  C8    . DG  I 5  58  ? -62.260 -16.598 57.047 1.00 133.72 ? -15  DG  I C8    1 
ATOM   7259  N  N7    . DG  I 5  58  ? -62.978 -15.514 57.161 1.00 126.43 ? -15  DG  I N7    1 
ATOM   7260  C  C5    . DG  I 5  58  ? -62.074 -14.545 57.580 1.00 134.15 ? -15  DG  I C5    1 
ATOM   7261  C  C6    . DG  I 5  58  ? -62.267 -13.168 57.877 1.00 129.83 ? -15  DG  I C6    1 
ATOM   7262  O  O6    . DG  I 5  58  ? -63.310 -12.506 57.823 1.00 121.90 ? -15  DG  I O6    1 
ATOM   7263  N  N1    . DG  I 5  58  ? -61.078 -12.554 58.257 1.00 127.66 ? -15  DG  I N1    1 
ATOM   7264  C  C2    . DG  I 5  58  ? -59.860 -13.182 58.353 1.00 123.40 ? -15  DG  I C2    1 
ATOM   7265  N  N2    . DG  I 5  58  ? -58.831 -12.418 58.744 1.00 116.07 ? -15  DG  I N2    1 
ATOM   7266  N  N3    . DG  I 5  58  ? -59.667 -14.464 58.085 1.00 125.83 ? -15  DG  I N3    1 
ATOM   7267  C  C4    . DG  I 5  58  ? -60.809 -15.080 57.707 1.00 136.66 ? -15  DG  I C4    1 
ATOM   7268  P  P     . DG  I 5  59  ? -56.694 -20.559 57.433 1.00 105.51 ? -14  DG  I P     1 
ATOM   7269  O  OP1   . DG  I 5  59  ? -56.452 -20.855 56.000 1.00 105.10 ? -14  DG  I OP1   1 
ATOM   7270  O  OP2   . DG  I 5  59  ? -56.824 -21.681 58.400 1.00 100.36 ? -14  DG  I OP2   1 
ATOM   7271  O  "O5'" . DG  I 5  59  ? -55.466 -19.650 57.879 1.00 100.57 ? -14  DG  I "O5'" 1 
ATOM   7272  C  "C5'" . DG  I 5  59  ? -54.829 -18.773 56.936 1.00 104.07 ? -14  DG  I "C5'" 1 
ATOM   7273  C  "C4'" . DG  I 5  59  ? -54.231 -17.583 57.651 1.00 112.17 ? -14  DG  I "C4'" 1 
ATOM   7274  O  "O4'" . DG  I 5  59  ? -55.292 -16.784 58.242 1.00 117.64 ? -14  DG  I "O4'" 1 
ATOM   7275  C  "C3'" . DG  I 5  59  ? -53.286 -17.891 58.804 1.00 109.93 ? -14  DG  I "C3'" 1 
ATOM   7276  O  "O3'" . DG  I 5  59  ? -52.455 -16.747 58.971 1.00 104.87 ? -14  DG  I "O3'" 1 
ATOM   7277  C  "C2'" . DG  I 5  59  ? -54.247 -17.981 59.981 1.00 109.60 ? -14  DG  I "C2'" 1 
ATOM   7278  C  "C1'" . DG  I 5  59  ? -55.200 -16.832 59.657 1.00 118.55 ? -14  DG  I "C1'" 1 
ATOM   7279  N  N9    . DG  I 5  59  ? -56.552 -16.988 60.179 1.00 127.78 ? -14  DG  I N9    1 
ATOM   7280  C  C8    . DG  I 5  59  ? -57.324 -18.125 60.152 1.00 131.45 ? -14  DG  I C8    1 
ATOM   7281  N  N7    . DG  I 5  59  ? -58.515 -17.947 60.655 1.00 135.74 ? -14  DG  I N7    1 
ATOM   7282  C  C5    . DG  I 5  59  ? -58.538 -16.608 61.019 1.00 133.30 ? -14  DG  I C5    1 
ATOM   7283  C  C6    . DG  I 5  59  ? -59.570 -15.834 61.610 1.00 131.08 ? -14  DG  I C6    1 
ATOM   7284  O  O6    . DG  I 5  59  ? -60.703 -16.194 61.952 1.00 133.23 ? -14  DG  I O6    1 
ATOM   7285  N  N1    . DG  I 5  59  ? -59.169 -14.517 61.811 1.00 125.78 ? -14  DG  I N1    1 
ATOM   7286  C  C2    . DG  I 5  59  ? -57.936 -14.007 61.484 1.00 125.48 ? -14  DG  I C2    1 
ATOM   7287  N  N2    . DG  I 5  59  ? -57.741 -12.708 61.754 1.00 129.92 ? -14  DG  I N2    1 
ATOM   7288  N  N3    . DG  I 5  59  ? -56.969 -14.716 60.927 1.00 116.26 ? -14  DG  I N3    1 
ATOM   7289  C  C4    . DG  I 5  59  ? -57.336 -15.999 60.724 1.00 124.81 ? -14  DG  I C4    1 
ATOM   7290  P  P     . DC  I 5  60  ? -50.996 -16.778 59.616 1.00 89.04  ? -13  DC  I P     1 
ATOM   7291  O  OP1   . DC  I 5  60  ? -50.081 -16.513 58.482 1.00 88.19  ? -13  DC  I OP1   1 
ATOM   7292  O  OP2   . DC  I 5  60  ? -50.847 -18.011 60.424 1.00 85.60  ? -13  DC  I OP2   1 
ATOM   7293  O  "O5'" . DC  I 5  60  ? -50.990 -15.577 60.668 1.00 93.13  ? -13  DC  I "O5'" 1 
ATOM   7294  C  "C5'" . DC  I 5  60  ? -51.290 -14.208 60.298 1.00 95.88  ? -13  DC  I "C5'" 1 
ATOM   7295  C  "C4'" . DC  I 5  60  ? -51.766 -13.414 61.501 1.00 97.09  ? -13  DC  I "C4'" 1 
ATOM   7296  O  "O4'" . DC  I 5  60  ? -53.113 -13.838 61.860 1.00 107.64 ? -13  DC  I "O4'" 1 
ATOM   7297  C  "C3'" . DC  I 5  60  ? -50.936 -13.531 62.783 1.00 97.31  ? -13  DC  I "C3'" 1 
ATOM   7298  O  "O3'" . DC  I 5  60  ? -50.908 -12.310 63.506 1.00 91.58  ? -13  DC  I "O3'" 1 
ATOM   7299  C  "C2'" . DC  I 5  60  ? -51.755 -14.488 63.643 1.00 101.55 ? -13  DC  I "C2'" 1 
ATOM   7300  C  "C1'" . DC  I 5  60  ? -53.174 -14.083 63.254 1.00 110.07 ? -13  DC  I "C1'" 1 
ATOM   7301  N  N1    . DC  I 5  60  ? -54.179 -15.130 63.497 1.00 109.62 ? -13  DC  I N1    1 
ATOM   7302  C  C2    . DC  I 5  60  ? -55.374 -14.800 64.149 1.00 105.83 ? -13  DC  I C2    1 
ATOM   7303  O  O2    . DC  I 5  60  ? -55.555 -13.630 64.518 1.00 101.38 ? -13  DC  I O2    1 
ATOM   7304  N  N3    . DC  I 5  60  ? -56.298 -15.767 64.362 1.00 106.20 ? -13  DC  I N3    1 
ATOM   7305  C  C4    . DC  I 5  60  ? -56.065 -17.016 63.947 1.00 106.97 ? -13  DC  I C4    1 
ATOM   7306  N  N4    . DC  I 5  60  ? -57.001 -17.939 64.176 1.00 103.81 ? -13  DC  I N4    1 
ATOM   7307  C  C5    . DC  I 5  60  ? -54.859 -17.375 63.280 1.00 113.30 ? -13  DC  I C5    1 
ATOM   7308  C  C6    . DC  I 5  60  ? -53.953 -16.411 63.076 1.00 110.33 ? -13  DC  I C6    1 
ATOM   7309  P  P     . DA  I 5  61  ? -49.663 -11.347 63.411 1.00 89.49  ? -12  DA  I P     1 
ATOM   7310  O  OP1   . DA  I 5  61  ? -49.644 -10.808 62.026 1.00 90.51  ? -12  DA  I OP1   1 
ATOM   7311  O  OP2   . DA  I 5  61  ? -48.493 -12.082 63.938 1.00 91.53  ? -12  DA  I OP2   1 
ATOM   7312  O  "O5'" . DA  I 5  61  ? -50.007 -10.188 64.447 1.00 95.30  ? -12  DA  I "O5'" 1 
ATOM   7313  C  "C5'" . DA  I 5  61  ? -51.024 -9.196  64.181 1.00 94.56  ? -12  DA  I "C5'" 1 
ATOM   7314  C  "C4'" . DA  I 5  61  ? -51.767 -8.870  65.454 1.00 90.62  ? -12  DA  I "C4'" 1 
ATOM   7315  O  "O4'" . DA  I 5  61  ? -52.666 -9.965  65.762 1.00 95.60  ? -12  DA  I "O4'" 1 
ATOM   7316  C  "C3'" . DA  I 5  61  ? -50.905 -8.651  66.703 1.00 92.99  ? -12  DA  I "C3'" 1 
ATOM   7317  O  "O3'" . DA  I 5  61  ? -51.395 -7.533  67.428 1.00 99.99  ? -12  DA  I "O3'" 1 
ATOM   7318  C  "C2'" . DA  I 5  61  ? -51.075 -9.946  67.495 1.00 88.10  ? -12  DA  I "C2'" 1 
ATOM   7319  C  "C1'" . DA  I 5  61  ? -52.491 -10.360 67.104 1.00 97.04  ? -12  DA  I "C1'" 1 
ATOM   7320  N  N9    . DA  I 5  61  ? -52.743 -11.794 67.175 1.00 103.29 ? -12  DA  I N9    1 
ATOM   7321  C  C8    . DA  I 5  61  ? -51.868 -12.829 66.951 1.00 113.77 ? -12  DA  I C8    1 
ATOM   7322  N  N7    . DA  I 5  61  ? -52.411 -14.016 67.069 1.00 115.29 ? -12  DA  I N7    1 
ATOM   7323  C  C5    . DA  I 5  61  ? -53.738 -13.745 67.372 1.00 122.55 ? -12  DA  I C5    1 
ATOM   7324  C  C6    . DA  I 5  61  ? -54.840 -14.579 67.619 1.00 129.13 ? -12  DA  I C6    1 
ATOM   7325  N  N6    . DA  I 5  61  ? -54.778 -15.912 67.594 1.00 128.46 ? -12  DA  I N6    1 
ATOM   7326  N  N1    . DA  I 5  61  ? -56.027 -13.990 67.888 1.00 130.83 ? -12  DA  I N1    1 
ATOM   7327  C  C2    . DA  I 5  61  ? -56.088 -12.652 67.908 1.00 123.94 ? -12  DA  I C2    1 
ATOM   7328  N  N3    . DA  I 5  61  ? -55.122 -11.761 67.693 1.00 120.44 ? -12  DA  I N3    1 
ATOM   7329  C  C4    . DA  I 5  61  ? -53.958 -12.380 67.429 1.00 117.59 ? -12  DA  I C4    1 
ATOM   7330  P  P     . DT  I 5  62  ? -50.606 -6.849  68.636 1.00 104.47 ? -11  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5  62  ? -50.918 -5.398  68.576 1.00 109.17 ? -11  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5  62  ? -49.190 -7.285  68.610 1.00 105.58 ? -11  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5  62  ? -51.336 -7.499  69.897 1.00 108.65 ? -11  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5  62  ? -52.720 -7.193  70.167 1.00 110.04 ? -11  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5  62  ? -53.326 -8.153  71.165 1.00 104.17 ? -11  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5  62  ? -53.586 -9.435  70.562 1.00 104.59 ? -11  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5  62  ? -52.483 -8.478  72.390 1.00 98.35  ? -11  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5  62  ? -52.698 -7.481  73.391 1.00 111.74 ? -11  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5  62  ? -53.075 -9.799  72.854 1.00 103.92 ? -11  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5  62  ? -53.751 -10.384 71.610 1.00 107.20 ? -11  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5  62  ? -53.167 -11.663 71.168 1.00 111.20 ? -11  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5  62  ? -53.987 -12.764 71.045 1.00 117.95 ? -11  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5  62  ? -55.185 -12.731 71.268 1.00 128.13 ? -11  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5  62  ? -53.348 -13.910 70.638 1.00 119.11 ? -11  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5  62  ? -52.002 -14.063 70.359 1.00 113.17 ? -11  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5  62  ? -51.573 -15.156 70.003 1.00 106.05 ? -11  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5  62  ? -51.200 -12.869 70.520 1.00 112.67 ? -11  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5  62  ? -49.733 -12.935 70.237 1.00 105.53 ? -11  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5  62  ? -51.815 -11.747 70.913 1.00 116.32 ? -11  DT  I C6    1 
ATOM   7350  P  P     . DG  I 5  63  ? -51.870 -7.430  74.764 1.00 125.97 ? -10  DG  I P     1 
ATOM   7351  O  OP1   . DG  I 5  63  ? -51.180 -6.119  74.772 1.00 128.38 ? -10  DG  I OP1   1 
ATOM   7352  O  OP2   . DG  I 5  63  ? -51.074 -8.668  74.936 1.00 128.34 ? -10  DG  I OP2   1 
ATOM   7353  O  "O5'" . DG  I 5  63  ? -52.940 -7.395  75.945 1.00 130.66 ? -10  DG  I "O5'" 1 
ATOM   7354  C  "C5'" . DG  I 5  63  ? -53.933 -8.427  76.093 1.00 132.11 ? -10  DG  I "C5'" 1 
ATOM   7355  C  "C4'" . DG  I 5  63  ? -53.612 -9.337  77.263 1.00 142.25 ? -10  DG  I "C4'" 1 
ATOM   7356  O  "O4'" . DG  I 5  63  ? -53.460 -10.693 76.766 1.00 142.88 ? -10  DG  I "O4'" 1 
ATOM   7357  C  "C3'" . DG  I 5  63  ? -52.356 -9.012  78.078 1.00 140.88 ? -10  DG  I "C3'" 1 
ATOM   7358  O  "O3'" . DG  I 5  63  ? -52.567 -8.895  79.496 1.00 144.86 ? -10  DG  I "O3'" 1 
ATOM   7359  C  "C2'" . DG  I 5  63  ? -51.351 -10.081 77.644 1.00 140.68 ? -10  DG  I "C2'" 1 
ATOM   7360  C  "C1'" . DG  I 5  63  ? -52.259 -11.250 77.254 1.00 142.63 ? -10  DG  I "C1'" 1 
ATOM   7361  N  N9    . DG  I 5  63  ? -51.690 -12.098 76.209 1.00 139.84 ? -10  DG  I N9    1 
ATOM   7362  C  C8    . DG  I 5  63  ? -50.659 -11.772 75.361 1.00 131.43 ? -10  DG  I C8    1 
ATOM   7363  N  N7    . DG  I 5  63  ? -50.360 -12.728 74.525 1.00 126.08 ? -10  DG  I N7    1 
ATOM   7364  C  C5    . DG  I 5  63  ? -51.245 -13.750 74.840 1.00 136.13 ? -10  DG  I C5    1 
ATOM   7365  C  C6    . DG  I 5  63  ? -51.397 -15.042 74.272 1.00 137.61 ? -10  DG  I C6    1 
ATOM   7366  O  O6    . DG  I 5  63  ? -50.760 -15.557 73.345 1.00 130.05 ? -10  DG  I O6    1 
ATOM   7367  N  N1    . DG  I 5  63  ? -52.415 -15.758 74.895 1.00 138.72 ? -10  DG  I N1    1 
ATOM   7368  C  C2    . DG  I 5  63  ? -53.192 -15.291 75.927 1.00 136.46 ? -10  DG  I C2    1 
ATOM   7369  N  N2    . DG  I 5  63  ? -54.131 -16.130 76.388 1.00 133.45 ? -10  DG  I N2    1 
ATOM   7370  N  N3    . DG  I 5  63  ? -53.062 -14.088 76.465 1.00 134.36 ? -10  DG  I N3    1 
ATOM   7371  C  C4    . DG  I 5  63  ? -52.075 -13.377 75.877 1.00 137.08 ? -10  DG  I C4    1 
ATOM   7372  P  P     . DT  I 5  64  ? -52.720 -10.058 80.622 1.00 149.19 ? -9   DT  I P     1 
ATOM   7373  O  OP1   . DT  I 5  64  ? -53.444 -9.428  81.757 1.00 153.53 ? -9   DT  I OP1   1 
ATOM   7374  O  OP2   . DT  I 5  64  ? -51.388 -10.671 80.867 1.00 144.07 ? -9   DT  I OP2   1 
ATOM   7375  O  "O5'" . DT  I 5  64  ? -53.657 -11.185 79.988 1.00 139.93 ? -9   DT  I "O5'" 1 
ATOM   7376  C  "C5'" . DT  I 5  64  ? -54.614 -11.914 80.783 1.00 134.25 ? -9   DT  I "C5'" 1 
ATOM   7377  C  "C4'" . DT  I 5  64  ? -54.164 -13.339 81.018 1.00 132.61 ? -9   DT  I "C4'" 1 
ATOM   7378  O  "O4'" . DT  I 5  64  ? -53.351 -13.839 79.927 1.00 138.91 ? -9   DT  I "O4'" 1 
ATOM   7379  C  "C3'" . DT  I 5  64  ? -53.350 -13.556 82.298 1.00 132.66 ? -9   DT  I "C3'" 1 
ATOM   7380  O  "O3'" . DT  I 5  64  ? -54.012 -14.548 83.091 1.00 135.72 ? -9   DT  I "O3'" 1 
ATOM   7381  C  "C2'" . DT  I 5  64  ? -51.998 -14.046 81.801 1.00 135.35 ? -9   DT  I "C2'" 1 
ATOM   7382  C  "C1'" . DT  I 5  64  ? -52.360 -14.690 80.477 1.00 136.14 ? -9   DT  I "C1'" 1 
ATOM   7383  N  N1    . DT  I 5  64  ? -51.248 -14.817 79.498 1.00 136.58 ? -9   DT  I N1    1 
ATOM   7384  C  C2    . DT  I 5  64  ? -51.022 -16.054 78.934 1.00 135.47 ? -9   DT  I C2    1 
ATOM   7385  O  O2    . DT  I 5  64  ? -51.696 -17.039 79.190 1.00 143.48 ? -9   DT  I O2    1 
ATOM   7386  N  N3    . DT  I 5  64  ? -49.969 -16.097 78.053 1.00 128.81 ? -9   DT  I N3    1 
ATOM   7387  C  C4    . DT  I 5  64  ? -49.139 -15.052 77.690 1.00 126.46 ? -9   DT  I C4    1 
ATOM   7388  O  O4    . DT  I 5  64  ? -48.231 -15.242 76.886 1.00 124.03 ? -9   DT  I O4    1 
ATOM   7389  C  C5    . DT  I 5  64  ? -49.427 -13.787 78.326 1.00 121.02 ? -9   DT  I C5    1 
ATOM   7390  C  C7    . DT  I 5  64  ? -48.578 -12.600 78.000 1.00 113.21 ? -9   DT  I C7    1 
ATOM   7391  C  C6    . DT  I 5  64  ? -50.449 -13.735 79.192 1.00 129.59 ? -9   DT  I C6    1 
ATOM   7392  P  P     . DT  I 5  65  ? -53.378 -15.186 84.418 1.00 138.00 ? -8   DT  I P     1 
ATOM   7393  O  OP1   . DT  I 5  65  ? -54.488 -15.670 85.280 1.00 141.07 ? -8   DT  I OP1   1 
ATOM   7394  O  OP2   . DT  I 5  65  ? -52.348 -14.268 84.982 1.00 137.27 ? -8   DT  I OP2   1 
ATOM   7395  O  "O5'" . DT  I 5  65  ? -52.629 -16.461 83.836 1.00 130.27 ? -8   DT  I "O5'" 1 
ATOM   7396  C  "C5'" . DT  I 5  65  ? -53.346 -17.645 83.454 1.00 131.18 ? -8   DT  I "C5'" 1 
ATOM   7397  C  "C4'" . DT  I 5  65  ? -52.361 -18.779 83.302 1.00 134.01 ? -8   DT  I "C4'" 1 
ATOM   7398  O  "O4'" . DT  I 5  65  ? -51.463 -18.481 82.203 1.00 138.51 ? -8   DT  I "O4'" 1 
ATOM   7399  C  "C3'" . DT  I 5  65  ? -51.480 -18.999 84.538 1.00 131.64 ? -8   DT  I "C3'" 1 
ATOM   7400  O  "O3'" . DT  I 5  65  ? -51.540 -20.366 84.968 1.00 125.46 ? -8   DT  I "O3'" 1 
ATOM   7401  C  "C2'" . DT  I 5  65  ? -50.086 -18.584 84.086 1.00 139.94 ? -8   DT  I "C2'" 1 
ATOM   7402  C  "C1'" . DT  I 5  65  ? -50.136 -18.802 82.583 1.00 142.23 ? -8   DT  I "C1'" 1 
ATOM   7403  N  N1    . DT  I 5  65  ? -49.207 -17.964 81.784 1.00 134.67 ? -8   DT  I N1    1 
ATOM   7404  C  C2    . DT  I 5  65  ? -48.678 -18.501 80.631 1.00 127.68 ? -8   DT  I C2    1 
ATOM   7405  O  O2    . DT  I 5  65  ? -48.944 -19.624 80.233 1.00 124.70 ? -8   DT  I O2    1 
ATOM   7406  N  N3    . DT  I 5  65  ? -47.818 -17.670 79.956 1.00 117.54 ? -8   DT  I N3    1 
ATOM   7407  C  C4    . DT  I 5  65  ? -47.438 -16.391 80.313 1.00 121.38 ? -8   DT  I C4    1 
ATOM   7408  O  O4    . DT  I 5  65  ? -46.657 -15.765 79.603 1.00 122.18 ? -8   DT  I O4    1 
ATOM   7409  C  C5    . DT  I 5  65  ? -48.026 -15.893 81.537 1.00 128.12 ? -8   DT  I C5    1 
ATOM   7410  C  C7    . DT  I 5  65  ? -47.677 -14.515 82.002 1.00 130.19 ? -8   DT  I C7    1 
ATOM   7411  C  C6    . DT  I 5  65  ? -48.866 -16.695 82.204 1.00 132.04 ? -8   DT  I C6    1 
ATOM   7412  P  P     . DC  I 5  66  ? -50.825 -20.900 86.311 1.00 123.63 ? -7   DC  I P     1 
ATOM   7413  O  OP1   . DC  I 5  66  ? -51.696 -21.921 86.952 1.00 122.95 ? -7   DC  I OP1   1 
ATOM   7414  O  OP2   . DC  I 5  66  ? -50.328 -19.742 87.100 1.00 115.10 ? -7   DC  I OP2   1 
ATOM   7415  O  "O5'" . DC  I 5  66  ? -49.531 -21.678 85.801 1.00 129.60 ? -7   DC  I "O5'" 1 
ATOM   7416  C  "C5'" . DC  I 5  66  ? -49.598 -22.670 84.754 1.00 118.99 ? -7   DC  I "C5'" 1 
ATOM   7417  C  "C4'" . DC  I 5  66  ? -48.206 -22.973 84.253 1.00 108.77 ? -7   DC  I "C4'" 1 
ATOM   7418  O  "O4'" . DC  I 5  66  ? -47.673 -21.810 83.559 1.00 108.02 ? -7   DC  I "O4'" 1 
ATOM   7419  C  "C3'" . DC  I 5  66  ? -47.182 -23.324 85.336 1.00 106.51 ? -7   DC  I "C3'" 1 
ATOM   7420  O  "O3'" . DC  I 5  66  ? -46.376 -24.417 84.925 1.00 109.86 ? -7   DC  I "O3'" 1 
ATOM   7421  C  "C2'" . DC  I 5  66  ? -46.302 -22.078 85.410 1.00 103.20 ? -7   DC  I "C2'" 1 
ATOM   7422  C  "C1'" . DC  I 5  66  ? -46.332 -21.617 83.957 1.00 111.15 ? -7   DC  I "C1'" 1 
ATOM   7423  N  N1    . DC  I 5  66  ? -45.952 -20.211 83.724 1.00 122.54 ? -7   DC  I N1    1 
ATOM   7424  C  C2    . DC  I 5  66  ? -45.584 -19.823 82.430 1.00 122.92 ? -7   DC  I C2    1 
ATOM   7425  O  O2    . DC  I 5  66  ? -45.614 -20.665 81.520 1.00 116.84 ? -7   DC  I O2    1 
ATOM   7426  N  N3    . DC  I 5  66  ? -45.218 -18.539 82.203 1.00 125.56 ? -7   DC  I N3    1 
ATOM   7427  C  C4    . DC  I 5  66  ? -45.198 -17.663 83.211 1.00 130.24 ? -7   DC  I C4    1 
ATOM   7428  N  N4    . DC  I 5  66  ? -44.829 -16.408 82.942 1.00 133.72 ? -7   DC  I N4    1 
ATOM   7429  C  C5    . DC  I 5  66  ? -45.552 -18.035 84.542 1.00 125.29 ? -7   DC  I C5    1 
ATOM   7430  C  C6    . DC  I 5  66  ? -45.915 -19.308 84.752 1.00 126.80 ? -7   DC  I C6    1 
ATOM   7431  P  P     . DA  I 5  67  ? -46.668 -25.895 85.447 1.00 115.21 ? -6   DA  I P     1 
ATOM   7432  O  OP1   . DA  I 5  67  ? -48.140 -26.071 85.344 1.00 115.50 ? -6   DA  I OP1   1 
ATOM   7433  O  OP2   . DA  I 5  67  ? -45.981 -26.036 86.760 1.00 110.07 ? -6   DA  I OP2   1 
ATOM   7434  O  "O5'" . DA  I 5  67  ? -45.952 -26.867 84.404 1.00 110.56 ? -6   DA  I "O5'" 1 
ATOM   7435  C  "C5'" . DA  I 5  67  ? -46.376 -26.932 83.021 1.00 107.18 ? -6   DA  I "C5'" 1 
ATOM   7436  C  "C4'" . DA  I 5  67  ? -45.197 -27.077 82.072 1.00 97.18  ? -6   DA  I "C4'" 1 
ATOM   7437  O  "O4'" . DA  I 5  67  ? -44.529 -25.800 81.875 1.00 92.73  ? -6   DA  I "O4'" 1 
ATOM   7438  C  "C3'" . DA  I 5  67  ? -44.096 -28.060 82.455 1.00 88.35  ? -6   DA  I "C3'" 1 
ATOM   7439  O  "O3'" . DA  I 5  67  ? -43.635 -28.537 81.206 1.00 83.26  ? -6   DA  I "O3'" 1 
ATOM   7440  C  "C2'" . DA  I 5  67  ? -43.064 -27.169 83.143 1.00 85.34  ? -6   DA  I "C2'" 1 
ATOM   7441  C  "C1'" . DA  I 5  67  ? -43.192 -25.872 82.342 1.00 92.87  ? -6   DA  I "C1'" 1 
ATOM   7442  N  N9    . DA  I 5  67  ? -42.934 -24.654 83.108 1.00 90.50  ? -6   DA  I N9    1 
ATOM   7443  C  C8    . DA  I 5  67  ? -43.135 -24.449 84.451 1.00 99.47  ? -6   DA  I C8    1 
ATOM   7444  N  N7    . DA  I 5  67  ? -42.861 -23.230 84.847 1.00 91.50  ? -6   DA  I N7    1 
ATOM   7445  C  C5    . DA  I 5  67  ? -42.474 -22.582 83.684 1.00 93.31  ? -6   DA  I C5    1 
ATOM   7446  C  C6    . DA  I 5  67  ? -42.063 -21.264 83.431 1.00 99.54  ? -6   DA  I C6    1 
ATOM   7447  N  N6    . DA  I 5  67  ? -41.971 -20.325 84.377 1.00 98.98  ? -6   DA  I N6    1 
ATOM   7448  N  N1    . DA  I 5  67  ? -41.749 -20.936 82.158 1.00 96.70  ? -6   DA  I N1    1 
ATOM   7449  C  C2    . DA  I 5  67  ? -41.842 -21.880 81.213 1.00 100.05 ? -6   DA  I C2    1 
ATOM   7450  N  N3    . DA  I 5  67  ? -42.208 -23.156 81.328 1.00 104.99 ? -6   DA  I N3    1 
ATOM   7451  C  C4    . DA  I 5  67  ? -42.520 -23.445 82.603 1.00 95.60  ? -6   DA  I C4    1 
ATOM   7452  P  P     . DG  I 5  68  ? -42.768 -29.871 81.041 1.00 96.51  ? -5   DG  I P     1 
ATOM   7453  O  OP1   . DG  I 5  68  ? -43.380 -30.644 79.930 1.00 102.10 ? -5   DG  I OP1   1 
ATOM   7454  O  OP2   . DG  I 5  68  ? -42.449 -30.555 82.321 1.00 88.67  ? -5   DG  I OP2   1 
ATOM   7455  O  "O5'" . DG  I 5  68  ? -41.401 -29.262 80.501 1.00 96.92  ? -5   DG  I "O5'" 1 
ATOM   7456  C  "C5'" . DG  I 5  68  ? -41.379 -28.079 79.680 1.00 97.55  ? -5   DG  I "C5'" 1 
ATOM   7457  C  "C4'" . DG  I 5  68  ? -40.007 -27.455 79.728 1.00 95.99  ? -5   DG  I "C4'" 1 
ATOM   7458  O  "O4'" . DG  I 5  68  ? -40.028 -26.296 80.610 1.00 101.90 ? -5   DG  I "O4'" 1 
ATOM   7459  C  "C3'" . DG  I 5  68  ? -38.892 -28.357 80.260 1.00 100.23 ? -5   DG  I "C3'" 1 
ATOM   7460  O  "O3'" . DG  I 5  68  ? -37.694 -27.958 79.621 1.00 103.38 ? -5   DG  I "O3'" 1 
ATOM   7461  C  "C2'" . DG  I 5  68  ? -38.723 -27.880 81.695 1.00 96.61  ? -5   DG  I "C2'" 1 
ATOM   7462  C  "C1'" . DG  I 5  68  ? -38.932 -26.386 81.497 1.00 99.05  ? -5   DG  I "C1'" 1 
ATOM   7463  N  N9    . DG  I 5  68  ? -39.211 -25.616 82.704 1.00 101.90 ? -5   DG  I N9    1 
ATOM   7464  C  C8    . DG  I 5  68  ? -39.661 -26.076 83.918 1.00 103.15 ? -5   DG  I C8    1 
ATOM   7465  N  N7    . DG  I 5  68  ? -39.768 -25.132 84.815 1.00 103.94 ? -5   DG  I N7    1 
ATOM   7466  C  C5    . DG  I 5  68  ? -39.346 -23.985 84.157 1.00 98.83  ? -5   DG  I C5    1 
ATOM   7467  C  C6    . DG  I 5  68  ? -39.239 -22.644 84.616 1.00 97.50  ? -5   DG  I C6    1 
ATOM   7468  O  O6    . DG  I 5  68  ? -39.507 -22.188 85.734 1.00 99.19  ? -5   DG  I O6    1 
ATOM   7469  N  N1    . DG  I 5  68  ? -38.764 -21.799 83.619 1.00 96.05  ? -5   DG  I N1    1 
ATOM   7470  C  C2    . DG  I 5  68  ? -38.436 -22.188 82.343 1.00 98.53  ? -5   DG  I C2    1 
ATOM   7471  N  N2    . DG  I 5  68  ? -38.001 -21.222 81.522 1.00 102.67 ? -5   DG  I N2    1 
ATOM   7472  N  N3    . DG  I 5  68  ? -38.529 -23.431 81.904 1.00 94.01  ? -5   DG  I N3    1 
ATOM   7473  C  C4    . DG  I 5  68  ? -38.991 -24.269 82.855 1.00 96.66  ? -5   DG  I C4    1 
ATOM   7474  P  P     . DC  I 5  69  ? -36.913 -28.857 78.570 1.00 94.45  ? -4   DC  I P     1 
ATOM   7475  O  OP1   . DC  I 5  69  ? -37.862 -29.318 77.518 1.00 80.60  ? -4   DC  I OP1   1 
ATOM   7476  O  OP2   . DC  I 5  69  ? -36.129 -29.843 79.367 1.00 85.68  ? -4   DC  I OP2   1 
ATOM   7477  O  "O5'" . DC  I 5  69  ? -35.959 -27.715 77.997 1.00 85.24  ? -4   DC  I "O5'" 1 
ATOM   7478  C  "C5'" . DC  I 5  69  ? -36.493 -26.668 77.173 1.00 77.07  ? -4   DC  I "C5'" 1 
ATOM   7479  C  "C4'" . DC  I 5  69  ? -35.781 -25.371 77.447 1.00 78.65  ? -4   DC  I "C4'" 1 
ATOM   7480  O  "O4'" . DC  I 5  69  ? -36.153 -24.864 78.752 1.00 77.36  ? -4   DC  I "O4'" 1 
ATOM   7481  C  "C3'" . DC  I 5  69  ? -34.260 -25.444 77.416 1.00 81.28  ? -4   DC  I "C3'" 1 
ATOM   7482  O  "O3'" . DC  I 5  69  ? -33.720 -24.476 76.529 1.00 78.96  ? -4   DC  I "O3'" 1 
ATOM   7483  C  "C2'" . DC  I 5  69  ? -33.834 -25.137 78.848 1.00 81.20  ? -4   DC  I "C2'" 1 
ATOM   7484  C  "C1'" . DC  I 5  69  ? -35.016 -24.339 79.388 1.00 81.11  ? -4   DC  I "C1'" 1 
ATOM   7485  N  N1    . DC  I 5  69  ? -35.150 -24.586 80.827 1.00 87.30  ? -4   DC  I N1    1 
ATOM   7486  C  C2    . DC  I 5  69  ? -35.035 -23.522 81.729 1.00 86.78  ? -4   DC  I C2    1 
ATOM   7487  O  O2    . DC  I 5  69  ? -34.859 -22.377 81.289 1.00 89.90  ? -4   DC  I O2    1 
ATOM   7488  N  N3    . DC  I 5  69  ? -35.127 -23.769 83.055 1.00 86.91  ? -4   DC  I N3    1 
ATOM   7489  C  C4    . DC  I 5  69  ? -35.315 -25.019 83.488 1.00 88.15  ? -4   DC  I C4    1 
ATOM   7490  N  N4    . DC  I 5  69  ? -35.416 -25.218 84.803 1.00 89.58  ? -4   DC  I N4    1 
ATOM   7491  C  C5    . DC  I 5  69  ? -35.413 -26.122 82.592 1.00 86.69  ? -4   DC  I C5    1 
ATOM   7492  C  C6    . DC  I 5  69  ? -35.314 -25.864 81.284 1.00 83.29  ? -4   DC  I C6    1 
ATOM   7493  P  P     . DT  I 5  70  ? -32.171 -24.555 76.178 1.00 70.22  ? -3   DT  I P     1 
ATOM   7494  O  OP1   . DT  I 5  70  ? -32.125 -24.389 74.696 1.00 64.36  ? -3   DT  I OP1   1 
ATOM   7495  O  OP2   . DT  I 5  70  ? -31.500 -25.705 76.841 1.00 62.52  ? -3   DT  I OP2   1 
ATOM   7496  O  "O5'" . DT  I 5  70  ? -31.642 -23.264 76.937 1.00 67.17  ? -3   DT  I "O5'" 1 
ATOM   7497  C  "C5'" . DT  I 5  70  ? -32.219 -21.982 76.651 1.00 71.64  ? -3   DT  I "C5'" 1 
ATOM   7498  C  "C4'" . DT  I 5  70  ? -31.656 -20.971 77.616 1.00 72.50  ? -3   DT  I "C4'" 1 
ATOM   7499  O  "O4'" . DT  I 5  70  ? -32.010 -21.372 78.957 1.00 82.11  ? -3   DT  I "O4'" 1 
ATOM   7500  C  "C3'" . DT  I 5  70  ? -30.131 -20.869 77.602 1.00 78.28  ? -3   DT  I "C3'" 1 
ATOM   7501  O  "O3'" . DT  I 5  70  ? -29.811 -19.490 77.752 1.00 81.78  ? -3   DT  I "O3'" 1 
ATOM   7502  C  "C2'" . DT  I 5  70  ? -29.700 -21.669 78.819 1.00 75.98  ? -3   DT  I "C2'" 1 
ATOM   7503  C  "C1'" . DT  I 5  70  ? -30.851 -21.425 79.769 1.00 79.78  ? -3   DT  I "C1'" 1 
ATOM   7504  N  N1    . DT  I 5  70  ? -31.066 -22.468 80.781 1.00 83.46  ? -3   DT  I N1    1 
ATOM   7505  C  C2    . DT  I 5  70  ? -31.329 -22.069 82.072 1.00 85.79  ? -3   DT  I C2    1 
ATOM   7506  O  O2    . DT  I 5  70  ? -31.359 -20.898 82.415 1.00 86.61  ? -3   DT  I O2    1 
ATOM   7507  N  N3    . DT  I 5  70  ? -31.540 -23.098 82.957 1.00 84.45  ? -3   DT  I N3    1 
ATOM   7508  C  C4    . DT  I 5  70  ? -31.528 -24.452 82.682 1.00 83.66  ? -3   DT  I C4    1 
ATOM   7509  O  O4    . DT  I 5  70  ? -31.729 -25.260 83.585 1.00 82.41  ? -3   DT  I O4    1 
ATOM   7510  C  C5    . DT  I 5  70  ? -31.258 -24.799 81.303 1.00 86.46  ? -3   DT  I C5    1 
ATOM   7511  C  C7    . DT  I 5  70  ? -31.223 -26.242 80.909 1.00 76.72  ? -3   DT  I C7    1 
ATOM   7512  C  C6    . DT  I 5  70  ? -31.048 -23.802 80.433 1.00 83.75  ? -3   DT  I C6    1 
ATOM   7513  P  P     . DG  I 5  71  ? -28.346 -18.984 77.498 1.00 76.02  ? -2   DG  I P     1 
ATOM   7514  O  OP1   . DG  I 5  71  ? -28.489 -17.668 76.805 1.00 76.32  ? -2   DG  I OP1   1 
ATOM   7515  O  OP2   . DG  I 5  71  ? -27.551 -20.096 76.939 1.00 73.52  ? -2   DG  I OP2   1 
ATOM   7516  O  "O5'" . DG  I 5  71  ? -27.709 -18.724 78.928 1.00 82.40  ? -2   DG  I "O5'" 1 
ATOM   7517  C  "C5'" . DG  I 5  71  ? -28.309 -17.804 79.854 1.00 79.34  ? -2   DG  I "C5'" 1 
ATOM   7518  C  "C4'" . DG  I 5  71  ? -27.666 -17.999 81.197 1.00 79.05  ? -2   DG  I "C4'" 1 
ATOM   7519  O  "O4'" . DG  I 5  71  ? -28.094 -19.273 81.739 1.00 78.92  ? -2   DG  I "O4'" 1 
ATOM   7520  C  "C3'" . DG  I 5  71  ? -26.139 -18.027 81.184 1.00 81.97  ? -2   DG  I "C3'" 1 
ATOM   7521  O  "O3'" . DG  I 5  71  ? -25.732 -17.224 82.269 1.00 89.10  ? -2   DG  I "O3'" 1 
ATOM   7522  C  "C2'" . DG  I 5  71  ? -25.790 -19.495 81.434 1.00 78.84  ? -2   DG  I "C2'" 1 
ATOM   7523  C  "C1'" . DG  I 5  71  ? -26.979 -19.944 82.274 1.00 81.63  ? -2   DG  I "C1'" 1 
ATOM   7524  N  N9    . DG  I 5  71  ? -27.263 -21.373 82.254 1.00 85.81  ? -2   DG  I N9    1 
ATOM   7525  C  C8    . DG  I 5  71  ? -27.113 -22.255 81.211 1.00 92.50  ? -2   DG  I C8    1 
ATOM   7526  N  N7    . DG  I 5  71  ? -27.483 -23.470 81.511 1.00 87.95  ? -2   DG  I N7    1 
ATOM   7527  C  C5    . DG  I 5  71  ? -27.908 -23.382 82.829 1.00 91.63  ? -2   DG  I C5    1 
ATOM   7528  C  C6    . DG  I 5  71  ? -28.419 -24.376 83.697 1.00 94.11  ? -2   DG  I C6    1 
ATOM   7529  O  O6    . DG  I 5  71  ? -28.604 -25.576 83.469 1.00 104.65 ? -2   DG  I O6    1 
ATOM   7530  N  N1    . DG  I 5  71  ? -28.725 -23.854 84.949 1.00 92.07  ? -2   DG  I N1    1 
ATOM   7531  C  C2    . DG  I 5  71  ? -28.558 -22.543 85.319 1.00 93.48  ? -2   DG  I C2    1 
ATOM   7532  N  N2    . DG  I 5  71  ? -28.913 -22.229 86.572 1.00 100.53 ? -2   DG  I N2    1 
ATOM   7533  N  N3    . DG  I 5  71  ? -28.085 -21.606 84.519 1.00 94.08  ? -2   DG  I N3    1 
ATOM   7534  C  C4    . DG  I 5  71  ? -27.783 -22.093 83.298 1.00 89.47  ? -2   DG  I C4    1 
ATOM   7535  P  P     . DA  I 5  72  ? -24.358 -16.447 82.301 1.00 89.55  ? -1   DA  I P     1 
ATOM   7536  O  OP1   . DA  I 5  72  ? -24.665 -15.087 81.804 1.00 91.40  ? -1   DA  I OP1   1 
ATOM   7537  O  OP2   . DA  I 5  72  ? -23.261 -17.247 81.710 1.00 92.00  ? -1   DA  I OP2   1 
ATOM   7538  O  "O5'" . DA  I 5  72  ? -24.105 -16.388 83.871 1.00 99.12  ? -1   DA  I "O5'" 1 
ATOM   7539  C  "C5'" . DA  I 5  72  ? -25.168 -16.002 84.763 1.00 98.40  ? -1   DA  I "C5'" 1 
ATOM   7540  C  "C4'" . DA  I 5  72  ? -24.973 -16.636 86.118 1.00 97.14  ? -1   DA  I "C4'" 1 
ATOM   7541  O  "O4'" . DA  I 5  72  ? -25.447 -18.006 86.092 1.00 100.45 ? -1   DA  I "O4'" 1 
ATOM   7542  C  "C3'" . DA  I 5  72  ? -23.536 -16.683 86.634 1.00 102.91 ? -1   DA  I "C3'" 1 
ATOM   7543  O  "O3'" . DA  I 5  72  ? -23.565 -16.254 87.990 1.00 113.83 ? -1   DA  I "O3'" 1 
ATOM   7544  C  "C2'" . DA  I 5  72  ? -23.142 -18.150 86.468 1.00 94.40  ? -1   DA  I "C2'" 1 
ATOM   7545  C  "C1'" . DA  I 5  72  ? -24.479 -18.858 86.662 1.00 91.85  ? -1   DA  I "C1'" 1 
ATOM   7546  N  N9    . DA  I 5  72  ? -24.544 -20.137 85.958 1.00 95.33  ? -1   DA  I N9    1 
ATOM   7547  C  C8    . DA  I 5  72  ? -24.197 -20.376 84.651 1.00 98.75  ? -1   DA  I C8    1 
ATOM   7548  N  N7    . DA  I 5  72  ? -24.370 -21.619 84.277 1.00 100.36 ? -1   DA  I N7    1 
ATOM   7549  C  C5    . DA  I 5  72  ? -24.876 -22.241 85.410 1.00 101.15 ? -1   DA  I C5    1 
ATOM   7550  C  C6    . DA  I 5  72  ? -25.267 -23.569 85.667 1.00 98.02  ? -1   DA  I C6    1 
ATOM   7551  N  N6    . DA  I 5  72  ? -25.209 -24.548 84.764 1.00 91.87  ? -1   DA  I N6    1 
ATOM   7552  N  N1    . DA  I 5  72  ? -25.725 -23.859 86.904 1.00 101.52 ? -1   DA  I N1    1 
ATOM   7553  C  C2    . DA  I 5  72  ? -25.780 -22.878 87.814 1.00 103.37 ? -1   DA  I C2    1 
ATOM   7554  N  N3    . DA  I 5  72  ? -25.439 -21.595 87.694 1.00 102.48 ? -1   DA  I N3    1 
ATOM   7555  C  C4    . DA  I 5  72  ? -24.991 -21.338 86.452 1.00 100.73 ? -1   DA  I C4    1 
ATOM   7556  P  P     . DA  I 5  73  ? -22.230 -16.042 88.832 1.00 110.74 ? 0    DA  I P     1 
ATOM   7557  O  OP1   . DA  I 5  73  ? -22.453 -14.909 89.759 1.00 107.49 ? 0    DA  I OP1   1 
ATOM   7558  O  OP2   . DA  I 5  73  ? -21.062 -16.023 87.908 1.00 114.98 ? 0    DA  I OP2   1 
ATOM   7559  O  "O5'" . DA  I 5  73  ? -22.173 -17.383 89.686 1.00 103.37 ? 0    DA  I "O5'" 1 
ATOM   7560  C  "C5'" . DA  I 5  73  ? -23.306 -17.855 90.431 1.00 96.13  ? 0    DA  I "C5'" 1 
ATOM   7561  C  "C4'" . DA  I 5  73  ? -22.882 -19.038 91.268 1.00 108.02 ? 0    DA  I "C4'" 1 
ATOM   7562  O  "O4'" . DA  I 5  73  ? -23.120 -20.267 90.533 1.00 114.20 ? 0    DA  I "O4'" 1 
ATOM   7563  C  "C3'" . DA  I 5  73  ? -21.411 -19.070 91.692 1.00 108.53 ? 0    DA  I "C3'" 1 
ATOM   7564  O  "O3'" . DA  I 5  73  ? -21.328 -19.564 93.019 1.00 112.61 ? 0    DA  I "O3'" 1 
ATOM   7565  C  "C2'" . DA  I 5  73  ? -20.776 -20.061 90.720 1.00 102.76 ? 0    DA  I "C2'" 1 
ATOM   7566  C  "C1'" . DA  I 5  73  ? -21.928 -21.029 90.468 1.00 107.69 ? 0    DA  I "C1'" 1 
ATOM   7567  N  N9    . DA  I 5  73  ? -21.859 -21.636 89.143 1.00 111.62 ? 0    DA  I N9    1 
ATOM   7568  C  C8    . DA  I 5  73  ? -21.576 -21.012 87.953 1.00 109.64 ? 0    DA  I C8    1 
ATOM   7569  N  N7    . DA  I 5  73  ? -21.602 -21.813 86.917 1.00 108.87 ? 0    DA  I N7    1 
ATOM   7570  C  C5    . DA  I 5  73  ? -21.933 -23.047 87.459 1.00 116.39 ? 0    DA  I C5    1 
ATOM   7571  C  C6    . DA  I 5  73  ? -22.114 -24.316 86.881 1.00 123.88 ? 0    DA  I C6    1 
ATOM   7572  N  N6    . DA  I 5  73  ? -21.982 -24.561 85.576 1.00 127.37 ? 0    DA  I N6    1 
ATOM   7573  N  N1    . DA  I 5  73  ? -22.438 -25.340 87.701 1.00 127.91 ? 0    DA  I N1    1 
ATOM   7574  C  C2    . DA  I 5  73  ? -22.568 -25.095 89.012 1.00 124.31 ? 0    DA  I C2    1 
ATOM   7575  N  N3    . DA  I 5  73  ? -22.419 -23.948 89.673 1.00 122.95 ? 0    DA  I N3    1 
ATOM   7576  C  C4    . DA  I 5  73  ? -22.098 -22.952 88.829 1.00 116.55 ? 0    DA  I C4    1 
ATOM   7577  P  P     . DT  I 5  74  ? -19.941 -19.688 93.794 1.00 116.33 ? 1    DT  I P     1 
ATOM   7578  O  OP1   . DT  I 5  74  ? -20.248 -19.342 95.207 1.00 118.00 ? 1    DT  I OP1   1 
ATOM   7579  O  OP2   . DT  I 5  74  ? -18.857 -18.970 93.067 1.00 116.76 ? 1    DT  I OP2   1 
ATOM   7580  O  "O5'" . DT  I 5  74  ? -19.622 -21.244 93.709 1.00 101.99 ? 1    DT  I "O5'" 1 
ATOM   7581  C  "C5'" . DT  I 5  74  ? -20.622 -22.214 94.038 1.00 92.59  ? 1    DT  I "C5'" 1 
ATOM   7582  C  "C4'" . DT  I 5  74  ? -20.071 -23.594 93.782 1.00 101.08 ? 1    DT  I "C4'" 1 
ATOM   7583  O  "O4'" . DT  I 5  74  ? -20.241 -23.950 92.389 1.00 113.16 ? 1    DT  I "O4'" 1 
ATOM   7584  C  "C3'" . DT  I 5  74  ? -18.577 -23.746 94.083 1.00 101.12 ? 1    DT  I "C3'" 1 
ATOM   7585  O  "O3'" . DT  I 5  74  ? -18.440 -24.853 94.976 1.00 112.83 ? 1    DT  I "O3'" 1 
ATOM   7586  C  "C2'" . DT  I 5  74  ? -17.947 -24.034 92.727 1.00 103.72 ? 1    DT  I "C2'" 1 
ATOM   7587  C  "C1'" . DT  I 5  74  ? -19.098 -24.672 91.973 1.00 105.13 ? 1    DT  I "C1'" 1 
ATOM   7588  N  N1    . DT  I 5  74  ? -19.026 -24.603 90.497 1.00 97.55  ? 1    DT  I N1    1 
ATOM   7589  C  C2    . DT  I 5  74  ? -19.242 -25.759 89.778 1.00 100.28 ? 1    DT  I C2    1 
ATOM   7590  O  O2    . DT  I 5  74  ? -19.482 -26.836 90.300 1.00 96.25  ? 1    DT  I O2    1 
ATOM   7591  N  N3    . DT  I 5  74  ? -19.163 -25.606 88.414 1.00 101.82 ? 1    DT  I N3    1 
ATOM   7592  C  C4    . DT  I 5  74  ? -18.899 -24.441 87.717 1.00 103.81 ? 1    DT  I C4    1 
ATOM   7593  O  O4    . DT  I 5  74  ? -18.870 -24.456 86.489 1.00 107.75 ? 1    DT  I O4    1 
ATOM   7594  C  C5    . DT  I 5  74  ? -18.685 -23.268 88.537 1.00 100.56 ? 1    DT  I C5    1 
ATOM   7595  C  C7    . DT  I 5  74  ? -18.390 -21.960 87.873 1.00 95.44  ? 1    DT  I C7    1 
ATOM   7596  C  C6    . DT  I 5  74  ? -18.762 -23.407 89.867 1.00 97.12  ? 1    DT  I C6    1 
ATOM   7597  P  P     . DC  I 5  75  ? -17.074 -25.194 95.732 1.00 121.35 ? 2    DC  I P     1 
ATOM   7598  O  OP1   . DC  I 5  75  ? -17.429 -25.678 97.094 1.00 112.52 ? 2    DC  I OP1   1 
ATOM   7599  O  OP2   . DC  I 5  75  ? -16.145 -24.040 95.589 1.00 113.42 ? 2    DC  I OP2   1 
ATOM   7600  O  "O5'" . DC  I 5  75  ? -16.544 -26.417 94.853 1.00 120.23 ? 2    DC  I "O5'" 1 
ATOM   7601  C  "C5'" . DC  I 5  75  ? -17.303 -27.642 94.743 1.00 112.94 ? 2    DC  I "C5'" 1 
ATOM   7602  C  "C4'" . DC  I 5  75  ? -16.646 -28.596 93.770 1.00 116.50 ? 2    DC  I "C4'" 1 
ATOM   7603  O  "O4'" . DC  I 5  75  ? -16.833 -28.123 92.411 1.00 119.03 ? 2    DC  I "O4'" 1 
ATOM   7604  C  "C3'" . DC  I 5  75  ? -15.149 -28.820 93.957 1.00 119.17 ? 2    DC  I "C3'" 1 
ATOM   7605  O  "O3'" . DC  I 5  75  ? -14.935 -30.211 94.147 1.00 126.00 ? 2    DC  I "O3'" 1 
ATOM   7606  C  "C2'" . DC  I 5  75  ? -14.515 -28.274 92.672 1.00 120.41 ? 2    DC  I "C2'" 1 
ATOM   7607  C  "C1'" . DC  I 5  75  ? -15.662 -28.365 91.664 1.00 115.33 ? 2    DC  I "C1'" 1 
ATOM   7608  N  N1    . DC  I 5  75  ? -15.586 -27.341 90.603 1.00 114.28 ? 2    DC  I N1    1 
ATOM   7609  C  C2    . DC  I 5  75  ? -15.898 -27.687 89.279 1.00 109.84 ? 2    DC  I C2    1 
ATOM   7610  O  O2    . DC  I 5  75  ? -16.211 -28.860 89.021 1.00 101.46 ? 2    DC  I O2    1 
ATOM   7611  N  N3    . DC  I 5  75  ? -15.846 -26.734 88.318 1.00 106.87 ? 2    DC  I N3    1 
ATOM   7612  C  C4    . DC  I 5  75  ? -15.505 -25.481 88.637 1.00 105.30 ? 2    DC  I C4    1 
ATOM   7613  N  N4    . DC  I 5  75  ? -15.458 -24.575 87.658 1.00 96.76  ? 2    DC  I N4    1 
ATOM   7614  C  C5    . DC  I 5  75  ? -15.187 -25.104 89.975 1.00 113.88 ? 2    DC  I C5    1 
ATOM   7615  C  C6    . DC  I 5  75  ? -15.246 -26.054 90.918 1.00 111.80 ? 2    DC  I C6    1 
ATOM   7616  P  P     . DA  I 5  76  ? -13.656 -30.712 94.965 1.00 129.22 ? 3    DA  I P     1 
ATOM   7617  O  OP1   . DA  I 5  76  ? -14.106 -30.948 96.359 1.00 134.01 ? 3    DA  I OP1   1 
ATOM   7618  O  OP2   . DA  I 5  76  ? -12.509 -29.799 94.699 1.00 113.66 ? 3    DA  I OP2   1 
ATOM   7619  O  "O5'" . DA  I 5  76  ? -13.339 -32.137 94.328 1.00 130.19 ? 3    DA  I "O5'" 1 
ATOM   7620  C  "C5'" . DA  I 5  76  ? -14.395 -32.992 93.839 1.00 130.34 ? 3    DA  I "C5'" 1 
ATOM   7621  C  "C4'" . DA  I 5  76  ? -13.977 -33.647 92.543 1.00 122.63 ? 3    DA  I "C4'" 1 
ATOM   7622  O  "O4'" . DA  I 5  76  ? -14.076 -32.677 91.463 1.00 120.96 ? 3    DA  I "O4'" 1 
ATOM   7623  C  "C3'" . DA  I 5  76  ? -12.544 -34.185 92.507 1.00 126.09 ? 3    DA  I "C3'" 1 
ATOM   7624  O  "O3'" . DA  I 5  76  ? -12.563 -35.470 91.897 1.00 127.04 ? 3    DA  I "O3'" 1 
ATOM   7625  C  "C2'" . DA  I 5  76  ? -11.794 -33.126 91.698 1.00 122.14 ? 3    DA  I "C2'" 1 
ATOM   7626  C  "C1'" . DA  I 5  76  ? -12.876 -32.674 90.722 1.00 119.68 ? 3    DA  I "C1'" 1 
ATOM   7627  N  N9    . DA  I 5  76  ? -12.676 -31.334 90.176 1.00 110.82 ? 3    DA  I N9    1 
ATOM   7628  C  C8    . DA  I 5  76  ? -12.163 -30.231 90.813 1.00 113.18 ? 3    DA  I C8    1 
ATOM   7629  N  N7    . DA  I 5  76  ? -12.103 -29.163 90.056 1.00 115.67 ? 3    DA  I N7    1 
ATOM   7630  C  C5    . DA  I 5  76  ? -12.618 -29.588 88.839 1.00 114.56 ? 3    DA  I C5    1 
ATOM   7631  C  C6    . DA  I 5  76  ? -12.825 -28.925 87.614 1.00 103.39 ? 3    DA  I C6    1 
ATOM   7632  N  N6    . DA  I 5  76  ? -12.531 -27.641 87.407 1.00 93.93  ? 3    DA  I N6    1 
ATOM   7633  N  N1    . DA  I 5  76  ? -13.352 -29.639 86.596 1.00 105.53 ? 3    DA  I N1    1 
ATOM   7634  C  C2    . DA  I 5  76  ? -13.643 -30.930 86.802 1.00 113.13 ? 3    DA  I C2    1 
ATOM   7635  N  N3    . DA  I 5  76  ? -13.495 -31.663 87.904 1.00 113.78 ? 3    DA  I N3    1 
ATOM   7636  C  C4    . DA  I 5  76  ? -12.972 -30.924 88.898 1.00 115.06 ? 3    DA  I C4    1 
ATOM   7637  P  P     . DG  I 5  77  ? -11.276 -36.434 91.826 1.00 134.70 ? 4    DG  I P     1 
ATOM   7638  O  OP1   . DG  I 5  77  ? -11.298 -37.362 92.989 1.00 131.59 ? 4    DG  I OP1   1 
ATOM   7639  O  OP2   . DG  I 5  77  ? -10.043 -35.630 91.561 1.00 129.61 ? 4    DG  I OP2   1 
ATOM   7640  O  "O5'" . DG  I 5  77  ? -11.653 -37.313 90.547 1.00 130.86 ? 4    DG  I "O5'" 1 
ATOM   7641  C  "C5'" . DG  I 5  77  ? -12.636 -36.860 89.591 1.00 110.67 ? 4    DG  I "C5'" 1 
ATOM   7642  C  "C4'" . DG  I 5  77  ? -11.985 -36.566 88.258 1.00 95.70  ? 4    DG  I "C4'" 1 
ATOM   7643  O  "O4'" . DG  I 5  77  ? -11.699 -35.145 88.126 1.00 94.76  ? 4    DG  I "O4'" 1 
ATOM   7644  C  "C3'" . DG  I 5  77  ? -10.675 -37.284 87.962 1.00 89.62  ? 4    DG  I "C3'" 1 
ATOM   7645  O  "O3'" . DG  I 5  77  ? -10.898 -37.574 86.605 1.00 92.75  ? 4    DG  I "O3'" 1 
ATOM   7646  C  "C2'" . DG  I 5  77  ? -9.626  -36.179 88.094 1.00 92.50  ? 4    DG  I "C2'" 1 
ATOM   7647  C  "C1'" . DG  I 5  77  ? -10.412 -34.986 87.564 1.00 100.75 ? 4    DG  I "C1'" 1 
ATOM   7648  N  N9    . DG  I 5  77  ? -9.914  -33.650 87.890 1.00 107.72 ? 4    DG  I N9    1 
ATOM   7649  C  C8    . DG  I 5  77  ? -9.269  -33.245 89.034 1.00 107.89 ? 4    DG  I C8    1 
ATOM   7650  N  N7    . DG  I 5  77  ? -8.973  -31.973 89.032 1.00 107.70 ? 4    DG  I N7    1 
ATOM   7651  C  C5    . DG  I 5  77  ? -9.449  -31.510 87.813 1.00 107.40 ? 4    DG  I C5    1 
ATOM   7652  C  C6    . DG  I 5  77  ? -9.410  -30.210 87.243 1.00 108.52 ? 4    DG  I C6    1 
ATOM   7653  O  O6    . DG  I 5  77  ? -8.936  -29.173 87.722 1.00 101.35 ? 4    DG  I O6    1 
ATOM   7654  N  N1    . DG  I 5  77  ? -10.005 -30.185 85.986 1.00 114.39 ? 4    DG  I N1    1 
ATOM   7655  C  C2    . DG  I 5  77  ? -10.565 -31.269 85.355 1.00 115.06 ? 4    DG  I C2    1 
ATOM   7656  N  N2    . DG  I 5  77  ? -11.091 -31.041 84.142 1.00 121.08 ? 4    DG  I N2    1 
ATOM   7657  N  N3    . DG  I 5  77  ? -10.606 -32.485 85.873 1.00 114.48 ? 4    DG  I N3    1 
ATOM   7658  C  C4    . DG  I 5  77  ? -10.034 -32.532 87.097 1.00 111.57 ? 4    DG  I C4    1 
ATOM   7659  P  P     . DC  I 5  78  ? -10.161 -38.780 85.940 1.00 102.21 ? 5    DC  I P     1 
ATOM   7660  O  OP1   . DC  I 5  78  ? -11.257 -39.704 85.550 1.00 98.85  ? 5    DC  I OP1   1 
ATOM   7661  O  OP2   . DC  I 5  78  ? -9.079  -39.225 86.853 1.00 101.60 ? 5    DC  I OP2   1 
ATOM   7662  O  "O5'" . DC  I 5  78  ? -9.461  -38.163 84.644 1.00 117.79 ? 5    DC  I "O5'" 1 
ATOM   7663  C  "C5'" . DC  I 5  78  ? -10.107 -37.157 83.827 1.00 114.86 ? 5    DC  I "C5'" 1 
ATOM   7664  C  "C4'" . DC  I 5  78  ? -9.077  -36.256 83.175 1.00 107.01 ? 5    DC  I "C4'" 1 
ATOM   7665  O  "O4'" . DC  I 5  78  ? -8.723  -35.167 84.072 1.00 104.05 ? 5    DC  I "O4'" 1 
ATOM   7666  C  "C3'" . DC  I 5  78  ? -7.755  -36.907 82.766 1.00 106.58 ? 5    DC  I "C3'" 1 
ATOM   7667  O  "O3'" . DC  I 5  78  ? -7.433  -36.445 81.467 1.00 105.23 ? 5    DC  I "O3'" 1 
ATOM   7668  C  "C2'" . DC  I 5  78  ? -6.739  -36.313 83.740 1.00 106.62 ? 5    DC  I "C2'" 1 
ATOM   7669  C  "C1'" . DC  I 5  78  ? -7.338  -34.931 83.969 1.00 106.89 ? 5    DC  I "C1'" 1 
ATOM   7670  N  N1    . DC  I 5  78  ? -6.882  -34.237 85.181 1.00 109.50 ? 5    DC  I N1    1 
ATOM   7671  C  C2    . DC  I 5  78  ? -6.837  -32.842 85.162 1.00 115.20 ? 5    DC  I C2    1 
ATOM   7672  O  O2    . DC  I 5  78  ? -7.189  -32.246 84.133 1.00 117.03 ? 5    DC  I O2    1 
ATOM   7673  N  N3    . DC  I 5  78  ? -6.416  -32.179 86.264 1.00 120.74 ? 5    DC  I N3    1 
ATOM   7674  C  C4    . DC  I 5  78  ? -6.051  -32.860 87.354 1.00 123.14 ? 5    DC  I C4    1 
ATOM   7675  N  N4    . DC  I 5  78  ? -5.646  -32.166 88.420 1.00 130.39 ? 5    DC  I N4    1 
ATOM   7676  C  C5    . DC  I 5  78  ? -6.082  -34.284 87.397 1.00 115.43 ? 5    DC  I C5    1 
ATOM   7677  C  C6    . DC  I 5  78  ? -6.499  -34.926 86.299 1.00 113.51 ? 5    DC  I C6    1 
ATOM   7678  P  P     . DT  I 5  79  ? -7.350  -37.491 80.279 1.00 99.44  ? 6    DT  I P     1 
ATOM   7679  O  OP1   . DT  I 5  79  ? -8.490  -38.430 80.445 1.00 107.77 ? 6    DT  I OP1   1 
ATOM   7680  O  OP2   . DT  I 5  79  ? -5.949  -37.992 80.149 1.00 82.28  ? 6    DT  I OP2   1 
ATOM   7681  O  "O5'" . DT  I 5  79  ? -7.737  -36.622 79.002 1.00 104.07 ? 6    DT  I "O5'" 1 
ATOM   7682  C  "C5'" . DT  I 5  79  ? -8.742  -35.594 79.068 1.00 84.60  ? 6    DT  I "C5'" 1 
ATOM   7683  C  "C4'" . DT  I 5  79  ? -8.140  -34.266 78.665 1.00 74.90  ? 6    DT  I "C4'" 1 
ATOM   7684  O  "O4'" . DT  I 5  79  ? -7.495  -33.652 79.804 1.00 79.56  ? 6    DT  I "O4'" 1 
ATOM   7685  C  "C3'" . DT  I 5  79  ? -7.076  -34.310 77.564 1.00 74.95  ? 6    DT  I "C3'" 1 
ATOM   7686  O  "O3'" . DT  I 5  79  ? -7.146  -33.079 76.856 1.00 72.59  ? 6    DT  I "O3'" 1 
ATOM   7687  C  "C2'" . DT  I 5  79  ? -5.775  -34.185 78.327 1.00 75.72  ? 6    DT  I "C2'" 1 
ATOM   7688  C  "C1'" . DT  I 5  79  ? -6.194  -33.233 79.425 1.00 84.30  ? 6    DT  I "C1'" 1 
ATOM   7689  N  N1    . DT  I 5  79  ? -5.344  -33.254 80.621 1.00 90.18  ? 6    DT  I N1    1 
ATOM   7690  C  C2    . DT  I 5  79  ? -5.214  -32.094 81.351 1.00 94.21  ? 6    DT  I C2    1 
ATOM   7691  O  O2    . DT  I 5  79  ? -5.781  -31.053 81.058 1.00 93.26  ? 6    DT  I O2    1 
ATOM   7692  N  N3    . DT  I 5  79  ? -4.402  -32.199 82.452 1.00 94.02  ? 6    DT  I N3    1 
ATOM   7693  C  C4    . DT  I 5  79  ? -3.724  -33.322 82.885 1.00 98.08  ? 6    DT  I C4    1 
ATOM   7694  O  O4    . DT  I 5  79  ? -3.028  -33.262 83.895 1.00 99.68  ? 6    DT  I O4    1 
ATOM   7695  C  C5    . DT  I 5  79  ? -3.905  -34.505 82.070 1.00 101.49 ? 6    DT  I C5    1 
ATOM   7696  C  C7    . DT  I 5  79  ? -3.209  -35.772 82.458 1.00 100.36 ? 6    DT  I C7    1 
ATOM   7697  C  C6    . DT  I 5  79  ? -4.694  -34.411 80.993 1.00 96.06  ? 6    DT  I C6    1 
ATOM   7698  P  P     . DG  I 5  80  ? -7.096  -32.937 75.286 1.00 67.56  ? 7    DG  I P     1 
ATOM   7699  O  OP1   . DG  I 5  80  ? -8.479  -32.491 74.997 1.00 68.31  ? 7    DG  I OP1   1 
ATOM   7700  O  OP2   . DG  I 5  80  ? -6.500  -34.103 74.595 1.00 62.11  ? 7    DG  I OP2   1 
ATOM   7701  O  "O5'" . DG  I 5  80  ? -6.099  -31.712 75.101 1.00 70.29  ? 7    DG  I "O5'" 1 
ATOM   7702  C  "C5'" . DG  I 5  80  ? -6.352  -30.455 75.750 1.00 66.47  ? 7    DG  I "C5'" 1 
ATOM   7703  C  "C4'" . DG  I 5  80  ? -5.057  -29.752 76.073 1.00 65.50  ? 7    DG  I "C4'" 1 
ATOM   7704  O  "O4'" . DG  I 5  80  ? -4.450  -30.350 77.246 1.00 68.84  ? 7    DG  I "O4'" 1 
ATOM   7705  C  "C3'" . DG  I 5  80  ? -3.980  -29.746 74.990 1.00 66.42  ? 7    DG  I "C3'" 1 
ATOM   7706  O  "O3'" . DG  I 5  80  ? -3.423  -28.442 75.059 1.00 64.82  ? 7    DG  I "O3'" 1 
ATOM   7707  C  "C2'" . DG  I 5  80  ? -2.969  -30.773 75.494 1.00 69.19  ? 7    DG  I "C2'" 1 
ATOM   7708  C  "C1'" . DG  I 5  80  ? -3.076  -30.558 77.001 1.00 74.90  ? 7    DG  I "C1'" 1 
ATOM   7709  N  N9    . DG  I 5  80  ? -2.619  -31.641 77.867 1.00 79.04  ? 7    DG  I N9    1 
ATOM   7710  C  C8    . DG  I 5  80  ? -2.665  -32.997 77.649 1.00 84.66  ? 7    DG  I C8    1 
ATOM   7711  N  N7    . DG  I 5  80  ? -2.203  -33.692 78.653 1.00 85.65  ? 7    DG  I N7    1 
ATOM   7712  C  C5    . DG  I 5  80  ? -1.836  -32.735 79.590 1.00 90.23  ? 7    DG  I C5    1 
ATOM   7713  C  C6    . DG  I 5  80  ? -1.272  -32.882 80.880 1.00 90.32  ? 7    DG  I C6    1 
ATOM   7714  O  O6    . DG  I 5  80  ? -0.975  -33.922 81.477 1.00 87.88  ? 7    DG  I O6    1 
ATOM   7715  N  N1    . DG  I 5  80  ? -1.061  -31.649 81.489 1.00 91.30  ? 7    DG  I N1    1 
ATOM   7716  C  C2    . DG  I 5  80  ? -1.362  -30.432 80.934 1.00 83.41  ? 7    DG  I C2    1 
ATOM   7717  N  N2    . DG  I 5  80  ? -1.087  -29.357 81.680 1.00 84.92  ? 7    DG  I N2    1 
ATOM   7718  N  N3    . DG  I 5  80  ? -1.895  -30.282 79.736 1.00 93.91  ? 7    DG  I N3    1 
ATOM   7719  C  C4    . DG  I 5  80  ? -2.099  -31.466 79.122 1.00 86.83  ? 7    DG  I C4    1 
ATOM   7720  P  P     . DA  I 5  81  ? -2.456  -27.854 73.946 1.00 66.07  ? 8    DA  I P     1 
ATOM   7721  O  OP1   . DA  I 5  81  ? -3.297  -27.143 72.947 1.00 73.40  ? 8    DA  I OP1   1 
ATOM   7722  O  OP2   . DA  I 5  81  ? -1.461  -28.851 73.489 1.00 69.26  ? 8    DA  I OP2   1 
ATOM   7723  O  "O5'" . DA  I 5  81  ? -1.652  -26.743 74.748 1.00 66.99  ? 8    DA  I "O5'" 1 
ATOM   7724  C  "C5'" . DA  I 5  81  ? -2.157  -26.213 75.993 1.00 66.46  ? 8    DA  I "C5'" 1 
ATOM   7725  C  "C4'" . DA  I 5  81  ? -1.051  -25.498 76.735 1.00 62.88  ? 8    DA  I "C4'" 1 
ATOM   7726  O  "O4'" . DA  I 5  81  ? -0.489  -26.380 77.741 1.00 63.90  ? 8    DA  I "O4'" 1 
ATOM   7727  C  "C3'" . DA  I 5  81  ? 0.130   -25.024 75.891 1.00 61.62  ? 8    DA  I "C3'" 1 
ATOM   7728  O  "O3'" . DA  I 5  81  ? 0.577   -23.806 76.476 1.00 63.66  ? 8    DA  I "O3'" 1 
ATOM   7729  C  "C2'" . DA  I 5  81  ? 1.112   -26.192 75.976 1.00 60.47  ? 8    DA  I "C2'" 1 
ATOM   7730  C  "C1'" . DA  I 5  81  ? 0.821   -26.770 77.366 1.00 67.82  ? 8    DA  I "C1'" 1 
ATOM   7731  N  N9    . DA  I 5  81  ? 0.889   -28.233 77.423 1.00 75.84  ? 8    DA  I N9    1 
ATOM   7732  C  C8    . DA  I 5  81  ? 0.429   -29.128 76.489 1.00 74.25  ? 8    DA  I C8    1 
ATOM   7733  N  N7    . DA  I 5  81  ? 0.614   -30.382 76.821 1.00 75.72  ? 8    DA  I N7    1 
ATOM   7734  C  C5    . DA  I 5  81  ? 1.235   -30.310 78.060 1.00 82.51  ? 8    DA  I C5    1 
ATOM   7735  C  C6    . DA  I 5  81  ? 1.701   -31.298 78.942 1.00 83.08  ? 8    DA  I C6    1 
ATOM   7736  N  N6    . DA  I 5  81  ? 1.607   -32.606 78.701 1.00 83.11  ? 8    DA  I N6    1 
ATOM   7737  N  N1    . DA  I 5  81  ? 2.270   -30.892 80.097 1.00 89.42  ? 8    DA  I N1    1 
ATOM   7738  C  C2    . DA  I 5  81  ? 2.358   -29.578 80.341 1.00 84.85  ? 8    DA  I C2    1 
ATOM   7739  N  N3    . DA  I 5  81  ? 1.968   -28.553 79.587 1.00 85.09  ? 8    DA  I N3    1 
ATOM   7740  C  C4    . DA  I 5  81  ? 1.405   -28.992 78.446 1.00 83.90  ? 8    DA  I C4    1 
ATOM   7741  P  P     . DA  I 5  82  ? 1.793   -22.955 75.922 1.00 65.78  ? 9    DA  I P     1 
ATOM   7742  O  OP1   . DA  I 5  82  ? 1.431   -21.556 76.269 1.00 70.65  ? 9    DA  I OP1   1 
ATOM   7743  O  OP2   . DA  I 5  82  ? 2.070   -23.309 74.498 1.00 69.83  ? 9    DA  I OP2   1 
ATOM   7744  O  "O5'" . DA  I 5  82  ? 3.056   -23.435 76.767 1.00 66.87  ? 9    DA  I "O5'" 1 
ATOM   7745  C  "C5'" . DA  I 5  82  ? 3.098   -23.306 78.204 1.00 66.39  ? 9    DA  I "C5'" 1 
ATOM   7746  C  "C4'" . DA  I 5  82  ? 4.346   -23.955 78.763 1.00 64.32  ? 9    DA  I "C4'" 1 
ATOM   7747  O  "O4'" . DA  I 5  82  ? 4.183   -25.393 78.778 1.00 65.02  ? 9    DA  I "O4'" 1 
ATOM   7748  C  "C3'" . DA  I 5  82  ? 5.654   -23.664 78.021 1.00 63.96  ? 9    DA  I "C3'" 1 
ATOM   7749  O  "O3'" . DA  I 5  82  ? 6.536   -23.065 78.956 1.00 73.60  ? 9    DA  I "O3'" 1 
ATOM   7750  C  "C2'" . DA  I 5  82  ? 6.125   -25.031 77.517 1.00 66.18  ? 9    DA  I "C2'" 1 
ATOM   7751  C  "C1'" . DA  I 5  82  ? 5.412   -26.004 78.455 1.00 68.63  ? 9    DA  I "C1'" 1 
ATOM   7752  N  N9    . DA  I 5  82  ? 5.123   -27.309 77.855 1.00 74.65  ? 9    DA  I N9    1 
ATOM   7753  C  C8    . DA  I 5  82  ? 4.623   -27.541 76.598 1.00 81.97  ? 9    DA  I C8    1 
ATOM   7754  N  N7    . DA  I 5  82  ? 4.426   -28.810 76.332 1.00 86.14  ? 9    DA  I N7    1 
ATOM   7755  C  C5    . DA  I 5  82  ? 4.817   -29.458 77.495 1.00 91.92  ? 9    DA  I C5    1 
ATOM   7756  C  C6    . DA  I 5  82  ? 4.854   -30.817 77.853 1.00 89.21  ? 9    DA  I C6    1 
ATOM   7757  N  N6    . DA  I 5  82  ? 4.473   -31.805 77.044 1.00 97.35  ? 9    DA  I N6    1 
ATOM   7758  N  N1    . DA  I 5  82  ? 5.287   -31.129 79.092 1.00 90.33  ? 9    DA  I N1    1 
ATOM   7759  C  C2    . DA  I 5  82  ? 5.669   -30.137 79.904 1.00 93.99  ? 9    DA  I C2    1 
ATOM   7760  N  N3    . DA  I 5  82  ? 5.681   -28.823 79.684 1.00 97.72  ? 9    DA  I N3    1 
ATOM   7761  C  C4    . DA  I 5  82  ? 5.238   -28.545 78.445 1.00 89.58  ? 9    DA  I C4    1 
ATOM   7762  P  P     . DC  I 5  83  ? 7.997   -22.503 78.619 1.00 78.99  ? 10   DC  I P     1 
ATOM   7763  O  OP1   . DC  I 5  83  ? 8.237   -21.443 79.650 1.00 76.51  ? 10   DC  I OP1   1 
ATOM   7764  O  OP2   . DC  I 5  83  ? 8.100   -22.214 77.167 1.00 75.91  ? 10   DC  I OP2   1 
ATOM   7765  O  "O5'" . DC  I 5  83  ? 9.018   -23.699 78.850 1.00 77.30  ? 10   DC  I "O5'" 1 
ATOM   7766  C  "C5'" . DC  I 5  83  ? 8.931   -24.523 80.023 1.00 75.15  ? 10   DC  I "C5'" 1 
ATOM   7767  C  "C4'" . DC  I 5  83  ? 9.860   -25.693 79.880 1.00 74.06  ? 10   DC  I "C4'" 1 
ATOM   7768  O  "O4'" . DC  I 5  83  ? 9.136   -26.805 79.298 1.00 75.35  ? 10   DC  I "O4'" 1 
ATOM   7769  C  "C3'" . DC  I 5  83  ? 11.079  -25.468 78.985 1.00 75.54  ? 10   DC  I "C3'" 1 
ATOM   7770  O  "O3'" . DC  I 5  83  ? 12.198  -25.997 79.681 1.00 81.01  ? 10   DC  I "O3'" 1 
ATOM   7771  C  "C2'" . DC  I 5  83  ? 10.760  -26.304 77.748 1.00 79.30  ? 10   DC  I "C2'" 1 
ATOM   7772  C  "C1'" . DC  I 5  83  ? 9.980   -27.450 78.380 1.00 83.29  ? 10   DC  I "C1'" 1 
ATOM   7773  N  N1    . DC  I 5  83  ? 9.163   -28.260 77.465 1.00 91.01  ? 10   DC  I N1    1 
ATOM   7774  C  C2    . DC  I 5  83  ? 8.872   -29.578 77.826 1.00 88.76  ? 10   DC  I C2    1 
ATOM   7775  O  O2    . DC  I 5  83  ? 9.285   -30.005 78.910 1.00 86.93  ? 10   DC  I O2    1 
ATOM   7776  N  N3    . DC  I 5  83  ? 8.131   -30.345 76.995 1.00 91.56  ? 10   DC  I N3    1 
ATOM   7777  C  C4    . DC  I 5  83  ? 7.712   -29.849 75.830 1.00 86.62  ? 10   DC  I C4    1 
ATOM   7778  N  N4    . DC  I 5  83  ? 6.995   -30.642 75.037 1.00 87.23  ? 10   DC  I N4    1 
ATOM   7779  C  C5    . DC  I 5  83  ? 7.995   -28.508 75.435 1.00 88.19  ? 10   DC  I C5    1 
ATOM   7780  C  C6    . DC  I 5  83  ? 8.716   -27.755 76.275 1.00 90.48  ? 10   DC  I C6    1 
ATOM   7781  P  P     . DA  I 5  84  ? 13.705  -25.718 79.255 1.00 87.84  ? 11   DA  I P     1 
ATOM   7782  O  OP1   . DA  I 5  84  ? 13.949  -24.316 79.683 1.00 82.62  ? 11   DA  I OP1   1 
ATOM   7783  O  OP2   . DA  I 5  84  ? 13.967  -26.117 77.847 1.00 86.43  ? 11   DA  I OP2   1 
ATOM   7784  O  "O5'" . DA  I 5  84  ? 14.486  -26.767 80.166 1.00 88.05  ? 11   DA  I "O5'" 1 
ATOM   7785  C  "C5'" . DA  I 5  84  ? 13.795  -27.836 80.850 1.00 89.72  ? 11   DA  I "C5'" 1 
ATOM   7786  C  "C4'" . DA  I 5  84  ? 14.464  -29.174 80.595 1.00 95.91  ? 11   DA  I "C4'" 1 
ATOM   7787  O  "O4'" . DA  I 5  84  ? 13.621  -29.991 79.733 1.00 93.57  ? 11   DA  I "O4'" 1 
ATOM   7788  C  "C3'" . DA  I 5  84  ? 15.837  -29.150 79.922 1.00 102.38 ? 11   DA  I "C3'" 1 
ATOM   7789  O  "O3'" . DA  I 5  84  ? 16.553  -30.311 80.331 1.00 118.64 ? 11   DA  I "O3'" 1 
ATOM   7790  C  "C2'" . DA  I 5  84  ? 15.485  -29.311 78.452 1.00 105.47 ? 11   DA  I "C2'" 1 
ATOM   7791  C  "C1'" . DA  I 5  84  ? 14.315  -30.291 78.535 1.00 108.31 ? 11   DA  I "C1'" 1 
ATOM   7792  N  N9    . DA  I 5  84  ? 13.397  -30.155 77.404 1.00 115.68 ? 11   DA  I N9    1 
ATOM   7793  C  C8    . DA  I 5  84  ? 13.118  -29.016 76.688 1.00 110.68 ? 11   DA  I C8    1 
ATOM   7794  N  N7    . DA  I 5  84  ? 12.284  -29.206 75.696 1.00 114.51 ? 11   DA  I N7    1 
ATOM   7795  C  C5    . DA  I 5  84  ? 12.001  -30.564 75.755 1.00 121.47 ? 11   DA  I C5    1 
ATOM   7796  C  C6    . DA  I 5  84  ? 11.179  -31.392 74.971 1.00 120.75 ? 11   DA  I C6    1 
ATOM   7797  N  N6    . DA  I 5  84  ? 10.454  -30.952 73.941 1.00 109.69 ? 11   DA  I N6    1 
ATOM   7798  N  N1    . DA  I 5  84  ? 11.119  -32.704 75.293 1.00 125.93 ? 11   DA  I N1    1 
ATOM   7799  C  C2    . DA  I 5  84  ? 11.841  -33.143 76.334 1.00 124.95 ? 11   DA  I C2    1 
ATOM   7800  N  N3    . DA  I 5  84  ? 12.653  -32.463 77.143 1.00 121.69 ? 11   DA  I N3    1 
ATOM   7801  C  C4    . DA  I 5  84  ? 12.689  -31.164 76.795 1.00 121.77 ? 11   DA  I C4    1 
ATOM   7802  P  P     . DT  I 5  85  ? 18.118  -30.569 80.060 1.00 119.64 ? 12   DT  I P     1 
ATOM   7803  O  OP1   . DT  I 5  85  ? 18.729  -30.780 81.407 1.00 111.97 ? 12   DT  I OP1   1 
ATOM   7804  O  OP2   . DT  I 5  85  ? 18.645  -29.499 79.156 1.00 102.97 ? 12   DT  I OP2   1 
ATOM   7805  O  "O5'" . DT  I 5  85  ? 18.152  -31.959 79.277 1.00 114.15 ? 12   DT  I "O5'" 1 
ATOM   7806  C  "C5'" . DT  I 5  85  ? 17.104  -32.945 79.418 1.00 120.14 ? 12   DT  I "C5'" 1 
ATOM   7807  C  "C4'" . DT  I 5  85  ? 17.080  -33.856 78.210 1.00 127.47 ? 12   DT  I "C4'" 1 
ATOM   7808  O  "O4'" . DT  I 5  85  ? 16.027  -33.441 77.303 1.00 127.24 ? 12   DT  I "O4'" 1 
ATOM   7809  C  "C3'" . DT  I 5  85  ? 18.376  -33.866 77.388 1.00 128.82 ? 12   DT  I "C3'" 1 
ATOM   7810  O  "O3'" . DT  I 5  85  ? 18.796  -35.203 77.097 1.00 133.93 ? 12   DT  I "O3'" 1 
ATOM   7811  C  "C2'" . DT  I 5  85  ? 18.002  -33.142 76.106 1.00 127.67 ? 12   DT  I "C2'" 1 
ATOM   7812  C  "C1'" . DT  I 5  85  ? 16.529  -33.483 75.979 1.00 130.81 ? 12   DT  I "C1'" 1 
ATOM   7813  N  N1    . DT  I 5  85  ? 15.737  -32.550 75.147 1.00 134.56 ? 12   DT  I N1    1 
ATOM   7814  C  C2    . DT  I 5  85  ? 14.723  -33.068 74.371 1.00 131.43 ? 12   DT  I C2    1 
ATOM   7815  O  O2    . DT  I 5  85  ? 14.423  -34.252 74.367 1.00 121.07 ? 12   DT  I O2    1 
ATOM   7816  N  N3    . DT  I 5  85  ? 14.054  -32.140 73.610 1.00 134.07 ? 12   DT  I N3    1 
ATOM   7817  C  C4    . DT  I 5  85  ? 14.302  -30.781 73.539 1.00 131.13 ? 12   DT  I C4    1 
ATOM   7818  O  O4    . DT  I 5  85  ? 13.613  -30.070 72.814 1.00 117.21 ? 12   DT  I O4    1 
ATOM   7819  C  C5    . DT  I 5  85  ? 15.387  -30.308 74.370 1.00 137.38 ? 12   DT  I C5    1 
ATOM   7820  C  C7    . DT  I 5  85  ? 15.729  -28.852 74.359 1.00 136.89 ? 12   DT  I C7    1 
ATOM   7821  C  C6    . DT  I 5  85  ? 16.045  -31.206 75.116 1.00 140.85 ? 12   DT  I C6    1 
ATOM   7822  P  P     . DG  I 5  86  ? 20.348  -35.523 76.835 1.00 132.19 ? 13   DG  I P     1 
ATOM   7823  O  OP1   . DG  I 5  86  ? 20.826  -36.156 78.093 1.00 134.15 ? 13   DG  I OP1   1 
ATOM   7824  O  OP2   . DG  I 5  86  ? 21.045  -34.323 76.289 1.00 113.38 ? 13   DG  I OP2   1 
ATOM   7825  O  "O5'" . DG  I 5  86  ? 20.361  -36.618 75.676 1.00 133.11 ? 13   DG  I "O5'" 1 
ATOM   7826  C  "C5'" . DG  I 5  86  ? 19.422  -37.713 75.657 1.00 129.38 ? 13   DG  I "C5'" 1 
ATOM   7827  C  "C4'" . DG  I 5  86  ? 19.088  -38.102 74.233 1.00 123.11 ? 13   DG  I "C4'" 1 
ATOM   7828  O  "O4'" . DG  I 5  86  ? 18.135  -37.153 73.680 1.00 131.42 ? 13   DG  I "O4'" 1 
ATOM   7829  C  "C3'" . DG  I 5  86  ? 20.255  -38.161 73.250 1.00 123.18 ? 13   DG  I "C3'" 1 
ATOM   7830  O  "O3'" . DG  I 5  86  ? 20.082  -39.336 72.463 1.00 112.67 ? 13   DG  I "O3'" 1 
ATOM   7831  C  "C2'" . DG  I 5  86  ? 20.111  -36.861 72.456 1.00 124.69 ? 13   DG  I "C2'" 1 
ATOM   7832  C  "C1'" . DG  I 5  86  ? 18.590  -36.706 72.418 1.00 137.71 ? 13   DG  I "C1'" 1 
ATOM   7833  N  N9    . DG  I 5  86  ? 18.093  -35.347 72.204 1.00 140.53 ? 13   DG  I N9    1 
ATOM   7834  C  C8    . DG  I 5  86  ? 18.494  -34.203 72.852 1.00 138.52 ? 13   DG  I C8    1 
ATOM   7835  N  N7    . DG  I 5  86  ? 17.847  -33.138 72.460 1.00 128.71 ? 13   DG  I N7    1 
ATOM   7836  C  C5    . DG  I 5  86  ? 16.956  -33.609 71.506 1.00 133.20 ? 13   DG  I C5    1 
ATOM   7837  C  C6    . DG  I 5  86  ? 15.994  -32.916 70.724 1.00 129.83 ? 13   DG  I C6    1 
ATOM   7838  O  O6    . DG  I 5  86  ? 15.724  -31.710 70.726 1.00 128.96 ? 13   DG  I O6    1 
ATOM   7839  N  N1    . DG  I 5  86  ? 15.309  -33.779 69.874 1.00 132.22 ? 13   DG  I N1    1 
ATOM   7840  C  C2    . DG  I 5  86  ? 15.521  -35.133 69.783 1.00 134.07 ? 13   DG  I C2    1 
ATOM   7841  N  N2    . DG  I 5  86  ? 14.753  -35.795 68.905 1.00 136.82 ? 13   DG  I N2    1 
ATOM   7842  N  N3    . DG  I 5  86  ? 16.413  -35.791 70.506 1.00 143.36 ? 13   DG  I N3    1 
ATOM   7843  C  C4    . DG  I 5  86  ? 17.091  -34.972 71.339 1.00 140.16 ? 13   DG  I C4    1 
ATOM   7844  P  P     . DC  I 5  87  ? 21.155  -39.774 71.364 1.00 113.93 ? 14   DC  I P     1 
ATOM   7845  O  OP1   . DC  I 5  87  ? 21.204  -41.260 71.345 1.00 116.44 ? 14   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I 5  87  ? 22.403  -38.976 71.484 1.00 114.45 ? 14   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I 5  87  ? 20.517  -39.281 69.996 1.00 116.09 ? 14   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I 5  87  ? 19.405  -39.967 69.408 1.00 118.91 ? 14   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I 5  87  ? 19.024  -39.267 68.131 1.00 110.89 ? 14   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I 5  87  ? 18.582  -37.923 68.452 1.00 105.99 ? 14   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I 5  87  ? 20.149  -39.124 67.100 1.00 104.06 ? 14   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I 5  87  ? 19.730  -39.540 65.801 1.00 104.16 ? 14   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I 5  87  ? 20.467  -37.627 67.112 1.00 107.36 ? 14   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I 5  87  ? 19.117  -37.033 67.505 1.00 107.96 ? 14   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I 5  87  ? 19.150  -35.686 68.096 1.00 117.69 ? 14   DC  I N1    1 
ATOM   7856  C  C2    . DC  I 5  87  ? 18.365  -34.695 67.503 1.00 117.19 ? 14   DC  I C2    1 
ATOM   7857  O  O2    . DC  I 5  87  ? 17.694  -34.985 66.499 1.00 111.42 ? 14   DC  I O2    1 
ATOM   7858  N  N3    . DC  I 5  87  ? 18.364  -33.447 68.030 1.00 110.54 ? 14   DC  I N3    1 
ATOM   7859  C  C4    . DC  I 5  87  ? 19.106  -33.177 69.108 1.00 107.41 ? 14   DC  I C4    1 
ATOM   7860  N  N4    . DC  I 5  87  ? 19.071  -31.937 69.598 1.00 107.69 ? 14   DC  I N4    1 
ATOM   7861  C  C5    . DC  I 5  87  ? 19.913  -34.171 69.735 1.00 113.09 ? 14   DC  I C5    1 
ATOM   7862  C  C6    . DC  I 5  87  ? 19.899  -35.403 69.206 1.00 119.79 ? 14   DC  I C6    1 
ATOM   7863  P  P     . DC  I 5  88  ? 19.403  -41.065 65.409 1.00 97.65  ? 15   DC  I P     1 
ATOM   7864  O  OP1   . DC  I 5  88  ? 19.048  -41.841 66.630 1.00 94.88  ? 15   DC  I OP1   1 
ATOM   7865  O  OP2   . DC  I 5  88  ? 20.479  -41.532 64.492 1.00 97.45  ? 15   DC  I OP2   1 
ATOM   7866  O  "O5'" . DC  I 5  88  ? 18.062  -41.020 64.552 1.00 101.72 ? 15   DC  I "O5'" 1 
ATOM   7867  C  "C5'" . DC  I 5  88  ? 16.794  -40.665 65.157 1.00 101.23 ? 15   DC  I "C5'" 1 
ATOM   7868  C  "C4'" . DC  I 5  88  ? 15.946  -39.867 64.185 1.00 93.02  ? 15   DC  I "C4'" 1 
ATOM   7869  O  "O4'" . DC  I 5  88  ? 16.493  -38.523 64.057 1.00 91.47  ? 15   DC  I "O4'" 1 
ATOM   7870  C  "C3'" . DC  I 5  88  ? 15.855  -40.421 62.762 1.00 87.99  ? 15   DC  I "C3'" 1 
ATOM   7871  O  "O3'" . DC  I 5  88  ? 14.583  -40.155 62.179 1.00 87.08  ? 15   DC  I "O3'" 1 
ATOM   7872  C  "C2'" . DC  I 5  88  ? 16.921  -39.628 62.018 1.00 86.35  ? 15   DC  I "C2'" 1 
ATOM   7873  C  "C1'" . DC  I 5  88  ? 16.803  -38.269 62.699 1.00 95.62  ? 15   DC  I "C1'" 1 
ATOM   7874  N  N1    . DC  I 5  88  ? 18.018  -37.441 62.634 1.00 106.12 ? 15   DC  I N1    1 
ATOM   7875  C  C2    . DC  I 5  88  ? 17.872  -36.054 62.701 1.00 111.03 ? 15   DC  I C2    1 
ATOM   7876  O  O2    . DC  I 5  88  ? 16.735  -35.578 62.834 1.00 109.56 ? 15   DC  I O2    1 
ATOM   7877  N  N3    . DC  I 5  88  ? 18.971  -35.268 62.628 1.00 118.37 ? 15   DC  I N3    1 
ATOM   7878  C  C4    . DC  I 5  88  ? 20.178  -35.820 62.484 1.00 110.04 ? 15   DC  I C4    1 
ATOM   7879  N  N4    . DC  I 5  88  ? 21.232  -35.005 62.409 1.00 98.61  ? 15   DC  I N4    1 
ATOM   7880  C  C5    . DC  I 5  88  ? 20.356  -37.233 62.402 1.00 108.63 ? 15   DC  I C5    1 
ATOM   7881  C  C6    . DC  I 5  88  ? 19.259  -37.999 62.480 1.00 108.71 ? 15   DC  I C6    1 
ATOM   7882  P  P     . DT  I 5  89  ? 14.041  -40.743 60.769 1.00 92.05  ? 16   DT  I P     1 
ATOM   7883  O  OP1   . DT  I 5  89  ? 12.759  -41.466 60.994 1.00 85.26  ? 16   DT  I OP1   1 
ATOM   7884  O  OP2   . DT  I 5  89  ? 15.117  -41.376 59.965 1.00 94.48  ? 16   DT  I OP2   1 
ATOM   7885  O  "O5'" . DT  I 5  89  ? 13.647  -39.439 59.949 1.00 86.60  ? 16   DT  I "O5'" 1 
ATOM   7886  C  "C5'" . DT  I 5  89  ? 13.034  -38.323 60.609 1.00 80.42  ? 16   DT  I "C5'" 1 
ATOM   7887  C  "C4'" . DT  I 5  89  ? 13.258  -37.068 59.800 1.00 77.04  ? 16   DT  I "C4'" 1 
ATOM   7888  O  "O4'" . DT  I 5  89  ? 14.587  -36.532 60.016 1.00 77.00  ? 16   DT  I "O4'" 1 
ATOM   7889  C  "C3'" . DT  I 5  89  ? 13.103  -37.253 58.289 1.00 72.28  ? 16   DT  I "C3'" 1 
ATOM   7890  O  "O3'" . DT  I 5  89  ? 12.056  -36.358 57.893 1.00 70.09  ? 16   DT  I "O3'" 1 
ATOM   7891  C  "C2'" . DT  I 5  89  ? 14.484  -36.937 57.728 1.00 75.15  ? 16   DT  I "C2'" 1 
ATOM   7892  C  "C1'" . DT  I 5  89  ? 15.081  -36.031 58.788 1.00 80.55  ? 16   DT  I "C1'" 1 
ATOM   7893  N  N1    . DT  I 5  89  ? 16.560  -35.995 58.872 1.00 87.93  ? 16   DT  I N1    1 
ATOM   7894  C  C2    . DT  I 5  89  ? 17.179  -34.764 58.905 1.00 87.45  ? 16   DT  I C2    1 
ATOM   7895  O  O2    . DT  I 5  89  ? 16.570  -33.709 58.845 1.00 87.41  ? 16   DT  I O2    1 
ATOM   7896  N  N3    . DT  I 5  89  ? 18.546  -34.814 59.006 1.00 93.50  ? 16   DT  I N3    1 
ATOM   7897  C  C4    . DT  I 5  89  ? 19.339  -35.944 59.084 1.00 95.41  ? 16   DT  I C4    1 
ATOM   7898  O  O4    . DT  I 5  89  ? 20.560  -35.830 59.173 1.00 92.20  ? 16   DT  I O4    1 
ATOM   7899  C  C5    . DT  I 5  89  ? 18.624  -37.201 59.048 1.00 90.40  ? 16   DT  I C5    1 
ATOM   7900  C  C7    . DT  I 5  89  ? 19.398  -38.479 59.120 1.00 86.74  ? 16   DT  I C7    1 
ATOM   7901  C  C6    . DT  I 5  89  ? 17.289  -37.164 58.949 1.00 90.63  ? 16   DT  I C6    1 
ATOM   7902  P  P     . DT  I 5  90  ? 11.520  -36.184 56.411 1.00 71.23  ? 17   DT  I P     1 
ATOM   7903  O  OP1   . DT  I 5  90  ? 10.065  -36.457 56.513 1.00 70.04  ? 17   DT  I OP1   1 
ATOM   7904  O  OP2   . DT  I 5  90  ? 12.361  -36.947 55.440 1.00 74.05  ? 17   DT  I OP2   1 
ATOM   7905  O  "O5'" . DT  I 5  90  ? 11.721  -34.650 56.033 1.00 71.77  ? 17   DT  I "O5'" 1 
ATOM   7906  C  "C5'" . DT  I 5  90  ? 11.689  -33.627 57.036 1.00 70.56  ? 17   DT  I "C5'" 1 
ATOM   7907  C  "C4'" . DT  I 5  90  ? 12.688  -32.547 56.701 1.00 75.19  ? 17   DT  I "C4'" 1 
ATOM   7908  O  "O4'" . DT  I 5  90  ? 14.030  -33.061 56.849 1.00 83.64  ? 17   DT  I "O4'" 1 
ATOM   7909  C  "C3'" . DT  I 5  90  ? 12.594  -31.982 55.279 1.00 71.40  ? 17   DT  I "C3'" 1 
ATOM   7910  O  "O3'" . DT  I 5  90  ? 12.276  -30.587 55.378 1.00 70.56  ? 17   DT  I "O3'" 1 
ATOM   7911  C  "C2'" . DT  I 5  90  ? 13.970  -32.247 54.677 1.00 79.15  ? 17   DT  I "C2'" 1 
ATOM   7912  C  "C1'" . DT  I 5  90  ? 14.854  -32.414 55.900 1.00 87.77  ? 17   DT  I "C1'" 1 
ATOM   7913  N  N1    . DT  I 5  90  ? 16.072  -33.235 55.728 1.00 100.58 ? 17   DT  I N1    1 
ATOM   7914  C  C2    . DT  I 5  90  ? 17.298  -32.654 55.963 1.00 99.09  ? 17   DT  I C2    1 
ATOM   7915  O  O2    . DT  I 5  90  ? 17.432  -31.479 56.267 1.00 103.33 ? 17   DT  I O2    1 
ATOM   7916  N  N3    . DT  I 5  90  ? 18.369  -33.501 55.819 1.00 99.13  ? 17   DT  I N3    1 
ATOM   7917  C  C4    . DT  I 5  90  ? 18.336  -34.840 55.476 1.00 102.36 ? 17   DT  I C4    1 
ATOM   7918  O  O4    . DT  I 5  90  ? 19.384  -35.473 55.382 1.00 111.60 ? 17   DT  I O4    1 
ATOM   7919  C  C5    . DT  I 5  90  ? 17.018  -35.387 55.256 1.00 107.20 ? 17   DT  I C5    1 
ATOM   7920  C  C7    . DT  I 5  90  ? 16.883  -36.830 54.881 1.00 98.00  ? 17   DT  I C7    1 
ATOM   7921  C  C6    . DT  I 5  90  ? 15.966  -34.571 55.401 1.00 109.30 ? 17   DT  I C6    1 
ATOM   7922  P  P     . DT  I 5  91  ? 12.017  -29.631 54.109 1.00 73.40  ? 18   DT  I P     1 
ATOM   7923  O  OP1   . DT  I 5  91  ? 10.917  -28.739 54.557 1.00 68.83  ? 18   DT  I OP1   1 
ATOM   7924  O  OP2   . DT  I 5  91  ? 11.885  -30.385 52.816 1.00 63.50  ? 18   DT  I OP2   1 
ATOM   7925  O  "O5'" . DT  I 5  91  ? 13.372  -28.797 53.964 1.00 73.97  ? 18   DT  I "O5'" 1 
ATOM   7926  C  "C5'" . DT  I 5  91  ? 14.108  -28.291 55.100 1.00 72.61  ? 18   DT  I "C5'" 1 
ATOM   7927  C  "C4'" . DT  I 5  91  ? 15.476  -27.814 54.667 1.00 80.42  ? 18   DT  I "C4'" 1 
ATOM   7928  O  "O4'" . DT  I 5  91  ? 16.405  -28.924 54.598 1.00 89.63  ? 18   DT  I "O4'" 1 
ATOM   7929  C  "C3'" . DT  I 5  91  ? 15.537  -27.123 53.303 1.00 85.97  ? 18   DT  I "C3'" 1 
ATOM   7930  O  "O3'" . DT  I 5  91  ? 16.340  -25.953 53.467 1.00 90.34  ? 18   DT  I "O3'" 1 
ATOM   7931  C  "C2'" . DT  I 5  91  ? 16.208  -28.149 52.400 1.00 89.08  ? 18   DT  I "C2'" 1 
ATOM   7932  C  "C1'" . DT  I 5  91  ? 17.122  -28.877 53.372 1.00 95.03  ? 18   DT  I "C1'" 1 
ATOM   7933  N  N1    . DT  I 5  91  ? 17.493  -30.264 53.012 1.00 105.17 ? 18   DT  I N1    1 
ATOM   7934  C  C2    . DT  I 5  91  ? 18.776  -30.693 53.279 1.00 113.49 ? 18   DT  I C2    1 
ATOM   7935  O  O2    . DT  I 5  91  ? 19.630  -29.975 53.774 1.00 122.23 ? 18   DT  I O2    1 
ATOM   7936  N  N3    . DT  I 5  91  ? 19.023  -32.002 52.942 1.00 113.13 ? 18   DT  I N3    1 
ATOM   7937  C  C4    . DT  I 5  91  ? 18.134  -32.904 52.385 1.00 108.35 ? 18   DT  I C4    1 
ATOM   7938  O  O4    . DT  I 5  91  ? 18.498  -34.049 52.136 1.00 107.38 ? 18   DT  I O4    1 
ATOM   7939  C  C5    . DT  I 5  91  ? 16.809  -32.389 52.136 1.00 108.50 ? 18   DT  I C5    1 
ATOM   7940  C  C7    . DT  I 5  91  ? 15.783  -33.292 51.529 1.00 98.53  ? 18   DT  I C7    1 
ATOM   7941  C  C6    . DT  I 5  91  ? 16.556  -31.114 52.462 1.00 109.77 ? 18   DT  I C6    1 
ATOM   7942  P  P     . DT  I 5  92  ? 16.363  -24.779 52.392 1.00 95.56  ? 19   DT  I P     1 
ATOM   7943  O  OP1   . DT  I 5  92  ? 16.213  -23.552 53.220 1.00 90.99  ? 19   DT  I OP1   1 
ATOM   7944  O  OP2   . DT  I 5  92  ? 15.461  -25.027 51.237 1.00 91.27  ? 19   DT  I OP2   1 
ATOM   7945  O  "O5'" . DT  I 5  92  ? 17.819  -24.895 51.760 1.00 101.57 ? 19   DT  I "O5'" 1 
ATOM   7946  C  "C5'" . DT  I 5  92  ? 18.990  -25.019 52.586 1.00 106.24 ? 19   DT  I "C5'" 1 
ATOM   7947  C  "C4'" . DT  I 5  92  ? 20.177  -25.421 51.741 1.00 110.05 ? 19   DT  I "C4'" 1 
ATOM   7948  O  "O4'" . DT  I 5  92  ? 20.191  -26.860 51.596 1.00 111.01 ? 19   DT  I "O4'" 1 
ATOM   7949  C  "C3'" . DT  I 5  92  ? 20.209  -24.843 50.320 1.00 113.24 ? 19   DT  I "C3'" 1 
ATOM   7950  O  "O3'" . DT  I 5  92  ? 21.511  -24.286 50.104 1.00 120.34 ? 19   DT  I "O3'" 1 
ATOM   7951  C  "C2'" . DT  I 5  92  ? 19.911  -26.040 49.427 1.00 106.10 ? 19   DT  I "C2'" 1 
ATOM   7952  C  "C1'" . DT  I 5  92  ? 20.478  -27.184 50.248 1.00 114.31 ? 19   DT  I "C1'" 1 
ATOM   7953  N  N1    . DT  I 5  92  ? 19.932  -28.527 49.981 1.00 115.92 ? 19   DT  I N1    1 
ATOM   7954  C  C2    . DT  I 5  92  ? 20.776  -29.603 50.142 1.00 116.94 ? 19   DT  I C2    1 
ATOM   7955  O  O2    . DT  I 5  92  ? 21.946  -29.491 50.469 1.00 119.49 ? 19   DT  I O2    1 
ATOM   7956  N  N3    . DT  I 5  92  ? 20.199  -30.825 49.895 1.00 116.12 ? 19   DT  I N3    1 
ATOM   7957  C  C4    . DT  I 5  92  ? 18.891  -31.071 49.525 1.00 118.02 ? 19   DT  I C4    1 
ATOM   7958  O  O4    . DT  I 5  92  ? 18.514  -32.226 49.341 1.00 112.80 ? 19   DT  I O4    1 
ATOM   7959  C  C5    . DT  I 5  92  ? 18.060  -29.896 49.379 1.00 122.43 ? 19   DT  I C5    1 
ATOM   7960  C  C7    . DT  I 5  92  ? 16.630  -30.063 48.972 1.00 118.75 ? 19   DT  I C7    1 
ATOM   7961  C  C6    . DT  I 5  92  ? 18.613  -28.700 49.619 1.00 122.83 ? 19   DT  I C6    1 
ATOM   7962  P  P     . DG  I 5  93  ? 22.040  -23.734 48.699 1.00 123.81 ? 20   DG  I P     1 
ATOM   7963  O  OP1   . DG  I 5  93  ? 23.022  -22.678 49.047 1.00 130.94 ? 20   DG  I OP1   1 
ATOM   7964  O  OP2   . DG  I 5  93  ? 20.909  -23.413 47.781 1.00 115.29 ? 20   DG  I OP2   1 
ATOM   7965  O  "O5'" . DG  I 5  93  ? 22.815  -25.004 48.127 1.00 119.19 ? 20   DG  I "O5'" 1 
ATOM   7966  C  "C5'" . DG  I 5  93  ? 24.199  -25.252 48.454 1.00 127.49 ? 20   DG  I "C5'" 1 
ATOM   7967  C  "C4'" . DG  I 5  93  ? 24.855  -26.087 47.375 1.00 139.28 ? 20   DG  I "C4'" 1 
ATOM   7968  O  "O4'" . DG  I 5  93  ? 24.188  -27.378 47.296 1.00 135.39 ? 20   DG  I "O4'" 1 
ATOM   7969  C  "C3'" . DG  I 5  93  ? 24.814  -25.519 45.959 1.00 139.37 ? 20   DG  I "C3'" 1 
ATOM   7970  O  "O3'" . DG  I 5  93  ? 25.961  -26.001 45.265 1.00 147.18 ? 20   DG  I "O3'" 1 
ATOM   7971  C  "C2'" . DG  I 5  93  ? 23.556  -26.164 45.390 1.00 138.35 ? 20   DG  I "C2'" 1 
ATOM   7972  C  "C1'" . DG  I 5  93  ? 23.656  -27.559 45.998 1.00 137.09 ? 20   DG  I "C1'" 1 
ATOM   7973  N  N9    . DG  I 5  93  ? 22.396  -28.282 46.120 1.00 146.96 ? 20   DG  I N9    1 
ATOM   7974  C  C8    . DG  I 5  93  ? 21.123  -27.764 46.146 1.00 152.45 ? 20   DG  I C8    1 
ATOM   7975  N  N7    . DG  I 5  93  ? 20.200  -28.679 46.269 1.00 150.03 ? 20   DG  I N7    1 
ATOM   7976  C  C5    . DG  I 5  93  ? 20.906  -29.872 46.336 1.00 146.33 ? 20   DG  I C5    1 
ATOM   7977  C  C6    . DG  I 5  93  ? 20.444  -31.208 46.473 1.00 140.46 ? 20   DG  I C6    1 
ATOM   7978  O  O6    . DG  I 5  93  ? 19.281  -31.615 46.565 1.00 137.46 ? 20   DG  I O6    1 
ATOM   7979  N  N1    . DG  I 5  93  ? 21.500  -32.114 46.493 1.00 144.56 ? 20   DG  I N1    1 
ATOM   7980  C  C2    . DG  I 5  93  ? 22.829  -31.781 46.397 1.00 152.61 ? 20   DG  I C2    1 
ATOM   7981  N  N2    . DG  I 5  93  ? 23.699  -32.801 46.437 1.00 148.57 ? 20   DG  I N2    1 
ATOM   7982  N  N3    . DG  I 5  93  ? 23.273  -30.541 46.271 1.00 158.00 ? 20   DG  I N3    1 
ATOM   7983  C  C4    . DG  I 5  93  ? 22.263  -29.644 46.247 1.00 152.76 ? 20   DG  I C4    1 
ATOM   7984  P  P     . DA  I 5  94  ? 26.270  -25.699 43.716 1.00 161.45 ? 21   DA  I P     1 
ATOM   7985  O  OP1   . DA  I 5  94  ? 26.823  -24.319 43.691 1.00 167.77 ? 21   DA  I OP1   1 
ATOM   7986  O  OP2   . DA  I 5  94  ? 25.134  -26.047 42.819 1.00 144.57 ? 21   DA  I OP2   1 
ATOM   7987  O  "O5'" . DA  I 5  94  ? 27.432  -26.739 43.384 1.00 164.13 ? 21   DA  I "O5'" 1 
ATOM   7988  C  "C5'" . DA  I 5  94  ? 27.609  -27.945 44.158 1.00 150.98 ? 21   DA  I "C5'" 1 
ATOM   7989  C  "C4'" . DA  I 5  94  ? 27.445  -29.175 43.292 1.00 143.46 ? 21   DA  I "C4'" 1 
ATOM   7990  O  "O4'" . DA  I 5  94  ? 26.148  -29.782 43.554 1.00 133.04 ? 21   DA  I "O4'" 1 
ATOM   7991  C  "C3'" . DA  I 5  94  ? 27.516  -28.971 41.773 1.00 154.72 ? 21   DA  I "C3'" 1 
ATOM   7992  O  "O3'" . DA  I 5  94  ? 28.295  -30.022 41.197 1.00 153.80 ? 21   DA  I "O3'" 1 
ATOM   7993  C  "C2'" . DA  I 5  94  ? 26.057  -29.103 41.343 1.00 146.51 ? 21   DA  I "C2'" 1 
ATOM   7994  C  "C1'" . DA  I 5  94  ? 25.569  -30.161 42.325 1.00 142.43 ? 21   DA  I "C1'" 1 
ATOM   7995  N  N9    . DA  I 5  94  ? 24.117  -30.242 42.479 1.00 144.48 ? 21   DA  I N9    1 
ATOM   7996  C  C8    . DA  I 5  94  ? 23.177  -29.253 42.319 1.00 148.09 ? 21   DA  I C8    1 
ATOM   7997  N  N7    . DA  I 5  94  ? 21.945  -29.658 42.511 1.00 136.42 ? 21   DA  I N7    1 
ATOM   7998  C  C5    . DA  I 5  94  ? 22.081  -31.008 42.807 1.00 137.55 ? 21   DA  I C5    1 
ATOM   7999  C  C6    . DA  I 5  94  ? 21.141  -32.009 43.113 1.00 134.73 ? 21   DA  I C6    1 
ATOM   8000  N  N6    . DA  I 5  94  ? 19.825  -31.795 43.176 1.00 125.75 ? 21   DA  I N6    1 
ATOM   8001  N  N1    . DA  I 5  94  ? 21.608  -33.254 43.360 1.00 132.89 ? 21   DA  I N1    1 
ATOM   8002  C  C2    . DA  I 5  94  ? 22.929  -33.467 43.299 1.00 136.17 ? 21   DA  I C2    1 
ATOM   8003  N  N3    . DA  I 5  94  ? 23.910  -32.608 43.026 1.00 139.47 ? 21   DA  I N3    1 
ATOM   8004  C  C4    . DA  I 5  94  ? 23.413  -31.382 42.785 1.00 140.93 ? 21   DA  I C4    1 
ATOM   8005  P  P     . DT  I 5  95  ? 28.412  -30.316 39.620 1.00 147.06 ? 22   DT  I P     1 
ATOM   8006  O  OP1   . DT  I 5  95  ? 29.873  -30.441 39.372 1.00 157.21 ? 22   DT  I OP1   1 
ATOM   8007  O  OP2   . DT  I 5  95  ? 27.625  -29.304 38.863 1.00 130.58 ? 22   DT  I OP2   1 
ATOM   8008  O  "O5'" . DT  I 5  95  ? 27.730  -31.747 39.435 1.00 146.53 ? 22   DT  I "O5'" 1 
ATOM   8009  C  "C5'" . DT  I 5  95  ? 28.427  -32.836 38.783 1.00 162.34 ? 22   DT  I "C5'" 1 
ATOM   8010  C  "C4'" . DT  I 5  95  ? 27.509  -34.019 38.572 1.00 178.93 ? 22   DT  I "C4'" 1 
ATOM   8011  O  "O4'" . DT  I 5  95  ? 26.225  -33.770 39.202 1.00 188.62 ? 22   DT  I "O4'" 1 
ATOM   8012  C  "C3'" . DT  I 5  95  ? 27.204  -34.353 37.104 1.00 189.65 ? 22   DT  I "C3'" 1 
ATOM   8013  O  "O3'" . DT  I 5  95  ? 27.240  -35.768 36.846 1.00 201.68 ? 22   DT  I "O3'" 1 
ATOM   8014  C  "C2'" . DT  I 5  95  ? 25.766  -33.896 36.933 1.00 195.17 ? 22   DT  I "C2'" 1 
ATOM   8015  C  "C1'" . DT  I 5  95  ? 25.213  -34.204 38.310 1.00 196.59 ? 22   DT  I "C1'" 1 
ATOM   8016  N  N1    . DT  I 5  95  ? 23.945  -33.528 38.666 1.00 193.60 ? 22   DT  I N1    1 
ATOM   8017  C  C2    . DT  I 5  95  ? 23.095  -34.153 39.554 1.00 184.64 ? 22   DT  I C2    1 
ATOM   8018  O  O2    . DT  I 5  95  ? 23.352  -35.221 40.086 1.00 172.18 ? 22   DT  I O2    1 
ATOM   8019  N  N3    . DT  I 5  95  ? 21.930  -33.470 39.808 1.00 178.05 ? 22   DT  I N3    1 
ATOM   8020  C  C4    . DT  I 5  95  ? 21.534  -32.261 39.264 1.00 175.13 ? 22   DT  I C4    1 
ATOM   8021  O  O4    . DT  I 5  95  ? 20.458  -31.768 39.590 1.00 162.22 ? 22   DT  I O4    1 
ATOM   8022  C  C5    . DT  I 5  95  ? 22.466  -31.672 38.327 1.00 181.58 ? 22   DT  I C5    1 
ATOM   8023  C  C7    . DT  I 5  95  ? 22.123  -30.363 37.688 1.00 170.08 ? 22   DT  I C7    1 
ATOM   8024  C  C6    . DT  I 5  95  ? 23.605  -32.329 38.075 1.00 188.55 ? 22   DT  I C6    1 
ATOM   8025  P  P     . DG  I 5  96  ? 27.225  -36.400 35.351 1.00 204.37 ? 23   DG  I P     1 
ATOM   8026  O  OP1   . DG  I 5  96  ? 28.378  -37.337 35.313 1.00 204.34 ? 23   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I 5  96  ? 27.171  -35.270 34.382 1.00 204.38 ? 23   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I 5  96  ? 25.914  -37.292 35.133 1.00 202.52 ? 23   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I 5  96  ? 25.635  -37.918 33.850 1.00 188.20 ? 23   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I 5  96  ? 24.495  -38.917 33.951 1.00 185.06 ? 23   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I 5  96  ? 23.595  -38.525 35.024 1.00 185.93 ? 23   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I 5  96  ? 23.601  -39.049 32.721 1.00 179.97 ? 23   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I 5  96  ? 22.935  -40.313 32.652 1.00 185.00 ? 23   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I 5  96  ? 22.558  -37.965 32.962 1.00 174.62 ? 23   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I 5  96  ? 22.378  -38.039 34.480 1.00 176.35 ? 23   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I 5  96  ? 22.111  -36.729 35.063 1.00 168.40 ? 23   DG  I N9    1 
ATOM   8037  C  C8    . DG  I 5  96  ? 22.995  -35.938 35.758 1.00 165.08 ? 23   DG  I C8    1 
ATOM   8038  N  N7    . DG  I 5  96  ? 22.477  -34.803 36.139 1.00 158.26 ? 23   DG  I N7    1 
ATOM   8039  C  C5    . DG  I 5  96  ? 21.174  -34.842 35.661 1.00 159.30 ? 23   DG  I C5    1 
ATOM   8040  C  C6    . DG  I 5  96  ? 20.130  -33.887 35.760 1.00 153.55 ? 23   DG  I C6    1 
ATOM   8041  O  O6    . DG  I 5  96  ? 20.147  -32.781 36.313 1.00 155.82 ? 23   DG  I O6    1 
ATOM   8042  N  N1    . DG  I 5  96  ? 18.972  -34.329 35.127 1.00 139.42 ? 23   DG  I N1    1 
ATOM   8043  C  C2    . DG  I 5  96  ? 18.833  -35.536 34.487 1.00 136.28 ? 23   DG  I C2    1 
ATOM   8044  N  N2    . DG  I 5  96  ? 17.635  -35.781 33.943 1.00 132.12 ? 23   DG  I N2    1 
ATOM   8045  N  N3    . DG  I 5  96  ? 19.798  -36.434 34.387 1.00 144.33 ? 23   DG  I N3    1 
ATOM   8046  C  C4    . DG  I 5  96  ? 20.934  -36.024 34.992 1.00 159.21 ? 23   DG  I C4    1 
ATOM   8047  P  P     . DG  I 5  97  ? 22.016  -40.807 31.409 1.00 184.99 ? 24   DG  I P     1 
ATOM   8048  O  OP1   . DG  I 5  97  ? 22.198  -42.278 31.262 1.00 184.85 ? 24   DG  I OP1   1 
ATOM   8049  O  OP2   . DG  I 5  97  ? 22.276  -39.917 30.246 1.00 172.40 ? 24   DG  I OP2   1 
ATOM   8050  O  "O5'" . DG  I 5  97  ? 20.484  -40.626 31.814 1.00 183.08 ? 24   DG  I "O5'" 1 
ATOM   8051  C  "C5'" . DG  I 5  97  ? 19.468  -41.497 31.261 1.00 159.67 ? 24   DG  I "C5'" 1 
ATOM   8052  C  "C4'" . DG  I 5  97  ? 18.131  -40.791 31.142 1.00 146.42 ? 24   DG  I "C4'" 1 
ATOM   8053  O  "O4'" . DG  I 5  97  ? 18.220  -39.427 31.640 1.00 145.70 ? 24   DG  I "O4'" 1 
ATOM   8054  C  "C3'" . DG  I 5  97  ? 17.556  -40.676 29.735 1.00 140.98 ? 24   DG  I "C3'" 1 
ATOM   8055  O  "O3'" . DG  I 5  97  ? 16.142  -40.761 29.843 1.00 142.37 ? 24   DG  I "O3'" 1 
ATOM   8056  C  "C2'" . DG  I 5  97  ? 17.968  -39.270 29.313 1.00 135.67 ? 24   DG  I "C2'" 1 
ATOM   8057  C  "C1'" . DG  I 5  97  ? 17.812  -38.519 30.631 1.00 140.22 ? 24   DG  I "C1'" 1 
ATOM   8058  N  N9    . DG  I 5  97  ? 18.623  -37.314 30.766 1.00 141.66 ? 24   DG  I N9    1 
ATOM   8059  C  C8    . DG  I 5  97  ? 19.994  -37.236 30.765 1.00 146.28 ? 24   DG  I C8    1 
ATOM   8060  N  N7    . DG  I 5  97  ? 20.439  -36.025 30.962 1.00 145.33 ? 24   DG  I N7    1 
ATOM   8061  C  C5    . DG  I 5  97  ? 19.292  -35.260 31.123 1.00 143.16 ? 24   DG  I C5    1 
ATOM   8062  C  C6    . DG  I 5  97  ? 19.140  -33.871 31.372 1.00 141.35 ? 24   DG  I C6    1 
ATOM   8063  O  O6    . DG  I 5  97  ? 20.019  -33.010 31.502 1.00 140.65 ? 24   DG  I O6    1 
ATOM   8064  N  N1    . DG  I 5  97  ? 17.799  -33.513 31.468 1.00 135.04 ? 24   DG  I N1    1 
ATOM   8065  C  C2    . DG  I 5  97  ? 16.740  -34.378 31.342 1.00 134.19 ? 24   DG  I C2    1 
ATOM   8066  N  N2    . DG  I 5  97  ? 15.520  -33.840 31.469 1.00 137.78 ? 24   DG  I N2    1 
ATOM   8067  N  N3    . DG  I 5  97  ? 16.867  -35.674 31.112 1.00 133.55 ? 24   DG  I N3    1 
ATOM   8068  C  C4    . DG  I 5  97  ? 18.162  -36.044 31.012 1.00 139.81 ? 24   DG  I C4    1 
ATOM   8069  P  P     . DA  I 5  98  ? 15.454  -42.156 29.504 1.00 152.98 ? 25   DA  I P     1 
ATOM   8070  O  OP1   . DA  I 5  98  ? 16.048  -43.187 30.396 1.00 156.10 ? 25   DA  I OP1   1 
ATOM   8071  O  OP2   . DA  I 5  98  ? 15.525  -42.307 28.027 1.00 150.72 ? 25   DA  I OP2   1 
ATOM   8072  O  "O5'" . DA  I 5  98  ? 13.909  -42.053 29.870 1.00 157.13 ? 25   DA  I "O5'" 1 
ATOM   8073  C  "C5'" . DA  I 5  98  ? 13.451  -42.015 31.235 1.00 148.29 ? 25   DA  I "C5'" 1 
ATOM   8074  C  "C4'" . DA  I 5  98  ? 12.394  -40.945 31.387 1.00 137.80 ? 25   DA  I "C4'" 1 
ATOM   8075  O  "O4'" . DA  I 5  98  ? 12.989  -39.641 31.134 1.00 136.38 ? 25   DA  I "O4'" 1 
ATOM   8076  C  "C3'" . DA  I 5  98  ? 11.191  -41.046 30.447 1.00 126.78 ? 25   DA  I "C3'" 1 
ATOM   8077  O  "O3'" . DA  I 5  98  ? 10.033  -40.578 31.133 1.00 118.11 ? 25   DA  I "O3'" 1 
ATOM   8078  C  "C2'" . DA  I 5  98  ? 11.576  -40.117 29.299 1.00 131.28 ? 25   DA  I "C2'" 1 
ATOM   8079  C  "C1'" . DA  I 5  98  ? 12.340  -39.019 30.038 1.00 134.04 ? 25   DA  I "C1'" 1 
ATOM   8080  N  N9    . DA  I 5  98  ? 13.357  -38.347 29.230 1.00 135.65 ? 25   DA  I N9    1 
ATOM   8081  C  C8    . DA  I 5  98  ? 14.272  -38.912 28.375 1.00 140.64 ? 25   DA  I C8    1 
ATOM   8082  N  N7    . DA  I 5  98  ? 15.071  -38.043 27.806 1.00 140.66 ? 25   DA  I N7    1 
ATOM   8083  C  C5    . DA  I 5  98  ? 14.659  -36.823 28.324 1.00 136.86 ? 25   DA  I C5    1 
ATOM   8084  C  C6    . DA  I 5  98  ? 15.107  -35.508 28.117 1.00 131.44 ? 25   DA  I C6    1 
ATOM   8085  N  N6    . DA  I 5  98  ? 16.111  -35.189 27.299 1.00 126.59 ? 25   DA  I N6    1 
ATOM   8086  N  N1    . DA  I 5  98  ? 14.477  -34.516 28.785 1.00 134.94 ? 25   DA  I N1    1 
ATOM   8087  C  C2    . DA  I 5  98  ? 13.468  -34.837 29.605 1.00 126.39 ? 25   DA  I C2    1 
ATOM   8088  N  N3    . DA  I 5  98  ? 12.959  -36.034 29.887 1.00 132.99 ? 25   DA  I N3    1 
ATOM   8089  C  C4    . DA  I 5  98  ? 13.606  -36.996 29.205 1.00 137.59 ? 25   DA  I C4    1 
ATOM   8090  P  P     . DG  I 5  99  ? 8.547   -40.582 30.520 1.00 114.05 ? 26   DG  I P     1 
ATOM   8091  O  OP1   . DG  I 5  99  ? 7.628   -40.793 31.671 1.00 111.20 ? 26   DG  I OP1   1 
ATOM   8092  O  OP2   . DG  I 5  99  ? 8.461   -41.484 29.343 1.00 111.85 ? 26   DG  I OP2   1 
ATOM   8093  O  "O5'" . DG  I 5  99  ? 8.356   -39.111 29.939 1.00 114.09 ? 26   DG  I "O5'" 1 
ATOM   8094  C  "C5'" . DG  I 5  99  ? 8.609   -37.934 30.735 1.00 103.07 ? 26   DG  I "C5'" 1 
ATOM   8095  C  "C4'" . DG  I 5  99  ? 8.345   -36.692 29.916 1.00 94.70  ? 26   DG  I "C4'" 1 
ATOM   8096  O  "O4'" . DG  I 5  99  ? 9.531   -36.361 29.137 1.00 103.07 ? 26   DG  I "O4'" 1 
ATOM   8097  C  "C3'" . DG  I 5  99  ? 7.195   -36.788 28.917 1.00 93.98  ? 26   DG  I "C3'" 1 
ATOM   8098  O  "O3'" . DG  I 5  99  ? 6.584   -35.504 28.900 1.00 95.89  ? 26   DG  I "O3'" 1 
ATOM   8099  C  "C2'" . DG  I 5  99  ? 7.915   -37.051 27.595 1.00 101.86 ? 26   DG  I "C2'" 1 
ATOM   8100  C  "C1'" . DG  I 5  99  ? 9.169   -36.198 27.778 1.00 113.78 ? 26   DG  I "C1'" 1 
ATOM   8101  N  N9    . DG  I 5  99  ? 10.327  -36.499 26.928 1.00 126.64 ? 26   DG  I N9    1 
ATOM   8102  C  C8    . DG  I 5  99  ? 10.644  -37.683 26.304 1.00 132.10 ? 26   DG  I C8    1 
ATOM   8103  N  N7    . DG  I 5  99  ? 11.747  -37.617 25.607 1.00 133.97 ? 26   DG  I N7    1 
ATOM   8104  C  C5    . DG  I 5  99  ? 12.185  -36.310 25.781 1.00 136.00 ? 26   DG  I C5    1 
ATOM   8105  C  C6    . DG  I 5  99  ? 13.333  -35.645 25.267 1.00 137.81 ? 26   DG  I C6    1 
ATOM   8106  O  O6    . DG  I 5  99  ? 14.224  -36.096 24.536 1.00 128.90 ? 26   DG  I O6    1 
ATOM   8107  N  N1    . DG  I 5  99  ? 13.390  -34.321 25.692 1.00 139.54 ? 26   DG  I N1    1 
ATOM   8108  C  C2    . DG  I 5  99  ? 12.465  -33.710 26.503 1.00 140.95 ? 26   DG  I C2    1 
ATOM   8109  N  N2    . DG  I 5  99  ? 12.699  -32.424 26.805 1.00 126.52 ? 26   DG  I N2    1 
ATOM   8110  N  N3    . DG  I 5  99  ? 11.395  -34.319 26.992 1.00 141.86 ? 26   DG  I N3    1 
ATOM   8111  C  C4    . DG  I 5  99  ? 11.318  -35.607 26.591 1.00 132.82 ? 26   DG  I C4    1 
ATOM   8112  P  P     . DC  I 5  100 ? 5.076   -35.136 29.307 1.00 86.45  ? 27   DC  I P     1 
ATOM   8113  O  OP1   . DC  I 5  100 ? 4.811   -35.498 30.715 1.00 84.94  ? 27   DC  I OP1   1 
ATOM   8114  O  OP2   . DC  I 5  100 ? 4.158   -35.597 28.240 1.00 87.82  ? 27   DC  I OP2   1 
ATOM   8115  O  "O5'" . DC  I 5  100 ? 5.131   -33.549 29.202 1.00 103.63 ? 27   DC  I "O5'" 1 
ATOM   8116  C  "C5'" . DC  I 5  100 ? 6.246   -32.812 29.746 1.00 107.36 ? 27   DC  I "C5'" 1 
ATOM   8117  C  "C4'" . DC  I 5  100 ? 6.806   -31.842 28.728 1.00 107.45 ? 27   DC  I "C4'" 1 
ATOM   8118  O  "O4'" . DC  I 5  100 ? 7.752   -32.522 27.860 1.00 109.07 ? 27   DC  I "O4'" 1 
ATOM   8119  C  "C3'" . DC  I 5  100 ? 5.794   -31.158 27.808 1.00 105.56 ? 27   DC  I "C3'" 1 
ATOM   8120  O  "O3'" . DC  I 5  100 ? 6.016   -29.753 27.884 1.00 111.13 ? 27   DC  I "O3'" 1 
ATOM   8121  C  "C2'" . DC  I 5  100 ? 6.110   -31.743 26.428 1.00 102.96 ? 27   DC  I "C2'" 1 
ATOM   8122  C  "C1'" . DC  I 5  100 ? 7.605   -32.025 26.553 1.00 104.92 ? 27   DC  I "C1'" 1 
ATOM   8123  N  N1    . DC  I 5  100 ? 8.173   -33.009 25.612 1.00 109.80 ? 27   DC  I N1    1 
ATOM   8124  C  C2    . DC  I 5  100 ? 9.440   -32.759 25.064 1.00 115.16 ? 27   DC  I C2    1 
ATOM   8125  O  O2    . DC  I 5  100 ? 10.031  -31.713 25.372 1.00 109.61 ? 27   DC  I O2    1 
ATOM   8126  N  N3    . DC  I 5  100 ? 9.983   -33.660 24.213 1.00 114.84 ? 27   DC  I N3    1 
ATOM   8127  C  C4    . DC  I 5  100 ? 9.319   -34.778 23.913 1.00 112.64 ? 27   DC  I C4    1 
ATOM   8128  N  N4    . DC  I 5  100 ? 9.895   -35.638 23.070 1.00 108.12 ? 27   DC  I N4    1 
ATOM   8129  C  C5    . DC  I 5  100 ? 8.030   -35.060 24.457 1.00 110.25 ? 27   DC  I C5    1 
ATOM   8130  C  C6    . DC  I 5  100 ? 7.502   -34.159 25.299 1.00 105.74 ? 27   DC  I C6    1 
ATOM   8131  P  P     . DA  I 5  101 ? 4.875   -28.622 27.784 1.00 115.49 ? 28   DA  I P     1 
ATOM   8132  O  OP1   . DA  I 5  101 ? 4.595   -28.082 29.142 1.00 94.45  ? 28   DA  I OP1   1 
ATOM   8133  O  OP2   . DA  I 5  101 ? 3.764   -29.133 26.930 1.00 108.58 ? 28   DA  I OP2   1 
ATOM   8134  O  "O5'" . DA  I 5  101 ? 5.619   -27.476 26.963 1.00 121.91 ? 28   DA  I "O5'" 1 
ATOM   8135  C  "C5'" . DA  I 5  101 ? 7.024   -27.592 26.647 1.00 130.35 ? 28   DA  I "C5'" 1 
ATOM   8136  C  "C4'" . DA  I 5  101 ? 7.264   -27.574 25.150 1.00 126.04 ? 28   DA  I "C4'" 1 
ATOM   8137  O  "O4'" . DA  I 5  101 ? 7.592   -28.905 24.660 1.00 127.54 ? 28   DA  I "O4'" 1 
ATOM   8138  C  "C3'" . DA  I 5  101 ? 6.126   -27.076 24.248 1.00 123.62 ? 28   DA  I "C3'" 1 
ATOM   8139  O  "O3'" . DA  I 5  101 ? 6.757   -26.292 23.249 1.00 132.81 ? 28   DA  I "O3'" 1 
ATOM   8140  C  "C2'" . DA  I 5  101 ? 5.693   -28.342 23.514 1.00 120.63 ? 28   DA  I "C2'" 1 
ATOM   8141  C  "C1'" . DA  I 5  101 ? 7.041   -29.033 23.372 1.00 122.85 ? 28   DA  I "C1'" 1 
ATOM   8142  N  N9    . DA  I 5  101 ? 7.043   -30.435 22.966 1.00 126.83 ? 28   DA  I N9    1 
ATOM   8143  C  C8    . DA  I 5  101 ? 6.183   -31.453 23.300 1.00 127.02 ? 28   DA  I C8    1 
ATOM   8144  N  N7    . DA  I 5  101 ? 6.474   -32.598 22.732 1.00 127.57 ? 28   DA  I N7    1 
ATOM   8145  C  C5    . DA  I 5  101 ? 7.591   -32.312 21.958 1.00 122.82 ? 28   DA  I C5    1 
ATOM   8146  C  C6    . DA  I 5  101 ? 8.378   -33.102 21.102 1.00 116.82 ? 28   DA  I C6    1 
ATOM   8147  N  N6    . DA  I 5  101 ? 8.153   -34.398 20.876 1.00 107.69 ? 28   DA  I N6    1 
ATOM   8148  N  N1    . DA  I 5  101 ? 9.419   -32.507 20.478 1.00 121.04 ? 28   DA  I N1    1 
ATOM   8149  C  C2    . DA  I 5  101 ? 9.643   -31.206 20.702 1.00 117.78 ? 28   DA  I C2    1 
ATOM   8150  N  N3    . DA  I 5  101 ? 8.973   -30.359 21.480 1.00 119.09 ? 28   DA  I N3    1 
ATOM   8151  C  C4    . DA  I 5  101 ? 7.948   -30.982 22.089 1.00 122.42 ? 28   DA  I C4    1 
ATOM   8152  P  P     . DG  I 5  102 ? 6.352   -24.805 22.853 1.00 134.73 ? 29   DG  I P     1 
ATOM   8153  O  OP1   . DG  I 5  102 ? 7.035   -23.881 23.801 1.00 130.99 ? 29   DG  I OP1   1 
ATOM   8154  O  OP2   . DG  I 5  102 ? 4.880   -24.741 22.673 1.00 128.08 ? 29   DG  I OP2   1 
ATOM   8155  O  "O5'" . DG  I 5  102 ? 7.025   -24.706 21.413 1.00 128.30 ? 29   DG  I "O5'" 1 
ATOM   8156  C  "C5'" . DG  I 5  102 ? 8.449   -24.532 21.270 1.00 139.76 ? 29   DG  I "C5'" 1 
ATOM   8157  C  "C4'" . DG  I 5  102 ? 8.928   -25.162 19.983 1.00 143.96 ? 29   DG  I "C4'" 1 
ATOM   8158  O  "O4'" . DG  I 5  102 ? 8.721   -26.597 20.048 1.00 143.19 ? 29   DG  I "O4'" 1 
ATOM   8159  C  "C3'" . DG  I 5  102 ? 8.240   -24.673 18.710 1.00 155.50 ? 29   DG  I "C3'" 1 
ATOM   8160  O  "O3'" . DG  I 5  102 ? 9.185   -24.325 17.703 1.00 165.24 ? 29   DG  I "O3'" 1 
ATOM   8161  C  "C2'" . DG  I 5  102 ? 7.348   -25.846 18.298 1.00 151.91 ? 29   DG  I "C2'" 1 
ATOM   8162  C  "C1'" . DG  I 5  102 ? 8.113   -27.043 18.857 1.00 143.08 ? 29   DG  I "C1'" 1 
ATOM   8163  N  N9    . DG  I 5  102 ? 7.239   -28.165 19.188 1.00 148.26 ? 29   DG  I N9    1 
ATOM   8164  C  C8    . DG  I 5  102 ? 6.162   -28.145 20.042 1.00 151.84 ? 29   DG  I C8    1 
ATOM   8165  N  N7    . DG  I 5  102 ? 5.565   -29.301 20.142 1.00 154.08 ? 29   DG  I N7    1 
ATOM   8166  C  C5    . DG  I 5  102 ? 6.287   -30.135 19.299 1.00 152.07 ? 29   DG  I C5    1 
ATOM   8167  C  C6    . DG  I 5  102 ? 6.112   -31.511 18.997 1.00 153.46 ? 29   DG  I C6    1 
ATOM   8168  O  O6    . DG  I 5  102 ? 5.251   -32.292 19.424 1.00 142.05 ? 29   DG  I O6    1 
ATOM   8169  N  N1    . DG  I 5  102 ? 7.072   -31.962 18.095 1.00 164.03 ? 29   DG  I N1    1 
ATOM   8170  C  C2    . DG  I 5  102 ? 8.072   -31.191 17.554 1.00 159.80 ? 29   DG  I C2    1 
ATOM   8171  N  N2    . DG  I 5  102 ? 8.903   -31.812 16.702 1.00 157.65 ? 29   DG  I N2    1 
ATOM   8172  N  N3    . DG  I 5  102 ? 8.248   -29.908 17.829 1.00 150.30 ? 29   DG  I N3    1 
ATOM   8173  C  C4    . DG  I 5  102 ? 7.325   -29.449 18.702 1.00 148.77 ? 29   DG  I C4    1 
ATOM   8174  P  P     . DT  I 5  103 ? 8.753   -23.388 16.472 1.00 168.90 ? 30   DT  I P     1 
ATOM   8175  O  OP1   . DT  I 5  103 ? 9.909   -22.492 16.207 1.00 166.64 ? 30   DT  I OP1   1 
ATOM   8176  O  OP2   . DT  I 5  103 ? 7.411   -22.802 16.744 1.00 163.30 ? 30   DT  I OP2   1 
ATOM   8177  O  "O5'" . DT  I 5  103 ? 8.595   -24.407 15.255 1.00 167.78 ? 30   DT  I "O5'" 1 
ATOM   8178  C  "C5'" . DT  I 5  103 ? 9.661   -24.605 14.306 1.00 164.06 ? 30   DT  I "C5'" 1 
ATOM   8179  C  "C4'" . DT  I 5  103 ? 9.444   -25.872 13.509 1.00 165.92 ? 30   DT  I "C4'" 1 
ATOM   8180  O  "O4'" . DT  I 5  103 ? 8.874   -26.907 14.340 1.00 162.39 ? 30   DT  I "O4'" 1 
ATOM   8181  C  "C3'" . DT  I 5  103 ? 8.502   -25.734 12.307 1.00 170.33 ? 30   DT  I "C3'" 1 
ATOM   8182  O  "O3'" . DT  I 5  103 ? 9.233   -25.766 11.072 1.00 178.12 ? 30   DT  I "O3'" 1 
ATOM   8183  C  "C2'" . DT  I 5  103 ? 7.577   -26.940 12.409 1.00 168.94 ? 30   DT  I "C2'" 1 
ATOM   8184  C  "C1'" . DT  I 5  103 ? 8.208   -27.810 13.482 1.00 164.50 ? 30   DT  I "C1'" 1 
ATOM   8185  N  N1    . DT  I 5  103 ? 7.233   -28.577 14.284 1.00 164.93 ? 30   DT  I N1    1 
ATOM   8186  C  C2    . DT  I 5  103 ? 7.202   -29.949 14.150 1.00 164.73 ? 30   DT  I C2    1 
ATOM   8187  O  O2    . DT  I 5  103 ? 7.960   -30.566 13.418 1.00 165.46 ? 30   DT  I O2    1 
ATOM   8188  N  N3    . DT  I 5  103 ? 6.247   -30.575 14.912 1.00 166.31 ? 30   DT  I N3    1 
ATOM   8189  C  C4    . DT  I 5  103 ? 5.340   -29.981 15.771 1.00 156.53 ? 30   DT  I C4    1 
ATOM   8190  O  O4    . DT  I 5  103 ? 4.542   -30.675 16.394 1.00 165.85 ? 30   DT  I O4    1 
ATOM   8191  C  C5    . DT  I 5  103 ? 5.424   -28.542 15.856 1.00 153.42 ? 30   DT  I C5    1 
ATOM   8192  C  C7    . DT  I 5  103 ? 4.479   -27.811 16.758 1.00 143.32 ? 30   DT  I C7    1 
ATOM   8193  C  C6    . DT  I 5  103 ? 6.351   -27.920 15.116 1.00 164.53 ? 30   DT  I C6    1 
ATOM   8194  P  P     . DT  I 5  104 ? 8.537   -25.471 9.647  1.00 166.50 ? 31   DT  I P     1 
ATOM   8195  O  OP1   . DT  I 5  104 ? 9.593   -25.149 8.652  1.00 169.65 ? 31   DT  I OP1   1 
ATOM   8196  O  OP2   . DT  I 5  104 ? 7.397   -24.537 9.844  1.00 161.69 ? 31   DT  I OP2   1 
ATOM   8197  O  "O5'" . DT  I 5  104 ? 7.920   -26.872 9.218  1.00 161.37 ? 31   DT  I "O5'" 1 
ATOM   8198  C  "C5'" . DT  I 5  104 ? 8.751   -28.031 9.052  1.00 161.78 ? 31   DT  I "C5'" 1 
ATOM   8199  C  "C4'" . DT  I 5  104 ? 7.908   -29.185 8.565  1.00 170.42 ? 31   DT  I "C4'" 1 
ATOM   8200  O  "O4'" . DT  I 5  104 ? 7.147   -29.737 9.666  1.00 170.25 ? 31   DT  I "O4'" 1 
ATOM   8201  C  "C3'" . DT  I 5  104 ? 6.885   -28.820 7.484  1.00 174.41 ? 31   DT  I "C3'" 1 
ATOM   8202  O  "O3'" . DT  I 5  104 ? 6.896   -29.834 6.481  1.00 183.04 ? 31   DT  I "O3'" 1 
ATOM   8203  C  "C2'" . DT  I 5  104 ? 5.552   -28.875 8.210  1.00 168.31 ? 31   DT  I "C2'" 1 
ATOM   8204  C  "C1'" . DT  I 5  104 ? 5.816   -29.960 9.233  1.00 169.23 ? 31   DT  I "C1'" 1 
ATOM   8205  N  N1    . DT  I 5  104 ? 4.940   -29.927 10.417 1.00 163.92 ? 31   DT  I N1    1 
ATOM   8206  C  C2    . DT  I 5  104 ? 4.337   -31.098 10.822 1.00 165.39 ? 31   DT  I C2    1 
ATOM   8207  O  O2    . DT  I 5  104 ? 4.487   -32.163 10.244 1.00 157.91 ? 31   DT  I O2    1 
ATOM   8208  N  N3    . DT  I 5  104 ? 3.542   -30.976 11.935 1.00 167.59 ? 31   DT  I N3    1 
ATOM   8209  C  C4    . DT  I 5  104 ? 3.298   -29.827 12.666 1.00 161.72 ? 31   DT  I C4    1 
ATOM   8210  O  O4    . DT  I 5  104 ? 2.559   -29.871 13.645 1.00 164.32 ? 31   DT  I O4    1 
ATOM   8211  C  C5    . DT  I 5  104 ? 3.964   -28.637 12.184 1.00 156.98 ? 31   DT  I C5    1 
ATOM   8212  C  C7    . DT  I 5  104 ? 3.757   -27.345 12.909 1.00 148.78 ? 31   DT  I C7    1 
ATOM   8213  C  C6    . DT  I 5  104 ? 4.740   -28.746 11.099 1.00 161.41 ? 31   DT  I C6    1 
ATOM   8214  P  P     . DT  I 5  105 ? 6.789   -29.449 4.941  1.00 193.29 ? 32   DT  I P     1 
ATOM   8215  O  OP1   . DT  I 5  105 ? 8.179   -29.382 4.419  1.00 201.32 ? 32   DT  I OP1   1 
ATOM   8216  O  OP2   . DT  I 5  105 ? 5.892   -28.270 4.808  1.00 176.06 ? 32   DT  I OP2   1 
ATOM   8217  O  "O5'" . DT  I 5  105 ? 6.075   -30.739 4.335  1.00 192.94 ? 32   DT  I "O5'" 1 
ATOM   8218  C  "C5'" . DT  I 5  105 ? 6.458   -32.065 4.757  1.00 184.83 ? 32   DT  I "C5'" 1 
ATOM   8219  C  "C4'" . DT  I 5  105 ? 5.238   -32.936 4.953  1.00 186.32 ? 32   DT  I "C4'" 1 
ATOM   8220  O  "O4'" . DT  I 5  105 ? 4.650   -32.709 6.256  1.00 193.33 ? 32   DT  I "O4'" 1 
ATOM   8221  C  "C3'" . DT  I 5  105 ? 4.113   -32.723 3.932  1.00 184.17 ? 32   DT  I "C3'" 1 
ATOM   8222  O  "O3'" . DT  I 5  105 ? 4.002   -33.897 3.118  1.00 179.52 ? 32   DT  I "O3'" 1 
ATOM   8223  C  "C2'" . DT  I 5  105 ? 2.881   -32.435 4.782  1.00 193.74 ? 32   DT  I "C2'" 1 
ATOM   8224  C  "C1'" . DT  I 5  105 ? 3.270   -32.991 6.140  1.00 201.35 ? 32   DT  I "C1'" 1 
ATOM   8225  N  N1    . DT  I 5  105 ? 2.566   -32.408 7.310  1.00 207.81 ? 32   DT  I N1    1 
ATOM   8226  C  C2    . DT  I 5  105 ? 1.939   -33.276 8.180  1.00 207.87 ? 32   DT  I C2    1 
ATOM   8227  O  O2    . DT  I 5  105 ? 1.958   -34.489 8.041  1.00 207.87 ? 32   DT  I O2    1 
ATOM   8228  N  N3    . DT  I 5  105 ? 1.293   -32.668 9.229  1.00 207.89 ? 32   DT  I N3    1 
ATOM   8229  C  C4    . DT  I 5  105 ? 1.205   -31.311 9.484  1.00 207.82 ? 32   DT  I C4    1 
ATOM   8230  O  O4    . DT  I 5  105 ? 0.591   -30.912 10.471 1.00 203.31 ? 32   DT  I O4    1 
ATOM   8231  C  C5    . DT  I 5  105 ? 1.876   -30.459 8.527  1.00 207.90 ? 32   DT  I C5    1 
ATOM   8232  C  C7    . DT  I 5  105 ? 1.835   -28.976 8.721  1.00 200.36 ? 32   DT  I C7    1 
ATOM   8233  C  C6    . DT  I 5  105 ? 2.511   -31.043 7.500  1.00 207.90 ? 32   DT  I C6    1 
ATOM   8234  P  P     . DC  I 5  106 ? 2.642   -34.698 2.829  1.00 191.41 ? 33   DC  I P     1 
ATOM   8235  O  OP1   . DC  I 5  106 ? 2.976   -35.762 1.847  1.00 195.05 ? 33   DC  I OP1   1 
ATOM   8236  O  OP2   . DC  I 5  106 ? 1.579   -33.710 2.500  1.00 189.71 ? 33   DC  I OP2   1 
ATOM   8237  O  "O5'" . DC  I 5  106 ? 2.296   -35.412 4.213  1.00 187.30 ? 33   DC  I "O5'" 1 
ATOM   8238  C  "C5'" . DC  I 5  106 ? 1.695   -36.721 4.253  1.00 180.09 ? 33   DC  I "C5'" 1 
ATOM   8239  C  "C4'" . DC  I 5  106 ? 0.209   -36.622 4.519  1.00 179.90 ? 33   DC  I "C4'" 1 
ATOM   8240  O  "O4'" . DC  I 5  106 ? -0.071  -35.522 5.425  1.00 185.45 ? 33   DC  I "O4'" 1 
ATOM   8241  C  "C3'" . DC  I 5  106 ? -0.685  -36.408 3.297  1.00 170.21 ? 33   DC  I "C3'" 1 
ATOM   8242  O  "O3'" . DC  I 5  106 ? -1.726  -37.370 3.347  1.00 172.39 ? 33   DC  I "O3'" 1 
ATOM   8243  C  "C2'" . DC  I 5  106 ? -1.255  -35.003 3.500  1.00 166.22 ? 33   DC  I "C2'" 1 
ATOM   8244  C  "C1'" . DC  I 5  106 ? -1.266  -34.895 5.022  1.00 177.33 ? 33   DC  I "C1'" 1 
ATOM   8245  N  N1    . DC  I 5  106 ? -1.276  -33.517 5.546  1.00 177.56 ? 33   DC  I N1    1 
ATOM   8246  C  C2    . DC  I 5  106 ? -1.915  -33.265 6.766  1.00 174.16 ? 33   DC  I C2    1 
ATOM   8247  O  O2    . DC  I 5  106 ? -2.455  -34.207 7.366  1.00 168.87 ? 33   DC  I O2    1 
ATOM   8248  N  N3    . DC  I 5  106 ? -1.927  -32.002 7.256  1.00 171.08 ? 33   DC  I N3    1 
ATOM   8249  C  C4    . DC  I 5  106 ? -1.335  -31.016 6.576  1.00 165.06 ? 33   DC  I C4    1 
ATOM   8250  N  N4    . DC  I 5  106 ? -1.371  -29.787 7.096  1.00 158.23 ? 33   DC  I N4    1 
ATOM   8251  C  C5    . DC  I 5  106 ? -0.679  -31.246 5.333  1.00 166.47 ? 33   DC  I C5    1 
ATOM   8252  C  C6    . DC  I 5  106 ? -0.673  -32.500 4.859  1.00 174.37 ? 33   DC  I C6    1 
ATOM   8253  P  P     . DC  I 5  107 ? -2.545  -37.769 2.041  1.00 176.66 ? 34   DC  I P     1 
ATOM   8254  O  OP1   . DC  I 5  107 ? -1.591  -38.480 1.153  1.00 181.84 ? 34   DC  I OP1   1 
ATOM   8255  O  OP2   . DC  I 5  107 ? -3.269  -36.568 1.538  1.00 166.89 ? 34   DC  I OP2   1 
ATOM   8256  O  "O5'" . DC  I 5  107 ? -3.615  -38.820 2.584  1.00 171.44 ? 34   DC  I "O5'" 1 
ATOM   8257  C  "C5'" . DC  I 5  107 ? -3.502  -39.389 3.906  1.00 160.05 ? 34   DC  I "C5'" 1 
ATOM   8258  C  "C4'" . DC  I 5  107 ? -4.612  -38.892 4.810  1.00 147.95 ? 34   DC  I "C4'" 1 
ATOM   8259  O  "O4'" . DC  I 5  107 ? -4.411  -37.491 5.147  1.00 148.58 ? 34   DC  I "O4'" 1 
ATOM   8260  C  "C3'" . DC  I 5  107 ? -6.043  -38.987 4.269  1.00 141.79 ? 34   DC  I "C3'" 1 
ATOM   8261  O  "O3'" . DC  I 5  107 ? -6.892  -39.422 5.314  1.00 138.29 ? 34   DC  I "O3'" 1 
ATOM   8262  C  "C2'" . DC  I 5  107 ? -6.435  -37.530 4.048  1.00 139.03 ? 34   DC  I "C2'" 1 
ATOM   8263  C  "C1'" . DC  I 5  107 ? -5.673  -36.865 5.186  1.00 145.20 ? 34   DC  I "C1'" 1 
ATOM   8264  N  N1    . DC  I 5  107 ? -5.513  -35.407 5.079  1.00 144.65 ? 34   DC  I N1    1 
ATOM   8265  C  C2    . DC  I 5  107 ? -5.963  -34.615 6.140  1.00 147.07 ? 34   DC  I C2    1 
ATOM   8266  O  O2    . DC  I 5  107 ? -6.464  -35.168 7.131  1.00 137.84 ? 34   DC  I O2    1 
ATOM   8267  N  N3    . DC  I 5  107 ? -5.838  -33.270 6.060  1.00 150.73 ? 34   DC  I N3    1 
ATOM   8268  C  C4    . DC  I 5  107 ? -5.294  -32.714 4.974  1.00 151.58 ? 34   DC  I C4    1 
ATOM   8269  N  N4    . DC  I 5  107 ? -5.191  -31.383 4.937  1.00 150.13 ? 34   DC  I N4    1 
ATOM   8270  C  C5    . DC  I 5  107 ? -4.832  -33.498 3.877  1.00 148.92 ? 34   DC  I C5    1 
ATOM   8271  C  C6    . DC  I 5  107 ? -4.965  -34.828 3.968  1.00 143.47 ? 34   DC  I C6    1 
ATOM   8272  P  P     . DA  I 5  108 ? -7.382  -40.925 5.371  1.00 145.62 ? 35   DA  I P     1 
ATOM   8273  O  OP1   . DA  I 5  108 ? -6.173  -41.791 5.398  1.00 141.53 ? 35   DA  I OP1   1 
ATOM   8274  O  OP2   . DA  I 5  108 ? -8.379  -41.062 4.281  1.00 133.66 ? 35   DA  I OP2   1 
ATOM   8275  O  "O5'" . DA  I 5  108 ? -8.140  -41.025 6.770  1.00 145.18 ? 35   DA  I "O5'" 1 
ATOM   8276  C  "C5'" . DA  I 5  108 ? -7.573  -40.461 7.972  1.00 140.55 ? 35   DA  I "C5'" 1 
ATOM   8277  C  "C4'" . DA  I 5  108 ? -8.579  -39.577 8.679  1.00 136.77 ? 35   DA  I "C4'" 1 
ATOM   8278  O  "O4'" . DA  I 5  108 ? -8.494  -38.226 8.153  1.00 121.85 ? 35   DA  I "O4'" 1 
ATOM   8279  C  "C3'" . DA  I 5  108 ? -10.052 -39.992 8.572  1.00 137.05 ? 35   DA  I "C3'" 1 
ATOM   8280  O  "O3'" . DA  I 5  108 ? -10.652 -40.025 9.871  1.00 136.00 ? 35   DA  I "O3'" 1 
ATOM   8281  C  "C2'" . DA  I 5  108 ? -10.649 -38.945 7.629  1.00 128.99 ? 35   DA  I "C2'" 1 
ATOM   8282  C  "C1'" . DA  I 5  108 ? -9.795  -37.723 7.951  1.00 124.78 ? 35   DA  I "C1'" 1 
ATOM   8283  N  N9    . DA  I 5  108 ? -9.731  -36.750 6.867  1.00 125.63 ? 35   DA  I N9    1 
ATOM   8284  C  C8    . DA  I 5  108 ? -9.740  -37.004 5.519  1.00 129.64 ? 35   DA  I C8    1 
ATOM   8285  N  N7    . DA  I 5  108 ? -9.643  -35.928 4.777  1.00 135.84 ? 35   DA  I N7    1 
ATOM   8286  C  C5    . DA  I 5  108 ? -9.552  -34.895 5.699  1.00 135.01 ? 35   DA  I C5    1 
ATOM   8287  C  C6    . DA  I 5  108 ? -9.422  -33.501 5.551  1.00 136.57 ? 35   DA  I C6    1 
ATOM   8288  N  N6    . DA  I 5  108 ? -9.365  -32.883 4.369  1.00 141.32 ? 35   DA  I N6    1 
ATOM   8289  N  N1    . DA  I 5  108 ? -9.364  -32.752 6.674  1.00 132.19 ? 35   DA  I N1    1 
ATOM   8290  C  C2    . DA  I 5  108 ? -9.419  -33.372 7.860  1.00 134.74 ? 35   DA  I C2    1 
ATOM   8291  N  N3    . DA  I 5  108 ? -9.539  -34.671 8.128  1.00 141.01 ? 35   DA  I N3    1 
ATOM   8292  C  C4    . DA  I 5  108 ? -9.601  -35.387 6.991  1.00 135.38 ? 35   DA  I C4    1 
ATOM   8293  P  P     . DA  I 5  109 ? -12.214 -39.764 10.163 1.00 140.48 ? 36   DA  I P     1 
ATOM   8294  O  OP1   . DA  I 5  109 ? -12.528 -40.204 11.547 1.00 137.12 ? 36   DA  I OP1   1 
ATOM   8295  O  OP2   . DA  I 5  109 ? -13.050 -40.245 9.034  1.00 135.98 ? 36   DA  I OP2   1 
ATOM   8296  O  "O5'" . DA  I 5  109 ? -12.300 -38.177 10.150 1.00 134.87 ? 36   DA  I "O5'" 1 
ATOM   8297  C  "C5'" . DA  I 5  109 ? -11.695 -37.393 11.192 1.00 129.81 ? 36   DA  I "C5'" 1 
ATOM   8298  C  "C4'" . DA  I 5  109 ? -12.317 -36.019 11.210 1.00 128.60 ? 36   DA  I "C4'" 1 
ATOM   8299  O  "O4'" . DA  I 5  109 ? -11.955 -35.322 9.987  1.00 131.62 ? 36   DA  I "O4'" 1 
ATOM   8300  C  "C3'" . DA  I 5  109 ? -13.848 -35.984 11.281 1.00 125.53 ? 36   DA  I "C3'" 1 
ATOM   8301  O  "O3'" . DA  I 5  109 ? -14.284 -34.951 12.160 1.00 128.70 ? 36   DA  I "O3'" 1 
ATOM   8302  C  "C2'" . DA  I 5  109 ? -14.251 -35.631 9.854  1.00 128.12 ? 36   DA  I "C2'" 1 
ATOM   8303  C  "C1'" . DA  I 5  109 ? -13.107 -34.705 9.460  1.00 135.25 ? 36   DA  I "C1'" 1 
ATOM   8304  N  N9    . DA  I 5  109 ? -12.941 -34.525 8.018  1.00 145.05 ? 36   DA  I N9    1 
ATOM   8305  C  C8    . DA  I 5  109 ? -13.034 -35.455 7.012  1.00 147.63 ? 36   DA  I C8    1 
ATOM   8306  N  N7    . DA  I 5  109 ? -12.856 -34.956 5.813  1.00 148.96 ? 36   DA  I N7    1 
ATOM   8307  C  C5    . DA  I 5  109 ? -12.646 -33.603 6.043  1.00 146.89 ? 36   DA  I C5    1 
ATOM   8308  C  C6    . DA  I 5  109 ? -12.394 -32.522 5.179  1.00 147.32 ? 36   DA  I C6    1 
ATOM   8309  N  N6    . DA  I 5  109 ? -12.310 -32.637 3.852  1.00 152.17 ? 36   DA  I N6    1 
ATOM   8310  N  N1    . DA  I 5  109 ? -12.221 -31.302 5.733  1.00 144.03 ? 36   DA  I N1    1 
ATOM   8311  C  C2    . DA  I 5  109 ? -12.299 -31.187 7.064  1.00 144.99 ? 36   DA  I C2    1 
ATOM   8312  N  N3    . DA  I 5  109 ? -12.535 -32.124 7.979  1.00 149.45 ? 36   DA  I N3    1 
ATOM   8313  C  C4    . DA  I 5  109 ? -12.699 -33.324 7.397  1.00 145.94 ? 36   DA  I C4    1 
ATOM   8314  P  P     . DA  I 5  110 ? -15.822 -34.807 12.611 1.00 130.48 ? 37   DA  I P     1 
ATOM   8315  O  OP1   . DA  I 5  110 ? -15.940 -35.230 14.027 1.00 127.58 ? 37   DA  I OP1   1 
ATOM   8316  O  OP2   . DA  I 5  110 ? -16.715 -35.407 11.582 1.00 121.14 ? 37   DA  I OP2   1 
ATOM   8317  O  "O5'" . DA  I 5  110 ? -16.080 -33.238 12.603 1.00 123.59 ? 37   DA  I "O5'" 1 
ATOM   8318  C  "C5'" . DA  I 5  110 ? -15.069 -32.308 13.034 1.00 120.08 ? 37   DA  I "C5'" 1 
ATOM   8319  C  "C4'" . DA  I 5  110 ? -15.288 -30.965 12.371 1.00 121.08 ? 37   DA  I "C4'" 1 
ATOM   8320  O  "O4'" . DA  I 5  110 ? -14.862 -31.045 10.982 1.00 129.92 ? 37   DA  I "O4'" 1 
ATOM   8321  C  "C3'" . DA  I 5  110 ? -16.734 -30.457 12.345 1.00 118.31 ? 37   DA  I "C3'" 1 
ATOM   8322  O  "O3'" . DA  I 5  110 ? -16.805 -29.044 12.520 1.00 109.93 ? 37   DA  I "O3'" 1 
ATOM   8323  C  "C2'" . DA  I 5  110 ? -17.200 -30.818 10.940 1.00 128.12 ? 37   DA  I "C2'" 1 
ATOM   8324  C  "C1'" . DA  I 5  110 ? -15.917 -30.619 10.140 1.00 138.58 ? 37   DA  I "C1'" 1 
ATOM   8325  N  N9    . DA  I 5  110 ? -15.895 -31.412 8.910  1.00 148.48 ? 37   DA  I N9    1 
ATOM   8326  C  C8    . DA  I 5  110 ? -16.186 -32.745 8.747  1.00 156.88 ? 37   DA  I C8    1 
ATOM   8327  N  N7    . DA  I 5  110 ? -16.102 -33.157 7.505  1.00 148.07 ? 37   DA  I N7    1 
ATOM   8328  C  C5    . DA  I 5  110 ? -15.744 -32.016 6.801  1.00 147.85 ? 37   DA  I C5    1 
ATOM   8329  C  C6    . DA  I 5  110 ? -15.499 -31.785 5.436  1.00 149.88 ? 37   DA  I C6    1 
ATOM   8330  N  N6    . DA  I 5  110 ? -15.579 -32.732 4.500  1.00 145.96 ? 37   DA  I N6    1 
ATOM   8331  N  N1    . DA  I 5  110 ? -15.159 -30.532 5.062  1.00 154.59 ? 37   DA  I N1    1 
ATOM   8332  C  C2    . DA  I 5  110 ? -15.079 -29.582 6.004  1.00 151.20 ? 37   DA  I C2    1 
ATOM   8333  N  N3    . DA  I 5  110 ? -15.288 -29.675 7.315  1.00 138.11 ? 37   DA  I N3    1 
ATOM   8334  C  C4    . DA  I 5  110 ? -15.622 -30.932 7.653  1.00 142.29 ? 37   DA  I C4    1 
ATOM   8335  P  P     . DT  I 5  111 ? -18.200 -28.247 12.419 1.00 104.59 ? 38   DT  I P     1 
ATOM   8336  O  OP1   . DT  I 5  111 ? -18.308 -27.310 13.569 1.00 100.04 ? 38   DT  I OP1   1 
ATOM   8337  O  OP2   . DT  I 5  111 ? -19.312 -29.189 12.117 1.00 96.33  ? 38   DT  I OP2   1 
ATOM   8338  O  "O5'" . DT  I 5  111 ? -18.009 -27.339 11.129 1.00 106.42 ? 38   DT  I "O5'" 1 
ATOM   8339  C  "C5'" . DT  I 5  111 ? -16.834 -26.523 10.968 1.00 121.21 ? 38   DT  I "C5'" 1 
ATOM   8340  C  "C4'" . DT  I 5  111 ? -16.918 -25.764 9.665  1.00 127.01 ? 38   DT  I "C4'" 1 
ATOM   8341  O  "O4'" . DT  I 5  111 ? -16.755 -26.681 8.553  1.00 129.35 ? 38   DT  I "O4'" 1 
ATOM   8342  C  "C3'" . DT  I 5  111 ? -18.253 -25.043 9.445  1.00 126.83 ? 38   DT  I "C3'" 1 
ATOM   8343  O  "O3'" . DT  I 5  111 ? -18.034 -23.679 9.064  1.00 129.31 ? 38   DT  I "O3'" 1 
ATOM   8344  C  "C2'" . DT  I 5  111 ? -18.936 -25.852 8.354  1.00 133.70 ? 38   DT  I "C2'" 1 
ATOM   8345  C  "C1'" . DT  I 5  111 ? -17.768 -26.448 7.586  1.00 133.16 ? 38   DT  I "C1'" 1 
ATOM   8346  N  N1    . DT  I 5  111 ? -18.064 -27.732 6.905  1.00 134.36 ? 38   DT  I N1    1 
ATOM   8347  C  C2    . DT  I 5  111 ? -17.858 -27.812 5.543  1.00 133.40 ? 38   DT  I C2    1 
ATOM   8348  O  O2    . DT  I 5  111 ? -17.425 -26.886 4.877  1.00 128.99 ? 38   DT  I O2    1 
ATOM   8349  N  N3    . DT  I 5  111 ? -18.169 -29.030 4.989  1.00 125.56 ? 38   DT  I N3    1 
ATOM   8350  C  C4    . DT  I 5  111 ? -18.658 -30.147 5.643  1.00 132.21 ? 38   DT  I C4    1 
ATOM   8351  O  O4    . DT  I 5  111 ? -18.886 -31.175 5.012  1.00 135.75 ? 38   DT  I O4    1 
ATOM   8352  C  C5    . DT  I 5  111 ? -18.859 -29.988 7.068  1.00 133.18 ? 38   DT  I C5    1 
ATOM   8353  C  C7    . DT  I 5  111 ? -19.388 -31.142 7.860  1.00 129.08 ? 38   DT  I C7    1 
ATOM   8354  C  C6    . DT  I 5  111 ? -18.559 -28.804 7.618  1.00 128.63 ? 38   DT  I C6    1 
ATOM   8355  P  P     . DA  I 5  112 ? -19.229 -22.603 9.003  1.00 128.84 ? 39   DA  I P     1 
ATOM   8356  O  OP1   . DA  I 5  112 ? -18.688 -21.246 9.264  1.00 125.74 ? 39   DA  I OP1   1 
ATOM   8357  O  OP2   . DA  I 5  112 ? -20.387 -23.101 9.789  1.00 119.11 ? 39   DA  I OP2   1 
ATOM   8358  O  "O5'" . DA  I 5  112 ? -19.643 -22.625 7.466  1.00 148.74 ? 39   DA  I "O5'" 1 
ATOM   8359  C  "C5'" . DA  I 5  112 ? -18.653 -22.662 6.413  1.00 151.92 ? 39   DA  I "C5'" 1 
ATOM   8360  C  "C4'" . DA  I 5  112 ? -19.323 -22.868 5.071  1.00 149.32 ? 39   DA  I "C4'" 1 
ATOM   8361  O  "O4'" . DA  I 5  112 ? -19.375 -24.287 4.756  1.00 142.12 ? 39   DA  I "O4'" 1 
ATOM   8362  C  "C3'" . DA  I 5  112 ? -20.762 -22.348 4.962  1.00 152.56 ? 39   DA  I "C3'" 1 
ATOM   8363  O  "O3'" . DA  I 5  112 ? -20.927 -21.510 3.821  1.00 159.38 ? 39   DA  I "O3'" 1 
ATOM   8364  C  "C2'" . DA  I 5  112 ? -21.600 -23.621 4.852  1.00 149.88 ? 39   DA  I "C2'" 1 
ATOM   8365  C  "C1'" . DA  I 5  112 ? -20.623 -24.574 4.172  1.00 144.11 ? 39   DA  I "C1'" 1 
ATOM   8366  N  N9    . DA  I 5  112 ? -20.942 -25.985 4.388  1.00 147.16 ? 39   DA  I N9    1 
ATOM   8367  C  C8    . DA  I 5  112 ? -21.101 -26.663 5.572  1.00 149.39 ? 39   DA  I C8    1 
ATOM   8368  N  N7    . DA  I 5  112 ? -21.425 -27.925 5.419  1.00 152.06 ? 39   DA  I N7    1 
ATOM   8369  C  C5    . DA  I 5  112 ? -21.498 -28.085 4.042  1.00 159.26 ? 39   DA  I C5    1 
ATOM   8370  C  C6    . DA  I 5  112 ? -21.802 -29.194 3.231  1.00 165.37 ? 39   DA  I C6    1 
ATOM   8371  N  N6    . DA  I 5  112 ? -22.098 -30.404 3.711  1.00 162.02 ? 39   DA  I N6    1 
ATOM   8372  N  N1    . DA  I 5  112 ? -21.791 -29.015 1.891  1.00 165.48 ? 39   DA  I N1    1 
ATOM   8373  C  C2    . DA  I 5  112 ? -21.495 -27.800 1.409  1.00 165.94 ? 39   DA  I C2    1 
ATOM   8374  N  N3    . DA  I 5  112 ? -21.190 -26.683 2.068  1.00 161.95 ? 39   DA  I N3    1 
ATOM   8375  C  C4    . DA  I 5  112 ? -21.212 -26.895 3.395  1.00 156.30 ? 39   DA  I C4    1 
ATOM   8376  P  P     . DC  I 5  113 ? -22.203 -20.551 3.633  1.00 151.17 ? 40   DC  I P     1 
ATOM   8377  O  OP1   . DC  I 5  113 ? -21.789 -19.190 4.061  1.00 145.85 ? 40   DC  I OP1   1 
ATOM   8378  O  OP2   . DC  I 5  113 ? -23.406 -21.179 4.247  1.00 145.83 ? 40   DC  I OP2   1 
ATOM   8379  O  "O5'" . DC  I 5  113 ? -22.385 -20.536 2.048  1.00 151.08 ? 40   DC  I "O5'" 1 
ATOM   8380  C  "C5'" . DC  I 5  113 ? -21.879 -21.608 1.224  1.00 142.40 ? 40   DC  I "C5'" 1 
ATOM   8381  C  "C4'" . DC  I 5  113 ? -23.013 -22.386 0.592  1.00 145.53 ? 40   DC  I "C4'" 1 
ATOM   8382  O  "O4'" . DC  I 5  113 ? -23.113 -23.697 1.196  1.00 150.05 ? 40   DC  I "O4'" 1 
ATOM   8383  C  "C3'" . DC  I 5  113 ? -24.414 -21.775 0.689  1.00 153.00 ? 40   DC  I "C3'" 1 
ATOM   8384  O  "O3'" . DC  I 5  113 ? -24.845 -21.415 -0.621 1.00 155.47 ? 40   DC  I "O3'" 1 
ATOM   8385  C  "C2'" . DC  I 5  113 ? -25.272 -22.875 1.336  1.00 151.45 ? 40   DC  I "C2'" 1 
ATOM   8386  C  "C1'" . DC  I 5  113 ? -24.444 -24.132 1.073  1.00 159.50 ? 40   DC  I "C1'" 1 
ATOM   8387  N  N1    . DC  I 5  113 ? -24.670 -25.251 2.012  1.00 163.76 ? 40   DC  I N1    1 
ATOM   8388  C  C2    . DC  I 5  113 ? -24.892 -26.536 1.493  1.00 165.47 ? 40   DC  I C2    1 
ATOM   8389  O  O2    . DC  I 5  113 ? -24.896 -26.695 0.263  1.00 159.43 ? 40   DC  I O2    1 
ATOM   8390  N  N3    . DC  I 5  113 ? -25.099 -27.566 2.346  1.00 165.22 ? 40   DC  I N3    1 
ATOM   8391  C  C4    . DC  I 5  113 ? -25.093 -27.353 3.664  1.00 163.44 ? 40   DC  I C4    1 
ATOM   8392  N  N4    . DC  I 5  113 ? -25.299 -28.399 4.467  1.00 164.84 ? 40   DC  I N4    1 
ATOM   8393  C  C5    . DC  I 5  113 ? -24.871 -26.056 4.218  1.00 158.58 ? 40   DC  I C5    1 
ATOM   8394  C  C6    . DC  I 5  113 ? -24.665 -25.044 3.364  1.00 155.41 ? 40   DC  I C6    1 
ATOM   8395  P  P     . DA  I 5  114 ? -26.231 -20.658 -0.911 1.00 158.84 ? 41   DA  I P     1 
ATOM   8396  O  OP1   . DA  I 5  114 ? -26.026 -19.716 -2.041 1.00 157.11 ? 41   DA  I OP1   1 
ATOM   8397  O  OP2   . DA  I 5  114 ? -26.800 -20.149 0.362  1.00 155.85 ? 41   DA  I OP2   1 
ATOM   8398  O  "O5'" . DA  I 5  114 ? -27.119 -21.876 -1.425 1.00 152.00 ? 41   DA  I "O5'" 1 
ATOM   8399  C  "C5'" . DA  I 5  114 ? -26.588 -22.822 -2.375 1.00 152.52 ? 41   DA  I "C5'" 1 
ATOM   8400  C  "C4'" . DA  I 5  114 ? -27.490 -24.030 -2.484 1.00 161.20 ? 41   DA  I "C4'" 1 
ATOM   8401  O  "O4'" . DA  I 5  114 ? -27.234 -24.936 -1.372 1.00 170.59 ? 41   DA  I "O4'" 1 
ATOM   8402  C  "C3'" . DA  I 5  114 ? -29.001 -23.757 -2.459 1.00 165.99 ? 41   DA  I "C3'" 1 
ATOM   8403  O  "O3'" . DA  I 5  114 ? -29.664 -24.586 -3.413 1.00 169.41 ? 41   DA  I "O3'" 1 
ATOM   8404  C  "C2'" . DA  I 5  114 ? -29.399 -24.212 -1.059 1.00 170.02 ? 41   DA  I "C2'" 1 
ATOM   8405  C  "C1'" . DA  I 5  114 ? -28.472 -25.407 -0.889 1.00 173.97 ? 41   DA  I "C1'" 1 
ATOM   8406  N  N9    . DA  I 5  114 ? -28.319 -25.892 0.483  1.00 173.02 ? 41   DA  I N9    1 
ATOM   8407  C  C8    . DA  I 5  114 ? -28.057 -25.187 1.633  1.00 172.83 ? 41   DA  I C8    1 
ATOM   8408  N  N7    . DA  I 5  114 ? -28.012 -25.932 2.711  1.00 171.48 ? 41   DA  I N7    1 
ATOM   8409  C  C5    . DA  I 5  114 ? -28.280 -27.211 2.243  1.00 172.25 ? 41   DA  I C5    1 
ATOM   8410  C  C6    . DA  I 5  114 ? -28.374 -28.456 2.890  1.00 170.42 ? 41   DA  I C6    1 
ATOM   8411  N  N6    . DA  I 5  114 ? -28.209 -28.620 4.204  1.00 162.77 ? 41   DA  I N6    1 
ATOM   8412  N  N1    . DA  I 5  114 ? -28.652 -29.540 2.132  1.00 167.17 ? 41   DA  I N1    1 
ATOM   8413  C  C2    . DA  I 5  114 ? -28.824 -29.373 0.814  1.00 162.71 ? 41   DA  I C2    1 
ATOM   8414  N  N3    . DA  I 5  114 ? -28.754 -28.258 0.090  1.00 166.40 ? 41   DA  I N3    1 
ATOM   8415  C  C4    . DA  I 5  114 ? -28.475 -27.200 0.874  1.00 170.26 ? 41   DA  I C4    1 
ATOM   8416  P  P     . DC  I 5  115 ? -31.268 -24.677 -3.546 1.00 167.62 ? 42   DC  I P     1 
ATOM   8417  O  OP1   . DC  I 5  115 ? -31.651 -23.595 -4.486 1.00 169.04 ? 42   DC  I OP1   1 
ATOM   8418  O  OP2   . DC  I 5  115 ? -31.938 -24.749 -2.221 1.00 160.48 ? 42   DC  I OP2   1 
ATOM   8419  O  "O5'" . DC  I 5  115 ? -31.524 -26.078 -4.266 1.00 182.09 ? 42   DC  I "O5'" 1 
ATOM   8420  C  "C5'" . DC  I 5  115 ? -30.678 -27.224 -4.026 1.00 186.56 ? 42   DC  I "C5'" 1 
ATOM   8421  C  "C4'" . DC  I 5  115 ? -31.403 -28.290 -3.226 1.00 187.99 ? 42   DC  I "C4'" 1 
ATOM   8422  O  "O4'" . DC  I 5  115 ? -31.053 -28.167 -1.827 1.00 188.70 ? 42   DC  I "O4'" 1 
ATOM   8423  C  "C3'" . DC  I 5  115 ? -32.936 -28.292 -3.289 1.00 182.64 ? 42   DC  I "C3'" 1 
ATOM   8424  O  "O3'" . DC  I 5  115 ? -33.420 -29.400 -4.060 1.00 172.00 ? 42   DC  I "O3'" 1 
ATOM   8425  C  "C2'" . DC  I 5  115 ? -33.387 -28.252 -1.819 1.00 190.66 ? 42   DC  I "C2'" 1 
ATOM   8426  C  "C1'" . DC  I 5  115 ? -32.122 -28.653 -1.055 1.00 188.07 ? 42   DC  I "C1'" 1 
ATOM   8427  N  N1    . DC  I 5  115 ? -32.042 -28.062 0.296  1.00 178.20 ? 42   DC  I N1    1 
ATOM   8428  C  C2    . DC  I 5  115 ? -32.287 -28.878 1.408  1.00 172.00 ? 42   DC  I C2    1 
ATOM   8429  O  O2    . DC  I 5  115 ? -32.544 -30.078 1.227  1.00 165.22 ? 42   DC  I O2    1 
ATOM   8430  N  N3    . DC  I 5  115 ? -32.232 -28.338 2.649  1.00 167.31 ? 42   DC  I N3    1 
ATOM   8431  C  C4    . DC  I 5  115 ? -31.952 -27.041 2.800  1.00 157.51 ? 42   DC  I C4    1 
ATOM   8432  N  N4    . DC  I 5  115 ? -31.909 -26.551 4.040  1.00 154.00 ? 42   DC  I N4    1 
ATOM   8433  C  C5    . DC  I 5  115 ? -31.704 -26.188 1.686  1.00 156.95 ? 42   DC  I C5    1 
ATOM   8434  C  C6    . DC  I 5  115 ? -31.765 -26.733 0.464  1.00 169.83 ? 42   DC  I C6    1 
ATOM   8435  P  P     . DT  I 5  116 ? -34.660 -30.403 -3.775 1.00 169.51 ? 43   DT  I P     1 
ATOM   8436  O  OP1   . DT  I 5  116 ? -34.862 -31.160 -5.039 1.00 170.18 ? 43   DT  I OP1   1 
ATOM   8437  O  OP2   . DT  I 5  116 ? -35.813 -29.687 -3.164 1.00 157.12 ? 43   DT  I OP2   1 
ATOM   8438  O  "O5'" . DT  I 5  116 ? -34.055 -31.402 -2.688 1.00 168.24 ? 43   DT  I "O5'" 1 
ATOM   8439  C  "C5'" . DT  I 5  116 ? -34.469 -32.780 -2.608 1.00 158.87 ? 43   DT  I "C5'" 1 
ATOM   8440  C  "C4'" . DT  I 5  116 ? -35.352 -32.995 -1.401 1.00 154.47 ? 43   DT  I "C4'" 1 
ATOM   8441  O  "O4'" . DT  I 5  116 ? -34.986 -32.087 -0.337 1.00 160.49 ? 43   DT  I "O4'" 1 
ATOM   8442  C  "C3'" . DT  I 5  116 ? -36.845 -32.765 -1.660 1.00 149.15 ? 43   DT  I "C3'" 1 
ATOM   8443  O  "O3'" . DT  I 5  116 ? -37.531 -34.025 -1.718 1.00 153.39 ? 43   DT  I "O3'" 1 
ATOM   8444  C  "C2'" . DT  I 5  116 ? -37.295 -31.839 -0.536 1.00 152.42 ? 43   DT  I "C2'" 1 
ATOM   8445  C  "C1'" . DT  I 5  116 ? -36.140 -31.878 0.453  1.00 163.88 ? 43   DT  I "C1'" 1 
ATOM   8446  N  N1    . DT  I 5  116 ? -35.947 -30.641 1.248  1.00 160.01 ? 43   DT  I N1    1 
ATOM   8447  C  C2    . DT  I 5  116 ? -35.710 -30.756 2.602  1.00 145.19 ? 43   DT  I C2    1 
ATOM   8448  O  O2    . DT  I 5  116 ? -35.627 -31.828 3.178  1.00 128.10 ? 43   DT  I O2    1 
ATOM   8449  N  N3    . DT  I 5  116 ? -35.567 -29.559 3.260  1.00 146.08 ? 43   DT  I N3    1 
ATOM   8450  C  C4    . DT  I 5  116 ? -35.638 -28.291 2.715  1.00 152.43 ? 43   DT  I C4    1 
ATOM   8451  O  O4    . DT  I 5  116 ? -35.480 -27.307 3.434  1.00 155.12 ? 43   DT  I O4    1 
ATOM   8452  C  C5    . DT  I 5  116 ? -35.901 -28.244 1.293  1.00 153.49 ? 43   DT  I C5    1 
ATOM   8453  C  C7    . DT  I 5  116 ? -35.996 -26.914 0.615  1.00 146.79 ? 43   DT  I C7    1 
ATOM   8454  C  C6    . DT  I 5  116 ? -36.042 -29.406 0.641  1.00 158.45 ? 43   DT  I C6    1 
ATOM   8455  P  P     . DT  I 5  117 ? -38.313 -34.791 -0.538 1.00 152.22 ? 44   DT  I P     1 
ATOM   8456  O  OP1   . DT  I 5  117 ? -38.518 -36.193 -0.982 1.00 154.69 ? 44   DT  I OP1   1 
ATOM   8457  O  OP2   . DT  I 5  117 ? -39.490 -33.976 -0.138 1.00 144.73 ? 44   DT  I OP2   1 
ATOM   8458  O  "O5'" . DT  I 5  117 ? -37.259 -34.820 0.658  1.00 165.82 ? 44   DT  I "O5'" 1 
ATOM   8459  C  "C5'" . DT  I 5  117 ? -37.003 -36.025 1.406  1.00 156.39 ? 44   DT  I "C5'" 1 
ATOM   8460  C  "C4'" . DT  I 5  117 ? -37.350 -35.833 2.865  1.00 144.62 ? 44   DT  I "C4'" 1 
ATOM   8461  O  "O4'" . DT  I 5  117 ? -37.287 -34.436 3.241  1.00 145.34 ? 44   DT  I "O4'" 1 
ATOM   8462  C  "C3'" . DT  I 5  117 ? -38.742 -36.323 3.283  1.00 140.37 ? 44   DT  I "C3'" 1 
ATOM   8463  O  "O3'" . DT  I 5  117 ? -38.549 -37.201 4.394  1.00 139.18 ? 44   DT  I "O3'" 1 
ATOM   8464  C  "C2'" . DT  I 5  117 ? -39.470 -35.056 3.704  1.00 139.02 ? 44   DT  I "C2'" 1 
ATOM   8465  C  "C1'" . DT  I 5  117 ? -38.314 -34.209 4.189  1.00 151.39 ? 44   DT  I "C1'" 1 
ATOM   8466  N  N1    . DT  I 5  117 ? -38.533 -32.748 4.298  1.00 154.62 ? 44   DT  I N1    1 
ATOM   8467  C  C2    . DT  I 5  117 ? -38.438 -32.182 5.551  1.00 153.71 ? 44   DT  I C2    1 
ATOM   8468  O  O2    . DT  I 5  117 ? -38.207 -32.828 6.561  1.00 150.03 ? 44   DT  I O2    1 
ATOM   8469  N  N3    . DT  I 5  117 ? -38.631 -30.822 5.580  1.00 148.84 ? 44   DT  I N3    1 
ATOM   8470  C  C4    . DT  I 5  117 ? -38.896 -29.993 4.507  1.00 150.91 ? 44   DT  I C4    1 
ATOM   8471  O  O4    . DT  I 5  117 ? -39.045 -28.788 4.688  1.00 145.97 ? 44   DT  I O4    1 
ATOM   8472  C  C5    . DT  I 5  117 ? -38.977 -30.653 3.222  1.00 157.77 ? 44   DT  I C5    1 
ATOM   8473  C  C7    . DT  I 5  117 ? -39.262 -29.835 2.002  1.00 153.38 ? 44   DT  I C7    1 
ATOM   8474  C  C6    . DT  I 5  117 ? -38.793 -31.980 3.183  1.00 154.26 ? 44   DT  I C6    1 
ATOM   8475  P  P     . DT  I 5  118 ? -39.740 -37.937 5.153  1.00 144.91 ? 45   DT  I P     1 
ATOM   8476  O  OP1   . DT  I 5  118 ? -39.316 -39.343 5.405  1.00 143.08 ? 45   DT  I OP1   1 
ATOM   8477  O  OP2   . DT  I 5  118 ? -41.018 -37.653 4.449  1.00 137.18 ? 45   DT  I OP2   1 
ATOM   8478  O  "O5'" . DT  I 5  118 ? -39.803 -37.160 6.542  1.00 152.68 ? 45   DT  I "O5'" 1 
ATOM   8479  C  "C5'" . DT  I 5  118 ? -38.963 -37.500 7.666  1.00 143.00 ? 45   DT  I "C5'" 1 
ATOM   8480  C  "C4'" . DT  I 5  118 ? -39.428 -36.716 8.869  1.00 132.04 ? 45   DT  I "C4'" 1 
ATOM   8481  O  "O4'" . DT  I 5  118 ? -39.372 -35.312 8.536  1.00 133.93 ? 45   DT  I "O4'" 1 
ATOM   8482  C  "C3'" . DT  I 5  118 ? -40.887 -36.988 9.235  1.00 141.36 ? 45   DT  I "C3'" 1 
ATOM   8483  O  "O3'" . DT  I 5  118 ? -41.044 -37.930 10.301 1.00 138.28 ? 45   DT  I "O3'" 1 
ATOM   8484  C  "C2'" . DT  I 5  118 ? -41.440 -35.630 9.640  1.00 141.55 ? 45   DT  I "C2'" 1 
ATOM   8485  C  "C1'" . DT  I 5  118 ? -40.367 -34.613 9.269  1.00 145.32 ? 45   DT  I "C1'" 1 
ATOM   8486  N  N1    . DT  I 5  118 ? -40.872 -33.504 8.428  1.00 153.15 ? 45   DT  I N1    1 
ATOM   8487  C  C2    . DT  I 5  118 ? -40.949 -32.243 8.979  1.00 155.60 ? 45   DT  I C2    1 
ATOM   8488  O  O2    . DT  I 5  118 ? -40.589 -31.987 10.116 1.00 151.20 ? 45   DT  I O2    1 
ATOM   8489  N  N3    . DT  I 5  118 ? -41.452 -31.281 8.138  1.00 157.38 ? 45   DT  I N3    1 
ATOM   8490  C  C4    . DT  I 5  118 ? -41.883 -31.451 6.835  1.00 159.85 ? 45   DT  I C4    1 
ATOM   8491  O  O4    . DT  I 5  118 ? -42.307 -30.489 6.200  1.00 142.21 ? 45   DT  I O4    1 
ATOM   8492  C  C5    . DT  I 5  118 ? -41.786 -32.803 6.326  1.00 161.74 ? 45   DT  I C5    1 
ATOM   8493  C  C7    . DT  I 5  118 ? -42.230 -33.085 4.925  1.00 158.54 ? 45   DT  I C7    1 
ATOM   8494  C  C6    . DT  I 5  118 ? -41.299 -33.749 7.140  1.00 159.83 ? 45   DT  I C6    1 
ATOM   8495  P  P     . DT  I 5  119 ? -40.185 -37.914 11.640 1.00 132.86 ? 46   DT  I P     1 
ATOM   8496  O  OP1   . DT  I 5  119 ? -38.876 -38.533 11.279 1.00 123.52 ? 46   DT  I OP1   1 
ATOM   8497  O  OP2   . DT  I 5  119 ? -41.031 -38.483 12.727 1.00 123.62 ? 46   DT  I OP2   1 
ATOM   8498  O  "O5'" . DT  I 5  119 ? -39.951 -36.379 11.988 1.00 131.77 ? 46   DT  I "O5'" 1 
ATOM   8499  C  "C5'" . DT  I 5  119 ? -38.709 -35.926 12.554 1.00 126.75 ? 46   DT  I "C5'" 1 
ATOM   8500  C  "C4'" . DT  I 5  119 ? -38.963 -34.740 13.456 1.00 125.29 ? 46   DT  I "C4'" 1 
ATOM   8501  O  "O4'" . DT  I 5  119 ? -39.793 -33.763 12.780 1.00 124.90 ? 46   DT  I "O4'" 1 
ATOM   8502  C  "C3'" . DT  I 5  119 ? -39.669 -35.065 14.774 1.00 127.72 ? 46   DT  I "C3'" 1 
ATOM   8503  O  "O3'" . DT  I 5  119 ? -39.003 -34.321 15.794 1.00 127.21 ? 46   DT  I "O3'" 1 
ATOM   8504  C  "C2'" . DT  I 5  119 ? -41.092 -34.578 14.557 1.00 131.46 ? 46   DT  I "C2'" 1 
ATOM   8505  C  "C1'" . DT  I 5  119 ? -40.909 -33.414 13.592 1.00 139.20 ? 46   DT  I "C1'" 1 
ATOM   8506  N  N1    . DT  I 5  119 ? -42.058 -33.142 12.691 1.00 137.65 ? 46   DT  I N1    1 
ATOM   8507  C  C2    . DT  I 5  119 ? -42.319 -31.842 12.307 1.00 134.92 ? 46   DT  I C2    1 
ATOM   8508  O  O2    . DT  I 5  119 ? -41.659 -30.886 12.683 1.00 123.05 ? 46   DT  I O2    1 
ATOM   8509  N  N3    . DT  I 5  119 ? -43.383 -31.702 11.450 1.00 140.41 ? 46   DT  I N3    1 
ATOM   8510  C  C4    . DT  I 5  119 ? -44.198 -32.704 10.957 1.00 145.70 ? 46   DT  I C4    1 
ATOM   8511  O  O4    . DT  I 5  119 ? -45.123 -32.422 10.200 1.00 148.62 ? 46   DT  I O4    1 
ATOM   8512  C  C5    . DT  I 5  119 ? -43.872 -34.042 11.406 1.00 143.40 ? 46   DT  I C5    1 
ATOM   8513  C  C7    . DT  I 5  119 ? -44.701 -35.192 10.927 1.00 133.17 ? 46   DT  I C7    1 
ATOM   8514  C  C6    . DT  I 5  119 ? -42.832 -34.190 12.237 1.00 138.29 ? 46   DT  I C6    1 
ATOM   8515  P  P     . DG  I 5  120 ? -39.066 -34.704 17.332 1.00 118.68 ? 47   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 5  120 ? -37.673 -34.937 17.799 1.00 106.14 ? 47   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 5  120 ? -40.124 -35.731 17.552 1.00 122.69 ? 47   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 5  120 ? -39.579 -33.318 17.916 1.00 109.03 ? 47   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 5  120 ? -38.994 -32.073 17.494 1.00 104.85 ? 47   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 5  120 ? -40.002 -30.960 17.644 1.00 105.46 ? 47   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 5  120 ? -41.020 -31.098 16.617 1.00 114.53 ? 47   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 5  120 ? -40.738 -30.907 18.981 1.00 104.87 ? 47   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 5  120 ? -40.821 -29.552 19.376 1.00 100.88 ? 47   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 5  120 ? -42.121 -31.470 18.659 1.00 112.21 ? 47   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 5  120 ? -42.302 -31.035 17.206 1.00 121.54 ? 47   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 5  120 ? -43.204 -31.888 16.435 1.00 125.51 ? 47   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 5  120 ? -43.393 -33.242 16.575 1.00 131.68 ? 47   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 5  120 ? -44.261 -33.729 15.731 1.00 132.69 ? 47   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 5  120 ? -44.671 -32.629 14.988 1.00 131.92 ? 47   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 5  120 ? -45.607 -32.534 13.924 1.00 126.78 ? 47   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 5  120 ? -46.283 -33.433 13.408 1.00 121.29 ? 47   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 5  120 ? -45.715 -31.228 13.455 1.00 126.20 ? 47   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 5  120 ? -45.016 -30.151 13.945 1.00 131.87 ? 47   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 5  120 ? -45.261 -28.969 13.360 1.00 126.76 ? 47   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 5  120 ? -44.148 -30.226 14.940 1.00 134.37 ? 47   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 5  120 ? -44.026 -31.485 15.411 1.00 127.69 ? 47   DG  I C4    1 
ATOM   8537  P  P     . DG  I 5  121 ? -40.812 -29.195 20.915 1.00 94.94  ? 48   DG  I P     1 
ATOM   8538  O  OP1   . DG  I 5  121 ? -39.411 -28.753 21.160 1.00 92.53  ? 48   DG  I OP1   1 
ATOM   8539  O  OP2   . DG  I 5  121 ? -41.391 -30.320 21.694 1.00 91.75  ? 48   DG  I OP2   1 
ATOM   8540  O  "O5'" . DG  I 5  121 ? -41.808 -27.950 20.942 1.00 100.62 ? 48   DG  I "O5'" 1 
ATOM   8541  C  "C5'" . DG  I 5  121 ? -41.503 -26.744 20.197 1.00 118.38 ? 48   DG  I "C5'" 1 
ATOM   8542  C  "C4'" . DG  I 5  121 ? -42.757 -25.980 19.806 1.00 118.84 ? 48   DG  I "C4'" 1 
ATOM   8543  O  "O4'" . DG  I 5  121 ? -43.497 -26.722 18.796 1.00 117.60 ? 48   DG  I "O4'" 1 
ATOM   8544  C  "C3'" . DG  I 5  121 ? -43.758 -25.681 20.923 1.00 117.36 ? 48   DG  I "C3'" 1 
ATOM   8545  O  "O3'" . DG  I 5  121 ? -44.412 -24.446 20.673 1.00 116.17 ? 48   DG  I "O3'" 1 
ATOM   8546  C  "C2'" . DG  I 5  121 ? -44.798 -26.776 20.739 1.00 123.68 ? 48   DG  I "C2'" 1 
ATOM   8547  C  "C1'" . DG  I 5  121 ? -44.836 -26.864 19.218 1.00 128.21 ? 48   DG  I "C1'" 1 
ATOM   8548  N  N9    . DG  I 5  121 ? -45.367 -28.115 18.691 1.00 139.46 ? 48   DG  I N9    1 
ATOM   8549  C  C8    . DG  I 5  121 ? -45.230 -29.385 19.200 1.00 143.26 ? 48   DG  I C8    1 
ATOM   8550  N  N7    . DG  I 5  121 ? -45.848 -30.289 18.491 1.00 141.62 ? 48   DG  I N7    1 
ATOM   8551  C  C5    . DG  I 5  121 ? -46.437 -29.571 17.459 1.00 145.62 ? 48   DG  I C5    1 
ATOM   8552  C  C6    . DG  I 5  121 ? -47.236 -30.010 16.375 1.00 157.34 ? 48   DG  I C6    1 
ATOM   8553  O  O6    . DG  I 5  121 ? -47.596 -31.161 16.100 1.00 166.09 ? 48   DG  I O6    1 
ATOM   8554  N  N1    . DG  I 5  121 ? -47.619 -28.947 15.560 1.00 164.14 ? 48   DG  I N1    1 
ATOM   8555  C  C2    . DG  I 5  121 ? -47.277 -27.631 15.762 1.00 148.59 ? 48   DG  I C2    1 
ATOM   8556  N  N2    . DG  I 5  121 ? -47.745 -26.750 14.866 1.00 143.31 ? 48   DG  I N2    1 
ATOM   8557  N  N3    . DG  I 5  121 ? -46.537 -27.211 16.772 1.00 141.36 ? 48   DG  I N3    1 
ATOM   8558  C  C4    . DG  I 5  121 ? -46.151 -28.227 17.572 1.00 144.05 ? 48   DG  I C4    1 
ATOM   8559  P  P     . DT  I 5  122 ? -45.315 -23.798 21.824 1.00 124.13 ? 49   DT  I P     1 
ATOM   8560  O  OP1   . DT  I 5  122 ? -44.557 -22.630 22.347 1.00 134.46 ? 49   DT  I OP1   1 
ATOM   8561  O  OP2   . DT  I 5  122 ? -45.807 -24.840 22.762 1.00 124.66 ? 49   DT  I OP2   1 
ATOM   8562  O  "O5'" . DT  I 5  122 ? -46.624 -23.267 21.090 1.00 128.15 ? 49   DT  I "O5'" 1 
ATOM   8563  C  "C5'" . DT  I 5  122 ? -46.630 -22.966 19.682 1.00 131.28 ? 49   DT  I "C5'" 1 
ATOM   8564  C  "C4'" . DT  I 5  122 ? -48.034 -23.102 19.142 1.00 135.30 ? 49   DT  I "C4'" 1 
ATOM   8565  O  "O4'" . DT  I 5  122 ? -48.263 -24.468 18.716 1.00 141.21 ? 49   DT  I "O4'" 1 
ATOM   8566  C  "C3'" . DT  I 5  122 ? -49.144 -22.773 20.146 1.00 141.32 ? 49   DT  I "C3'" 1 
ATOM   8567  O  "O3'" . DT  I 5  122 ? -50.089 -21.906 19.509 1.00 154.73 ? 49   DT  I "O3'" 1 
ATOM   8568  C  "C2'" . DT  I 5  122 ? -49.742 -24.130 20.482 1.00 139.44 ? 49   DT  I "C2'" 1 
ATOM   8569  C  "C1'" . DT  I 5  122 ? -49.530 -24.889 19.186 1.00 143.75 ? 49   DT  I "C1'" 1 
ATOM   8570  N  N1    . DT  I 5  122 ? -49.524 -26.369 19.279 1.00 148.41 ? 49   DT  I N1    1 
ATOM   8571  C  C2    . DT  I 5  122 ? -49.755 -27.082 18.123 1.00 141.80 ? 49   DT  I C2    1 
ATOM   8572  O  O2    . DT  I 5  122 ? -49.942 -26.554 17.040 1.00 138.32 ? 49   DT  I O2    1 
ATOM   8573  N  N3    . DT  I 5  122 ? -49.754 -28.447 18.283 1.00 143.66 ? 49   DT  I N3    1 
ATOM   8574  C  C4    . DT  I 5  122 ? -49.556 -29.152 19.456 1.00 143.97 ? 49   DT  I C4    1 
ATOM   8575  O  O4    . DT  I 5  122 ? -49.586 -30.380 19.445 1.00 138.70 ? 49   DT  I O4    1 
ATOM   8576  C  C5    . DT  I 5  122 ? -49.332 -28.341 20.632 1.00 147.96 ? 49   DT  I C5    1 
ATOM   8577  C  C7    . DT  I 5  122 ? -49.111 -29.016 21.949 1.00 144.69 ? 49   DT  I C7    1 
ATOM   8578  C  C6    . DT  I 5  122 ? -49.328 -27.008 20.486 1.00 149.96 ? 49   DT  I C6    1 
ATOM   8579  P  P     . DA  I 5  123 ? -51.074 -20.868 20.242 1.00 157.22 ? 50   DA  I P     1 
ATOM   8580  O  OP1   . DA  I 5  123 ? -50.379 -19.563 20.424 1.00 149.82 ? 50   DA  I OP1   1 
ATOM   8581  O  OP2   . DA  I 5  123 ? -51.721 -21.527 21.409 1.00 152.91 ? 50   DA  I OP2   1 
ATOM   8582  O  "O5'" . DA  I 5  123 ? -52.177 -20.695 19.103 1.00 165.02 ? 50   DA  I "O5'" 1 
ATOM   8583  C  "C5'" . DA  I 5  123 ? -52.157 -21.523 17.918 1.00 162.90 ? 50   DA  I "C5'" 1 
ATOM   8584  C  "C4'" . DA  I 5  123 ? -53.347 -22.457 17.893 1.00 157.76 ? 50   DA  I "C4'" 1 
ATOM   8585  O  "O4'" . DA  I 5  123 ? -52.936 -23.813 18.233 1.00 155.24 ? 50   DA  I "O4'" 1 
ATOM   8586  C  "C3'" . DA  I 5  123 ? -54.502 -22.121 18.845 1.00 161.57 ? 50   DA  I "C3'" 1 
ATOM   8587  O  "O3'" . DA  I 5  123 ? -55.715 -22.258 18.115 1.00 165.86 ? 50   DA  I "O3'" 1 
ATOM   8588  C  "C2'" . DA  I 5  123 ? -54.415 -23.226 19.894 1.00 160.92 ? 50   DA  I "C2'" 1 
ATOM   8589  C  "C1'" . DA  I 5  123 ? -53.948 -24.387 19.027 1.00 164.16 ? 50   DA  I "C1'" 1 
ATOM   8590  N  N9    . DA  I 5  123 ? -53.430 -25.560 19.734 1.00 174.63 ? 50   DA  I N9    1 
ATOM   8591  C  C8    . DA  I 5  123 ? -52.857 -25.653 20.979 1.00 176.04 ? 50   DA  I C8    1 
ATOM   8592  N  N7    . DA  I 5  123 ? -52.545 -26.878 21.328 1.00 177.50 ? 50   DA  I N7    1 
ATOM   8593  C  C5    . DA  I 5  123 ? -52.957 -27.647 20.247 1.00 181.40 ? 50   DA  I C5    1 
ATOM   8594  C  C6    . DA  I 5  123 ? -52.911 -29.031 19.994 1.00 177.83 ? 50   DA  I C6    1 
ATOM   8595  N  N6    . DA  I 5  123 ? -52.400 -29.923 20.846 1.00 168.26 ? 50   DA  I N6    1 
ATOM   8596  N  N1    . DA  I 5  123 ? -53.415 -29.473 18.820 1.00 169.31 ? 50   DA  I N1    1 
ATOM   8597  C  C2    . DA  I 5  123 ? -53.927 -28.577 17.965 1.00 167.56 ? 50   DA  I C2    1 
ATOM   8598  N  N3    . DA  I 5  123 ? -54.028 -27.255 18.089 1.00 171.44 ? 50   DA  I N3    1 
ATOM   8599  C  C4    . DA  I 5  123 ? -53.518 -26.848 19.265 1.00 178.81 ? 50   DA  I C4    1 
ATOM   8600  P  P     . DG  I 5  124 ? -57.122 -21.722 18.652 1.00 161.75 ? 51   DG  I P     1 
ATOM   8601  O  OP1   . DG  I 5  124 ? -57.012 -20.251 18.823 1.00 161.75 ? 51   DG  I OP1   1 
ATOM   8602  O  OP2   . DG  I 5  124 ? -57.558 -22.562 19.799 1.00 165.53 ? 51   DG  I OP2   1 
ATOM   8603  O  "O5'" . DG  I 5  124 ? -58.073 -22.017 17.407 1.00 172.73 ? 51   DG  I "O5'" 1 
ATOM   8604  C  "C5'" . DG  I 5  124 ? -57.808 -23.103 16.491 1.00 178.29 ? 51   DG  I "C5'" 1 
ATOM   8605  C  "C4'" . DG  I 5  124 ? -58.481 -24.369 16.967 1.00 185.56 ? 51   DG  I "C4'" 1 
ATOM   8606  O  "O4'" . DG  I 5  124 ? -57.515 -25.184 17.658 1.00 179.35 ? 51   DG  I "O4'" 1 
ATOM   8607  C  "C3'" . DG  I 5  124 ? -59.605 -24.168 17.979 1.00 198.27 ? 51   DG  I "C3'" 1 
ATOM   8608  O  "O3'" . DG  I 5  124 ? -60.881 -24.085 17.344 1.00 209.07 ? 51   DG  I "O3'" 1 
ATOM   8609  C  "C2'" . DG  I 5  124 ? -59.507 -25.376 18.923 1.00 197.17 ? 51   DG  I "C2'" 1 
ATOM   8610  C  "C1'" . DG  I 5  124 ? -58.203 -26.065 18.508 1.00 189.63 ? 51   DG  I "C1'" 1 
ATOM   8611  N  N9    . DG  I 5  124 ? -57.345 -26.377 19.647 1.00 204.04 ? 51   DG  I N9    1 
ATOM   8612  C  C8    . DG  I 5  124 ? -56.819 -25.488 20.554 1.00 209.20 ? 51   DG  I C8    1 
ATOM   8613  N  N7    . DG  I 5  124 ? -56.095 -26.063 21.475 1.00 212.10 ? 51   DG  I N7    1 
ATOM   8614  C  C5    . DG  I 5  124 ? -56.157 -27.416 21.167 1.00 207.73 ? 51   DG  I C5    1 
ATOM   8615  C  C6    . DG  I 5  124 ? -55.573 -28.537 21.817 1.00 199.49 ? 51   DG  I C6    1 
ATOM   8616  O  O6    . DG  I 5  124 ? -54.853 -28.557 22.824 1.00 185.21 ? 51   DG  I O6    1 
ATOM   8617  N  N1    . DG  I 5  124 ? -55.895 -29.727 21.171 1.00 199.68 ? 51   DG  I N1    1 
ATOM   8618  C  C2    . DG  I 5  124 ? -56.679 -29.829 20.048 1.00 205.25 ? 51   DG  I C2    1 
ATOM   8619  N  N2    . DG  I 5  124 ? -56.877 -31.069 19.576 1.00 199.47 ? 51   DG  I N2    1 
ATOM   8620  N  N3    . DG  I 5  124 ? -57.231 -28.794 19.434 1.00 207.32 ? 51   DG  I N3    1 
ATOM   8621  C  C4    . DG  I 5  124 ? -56.931 -27.627 20.044 1.00 207.84 ? 51   DG  I C4    1 
ATOM   8622  P  P     . DT  I 5  125 ? -62.221 -23.627 18.118 1.00 204.13 ? 52   DT  I P     1 
ATOM   8623  O  OP1   . DT  I 5  125 ? -63.016 -22.802 17.171 1.00 207.64 ? 52   DT  I OP1   1 
ATOM   8624  O  OP2   . DT  I 5  125 ? -61.882 -23.071 19.459 1.00 182.43 ? 52   DT  I OP2   1 
ATOM   8625  O  "O5'" . DT  I 5  125 ? -63.012 -24.994 18.335 1.00 203.12 ? 52   DT  I "O5'" 1 
ATOM   8626  C  "C5'" . DT  I 5  125 ? -62.657 -26.202 17.625 1.00 191.49 ? 52   DT  I "C5'" 1 
ATOM   8627  C  "C4'" . DT  I 5  125 ? -62.758 -27.398 18.545 1.00 188.89 ? 52   DT  I "C4'" 1 
ATOM   8628  O  "O4'" . DT  I 5  125 ? -61.480 -27.666 19.160 1.00 179.01 ? 52   DT  I "O4'" 1 
ATOM   8629  C  "C3'" . DT  I 5  125 ? -63.744 -27.232 19.705 1.00 193.26 ? 52   DT  I "C3'" 1 
ATOM   8630  O  "O3'" . DT  I 5  125 ? -64.971 -27.914 19.416 1.00 206.37 ? 52   DT  I "O3'" 1 
ATOM   8631  C  "C2'" . DT  I 5  125 ? -63.033 -27.856 20.898 1.00 188.06 ? 52   DT  I "C2'" 1 
ATOM   8632  C  "C1'" . DT  I 5  125 ? -61.729 -28.401 20.340 1.00 186.56 ? 52   DT  I "C1'" 1 
ATOM   8633  N  N1    . DT  I 5  125 ? -60.593 -28.204 21.259 1.00 202.56 ? 52   DT  I N1    1 
ATOM   8634  C  C2    . DT  I 5  125 ? -59.796 -29.289 21.556 1.00 205.18 ? 52   DT  I C2    1 
ATOM   8635  O  O2    . DT  I 5  125 ? -59.958 -30.394 21.061 1.00 182.98 ? 52   DT  I O2    1 
ATOM   8636  N  N3    . DT  I 5  125 ? -58.787 -29.027 22.452 1.00 212.34 ? 52   DT  I N3    1 
ATOM   8637  C  C4    . DT  I 5  125 ? -58.518 -27.824 23.083 1.00 210.64 ? 52   DT  I C4    1 
ATOM   8638  O  O4    . DT  I 5  125 ? -57.575 -27.741 23.866 1.00 211.19 ? 52   DT  I O4    1 
ATOM   8639  C  C5    . DT  I 5  125 ? -59.403 -26.733 22.733 1.00 203.89 ? 52   DT  I C5    1 
ATOM   8640  C  C7    . DT  I 5  125 ? -59.187 -25.391 23.358 1.00 183.50 ? 52   DT  I C7    1 
ATOM   8641  C  C6    . DT  I 5  125 ? -60.391 -26.980 21.862 1.00 205.37 ? 52   DT  I C6    1 
ATOM   8642  P  P     . DA  I 5  126 ? -66.126 -28.180 20.507 1.00 205.35 ? 53   DA  I P     1 
ATOM   8643  O  OP1   . DA  I 5  126 ? -67.408 -28.317 19.768 1.00 211.92 ? 53   DA  I OP1   1 
ATOM   8644  O  OP2   . DA  I 5  126 ? -66.021 -27.176 21.598 1.00 201.60 ? 53   DA  I OP2   1 
ATOM   8645  O  "O5'" . DA  I 5  126 ? -65.765 -29.616 21.099 1.00 204.46 ? 53   DA  I "O5'" 1 
ATOM   8646  C  "C5'" . DA  I 5  126 ? -65.033 -30.589 20.322 1.00 200.65 ? 53   DA  I "C5'" 1 
ATOM   8647  C  "C4'" . DA  I 5  126 ? -64.371 -31.598 21.229 1.00 199.40 ? 53   DA  I "C4'" 1 
ATOM   8648  O  "O4'" . DA  I 5  126 ? -63.099 -31.095 21.701 1.00 202.15 ? 53   DA  I "O4'" 1 
ATOM   8649  C  "C3'" . DA  I 5  126 ? -65.159 -31.969 22.490 1.00 200.96 ? 53   DA  I "C3'" 1 
ATOM   8650  O  "O3'" . DA  I 5  126 ? -65.725 -33.267 22.328 1.00 204.29 ? 53   DA  I "O3'" 1 
ATOM   8651  C  "C2'" . DA  I 5  126 ? -64.151 -31.823 23.642 1.00 205.14 ? 53   DA  I "C2'" 1 
ATOM   8652  C  "C1'" . DA  I 5  126 ? -62.808 -31.739 22.914 1.00 208.59 ? 53   DA  I "C1'" 1 
ATOM   8653  N  N9    . DA  I 5  126 ? -61.800 -30.971 23.651 1.00 208.78 ? 53   DA  I N9    1 
ATOM   8654  C  C8    . DA  I 5  126 ? -61.893 -29.682 24.120 1.00 208.82 ? 53   DA  I C8    1 
ATOM   8655  N  N7    . DA  I 5  126 ? -60.840 -29.287 24.794 1.00 208.91 ? 53   DA  I N7    1 
ATOM   8656  C  C5    . DA  I 5  126 ? -60.004 -30.396 24.788 1.00 199.30 ? 53   DA  I C5    1 
ATOM   8657  C  C6    . DA  I 5  126 ? -58.724 -30.621 25.328 1.00 183.68 ? 53   DA  I C6    1 
ATOM   8658  N  N6    . DA  I 5  126 ? -58.038 -29.704 26.013 1.00 174.84 ? 53   DA  I N6    1 
ATOM   8659  N  N1    . DA  I 5  126 ? -58.167 -31.837 25.138 1.00 177.54 ? 53   DA  I N1    1 
ATOM   8660  C  C2    . DA  I 5  126 ? -58.854 -32.756 24.448 1.00 181.28 ? 53   DA  I C2    1 
ATOM   8661  N  N3    . DA  I 5  126 ? -60.059 -32.663 23.887 1.00 190.82 ? 53   DA  I N3    1 
ATOM   8662  C  C4    . DA  I 5  126 ? -60.585 -31.442 24.092 1.00 204.73 ? 53   DA  I C4    1 
ATOM   8663  P  P     . DT  I 5  127 ? -65.199 -34.615 23.024 1.00 204.37 ? 54   DT  I P     1 
ATOM   8664  O  OP1   . DT  I 5  127 ? -65.876 -35.739 22.324 1.00 204.20 ? 54   DT  I OP1   1 
ATOM   8665  O  OP2   . DT  I 5  127 ? -65.378 -34.459 24.494 1.00 204.33 ? 54   DT  I OP2   1 
ATOM   8666  O  "O5'" . DT  I 5  127 ? -63.639 -34.673 22.685 1.00 201.56 ? 54   DT  I "O5'" 1 
ATOM   8667  C  "C5'" . DT  I 5  127 ? -62.952 -35.920 22.432 1.00 191.00 ? 54   DT  I "C5'" 1 
ATOM   8668  C  "C4'" . DT  I 5  127 ? -62.257 -36.430 23.676 1.00 178.64 ? 54   DT  I "C4'" 1 
ATOM   8669  O  "O4'" . DT  I 5  127 ? -61.502 -35.375 24.318 1.00 178.94 ? 54   DT  I "O4'" 1 
ATOM   8670  C  "C3'" . DT  I 5  127 ? -63.180 -37.015 24.753 1.00 172.42 ? 54   DT  I "C3'" 1 
ATOM   8671  O  "O3'" . DT  I 5  127 ? -62.901 -38.408 24.940 1.00 158.73 ? 54   DT  I "O3'" 1 
ATOM   8672  C  "C2'" . DT  I 5  127 ? -62.859 -36.217 26.008 1.00 170.05 ? 54   DT  I "C2'" 1 
ATOM   8673  C  "C1'" . DT  I 5  127 ? -61.492 -35.637 25.708 1.00 174.01 ? 54   DT  I "C1'" 1 
ATOM   8674  N  N1    . DT  I 5  127 ? -61.176 -34.375 26.415 1.00 173.61 ? 54   DT  I N1    1 
ATOM   8675  C  C2    . DT  I 5  127 ? -59.949 -34.277 27.034 1.00 166.16 ? 54   DT  I C2    1 
ATOM   8676  O  O2    . DT  I 5  127 ? -59.115 -35.167 27.010 1.00 149.34 ? 54   DT  I O2    1 
ATOM   8677  N  N3    . DT  I 5  127 ? -59.727 -33.081 27.674 1.00 164.61 ? 54   DT  I N3    1 
ATOM   8678  C  C4    . DT  I 5  127 ? -60.592 -32.006 27.763 1.00 162.10 ? 54   DT  I C4    1 
ATOM   8679  O  O4    . DT  I 5  127 ? -60.251 -30.996 28.372 1.00 154.85 ? 54   DT  I O4    1 
ATOM   8680  C  C5    . DT  I 5  127 ? -61.865 -32.182 27.099 1.00 168.78 ? 54   DT  I C5    1 
ATOM   8681  C  C7    . DT  I 5  127 ? -62.868 -31.073 27.146 1.00 163.86 ? 54   DT  I C7    1 
ATOM   8682  C  C6    . DT  I 5  127 ? -62.090 -33.343 26.469 1.00 174.12 ? 54   DT  I C6    1 
ATOM   8683  P  P     . DC  I 5  128 ? -63.621 -39.290 26.074 1.00 151.40 ? 55   DC  I P     1 
ATOM   8684  O  OP1   . DC  I 5  128 ? -63.666 -40.699 25.604 1.00 141.41 ? 55   DC  I OP1   1 
ATOM   8685  O  OP2   . DC  I 5  128 ? -64.861 -38.631 26.565 1.00 147.05 ? 55   DC  I OP2   1 
ATOM   8686  O  "O5'" . DC  I 5  128 ? -62.554 -39.226 27.252 1.00 157.31 ? 55   DC  I "O5'" 1 
ATOM   8687  C  "C5'" . DC  I 5  128 ? -61.176 -39.565 27.007 1.00 150.42 ? 55   DC  I "C5'" 1 
ATOM   8688  C  "C4'" . DC  I 5  128 ? -60.356 -39.377 28.261 1.00 138.58 ? 55   DC  I "C4'" 1 
ATOM   8689  O  "O4'" . DC  I 5  128 ? -60.263 -37.962 28.576 1.00 136.44 ? 55   DC  I "O4'" 1 
ATOM   8690  C  "C3'" . DC  I 5  128 ? -60.882 -40.066 29.520 1.00 132.17 ? 55   DC  I "C3'" 1 
ATOM   8691  O  "O3'" . DC  I 5  128 ? -59.785 -40.733 30.121 1.00 123.29 ? 55   DC  I "O3'" 1 
ATOM   8692  C  "C2'" . DC  I 5  128 ? -61.386 -38.910 30.385 1.00 127.76 ? 55   DC  I "C2'" 1 
ATOM   8693  C  "C1'" . DC  I 5  128 ? -60.442 -37.789 29.964 1.00 134.68 ? 55   DC  I "C1'" 1 
ATOM   8694  N  N1    . DC  I 5  128 ? -60.929 -36.420 30.207 1.00 136.19 ? 55   DC  I N1    1 
ATOM   8695  C  C2    . DC  I 5  128 ? -60.361 -35.686 31.252 1.00 136.30 ? 55   DC  I C2    1 
ATOM   8696  O  O2    . DC  I 5  128 ? -59.495 -36.222 31.961 1.00 132.53 ? 55   DC  I O2    1 
ATOM   8697  N  N3    . DC  I 5  128 ? -60.778 -34.418 31.473 1.00 141.85 ? 55   DC  I N3    1 
ATOM   8698  C  C4    . DC  I 5  128 ? -61.717 -33.879 30.691 1.00 138.17 ? 55   DC  I C4    1 
ATOM   8699  N  N4    . DC  I 5  128 ? -62.103 -32.628 30.949 1.00 139.69 ? 55   DC  I N4    1 
ATOM   8700  C  C5    . DC  I 5  128 ? -62.309 -34.603 29.616 1.00 136.13 ? 55   DC  I C5    1 
ATOM   8701  C  C6    . DC  I 5  128 ? -61.885 -35.857 29.408 1.00 137.01 ? 55   DC  I C6    1 
ATOM   8702  P  P     . DT  I 5  129 ? -59.966 -42.029 31.031 1.00 133.38 ? 56   DT  I P     1 
ATOM   8703  O  OP1   . DT  I 5  129 ? -59.048 -43.082 30.511 1.00 126.12 ? 56   DT  I OP1   1 
ATOM   8704  O  OP2   . DT  I 5  129 ? -61.409 -42.328 31.210 1.00 126.35 ? 56   DT  I OP2   1 
ATOM   8705  O  "O5'" . DT  I 5  129 ? -59.419 -41.510 32.435 1.00 138.08 ? 56   DT  I "O5'" 1 
ATOM   8706  C  "C5'" . DT  I 5  129 ? -58.060 -41.042 32.580 1.00 126.25 ? 56   DT  I "C5'" 1 
ATOM   8707  C  "C4'" . DT  I 5  129 ? -57.890 -40.311 33.891 1.00 117.04 ? 56   DT  I "C4'" 1 
ATOM   8708  O  "O4'" . DT  I 5  129 ? -58.512 -39.004 33.826 1.00 118.91 ? 56   DT  I "O4'" 1 
ATOM   8709  C  "C3'" . DT  I 5  129 ? -58.503 -41.017 35.104 1.00 112.32 ? 56   DT  I "C3'" 1 
ATOM   8710  O  "O3'" . DT  I 5  129 ? -57.532 -41.025 36.150 1.00 110.30 ? 56   DT  I "O3'" 1 
ATOM   8711  C  "C2'" . DT  I 5  129 ? -59.701 -40.153 35.462 1.00 120.40 ? 56   DT  I "C2'" 1 
ATOM   8712  C  "C1'" . DT  I 5  129 ? -59.227 -38.782 35.029 1.00 118.89 ? 56   DT  I "C1'" 1 
ATOM   8713  N  N1    . DT  I 5  129 ? -60.273 -37.770 34.765 1.00 122.49 ? 56   DT  I N1    1 
ATOM   8714  C  C2    . DT  I 5  129 ? -60.096 -36.529 35.333 1.00 128.58 ? 56   DT  I C2    1 
ATOM   8715  O  O2    . DT  I 5  129 ? -59.138 -36.248 36.033 1.00 122.27 ? 56   DT  I O2    1 
ATOM   8716  N  N3    . DT  I 5  129 ? -61.089 -35.623 35.051 1.00 132.86 ? 56   DT  I N3    1 
ATOM   8717  C  C4    . DT  I 5  129 ? -62.215 -35.831 34.277 1.00 128.00 ? 56   DT  I C4    1 
ATOM   8718  O  O4    . DT  I 5  129 ? -63.018 -34.918 34.109 1.00 117.39 ? 56   DT  I O4    1 
ATOM   8719  C  C5    . DT  I 5  129 ? -62.339 -37.157 33.713 1.00 129.23 ? 56   DT  I C5    1 
ATOM   8720  C  C7    . DT  I 5  129 ? -63.527 -37.475 32.862 1.00 133.95 ? 56   DT  I C7    1 
ATOM   8721  C  C6    . DT  I 5  129 ? -61.372 -38.047 33.979 1.00 126.99 ? 56   DT  I C6    1 
ATOM   8722  P  P     . DG  I 5  130 ? -56.469 -42.214 36.318 1.00 115.68 ? 57   DG  I P     1 
ATOM   8723  O  OP1   . DG  I 5  130 ? -55.834 -42.556 35.010 1.00 107.76 ? 57   DG  I OP1   1 
ATOM   8724  O  OP2   . DG  I 5  130 ? -57.140 -43.269 37.123 1.00 113.93 ? 57   DG  I OP2   1 
ATOM   8725  O  "O5'" . DG  I 5  130 ? -55.357 -41.551 37.247 1.00 114.09 ? 57   DG  I "O5'" 1 
ATOM   8726  C  "C5'" . DG  I 5  130 ? -54.625 -40.386 36.818 1.00 106.29 ? 57   DG  I "C5'" 1 
ATOM   8727  C  "C4'" . DG  I 5  130 ? -54.309 -39.475 37.987 1.00 100.74 ? 57   DG  I "C4'" 1 
ATOM   8728  O  "O4'" . DG  I 5  130 ? -55.390 -38.531 38.192 1.00 99.18  ? 57   DG  I "O4'" 1 
ATOM   8729  C  "C3'" . DG  I 5  130 ? -54.051 -40.111 39.346 1.00 103.04 ? 57   DG  I "C3'" 1 
ATOM   8730  O  "O3'" . DG  I 5  130 ? -53.033 -39.324 39.967 1.00 103.46 ? 57   DG  I "O3'" 1 
ATOM   8731  C  "C2'" . DG  I 5  130 ? -55.427 -40.070 40.021 1.00 104.35 ? 57   DG  I "C2'" 1 
ATOM   8732  C  "C1'" . DG  I 5  130 ? -56.067 -38.820 39.404 1.00 104.82 ? 57   DG  I "C1'" 1 
ATOM   8733  N  N9    . DG  I 5  130 ? -57.486 -38.950 39.084 1.00 109.35 ? 57   DG  I N9    1 
ATOM   8734  C  C8    . DG  I 5  130 ? -58.142 -40.091 38.691 1.00 111.80 ? 57   DG  I C8    1 
ATOM   8735  N  N7    . DG  I 5  130 ? -59.402 -39.890 38.416 1.00 112.45 ? 57   DG  I N7    1 
ATOM   8736  C  C5    . DG  I 5  130 ? -59.586 -38.530 38.626 1.00 115.08 ? 57   DG  I C5    1 
ATOM   8737  C  C6    . DG  I 5  130 ? -60.750 -37.729 38.491 1.00 121.00 ? 57   DG  I C6    1 
ATOM   8738  O  O6    . DG  I 5  130 ? -61.886 -38.072 38.139 1.00 123.35 ? 57   DG  I O6    1 
ATOM   8739  N  N1    . DG  I 5  130 ? -60.496 -36.400 38.813 1.00 117.51 ? 57   DG  I N1    1 
ATOM   8740  C  C2    . DG  I 5  130 ? -59.279 -35.902 39.208 1.00 115.45 ? 57   DG  I C2    1 
ATOM   8741  N  N2    . DG  I 5  130 ? -59.235 -34.587 39.469 1.00 116.52 ? 57   DG  I N2    1 
ATOM   8742  N  N3    . DG  I 5  130 ? -58.186 -36.637 39.334 1.00 115.83 ? 57   DG  I N3    1 
ATOM   8743  C  C4    . DG  I 5  130 ? -58.411 -37.933 39.030 1.00 111.67 ? 57   DG  I C4    1 
ATOM   8744  P  P     . DC  I 5  131 ? -52.381 -39.535 41.420 1.00 110.47 ? 58   DC  I P     1 
ATOM   8745  O  OP1   . DC  I 5  131 ? -51.007 -38.994 41.304 1.00 102.70 ? 58   DC  I OP1   1 
ATOM   8746  O  OP2   . DC  I 5  131 ? -52.575 -40.940 41.869 1.00 111.52 ? 58   DC  I OP2   1 
ATOM   8747  O  "O5'" . DC  I 5  131 ? -53.203 -38.551 42.370 1.00 101.20 ? 58   DC  I "O5'" 1 
ATOM   8748  C  "C5'" . DC  I 5  131 ? -53.529 -37.219 41.928 1.00 96.50  ? 58   DC  I "C5'" 1 
ATOM   8749  C  "C4'" . DC  I 5  131 ? -54.495 -36.540 42.875 1.00 106.07 ? 58   DC  I "C4'" 1 
ATOM   8750  O  "O4'" . DC  I 5  131 ? -55.861 -36.713 42.400 1.00 109.11 ? 58   DC  I "O4'" 1 
ATOM   8751  C  "C3'" . DC  I 5  131 ? -54.487 -37.013 44.326 1.00 109.65 ? 58   DC  I "C3'" 1 
ATOM   8752  O  "O3'" . DC  I 5  131 ? -54.648 -35.874 45.163 1.00 113.70 ? 58   DC  I "O3'" 1 
ATOM   8753  C  "C2'" . DC  I 5  131 ? -55.741 -37.879 44.407 1.00 113.50 ? 58   DC  I "C2'" 1 
ATOM   8754  C  "C1'" . DC  I 5  131 ? -56.681 -37.116 43.477 1.00 114.86 ? 58   DC  I "C1'" 1 
ATOM   8755  N  N1    . DC  I 5  131 ? -57.808 -37.898 42.935 1.00 117.99 ? 58   DC  I N1    1 
ATOM   8756  C  C2    . DC  I 5  131 ? -59.006 -37.238 42.643 1.00 114.37 ? 58   DC  I C2    1 
ATOM   8757  O  O2    . DC  I 5  131 ? -59.090 -36.020 42.864 1.00 115.76 ? 58   DC  I O2    1 
ATOM   8758  N  N3    . DC  I 5  131 ? -60.041 -37.942 42.130 1.00 119.82 ? 58   DC  I N3    1 
ATOM   8759  C  C4    . DC  I 5  131 ? -59.911 -39.252 41.907 1.00 116.68 ? 58   DC  I C4    1 
ATOM   8760  N  N4    . DC  I 5  131 ? -60.960 -39.908 41.405 1.00 117.40 ? 58   DC  I N4    1 
ATOM   8761  C  C5    . DC  I 5  131 ? -58.700 -39.949 42.190 1.00 112.55 ? 58   DC  I C5    1 
ATOM   8762  C  C6    . DC  I 5  131 ? -57.683 -39.239 42.696 1.00 114.76 ? 58   DC  I C6    1 
ATOM   8763  P  P     . DA  I 5  132 ? -53.446 -35.193 45.980 1.00 103.43 ? 59   DA  I P     1 
ATOM   8764  O  OP1   . DA  I 5  132 ? -52.422 -34.786 44.990 1.00 96.32  ? 59   DA  I OP1   1 
ATOM   8765  O  OP2   . DA  I 5  132 ? -53.067 -36.018 47.166 1.00 93.08  ? 59   DA  I OP2   1 
ATOM   8766  O  "O5'" . DA  I 5  132 ? -54.162 -33.869 46.497 1.00 103.52 ? 59   DA  I "O5'" 1 
ATOM   8767  C  "C5'" . DA  I 5  132 ? -54.503 -32.831 45.563 1.00 109.85 ? 59   DA  I "C5'" 1 
ATOM   8768  C  "C4'" . DA  I 5  132 ? -55.657 -32.004 46.083 1.00 114.80 ? 59   DA  I "C4'" 1 
ATOM   8769  O  "O4'" . DA  I 5  132 ? -56.910 -32.687 45.840 1.00 119.05 ? 59   DA  I "O4'" 1 
ATOM   8770  C  "C3'" . DA  I 5  132 ? -55.639 -31.645 47.567 1.00 115.79 ? 59   DA  I "C3'" 1 
ATOM   8771  O  "O3'" . DA  I 5  132 ? -55.985 -30.262 47.676 1.00 109.34 ? 59   DA  I "O3'" 1 
ATOM   8772  C  "C2'" . DA  I 5  132 ? -56.553 -32.693 48.214 1.00 116.39 ? 59   DA  I "C2'" 1 
ATOM   8773  C  "C1'" . DA  I 5  132 ? -57.471 -33.123 47.063 1.00 118.26 ? 59   DA  I "C1'" 1 
ATOM   8774  N  N9    . DA  I 5  132 ? -57.655 -34.571 46.963 1.00 123.53 ? 59   DA  I N9    1 
ATOM   8775  C  C8    . DA  I 5  132 ? -56.761 -35.546 47.332 1.00 124.21 ? 59   DA  I C8    1 
ATOM   8776  N  N7    . DA  I 5  132 ? -57.181 -36.765 47.095 1.00 117.29 ? 59   DA  I N7    1 
ATOM   8777  C  C5    . DA  I 5  132 ? -58.426 -36.582 46.511 1.00 120.04 ? 59   DA  I C5    1 
ATOM   8778  C  C6    . DA  I 5  132 ? -59.384 -37.488 46.022 1.00 109.47 ? 59   DA  I C6    1 
ATOM   8779  N  N6    . DA  I 5  132 ? -59.230 -38.813 46.049 1.00 111.09 ? 59   DA  I N6    1 
ATOM   8780  N  N1    . DA  I 5  132 ? -60.522 -36.979 45.502 1.00 106.47 ? 59   DA  I N1    1 
ATOM   8781  C  C2    . DA  I 5  132 ? -60.680 -35.650 45.484 1.00 112.04 ? 59   DA  I C2    1 
ATOM   8782  N  N3    . DA  I 5  132 ? -59.851 -34.696 45.908 1.00 119.88 ? 59   DA  I N3    1 
ATOM   8783  C  C4    . DA  I 5  132 ? -58.728 -35.235 46.416 1.00 123.65 ? 59   DA  I C4    1 
ATOM   8784  P  P     . DG  I 5  133 ? -57.055 -29.590 48.653 1.00 114.60 ? 60   DG  I P     1 
ATOM   8785  O  OP1   . DG  I 5  133 ? -57.085 -28.143 48.312 1.00 110.43 ? 60   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I 5  133 ? -56.746 -30.015 50.047 1.00 106.17 ? 60   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I 5  133 ? -58.438 -30.241 48.199 1.00 116.14 ? 60   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I 5  133 ? -59.685 -29.541 48.365 1.00 115.73 ? 60   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I 5  133 ? -60.691 -30.390 49.114 1.00 119.01 ? 60   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I 5  133 ? -60.507 -31.803 48.818 1.00 119.34 ? 60   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I 5  133 ? -60.687 -30.284 50.643 1.00 117.11 ? 60   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I 5  133 ? -62.056 -30.217 51.026 1.00 125.94 ? 60   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I 5  133 ? -60.153 -31.646 51.084 1.00 111.65 ? 60   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I 5  133 ? -60.748 -32.532 49.999 1.00 116.92 ? 60   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I 5  133 ? -60.198 -33.876 49.858 1.00 119.21 ? 60   DG  I N9    1 
ATOM   8796  C  C8    . DG  I 5  133 ? -58.900 -34.290 50.041 1.00 117.39 ? 60   DG  I C8    1 
ATOM   8797  N  N7    . DG  I 5  133 ? -58.737 -35.569 49.838 1.00 111.24 ? 60   DG  I N7    1 
ATOM   8798  C  C5    . DG  I 5  133 ? -60.005 -36.029 49.509 1.00 113.28 ? 60   DG  I C5    1 
ATOM   8799  C  C6    . DG  I 5  133 ? -60.453 -37.335 49.182 1.00 110.99 ? 60   DG  I C6    1 
ATOM   8800  O  O6    . DG  I 5  133 ? -59.799 -38.382 49.120 1.00 104.79 ? 60   DG  I O6    1 
ATOM   8801  N  N1    . DG  I 5  133 ? -61.819 -37.354 48.917 1.00 118.01 ? 60   DG  I N1    1 
ATOM   8802  C  C2    . DG  I 5  133 ? -62.649 -36.260 48.960 1.00 116.44 ? 60   DG  I C2    1 
ATOM   8803  N  N2    . DG  I 5  133 ? -63.939 -36.485 48.678 1.00 119.47 ? 60   DG  I N2    1 
ATOM   8804  N  N3    . DG  I 5  133 ? -62.243 -35.038 49.265 1.00 114.38 ? 60   DG  I N3    1 
ATOM   8805  C  C4    . DG  I 5  133 ? -60.918 -34.996 49.521 1.00 118.56 ? 60   DG  I C4    1 
ATOM   8806  P  P     . DG  I 5  134 ? -62.573 -29.518 52.363 1.00 130.97 ? 61   DG  I P     1 
ATOM   8807  O  OP1   . DG  I 5  134 ? -63.123 -28.189 51.990 1.00 130.59 ? 61   DG  I OP1   1 
ATOM   8808  O  OP2   . DG  I 5  134 ? -61.493 -29.616 53.380 1.00 124.02 ? 61   DG  I OP2   1 
ATOM   8809  O  "O5'" . DG  I 5  134 ? -63.783 -30.439 52.844 1.00 137.31 ? 61   DG  I "O5'" 1 
ATOM   8810  C  "C5'" . DG  I 5  134 ? -64.870 -30.783 51.962 1.00 137.00 ? 61   DG  I "C5'" 1 
ATOM   8811  C  "C4'" . DG  I 5  134 ? -65.403 -32.161 52.289 1.00 136.06 ? 61   DG  I "C4'" 1 
ATOM   8812  O  "O4'" . DG  I 5  134 ? -64.481 -33.173 51.818 1.00 138.32 ? 61   DG  I "O4'" 1 
ATOM   8813  C  "C3'" . DG  I 5  134 ? -65.626 -32.460 53.772 1.00 132.67 ? 61   DG  I "C3'" 1 
ATOM   8814  O  "O3'" . DG  I 5  134 ? -67.006 -32.623 54.071 1.00 134.43 ? 61   DG  I "O3'" 1 
ATOM   8815  C  "C2'" . DG  I 5  134 ? -64.849 -33.757 54.032 1.00 130.96 ? 61   DG  I "C2'" 1 
ATOM   8816  C  "C1'" . DG  I 5  134 ? -64.628 -34.310 52.625 1.00 132.24 ? 61   DG  I "C1'" 1 
ATOM   8817  N  N9    . DG  I 5  134 ? -63.410 -35.110 52.541 1.00 129.91 ? 61   DG  I N9    1 
ATOM   8818  C  C8    . DG  I 5  134 ? -62.137 -34.704 52.863 1.00 125.95 ? 61   DG  I C8    1 
ATOM   8819  N  N7    . DG  I 5  134 ? -61.249 -35.652 52.737 1.00 121.80 ? 61   DG  I N7    1 
ATOM   8820  C  C5    . DG  I 5  134 ? -61.981 -36.756 52.319 1.00 120.04 ? 61   DG  I C5    1 
ATOM   8821  C  C6    . DG  I 5  134 ? -61.560 -38.080 52.025 1.00 117.00 ? 61   DG  I C6    1 
ATOM   8822  O  O6    . DG  I 5  134 ? -60.417 -38.553 52.065 1.00 105.70 ? 61   DG  I O6    1 
ATOM   8823  N  N1    . DG  I 5  134 ? -62.629 -38.881 51.634 1.00 121.92 ? 61   DG  I N1    1 
ATOM   8824  C  C2    . DG  I 5  134 ? -63.937 -38.469 51.551 1.00 120.93 ? 61   DG  I C2    1 
ATOM   8825  N  N2    . DG  I 5  134 ? -64.825 -39.396 51.162 1.00 114.10 ? 61   DG  I N2    1 
ATOM   8826  N  N3    . DG  I 5  134 ? -64.344 -37.239 51.829 1.00 124.04 ? 61   DG  I N3    1 
ATOM   8827  C  C4    . DG  I 5  134 ? -63.319 -36.441 52.204 1.00 124.17 ? 61   DG  I C4    1 
ATOM   8828  P  P     . DT  I 5  135 ? -67.444 -32.956 55.577 1.00 143.33 ? 62   DT  I P     1 
ATOM   8829  O  OP1   . DT  I 5  135 ? -68.769 -32.334 55.848 1.00 139.15 ? 62   DT  I OP1   1 
ATOM   8830  O  OP2   . DT  I 5  135 ? -66.307 -32.700 56.504 1.00 130.98 ? 62   DT  I OP2   1 
ATOM   8831  O  "O5'" . DT  I 5  135 ? -67.624 -34.534 55.495 1.00 143.22 ? 62   DT  I "O5'" 1 
ATOM   8832  C  "C5'" . DT  I 5  135 ? -68.730 -35.127 54.794 1.00 143.85 ? 62   DT  I "C5'" 1 
ATOM   8833  C  "C4'" . DT  I 5  135 ? -68.798 -36.597 55.135 1.00 146.77 ? 62   DT  I "C4'" 1 
ATOM   8834  O  "O4'" . DT  I 5  135 ? -67.603 -37.237 54.631 1.00 141.97 ? 62   DT  I "O4'" 1 
ATOM   8835  C  "C3'" . DT  I 5  135 ? -68.859 -36.883 56.639 1.00 143.47 ? 62   DT  I "C3'" 1 
ATOM   8836  O  "O3'" . DT  I 5  135 ? -70.062 -37.586 56.973 1.00 137.71 ? 62   DT  I "O3'" 1 
ATOM   8837  C  "C2'" . DT  I 5  135 ? -67.581 -37.649 56.943 1.00 144.98 ? 62   DT  I "C2'" 1 
ATOM   8838  C  "C1'" . DT  I 5  135 ? -67.075 -38.128 55.593 1.00 143.35 ? 62   DT  I "C1'" 1 
ATOM   8839  N  N1    . DT  I 5  135 ? -65.604 -38.089 55.483 1.00 142.23 ? 62   DT  I N1    1 
ATOM   8840  C  C2    . DT  I 5  135 ? -64.953 -39.163 54.914 1.00 137.26 ? 62   DT  I C2    1 
ATOM   8841  O  O2    . DT  I 5  135 ? -65.536 -40.139 54.473 1.00 138.42 ? 62   DT  I O2    1 
ATOM   8842  N  N3    . DT  I 5  135 ? -63.586 -39.045 54.871 1.00 137.57 ? 62   DT  I N3    1 
ATOM   8843  C  C4    . DT  I 5  135 ? -62.822 -37.988 55.334 1.00 144.17 ? 62   DT  I C4    1 
ATOM   8844  O  O4    . DT  I 5  135 ? -61.600 -38.021 55.219 1.00 134.66 ? 62   DT  I O4    1 
ATOM   8845  C  C5    . DT  I 5  135 ? -63.571 -36.900 55.927 1.00 147.00 ? 62   DT  I C5    1 
ATOM   8846  C  C7    . DT  I 5  135 ? -62.832 -35.713 56.459 1.00 144.98 ? 62   DT  I C7    1 
ATOM   8847  C  C6    . DT  I 5  135 ? -64.906 -37.005 55.971 1.00 145.04 ? 62   DT  I C6    1 
ATOM   8848  P  P     . DG  I 5  136 ? -70.203 -38.605 58.200 1.00 145.91 ? 63   DG  I P     1 
ATOM   8849  O  OP1   . DG  I 5  136 ? -71.654 -38.745 58.481 1.00 146.42 ? 63   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I 5  136 ? -69.289 -38.195 59.304 1.00 142.31 ? 63   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I 5  136 ? -69.682 -39.943 57.502 1.00 153.00 ? 63   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I 5  136 ? -70.277 -41.233 57.771 1.00 154.15 ? 63   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I 5  136 ? -69.460 -41.976 58.802 1.00 156.71 ? 63   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I 5  136 ? -68.065 -41.915 58.428 1.00 153.85 ? 63   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I 5  136 ? -69.566 -41.428 60.225 1.00 163.08 ? 63   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I 5  136 ? -70.330 -42.302 61.059 1.00 166.88 ? 63   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I 5  136 ? -68.122 -41.108 60.649 1.00 155.01 ? 63   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I 5  136 ? -67.274 -41.817 59.588 1.00 155.87 ? 63   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I 5  136 ? -66.041 -41.109 59.238 1.00 152.69 ? 63   DG  I N9    1 
ATOM   8860  C  C8    . DG  I 5  136 ? -65.834 -39.750 59.263 1.00 143.47 ? 63   DG  I C8    1 
ATOM   8861  N  N7    . DG  I 5  136 ? -64.630 -39.408 58.890 1.00 130.62 ? 63   DG  I N7    1 
ATOM   8862  C  C5    . DG  I 5  136 ? -64.004 -40.613 58.595 1.00 133.09 ? 63   DG  I C5    1 
ATOM   8863  C  C6    . DG  I 5  136 ? -62.682 -40.879 58.142 1.00 124.90 ? 63   DG  I C6    1 
ATOM   8864  O  O6    . DG  I 5  136 ? -61.773 -40.077 57.900 1.00 118.99 ? 63   DG  I O6    1 
ATOM   8865  N  N1    . DG  I 5  136 ? -62.464 -42.243 57.975 1.00 117.12 ? 63   DG  I N1    1 
ATOM   8866  C  C2    . DG  I 5  136 ? -63.393 -43.226 58.209 1.00 116.52 ? 63   DG  I C2    1 
ATOM   8867  N  N2    . DG  I 5  136 ? -62.990 -44.484 57.981 1.00 116.45 ? 63   DG  I N2    1 
ATOM   8868  N  N3    . DG  I 5  136 ? -64.627 -42.994 58.632 1.00 125.98 ? 63   DG  I N3    1 
ATOM   8869  C  C4    . DG  I 5  136 ? -64.862 -41.674 58.804 1.00 138.63 ? 63   DG  I C4    1 
ATOM   8870  P  P     . DG  I 5  137 ? -69.802 -43.563 61.893 1.00 168.63 ? 64   DG  I P     1 
ATOM   8871  O  OP1   . DG  I 5  137 ? -70.979 -44.417 62.189 1.00 176.64 ? 64   DG  I OP1   1 
ATOM   8872  O  OP2   . DG  I 5  137 ? -68.999 -43.006 63.019 1.00 156.34 ? 64   DG  I OP2   1 
ATOM   8873  O  "O5'" . DG  I 5  137 ? -68.903 -44.414 60.887 1.00 156.33 ? 64   DG  I "O5'" 1 
ATOM   8874  C  "C5'" . DG  I 5  137 ? -68.567 -45.790 61.161 1.00 149.76 ? 64   DG  I "C5'" 1 
ATOM   8875  C  "C4'" . DG  I 5  137 ? -67.324 -45.873 62.023 1.00 152.10 ? 64   DG  I "C4'" 1 
ATOM   8876  O  "O4'" . DG  I 5  137 ? -66.366 -44.876 61.600 1.00 150.62 ? 64   DG  I "O4'" 1 
ATOM   8877  C  "C3'" . DG  I 5  137 ? -67.526 -45.642 63.527 1.00 152.28 ? 64   DG  I "C3'" 1 
ATOM   8878  O  "O3'" . DG  I 5  137 ? -67.473 -46.847 64.302 1.00 153.99 ? 64   DG  I "O3'" 1 
ATOM   8879  C  "C2'" . DG  I 5  137 ? -66.468 -44.598 63.918 1.00 147.40 ? 64   DG  I "C2'" 1 
ATOM   8880  C  "C1'" . DG  I 5  137 ? -65.546 -44.569 62.698 1.00 142.39 ? 64   DG  I "C1'" 1 
ATOM   8881  N  N9    . DG  I 5  137 ? -64.892 -43.281 62.470 1.00 131.60 ? 64   DG  I N9    1 
ATOM   8882  C  C8    . DG  I 5  137 ? -65.408 -42.027 62.696 1.00 131.06 ? 64   DG  I C8    1 
ATOM   8883  N  N7    . DG  I 5  137 ? -64.563 -41.069 62.427 1.00 126.57 ? 64   DG  I N7    1 
ATOM   8884  C  C5    . DG  I 5  137 ? -63.413 -41.729 62.017 1.00 125.19 ? 64   DG  I C5    1 
ATOM   8885  C  C6    . DG  I 5  137 ? -62.158 -41.216 61.595 1.00 119.09 ? 64   DG  I C6    1 
ATOM   8886  O  O6    . DG  I 5  137 ? -61.801 -40.036 61.496 1.00 119.14 ? 64   DG  I O6    1 
ATOM   8887  N  N1    . DG  I 5  137 ? -61.274 -42.239 61.260 1.00 109.68 ? 64   DG  I N1    1 
ATOM   8888  C  C2    . DG  I 5  137 ? -61.556 -43.580 61.328 1.00 108.58 ? 64   DG  I C2    1 
ATOM   8889  N  N2    . DG  I 5  137 ? -60.568 -44.410 60.971 1.00 104.76 ? 64   DG  I N2    1 
ATOM   8890  N  N3    . DG  I 5  137 ? -62.721 -44.072 61.721 1.00 120.06 ? 64   DG  I N3    1 
ATOM   8891  C  C4    . DG  I 5  137 ? -63.598 -43.096 62.043 1.00 127.81 ? 64   DG  I C4    1 
ATOM   8892  P  P     . DA  I 5  138 ? -66.192 -47.641 64.894 1.00 145.81 ? 65   DA  I P     1 
ATOM   8893  O  OP1   . DA  I 5  138 ? -66.657 -49.003 65.275 1.00 143.73 ? 65   DA  I OP1   1 
ATOM   8894  O  OP2   . DA  I 5  138 ? -65.529 -46.796 65.922 1.00 131.06 ? 65   DA  I OP2   1 
ATOM   8895  O  "O5'" . DA  I 5  138 ? -65.221 -47.832 63.643 1.00 146.71 ? 65   DA  I "O5'" 1 
ATOM   8896  C  "C5'" . DA  I 5  138 ? -64.626 -49.115 63.349 1.00 138.25 ? 65   DA  I "C5'" 1 
ATOM   8897  C  "C4'" . DA  I 5  138 ? -63.148 -49.109 63.680 1.00 133.92 ? 65   DA  I "C4'" 1 
ATOM   8898  O  "O4'" . DA  I 5  138 ? -62.590 -47.782 63.443 1.00 140.89 ? 65   DA  I "O4'" 1 
ATOM   8899  C  "C3'" . DA  I 5  138 ? -62.777 -49.470 65.122 1.00 129.73 ? 65   DA  I "C3'" 1 
ATOM   8900  O  "O3'" . DA  I 5  138 ? -61.599 -50.283 65.145 1.00 127.87 ? 65   DA  I "O3'" 1 
ATOM   8901  C  "C2'" . DA  I 5  138 ? -62.496 -48.107 65.745 1.00 130.77 ? 65   DA  I "C2'" 1 
ATOM   8902  C  "C1'" . DA  I 5  138 ? -61.835 -47.389 64.572 1.00 132.26 ? 65   DA  I "C1'" 1 
ATOM   8903  N  N9    . DA  I 5  138 ? -61.854 -45.929 64.672 1.00 123.85 ? 65   DA  I N9    1 
ATOM   8904  C  C8    . DA  I 5  138 ? -62.902 -45.115 65.024 1.00 125.80 ? 65   DA  I C8    1 
ATOM   8905  N  N7    . DA  I 5  138 ? -62.600 -43.840 65.038 1.00 115.51 ? 65   DA  I N7    1 
ATOM   8906  C  C5    . DA  I 5  138 ? -61.260 -43.812 64.681 1.00 112.30 ? 65   DA  I C5    1 
ATOM   8907  C  C6    . DA  I 5  138 ? -60.350 -42.756 64.513 1.00 107.46 ? 65   DA  I C6    1 
ATOM   8908  N  N6    . DA  I 5  138 ? -60.668 -41.472 64.688 1.00 105.63 ? 65   DA  I N6    1 
ATOM   8909  N  N1    . DA  I 5  138 ? -59.087 -43.067 64.147 1.00 103.80 ? 65   DA  I N1    1 
ATOM   8910  C  C2    . DA  I 5  138 ? -58.772 -44.356 63.967 1.00 105.30 ? 65   DA  I C2    1 
ATOM   8911  N  N3    . DA  I 5  138 ? -59.539 -45.437 64.093 1.00 110.80 ? 65   DA  I N3    1 
ATOM   8912  C  C4    . DA  I 5  138 ? -60.787 -45.092 64.454 1.00 114.03 ? 65   DA  I C4    1 
ATOM   8913  P  P     . DT  I 5  139 ? -60.626 -50.452 66.427 1.00 130.41 ? 66   DT  I P     1 
ATOM   8914  O  OP1   . DT  I 5  139 ? -59.841 -51.719 66.365 1.00 120.03 ? 66   DT  I OP1   1 
ATOM   8915  O  OP2   . DT  I 5  139 ? -61.380 -50.112 67.664 1.00 121.71 ? 66   DT  I OP2   1 
ATOM   8916  O  "O5'" . DT  I 5  139 ? -59.582 -49.280 66.167 1.00 135.75 ? 66   DT  I "O5'" 1 
ATOM   8917  C  "C5'" . DT  I 5  139 ? -58.417 -49.501 65.357 1.00 134.74 ? 66   DT  I "C5'" 1 
ATOM   8918  C  "C4'" . DT  I 5  139 ? -57.251 -48.704 65.896 1.00 129.32 ? 66   DT  I "C4'" 1 
ATOM   8919  O  "O4'" . DT  I 5  139 ? -57.596 -47.301 65.966 1.00 127.30 ? 66   DT  I "O4'" 1 
ATOM   8920  C  "C3'" . DT  I 5  139 ? -56.759 -49.092 67.293 1.00 124.36 ? 66   DT  I "C3'" 1 
ATOM   8921  O  "O3'" . DT  I 5  139 ? -55.327 -49.093 67.200 1.00 120.67 ? 66   DT  I "O3'" 1 
ATOM   8922  C  "C2'" . DT  I 5  139 ? -57.340 -48.007 68.191 1.00 119.73 ? 66   DT  I "C2'" 1 
ATOM   8923  C  "C1'" . DT  I 5  139 ? -57.336 -46.797 67.270 1.00 117.32 ? 66   DT  I "C1'" 1 
ATOM   8924  N  N1    . DT  I 5  139 ? -58.315 -45.713 67.539 1.00 109.18 ? 66   DT  I N1    1 
ATOM   8925  C  C2    . DT  I 5  139 ? -57.899 -44.422 67.294 1.00 108.61 ? 66   DT  I C2    1 
ATOM   8926  O  O2    . DT  I 5  139 ? -56.771 -44.143 66.919 1.00 110.30 ? 66   DT  I O2    1 
ATOM   8927  N  N3    . DT  I 5  139 ? -58.855 -43.461 67.516 1.00 104.46 ? 66   DT  I N3    1 
ATOM   8928  C  C4    . DT  I 5  139 ? -60.156 -43.657 67.933 1.00 102.82 ? 66   DT  I C4    1 
ATOM   8929  O  O4    . DT  I 5  139 ? -60.898 -42.692 68.093 1.00 95.02  ? 66   DT  I O4    1 
ATOM   8930  C  C5    . DT  I 5  139 ? -60.532 -45.037 68.155 1.00 104.38 ? 66   DT  I C5    1 
ATOM   8931  C  C7    . DT  I 5  139 ? -61.921 -45.347 68.615 1.00 105.45 ? 66   DT  I C7    1 
ATOM   8932  C  C6    . DT  I 5  139 ? -59.607 -45.984 67.941 1.00 103.82 ? 66   DT  I C6    1 
ATOM   8933  P  P     . DA  I 5  140 ? -54.208 -49.314 68.333 1.00 116.34 ? 67   DA  I P     1 
ATOM   8934  O  OP1   . DA  I 5  140 ? -53.613 -50.660 68.166 1.00 120.13 ? 67   DA  I OP1   1 
ATOM   8935  O  OP2   . DA  I 5  140 ? -54.720 -48.896 69.662 1.00 114.34 ? 67   DA  I OP2   1 
ATOM   8936  O  "O5'" . DA  I 5  140 ? -53.111 -48.254 67.869 1.00 118.43 ? 67   DA  I "O5'" 1 
ATOM   8937  C  "C5'" . DA  I 5  140 ? -53.486 -47.141 67.023 1.00 114.04 ? 67   DA  I "C5'" 1 
ATOM   8938  C  "C4'" . DA  I 5  140 ? -52.592 -45.933 67.238 1.00 109.55 ? 67   DA  I "C4'" 1 
ATOM   8939  O  "O4'" . DA  I 5  140 ? -53.406 -44.752 67.479 1.00 112.21 ? 67   DA  I "O4'" 1 
ATOM   8940  C  "C3'" . DA  I 5  140 ? -51.591 -45.976 68.391 1.00 105.52 ? 67   DA  I "C3'" 1 
ATOM   8941  O  "O3'" . DA  I 5  140 ? -50.466 -45.218 67.962 1.00 101.43 ? 67   DA  I "O3'" 1 
ATOM   8942  C  "C2'" . DA  I 5  140 ? -52.363 -45.326 69.542 1.00 100.09 ? 67   DA  I "C2'" 1 
ATOM   8943  C  "C1'" . DA  I 5  140 ? -53.225 -44.295 68.810 1.00 101.07 ? 67   DA  I "C1'" 1 
ATOM   8944  N  N9    . DA  I 5  140 ? -54.554 -44.098 69.397 1.00 100.43 ? 67   DA  I N9    1 
ATOM   8945  C  C8    . DA  I 5  140 ? -55.476 -45.069 69.697 1.00 101.27 ? 67   DA  I C8    1 
ATOM   8946  N  N7    . DA  I 5  140 ? -56.602 -44.600 70.178 1.00 101.47 ? 67   DA  I N7    1 
ATOM   8947  C  C5    . DA  I 5  140 ? -56.412 -43.225 70.190 1.00 96.90  ? 67   DA  I C5    1 
ATOM   8948  C  C6    . DA  I 5  140 ? -57.238 -42.158 70.591 1.00 98.27  ? 67   DA  I C6    1 
ATOM   8949  N  N6    . DA  I 5  140 ? -58.471 -42.316 71.075 1.00 100.24 ? 67   DA  I N6    1 
ATOM   8950  N  N1    . DA  I 5  140 ? -56.749 -40.905 70.468 1.00 98.08  ? 67   DA  I N1    1 
ATOM   8951  C  C2    . DA  I 5  140 ? -55.513 -40.745 69.979 1.00 95.23  ? 67   DA  I C2    1 
ATOM   8952  N  N3    . DA  I 5  140 ? -54.643 -41.665 69.568 1.00 94.78  ? 67   DA  I N3    1 
ATOM   8953  C  C4    . DA  I 5  140 ? -55.159 -42.900 69.701 1.00 98.06  ? 67   DA  I C4    1 
ATOM   8954  P  P     . DT  I 5  141 ? -49.151 -44.932 68.824 1.00 105.09 ? 68   DT  I P     1 
ATOM   8955  O  OP1   . DT  I 5  141 ? -48.057 -44.620 67.867 1.00 100.16 ? 68   DT  I OP1   1 
ATOM   8956  O  OP2   . DT  I 5  141 ? -48.982 -46.036 69.802 1.00 95.99  ? 68   DT  I OP2   1 
ATOM   8957  O  "O5'" . DT  I 5  141 ? -49.499 -43.568 69.573 1.00 95.67  ? 68   DT  I "O5'" 1 
ATOM   8958  C  "C5'" . DT  I 5  141 ? -49.886 -42.404 68.821 1.00 90.66  ? 68   DT  I "C5'" 1 
ATOM   8959  C  "C4'" . DT  I 5  141 ? -49.944 -41.175 69.700 1.00 94.68  ? 68   DT  I "C4'" 1 
ATOM   8960  O  "O4'" . DT  I 5  141 ? -51.268 -41.001 70.259 1.00 103.82 ? 68   DT  I "O4'" 1 
ATOM   8961  C  "C3'" . DT  I 5  141 ? -48.971 -41.121 70.882 1.00 95.31  ? 68   DT  I "C3'" 1 
ATOM   8962  O  "O3'" . DT  I 5  141 ? -48.427 -39.794 70.885 1.00 99.04  ? 68   DT  I "O3'" 1 
ATOM   8963  C  "C2'" . DT  I 5  141 ? -49.856 -41.391 72.092 1.00 93.32  ? 68   DT  I "C2'" 1 
ATOM   8964  C  "C1'" . DT  I 5  141 ? -51.186 -40.785 71.665 1.00 101.45 ? 68   DT  I "C1'" 1 
ATOM   8965  N  N1    . DT  I 5  141 ? -52.405 -41.368 72.280 1.00 100.28 ? 68   DT  I N1    1 
ATOM   8966  C  C2    . DT  I 5  141 ? -53.460 -40.534 72.588 1.00 103.28 ? 68   DT  I C2    1 
ATOM   8967  O  O2    . DT  I 5  141 ? -53.430 -39.325 72.420 1.00 99.74  ? 68   DT  I O2    1 
ATOM   8968  N  N3    . DT  I 5  141 ? -54.558 -41.173 73.112 1.00 106.34 ? 68   DT  I N3    1 
ATOM   8969  C  C4    . DT  I 5  141 ? -54.707 -42.528 73.341 1.00 99.36  ? 68   DT  I C4    1 
ATOM   8970  O  O4    . DT  I 5  141 ? -55.756 -42.954 73.815 1.00 102.79 ? 68   DT  I O4    1 
ATOM   8971  C  C5    . DT  I 5  141 ? -53.566 -43.343 72.985 1.00 86.79  ? 68   DT  I C5    1 
ATOM   8972  C  C7    . DT  I 5  141 ? -53.631 -44.822 73.201 1.00 83.20  ? 68   DT  I C7    1 
ATOM   8973  C  C6    . DT  I 5  141 ? -52.491 -42.731 72.474 1.00 91.43  ? 68   DT  I C6    1 
ATOM   8974  P  P     . DT  I 5  142 ? -47.165 -39.258 71.716 1.00 97.08  ? 69   DT  I P     1 
ATOM   8975  O  OP1   . DT  I 5  142 ? -46.370 -38.393 70.816 1.00 98.00  ? 69   DT  I OP1   1 
ATOM   8976  O  OP2   . DT  I 5  142 ? -46.517 -40.388 72.440 1.00 94.44  ? 69   DT  I OP2   1 
ATOM   8977  O  "O5'" . DT  I 5  142 ? -47.842 -38.253 72.747 1.00 91.50  ? 69   DT  I "O5'" 1 
ATOM   8978  C  "C5'" . DT  I 5  142 ? -48.743 -37.237 72.270 1.00 94.35  ? 69   DT  I "C5'" 1 
ATOM   8979  C  "C4'" . DT  I 5  142 ? -49.630 -36.769 73.400 1.00 97.74  ? 69   DT  I "C4'" 1 
ATOM   8980  O  "O4'" . DT  I 5  142 ? -50.619 -37.780 73.709 1.00 96.19  ? 69   DT  I "O4'" 1 
ATOM   8981  C  "C3'" . DT  I 5  142 ? -48.883 -36.489 74.709 1.00 95.46  ? 69   DT  I "C3'" 1 
ATOM   8982  O  "O3'" . DT  I 5  142 ? -49.197 -35.169 75.153 1.00 97.47  ? 69   DT  I "O3'" 1 
ATOM   8983  C  "C2'" . DT  I 5  142 ? -49.433 -37.518 75.684 1.00 97.10  ? 69   DT  I "C2'" 1 
ATOM   8984  C  "C1'" . DT  I 5  142 ? -50.807 -37.786 75.111 1.00 95.44  ? 69   DT  I "C1'" 1 
ATOM   8985  N  N1    . DT  I 5  142 ? -51.417 -39.073 75.485 1.00 90.78  ? 69   DT  I N1    1 
ATOM   8986  C  C2    . DT  I 5  142 ? -52.720 -39.055 75.928 1.00 90.21  ? 69   DT  I C2    1 
ATOM   8987  O  O2    . DT  I 5  142 ? -53.372 -38.028 76.036 1.00 80.05  ? 69   DT  I O2    1 
ATOM   8988  N  N3    . DT  I 5  142 ? -53.235 -40.290 76.243 1.00 92.05  ? 69   DT  I N3    1 
ATOM   8989  C  C4    . DT  I 5  142 ? -52.587 -41.511 76.164 1.00 96.18  ? 69   DT  I C4    1 
ATOM   8990  O  O4    . DT  I 5  142 ? -53.178 -42.540 76.483 1.00 104.07 ? 69   DT  I O4    1 
ATOM   8991  C  C5    . DT  I 5  142 ? -51.219 -41.453 75.696 1.00 95.93  ? 69   DT  I C5    1 
ATOM   8992  C  C7    . DT  I 5  142 ? -50.434 -42.723 75.589 1.00 83.65  ? 69   DT  I C7    1 
ATOM   8993  C  C6    . DT  I 5  142 ? -50.712 -40.254 75.382 1.00 94.47  ? 69   DT  I C6    1 
ATOM   8994  P  P     . DG  I 5  143 ? -48.255 -34.469 76.230 1.00 95.25  ? 70   DG  I P     1 
ATOM   8995  O  OP1   . DG  I 5  143 ? -47.955 -33.088 75.762 1.00 90.06  ? 70   DG  I OP1   1 
ATOM   8996  O  OP2   . DG  I 5  143 ? -47.170 -35.402 76.631 1.00 82.31  ? 70   DG  I OP2   1 
ATOM   8997  O  "O5'" . DG  I 5  143 ? -49.248 -34.289 77.451 1.00 100.16 ? 70   DG  I "O5'" 1 
ATOM   8998  C  "C5'" . DG  I 5  143 ? -50.508 -33.633 77.250 1.00 111.93 ? 70   DG  I "C5'" 1 
ATOM   8999  C  "C4'" . DG  I 5  143 ? -51.413 -33.967 78.403 1.00 114.77 ? 70   DG  I "C4'" 1 
ATOM   9000  O  "O4'" . DG  I 5  143 ? -51.820 -35.363 78.303 1.00 114.15 ? 70   DG  I "O4'" 1 
ATOM   9001  C  "C3'" . DG  I 5  143 ? -50.754 -33.823 79.775 1.00 109.52 ? 70   DG  I "C3'" 1 
ATOM   9002  O  "O3'" . DG  I 5  143 ? -51.701 -33.227 80.651 1.00 115.23 ? 70   DG  I "O3'" 1 
ATOM   9003  C  "C2'" . DG  I 5  143 ? -50.447 -35.270 80.158 1.00 101.75 ? 70   DG  I "C2'" 1 
ATOM   9004  C  "C1'" . DG  I 5  143 ? -51.673 -35.953 79.571 1.00 110.27 ? 70   DG  I "C1'" 1 
ATOM   9005  N  N9    . DG  I 5  143 ? -51.678 -37.407 79.451 1.00 107.97 ? 70   DG  I N9    1 
ATOM   9006  C  C8    . DG  I 5  143 ? -50.642 -38.264 79.162 1.00 102.18 ? 70   DG  I C8    1 
ATOM   9007  N  N7    . DG  I 5  143 ? -51.000 -39.519 79.172 1.00 104.27 ? 70   DG  I N7    1 
ATOM   9008  C  C5    . DG  I 5  143 ? -52.349 -39.489 79.503 1.00 99.79  ? 70   DG  I C5    1 
ATOM   9009  C  C6    . DG  I 5  143 ? -53.280 -40.546 79.665 1.00 97.32  ? 70   DG  I C6    1 
ATOM   9010  O  O6    . DG  I 5  143 ? -53.092 -41.762 79.547 1.00 95.26  ? 70   DG  I O6    1 
ATOM   9011  N  N1    . DG  I 5  143 ? -54.542 -40.067 80.006 1.00 99.79  ? 70   DG  I N1    1 
ATOM   9012  C  C2    . DG  I 5  143 ? -54.869 -38.743 80.168 1.00 103.66 ? 70   DG  I C2    1 
ATOM   9013  N  N2    . DG  I 5  143 ? -56.145 -38.482 80.490 1.00 106.93 ? 70   DG  I N2    1 
ATOM   9014  N  N3    . DG  I 5  143 ? -54.010 -37.749 80.018 1.00 102.14 ? 70   DG  I N3    1 
ATOM   9015  C  C4    . DG  I 5  143 ? -52.779 -38.192 79.685 1.00 102.42 ? 70   DG  I C4    1 
ATOM   9016  P  P     . DA  I 5  144 ? -51.141 -32.625 82.020 1.00 125.15 ? 71   DA  I P     1 
ATOM   9017  O  OP1   . DA  I 5  144 ? -50.521 -31.324 81.651 1.00 121.97 ? 71   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I 5  144 ? -50.324 -33.668 82.716 1.00 103.91 ? 71   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I 5  144 ? -52.434 -32.321 82.904 1.00 119.28 ? 71   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I 5  144 ? -53.773 -32.484 82.389 1.00 116.90 ? 71   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I 5  144 ? -54.553 -33.480 83.226 1.00 117.67 ? 71   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I 5  144 ? -54.301 -34.822 82.738 1.00 109.24 ? 71   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I 5  144 ? -54.264 -33.500 84.734 1.00 121.77 ? 71   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I 5  144 ? -55.457 -33.275 85.483 1.00 134.08 ? 71   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I 5  144 ? -53.699 -34.898 84.999 1.00 105.73 ? 71   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I 5  144 ? -54.254 -35.707 83.829 1.00 99.94  ? 71   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I 5  144 ? -53.366 -36.810 83.475 1.00 96.53  ? 71   DA  I N9    1 
ATOM   9028  C  C8    . DA  I 5  144 ? -52.021 -36.723 83.215 1.00 96.11  ? 71   DA  I C8    1 
ATOM   9029  N  N7    . DA  I 5  144 ? -51.459 -37.877 82.948 1.00 96.46  ? 71   DA  I N7    1 
ATOM   9030  C  C5    . DA  I 5  144 ? -52.501 -38.787 83.051 1.00 92.01  ? 71   DA  I C5    1 
ATOM   9031  C  C6    . DA  I 5  144 ? -52.557 -40.182 82.885 1.00 88.46  ? 71   DA  I C6    1 
ATOM   9032  N  N6    . DA  I 5  144 ? -51.500 -40.933 82.571 1.00 86.73  ? 71   DA  I N6    1 
ATOM   9033  N  N1    . DA  I 5  144 ? -53.752 -40.788 83.053 1.00 85.94  ? 71   DA  I N1    1 
ATOM   9034  C  C2    . DA  I 5  144 ? -54.811 -40.034 83.375 1.00 89.84  ? 71   DA  I C2    1 
ATOM   9035  N  N3    . DA  I 5  144 ? -54.884 -38.716 83.557 1.00 88.99  ? 71   DA  I N3    1 
ATOM   9036  C  C4    . DA  I 5  144 ? -53.681 -38.145 83.379 1.00 91.14  ? 71   DA  I C4    1 
ATOM   9037  P  P     . DT  I 5  145 ? -55.490 -32.890 87.049 1.00 125.44 ? 72   DT  I P     1 
ATOM   9038  O  OP1   . DT  I 5  145 ? -56.814 -32.234 87.246 1.00 117.19 ? 72   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I 5  145 ? -54.246 -32.198 87.476 1.00 119.94 ? 72   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I 5  145 ? -55.466 -34.309 87.772 1.00 123.62 ? 72   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I 5  145 ? -56.520 -35.263 87.548 1.00 123.22 ? 72   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I 5  145 ? -56.199 -36.582 88.213 1.00 124.72 ? 72   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I 5  145 ? -55.525 -37.458 87.289 1.00 120.13 ? 72   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I 5  145 ? -55.269 -36.510 89.421 1.00 124.74 ? 72   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I 5  145 ? -56.036 -36.334 90.617 1.00 121.57 ? 72   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I 5  145 ? -54.590 -37.872 89.425 1.00 119.80 ? 72   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I 5  145 ? -54.905 -38.477 88.055 1.00 119.17 ? 72   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I 5  145 ? -53.716 -38.949 87.321 1.00 115.63 ? 72   DT  I N1    1 
ATOM   9049  C  C2    . DT  I 5  145 ? -53.678 -40.272 86.942 1.00 112.36 ? 72   DT  I C2    1 
ATOM   9050  O  O2    . DT  I 5  145 ? -54.592 -41.052 87.151 1.00 121.87 ? 72   DT  I O2    1 
ATOM   9051  N  N3    . DT  I 5  145 ? -52.528 -40.649 86.294 1.00 110.65 ? 72   DT  I N3    1 
ATOM   9052  C  C4    . DT  I 5  145 ? -51.436 -39.855 86.001 1.00 113.27 ? 72   DT  I C4    1 
ATOM   9053  O  O4    . DT  I 5  145 ? -50.474 -40.336 85.408 1.00 114.47 ? 72   DT  I O4    1 
ATOM   9054  C  C5    . DT  I 5  145 ? -51.541 -38.478 86.434 1.00 114.36 ? 72   DT  I C5    1 
ATOM   9055  C  C7    . DT  I 5  145 ? -50.401 -37.544 86.174 1.00 112.94 ? 72   DT  I C7    1 
ATOM   9056  C  C6    . DT  I 5  145 ? -52.657 -38.102 87.072 1.00 119.09 ? 72   DT  I C6    1 
ATOM   9057  O  "O5'" . DA  J 6  1   ? -49.637 -50.184 84.954 1.00 133.32 ? -72  DA  J "O5'" 1 
ATOM   9058  C  "C5'" . DA  J 6  1   ? -50.909 -50.671 84.474 1.00 132.57 ? -72  DA  J "C5'" 1 
ATOM   9059  C  "C4'" . DA  J 6  1   ? -52.020 -50.309 85.436 1.00 131.22 ? -72  DA  J "C4'" 1 
ATOM   9060  O  "O4'" . DA  J 6  1   ? -51.494 -49.489 86.513 1.00 138.93 ? -72  DA  J "O4'" 1 
ATOM   9061  C  "C3'" . DA  J 6  1   ? -53.183 -49.531 84.822 1.00 128.67 ? -72  DA  J "C3'" 1 
ATOM   9062  O  "O3'" . DA  J 6  1   ? -54.202 -50.474 84.502 1.00 129.78 ? -72  DA  J "O3'" 1 
ATOM   9063  C  "C2'" . DA  J 6  1   ? -53.605 -48.572 85.934 1.00 125.49 ? -72  DA  J "C2'" 1 
ATOM   9064  C  "C1'" . DA  J 6  1   ? -52.291 -48.332 86.677 1.00 132.36 ? -72  DA  J "C1'" 1 
ATOM   9065  N  N9    . DA  J 6  1   ? -51.522 -47.171 86.221 1.00 132.73 ? -72  DA  J N9    1 
ATOM   9066  C  C8    . DA  J 6  1   ? -50.272 -47.176 85.652 1.00 128.85 ? -72  DA  J C8    1 
ATOM   9067  N  N7    . DA  J 6  1   ? -49.818 -45.980 85.363 1.00 125.12 ? -72  DA  J N7    1 
ATOM   9068  C  C5    . DA  J 6  1   ? -50.834 -45.129 85.772 1.00 123.44 ? -72  DA  J C5    1 
ATOM   9069  C  C6    . DA  J 6  1   ? -50.972 -43.727 85.732 1.00 116.76 ? -72  DA  J C6    1 
ATOM   9070  N  N6    . DA  J 6  1   ? -50.041 -42.903 85.243 1.00 112.65 ? -72  DA  J N6    1 
ATOM   9071  N  N1    . DA  J 6  1   ? -52.114 -43.193 86.218 1.00 107.13 ? -72  DA  J N1    1 
ATOM   9072  C  C2    . DA  J 6  1   ? -53.048 -44.018 86.709 1.00 114.62 ? -72  DA  J C2    1 
ATOM   9073  N  N3    . DA  J 6  1   ? -53.038 -45.349 86.798 1.00 125.33 ? -72  DA  J N3    1 
ATOM   9074  C  C4    . DA  J 6  1   ? -51.888 -45.848 86.310 1.00 129.37 ? -72  DA  J C4    1 
ATOM   9075  P  P     . DT  J 6  2   ? -55.707 -50.089 84.085 1.00 138.07 ? -71  DT  J P     1 
ATOM   9076  O  OP1   . DT  J 6  2   ? -56.428 -51.361 83.817 1.00 139.27 ? -71  DT  J OP1   1 
ATOM   9077  O  OP2   . DT  J 6  2   ? -55.663 -49.038 83.031 1.00 128.65 ? -71  DT  J OP2   1 
ATOM   9078  O  "O5'" . DT  J 6  2   ? -56.278 -49.479 85.442 1.00 138.98 ? -71  DT  J "O5'" 1 
ATOM   9079  C  "C5'" . DT  J 6  2   ? -57.690 -49.320 85.671 1.00 140.31 ? -71  DT  J "C5'" 1 
ATOM   9080  C  "C4'" . DT  J 6  2   ? -58.124 -47.926 85.283 1.00 139.10 ? -71  DT  J "C4'" 1 
ATOM   9081  O  "O4'" . DT  J 6  2   ? -57.006 -47.009 85.360 1.00 137.43 ? -71  DT  J "O4'" 1 
ATOM   9082  C  "C3'" . DT  J 6  2   ? -58.662 -47.814 83.853 1.00 143.37 ? -71  DT  J "C3'" 1 
ATOM   9083  O  "O3'" . DT  J 6  2   ? -60.092 -47.704 83.812 1.00 148.65 ? -71  DT  J "O3'" 1 
ATOM   9084  C  "C2'" . DT  J 6  2   ? -57.993 -46.571 83.287 1.00 145.61 ? -71  DT  J "C2'" 1 
ATOM   9085  C  "C1'" . DT  J 6  2   ? -57.271 -45.942 84.471 1.00 139.15 ? -71  DT  J "C1'" 1 
ATOM   9086  N  N1    . DT  J 6  2   ? -55.986 -45.297 84.100 1.00 133.50 ? -71  DT  J N1    1 
ATOM   9087  C  C2    . DT  J 6  2   ? -55.945 -43.919 84.062 1.00 122.20 ? -71  DT  J C2    1 
ATOM   9088  O  O2    . DT  J 6  2   ? -56.893 -43.212 84.369 1.00 111.84 ? -71  DT  J O2    1 
ATOM   9089  N  N3    . DT  J 6  2   ? -54.740 -43.394 83.665 1.00 113.70 ? -71  DT  J N3    1 
ATOM   9090  C  C4    . DT  J 6  2   ? -53.605 -44.091 83.292 1.00 112.75 ? -71  DT  J C4    1 
ATOM   9091  O  O4    . DT  J 6  2   ? -52.592 -43.480 82.966 1.00 106.12 ? -71  DT  J O4    1 
ATOM   9092  C  C5    . DT  J 6  2   ? -53.726 -45.532 83.333 1.00 117.35 ? -71  DT  J C5    1 
ATOM   9093  C  C7    . DT  J 6  2   ? -52.549 -46.371 82.945 1.00 112.47 ? -71  DT  J C7    1 
ATOM   9094  C  C6    . DT  J 6  2   ? -54.897 -46.055 83.722 1.00 126.25 ? -71  DT  J C6    1 
ATOM   9095  P  P     . DC  J 6  3   ? -60.974 -46.599 84.592 1.00 157.36 ? -70  DC  J P     1 
ATOM   9096  O  OP1   . DC  J 6  3   ? -60.667 -46.706 86.046 1.00 154.70 ? -70  DC  J OP1   1 
ATOM   9097  O  OP2   . DC  J 6  3   ? -62.385 -46.722 84.136 1.00 154.12 ? -70  DC  J OP2   1 
ATOM   9098  O  "O5'" . DC  J 6  3   ? -60.467 -45.174 84.085 1.00 152.91 ? -70  DC  J "O5'" 1 
ATOM   9099  C  "C5'" . DC  J 6  3   ? -60.955 -43.961 84.695 1.00 142.82 ? -70  DC  J "C5'" 1 
ATOM   9100  C  "C4'" . DC  J 6  3   ? -60.947 -42.812 83.709 1.00 137.12 ? -70  DC  J "C4'" 1 
ATOM   9101  O  "O4'" . DC  J 6  3   ? -59.601 -42.598 83.197 1.00 139.61 ? -70  DC  J "O4'" 1 
ATOM   9102  C  "C3'" . DC  J 6  3   ? -61.851 -42.943 82.485 1.00 131.48 ? -70  DC  J "C3'" 1 
ATOM   9103  O  "O3'" . DC  J 6  3   ? -62.385 -41.646 82.252 1.00 135.98 ? -70  DC  J "O3'" 1 
ATOM   9104  C  "C2'" . DC  J 6  3   ? -60.870 -43.286 81.367 1.00 133.68 ? -70  DC  J "C2'" 1 
ATOM   9105  C  "C1'" . DC  J 6  3   ? -59.653 -42.465 81.790 1.00 138.72 ? -70  DC  J "C1'" 1 
ATOM   9106  N  N1    . DC  J 6  3   ? -58.360 -42.906 81.233 1.00 134.90 ? -70  DC  J N1    1 
ATOM   9107  C  C2    . DC  J 6  3   ? -57.343 -41.959 81.059 1.00 127.29 ? -70  DC  J C2    1 
ATOM   9108  O  O2    . DC  J 6  3   ? -57.568 -40.775 81.355 1.00 115.65 ? -70  DC  J O2    1 
ATOM   9109  N  N3    . DC  J 6  3   ? -56.146 -42.357 80.566 1.00 124.36 ? -70  DC  J N3    1 
ATOM   9110  C  C4    . DC  J 6  3   ? -55.946 -43.640 80.254 1.00 128.23 ? -70  DC  J C4    1 
ATOM   9111  N  N4    . DC  J 6  3   ? -54.752 -43.988 79.768 1.00 121.95 ? -70  DC  J N4    1 
ATOM   9112  C  C5    . DC  J 6  3   ? -56.964 -44.625 80.423 1.00 129.48 ? -70  DC  J C5    1 
ATOM   9113  C  C6    . DC  J 6  3   ? -58.144 -44.218 80.911 1.00 128.42 ? -70  DC  J C6    1 
ATOM   9114  P  P     . DA  J 6  4   ? -63.585 -41.384 81.229 1.00 146.89 ? -69  DA  J P     1 
ATOM   9115  O  OP1   . DA  J 6  4   ? -64.815 -41.772 81.965 1.00 145.52 ? -69  DA  J OP1   1 
ATOM   9116  O  OP2   . DA  J 6  4   ? -63.259 -42.059 79.938 1.00 134.32 ? -69  DA  J OP2   1 
ATOM   9117  O  "O5'" . DA  J 6  4   ? -63.677 -39.804 81.006 1.00 140.49 ? -69  DA  J "O5'" 1 
ATOM   9118  C  "C5'" . DA  J 6  4   ? -62.629 -38.899 81.423 1.00 132.92 ? -69  DA  J "C5'" 1 
ATOM   9119  C  "C4'" . DA  J 6  4   ? -61.965 -38.246 80.226 1.00 122.96 ? -69  DA  J "C4'" 1 
ATOM   9120  O  "O4'" . DA  J 6  4   ? -60.723 -38.945 79.913 1.00 116.57 ? -69  DA  J "O4'" 1 
ATOM   9121  C  "C3'" . DA  J 6  4   ? -62.768 -38.222 78.917 1.00 122.79 ? -69  DA  J "C3'" 1 
ATOM   9122  O  "O3'" . DA  J 6  4   ? -62.497 -37.033 78.189 1.00 121.55 ? -69  DA  J "O3'" 1 
ATOM   9123  C  "C2'" . DA  J 6  4   ? -62.103 -39.317 78.092 1.00 123.53 ? -69  DA  J "C2'" 1 
ATOM   9124  C  "C1'" . DA  J 6  4   ? -60.651 -39.125 78.514 1.00 119.12 ? -69  DA  J "C1'" 1 
ATOM   9125  N  N9    . DA  J 6  4   ? -59.718 -40.211 78.202 1.00 115.56 ? -69  DA  J N9    1 
ATOM   9126  C  C8    . DA  J 6  4   ? -59.922 -41.570 78.171 1.00 113.66 ? -69  DA  J C8    1 
ATOM   9127  N  N7    . DA  J 6  4   ? -58.858 -42.256 77.830 1.00 107.33 ? -69  DA  J N7    1 
ATOM   9128  C  C5    . DA  J 6  4   ? -57.893 -41.284 77.605 1.00 103.41 ? -69  DA  J C5    1 
ATOM   9129  C  C6    . DA  J 6  4   ? -56.545 -41.360 77.213 1.00 96.54  ? -69  DA  J C6    1 
ATOM   9130  N  N6    . DA  J 6  4   ? -55.908 -42.507 76.972 1.00 94.06  ? -69  DA  J N6    1 
ATOM   9131  N  N1    . DA  J 6  4   ? -55.863 -40.201 77.084 1.00 92.76  ? -69  DA  J N1    1 
ATOM   9132  C  C2    . DA  J 6  4   ? -56.501 -39.050 77.330 1.00 92.34  ? -69  DA  J C2    1 
ATOM   9133  N  N3    . DA  J 6  4   ? -57.761 -38.849 77.703 1.00 99.42  ? -69  DA  J N3    1 
ATOM   9134  C  C4    . DA  J 6  4   ? -58.411 -40.020 77.825 1.00 107.83 ? -69  DA  J C4    1 
ATOM   9135  P  P     . DA  J 6  5   ? -63.390 -35.722 78.274 1.00 129.63 ? -68  DA  J P     1 
ATOM   9136  O  OP1   . DA  J 6  5   ? -63.422 -35.316 79.709 1.00 128.44 ? -68  DA  J OP1   1 
ATOM   9137  O  OP2   . DA  J 6  5   ? -64.653 -35.983 77.534 1.00 135.01 ? -68  DA  J OP2   1 
ATOM   9138  O  "O5'" . DA  J 6  5   ? -62.553 -34.673 77.412 1.00 138.05 ? -68  DA  J "O5'" 1 
ATOM   9139  C  "C5'" . DA  J 6  5   ? -61.305 -34.131 77.911 1.00 143.98 ? -68  DA  J "C5'" 1 
ATOM   9140  C  "C4'" . DA  J 6  5   ? -60.278 -33.967 76.805 1.00 129.50 ? -68  DA  J "C4'" 1 
ATOM   9141  O  "O4'" . DA  J 6  5   ? -59.548 -35.208 76.601 1.00 121.94 ? -68  DA  J "O4'" 1 
ATOM   9142  C  "C3'" . DA  J 6  5   ? -60.798 -33.526 75.434 1.00 123.79 ? -68  DA  J "C3'" 1 
ATOM   9143  O  "O3'" . DA  J 6  5   ? -59.986 -32.439 75.014 1.00 121.81 ? -68  DA  J "O3'" 1 
ATOM   9144  C  "C2'" . DA  J 6  5   ? -60.654 -34.780 74.568 1.00 112.02 ? -68  DA  J "C2'" 1 
ATOM   9145  C  "C1'" . DA  J 6  5   ? -59.458 -35.476 75.219 1.00 119.03 ? -68  DA  J "C1'" 1 
ATOM   9146  N  N9    . DA  J 6  5   ? -59.448 -36.927 75.036 1.00 120.01 ? -68  DA  J N9    1 
ATOM   9147  C  C8    . DA  J 6  5   ? -60.484 -37.806 75.233 1.00 127.05 ? -68  DA  J C8    1 
ATOM   9148  N  N7    . DA  J 6  5   ? -60.171 -39.056 74.989 1.00 121.79 ? -68  DA  J N7    1 
ATOM   9149  C  C5    . DA  J 6  5   ? -58.838 -38.997 74.607 1.00 111.41 ? -68  DA  J C5    1 
ATOM   9150  C  C6    . DA  J 6  5   ? -57.919 -39.990 74.219 1.00 111.36 ? -68  DA  J C6    1 
ATOM   9151  N  N6    . DA  J 6  5   ? -58.216 -41.289 74.147 1.00 112.65 ? -68  DA  J N6    1 
ATOM   9152  N  N1    . DA  J 6  5   ? -56.668 -39.596 73.897 1.00 111.52 ? -68  DA  J N1    1 
ATOM   9153  C  C2    . DA  J 6  5   ? -56.369 -38.293 73.969 1.00 117.22 ? -68  DA  J C2    1 
ATOM   9154  N  N3    . DA  J 6  5   ? -57.143 -37.267 74.321 1.00 114.29 ? -68  DA  J N3    1 
ATOM   9155  C  C4    . DA  J 6  5   ? -58.379 -37.692 74.634 1.00 113.16 ? -68  DA  J C4    1 
ATOM   9156  P  P     . DT  J 6  6   ? -60.402 -31.468 73.817 1.00 126.34 ? -67  DT  J P     1 
ATOM   9157  O  OP1   . DT  J 6  6   ? -60.039 -30.093 74.267 1.00 108.92 ? -67  DT  J OP1   1 
ATOM   9158  O  OP2   . DT  J 6  6   ? -61.792 -31.770 73.378 1.00 108.55 ? -67  DT  J OP2   1 
ATOM   9159  O  "O5'" . DT  J 6  6   ? -59.425 -31.977 72.663 1.00 124.95 ? -67  DT  J "O5'" 1 
ATOM   9160  C  "C5'" . DT  J 6  6   ? -58.027 -32.206 72.932 1.00 123.42 ? -67  DT  J "C5'" 1 
ATOM   9161  C  "C4'" . DT  J 6  6   ? -57.408 -33.123 71.900 1.00 119.23 ? -67  DT  J "C4'" 1 
ATOM   9162  O  "O4'" . DT  J 6  6   ? -57.717 -34.517 72.158 1.00 116.22 ? -67  DT  J "O4'" 1 
ATOM   9163  C  "C3'" . DT  J 6  6   ? -57.801 -32.857 70.441 1.00 116.94 ? -67  DT  J "C3'" 1 
ATOM   9164  O  "O3'" . DT  J 6  6   ? -56.598 -32.637 69.698 1.00 116.42 ? -67  DT  J "O3'" 1 
ATOM   9165  C  "C2'" . DT  J 6  6   ? -58.436 -34.164 69.991 1.00 111.52 ? -67  DT  J "C2'" 1 
ATOM   9166  C  "C1'" . DT  J 6  6   ? -57.754 -35.163 70.902 1.00 111.55 ? -67  DT  J "C1'" 1 
ATOM   9167  N  N1    . DT  J 6  6   ? -58.435 -36.471 71.054 1.00 113.01 ? -67  DT  J N1    1 
ATOM   9168  C  C2    . DT  J 6  6   ? -57.684 -37.608 70.847 1.00 113.03 ? -67  DT  J C2    1 
ATOM   9169  O  O2    . DT  J 6  6   ? -56.491 -37.583 70.591 1.00 108.03 ? -67  DT  J O2    1 
ATOM   9170  N  N3    . DT  J 6  6   ? -58.383 -38.785 70.964 1.00 115.34 ? -67  DT  J N3    1 
ATOM   9171  C  C4    . DT  J 6  6   ? -59.726 -38.935 71.255 1.00 118.62 ? -67  DT  J C4    1 
ATOM   9172  O  O4    . DT  J 6  6   ? -60.211 -40.061 71.338 1.00 116.48 ? -67  DT  J O4    1 
ATOM   9173  C  C5    . DT  J 6  6   ? -60.458 -37.699 71.440 1.00 121.10 ? -67  DT  J C5    1 
ATOM   9174  C  C7    . DT  J 6  6   ? -61.920 -37.759 71.755 1.00 122.16 ? -67  DT  J C7    1 
ATOM   9175  C  C6    . DT  J 6  6   ? -59.786 -36.545 71.321 1.00 116.53 ? -67  DT  J C6    1 
ATOM   9176  P  P     . DA  J 6  7   ? -56.479 -31.901 68.277 1.00 112.23 ? -66  DA  J P     1 
ATOM   9177  O  OP1   . DA  J 6  7   ? -56.189 -30.473 68.567 1.00 108.56 ? -66  DA  J OP1   1 
ATOM   9178  O  OP2   . DA  J 6  7   ? -57.579 -32.270 67.348 1.00 100.99 ? -66  DA  J OP2   1 
ATOM   9179  O  "O5'" . DA  J 6  7   ? -55.170 -32.594 67.699 1.00 104.47 ? -66  DA  J "O5'" 1 
ATOM   9180  C  "C5'" . DA  J 6  7   ? -54.177 -33.151 68.578 1.00 96.34  ? -66  DA  J "C5'" 1 
ATOM   9181  C  "C4'" . DA  J 6  7   ? -53.723 -34.490 68.056 1.00 103.33 ? -66  DA  J "C4'" 1 
ATOM   9182  O  "O4'" . DA  J 6  7   ? -54.729 -35.497 68.353 1.00 107.40 ? -66  DA  J "O4'" 1 
ATOM   9183  C  "C3'" . DA  J 6  7   ? -53.477 -34.564 66.545 1.00 106.58 ? -66  DA  J "C3'" 1 
ATOM   9184  O  "O3'" . DA  J 6  7   ? -52.211 -35.175 66.307 1.00 104.84 ? -66  DA  J "O3'" 1 
ATOM   9185  C  "C2'" . DA  J 6  7   ? -54.649 -35.405 66.035 1.00 107.36 ? -66  DA  J "C2'" 1 
ATOM   9186  C  "C1'" . DA  J 6  7   ? -54.896 -36.327 67.225 1.00 106.57 ? -66  DA  J "C1'" 1 
ATOM   9187  N  N9    . DA  J 6  7   ? -56.232 -36.932 67.274 1.00 104.40 ? -66  DA  J N9    1 
ATOM   9188  C  C8    . DA  J 6  7   ? -57.444 -36.304 67.426 1.00 98.98  ? -66  DA  J C8    1 
ATOM   9189  N  N7    . DA  J 6  7   ? -58.468 -37.123 67.428 1.00 99.87  ? -66  DA  J N7    1 
ATOM   9190  C  C5    . DA  J 6  7   ? -57.893 -38.376 67.267 1.00 99.80  ? -66  DA  J C5    1 
ATOM   9191  C  C6    . DA  J 6  7   ? -58.443 -39.669 67.193 1.00 99.13  ? -66  DA  J C6    1 
ATOM   9192  N  N6    . DA  J 6  7   ? -59.750 -39.925 67.276 1.00 94.58  ? -66  DA  J N6    1 
ATOM   9193  N  N1    . DA  J 6  7   ? -57.592 -40.704 67.025 1.00 100.76 ? -66  DA  J N1    1 
ATOM   9194  C  C2    . DA  J 6  7   ? -56.280 -40.449 66.940 1.00 93.83  ? -66  DA  J C2    1 
ATOM   9195  N  N3    . DA  J 6  7   ? -55.644 -39.282 66.998 1.00 89.45  ? -66  DA  J N3    1 
ATOM   9196  C  C4    . DA  J 6  7   ? -56.516 -38.273 67.167 1.00 96.06  ? -66  DA  J C4    1 
ATOM   9197  P  P     . DT  J 6  8   ? -51.547 -35.216 64.854 1.00 98.73  ? -65  DT  J P     1 
ATOM   9198  O  OP1   . DT  J 6  8   ? -50.086 -35.302 65.068 1.00 95.95  ? -65  DT  J OP1   1 
ATOM   9199  O  OP2   . DT  J 6  8   ? -52.119 -34.135 64.001 1.00 93.95  ? -65  DT  J OP2   1 
ATOM   9200  O  "O5'" . DT  J 6  8   ? -51.985 -36.646 64.307 1.00 99.09  ? -65  DT  J "O5'" 1 
ATOM   9201  C  "C5'" . DT  J 6  8   ? -51.560 -37.840 64.989 1.00 98.90  ? -65  DT  J "C5'" 1 
ATOM   9202  C  "C4'" . DT  J 6  8   ? -52.160 -39.068 64.343 1.00 103.10 ? -65  DT  J "C4'" 1 
ATOM   9203  O  "O4'" . DT  J 6  8   ? -53.567 -39.190 64.667 1.00 110.82 ? -65  DT  J "O4'" 1 
ATOM   9204  C  "C3'" . DT  J 6  8   ? -52.064 -39.120 62.813 1.00 100.23 ? -65  DT  J "C3'" 1 
ATOM   9205  O  "O3'" . DT  J 6  8   ? -51.383 -40.334 62.482 1.00 105.84 ? -65  DT  J "O3'" 1 
ATOM   9206  C  "C2'" . DT  J 6  8   ? -53.513 -39.153 62.349 1.00 103.59 ? -65  DT  J "C2'" 1 
ATOM   9207  C  "C1'" . DT  J 6  8   ? -54.223 -39.757 63.548 1.00 104.42 ? -65  DT  J "C1'" 1 
ATOM   9208  N  N1    . DT  J 6  8   ? -55.673 -39.472 63.662 1.00 98.68  ? -65  DT  J N1    1 
ATOM   9209  C  C2    . DT  J 6  8   ? -56.538 -40.530 63.842 1.00 97.22  ? -65  DT  J C2    1 
ATOM   9210  O  O2    . DT  J 6  8   ? -56.167 -41.691 63.916 1.00 98.47  ? -65  DT  J O2    1 
ATOM   9211  N  N3    . DT  J 6  8   ? -57.861 -40.176 63.942 1.00 94.23  ? -65  DT  J N3    1 
ATOM   9212  C  C4    . DT  J 6  8   ? -58.393 -38.901 63.875 1.00 98.46  ? -65  DT  J C4    1 
ATOM   9213  O  O4    . DT  J 6  8   ? -59.604 -38.736 63.986 1.00 107.11 ? -65  DT  J O4    1 
ATOM   9214  C  C5    . DT  J 6  8   ? -57.430 -37.842 63.677 1.00 99.41  ? -65  DT  J C5    1 
ATOM   9215  C  C7    . DT  J 6  8   ? -57.913 -36.427 63.601 1.00 94.28  ? -65  DT  J C7    1 
ATOM   9216  C  C6    . DT  J 6  8   ? -56.137 -38.176 63.581 1.00 101.48 ? -65  DT  J C6    1 
ATOM   9217  P  P     . DC  J 6  9   ? -50.885 -40.776 61.026 1.00 105.96 ? -64  DC  J P     1 
ATOM   9218  O  OP1   . DC  J 6  9   ? -49.541 -41.385 61.220 1.00 91.48  ? -64  DC  J OP1   1 
ATOM   9219  O  OP2   . DC  J 6  9   ? -51.068 -39.650 60.064 1.00 99.67  ? -64  DC  J OP2   1 
ATOM   9220  O  "O5'" . DC  J 6  9   ? -51.877 -41.960 60.627 1.00 108.74 ? -64  DC  J "O5'" 1 
ATOM   9221  C  "C5'" . DC  J 6  9   ? -52.000 -43.155 61.430 1.00 107.90 ? -64  DC  J "C5'" 1 
ATOM   9222  C  "C4'" . DC  J 6  9   ? -53.237 -43.917 61.022 1.00 107.67 ? -64  DC  J "C4'" 1 
ATOM   9223  O  "O4'" . DC  J 6  9   ? -54.401 -43.203 61.486 1.00 108.00 ? -64  DC  J "O4'" 1 
ATOM   9224  C  "C3'" . DC  J 6  9   ? -53.425 -44.050 59.515 1.00 109.99 ? -64  DC  J "C3'" 1 
ATOM   9225  O  "O3'" . DC  J 6  9   ? -52.926 -45.311 59.077 1.00 113.63 ? -64  DC  J "O3'" 1 
ATOM   9226  C  "C2'" . DC  J 6  9   ? -54.938 -43.922 59.284 1.00 111.66 ? -64  DC  J "C2'" 1 
ATOM   9227  C  "C1'" . DC  J 6  9   ? -55.490 -43.513 60.653 1.00 105.18 ? -64  DC  J "C1'" 1 
ATOM   9228  N  N1    . DC  J 6  9   ? -56.367 -42.334 60.589 1.00 100.12 ? -64  DC  J N1    1 
ATOM   9229  C  C2    . DC  J 6  9   ? -57.755 -42.513 60.626 1.00 105.32 ? -64  DC  J C2    1 
ATOM   9230  O  O2    . DC  J 6  9   ? -58.209 -43.665 60.712 1.00 109.40 ? -64  DC  J O2    1 
ATOM   9231  N  N3    . DC  J 6  9   ? -58.563 -41.428 60.568 1.00 104.32 ? -64  DC  J N3    1 
ATOM   9232  C  C4    . DC  J 6  9   ? -58.032 -40.205 60.478 1.00 95.60  ? -64  DC  J C4    1 
ATOM   9233  N  N4    . DC  J 6  9   ? -58.863 -39.162 60.427 1.00 93.23  ? -64  DC  J N4    1 
ATOM   9234  C  C5    . DC  J 6  9   ? -56.623 -39.996 60.435 1.00 96.73  ? -64  DC  J C5    1 
ATOM   9235  C  C6    . DC  J 6  9   ? -55.836 -41.079 60.488 1.00 96.07  ? -64  DC  J C6    1 
ATOM   9236  P  P     . DC  J 6  10  ? -52.655 -45.613 57.523 1.00 109.09 ? -63  DC  J P     1 
ATOM   9237  O  OP1   . DC  J 6  10  ? -51.615 -46.672 57.406 1.00 103.42 ? -63  DC  J OP1   1 
ATOM   9238  O  OP2   . DC  J 6  10  ? -52.467 -44.314 56.828 1.00 107.43 ? -63  DC  J OP2   1 
ATOM   9239  O  "O5'" . DC  J 6  10  ? -54.040 -46.228 57.031 1.00 110.30 ? -63  DC  J "O5'" 1 
ATOM   9240  C  "C5'" . DC  J 6  10  ? -54.682 -47.289 57.763 1.00 112.91 ? -63  DC  J "C5'" 1 
ATOM   9241  C  "C4'" . DC  J 6  10  ? -56.130 -47.388 57.359 1.00 113.85 ? -63  DC  J "C4'" 1 
ATOM   9242  O  "O4'" . DC  J 6  10  ? -56.840 -46.232 57.856 1.00 112.44 ? -63  DC  J "O4'" 1 
ATOM   9243  C  "C3'" . DC  J 6  10  ? -56.371 -47.437 55.851 1.00 117.10 ? -63  DC  J "C3'" 1 
ATOM   9244  O  "O3'" . DC  J 6  10  ? -56.924 -48.692 55.485 1.00 124.79 ? -63  DC  J "O3'" 1 
ATOM   9245  C  "C2'" . DC  J 6  10  ? -57.321 -46.269 55.556 1.00 110.04 ? -63  DC  J "C2'" 1 
ATOM   9246  C  "C1'" . DC  J 6  10  ? -57.844 -45.887 56.940 1.00 108.25 ? -63  DC  J "C1'" 1 
ATOM   9247  N  N1    . DC  J 6  10  ? -58.087 -44.445 57.059 1.00 105.24 ? -63  DC  J N1    1 
ATOM   9248  C  C2    . DC  J 6  10  ? -59.345 -44.001 57.479 1.00 109.23 ? -63  DC  J C2    1 
ATOM   9249  O  O2    . DC  J 6  10  ? -60.215 -44.841 57.756 1.00 119.46 ? -63  DC  J O2    1 
ATOM   9250  N  N3    . DC  J 6  10  ? -59.580 -42.672 57.573 1.00 103.97 ? -63  DC  J N3    1 
ATOM   9251  C  C4    . DC  J 6  10  ? -58.615 -41.801 57.264 1.00 103.79 ? -63  DC  J C4    1 
ATOM   9252  N  N4    . DC  J 6  10  ? -58.888 -40.500 57.378 1.00 103.32 ? -63  DC  J N4    1 
ATOM   9253  C  C5    . DC  J 6  10  ? -57.326 -42.226 56.827 1.00 100.73 ? -63  DC  J C5    1 
ATOM   9254  C  C6    . DC  J 6  10  ? -57.110 -43.544 56.733 1.00 100.89 ? -63  DC  J C6    1 
ATOM   9255  P  P     . DA  J 6  11  ? -57.072 -49.103 53.947 1.00 128.37 ? -62  DA  J P     1 
ATOM   9256  O  OP1   . DA  J 6  11  ? -56.931 -50.584 53.904 1.00 120.43 ? -62  DA  J OP1   1 
ATOM   9257  O  OP2   . DA  J 6  11  ? -56.225 -48.245 53.069 1.00 117.03 ? -62  DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  J 6  11  ? -58.593 -48.715 53.692 1.00 123.07 ? -62  DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  J 6  11  ? -59.647 -49.367 54.420 1.00 122.17 ? -62  DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  J 6  11  ? -60.962 -48.738 54.052 1.00 114.43 ? -62  DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  J 6  11  ? -60.993 -47.409 54.610 1.00 112.80 ? -62  DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  J 6  11  ? -61.177 -48.588 52.546 1.00 111.21 ? -62  DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  J 6  11  ? -62.155 -49.516 52.069 1.00 118.24 ? -62  DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  J 6  11  ? -61.558 -47.115 52.335 1.00 114.29 ? -62  DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  J 6  11  ? -61.712 -46.565 53.753 1.00 114.39 ? -62  DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  J 6  11  ? -61.155 -45.220 53.880 1.00 117.92 ? -62  DA  J N9    1 
ATOM   9267  C  C8    . DA  J 6  11  ? -59.849 -44.837 53.692 1.00 113.55 ? -62  DA  J C8    1 
ATOM   9268  N  N7    . DA  J 6  11  ? -59.642 -43.556 53.876 1.00 109.79 ? -62  DA  J N7    1 
ATOM   9269  C  C5    . DA  J 6  11  ? -60.896 -43.059 54.203 1.00 113.23 ? -62  DA  J C5    1 
ATOM   9270  C  C6    . DA  J 6  11  ? -61.351 -41.763 54.512 1.00 115.55 ? -62  DA  J C6    1 
ATOM   9271  N  N6    . DA  J 6  11  ? -60.560 -40.688 54.544 1.00 109.78 ? -62  DA  J N6    1 
ATOM   9272  N  N1    . DA  J 6  11  ? -62.665 -41.606 54.786 1.00 116.34 ? -62  DA  J N1    1 
ATOM   9273  C  C2    . DA  J 6  11  ? -63.459 -42.685 54.753 1.00 117.40 ? -62  DA  J C2    1 
ATOM   9274  N  N3    . DA  J 6  11  ? -63.150 -43.952 54.477 1.00 118.99 ? -62  DA  J N3    1 
ATOM   9275  C  C4    . DA  J 6  11  ? -61.839 -44.072 54.206 1.00 118.56 ? -62  DA  J C4    1 
ATOM   9276  P  P     . DC  J 6  12  ? -62.550 -49.666 50.508 1.00 117.75 ? -61  DC  J P     1 
ATOM   9277  O  OP1   . DC  J 6  12  ? -63.082 -51.036 50.285 1.00 107.58 ? -61  DC  J OP1   1 
ATOM   9278  O  OP2   . DC  J 6  12  ? -61.413 -49.191 49.673 1.00 115.64 ? -61  DC  J OP2   1 
ATOM   9279  O  "O5'" . DC  J 6  12  ? -63.756 -48.635 50.338 1.00 110.63 ? -61  DC  J "O5'" 1 
ATOM   9280  C  "C5'" . DC  J 6  12  ? -64.629 -48.294 51.443 1.00 113.09 ? -61  DC  J "C5'" 1 
ATOM   9281  C  "C4'" . DC  J 6  12  ? -65.464 -47.084 51.093 1.00 116.80 ? -61  DC  J "C4'" 1 
ATOM   9282  O  "O4'" . DC  J 6  12  ? -64.808 -45.882 51.589 1.00 124.34 ? -61  DC  J "O4'" 1 
ATOM   9283  C  "C3'" . DC  J 6  12  ? -65.686 -46.861 49.594 1.00 115.95 ? -61  DC  J "C3'" 1 
ATOM   9284  O  "O3'" . DC  J 6  12  ? -67.037 -46.551 49.260 1.00 115.33 ? -61  DC  J "O3'" 1 
ATOM   9285  C  "C2'" . DC  J 6  12  ? -64.781 -45.674 49.277 1.00 124.86 ? -61  DC  J "C2'" 1 
ATOM   9286  C  "C1'" . DC  J 6  12  ? -64.852 -44.889 50.583 1.00 128.06 ? -61  DC  J "C1'" 1 
ATOM   9287  N  N1    . DC  J 6  12  ? -63.718 -43.962 50.755 1.00 126.56 ? -61  DC  J N1    1 
ATOM   9288  C  C2    . DC  J 6  12  ? -63.974 -42.616 51.057 1.00 123.29 ? -61  DC  J C2    1 
ATOM   9289  O  O2    . DC  J 6  12  ? -65.149 -42.246 51.209 1.00 117.11 ? -61  DC  J O2    1 
ATOM   9290  N  N3    . DC  J 6  12  ? -62.933 -41.759 51.188 1.00 118.87 ? -61  DC  J N3    1 
ATOM   9291  C  C4    . DC  J 6  12  ? -61.683 -42.196 51.010 1.00 109.38 ? -61  DC  J C4    1 
ATOM   9292  N  N4    . DC  J 6  12  ? -60.687 -41.321 51.154 1.00 91.61  ? -61  DC  J N4    1 
ATOM   9293  C  C5    . DC  J 6  12  ? -61.398 -43.554 50.682 1.00 119.48 ? -61  DC  J C5    1 
ATOM   9294  C  C6    . DC  J 6  12  ? -62.436 -44.391 50.553 1.00 123.11 ? -61  DC  J C6    1 
ATOM   9295  P  P     . DC  J 6  13  ? -67.454 -46.143 47.752 1.00 114.75 ? -60  DC  J P     1 
ATOM   9296  O  OP1   . DC  J 6  13  ? -68.836 -46.645 47.531 1.00 113.77 ? -60  DC  J OP1   1 
ATOM   9297  O  OP2   . DC  J 6  13  ? -66.379 -46.508 46.784 1.00 104.28 ? -60  DC  J OP2   1 
ATOM   9298  O  "O5'" . DC  J 6  13  ? -67.541 -44.554 47.829 1.00 110.99 ? -60  DC  J "O5'" 1 
ATOM   9299  C  "C5'" . DC  J 6  13  ? -68.552 -43.903 48.629 1.00 117.41 ? -60  DC  J "C5'" 1 
ATOM   9300  C  "C4'" . DC  J 6  13  ? -68.693 -42.460 48.206 1.00 122.07 ? -60  DC  J "C4'" 1 
ATOM   9301  O  "O4'" . DC  J 6  13  ? -67.486 -41.740 48.586 1.00 127.36 ? -60  DC  J "O4'" 1 
ATOM   9302  C  "C3'" . DC  J 6  13  ? -68.877 -42.226 46.706 1.00 125.44 ? -60  DC  J "C3'" 1 
ATOM   9303  O  "O3'" . DC  J 6  13  ? -69.814 -41.177 46.458 1.00 136.38 ? -60  DC  J "O3'" 1 
ATOM   9304  C  "C2'" . DC  J 6  13  ? -67.479 -41.822 46.252 1.00 127.94 ? -60  DC  J "C2'" 1 
ATOM   9305  C  "C1'" . DC  J 6  13  ? -66.988 -41.036 47.466 1.00 127.53 ? -60  DC  J "C1'" 1 
ATOM   9306  N  N1    . DC  J 6  13  ? -65.518 -40.954 47.558 1.00 123.78 ? -60  DC  J N1    1 
ATOM   9307  C  C2    . DC  J 6  13  ? -64.922 -39.709 47.799 1.00 121.84 ? -60  DC  J C2    1 
ATOM   9308  O  O2    . DC  J 6  13  ? -65.648 -38.716 47.966 1.00 122.07 ? -60  DC  J O2    1 
ATOM   9309  N  N3    . DC  J 6  13  ? -63.572 -39.623 47.855 1.00 112.26 ? -60  DC  J N3    1 
ATOM   9310  C  C4    . DC  J 6  13  ? -62.825 -40.716 47.672 1.00 112.45 ? -60  DC  J C4    1 
ATOM   9311  N  N4    . DC  J 6  13  ? -61.500 -40.586 47.745 1.00 109.35 ? -60  DC  J N4    1 
ATOM   9312  C  C5    . DC  J 6  13  ? -63.406 -41.992 47.412 1.00 116.22 ? -60  DC  J C5    1 
ATOM   9313  C  C6    . DC  J 6  13  ? -64.743 -42.064 47.359 1.00 116.25 ? -60  DC  J C6    1 
ATOM   9314  P  P     . DT  J 6  14  ? -70.295 -40.760 44.973 1.00 138.63 ? -59  DT  J P     1 
ATOM   9315  O  OP1   . DT  J 6  14  ? -71.603 -41.428 44.738 1.00 126.76 ? -59  DT  J OP1   1 
ATOM   9316  O  OP2   . DT  J 6  14  ? -69.184 -40.985 44.002 1.00 131.82 ? -59  DT  J OP2   1 
ATOM   9317  O  "O5'" . DT  J 6  14  ? -70.582 -39.192 45.083 1.00 131.93 ? -59  DT  J "O5'" 1 
ATOM   9318  C  "C5'" . DT  J 6  14  ? -69.867 -38.346 46.009 1.00 133.40 ? -59  DT  J "C5'" 1 
ATOM   9319  C  "C4'" . DT  J 6  14  ? -68.988 -37.352 45.280 1.00 141.02 ? -59  DT  J "C4'" 1 
ATOM   9320  O  "O4'" . DT  J 6  14  ? -67.588 -37.694 45.455 1.00 136.63 ? -59  DT  J "O4'" 1 
ATOM   9321  C  "C3'" . DT  J 6  14  ? -69.211 -37.228 43.765 1.00 143.78 ? -59  DT  J "C3'" 1 
ATOM   9322  O  "O3'" . DT  J 6  14  ? -69.348 -35.855 43.378 1.00 142.90 ? -59  DT  J "O3'" 1 
ATOM   9323  C  "C2'" . DT  J 6  14  ? -67.920 -37.755 43.161 1.00 140.80 ? -59  DT  J "C2'" 1 
ATOM   9324  C  "C1'" . DT  J 6  14  ? -66.924 -37.391 44.240 1.00 140.87 ? -59  DT  J "C1'" 1 
ATOM   9325  N  N1    . DT  J 6  14  ? -65.651 -38.139 44.194 1.00 134.65 ? -59  DT  J N1    1 
ATOM   9326  C  C2    . DT  J 6  14  ? -64.477 -37.421 44.262 1.00 130.49 ? -59  DT  J C2    1 
ATOM   9327  O  O2    . DT  J 6  14  ? -64.442 -36.208 44.394 1.00 134.52 ? -59  DT  J O2    1 
ATOM   9328  N  N3    . DT  J 6  14  ? -63.336 -38.180 44.185 1.00 124.61 ? -59  DT  J N3    1 
ATOM   9329  C  C4    . DT  J 6  14  ? -63.254 -39.551 44.035 1.00 133.90 ? -59  DT  J C4    1 
ATOM   9330  O  O4    . DT  J 6  14  ? -62.155 -40.094 43.983 1.00 135.07 ? -59  DT  J O4    1 
ATOM   9331  C  C5    . DT  J 6  14  ? -64.524 -40.240 43.951 1.00 139.73 ? -59  DT  J C5    1 
ATOM   9332  C  C7    . DT  J 6  14  ? -64.536 -41.727 43.789 1.00 129.04 ? -59  DT  J C7    1 
ATOM   9333  C  C6    . DT  J 6  14  ? -65.643 -39.507 44.023 1.00 135.55 ? -59  DT  J C6    1 
ATOM   9334  P  P     . DG  J 6  15  ? -69.895 -35.463 41.918 1.00 149.54 ? -58  DG  J P     1 
ATOM   9335  O  OP1   . DG  J 6  15  ? -71.360 -35.692 42.006 1.00 149.09 ? -58  DG  J OP1   1 
ATOM   9336  O  OP2   . DG  J 6  15  ? -69.119 -36.131 40.832 1.00 124.87 ? -58  DG  J OP2   1 
ATOM   9337  O  "O5'" . DG  J 6  15  ? -69.646 -33.890 41.817 1.00 150.26 ? -58  DG  J "O5'" 1 
ATOM   9338  C  "C5'" . DG  J 6  15  ? -68.963 -33.157 42.856 1.00 144.75 ? -58  DG  J "C5'" 1 
ATOM   9339  C  "C4'" . DG  J 6  15  ? -67.960 -32.193 42.256 1.00 136.68 ? -58  DG  J "C4'" 1 
ATOM   9340  O  "O4'" . DG  J 6  15  ? -66.659 -32.831 42.170 1.00 134.26 ? -58  DG  J "O4'" 1 
ATOM   9341  C  "C3'" . DG  J 6  15  ? -68.276 -31.663 40.862 1.00 138.79 ? -58  DG  J "C3'" 1 
ATOM   9342  O  "O3'" . DG  J 6  15  ? -68.045 -30.253 40.842 1.00 133.89 ? -58  DG  J "O3'" 1 
ATOM   9343  C  "C2'" . DG  J 6  15  ? -67.447 -32.560 39.936 1.00 139.59 ? -58  DG  J "C2'" 1 
ATOM   9344  C  "C1'" . DG  J 6  15  ? -66.251 -32.928 40.816 1.00 138.90 ? -58  DG  J "C1'" 1 
ATOM   9345  N  N9    . DG  J 6  15  ? -65.762 -34.286 40.599 1.00 133.84 ? -58  DG  J N9    1 
ATOM   9346  C  C8    . DG  J 6  15  ? -66.462 -35.342 40.065 1.00 131.46 ? -58  DG  J C8    1 
ATOM   9347  N  N7    . DG  J 6  15  ? -65.774 -36.450 40.032 1.00 129.85 ? -58  DG  J N7    1 
ATOM   9348  C  C5    . DG  J 6  15  ? -64.546 -36.108 40.583 1.00 129.04 ? -58  DG  J C5    1 
ATOM   9349  C  C6    . DG  J 6  15  ? -63.387 -36.898 40.811 1.00 126.03 ? -58  DG  J C6    1 
ATOM   9350  O  O6    . DG  J 6  15  ? -63.209 -38.097 40.564 1.00 117.71 ? -58  DG  J O6    1 
ATOM   9351  N  N1    . DG  J 6  15  ? -62.367 -36.152 41.393 1.00 129.50 ? -58  DG  J N1    1 
ATOM   9352  C  C2    . DG  J 6  15  ? -62.449 -34.820 41.720 1.00 126.88 ? -58  DG  J C2    1 
ATOM   9353  N  N2    . DG  J 6  15  ? -61.357 -34.279 42.280 1.00 120.87 ? -58  DG  J N2    1 
ATOM   9354  N  N3    . DG  J 6  15  ? -63.523 -34.073 41.515 1.00 125.33 ? -58  DG  J N3    1 
ATOM   9355  C  C4    . DG  J 6  15  ? -64.526 -34.777 40.946 1.00 130.63 ? -58  DG  J C4    1 
ATOM   9356  P  P     . DC  J 6  16  ? -67.110 -29.435 39.832 1.00 130.32 ? -57  DC  J P     1 
ATOM   9357  O  OP1   . DC  J 6  16  ? -67.321 -27.999 40.152 1.00 127.04 ? -57  DC  J OP1   1 
ATOM   9358  O  OP2   . DC  J 6  16  ? -67.352 -29.933 38.448 1.00 120.28 ? -57  DC  J OP2   1 
ATOM   9359  O  "O5'" . DC  J 6  16  ? -65.639 -29.851 40.289 1.00 138.22 ? -57  DC  J "O5'" 1 
ATOM   9360  C  "C5'" . DC  J 6  16  ? -64.572 -28.886 40.442 1.00 118.94 ? -57  DC  J "C5'" 1 
ATOM   9361  C  "C4'" . DC  J 6  16  ? -63.431 -29.181 39.487 1.00 109.31 ? -57  DC  J "C4'" 1 
ATOM   9362  O  "O4'" . DC  J 6  16  ? -63.197 -30.612 39.383 1.00 100.83 ? -57  DC  J "O4'" 1 
ATOM   9363  C  "C3'" . DC  J 6  16  ? -63.606 -28.669 38.053 1.00 108.51 ? -57  DC  J "C3'" 1 
ATOM   9364  O  "O3'" . DC  J 6  16  ? -62.452 -27.955 37.634 1.00 106.01 ? -57  DC  J "O3'" 1 
ATOM   9365  C  "C2'" . DC  J 6  16  ? -63.715 -29.944 37.218 1.00 101.10 ? -57  DC  J "C2'" 1 
ATOM   9366  C  "C1'" . DC  J 6  16  ? -62.880 -30.917 38.045 1.00 104.93 ? -57  DC  J "C1'" 1 
ATOM   9367  N  N1    . DC  J 6  16  ? -63.170 -32.338 37.795 1.00 111.76 ? -57  DC  J N1    1 
ATOM   9368  C  C2    . DC  J 6  16  ? -62.372 -33.303 38.412 1.00 110.48 ? -57  DC  J C2    1 
ATOM   9369  O  O2    . DC  J 6  16  ? -61.460 -32.932 39.165 1.00 110.13 ? -57  DC  J O2    1 
ATOM   9370  N  N3    . DC  J 6  16  ? -62.612 -34.613 38.173 1.00 114.76 ? -57  DC  J N3    1 
ATOM   9371  C  C4    . DC  J 6  16  ? -63.600 -34.970 37.349 1.00 112.26 ? -57  DC  J C4    1 
ATOM   9372  N  N4    . DC  J 6  16  ? -63.803 -36.272 37.145 1.00 115.29 ? -57  DC  J N4    1 
ATOM   9373  C  C5    . DC  J 6  16  ? -64.430 -34.006 36.707 1.00 113.06 ? -57  DC  J C5    1 
ATOM   9374  C  C6    . DC  J 6  16  ? -64.175 -32.714 36.947 1.00 117.84 ? -57  DC  J C6    1 
ATOM   9375  P  P     . DA  J 6  17  ? -62.153 -26.486 38.176 1.00 116.92 ? -56  DA  J P     1 
ATOM   9376  O  OP1   . DA  J 6  17  ? -62.904 -26.206 39.432 1.00 115.78 ? -56  DA  J OP1   1 
ATOM   9377  O  OP2   . DA  J 6  17  ? -62.313 -25.596 37.004 1.00 125.38 ? -56  DA  J OP2   1 
ATOM   9378  O  "O5'" . DA  J 6  17  ? -60.602 -26.529 38.536 1.00 120.29 ? -56  DA  J "O5'" 1 
ATOM   9379  C  "C5'" . DA  J 6  17  ? -60.143 -27.075 39.789 1.00 123.97 ? -56  DA  J "C5'" 1 
ATOM   9380  C  "C4'" . DA  J 6  17  ? -58.798 -27.752 39.621 1.00 121.82 ? -56  DA  J "C4'" 1 
ATOM   9381  O  "O4'" . DA  J 6  17  ? -58.956 -29.017 38.924 1.00 117.71 ? -56  DA  J "O4'" 1 
ATOM   9382  C  "C3'" . DA  J 6  17  ? -57.736 -26.988 38.836 1.00 118.71 ? -56  DA  J "C3'" 1 
ATOM   9383  O  "O3'" . DA  J 6  17  ? -56.470 -27.373 39.359 1.00 121.10 ? -56  DA  J "O3'" 1 
ATOM   9384  C  "C2'" . DA  J 6  17  ? -57.939 -27.494 37.409 1.00 111.11 ? -56  DA  J "C2'" 1 
ATOM   9385  C  "C1'" . DA  J 6  17  ? -58.348 -28.948 37.647 1.00 113.65 ? -56  DA  J "C1'" 1 
ATOM   9386  N  N9    . DA  J 6  17  ? -59.317 -29.452 36.678 1.00 121.58 ? -56  DA  J N9    1 
ATOM   9387  C  C8    . DA  J 6  17  ? -60.169 -28.730 35.879 1.00 121.36 ? -56  DA  J C8    1 
ATOM   9388  N  N7    . DA  J 6  17  ? -60.953 -29.472 35.136 1.00 118.16 ? -56  DA  J N7    1 
ATOM   9389  C  C5    . DA  J 6  17  ? -60.610 -30.771 35.485 1.00 121.63 ? -56  DA  J C5    1 
ATOM   9390  C  C6    . DA  J 6  17  ? -61.083 -32.024 35.053 1.00 126.37 ? -56  DA  J C6    1 
ATOM   9391  N  N6    . DA  J 6  17  ? -62.042 -32.179 34.137 1.00 128.63 ? -56  DA  J N6    1 
ATOM   9392  N  N1    . DA  J 6  17  ? -60.522 -33.128 35.594 1.00 117.53 ? -56  DA  J N1    1 
ATOM   9393  C  C2    . DA  J 6  17  ? -59.558 -32.972 36.511 1.00 114.58 ? -56  DA  J C2    1 
ATOM   9394  N  N3    . DA  J 6  17  ? -59.036 -31.851 37.004 1.00 115.29 ? -56  DA  J N3    1 
ATOM   9395  C  C4    . DA  J 6  17  ? -59.610 -30.773 36.440 1.00 123.01 ? -56  DA  J C4    1 
ATOM   9396  P  P     . DG  J 6  18  ? -55.083 -26.816 38.790 1.00 121.94 ? -55  DG  J P     1 
ATOM   9397  O  OP1   . DG  J 6  18  ? -54.212 -26.591 39.975 1.00 115.56 ? -55  DG  J OP1   1 
ATOM   9398  O  OP2   . DG  J 6  18  ? -55.324 -25.718 37.814 1.00 123.02 ? -55  DG  J OP2   1 
ATOM   9399  O  "O5'" . DG  J 6  18  ? -54.490 -28.027 37.949 1.00 108.85 ? -55  DG  J "O5'" 1 
ATOM   9400  C  "C5'" . DG  J 6  18  ? -54.422 -29.341 38.513 1.00 110.08 ? -55  DG  J "C5'" 1 
ATOM   9401  C  "C4'" . DG  J 6  18  ? -54.226 -30.336 37.405 1.00 110.30 ? -55  DG  J "C4'" 1 
ATOM   9402  O  "O4'" . DG  J 6  18  ? -55.485 -30.529 36.699 1.00 120.15 ? -55  DG  J "O4'" 1 
ATOM   9403  C  "C3'" . DG  J 6  18  ? -53.209 -29.926 36.338 1.00 105.78 ? -55  DG  J "C3'" 1 
ATOM   9404  O  "O3'" . DG  J 6  18  ? -52.559 -31.113 35.918 1.00 113.29 ? -55  DG  J "O3'" 1 
ATOM   9405  C  "C2'" . DG  J 6  18  ? -54.090 -29.515 35.167 1.00 110.08 ? -55  DG  J "C2'" 1 
ATOM   9406  C  "C1'" . DG  J 6  18  ? -55.215 -30.528 35.319 1.00 122.13 ? -55  DG  J "C1'" 1 
ATOM   9407  N  N9    . DG  J 6  18  ? -56.440 -30.283 34.564 1.00 125.52 ? -55  DG  J N9    1 
ATOM   9408  C  C8    . DG  J 6  18  ? -57.008 -29.082 34.210 1.00 121.49 ? -55  DG  J C8    1 
ATOM   9409  N  N7    . DG  J 6  18  ? -58.081 -29.220 33.478 1.00 123.21 ? -55  DG  J N7    1 
ATOM   9410  C  C5    . DG  J 6  18  ? -58.215 -30.594 33.323 1.00 128.75 ? -55  DG  J C5    1 
ATOM   9411  C  C6    . DG  J 6  18  ? -59.192 -31.352 32.625 1.00 130.36 ? -55  DG  J C6    1 
ATOM   9412  O  O6    . DG  J 6  18  ? -60.173 -30.947 31.993 1.00 138.21 ? -55  DG  J O6    1 
ATOM   9413  N  N1    . DG  J 6  18  ? -58.950 -32.719 32.732 1.00 126.57 ? -55  DG  J N1    1 
ATOM   9414  C  C2    . DG  J 6  18  ? -57.907 -33.286 33.420 1.00 118.91 ? -55  DG  J C2    1 
ATOM   9415  N  N2    . DG  J 6  18  ? -57.839 -34.624 33.398 1.00 117.72 ? -55  DG  J N2    1 
ATOM   9416  N  N3    . DG  J 6  18  ? -56.987 -32.592 34.066 1.00 114.63 ? -55  DG  J N3    1 
ATOM   9417  C  C4    . DG  J 6  18  ? -57.204 -31.262 33.981 1.00 122.82 ? -55  DG  J C4    1 
ATOM   9418  P  P     . DA  J 6  19  ? -51.025 -31.134 35.514 1.00 112.43 ? -54  DA  J P     1 
ATOM   9419  O  OP1   . DA  J 6  19  ? -50.311 -31.573 36.741 1.00 108.31 ? -54  DA  J OP1   1 
ATOM   9420  O  OP2   . DA  J 6  19  ? -50.657 -29.858 34.845 1.00 107.86 ? -54  DA  J OP2   1 
ATOM   9421  O  "O5'" . DA  J 6  19  ? -50.965 -32.290 34.426 1.00 101.48 ? -54  DA  J "O5'" 1 
ATOM   9422  C  "C5'" . DA  J 6  19  ? -50.989 -33.654 34.847 1.00 112.67 ? -54  DA  J "C5'" 1 
ATOM   9423  C  "C4'" . DA  J 6  19  ? -51.995 -34.438 34.043 1.00 118.30 ? -54  DA  J "C4'" 1 
ATOM   9424  O  "O4'" . DA  J 6  19  ? -53.211 -33.685 33.878 1.00 122.24 ? -54  DA  J "O4'" 1 
ATOM   9425  C  "C3'" . DA  J 6  19  ? -51.593 -34.777 32.615 1.00 106.76 ? -54  DA  J "C3'" 1 
ATOM   9426  O  "O3'" . DA  J 6  19  ? -50.875 -35.999 32.691 1.00 108.94 ? -54  DA  J "O3'" 1 
ATOM   9427  C  "C2'" . DA  J 6  19  ? -52.937 -35.015 31.921 1.00 112.85 ? -54  DA  J "C2'" 1 
ATOM   9428  C  "C1'" . DA  J 6  19  ? -53.928 -34.232 32.795 1.00 122.67 ? -54  DA  J "C1'" 1 
ATOM   9429  N  N9    . DA  J 6  19  ? -54.600 -33.138 32.097 1.00 128.55 ? -54  DA  J N9    1 
ATOM   9430  C  C8    . DA  J 6  19  ? -54.289 -31.803 32.171 1.00 129.53 ? -54  DA  J C8    1 
ATOM   9431  N  N7    . DA  J 6  19  ? -55.065 -31.038 31.442 1.00 131.02 ? -54  DA  J N7    1 
ATOM   9432  C  C5    . DA  J 6  19  ? -55.949 -31.929 30.849 1.00 124.07 ? -54  DA  J C5    1 
ATOM   9433  C  C6    . DA  J 6  19  ? -57.019 -31.744 29.958 1.00 123.27 ? -54  DA  J C6    1 
ATOM   9434  N  N6    . DA  J 6  19  ? -57.397 -30.552 29.494 1.00 125.47 ? -54  DA  J N6    1 
ATOM   9435  N  N1    . DA  J 6  19  ? -57.697 -32.841 29.557 1.00 124.23 ? -54  DA  J N1    1 
ATOM   9436  C  C2    . DA  J 6  19  ? -57.319 -34.037 30.027 1.00 120.55 ? -54  DA  J C2    1 
ATOM   9437  N  N3    . DA  J 6  19  ? -56.332 -34.338 30.868 1.00 119.61 ? -54  DA  J N3    1 
ATOM   9438  C  C4    . DA  J 6  19  ? -55.674 -33.226 31.242 1.00 125.26 ? -54  DA  J C4    1 
ATOM   9439  P  P     . DT  J 6  20  ? -49.803 -36.434 31.598 1.00 121.10 ? -53  DT  J P     1 
ATOM   9440  O  OP1   . DT  J 6  20  ? -48.974 -37.534 32.160 1.00 128.19 ? -53  DT  J OP1   1 
ATOM   9441  O  OP2   . DT  J 6  20  ? -49.138 -35.206 31.102 1.00 119.83 ? -53  DT  J OP2   1 
ATOM   9442  O  "O5'" . DT  J 6  20  ? -50.729 -37.042 30.452 1.00 121.81 ? -53  DT  J "O5'" 1 
ATOM   9443  C  "C5'" . DT  J 6  20  ? -51.540 -38.203 30.715 1.00 118.49 ? -53  DT  J "C5'" 1 
ATOM   9444  C  "C4'" . DT  J 6  20  ? -52.610 -38.357 29.659 1.00 123.58 ? -53  DT  J "C4'" 1 
ATOM   9445  O  "O4'" . DT  J 6  20  ? -53.411 -37.158 29.558 1.00 124.57 ? -53  DT  J "O4'" 1 
ATOM   9446  C  "C3'" . DT  J 6  20  ? -52.099 -38.655 28.247 1.00 126.58 ? -53  DT  J "C3'" 1 
ATOM   9447  O  "O3'" . DT  J 6  20  ? -52.832 -39.790 27.776 1.00 137.90 ? -53  DT  J "O3'" 1 
ATOM   9448  C  "C2'" . DT  J 6  20  ? -52.410 -37.386 27.468 1.00 121.02 ? -53  DT  J "C2'" 1 
ATOM   9449  C  "C1'" . DT  J 6  20  ? -53.634 -36.857 28.192 1.00 125.13 ? -53  DT  J "C1'" 1 
ATOM   9450  N  N1    . DT  J 6  20  ? -53.853 -35.404 28.085 1.00 125.00 ? -53  DT  J N1    1 
ATOM   9451  C  C2    . DT  J 6  20  ? -55.024 -34.941 27.523 1.00 130.08 ? -53  DT  J C2    1 
ATOM   9452  O  O2    . DT  J 6  20  ? -55.885 -35.678 27.072 1.00 146.72 ? -53  DT  J O2    1 
ATOM   9453  N  N3    . DT  J 6  20  ? -55.143 -33.573 27.498 1.00 126.10 ? -53  DT  J N3    1 
ATOM   9454  C  C4    . DT  J 6  20  ? -54.237 -32.646 27.979 1.00 130.39 ? -53  DT  J C4    1 
ATOM   9455  O  O4    . DT  J 6  20  ? -54.485 -31.446 27.890 1.00 126.90 ? -53  DT  J O4    1 
ATOM   9456  C  C5    . DT  J 6  20  ? -53.039 -33.204 28.569 1.00 130.81 ? -53  DT  J C5    1 
ATOM   9457  C  C7    . DT  J 6  20  ? -51.999 -32.279 29.119 1.00 121.29 ? -53  DT  J C7    1 
ATOM   9458  C  C6    . DT  J 6  20  ? -52.911 -34.536 28.592 1.00 127.37 ? -53  DT  J C6    1 
ATOM   9459  P  P     . DA  J 6  21  ? -52.567 -40.534 26.389 1.00 143.38 ? -52  DA  J P     1 
ATOM   9460  O  OP1   . DA  J 6  21  ? -53.053 -41.932 26.544 1.00 144.06 ? -52  DA  J OP1   1 
ATOM   9461  O  OP2   . DA  J 6  21  ? -51.168 -40.290 25.949 1.00 140.59 ? -52  DA  J OP2   1 
ATOM   9462  O  "O5'" . DA  J 6  21  ? -53.542 -39.728 25.420 1.00 145.93 ? -52  DA  J "O5'" 1 
ATOM   9463  C  "C5'" . DA  J 6  21  ? -54.975 -39.835 25.539 1.00 152.89 ? -52  DA  J "C5'" 1 
ATOM   9464  C  "C4'" . DA  J 6  21  ? -55.650 -39.209 24.338 1.00 155.23 ? -52  DA  J "C4'" 1 
ATOM   9465  O  "O4'" . DA  J 6  21  ? -55.735 -37.772 24.534 1.00 150.25 ? -52  DA  J "O4'" 1 
ATOM   9466  C  "C3'" . DA  J 6  21  ? -54.959 -39.425 22.985 1.00 148.55 ? -52  DA  J "C3'" 1 
ATOM   9467  O  "O3'" . DA  J 6  21  ? -55.901 -39.865 22.001 1.00 150.66 ? -52  DA  J "O3'" 1 
ATOM   9468  C  "C2'" . DA  J 6  21  ? -54.324 -38.065 22.694 1.00 137.98 ? -52  DA  J "C2'" 1 
ATOM   9469  C  "C1'" . DA  J 6  21  ? -55.319 -37.117 23.358 1.00 143.79 ? -52  DA  J "C1'" 1 
ATOM   9470  N  N9    . DA  J 6  21  ? -54.738 -35.831 23.734 1.00 149.53 ? -52  DA  J N9    1 
ATOM   9471  C  C8    . DA  J 6  21  ? -53.637 -35.607 24.523 1.00 144.20 ? -52  DA  J C8    1 
ATOM   9472  N  N7    . DA  J 6  21  ? -53.355 -34.338 24.691 1.00 139.75 ? -52  DA  J N7    1 
ATOM   9473  C  C5    . DA  J 6  21  ? -54.336 -33.681 23.961 1.00 148.19 ? -52  DA  J C5    1 
ATOM   9474  C  C6    . DA  J 6  21  ? -54.592 -32.316 23.733 1.00 150.23 ? -52  DA  J C6    1 
ATOM   9475  N  N6    . DA  J 6  21  ? -53.851 -31.329 24.241 1.00 138.10 ? -52  DA  J N6    1 
ATOM   9476  N  N1    . DA  J 6  21  ? -55.654 -31.995 22.961 1.00 160.25 ? -52  DA  J N1    1 
ATOM   9477  C  C2    . DA  J 6  21  ? -56.398 -32.986 22.452 1.00 159.91 ? -52  DA  J C2    1 
ATOM   9478  N  N3    . DA  J 6  21  ? -56.262 -34.304 22.597 1.00 160.16 ? -52  DA  J N3    1 
ATOM   9479  C  C4    . DA  J 6  21  ? -55.198 -34.588 23.370 1.00 154.91 ? -52  DA  J C4    1 
ATOM   9480  P  P     . DC  J 6  22  ? -55.824 -39.656 20.402 1.00 148.91 ? -51  DC  J P     1 
ATOM   9481  O  OP1   . DC  J 6  22  ? -56.947 -40.439 19.825 1.00 154.47 ? -51  DC  J OP1   1 
ATOM   9482  O  OP2   . DC  J 6  22  ? -54.442 -39.878 19.893 1.00 129.55 ? -51  DC  J OP2   1 
ATOM   9483  O  "O5'" . DC  J 6  22  ? -56.179 -38.110 20.251 1.00 148.75 ? -51  DC  J "O5'" 1 
ATOM   9484  C  "C5'" . DC  J 6  22  ? -57.490 -37.664 19.851 1.00 152.26 ? -51  DC  J "C5'" 1 
ATOM   9485  C  "C4'" . DC  J 6  22  ? -57.359 -36.620 18.769 1.00 159.35 ? -51  DC  J "C4'" 1 
ATOM   9486  O  "O4'" . DC  J 6  22  ? -56.643 -35.467 19.298 1.00 158.93 ? -51  DC  J "O4'" 1 
ATOM   9487  C  "C3'" . DC  J 6  22  ? -56.589 -37.072 17.529 1.00 166.44 ? -51  DC  J "C3'" 1 
ATOM   9488  O  "O3'" . DC  J 6  22  ? -57.215 -36.616 16.337 1.00 174.87 ? -51  DC  J "O3'" 1 
ATOM   9489  C  "C2'" . DC  J 6  22  ? -55.218 -36.427 17.712 1.00 169.41 ? -51  DC  J "C2'" 1 
ATOM   9490  C  "C1'" . DC  J 6  22  ? -55.589 -35.127 18.422 1.00 164.40 ? -51  DC  J "C1'" 1 
ATOM   9491  N  N1    . DC  J 6  22  ? -54.484 -34.552 19.209 1.00 167.57 ? -51  DC  J N1    1 
ATOM   9492  C  C2    . DC  J 6  22  ? -54.360 -33.159 19.288 1.00 165.04 ? -51  DC  J C2    1 
ATOM   9493  O  O2    . DC  J 6  22  ? -55.196 -32.448 18.710 1.00 151.90 ? -51  DC  J O2    1 
ATOM   9494  N  N3    . DC  J 6  22  ? -53.339 -32.625 19.999 1.00 169.31 ? -51  DC  J N3    1 
ATOM   9495  C  C4    . DC  J 6  22  ? -52.459 -33.426 20.608 1.00 168.62 ? -51  DC  J C4    1 
ATOM   9496  N  N4    . DC  J 6  22  ? -51.468 -32.857 21.297 1.00 163.39 ? -51  DC  J N4    1 
ATOM   9497  C  C5    . DC  J 6  22  ? -52.558 -34.847 20.537 1.00 163.39 ? -51  DC  J C5    1 
ATOM   9498  C  C6    . DC  J 6  22  ? -53.573 -35.362 19.831 1.00 167.82 ? -51  DC  J C6    1 
ATOM   9499  P  P     . DT  J 6  23  ? -56.821 -37.292 14.940 1.00 184.50 ? -50  DT  J P     1 
ATOM   9500  O  OP1   . DT  J 6  23  ? -57.223 -38.721 15.029 1.00 182.33 ? -50  DT  J OP1   1 
ATOM   9501  O  OP2   . DT  J 6  23  ? -55.409 -36.959 14.606 1.00 175.00 ? -50  DT  J OP2   1 
ATOM   9502  O  "O5'" . DT  J 6  23  ? -57.765 -36.541 13.895 1.00 188.52 ? -50  DT  J "O5'" 1 
ATOM   9503  C  "C5'" . DT  J 6  23  ? -58.241 -35.195 14.125 1.00 177.02 ? -50  DT  J "C5'" 1 
ATOM   9504  C  "C4'" . DT  J 6  23  ? -57.372 -34.172 13.425 1.00 181.26 ? -50  DT  J "C4'" 1 
ATOM   9505  O  "O4'" . DT  J 6  23  ? -56.565 -33.484 14.407 1.00 170.37 ? -50  DT  J "O4'" 1 
ATOM   9506  C  "C3'" . DT  J 6  23  ? -56.392 -34.716 12.373 1.00 186.80 ? -50  DT  J "C3'" 1 
ATOM   9507  O  "O3'" . DT  J 6  23  ? -56.793 -34.434 11.016 1.00 195.94 ? -50  DT  J "O3'" 1 
ATOM   9508  C  "C2'" . DT  J 6  23  ? -55.045 -34.114 12.751 1.00 180.96 ? -50  DT  J "C2'" 1 
ATOM   9509  C  "C1'" . DT  J 6  23  ? -55.386 -33.038 13.769 1.00 174.96 ? -50  DT  J "C1'" 1 
ATOM   9510  N  N1    . DT  J 6  23  ? -54.355 -32.816 14.809 1.00 177.85 ? -50  DT  J N1    1 
ATOM   9511  C  C2    . DT  J 6  23  ? -54.404 -31.651 15.543 1.00 180.67 ? -50  DT  J C2    1 
ATOM   9512  O  O2    . DT  J 6  23  ? -55.267 -30.801 15.390 1.00 174.35 ? -50  DT  J O2    1 
ATOM   9513  N  N3    . DT  J 6  23  ? -53.402 -31.519 16.474 1.00 181.00 ? -50  DT  J N3    1 
ATOM   9514  C  C4    . DT  J 6  23  ? -52.381 -32.415 16.737 1.00 170.75 ? -50  DT  J C4    1 
ATOM   9515  O  O4    . DT  J 6  23  ? -51.548 -32.158 17.603 1.00 164.90 ? -50  DT  J O4    1 
ATOM   9516  C  C5    . DT  J 6  23  ? -52.386 -33.612 15.924 1.00 166.00 ? -50  DT  J C5    1 
ATOM   9517  C  C7    . DT  J 6  23  ? -51.319 -34.639 16.135 1.00 148.39 ? -50  DT  J C7    1 
ATOM   9518  C  C6    . DT  J 6  23  ? -53.358 -33.748 15.011 1.00 174.47 ? -50  DT  J C6    1 
ATOM   9519  P  P     . DA  J 6  24  ? -56.467 -33.144 10.089 1.00 191.18 ? -49  DA  J P     1 
ATOM   9520  O  OP1   . DA  J 6  24  ? -57.331 -33.248 8.882  1.00 181.28 ? -49  DA  J OP1   1 
ATOM   9521  O  OP2   . DA  J 6  24  ? -54.999 -32.967 9.917  1.00 170.85 ? -49  DA  J OP2   1 
ATOM   9522  O  "O5'" . DA  J 6  24  ? -57.022 -31.945 10.978 1.00 189.63 ? -49  DA  J "O5'" 1 
ATOM   9523  C  "C5'" . DA  J 6  24  ? -57.538 -30.747 10.374 1.00 193.01 ? -49  DA  J "C5'" 1 
ATOM   9524  C  "C4'" . DA  J 6  24  ? -56.566 -29.608 10.566 1.00 195.93 ? -49  DA  J "C4'" 1 
ATOM   9525  O  "O4'" . DA  J 6  24  ? -55.619 -29.940 11.618 1.00 190.21 ? -49  DA  J "O4'" 1 
ATOM   9526  C  "C3'" . DA  J 6  24  ? -55.726 -29.234 9.339  1.00 208.12 ? -49  DA  J "C3'" 1 
ATOM   9527  O  "O3'" . DA  J 6  24  ? -55.871 -27.837 9.069  1.00 220.72 ? -49  DA  J "O3'" 1 
ATOM   9528  C  "C2'" . DA  J 6  24  ? -54.309 -29.661 9.731  1.00 202.54 ? -49  DA  J "C2'" 1 
ATOM   9529  C  "C1'" . DA  J 6  24  ? -54.346 -29.469 11.244 1.00 200.41 ? -49  DA  J "C1'" 1 
ATOM   9530  N  N9    . DA  J 6  24  ? -53.328 -30.223 11.975 1.00 201.60 ? -49  DA  J N9    1 
ATOM   9531  C  C8    . DA  J 6  24  ? -52.878 -31.496 11.721 1.00 204.54 ? -49  DA  J C8    1 
ATOM   9532  N  N7    . DA  J 6  24  ? -51.946 -31.902 12.548 1.00 203.03 ? -49  DA  J N7    1 
ATOM   9533  C  C5    . DA  J 6  24  ? -51.763 -30.823 13.401 1.00 198.17 ? -49  DA  J C5    1 
ATOM   9534  C  C6    . DA  J 6  24  ? -50.905 -30.617 14.496 1.00 198.57 ? -49  DA  J C6    1 
ATOM   9535  N  N6    . DA  J 6  24  ? -50.042 -31.532 14.942 1.00 196.71 ? -49  DA  J N6    1 
ATOM   9536  N  N1    . DA  J 6  24  ? -50.974 -29.427 15.133 1.00 197.21 ? -49  DA  J N1    1 
ATOM   9537  C  C2    . DA  J 6  24  ? -51.842 -28.510 14.686 1.00 191.65 ? -49  DA  J C2    1 
ATOM   9538  N  N3    . DA  J 6  24  ? -52.694 -28.583 13.665 1.00 188.97 ? -49  DA  J N3    1 
ATOM   9539  C  C4    . DA  J 6  24  ? -52.603 -29.779 13.056 1.00 196.88 ? -49  DA  J C4    1 
ATOM   9540  P  P     . DC  J 6  25  ? -54.715 -26.837 8.557  1.00 221.17 ? -48  DC  J P     1 
ATOM   9541  O  OP1   . DC  J 6  25  ? -55.372 -25.579 8.112  1.00 221.07 ? -48  DC  J OP1   1 
ATOM   9542  O  OP2   . DC  J 6  25  ? -53.818 -27.564 7.617  1.00 218.18 ? -48  DC  J OP2   1 
ATOM   9543  O  "O5'" . DC  J 6  25  ? -53.930 -26.519 9.908  1.00 218.32 ? -48  DC  J "O5'" 1 
ATOM   9544  C  "C5'" . DC  J 6  25  ? -53.309 -25.239 10.132 1.00 214.70 ? -48  DC  J "C5'" 1 
ATOM   9545  C  "C4'" . DC  J 6  25  ? -51.833 -25.316 9.819  1.00 214.54 ? -48  DC  J "C4'" 1 
ATOM   9546  O  "O4'" . DC  J 6  25  ? -51.228 -26.383 10.595 1.00 215.15 ? -48  DC  J "O4'" 1 
ATOM   9547  C  "C3'" . DC  J 6  25  ? -51.476 -25.594 8.354  1.00 209.04 ? -48  DC  J "C3'" 1 
ATOM   9548  O  "O3'" . DC  J 6  25  ? -50.609 -24.614 7.791  1.00 212.20 ? -48  DC  J "O3'" 1 
ATOM   9549  C  "C2'" . DC  J 6  25  ? -50.784 -26.959 8.392  1.00 200.76 ? -48  DC  J "C2'" 1 
ATOM   9550  C  "C1'" . DC  J 6  25  ? -50.229 -26.990 9.815  1.00 203.27 ? -48  DC  J "C1'" 1 
ATOM   9551  N  N1    . DC  J 6  25  ? -49.956 -28.339 10.347 1.00 194.65 ? -48  DC  J N1    1 
ATOM   9552  C  C2    . DC  J 6  25  ? -49.299 -28.464 11.578 1.00 178.34 ? -48  DC  J C2    1 
ATOM   9553  O  O2    . DC  J 6  25  ? -48.982 -27.438 12.197 1.00 167.98 ? -48  DC  J O2    1 
ATOM   9554  N  N3    . DC  J 6  25  ? -49.022 -29.700 12.056 1.00 168.46 ? -48  DC  J N3    1 
ATOM   9555  C  C4    . DC  J 6  25  ? -49.373 -30.781 11.355 1.00 169.33 ? -48  DC  J C4    1 
ATOM   9556  N  N4    . DC  J 6  25  ? -49.092 -31.979 11.871 1.00 162.71 ? -48  DC  J N4    1 
ATOM   9557  C  C5    . DC  J 6  25  ? -50.042 -30.682 10.100 1.00 181.18 ? -48  DC  J C5    1 
ATOM   9558  C  C6    . DC  J 6  25  ? -50.307 -29.453 9.636  1.00 191.08 ? -48  DC  J C6    1 
ATOM   9559  P  P     . DC  J 6  26  ? -51.094 -23.154 7.324  1.00 219.40 ? -47  DC  J P     1 
ATOM   9560  O  OP1   . DC  J 6  26  ? -52.441 -22.848 7.877  1.00 219.37 ? -47  DC  J OP1   1 
ATOM   9561  O  OP2   . DC  J 6  26  ? -50.863 -23.030 5.860  1.00 209.27 ? -47  DC  J OP2   1 
ATOM   9562  O  "O5'" . DC  J 6  26  ? -50.038 -22.225 8.073  1.00 211.36 ? -47  DC  J "O5'" 1 
ATOM   9563  C  "C5'" . DC  J 6  26  ? -49.450 -22.635 9.322  1.00 188.99 ? -47  DC  J "C5'" 1 
ATOM   9564  C  "C4'" . DC  J 6  26  ? -48.040 -23.146 9.114  1.00 187.14 ? -47  DC  J "C4'" 1 
ATOM   9565  O  "O4'" . DC  J 6  26  ? -47.938 -24.538 9.516  1.00 189.97 ? -47  DC  J "O4'" 1 
ATOM   9566  C  "C3'" . DC  J 6  26  ? -47.461 -23.087 7.694  1.00 179.42 ? -47  DC  J "C3'" 1 
ATOM   9567  O  "O3'" . DC  J 6  26  ? -46.196 -22.437 7.732  1.00 192.69 ? -47  DC  J "O3'" 1 
ATOM   9568  C  "C2'" . DC  J 6  26  ? -47.196 -24.555 7.354  1.00 172.24 ? -47  DC  J "C2'" 1 
ATOM   9569  C  "C1'" . DC  J 6  26  ? -46.923 -25.123 8.743  1.00 186.09 ? -47  DC  J "C1'" 1 
ATOM   9570  N  N1    . DC  J 6  26  ? -46.957 -26.590 8.895  1.00 191.77 ? -47  DC  J N1    1 
ATOM   9571  C  C2    . DC  J 6  26  ? -46.614 -27.149 10.133 1.00 186.70 ? -47  DC  J C2    1 
ATOM   9572  O  O2    . DC  J 6  26  ? -46.341 -26.393 11.078 1.00 191.33 ? -47  DC  J O2    1 
ATOM   9573  N  N3    . DC  J 6  26  ? -46.607 -28.495 10.272 1.00 178.78 ? -47  DC  J N3    1 
ATOM   9574  C  C4    . DC  J 6  26  ? -46.907 -29.275 9.231  1.00 175.37 ? -47  DC  J C4    1 
ATOM   9575  N  N4    . DC  J 6  26  ? -46.886 -30.597 9.413  1.00 162.73 ? -47  DC  J N4    1 
ATOM   9576  C  C5    . DC  J 6  26  ? -47.242 -28.733 7.955  1.00 186.37 ? -47  DC  J C5    1 
ATOM   9577  C  C6    . DC  J 6  26  ? -47.240 -27.399 7.829  1.00 197.02 ? -47  DC  J C6    1 
ATOM   9578  P  P     . DA  J 6  27  ? -46.032 -20.848 7.596  1.00 209.66 ? -46  DA  J P     1 
ATOM   9579  O  OP1   . DA  J 6  27  ? -47.383 -20.235 7.481  1.00 212.08 ? -46  DA  J OP1   1 
ATOM   9580  O  OP2   . DA  J 6  27  ? -45.036 -20.641 6.509  1.00 190.18 ? -46  DA  J OP2   1 
ATOM   9581  O  "O5'" . DA  J 6  27  ? -45.401 -20.310 8.960  1.00 205.20 ? -46  DA  J "O5'" 1 
ATOM   9582  C  "C5'" . DA  J 6  27  ? -45.556 -21.011 10.210 1.00 176.47 ? -46  DA  J "C5'" 1 
ATOM   9583  C  "C4'" . DA  J 6  27  ? -44.272 -21.719 10.570 1.00 154.52 ? -46  DA  J "C4'" 1 
ATOM   9584  O  "O4'" . DA  J 6  27  ? -44.391 -23.136 10.273 1.00 154.17 ? -46  DA  J "O4'" 1 
ATOM   9585  C  "C3'" . DA  J 6  27  ? -43.018 -21.240 9.834  1.00 143.63 ? -46  DA  J "C3'" 1 
ATOM   9586  O  "O3'" . DA  J 6  27  ? -42.003 -21.136 10.811 1.00 147.96 ? -46  DA  J "O3'" 1 
ATOM   9587  C  "C2'" . DA  J 6  27  ? -42.703 -22.389 8.879  1.00 138.92 ? -46  DA  J "C2'" 1 
ATOM   9588  C  "C1'" . DA  J 6  27  ? -43.185 -23.580 9.696  1.00 151.34 ? -46  DA  J "C1'" 1 
ATOM   9589  N  N9    . DA  J 6  27  ? -43.450 -24.797 8.932  1.00 157.20 ? -46  DA  J N9    1 
ATOM   9590  C  C8    . DA  J 6  27  ? -43.724 -24.925 7.593  1.00 160.90 ? -46  DA  J C8    1 
ATOM   9591  N  N7    . DA  J 6  27  ? -43.913 -26.164 7.208  1.00 160.40 ? -46  DA  J N7    1 
ATOM   9592  C  C5    . DA  J 6  27  ? -43.744 -26.903 8.370  1.00 160.98 ? -46  DA  J C5    1 
ATOM   9593  C  C6    . DA  J 6  27  ? -43.808 -28.285 8.633  1.00 167.55 ? -46  DA  J C6    1 
ATOM   9594  N  N6    . DA  J 6  27  ? -44.073 -29.205 7.703  1.00 167.20 ? -46  DA  J N6    1 
ATOM   9595  N  N1    . DA  J 6  27  ? -43.589 -28.694 9.903  1.00 176.46 ? -46  DA  J N1    1 
ATOM   9596  C  C2    . DA  J 6  27  ? -43.323 -27.771 10.836 1.00 172.98 ? -46  DA  J C2    1 
ATOM   9597  N  N3    . DA  J 6  27  ? -43.233 -26.448 10.712 1.00 169.00 ? -46  DA  J N3    1 
ATOM   9598  C  C4    . DA  J 6  27  ? -43.456 -26.074 9.440  1.00 161.86 ? -46  DA  J C4    1 
ATOM   9599  P  P     . DA  J 6  28  ? -40.634 -20.415 10.465 1.00 169.69 ? -45  DA  J P     1 
ATOM   9600  O  OP1   . DA  J 6  28  ? -40.935 -18.971 10.273 1.00 176.51 ? -45  DA  J OP1   1 
ATOM   9601  O  OP2   . DA  J 6  28  ? -39.975 -21.179 9.373  1.00 163.00 ? -45  DA  J OP2   1 
ATOM   9602  O  "O5'" . DA  J 6  28  ? -39.808 -20.591 11.819 1.00 174.99 ? -45  DA  J "O5'" 1 
ATOM   9603  C  "C5'" . DA  J 6  28  ? -40.234 -21.519 12.840 1.00 162.36 ? -45  DA  J "C5'" 1 
ATOM   9604  C  "C4'" . DA  J 6  28  ? -39.433 -22.800 12.765 1.00 153.34 ? -45  DA  J "C4'" 1 
ATOM   9605  O  "O4'" . DA  J 6  28  ? -40.027 -23.713 11.799 1.00 150.76 ? -45  DA  J "O4'" 1 
ATOM   9606  C  "C3'" . DA  J 6  28  ? -37.963 -22.655 12.354 1.00 148.18 ? -45  DA  J "C3'" 1 
ATOM   9607  O  "O3'" . DA  J 6  28  ? -37.174 -23.520 13.149 1.00 140.73 ? -45  DA  J "O3'" 1 
ATOM   9608  C  "C2'" . DA  J 6  28  ? -37.931 -23.236 10.946 1.00 150.68 ? -45  DA  J "C2'" 1 
ATOM   9609  C  "C1'" . DA  J 6  28  ? -38.988 -24.324 11.069 1.00 151.73 ? -45  DA  J "C1'" 1 
ATOM   9610  N  N9    . DA  J 6  28  ? -39.511 -24.808 9.795  1.00 150.81 ? -45  DA  J N9    1 
ATOM   9611  C  C8    . DA  J 6  28  ? -39.761 -24.109 8.640  1.00 144.00 ? -45  DA  J C8    1 
ATOM   9612  N  N7    . DA  J 6  28  ? -40.208 -24.853 7.659  1.00 144.64 ? -45  DA  J N7    1 
ATOM   9613  C  C5    . DA  J 6  28  ? -40.237 -26.132 8.197  1.00 148.90 ? -45  DA  J C5    1 
ATOM   9614  C  C6    . DA  J 6  28  ? -40.614 -27.376 7.663  1.00 154.54 ? -45  DA  J C6    1 
ATOM   9615  N  N6    . DA  J 6  28  ? -41.055 -27.543 6.414  1.00 161.14 ? -45  DA  J N6    1 
ATOM   9616  N  N1    . DA  J 6  28  ? -40.525 -28.459 8.467  1.00 161.14 ? -45  DA  J N1    1 
ATOM   9617  C  C2    . DA  J 6  28  ? -40.087 -28.291 9.721  1.00 158.53 ? -45  DA  J C2    1 
ATOM   9618  N  N3    . DA  J 6  28  ? -39.701 -27.175 10.336 1.00 155.04 ? -45  DA  J N3    1 
ATOM   9619  C  C4    . DA  J 6  28  ? -39.804 -26.119 9.510  1.00 151.19 ? -45  DA  J C4    1 
ATOM   9620  P  P     . DA  J 6  29  ? -36.425 -22.928 14.409 1.00 131.99 ? -44  DA  J P     1 
ATOM   9621  O  OP1   . DA  J 6  29  ? -37.094 -23.458 15.626 1.00 140.82 ? -44  DA  J OP1   1 
ATOM   9622  O  OP2   . DA  J 6  29  ? -36.314 -21.464 14.203 1.00 136.43 ? -44  DA  J OP2   1 
ATOM   9623  O  "O5'" . DA  J 6  29  ? -34.967 -23.554 14.283 1.00 130.79 ? -44  DA  J "O5'" 1 
ATOM   9624  C  "C5'" . DA  J 6  29  ? -34.684 -24.567 13.306 1.00 121.49 ? -44  DA  J "C5'" 1 
ATOM   9625  C  "C4'" . DA  J 6  29  ? -35.026 -25.927 13.865 1.00 112.82 ? -44  DA  J "C4'" 1 
ATOM   9626  O  "O4'" . DA  J 6  29  ? -36.123 -26.506 13.114 1.00 110.28 ? -44  DA  J "O4'" 1 
ATOM   9627  C  "C3'" . DA  J 6  29  ? -33.913 -26.960 13.767 1.00 116.68 ? -44  DA  J "C3'" 1 
ATOM   9628  O  "O3'" . DA  J 6  29  ? -34.149 -27.991 14.706 1.00 124.45 ? -44  DA  J "O3'" 1 
ATOM   9629  C  "C2'" . DA  J 6  29  ? -34.099 -27.508 12.360 1.00 122.31 ? -44  DA  J "C2'" 1 
ATOM   9630  C  "C1'" . DA  J 6  29  ? -35.620 -27.469 12.202 1.00 126.06 ? -44  DA  J "C1'" 1 
ATOM   9631  N  N9    . DA  J 6  29  ? -36.030 -27.082 10.851 1.00 139.42 ? -44  DA  J N9    1 
ATOM   9632  C  C8    . DA  J 6  29  ? -35.971 -25.829 10.289 1.00 137.65 ? -44  DA  J C8    1 
ATOM   9633  N  N7    . DA  J 6  29  ? -36.410 -25.781 9.056  1.00 128.83 ? -44  DA  J N7    1 
ATOM   9634  C  C5    . DA  J 6  29  ? -36.760 -27.094 8.775  1.00 126.34 ? -44  DA  J C5    1 
ATOM   9635  C  C6    . DA  J 6  29  ? -37.286 -27.705 7.626  1.00 123.11 ? -44  DA  J C6    1 
ATOM   9636  N  N6    . DA  J 6  29  ? -37.559 -27.046 6.498  1.00 119.53 ? -44  DA  J N6    1 
ATOM   9637  N  N1    . DA  J 6  29  ? -37.526 -29.034 7.676  1.00 127.16 ? -44  DA  J N1    1 
ATOM   9638  C  C2    . DA  J 6  29  ? -37.255 -29.692 8.810  1.00 132.21 ? -44  DA  J C2    1 
ATOM   9639  N  N3    . DA  J 6  29  ? -36.759 -29.229 9.955  1.00 136.62 ? -44  DA  J N3    1 
ATOM   9640  C  C4    . DA  J 6  29  ? -36.530 -27.907 9.872  1.00 135.24 ? -44  DA  J C4    1 
ATOM   9641  P  P     . DA  J 6  30  ? -32.932 -28.913 15.136 1.00 133.42 ? -43  DA  J P     1 
ATOM   9642  O  OP1   . DA  J 6  30  ? -33.224 -29.386 16.517 1.00 132.68 ? -43  DA  J OP1   1 
ATOM   9643  O  OP2   . DA  J 6  30  ? -31.650 -28.222 14.826 1.00 121.56 ? -43  DA  J OP2   1 
ATOM   9644  O  "O5'" . DA  J 6  30  ? -33.062 -30.114 14.102 1.00 131.30 ? -43  DA  J "O5'" 1 
ATOM   9645  C  "C5'" . DA  J 6  30  ? -33.722 -31.343 14.439 1.00 122.74 ? -43  DA  J "C5'" 1 
ATOM   9646  C  "C4'" . DA  J 6  30  ? -33.633 -32.257 13.249 1.00 120.83 ? -43  DA  J "C4'" 1 
ATOM   9647  O  "O4'" . DA  J 6  30  ? -34.085 -31.528 12.072 1.00 128.16 ? -43  DA  J "O4'" 1 
ATOM   9648  C  "C3'" . DA  J 6  30  ? -32.216 -32.740 12.925 1.00 118.39 ? -43  DA  J "C3'" 1 
ATOM   9649  O  "O3'" . DA  J 6  30  ? -32.220 -34.100 12.514 1.00 117.12 ? -43  DA  J "O3'" 1 
ATOM   9650  C  "C2'" . DA  J 6  30  ? -31.806 -31.860 11.751 1.00 122.89 ? -43  DA  J "C2'" 1 
ATOM   9651  C  "C1'" . DA  J 6  30  ? -33.142 -31.695 11.034 1.00 134.83 ? -43  DA  J "C1'" 1 
ATOM   9652  N  N9    . DA  J 6  30  ? -33.206 -30.540 10.135 1.00 138.20 ? -43  DA  J N9    1 
ATOM   9653  C  C8    . DA  J 6  30  ? -32.645 -29.298 10.305 1.00 130.77 ? -43  DA  J C8    1 
ATOM   9654  N  N7    . DA  J 6  30  ? -32.862 -28.478 9.305  1.00 120.81 ? -43  DA  J N7    1 
ATOM   9655  C  C5    . DA  J 6  30  ? -33.600 -29.236 8.407  1.00 129.60 ? -43  DA  J C5    1 
ATOM   9656  C  C6    . DA  J 6  30  ? -34.144 -28.944 7.143  1.00 127.21 ? -43  DA  J C6    1 
ATOM   9657  N  N6    . DA  J 6  30  ? -34.021 -27.759 6.539  1.00 117.41 ? -43  DA  J N6    1 
ATOM   9658  N  N1    . DA  J 6  30  ? -34.825 -29.924 6.510  1.00 132.74 ? -43  DA  J N1    1 
ATOM   9659  C  C2    . DA  J 6  30  ? -34.944 -31.115 7.112  1.00 130.11 ? -43  DA  J C2    1 
ATOM   9660  N  N3    . DA  J 6  30  ? -34.484 -31.509 8.298  1.00 134.06 ? -43  DA  J N3    1 
ATOM   9661  C  C4    . DA  J 6  30  ? -33.813 -30.511 8.902  1.00 137.21 ? -43  DA  J C4    1 
ATOM   9662  P  P     . DG  J 6  31  ? -30.847 -34.927 12.496 1.00 123.49 ? -42  DG  J P     1 
ATOM   9663  O  OP1   . DG  J 6  31  ? -30.850 -35.916 13.611 1.00 127.18 ? -42  DG  J OP1   1 
ATOM   9664  O  OP2   . DG  J 6  31  ? -29.694 -34.005 12.339 1.00 119.53 ? -42  DG  J OP2   1 
ATOM   9665  O  "O5'" . DG  J 6  31  ? -30.958 -35.719 11.120 1.00 136.10 ? -42  DG  J "O5'" 1 
ATOM   9666  C  "C5'" . DG  J 6  31  ? -32.225 -36.197 10.629 1.00 138.31 ? -42  DG  J "C5'" 1 
ATOM   9667  C  "C4'" . DG  J 6  31  ? -32.229 -36.184 9.119  1.00 128.78 ? -42  DG  J "C4'" 1 
ATOM   9668  O  "O4'" . DG  J 6  31  ? -32.384 -34.816 8.657  1.00 122.98 ? -42  DG  J "O4'" 1 
ATOM   9669  C  "C3'" . DG  J 6  31  ? -30.964 -36.727 8.452  1.00 129.71 ? -42  DG  J "C3'" 1 
ATOM   9670  O  "O3'" . DG  J 6  31  ? -31.294 -37.684 7.449  1.00 132.09 ? -42  DG  J "O3'" 1 
ATOM   9671  C  "C2'" . DG  J 6  31  ? -30.296 -35.479 7.872  1.00 124.07 ? -42  DG  J "C2'" 1 
ATOM   9672  C  "C1'" . DG  J 6  31  ? -31.506 -34.597 7.582  1.00 128.03 ? -42  DG  J "C1'" 1 
ATOM   9673  N  N9    . DG  J 6  31  ? -31.222 -33.168 7.494  1.00 138.65 ? -42  DG  J N9    1 
ATOM   9674  C  C8    . DG  J 6  31  ? -30.616 -32.368 8.434  1.00 140.49 ? -42  DG  J C8    1 
ATOM   9675  N  N7    . DG  J 6  31  ? -30.507 -31.124 8.054  1.00 133.25 ? -42  DG  J N7    1 
ATOM   9676  C  C5    . DG  J 6  31  ? -31.078 -31.100 6.789  1.00 137.82 ? -42  DG  J C5    1 
ATOM   9677  C  C6    . DG  J 6  31  ? -31.247 -30.027 5.876  1.00 141.15 ? -42  DG  J C6    1 
ATOM   9678  O  O6    . DG  J 6  31  ? -30.922 -28.842 6.011  1.00 146.94 ? -42  DG  J O6    1 
ATOM   9679  N  N1    . DG  J 6  31  ? -31.869 -30.446 4.704  1.00 144.37 ? -42  DG  J N1    1 
ATOM   9680  C  C2    . DG  J 6  31  ? -32.279 -31.730 4.442  1.00 146.39 ? -42  DG  J C2    1 
ATOM   9681  N  N2    . DG  J 6  31  ? -32.861 -31.934 3.251  1.00 150.00 ? -42  DG  J N2    1 
ATOM   9682  N  N3    . DG  J 6  31  ? -32.128 -32.738 5.284  1.00 145.71 ? -42  DG  J N3    1 
ATOM   9683  C  C4    . DG  J 6  31  ? -31.524 -32.354 6.430  1.00 141.28 ? -42  DG  J C4    1 
ATOM   9684  P  P     . DT  J 6  32  ? -30.208 -38.700 6.842  1.00 130.48 ? -41  DT  J P     1 
ATOM   9685  O  OP1   . DT  J 6  32  ? -30.788 -40.068 6.811  1.00 134.47 ? -41  DT  J OP1   1 
ATOM   9686  O  OP2   . DT  J 6  32  ? -28.860 -38.489 7.423  1.00 121.17 ? -41  DT  J OP2   1 
ATOM   9687  O  "O5'" . DT  J 6  32  ? -30.126 -38.168 5.348  1.00 129.96 ? -41  DT  J "O5'" 1 
ATOM   9688  C  "C5'" . DT  J 6  32  ? -31.282 -38.160 4.497  1.00 125.97 ? -41  DT  J "C5'" 1 
ATOM   9689  C  "C4'" . DT  J 6  32  ? -30.954 -37.448 3.205  1.00 132.16 ? -41  DT  J "C4'" 1 
ATOM   9690  O  "O4'" . DT  J 6  32  ? -30.874 -36.022 3.438  1.00 128.04 ? -41  DT  J "O4'" 1 
ATOM   9691  C  "C3'" . DT  J 6  32  ? -29.625 -37.850 2.558  1.00 141.20 ? -41  DT  J "C3'" 1 
ATOM   9692  O  "O3'" . DT  J 6  32  ? -29.844 -38.074 1.160  1.00 150.62 ? -41  DT  J "O3'" 1 
ATOM   9693  C  "C2'" . DT  J 6  32  ? -28.735 -36.638 2.780  1.00 137.20 ? -41  DT  J "C2'" 1 
ATOM   9694  C  "C1'" . DT  J 6  32  ? -29.749 -35.515 2.746  1.00 135.67 ? -41  DT  J "C1'" 1 
ATOM   9695  N  N1    . DT  J 6  32  ? -29.335 -34.252 3.395  1.00 151.29 ? -41  DT  J N1    1 
ATOM   9696  C  C2    . DT  J 6  32  ? -29.594 -33.076 2.726  1.00 161.18 ? -41  DT  J C2    1 
ATOM   9697  O  O2    . DT  J 6  32  ? -30.149 -33.035 1.640  1.00 170.65 ? -41  DT  J O2    1 
ATOM   9698  N  N3    . DT  J 6  32  ? -29.180 -31.942 3.380  1.00 161.35 ? -41  DT  J N3    1 
ATOM   9699  C  C4    . DT  J 6  32  ? -28.549 -31.869 4.608  1.00 161.71 ? -41  DT  J C4    1 
ATOM   9700  O  O4    . DT  J 6  32  ? -28.237 -30.775 5.070  1.00 162.08 ? -41  DT  J O4    1 
ATOM   9701  C  C5    . DT  J 6  32  ? -28.303 -33.141 5.252  1.00 161.81 ? -41  DT  J C5    1 
ATOM   9702  C  C7    . DT  J 6  32  ? -27.621 -33.161 6.584  1.00 152.91 ? -41  DT  J C7    1 
ATOM   9703  C  C6    . DT  J 6  32  ? -28.704 -34.253 4.622  1.00 158.49 ? -41  DT  J C6    1 
ATOM   9704  P  P     . DG  J 6  33  ? -28.762 -38.752 0.191  1.00 150.26 ? -40  DG  J P     1 
ATOM   9705  O  OP1   . DG  J 6  33  ? -29.098 -40.192 0.029  1.00 150.73 ? -40  DG  J OP1   1 
ATOM   9706  O  OP2   . DG  J 6  33  ? -27.382 -38.356 0.586  1.00 153.93 ? -40  DG  J OP2   1 
ATOM   9707  O  "O5'" . DG  J 6  33  ? -29.134 -38.003 -1.164 1.00 154.02 ? -40  DG  J "O5'" 1 
ATOM   9708  C  "C5'" . DG  J 6  33  ? -28.218 -38.001 -2.267 1.00 165.70 ? -40  DG  J "C5'" 1 
ATOM   9709  C  "C4'" . DG  J 6  33  ? -27.574 -36.643 -2.427 1.00 171.87 ? -40  DG  J "C4'" 1 
ATOM   9710  O  "O4'" . DG  J 6  33  ? -27.697 -35.845 -1.220 1.00 176.48 ? -40  DG  J "O4'" 1 
ATOM   9711  C  "C3'" . DG  J 6  33  ? -26.082 -36.666 -2.753 1.00 168.98 ? -40  DG  J "C3'" 1 
ATOM   9712  O  "O3'" . DG  J 6  33  ? -25.881 -36.100 -4.039 1.00 162.68 ? -40  DG  J "O3'" 1 
ATOM   9713  C  "C2'" . DG  J 6  33  ? -25.436 -35.808 -1.657 1.00 172.76 ? -40  DG  J "C2'" 1 
ATOM   9714  C  "C1'" . DG  J 6  33  ? -26.608 -34.955 -1.179 1.00 172.33 ? -40  DG  J "C1'" 1 
ATOM   9715  N  N9    . DG  J 6  33  ? -26.435 -34.455 0.183  1.00 169.27 ? -40  DG  J N9    1 
ATOM   9716  C  C8    . DG  J 6  33  ? -26.414 -35.196 1.341  1.00 160.11 ? -40  DG  J C8    1 
ATOM   9717  N  N7    . DG  J 6  33  ? -26.206 -34.474 2.408  1.00 149.28 ? -40  DG  J N7    1 
ATOM   9718  C  C5    . DG  J 6  33  ? -26.060 -33.181 1.926  1.00 155.63 ? -40  DG  J C5    1 
ATOM   9719  C  C6    . DG  J 6  33  ? -25.810 -31.966 2.616  1.00 152.06 ? -40  DG  J C6    1 
ATOM   9720  O  O6    . DG  J 6  33  ? -25.663 -31.786 3.831  1.00 143.32 ? -40  DG  J O6    1 
ATOM   9721  N  N1    . DG  J 6  33  ? -25.733 -30.887 1.742  1.00 150.91 ? -40  DG  J N1    1 
ATOM   9722  C  C2    . DG  J 6  33  ? -25.877 -30.963 0.379  1.00 148.93 ? -40  DG  J C2    1 
ATOM   9723  N  N2    . DG  J 6  33  ? -25.770 -29.807 -0.290 1.00 144.27 ? -40  DG  J N2    1 
ATOM   9724  N  N3    . DG  J 6  33  ? -26.112 -32.089 -0.278 1.00 154.84 ? -40  DG  J N3    1 
ATOM   9725  C  C4    . DG  J 6  33  ? -26.189 -33.152 0.553  1.00 161.00 ? -40  DG  J C4    1 
ATOM   9726  P  P     . DT  J 6  34  ? -24.401 -35.972 -4.609 1.00 164.70 ? -39  DT  J P     1 
ATOM   9727  O  OP1   . DT  J 6  34  ? -24.513 -36.141 -6.079 1.00 173.54 ? -39  DT  J OP1   1 
ATOM   9728  O  OP2   . DT  J 6  34  ? -23.514 -36.882 -3.832 1.00 161.17 ? -39  DT  J OP2   1 
ATOM   9729  O  "O5'" . DT  J 6  34  ? -24.028 -34.455 -4.289 1.00 163.93 ? -39  DT  J "O5'" 1 
ATOM   9730  C  "C5'" . DT  J 6  34  ? -24.441 -33.383 -5.165 1.00 162.29 ? -39  DT  J "C5'" 1 
ATOM   9731  C  "C4'" . DT  J 6  34  ? -23.431 -32.256 -5.159 1.00 164.30 ? -39  DT  J "C4'" 1 
ATOM   9732  O  "O4'" . DT  J 6  34  ? -23.433 -31.610 -3.864 1.00 165.56 ? -39  DT  J "O4'" 1 
ATOM   9733  C  "C3'" . DT  J 6  34  ? -21.979 -32.661 -5.428 1.00 168.72 ? -39  DT  J "C3'" 1 
ATOM   9734  O  "O3'" . DT  J 6  34  ? -21.324 -31.655 -6.214 1.00 172.54 ? -39  DT  J "O3'" 1 
ATOM   9735  C  "C2'" . DT  J 6  34  ? -21.381 -32.750 -4.036 1.00 173.68 ? -39  DT  J "C2'" 1 
ATOM   9736  C  "C1'" . DT  J 6  34  ? -22.132 -31.656 -3.290 1.00 180.11 ? -39  DT  J "C1'" 1 
ATOM   9737  N  N1    . DT  J 6  34  ? -22.283 -31.892 -1.838 1.00 183.68 ? -39  DT  J N1    1 
ATOM   9738  C  C2    . DT  J 6  34  ? -22.446 -30.805 -1.005 1.00 181.27 ? -39  DT  J C2    1 
ATOM   9739  O  O2    . DT  J 6  34  ? -22.479 -29.653 -1.407 1.00 181.87 ? -39  DT  J O2    1 
ATOM   9740  N  N3    . DT  J 6  34  ? -22.573 -31.120 0.326  1.00 173.31 ? -39  DT  J N3    1 
ATOM   9741  C  C4    . DT  J 6  34  ? -22.550 -32.381 0.893  1.00 173.65 ? -39  DT  J C4    1 
ATOM   9742  O  O4    . DT  J 6  34  ? -22.680 -32.507 2.108  1.00 170.11 ? -39  DT  J O4    1 
ATOM   9743  C  C5    . DT  J 6  34  ? -22.372 -33.473 -0.039 1.00 173.94 ? -39  DT  J C5    1 
ATOM   9744  C  C7    . DT  J 6  34  ? -22.334 -34.875 0.483  1.00 170.70 ? -39  DT  J C7    1 
ATOM   9745  C  C6    . DT  J 6  34  ? -22.249 -33.177 -1.339 1.00 177.47 ? -39  DT  J C6    1 
ATOM   9746  P  P     . DA  J 6  35  ? -19.727 -31.452 -6.310 1.00 170.31 ? -38  DA  J P     1 
ATOM   9747  O  OP1   . DA  J 6  35  ? -19.433 -30.839 -7.632 1.00 164.79 ? -38  DA  J OP1   1 
ATOM   9748  O  OP2   . DA  J 6  35  ? -19.027 -32.706 -5.912 1.00 161.09 ? -38  DA  J OP2   1 
ATOM   9749  O  "O5'" . DA  J 6  35  ? -19.457 -30.334 -5.208 1.00 164.14 ? -38  DA  J "O5'" 1 
ATOM   9750  C  "C5'" . DA  J 6  35  ? -19.862 -28.964 -5.417 1.00 161.77 ? -38  DA  J "C5'" 1 
ATOM   9751  C  "C4'" . DA  J 6  35  ? -18.935 -28.009 -4.689 1.00 162.71 ? -38  DA  J "C4'" 1 
ATOM   9752  O  "O4'" . DA  J 6  35  ? -19.042 -28.209 -3.255 1.00 161.63 ? -38  DA  J "O4'" 1 
ATOM   9753  C  "C3'" . DA  J 6  35  ? -17.445 -28.114 -5.010 1.00 163.25 ? -38  DA  J "C3'" 1 
ATOM   9754  O  "O3'" . DA  J 6  35  ? -16.890 -26.803 -4.936 1.00 159.55 ? -38  DA  J "O3'" 1 
ATOM   9755  C  "C2'" . DA  J 6  35  ? -16.929 -29.071 -3.937 1.00 158.76 ? -38  DA  J "C2'" 1 
ATOM   9756  C  "C1'" . DA  J 6  35  ? -17.824 -28.725 -2.745 1.00 164.13 ? -38  DA  J "C1'" 1 
ATOM   9757  N  N9    . DA  J 6  35  ? -18.142 -29.882 -1.907 1.00 163.39 ? -38  DA  J N9    1 
ATOM   9758  C  C8    . DA  J 6  35  ? -18.332 -31.179 -2.315 1.00 157.98 ? -38  DA  J C8    1 
ATOM   9759  N  N7    . DA  J 6  35  ? -18.619 -32.004 -1.339 1.00 153.23 ? -38  DA  J N7    1 
ATOM   9760  C  C5    . DA  J 6  35  ? -18.624 -31.197 -0.211 1.00 155.00 ? -38  DA  J C5    1 
ATOM   9761  C  C6    . DA  J 6  35  ? -18.860 -31.471 1.146  1.00 153.05 ? -38  DA  J C6    1 
ATOM   9762  N  N6    . DA  J 6  35  ? -19.151 -32.687 1.615  1.00 146.73 ? -38  DA  J N6    1 
ATOM   9763  N  N1    . DA  J 6  35  ? -18.788 -30.441 2.017  1.00 158.62 ? -38  DA  J N1    1 
ATOM   9764  C  C2    . DA  J 6  35  ? -18.494 -29.221 1.546  1.00 153.33 ? -38  DA  J C2    1 
ATOM   9765  N  N3    . DA  J 6  35  ? -18.256 -28.838 0.294  1.00 151.13 ? -38  DA  J N3    1 
ATOM   9766  C  C4    . DA  J 6  35  ? -18.336 -29.885 -0.546 1.00 159.05 ? -38  DA  J C4    1 
ATOM   9767  P  P     . DT  J 6  36  ? -15.345 -26.458 -4.680 1.00 161.21 ? -37  DT  J P     1 
ATOM   9768  O  OP1   . DT  J 6  36  ? -15.100 -25.116 -5.276 1.00 154.24 ? -37  DT  J OP1   1 
ATOM   9769  O  OP2   . DT  J 6  36  ? -14.468 -27.604 -5.054 1.00 143.66 ? -37  DT  J OP2   1 
ATOM   9770  O  "O5'" . DT  J 6  36  ? -15.313 -26.316 -3.094 1.00 162.40 ? -37  DT  J "O5'" 1 
ATOM   9771  C  "C5'" . DT  J 6  36  ? -16.181 -25.395 -2.397 1.00 160.24 ? -37  DT  J "C5'" 1 
ATOM   9772  C  "C4'" . DT  J 6  36  ? -15.560 -24.990 -1.079 1.00 157.81 ? -37  DT  J "C4'" 1 
ATOM   9773  O  "O4'" . DT  J 6  36  ? -15.854 -25.988 -0.070 1.00 155.18 ? -37  DT  J "O4'" 1 
ATOM   9774  C  "C3'" . DT  J 6  36  ? -14.035 -24.842 -1.114 1.00 158.81 ? -37  DT  J "C3'" 1 
ATOM   9775  O  "O3'" . DT  J 6  36  ? -13.637 -23.573 -0.577 1.00 160.66 ? -37  DT  J "O3'" 1 
ATOM   9776  C  "C2'" . DT  J 6  36  ? -13.525 -26.033 -0.319 1.00 155.59 ? -37  DT  J "C2'" 1 
ATOM   9777  C  "C1'" . DT  J 6  36  ? -14.670 -26.340 0.627  1.00 156.73 ? -37  DT  J "C1'" 1 
ATOM   9778  N  N1    . DT  J 6  36  ? -14.771 -27.765 1.013  1.00 157.91 ? -37  DT  J N1    1 
ATOM   9779  C  C2    . DT  J 6  36  ? -14.749 -28.082 2.354  1.00 158.05 ? -37  DT  J C2    1 
ATOM   9780  O  O2    . DT  J 6  36  ? -14.661 -27.245 3.237  1.00 155.42 ? -37  DT  J O2    1 
ATOM   9781  N  N3    . DT  J 6  36  ? -14.839 -29.426 2.624  1.00 152.14 ? -37  DT  J N3    1 
ATOM   9782  C  C4    . DT  J 6  36  ? -14.946 -30.457 1.710  1.00 151.67 ? -37  DT  J C4    1 
ATOM   9783  O  O4    . DT  J 6  36  ? -15.022 -31.617 2.103  1.00 150.28 ? -37  DT  J O4    1 
ATOM   9784  C  C5    . DT  J 6  36  ? -14.957 -30.053 0.322  1.00 154.13 ? -37  DT  J C5    1 
ATOM   9785  C  C7    . DT  J 6  36  ? -15.064 -31.102 -0.739 1.00 149.62 ? -37  DT  J C7    1 
ATOM   9786  C  C6    . DT  J 6  36  ? -14.866 -28.745 0.047  1.00 155.29 ? -37  DT  J C6    1 
ATOM   9787  P  P     . DT  J 6  37  ? -12.108 -23.149 -0.279 1.00 160.94 ? -36  DT  J P     1 
ATOM   9788  O  OP1   . DT  J 6  37  ? -12.005 -21.677 -0.470 1.00 148.90 ? -36  DT  J OP1   1 
ATOM   9789  O  OP2   . DT  J 6  37  ? -11.139 -24.052 -0.968 1.00 141.67 ? -36  DT  J OP2   1 
ATOM   9790  O  "O5'" . DT  J 6  37  ? -12.047 -23.428 1.290  1.00 164.19 ? -36  DT  J "O5'" 1 
ATOM   9791  C  "C5'" . DT  J 6  37  ? -13.175 -23.126 2.141  1.00 151.78 ? -36  DT  J "C5'" 1 
ATOM   9792  C  "C4'" . DT  J 6  37  ? -12.870 -23.494 3.574  1.00 139.87 ? -36  DT  J "C4'" 1 
ATOM   9793  O  "O4'" . DT  J 6  37  ? -13.018 -24.922 3.755  1.00 135.84 ? -36  DT  J "O4'" 1 
ATOM   9794  C  "C3'" . DT  J 6  37  ? -11.456 -23.145 4.041  1.00 136.11 ? -36  DT  J "C3'" 1 
ATOM   9795  O  "O3'" . DT  J 6  37  ? -11.541 -22.543 5.334  1.00 138.37 ? -36  DT  J "O3'" 1 
ATOM   9796  C  "C2'" . DT  J 6  37  ? -10.738 -24.484 4.066  1.00 132.87 ? -36  DT  J "C2'" 1 
ATOM   9797  C  "C1'" . DT  J 6  37  ? -11.863 -25.455 4.380  1.00 141.70 ? -36  DT  J "C1'" 1 
ATOM   9798  N  N1    . DT  J 6  37  ? -11.649 -26.815 3.850  1.00 146.24 ? -36  DT  J N1    1 
ATOM   9799  C  C2    . DT  J 6  37  ? -11.736 -27.891 4.709  1.00 154.19 ? -36  DT  J C2    1 
ATOM   9800  O  O2    . DT  J 6  37  ? -11.986 -27.779 5.899  1.00 163.00 ? -36  DT  J O2    1 
ATOM   9801  N  N3    . DT  J 6  37  ? -11.517 -29.111 4.119  1.00 151.73 ? -36  DT  J N3    1 
ATOM   9802  C  C4    . DT  J 6  37  ? -11.226 -29.357 2.790  1.00 150.28 ? -36  DT  J C4    1 
ATOM   9803  O  O4    . DT  J 6  37  ? -11.053 -30.510 2.405  1.00 140.89 ? -36  DT  J O4    1 
ATOM   9804  C  C5    . DT  J 6  37  ? -11.150 -28.183 1.948  1.00 152.77 ? -36  DT  J C5    1 
ATOM   9805  C  C7    . DT  J 6  37  ? -10.841 -28.351 0.493  1.00 152.85 ? -36  DT  J C7    1 
ATOM   9806  C  C6    . DT  J 6  37  ? -11.361 -26.988 2.514  1.00 148.53 ? -36  DT  J C6    1 
ATOM   9807  P  P     . DT  J 6  38  ? -10.244 -22.018 6.097  1.00 143.47 ? -35  DT  J P     1 
ATOM   9808  O  OP1   . DT  J 6  38  ? -10.612 -20.734 6.756  1.00 136.18 ? -35  DT  J OP1   1 
ATOM   9809  O  OP2   . DT  J 6  38  ? -9.083  -22.073 5.164  1.00 130.27 ? -35  DT  J OP2   1 
ATOM   9810  O  "O5'" . DT  J 6  38  ? -9.997  -23.129 7.216  1.00 151.80 ? -35  DT  J "O5'" 1 
ATOM   9811  C  "C5'" . DT  J 6  38  ? -11.074 -23.674 8.013  1.00 138.21 ? -35  DT  J "C5'" 1 
ATOM   9812  C  "C4'" . DT  J 6  38  ? -10.602 -24.867 8.816  1.00 138.94 ? -35  DT  J "C4'" 1 
ATOM   9813  O  "O4'" . DT  J 6  38  ? -10.562 -26.069 8.004  1.00 138.24 ? -35  DT  J "O4'" 1 
ATOM   9814  C  "C3'" . DT  J 6  38  ? -9.215  -24.742 9.453  1.00 149.85 ? -35  DT  J "C3'" 1 
ATOM   9815  O  "O3'" . DT  J 6  38  ? -9.298  -25.224 10.794 1.00 153.11 ? -35  DT  J "O3'" 1 
ATOM   9816  C  "C2'" . DT  J 6  38  ? -8.355  -25.700 8.645  1.00 141.35 ? -35  DT  J "C2'" 1 
ATOM   9817  C  "C1'" . DT  J 6  38  ? -9.363  -26.773 8.286  1.00 136.48 ? -35  DT  J "C1'" 1 
ATOM   9818  N  N1    . DT  J 6  38  ? -9.020  -27.597 7.107  1.00 138.81 ? -35  DT  J N1    1 
ATOM   9819  C  C2    . DT  J 6  38  ? -9.149  -28.965 7.219  1.00 139.65 ? -35  DT  J C2    1 
ATOM   9820  O  O2    . DT  J 6  38  ? -9.537  -29.518 8.235  1.00 136.43 ? -35  DT  J O2    1 
ATOM   9821  N  N3    . DT  J 6  38  ? -8.812  -29.664 6.085  1.00 138.70 ? -35  DT  J N3    1 
ATOM   9822  C  C4    . DT  J 6  38  ? -8.366  -29.145 4.883  1.00 132.79 ? -35  DT  J C4    1 
ATOM   9823  O  O4    . DT  J 6  38  ? -8.107  -29.900 3.950  1.00 127.36 ? -35  DT  J O4    1 
ATOM   9824  C  C5    . DT  J 6  38  ? -8.251  -27.703 4.839  1.00 130.76 ? -35  DT  J C5    1 
ATOM   9825  C  C7    . DT  J 6  38  ? -7.781  -27.048 3.578  1.00 129.63 ? -35  DT  J C7    1 
ATOM   9826  C  C6    . DT  J 6  38  ? -8.577  -27.012 5.939  1.00 136.91 ? -35  DT  J C6    1 
ATOM   9827  P  P     . DG  J 6  39  ? -8.444  -24.559 11.964 1.00 143.92 ? -34  DG  J P     1 
ATOM   9828  O  OP1   . DG  J 6  39  ? -9.116  -23.284 12.337 1.00 134.04 ? -34  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J 6  39  ? -7.002  -24.564 11.599 1.00 131.67 ? -34  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J 6  39  ? -8.674  -25.636 13.112 1.00 139.72 ? -34  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J 6  39  ? -9.819  -26.504 13.083 1.00 134.51 ? -34  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J 6  39  ? -9.385  -27.935 13.265 1.00 129.55 ? -34  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J 6  39  ? -8.883  -28.446 12.004 1.00 135.20 ? -34  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J 6  39  ? -8.273  -28.150 14.289 1.00 130.69 ? -34  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J 6  39  ? -8.602  -29.247 15.127 1.00 125.81 ? -34  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J 6  39  ? -7.048  -28.451 13.430 1.00 135.24 ? -34  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J 6  39  ? -7.688  -29.153 12.239 1.00 149.05 ? -34  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J 6  39  ? -6.889  -29.127 11.019 1.00 171.35 ? -34  DG  J N9    1 
ATOM   9839  C  C8    . DG  J 6  39  ? -6.355  -28.025 10.393 1.00 176.21 ? -34  DG  J C8    1 
ATOM   9840  N  N7    . DG  J 6  39  ? -5.694  -28.322 9.307  1.00 176.34 ? -34  DG  J N7    1 
ATOM   9841  C  C5    . DG  J 6  39  ? -5.798  -29.704 9.209  1.00 179.35 ? -34  DG  J C5    1 
ATOM   9842  C  C6    . DG  J 6  39  ? -5.283  -30.598 8.235  1.00 179.22 ? -34  DG  J C6    1 
ATOM   9843  O  O6    . DG  J 6  39  ? -4.608  -30.339 7.231  1.00 181.59 ? -34  DG  J O6    1 
ATOM   9844  N  N1    . DG  J 6  39  ? -5.626  -31.916 8.519  1.00 176.34 ? -34  DG  J N1    1 
ATOM   9845  C  C2    . DG  J 6  39  ? -6.370  -32.324 9.599  1.00 172.08 ? -34  DG  J C2    1 
ATOM   9846  N  N2    . DG  J 6  39  ? -6.595  -33.642 9.700  1.00 179.03 ? -34  DG  J N2    1 
ATOM   9847  N  N3    . DG  J 6  39  ? -6.855  -31.502 10.514 1.00 171.06 ? -34  DG  J N3    1 
ATOM   9848  C  C4    . DG  J 6  39  ? -6.533  -30.215 10.258 1.00 177.15 ? -34  DG  J C4    1 
ATOM   9849  P  P     . DG  J 6  40  ? -8.235  -29.183 16.676 1.00 117.67 ? -33  DG  J P     1 
ATOM   9850  O  OP1   . DG  J 6  40  ? -9.533  -29.224 17.395 1.00 113.38 ? -33  DG  J OP1   1 
ATOM   9851  O  OP2   . DG  J 6  40  ? -7.287  -28.064 16.922 1.00 105.65 ? -33  DG  J OP2   1 
ATOM   9852  O  "O5'" . DG  J 6  40  ? -7.450  -30.548 16.919 1.00 119.77 ? -33  DG  J "O5'" 1 
ATOM   9853  C  "C5'" . DG  J 6  40  ? -7.864  -31.772 16.281 1.00 128.50 ? -33  DG  J "C5'" 1 
ATOM   9854  C  "C4'" . DG  J 6  40  ? -6.657  -32.599 15.903 1.00 137.69 ? -33  DG  J "C4'" 1 
ATOM   9855  O  "O4'" . DG  J 6  40  ? -6.072  -32.096 14.667 1.00 132.99 ? -33  DG  J "O4'" 1 
ATOM   9856  C  "C3'" . DG  J 6  40  ? -5.510  -32.622 16.919 1.00 146.09 ? -33  DG  J "C3'" 1 
ATOM   9857  O  "O3'" . DG  J 6  40  ? -4.932  -33.918 16.937 1.00 146.51 ? -33  DG  J "O3'" 1 
ATOM   9858  C  "C2'" . DG  J 6  40  ? -4.470  -31.711 16.278 1.00 144.11 ? -33  DG  J "C2'" 1 
ATOM   9859  C  "C1'" . DG  J 6  40  ? -4.670  -32.081 14.815 1.00 145.75 ? -33  DG  J "C1'" 1 
ATOM   9860  N  N9    . DG  J 6  40  ? -4.084  -31.182 13.830 1.00 146.07 ? -33  DG  J N9    1 
ATOM   9861  C  C8    . DG  J 6  40  ? -3.766  -29.853 13.974 1.00 139.83 ? -33  DG  J C8    1 
ATOM   9862  N  N7    . DG  J 6  40  ? -3.227  -29.337 12.902 1.00 142.75 ? -33  DG  J N7    1 
ATOM   9863  C  C5    . DG  J 6  40  ? -3.174  -30.393 12.003 1.00 152.72 ? -33  DG  J C5    1 
ATOM   9864  C  C6    . DG  J 6  40  ? -2.690  -30.443 10.670 1.00 161.13 ? -33  DG  J C6    1 
ATOM   9865  O  O6    . DG  J 6  40  ? -2.195  -29.532 9.996  1.00 173.60 ? -33  DG  J O6    1 
ATOM   9866  N  N1    . DG  J 6  40  ? -2.824  -31.717 10.125 1.00 162.69 ? -33  DG  J N1    1 
ATOM   9867  C  C2    . DG  J 6  40  ? -3.355  -32.804 10.776 1.00 161.64 ? -33  DG  J C2    1 
ATOM   9868  N  N2    . DG  J 6  40  ? -3.399  -33.951 10.080 1.00 165.60 ? -33  DG  J N2    1 
ATOM   9869  N  N3    . DG  J 6  40  ? -3.812  -32.769 12.016 1.00 158.98 ? -33  DG  J N3    1 
ATOM   9870  C  C4    . DG  J 6  40  ? -3.690  -31.541 12.565 1.00 152.96 ? -33  DG  J C4    1 
ATOM   9871  P  P     . DA  J 6  41  ? -5.209  -34.894 18.153 1.00 149.60 ? -32  DA  J P     1 
ATOM   9872  O  OP1   . DA  J 6  41  ? -6.666  -35.194 18.155 1.00 145.73 ? -32  DA  J OP1   1 
ATOM   9873  O  OP2   . DA  J 6  41  ? -4.585  -34.264 19.343 1.00 145.19 ? -32  DA  J OP2   1 
ATOM   9874  O  "O5'" . DA  J 6  41  ? -4.334  -36.161 17.739 1.00 149.33 ? -32  DA  J "O5'" 1 
ATOM   9875  C  "C5'" . DA  J 6  41  ? -4.934  -37.431 17.421 1.00 149.90 ? -32  DA  J "C5'" 1 
ATOM   9876  C  "C4'" . DA  J 6  41  ? -4.095  -38.150 16.391 1.00 156.54 ? -32  DA  J "C4'" 1 
ATOM   9877  O  "O4'" . DA  J 6  41  ? -3.712  -37.208 15.351 1.00 152.07 ? -32  DA  J "O4'" 1 
ATOM   9878  C  "C3'" . DA  J 6  41  ? -2.792  -38.771 16.907 1.00 162.63 ? -32  DA  J "C3'" 1 
ATOM   9879  O  "O3'" . DA  J 6  41  ? -2.580  -40.042 16.287 1.00 171.36 ? -32  DA  J "O3'" 1 
ATOM   9880  C  "C2'" . DA  J 6  41  ? -1.744  -37.741 16.500 1.00 159.20 ? -32  DA  J "C2'" 1 
ATOM   9881  C  "C1'" . DA  J 6  41  ? -2.313  -37.257 15.169 1.00 156.08 ? -32  DA  J "C1'" 1 
ATOM   9882  N  N9    . DA  J 6  41  ? -1.847  -35.928 14.778 1.00 149.52 ? -32  DA  J N9    1 
ATOM   9883  C  C8    . DA  J 6  41  ? -1.776  -34.790 15.544 1.00 142.54 ? -32  DA  J C8    1 
ATOM   9884  N  N7    . DA  J 6  41  ? -1.301  -33.750 14.904 1.00 136.16 ? -32  DA  J N7    1 
ATOM   9885  C  C5    . DA  J 6  41  ? -1.037  -34.236 13.630 1.00 139.23 ? -32  DA  J C5    1 
ATOM   9886  C  C6    . DA  J 6  41  ? -0.519  -33.627 12.474 1.00 132.94 ? -32  DA  J C6    1 
ATOM   9887  N  N6    . DA  J 6  41  ? -0.157  -32.343 12.411 1.00 126.63 ? -32  DA  J N6    1 
ATOM   9888  N  N1    . DA  J 6  41  ? -0.382  -34.392 11.368 1.00 139.57 ? -32  DA  J N1    1 
ATOM   9889  C  C2    . DA  J 6  41  ? -0.746  -35.680 11.431 1.00 146.27 ? -32  DA  J C2    1 
ATOM   9890  N  N3    . DA  J 6  41  ? -1.244  -36.366 12.458 1.00 148.28 ? -32  DA  J N3    1 
ATOM   9891  C  C4    . DA  J 6  41  ? -1.367  -35.577 13.540 1.00 147.02 ? -32  DA  J C4    1 
ATOM   9892  P  P     . DA  J 6  42  ? -1.155  -40.742 15.987 1.00 176.33 ? -31  DA  J P     1 
ATOM   9893  O  OP1   . DA  J 6  42  ? -1.348  -42.202 16.188 1.00 187.53 ? -31  DA  J OP1   1 
ATOM   9894  O  OP2   . DA  J 6  42  ? -0.068  -40.044 16.726 1.00 166.90 ? -31  DA  J OP2   1 
ATOM   9895  O  "O5'" . DA  J 6  42  ? -0.954  -40.489 14.424 1.00 179.08 ? -31  DA  J "O5'" 1 
ATOM   9896  C  "C5'" . DA  J 6  42  ? -0.380  -41.494 13.560 1.00 168.52 ? -31  DA  J "C5'" 1 
ATOM   9897  C  "C4'" . DA  J 6  42  ? 1.067   -41.170 13.280 1.00 165.11 ? -31  DA  J "C4'" 1 
ATOM   9898  O  "O4'" . DA  J 6  42  ? 1.187   -39.749 13.045 1.00 152.36 ? -31  DA  J "O4'" 1 
ATOM   9899  C  "C3'" . DA  J 6  42  ? 2.035   -41.524 14.415 1.00 163.10 ? -31  DA  J "C3'" 1 
ATOM   9900  O  "O3'" . DA  J 6  42  ? 2.954   -42.579 14.123 1.00 165.58 ? -31  DA  J "O3'" 1 
ATOM   9901  C  "C2'" . DA  J 6  42  ? 2.724   -40.206 14.786 1.00 163.24 ? -31  DA  J "C2'" 1 
ATOM   9902  C  "C1'" . DA  J 6  42  ? 2.384   -39.282 13.613 1.00 161.77 ? -31  DA  J "C1'" 1 
ATOM   9903  N  N9    . DA  J 6  42  ? 2.176   -37.894 14.028 1.00 167.95 ? -31  DA  J N9    1 
ATOM   9904  C  C8    . DA  J 6  42  ? 1.543   -37.447 15.163 1.00 167.24 ? -31  DA  J C8    1 
ATOM   9905  N  N7    . DA  J 6  42  ? 1.511   -36.141 15.271 1.00 165.71 ? -31  DA  J N7    1 
ATOM   9906  C  C5    . DA  J 6  42  ? 2.166   -35.696 14.131 1.00 171.13 ? -31  DA  J C5    1 
ATOM   9907  C  C6    . DA  J 6  42  ? 2.463   -34.406 13.652 1.00 168.70 ? -31  DA  J C6    1 
ATOM   9908  N  N6    . DA  J 6  42  ? 2.125   -33.283 14.289 1.00 161.82 ? -31  DA  J N6    1 
ATOM   9909  N