data_5DPT
# 
_entry.id   5DPT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.295 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DPT         
WWPDB D_1000213638 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5DPR PDB . 
unspecified 5DPS PDB . 
unspecified 5DPW PDB . 
unspecified 3X0W PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DPT 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ravichandran, A.C.' 1 
'Suzuki, H.'         2 
'Dobson, R.C.J.'     3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'EMBO Rep.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1469-3178 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            18 
_citation.language                  ? 
_citation.page_first                1382 
_citation.page_last                 1396 
_citation.title                     'Structural and functional analysis of the GABARAP interaction motif (GIM).' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.15252/embr.201643587 
_citation.pdbx_database_id_PubMed   28655748 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rogov, V.V.'        1  
primary 'Stolz, A.'          2  
primary 'Ravichandran, A.C.' 3  
primary 'Rios-Szwed, D.O.'   4  
primary 'Suzuki, H.'         5  
primary 'Kniss, A.'          6  
primary 'Lohr, F.'           7  
primary 'Wakatsuki, S.'      8  
primary 'Dotsch, V.'         9  
primary 'Dikic, I.'          10 
primary 'Dobson, R.C.'       11 
primary 'McEwan, D.G.'       12 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5DPT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     84.791 
_cell.length_a_esd                 ? 
_cell.length_b                     84.791 
_cell.length_b_esd                 ? 
_cell.length_c                     105.440 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5DPT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 
;Pleckstrin homology domain-containing family M member 1, Gamma-aminobutyric acid receptor-associated protein-like 1,Gamma-aminobutyric acid receptor-associated protein-like 1
;
15706.726 2 ? ? 'UNP Q9Y4G2 627-638, UNP Q9H0R8 2-117' ? 
2 non-polymer syn '(4S)-2-METHYL-2,4-PENTANEDIOL' 118.174   2 ? ? ?                                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;PH domain-containing family M member 1,162 kDa adapter protein,AP162,Early estrogen-regulated protein,GABA(A) receptor-associated protein-like 1,Glandular epithelial cell protein 1,GEC-1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSVRPQQEDEWVNVGSKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIR
KRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSVRPQQEDEWVNVGSKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIR
KRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   VAL n 
1 4   ARG n 
1 5   PRO n 
1 6   GLN n 
1 7   GLN n 
1 8   GLU n 
1 9   ASP n 
1 10  GLU n 
1 11  TRP n 
1 12  VAL n 
1 13  ASN n 
1 14  VAL n 
1 15  GLY n 
1 16  SER n 
1 17  LYS n 
1 18  PHE n 
1 19  GLN n 
1 20  TYR n 
1 21  LYS n 
1 22  GLU n 
1 23  ASP n 
1 24  HIS n 
1 25  PRO n 
1 26  PHE n 
1 27  GLU n 
1 28  TYR n 
1 29  ARG n 
1 30  LYS n 
1 31  LYS n 
1 32  GLU n 
1 33  GLY n 
1 34  GLU n 
1 35  LYS n 
1 36  ILE n 
1 37  ARG n 
1 38  LYS n 
1 39  LYS n 
1 40  TYR n 
1 41  PRO n 
1 42  ASP n 
1 43  ARG n 
1 44  VAL n 
1 45  PRO n 
1 46  VAL n 
1 47  ILE n 
1 48  VAL n 
1 49  GLU n 
1 50  LYS n 
1 51  ALA n 
1 52  PRO n 
1 53  LYS n 
1 54  ALA n 
1 55  ARG n 
1 56  VAL n 
1 57  PRO n 
1 58  ASP n 
1 59  LEU n 
1 60  ASP n 
1 61  LYS n 
1 62  ARG n 
1 63  LYS n 
1 64  TYR n 
1 65  LEU n 
1 66  VAL n 
1 67  PRO n 
1 68  SER n 
1 69  ASP n 
1 70  LEU n 
1 71  THR n 
1 72  VAL n 
1 73  GLY n 
1 74  GLN n 
1 75  PHE n 
1 76  TYR n 
1 77  PHE n 
1 78  LEU n 
1 79  ILE n 
1 80  ARG n 
1 81  LYS n 
1 82  ARG n 
1 83  ILE n 
1 84  HIS n 
1 85  LEU n 
1 86  ARG n 
1 87  PRO n 
1 88  GLU n 
1 89  ASP n 
1 90  ALA n 
1 91  LEU n 
1 92  PHE n 
1 93  PHE n 
1 94  PHE n 
1 95  VAL n 
1 96  ASN n 
1 97  ASN n 
1 98  THR n 
1 99  ILE n 
1 100 PRO n 
1 101 PRO n 
1 102 THR n 
1 103 SER n 
1 104 ALA n 
1 105 THR n 
1 106 MET n 
1 107 GLY n 
1 108 GLN n 
1 109 LEU n 
1 110 TYR n 
1 111 GLU n 
1 112 ASP n 
1 113 ASN n 
1 114 HIS n 
1 115 GLU n 
1 116 GLU n 
1 117 ASP n 
1 118 TYR n 
1 119 PHE n 
1 120 LEU n 
1 121 TYR n 
1 122 VAL n 
1 123 ALA n 
1 124 TYR n 
1 125 SER n 
1 126 ASP n 
1 127 GLU n 
1 128 SER n 
1 129 VAL n 
1 130 TYR n 
1 131 GLY n 
1 132 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   14 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PLEKHM1, GABARAPL1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'BL21(de3)' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PKHM1_HUMAN Q9Y4G2 ? 1 VRPQQEDEWVNV 627 
2 UNP GBRL1_HUMAN Q9H0R8 ? 1 
;KFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVN
NTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
;
2   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DPT A 3  ? 14  ? Q9Y4G2 627 ? 638 ? -5 6   
2 2 5DPT A 17 ? 132 ? Q9H0R8 2   ? 117 ? 9  124 
3 1 5DPT B 3  ? 14  ? Q9Y4G2 627 ? 638 ? -5 6   
4 2 5DPT B 17 ? 132 ? Q9H0R8 2   ? 117 ? 9  124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DPT GLY A 1  ? UNP Q9Y4G2 ? ? 'expression tag' -7 1 
1 5DPT SER A 2  ? UNP Q9Y4G2 ? ? 'expression tag' -6 2 
1 5DPT GLY A 15 ? UNP Q9Y4G2 ? ? linker           7  3 
1 5DPT SER A 16 ? UNP Q9Y4G2 ? ? linker           8  4 
3 5DPT GLY B 1  ? UNP Q9Y4G2 ? ? 'expression tag' -7 5 
3 5DPT SER B 2  ? UNP Q9Y4G2 ? ? 'expression tag' -6 6 
3 5DPT GLY B 15 ? UNP Q9Y4G2 ? ? linker           7  7 
3 5DPT SER B 16 ? UNP Q9Y4G2 ? ? linker           8  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
MPD non-polymer         . '(4S)-2-METHYL-2,4-PENTANEDIOL' ? 'C6 H14 O2'      118.174 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DPT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20% w/v Polyethylene glycol 3,350, 0.2 M NaCl, 8% MPD pH 7.2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9537 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9537 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DPT 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.90 
_reflns.d_resolution_low                 42.826 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       10119 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   3.03 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5DPT 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.900 
_refine.ls_d_res_low                             42.826 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     10105 
_refine.ls_number_reflns_R_free                  562 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.82 
_refine.ls_percent_reflns_R_free                 5.56 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2162 
_refine.ls_R_factor_R_free                       0.2595 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2140 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.90 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1933 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1949 
_refine_hist.d_res_high                       2.900 
_refine_hist.d_res_low                        42.826 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 2004 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.778  ? 2741 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.428 ? 704  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.030  ? 294  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 361  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9001 3.1919  . . 149 2317 100.00 . . . 0.3699 . 0.3081 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1919 3.6536  . . 144 2349 100.00 . . . 0.3666 . 0.2619 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6536 4.6023  . . 139 2381 100.00 . . . 0.2481 . 0.2107 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6023 42.8303 . . 130 2496 100.00 . . . 0.2136 . 0.1900 . . . . . . . . . . 
# 
_struct.entry_id                     5DPT 
_struct.title                        'Crystal structure of PLEKHM1 LIR-fused human GABARAPL1_2-117' 
_struct.pdbx_descriptor              
'Pleckstrin homology domain-containing family M member 1, Gamma-aminobutyric acid receptor-associated protein-like 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DPT 
_struct_keywords.text            'Autophagy, chimeric protein, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLN A 19  ? HIS A 24  ? GLN A 11 HIS A 16  1 ? 6  
HELX_P HELX_P2 AA2 PRO A 25  ? TYR A 40  ? PRO A 17 TYR A 32  1 ? 16 
HELX_P HELX_P3 AA3 THR A 71  ? HIS A 84  ? THR A 63 HIS A 76  1 ? 14 
HELX_P HELX_P4 AA4 THR A 105 ? HIS A 114 ? THR A 97 HIS A 106 1 ? 10 
HELX_P HELX_P5 AA5 GLN B 19  ? HIS B 24  ? GLN B 11 HIS B 16  1 ? 6  
HELX_P HELX_P6 AA6 PRO B 25  ? TYR B 40  ? PRO B 17 TYR B 32  1 ? 16 
HELX_P HELX_P7 AA7 THR B 71  ? HIS B 84  ? THR B 63 HIS B 76  1 ? 14 
HELX_P HELX_P8 AA8 THR B 105 ? HIS B 114 ? THR B 97 HIS B 106 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 8   A . ? GLU 0   A ASP 9   A ? ASP 1   A 1 -0.92 
2 GLY 15  B . ? GLY 7   B SER 16  B ? SER 8   B 1 2.93  
3 PRO 87  B . ? PRO 79  B GLU 88  B ? GLU 80  B 1 8.18  
4 VAL 129 B . ? VAL 121 B TYR 130 B ? TYR 122 B 1 3.77  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 12  ? ASN A 13  ? VAL A 4   ASN A 5   
AA1 2 LYS B 63  ? PRO B 67  ? LYS B 55  PRO B 59  
AA1 3 ARG B 43  ? LYS B 50  ? ARG B 35  LYS B 42  
AA1 4 LEU B 120 ? SER B 125 ? LEU B 112 SER B 117 
AA1 5 PHE B 92  ? PHE B 94  ? PHE B 84  PHE B 86  
AA2 1 LYS A 63  ? PRO A 67  ? LYS A 55  PRO A 59  
AA2 2 ARG A 43  ? LYS A 50  ? ARG A 35  LYS A 42  
AA2 3 LEU A 120 ? SER A 125 ? LEU A 112 SER A 117 
AA2 4 PHE A 92  ? PHE A 94  ? PHE A 84  PHE A 86  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 12  ? N VAL A 4   O LEU B 65  ? O LEU B 57  
AA1 2 3 O VAL B 66  ? O VAL B 58  N VAL B 44  ? N VAL B 36  
AA1 3 4 N ILE B 47  ? N ILE B 39  O LEU B 120 ? O LEU B 112 
AA1 4 5 O ALA B 123 ? O ALA B 115 N PHE B 94  ? N PHE B 86  
AA2 1 2 O VAL A 66  ? O VAL A 58  N VAL A 44  ? N VAL A 36  
AA2 2 3 N ILE A 47  ? N ILE A 39  O LEU A 120 ? O LEU A 112 
AA2 3 4 O ALA A 123 ? O ALA A 115 N PHE A 94  ? N PHE A 86  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MPD 201 ? 6 'binding site for residue MPD A 201' 
AC2 Software B MPD 201 ? 6 'binding site for residue MPD B 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 PHE A 77  ? PHE A 69 . ? 1_555 ? 
2  AC1 6 PRO A 87  ? PRO A 79 . ? 1_555 ? 
3  AC1 6 TYR B 76  ? TYR B 68 . ? 3_455 ? 
4  AC1 6 PHE B 93  ? PHE B 85 . ? 3_455 ? 
5  AC1 6 ILE B 99  ? ILE B 91 . ? 3_455 ? 
6  AC1 6 THR B 102 ? THR B 94 . ? 3_455 ? 
7  AC2 6 TYR A 76  ? TYR A 68 . ? 2_564 ? 
8  AC2 6 PHE A 92  ? PHE A 84 . ? 2_564 ? 
9  AC2 6 PHE A 93  ? PHE A 85 . ? 2_564 ? 
10 AC2 6 ILE A 99  ? ILE A 91 . ? 2_564 ? 
11 AC2 6 PRO A 100 ? PRO A 92 . ? 2_564 ? 
12 AC2 6 PRO B 87  ? PRO B 79 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DPT 
_atom_sites.fract_transf_matrix[1][1]   0.011794 
_atom_sites.fract_transf_matrix[1][2]   0.006809 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013618 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009484 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 8   ? -44.754 5.175   1.394   1.00 146.81 ? 0   GLU A N   1 
ATOM   2    C CA  . GLU A 1 8   ? -44.502 3.818   0.932   1.00 150.99 ? 0   GLU A CA  1 
ATOM   3    C C   . GLU A 1 8   ? -45.098 3.437   -0.451  1.00 145.85 ? 0   GLU A C   1 
ATOM   4    O O   . GLU A 1 8   ? -44.349 2.850   -1.233  1.00 148.17 ? 0   GLU A O   1 
ATOM   5    C CB  . GLU A 1 8   ? -44.964 2.819   1.999   1.00 144.06 ? 0   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 8   ? -44.700 1.363   1.661   1.00 145.99 ? 0   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 8   ? -45.140 0.426   2.767   1.00 152.72 ? 0   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 8   ? -45.680 0.916   3.781   1.00 155.05 ? 0   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 8   ? -44.950 -0.800  2.623   1.00 154.12 ? 0   GLU A OE2 1 
ATOM   10   N N   . ASP A 1 9   ? -46.363 3.711   -0.831  1.00 137.55 ? 1   ASP A N   1 
ATOM   11   C CA  . ASP A 1 9   ? -47.496 4.373   -0.141  1.00 139.08 ? 1   ASP A CA  1 
ATOM   12   C C   . ASP A 1 9   ? -47.236 5.789   0.372   1.00 129.89 ? 1   ASP A C   1 
ATOM   13   O O   . ASP A 1 9   ? -47.586 6.125   1.504   1.00 126.94 ? 1   ASP A O   1 
ATOM   14   C CB  . ASP A 1 9   ? -48.017 3.501   1.009   1.00 153.32 ? 1   ASP A CB  1 
ATOM   15   C CG  . ASP A 1 9   ? -49.503 3.686   1.256   1.00 158.68 ? 1   ASP A CG  1 
ATOM   16   O OD1 . ASP A 1 9   ? -50.220 4.080   0.313   1.00 159.12 ? 1   ASP A OD1 1 
ATOM   17   O OD2 . ASP A 1 9   ? -49.954 3.434   2.393   1.00 159.25 ? 1   ASP A OD2 1 
ATOM   18   N N   . GLU A 1 10  ? -46.618 6.613   -0.468  1.00 125.27 ? 2   GLU A N   1 
ATOM   19   C CA  . GLU A 1 10  ? -46.363 8.010   -0.132  1.00 115.98 ? 2   GLU A CA  1 
ATOM   20   C C   . GLU A 1 10  ? -46.832 8.916   -1.265  1.00 120.14 ? 2   GLU A C   1 
ATOM   21   O O   . GLU A 1 10  ? -46.558 8.649   -2.435  1.00 130.45 ? 2   GLU A O   1 
ATOM   22   C CB  . GLU A 1 10  ? -44.877 8.239   0.153   1.00 103.24 ? 2   GLU A CB  1 
ATOM   23   N N   . TRP A 1 11  ? -47.540 9.985   -0.911  1.00 105.84 ? 3   TRP A N   1 
ATOM   24   C CA  . TRP A 1 11  ? -48.123 10.890  -1.899  1.00 96.33  ? 3   TRP A CA  1 
ATOM   25   C C   . TRP A 1 11  ? -47.076 11.581  -2.770  1.00 92.37  ? 3   TRP A C   1 
ATOM   26   O O   . TRP A 1 11  ? -46.011 11.972  -2.290  1.00 89.70  ? 3   TRP A O   1 
ATOM   27   C CB  . TRP A 1 11  ? -48.985 11.948  -1.207  1.00 100.10 ? 3   TRP A CB  1 
ATOM   28   C CG  . TRP A 1 11  ? -50.295 11.428  -0.701  1.00 107.35 ? 3   TRP A CG  1 
ATOM   29   C CD1 . TRP A 1 11  ? -50.625 11.155  0.594   1.00 105.11 ? 3   TRP A CD1 1 
ATOM   30   C CD2 . TRP A 1 11  ? -51.453 11.119  -1.485  1.00 122.67 ? 3   TRP A CD2 1 
ATOM   31   N NE1 . TRP A 1 11  ? -51.918 10.695  0.666   1.00 110.22 ? 3   TRP A NE1 1 
ATOM   32   C CE2 . TRP A 1 11  ? -52.448 10.664  -0.598  1.00 123.66 ? 3   TRP A CE2 1 
ATOM   33   C CE3 . TRP A 1 11  ? -51.745 11.183  -2.851  1.00 128.09 ? 3   TRP A CE3 1 
ATOM   34   C CZ2 . TRP A 1 11  ? -53.713 10.273  -1.032  1.00 135.76 ? 3   TRP A CZ2 1 
ATOM   35   C CZ3 . TRP A 1 11  ? -53.000 10.795  -3.280  1.00 128.38 ? 3   TRP A CZ3 1 
ATOM   36   C CH2 . TRP A 1 11  ? -53.968 10.346  -2.374  1.00 135.74 ? 3   TRP A CH2 1 
ATOM   37   N N   . VAL A 1 12  ? -47.393 11.726  -4.053  1.00 91.94  ? 4   VAL A N   1 
ATOM   38   C CA  . VAL A 1 12  ? -46.544 12.461  -4.985  1.00 90.94  ? 4   VAL A CA  1 
ATOM   39   C C   . VAL A 1 12  ? -47.084 13.874  -5.171  1.00 93.44  ? 4   VAL A C   1 
ATOM   40   O O   . VAL A 1 12  ? -48.236 14.059  -5.564  1.00 102.40 ? 4   VAL A O   1 
ATOM   41   C CB  . VAL A 1 12  ? -46.456 11.763  -6.356  1.00 84.95  ? 4   VAL A CB  1 
ATOM   42   C CG1 . VAL A 1 12  ? -45.640 12.601  -7.329  1.00 71.03  ? 4   VAL A CG1 1 
ATOM   43   C CG2 . VAL A 1 12  ? -45.856 10.375  -6.208  1.00 93.88  ? 4   VAL A CG2 1 
ATOM   44   N N   . ASN A 1 13  ? -46.249 14.867  -4.889  1.00 97.83  ? 5   ASN A N   1 
ATOM   45   C CA  . ASN A 1 13  ? -46.680 16.259  -4.931  1.00 91.21  ? 5   ASN A CA  1 
ATOM   46   C C   . ASN A 1 13  ? -46.503 16.903  -6.301  1.00 98.78  ? 5   ASN A C   1 
ATOM   47   O O   . ASN A 1 13  ? -45.392 16.985  -6.826  1.00 110.20 ? 5   ASN A O   1 
ATOM   48   C CB  . ASN A 1 13  ? -45.926 17.071  -3.877  1.00 88.42  ? 5   ASN A CB  1 
ATOM   49   C CG  . ASN A 1 13  ? -46.269 16.647  -2.463  1.00 94.59  ? 5   ASN A CG  1 
ATOM   50   O OD1 . ASN A 1 13  ? -47.440 16.495  -2.115  1.00 86.99  ? 5   ASN A OD1 1 
ATOM   51   N ND2 . ASN A 1 13  ? -45.245 16.445  -1.641  1.00 95.68  ? 5   ASN A ND2 1 
ATOM   52   N N   . VAL A 1 14  ? -47.613 17.356  -6.874  1.00 86.21  ? 6   VAL A N   1 
ATOM   53   C CA  . VAL A 1 14  ? -47.589 18.106  -8.122  1.00 77.14  ? 6   VAL A CA  1 
ATOM   54   C C   . VAL A 1 14  ? -48.017 19.544  -7.855  1.00 87.85  ? 6   VAL A C   1 
ATOM   55   O O   . VAL A 1 14  ? -49.035 19.786  -7.206  1.00 83.32  ? 6   VAL A O   1 
ATOM   56   C CB  . VAL A 1 14  ? -48.508 17.476  -9.187  1.00 73.57  ? 6   VAL A CB  1 
ATOM   57   C CG1 . VAL A 1 14  ? -48.505 18.313  -10.459 1.00 76.41  ? 6   VAL A CG1 1 
ATOM   58   C CG2 . VAL A 1 14  ? -48.074 16.048  -9.483  1.00 76.92  ? 6   VAL A CG2 1 
ATOM   59   N N   . GLY A 1 15  ? -47.229 20.496  -8.342  1.00 101.36 ? 7   GLY A N   1 
ATOM   60   C CA  . GLY A 1 15  ? -47.518 21.901  -8.126  1.00 101.15 ? 7   GLY A CA  1 
ATOM   61   C C   . GLY A 1 15  ? -47.818 22.635  -9.416  1.00 106.69 ? 7   GLY A C   1 
ATOM   62   O O   . GLY A 1 15  ? -47.776 22.051  -10.499 1.00 113.69 ? 7   GLY A O   1 
ATOM   63   N N   . SER A 1 16  ? -48.122 23.924  -9.298  1.00 109.89 ? 8   SER A N   1 
ATOM   64   C CA  . SER A 1 16  ? -48.393 24.754  -10.465 1.00 104.96 ? 8   SER A CA  1 
ATOM   65   C C   . SER A 1 16  ? -47.112 25.021  -11.246 1.00 96.79  ? 8   SER A C   1 
ATOM   66   O O   . SER A 1 16  ? -46.031 24.574  -10.860 1.00 91.61  ? 8   SER A O   1 
ATOM   67   C CB  . SER A 1 16  ? -49.043 26.075  -10.049 1.00 114.23 ? 8   SER A CB  1 
ATOM   68   O OG  . SER A 1 16  ? -50.281 25.853  -9.398  1.00 131.39 ? 8   SER A OG  1 
ATOM   69   N N   . LYS A 1 17  ? -47.238 25.755  -12.345 1.00 102.46 ? 9   LYS A N   1 
ATOM   70   C CA  . LYS A 1 17  ? -46.092 26.054  -13.192 1.00 111.59 ? 9   LYS A CA  1 
ATOM   71   C C   . LYS A 1 17  ? -45.165 27.082  -12.546 1.00 105.33 ? 9   LYS A C   1 
ATOM   72   O O   . LYS A 1 17  ? -45.542 28.238  -12.351 1.00 100.30 ? 9   LYS A O   1 
ATOM   73   C CB  . LYS A 1 17  ? -46.558 26.554  -14.563 1.00 96.36  ? 9   LYS A CB  1 
ATOM   74   N N   . PHE A 1 18  ? -43.956 26.647  -12.205 1.00 100.15 ? 10  PHE A N   1 
ATOM   75   C CA  . PHE A 1 18  ? -42.912 27.555  -11.744 1.00 101.89 ? 10  PHE A CA  1 
ATOM   76   C C   . PHE A 1 18  ? -41.912 27.794  -12.872 1.00 101.77 ? 10  PHE A C   1 
ATOM   77   O O   . PHE A 1 18  ? -41.703 26.923  -13.712 1.00 104.63 ? 10  PHE A O   1 
ATOM   78   C CB  . PHE A 1 18  ? -42.208 26.996  -10.503 1.00 99.04  ? 10  PHE A CB  1 
ATOM   79   C CG  . PHE A 1 18  ? -42.985 27.184  -9.228  1.00 95.85  ? 10  PHE A CG  1 
ATOM   80   C CD1 . PHE A 1 18  ? -44.010 26.315  -8.887  1.00 97.10  ? 10  PHE A CD1 1 
ATOM   81   C CD2 . PHE A 1 18  ? -42.687 28.230  -8.369  1.00 89.99  ? 10  PHE A CD2 1 
ATOM   82   C CE1 . PHE A 1 18  ? -44.724 26.489  -7.714  1.00 93.35  ? 10  PHE A CE1 1 
ATOM   83   C CE2 . PHE A 1 18  ? -43.397 28.408  -7.196  1.00 87.90  ? 10  PHE A CE2 1 
ATOM   84   C CZ  . PHE A 1 18  ? -44.417 27.537  -6.868  1.00 90.65  ? 10  PHE A CZ  1 
ATOM   85   N N   . GLN A 1 19  ? -41.308 28.977  -12.901 1.00 99.45  ? 11  GLN A N   1 
ATOM   86   C CA  . GLN A 1 19  ? -40.371 29.325  -13.967 1.00 107.75 ? 11  GLN A CA  1 
ATOM   87   C C   . GLN A 1 19  ? -39.127 28.442  -13.934 1.00 115.03 ? 11  GLN A C   1 
ATOM   88   O O   . GLN A 1 19  ? -38.594 28.070  -14.980 1.00 117.86 ? 11  GLN A O   1 
ATOM   89   C CB  . GLN A 1 19  ? -39.968 30.796  -13.876 1.00 103.35 ? 11  GLN A CB  1 
ATOM   90   C CG  . GLN A 1 19  ? -39.068 31.257  -15.011 1.00 125.92 ? 11  GLN A CG  1 
ATOM   91   C CD  . GLN A 1 19  ? -39.755 31.188  -16.361 1.00 139.89 ? 11  GLN A CD  1 
ATOM   92   O OE1 . GLN A 1 19  ? -40.730 31.897  -16.609 1.00 145.23 ? 11  GLN A OE1 1 
ATOM   93   N NE2 . GLN A 1 19  ? -39.250 30.330  -17.240 1.00 143.71 ? 11  GLN A NE2 1 
ATOM   94   N N   . TYR A 1 20  ? -38.676 28.104  -12.729 1.00 118.92 ? 12  TYR A N   1 
ATOM   95   C CA  . TYR A 1 20  ? -37.572 27.173  -12.563 1.00 113.71 ? 12  TYR A CA  1 
ATOM   96   C C   . TYR A 1 20  ? -38.015 25.834  -13.144 1.00 107.78 ? 12  TYR A C   1 
ATOM   97   O O   . TYR A 1 20  ? -37.189 25.030  -13.564 1.00 113.11 ? 12  TYR A O   1 
ATOM   98   C CB  . TYR A 1 20  ? -37.185 27.031  -11.088 1.00 107.71 ? 12  TYR A CB  1 
ATOM   99   C CG  . TYR A 1 20  ? -35.862 26.342  -10.835 1.00 110.92 ? 12  TYR A CG  1 
ATOM   100  C CD1 . TYR A 1 20  ? -34.663 27.025  -10.992 1.00 116.33 ? 12  TYR A CD1 1 
ATOM   101  C CD2 . TYR A 1 20  ? -35.812 25.015  -10.431 1.00 105.44 ? 12  TYR A CD2 1 
ATOM   102  C CE1 . TYR A 1 20  ? -33.449 26.405  -10.757 1.00 117.73 ? 12  TYR A CE1 1 
ATOM   103  C CE2 . TYR A 1 20  ? -34.602 24.384  -10.194 1.00 102.29 ? 12  TYR A CE2 1 
ATOM   104  C CZ  . TYR A 1 20  ? -33.424 25.084  -10.359 1.00 107.09 ? 12  TYR A CZ  1 
ATOM   105  O OH  . TYR A 1 20  ? -32.219 24.456  -10.124 1.00 106.02 ? 12  TYR A OH  1 
ATOM   106  N N   . LYS A 1 21  ? -39.330 25.617  -13.183 1.00 102.12 ? 13  LYS A N   1 
ATOM   107  C CA  . LYS A 1 21  ? -39.881 24.407  -13.768 1.00 103.04 ? 13  LYS A CA  1 
ATOM   108  C C   . LYS A 1 21  ? -40.169 24.533  -15.268 1.00 125.97 ? 13  LYS A C   1 
ATOM   109  O O   . LYS A 1 21  ? -40.735 23.629  -15.878 1.00 139.21 ? 13  LYS A O   1 
ATOM   110  C CB  . LYS A 1 21  ? -41.142 23.972  -13.012 1.00 97.01  ? 13  LYS A CB  1 
ATOM   111  C CG  . LYS A 1 21  ? -40.894 23.554  -11.580 1.00 108.27 ? 13  LYS A CG  1 
ATOM   112  C CD  . LYS A 1 21  ? -42.210 23.402  -10.871 1.00 111.70 ? 13  LYS A CD  1 
ATOM   113  C CE  . LYS A 1 21  ? -42.980 22.212  -11.434 1.00 116.81 ? 13  LYS A CE  1 
ATOM   114  N NZ  . LYS A 1 21  ? -44.255 21.975  -10.693 1.00 114.92 ? 13  LYS A NZ  1 
ATOM   115  N N   . GLU A 1 22  ? -39.737 25.635  -15.867 1.00 116.33 ? 14  GLU A N   1 
ATOM   116  C CA  . GLU A 1 22  ? -39.738 25.772  -17.319 1.00 116.41 ? 14  GLU A CA  1 
ATOM   117  C C   . GLU A 1 22  ? -38.311 25.841  -17.894 1.00 132.33 ? 14  GLU A C   1 
ATOM   118  O O   . GLU A 1 22  ? -38.065 25.456  -19.041 1.00 139.45 ? 14  GLU A O   1 
ATOM   119  C CB  . GLU A 1 22  ? -40.525 27.025  -17.737 1.00 108.13 ? 14  GLU A CB  1 
ATOM   120  N N   . ASP A 1 23  ? -37.367 26.308  -17.081 1.00 128.38 ? 15  ASP A N   1 
ATOM   121  C CA  . ASP A 1 23  ? -36.014 26.604  -17.554 1.00 131.01 ? 15  ASP A CA  1 
ATOM   122  C C   . ASP A 1 23  ? -35.023 25.407  -17.614 1.00 140.32 ? 15  ASP A C   1 
ATOM   123  O O   . ASP A 1 23  ? -34.035 25.488  -18.352 1.00 154.42 ? 15  ASP A O   1 
ATOM   124  C CB  . ASP A 1 23  ? -35.385 27.705  -16.673 1.00 129.55 ? 15  ASP A CB  1 
ATOM   125  C CG  . ASP A 1 23  ? -36.167 29.013  -16.694 1.00 130.29 ? 15  ASP A CG  1 
ATOM   126  O OD1 . ASP A 1 23  ? -37.264 29.047  -17.289 1.00 140.00 ? 15  ASP A OD1 1 
ATOM   127  O OD2 . ASP A 1 23  ? -35.687 30.007  -16.104 1.00 122.64 ? 15  ASP A OD2 1 
ATOM   128  N N   . HIS A 1 24  ? -35.301 24.319  -16.881 1.00 118.57 ? 16  HIS A N   1 
ATOM   129  C CA  . HIS A 1 24  ? -34.296 23.319  -16.458 1.00 128.93 ? 16  HIS A CA  1 
ATOM   130  C C   . HIS A 1 24  ? -34.761 21.857  -16.366 1.00 121.89 ? 16  HIS A C   1 
ATOM   131  O O   . HIS A 1 24  ? -35.062 21.464  -15.278 1.00 109.41 ? 16  HIS A O   1 
ATOM   132  C CB  . HIS A 1 24  ? -33.825 23.637  -15.034 1.00 135.58 ? 16  HIS A CB  1 
ATOM   133  C CG  . HIS A 1 24  ? -32.827 24.742  -14.907 1.00 133.97 ? 16  HIS A CG  1 
ATOM   134  N ND1 . HIS A 1 24  ? -32.817 25.573  -13.808 1.00 123.47 ? 16  HIS A ND1 1 
ATOM   135  C CD2 . HIS A 1 24  ? -31.764 25.103  -15.662 1.00 143.50 ? 16  HIS A CD2 1 
ATOM   136  C CE1 . HIS A 1 24  ? -31.817 26.427  -13.912 1.00 134.44 ? 16  HIS A CE1 1 
ATOM   137  N NE2 . HIS A 1 24  ? -31.161 26.165  -15.027 1.00 145.56 ? 16  HIS A NE2 1 
ATOM   138  N N   . PRO A 1 25  ? -34.744 21.037  -17.439 1.00 138.89 ? 17  PRO A N   1 
ATOM   139  C CA  . PRO A 1 25  ? -35.487 19.757  -17.506 1.00 144.60 ? 17  PRO A CA  1 
ATOM   140  C C   . PRO A 1 25  ? -35.540 18.929  -16.213 1.00 147.13 ? 17  PRO A C   1 
ATOM   141  O O   . PRO A 1 25  ? -34.565 18.955  -15.464 1.00 148.95 ? 17  PRO A O   1 
ATOM   142  C CB  . PRO A 1 25  ? -34.723 18.977  -18.581 1.00 137.78 ? 17  PRO A CB  1 
ATOM   143  C CG  . PRO A 1 25  ? -33.382 19.624  -18.633 1.00 131.52 ? 17  PRO A CG  1 
ATOM   144  C CD  . PRO A 1 25  ? -33.701 21.075  -18.466 1.00 131.14 ? 17  PRO A CD  1 
ATOM   145  N N   . PHE A 1 26  ? -36.625 18.179  -15.991 1.00 140.66 ? 18  PHE A N   1 
ATOM   146  C CA  . PHE A 1 26  ? -36.798 17.404  -14.755 1.00 126.01 ? 18  PHE A CA  1 
ATOM   147  C C   . PHE A 1 26  ? -35.569 16.573  -14.428 1.00 131.19 ? 18  PHE A C   1 
ATOM   148  O O   . PHE A 1 26  ? -35.211 16.442  -13.266 1.00 127.51 ? 18  PHE A O   1 
ATOM   149  C CB  . PHE A 1 26  ? -38.025 16.483  -14.832 1.00 115.64 ? 18  PHE A CB  1 
ATOM   150  C CG  . PHE A 1 26  ? -38.192 15.580  -13.628 1.00 110.39 ? 18  PHE A CG  1 
ATOM   151  C CD1 . PHE A 1 26  ? -38.722 16.067  -12.442 1.00 95.77  ? 18  PHE A CD1 1 
ATOM   152  C CD2 . PHE A 1 26  ? -37.827 14.243  -13.688 1.00 118.13 ? 18  PHE A CD2 1 
ATOM   153  C CE1 . PHE A 1 26  ? -38.881 15.237  -11.335 1.00 103.19 ? 18  PHE A CE1 1 
ATOM   154  C CE2 . PHE A 1 26  ? -37.983 13.407  -12.588 1.00 108.53 ? 18  PHE A CE2 1 
ATOM   155  C CZ  . PHE A 1 26  ? -38.511 13.905  -11.410 1.00 108.03 ? 18  PHE A CZ  1 
ATOM   156  N N   . GLU A 1 27  ? -34.914 16.032  -15.453 1.00 142.20 ? 19  GLU A N   1 
ATOM   157  C CA  . GLU A 1 27  ? -33.702 15.237  -15.250 1.00 140.92 ? 19  GLU A CA  1 
ATOM   158  C C   . GLU A 1 27  ? -32.562 16.094  -14.701 1.00 153.78 ? 19  GLU A C   1 
ATOM   159  O O   . GLU A 1 27  ? -31.662 15.593  -14.020 1.00 159.39 ? 19  GLU A O   1 
ATOM   160  C CB  . GLU A 1 27  ? -33.268 14.561  -16.555 1.00 128.86 ? 19  GLU A CB  1 
ATOM   161  N N   . TYR A 1 28  ? -32.612 17.390  -14.997 1.00 147.92 ? 20  TYR A N   1 
ATOM   162  C CA  . TYR A 1 28  ? -31.606 18.331  -14.515 1.00 126.69 ? 20  TYR A CA  1 
ATOM   163  C C   . TYR A 1 28  ? -32.001 18.928  -13.161 1.00 121.05 ? 20  TYR A C   1 
ATOM   164  O O   . TYR A 1 28  ? -31.163 19.034  -12.269 1.00 127.30 ? 20  TYR A O   1 
ATOM   165  C CB  . TYR A 1 28  ? -31.379 19.443  -15.543 1.00 122.91 ? 20  TYR A CB  1 
ATOM   166  N N   . ARG A 1 29  ? -33.270 19.312  -13.003 1.00 129.69 ? 21  ARG A N   1 
ATOM   167  C CA  . ARG A 1 29  ? -33.771 19.752  -11.692 1.00 119.29 ? 21  ARG A CA  1 
ATOM   168  C C   . ARG A 1 29  ? -33.524 18.706  -10.634 1.00 121.28 ? 21  ARG A C   1 
ATOM   169  O O   . ARG A 1 29  ? -33.068 19.007  -9.530  1.00 123.08 ? 21  ARG A O   1 
ATOM   170  C CB  . ARG A 1 29  ? -35.270 20.064  -11.726 1.00 101.92 ? 21  ARG A CB  1 
ATOM   171  C CG  . ARG A 1 29  ? -35.571 21.248  -12.568 1.00 99.63  ? 21  ARG A CG  1 
ATOM   172  C CD  . ARG A 1 29  ? -37.019 21.694  -12.632 1.00 103.48 ? 21  ARG A CD  1 
ATOM   173  N NE  . ARG A 1 29  ? -37.148 22.638  -13.734 1.00 149.34 ? 21  ARG A NE  1 
ATOM   174  C CZ  . ARG A 1 29  ? -37.660 22.329  -14.921 1.00 163.23 ? 21  ARG A CZ  1 
ATOM   175  N NH1 . ARG A 1 29  ? -38.167 21.124  -15.132 1.00 175.61 ? 21  ARG A NH1 1 
ATOM   176  N NH2 . ARG A 1 29  ? -37.696 23.241  -15.881 1.00 144.14 ? 21  ARG A NH2 1 
ATOM   177  N N   . LYS A 1 30  ? -33.869 17.472  -10.974 1.00 121.15 ? 22  LYS A N   1 
ATOM   178  C CA  . LYS A 1 30  ? -33.726 16.362  -10.048 1.00 111.09 ? 22  LYS A CA  1 
ATOM   179  C C   . LYS A 1 30  ? -32.298 16.286  -9.534  1.00 116.77 ? 22  LYS A C   1 
ATOM   180  O O   . LYS A 1 30  ? -32.066 16.363  -8.337  1.00 118.57 ? 22  LYS A O   1 
ATOM   181  C CB  . LYS A 1 30  ? -34.103 15.041  -10.720 1.00 104.46 ? 22  LYS A CB  1 
ATOM   182  N N   . LYS A 1 31  ? -31.356 16.173  -10.469 1.00 155.91 ? 23  LYS A N   1 
ATOM   183  C CA  . LYS A 1 31  ? -29.941 15.923  -10.187 1.00 163.17 ? 23  LYS A CA  1 
ATOM   184  C C   . LYS A 1 31  ? -29.363 16.767  -9.046  1.00 158.77 ? 23  LYS A C   1 
ATOM   185  O O   . LYS A 1 31  ? -28.819 16.227  -8.079  1.00 169.79 ? 23  LYS A O   1 
ATOM   186  C CB  . LYS A 1 31  ? -29.120 16.139  -11.465 1.00 165.32 ? 23  LYS A CB  1 
ATOM   187  N N   . GLU A 1 32  ? -29.500 18.085  -9.154  1.00 154.60 ? 24  GLU A N   1 
ATOM   188  C CA  . GLU A 1 32  ? -28.995 19.001  -8.126  1.00 165.10 ? 24  GLU A CA  1 
ATOM   189  C C   . GLU A 1 32  ? -29.760 18.866  -6.814  1.00 157.98 ? 24  GLU A C   1 
ATOM   190  O O   . GLU A 1 32  ? -29.251 19.222  -5.753  1.00 160.07 ? 24  GLU A O   1 
ATOM   191  C CB  . GLU A 1 32  ? -29.046 20.454  -8.611  1.00 171.62 ? 24  GLU A CB  1 
ATOM   192  C CG  . GLU A 1 32  ? -28.991 20.617  -10.132 1.00 186.17 ? 24  GLU A CG  1 
ATOM   193  C CD  . GLU A 1 32  ? -28.961 22.074  -10.585 1.00 185.84 ? 24  GLU A CD  1 
ATOM   194  O OE1 . GLU A 1 32  ? -28.777 22.972  -9.733  1.00 172.82 ? 24  GLU A OE1 1 
ATOM   195  O OE2 . GLU A 1 32  ? -29.105 22.314  -11.805 1.00 191.84 ? 24  GLU A OE2 1 
ATOM   196  N N   . GLY A 1 33  ? -30.979 18.341  -6.900  1.00 146.66 ? 25  GLY A N   1 
ATOM   197  C CA  . GLY A 1 33  ? -31.798 18.077  -5.732  1.00 128.91 ? 25  GLY A CA  1 
ATOM   198  C C   . GLY A 1 33  ? -31.219 17.041  -4.783  1.00 133.04 ? 25  GLY A C   1 
ATOM   199  O O   . GLY A 1 33  ? -31.016 17.328  -3.603  1.00 126.64 ? 25  GLY A O   1 
ATOM   200  N N   . GLU A 1 34  ? -30.947 15.835  -5.279  1.00 141.64 ? 26  GLU A N   1 
ATOM   201  C CA  . GLU A 1 34  ? -30.374 14.799  -4.418  1.00 151.97 ? 26  GLU A CA  1 
ATOM   202  C C   . GLU A 1 34  ? -28.926 15.098  -4.039  1.00 152.50 ? 26  GLU A C   1 
ATOM   203  O O   . GLU A 1 34  ? -28.396 14.530  -3.082  1.00 158.75 ? 26  GLU A O   1 
ATOM   204  C CB  . GLU A 1 34  ? -30.438 13.417  -5.074  1.00 170.62 ? 26  GLU A CB  1 
ATOM   205  C CG  . GLU A 1 34  ? -30.119 13.381  -6.555  1.00 183.18 ? 26  GLU A CG  1 
ATOM   206  C CD  . GLU A 1 34  ? -31.330 13.599  -7.422  1.00 187.67 ? 26  GLU A CD  1 
ATOM   207  O OE1 . GLU A 1 34  ? -32.402 13.959  -6.888  1.00 174.33 ? 26  GLU A OE1 1 
ATOM   208  O OE2 . GLU A 1 34  ? -31.213 13.384  -8.644  1.00 203.76 ? 26  GLU A OE2 1 
ATOM   209  N N   . LYS A 1 35  ? -28.283 15.975  -4.801  1.00 147.66 ? 27  LYS A N   1 
ATOM   210  C CA  . LYS A 1 35  ? -26.902 16.341  -4.524  1.00 150.90 ? 27  LYS A CA  1 
ATOM   211  C C   . LYS A 1 35  ? -26.820 17.209  -3.273  1.00 147.08 ? 27  LYS A C   1 
ATOM   212  O O   . LYS A 1 35  ? -25.888 17.081  -2.479  1.00 145.56 ? 27  LYS A O   1 
ATOM   213  C CB  . LYS A 1 35  ? -26.288 17.070  -5.721  1.00 143.72 ? 27  LYS A CB  1 
ATOM   214  N N   . ILE A 1 36  ? -27.809 18.081  -3.099  1.00 137.57 ? 28  ILE A N   1 
ATOM   215  C CA  . ILE A 1 36  ? -27.839 18.998  -1.962  1.00 133.85 ? 28  ILE A CA  1 
ATOM   216  C C   . ILE A 1 36  ? -28.139 18.280  -0.650  1.00 147.95 ? 28  ILE A C   1 
ATOM   217  O O   . ILE A 1 36  ? -27.439 18.471  0.346   1.00 167.06 ? 28  ILE A O   1 
ATOM   218  C CB  . ILE A 1 36  ? -28.888 20.113  -2.161  1.00 120.26 ? 28  ILE A CB  1 
ATOM   219  C CG1 . ILE A 1 36  ? -28.517 21.001  -3.350  1.00 123.51 ? 28  ILE A CG1 1 
ATOM   220  C CG2 . ILE A 1 36  ? -29.022 20.949  -0.901  1.00 114.73 ? 28  ILE A CG2 1 
ATOM   221  C CD1 . ILE A 1 36  ? -27.143 21.620  -3.252  1.00 135.15 ? 28  ILE A CD1 1 
ATOM   222  N N   . ARG A 1 37  ? -29.178 17.449  -0.660  1.00 144.07 ? 29  ARG A N   1 
ATOM   223  C CA  . ARG A 1 37  ? -29.642 16.767  0.546   1.00 147.10 ? 29  ARG A CA  1 
ATOM   224  C C   . ARG A 1 37  ? -28.583 15.840  1.143   1.00 160.05 ? 29  ARG A C   1 
ATOM   225  O O   . ARG A 1 37  ? -28.653 15.485  2.320   1.00 164.73 ? 29  ARG A O   1 
ATOM   226  C CB  . ARG A 1 37  ? -30.914 15.974  0.243   1.00 145.39 ? 29  ARG A CB  1 
ATOM   227  C CG  . ARG A 1 37  ? -32.015 16.802  -0.397  1.00 133.63 ? 29  ARG A CG  1 
ATOM   228  C CD  . ARG A 1 37  ? -33.222 16.921  0.517   1.00 124.04 ? 29  ARG A CD  1 
ATOM   229  N NE  . ARG A 1 37  ? -32.922 17.653  1.744   1.00 125.52 ? 29  ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 37  ? -33.342 17.288  2.951   1.00 135.59 ? 29  ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 37  ? -34.083 16.198  3.096   1.00 139.14 ? 29  ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 37  ? -33.023 18.014  4.014   1.00 138.91 ? 29  ARG A NH2 1 
ATOM   233  N N   . LYS A 1 38  ? -27.609 15.450  0.327   1.00 163.09 ? 30  LYS A N   1 
ATOM   234  C CA  . LYS A 1 38  ? -26.495 14.640  0.802   1.00 172.21 ? 30  LYS A CA  1 
ATOM   235  C C   . LYS A 1 38  ? -25.364 15.532  1.305   1.00 173.40 ? 30  LYS A C   1 
ATOM   236  O O   . LYS A 1 38  ? -24.623 15.160  2.215   1.00 185.65 ? 30  LYS A O   1 
ATOM   237  C CB  . LYS A 1 38  ? -25.989 13.714  -0.306  1.00 176.59 ? 30  LYS A CB  1 
ATOM   238  N N   . LYS A 1 39  ? -25.240 16.711  0.705   1.00 155.75 ? 31  LYS A N   1 
ATOM   239  C CA  . LYS A 1 39  ? -24.226 17.677  1.112   1.00 145.93 ? 31  LYS A CA  1 
ATOM   240  C C   . LYS A 1 39  ? -24.690 18.464  2.334   1.00 144.61 ? 31  LYS A C   1 
ATOM   241  O O   . LYS A 1 39  ? -23.884 18.834  3.188   1.00 159.08 ? 31  LYS A O   1 
ATOM   242  C CB  . LYS A 1 39  ? -23.898 18.632  -0.038  1.00 130.47 ? 31  LYS A CB  1 
ATOM   243  N N   . TYR A 1 40  ? -25.993 18.717  2.407   1.00 134.05 ? 32  TYR A N   1 
ATOM   244  C CA  . TYR A 1 40  ? -26.577 19.426  3.540   1.00 130.18 ? 32  TYR A CA  1 
ATOM   245  C C   . TYR A 1 40  ? -27.857 18.738  4.008   1.00 137.79 ? 32  TYR A C   1 
ATOM   246  O O   . TYR A 1 40  ? -28.942 19.033  3.507   1.00 135.83 ? 32  TYR A O   1 
ATOM   247  C CB  . TYR A 1 40  ? -26.871 20.883  3.177   1.00 115.19 ? 32  TYR A CB  1 
ATOM   248  C CG  . TYR A 1 40  ? -25.726 21.600  2.496   1.00 124.97 ? 32  TYR A CG  1 
ATOM   249  C CD1 . TYR A 1 40  ? -24.581 21.951  3.200   1.00 129.94 ? 32  TYR A CD1 1 
ATOM   250  C CD2 . TYR A 1 40  ? -25.797 21.936  1.150   1.00 121.92 ? 32  TYR A CD2 1 
ATOM   251  C CE1 . TYR A 1 40  ? -23.534 22.609  2.579   1.00 133.90 ? 32  TYR A CE1 1 
ATOM   252  C CE2 . TYR A 1 40  ? -24.756 22.595  0.522   1.00 131.34 ? 32  TYR A CE2 1 
ATOM   253  C CZ  . TYR A 1 40  ? -23.628 22.929  1.241   1.00 141.55 ? 32  TYR A CZ  1 
ATOM   254  O OH  . TYR A 1 40  ? -22.590 23.585  0.620   1.00 144.96 ? 32  TYR A OH  1 
ATOM   255  N N   . PRO A 1 41  ? -27.730 17.812  4.970   1.00 142.89 ? 33  PRO A N   1 
ATOM   256  C CA  . PRO A 1 41  ? -28.876 17.068  5.503   1.00 148.30 ? 33  PRO A CA  1 
ATOM   257  C C   . PRO A 1 41  ? -29.663 17.867  6.538   1.00 153.91 ? 33  PRO A C   1 
ATOM   258  O O   . PRO A 1 41  ? -30.815 17.543  6.829   1.00 148.54 ? 33  PRO A O   1 
ATOM   259  C CB  . PRO A 1 41  ? -28.221 15.847  6.147   1.00 155.67 ? 33  PRO A CB  1 
ATOM   260  C CG  . PRO A 1 41  ? -26.895 16.353  6.601   1.00 155.74 ? 33  PRO A CG  1 
ATOM   261  C CD  . PRO A 1 41  ? -26.459 17.368  5.571   1.00 148.96 ? 33  PRO A CD  1 
ATOM   262  N N   . ASP A 1 42  ? -29.038 18.904  7.084   1.00 159.90 ? 34  ASP A N   1 
ATOM   263  C CA  . ASP A 1 42  ? -29.659 19.714  8.122   1.00 149.56 ? 34  ASP A CA  1 
ATOM   264  C C   . ASP A 1 42  ? -30.464 20.868  7.537   1.00 128.76 ? 34  ASP A C   1 
ATOM   265  O O   . ASP A 1 42  ? -31.100 21.622  8.272   1.00 128.18 ? 34  ASP A O   1 
ATOM   266  C CB  . ASP A 1 42  ? -28.594 20.254  9.079   1.00 153.72 ? 34  ASP A CB  1 
ATOM   267  C CG  . ASP A 1 42  ? -27.462 20.958  8.354   1.00 156.70 ? 34  ASP A CG  1 
ATOM   268  O OD1 . ASP A 1 42  ? -27.373 20.825  7.115   1.00 149.08 ? 34  ASP A OD1 1 
ATOM   269  O OD2 . ASP A 1 42  ? -26.660 21.644  9.022   1.00 167.96 ? 34  ASP A OD2 1 
ATOM   270  N N   . ARG A 1 43  ? -30.427 21.012  6.214   1.00 113.76 ? 35  ARG A N   1 
ATOM   271  C CA  . ARG A 1 43  ? -31.076 22.146  5.560   1.00 104.39 ? 35  ARG A CA  1 
ATOM   272  C C   . ARG A 1 43  ? -31.925 21.724  4.362   1.00 111.71 ? 35  ARG A C   1 
ATOM   273  O O   . ARG A 1 43  ? -31.865 20.579  3.914   1.00 116.42 ? 35  ARG A O   1 
ATOM   274  C CB  . ARG A 1 43  ? -30.026 23.175  5.134   1.00 90.12  ? 35  ARG A CB  1 
ATOM   275  C CG  . ARG A 1 43  ? -29.075 23.529  6.261   1.00 106.67 ? 35  ARG A CG  1 
ATOM   276  C CD  . ARG A 1 43  ? -28.310 24.808  6.031   1.00 116.49 ? 35  ARG A CD  1 
ATOM   277  N NE  . ARG A 1 43  ? -27.420 25.069  7.158   1.00 136.40 ? 35  ARG A NE  1 
ATOM   278  C CZ  . ARG A 1 43  ? -26.755 26.203  7.342   1.00 151.81 ? 35  ARG A CZ  1 
ATOM   279  N NH1 . ARG A 1 43  ? -26.879 27.193  6.471   1.00 156.67 ? 35  ARG A NH1 1 
ATOM   280  N NH2 . ARG A 1 43  ? -25.969 26.346  8.400   1.00 157.27 ? 35  ARG A NH2 1 
ATOM   281  N N   . VAL A 1 44  ? -32.712 22.665  3.848   1.00 116.23 ? 36  VAL A N   1 
ATOM   282  C CA  . VAL A 1 44  ? -33.705 22.371  2.820   1.00 116.09 ? 36  VAL A CA  1 
ATOM   283  C C   . VAL A 1 44  ? -33.606 23.313  1.619   1.00 101.47 ? 36  VAL A C   1 
ATOM   284  O O   . VAL A 1 44  ? -33.577 24.532  1.783   1.00 98.26  ? 36  VAL A O   1 
ATOM   285  C CB  . VAL A 1 44  ? -35.135 22.452  3.404   1.00 107.71 ? 36  VAL A CB  1 
ATOM   286  C CG1 . VAL A 1 44  ? -36.170 22.528  2.297   1.00 116.41 ? 36  VAL A CG1 1 
ATOM   287  C CG2 . VAL A 1 44  ? -35.405 21.268  4.322   1.00 104.02 ? 36  VAL A CG2 1 
ATOM   288  N N   . PRO A 1 45  ? -33.549 22.743  0.404   1.00 88.05  ? 37  PRO A N   1 
ATOM   289  C CA  . PRO A 1 45  ? -33.553 23.527  -0.836  1.00 88.70  ? 37  PRO A CA  1 
ATOM   290  C C   . PRO A 1 45  ? -34.949 24.041  -1.186  1.00 87.36  ? 37  PRO A C   1 
ATOM   291  O O   . PRO A 1 45  ? -35.877 23.249  -1.355  1.00 100.62 ? 37  PRO A O   1 
ATOM   292  C CB  . PRO A 1 45  ? -33.056 22.526  -1.881  1.00 94.00  ? 37  PRO A CB  1 
ATOM   293  C CG  . PRO A 1 45  ? -33.485 21.201  -1.354  1.00 96.06  ? 37  PRO A CG  1 
ATOM   294  C CD  . PRO A 1 45  ? -33.400 21.299  0.146   1.00 96.22  ? 37  PRO A CD  1 
ATOM   295  N N   . VAL A 1 46  ? -35.092 25.358  -1.292  1.00 75.94  ? 38  VAL A N   1 
ATOM   296  C CA  . VAL A 1 46  ? -36.394 25.967  -1.544  1.00 73.87  ? 38  VAL A CA  1 
ATOM   297  C C   . VAL A 1 46  ? -36.355 26.917  -2.736  1.00 80.71  ? 38  VAL A C   1 
ATOM   298  O O   . VAL A 1 46  ? -35.476 27.774  -2.830  1.00 83.51  ? 38  VAL A O   1 
ATOM   299  C CB  . VAL A 1 46  ? -36.901 26.739  -0.304  1.00 81.16  ? 38  VAL A CB  1 
ATOM   300  C CG1 . VAL A 1 46  ? -38.201 27.468  -0.616  1.00 68.42  ? 38  VAL A CG1 1 
ATOM   301  C CG2 . VAL A 1 46  ? -37.087 25.795  0.871   1.00 99.09  ? 38  VAL A CG2 1 
ATOM   302  N N   . ILE A 1 47  ? -37.310 26.755  -3.646  1.00 74.78  ? 39  ILE A N   1 
ATOM   303  C CA  . ILE A 1 47  ? -37.457 27.665  -4.775  1.00 78.98  ? 39  ILE A CA  1 
ATOM   304  C C   . ILE A 1 47  ? -38.573 28.667  -4.496  1.00 72.84  ? 39  ILE A C   1 
ATOM   305  O O   . ILE A 1 47  ? -39.717 28.280  -4.257  1.00 74.24  ? 39  ILE A O   1 
ATOM   306  C CB  . ILE A 1 47  ? -37.765 26.909  -6.081  1.00 86.86  ? 39  ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 47  ? -36.785 25.748  -6.274  1.00 86.62  ? 39  ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 47  ? -37.734 27.861  -7.269  1.00 81.77  ? 39  ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 47  ? -35.337 26.175  -6.370  1.00 87.30  ? 39  ILE A CD1 1 
ATOM   310  N N   . VAL A 1 48  ? -38.237 29.953  -4.521  1.00 68.14  ? 40  VAL A N   1 
ATOM   311  C CA  . VAL A 1 48  ? -39.210 31.001  -4.232  1.00 69.52  ? 40  VAL A CA  1 
ATOM   312  C C   . VAL A 1 48  ? -39.432 31.903  -5.443  1.00 85.04  ? 40  VAL A C   1 
ATOM   313  O O   . VAL A 1 48  ? -38.500 32.546  -5.926  1.00 99.61  ? 40  VAL A O   1 
ATOM   314  C CB  . VAL A 1 48  ? -38.770 31.865  -3.033  1.00 73.17  ? 40  VAL A CB  1 
ATOM   315  C CG1 . VAL A 1 48  ? -39.857 32.866  -2.673  1.00 69.34  ? 40  VAL A CG1 1 
ATOM   316  C CG2 . VAL A 1 48  ? -38.438 30.985  -1.837  1.00 63.60  ? 40  VAL A CG2 1 
ATOM   317  N N   . GLU A 1 49  ? -40.669 31.949  -5.928  1.00 92.17  ? 41  GLU A N   1 
ATOM   318  C CA  . GLU A 1 49  ? -41.001 32.753  -7.100  1.00 97.17  ? 41  GLU A CA  1 
ATOM   319  C C   . GLU A 1 49  ? -42.276 33.564  -6.906  1.00 90.59  ? 41  GLU A C   1 
ATOM   320  O O   . GLU A 1 49  ? -43.131 33.214  -6.094  1.00 87.49  ? 41  GLU A O   1 
ATOM   321  C CB  . GLU A 1 49  ? -41.152 31.865  -8.336  1.00 101.71 ? 41  GLU A CB  1 
ATOM   322  C CG  . GLU A 1 49  ? -39.858 31.262  -8.845  1.00 106.01 ? 41  GLU A CG  1 
ATOM   323  C CD  . GLU A 1 49  ? -40.039 30.569  -10.180 1.00 107.65 ? 41  GLU A CD  1 
ATOM   324  O OE1 . GLU A 1 49  ? -41.044 30.858  -10.864 1.00 96.98  ? 41  GLU A OE1 1 
ATOM   325  O OE2 . GLU A 1 49  ? -39.180 29.738  -10.544 1.00 112.18 ? 41  GLU A OE2 1 
ATOM   326  N N   . LYS A 1 50  ? -42.396 34.647  -7.665  1.00 94.14  ? 42  LYS A N   1 
ATOM   327  C CA  . LYS A 1 50  ? -43.596 35.473  -7.647  1.00 93.71  ? 42  LYS A CA  1 
ATOM   328  C C   . LYS A 1 50  ? -44.716 34.823  -8.453  1.00 100.65 ? 42  LYS A C   1 
ATOM   329  O O   . LYS A 1 50  ? -44.479 34.285  -9.535  1.00 93.95  ? 42  LYS A O   1 
ATOM   330  C CB  . LYS A 1 50  ? -43.293 36.868  -8.201  1.00 100.03 ? 42  LYS A CB  1 
ATOM   331  C CG  . LYS A 1 50  ? -44.508 37.774  -8.318  1.00 97.33  ? 42  LYS A CG  1 
ATOM   332  C CD  . LYS A 1 50  ? -44.197 39.013  -9.140  1.00 98.06  ? 42  LYS A CD  1 
ATOM   333  N N   . ALA A 1 51  ? -45.932 34.869  -7.916  1.00 107.07 ? 43  ALA A N   1 
ATOM   334  C CA  . ALA A 1 51  ? -47.109 34.400  -8.638  1.00 106.79 ? 43  ALA A CA  1 
ATOM   335  C C   . ALA A 1 51  ? -47.302 35.235  -9.903  1.00 105.73 ? 43  ALA A C   1 
ATOM   336  O O   . ALA A 1 51  ? -46.948 36.414  -9.922  1.00 105.51 ? 43  ALA A O   1 
ATOM   337  C CB  . ALA A 1 51  ? -48.344 34.471  -7.745  1.00 109.17 ? 43  ALA A CB  1 
ATOM   338  N N   . PRO A 1 52  ? -47.852 34.622  -10.966 1.00 109.50 ? 44  PRO A N   1 
ATOM   339  C CA  . PRO A 1 52  ? -48.015 35.274  -12.272 1.00 120.31 ? 44  PRO A CA  1 
ATOM   340  C C   . PRO A 1 52  ? -48.637 36.674  -12.222 1.00 132.16 ? 44  PRO A C   1 
ATOM   341  O O   . PRO A 1 52  ? -47.981 37.641  -12.611 1.00 132.07 ? 44  PRO A O   1 
ATOM   342  C CB  . PRO A 1 52  ? -48.936 34.308  -13.020 1.00 118.52 ? 44  PRO A CB  1 
ATOM   343  C CG  . PRO A 1 52  ? -48.592 32.978  -12.458 1.00 99.67  ? 44  PRO A CG  1 
ATOM   344  C CD  . PRO A 1 52  ? -48.296 33.216  -11.000 1.00 100.09 ? 44  PRO A CD  1 
ATOM   345  N N   . LYS A 1 53  ? -49.872 36.780  -11.744 1.00 131.82 ? 45  LYS A N   1 
ATOM   346  C CA  . LYS A 1 53  ? -50.607 38.042  -11.800 1.00 120.60 ? 45  LYS A CA  1 
ATOM   347  C C   . LYS A 1 53  ? -50.341 38.948  -10.601 1.00 113.50 ? 45  LYS A C   1 
ATOM   348  O O   . LYS A 1 53  ? -50.886 40.048  -10.513 1.00 125.92 ? 45  LYS A O   1 
ATOM   349  C CB  . LYS A 1 53  ? -52.108 37.769  -11.909 1.00 116.60 ? 45  LYS A CB  1 
ATOM   350  N N   . ALA A 1 54  ? -49.495 38.489  -9.686  1.00 110.72 ? 46  ALA A N   1 
ATOM   351  C CA  . ALA A 1 54  ? -49.236 39.210  -8.439  1.00 98.75  ? 46  ALA A CA  1 
ATOM   352  C C   . ALA A 1 54  ? -48.556 40.562  -8.655  1.00 98.13  ? 46  ALA A C   1 
ATOM   353  O O   . ALA A 1 54  ? -47.656 40.689  -9.483  1.00 110.47 ? 46  ALA A O   1 
ATOM   354  C CB  . ALA A 1 54  ? -48.395 38.349  -7.512  1.00 74.28  ? 46  ALA A CB  1 
ATOM   355  N N   . ARG A 1 55  ? -48.993 41.566  -7.897  1.00 88.72  ? 47  ARG A N   1 
ATOM   356  C CA  . ARG A 1 55  ? -48.432 42.914  -7.980  1.00 95.70  ? 47  ARG A CA  1 
ATOM   357  C C   . ARG A 1 55  ? -47.404 43.170  -6.882  1.00 100.42 ? 47  ARG A C   1 
ATOM   358  O O   . ARG A 1 55  ? -47.600 44.040  -6.031  1.00 103.99 ? 47  ARG A O   1 
ATOM   359  C CB  . ARG A 1 55  ? -49.534 43.969  -7.881  1.00 96.86  ? 47  ARG A CB  1 
ATOM   360  C CG  . ARG A 1 55  ? -50.721 43.746  -8.784  1.00 105.27 ? 47  ARG A CG  1 
ATOM   361  C CD  . ARG A 1 55  ? -51.646 44.943  -8.730  1.00 102.11 ? 47  ARG A CD  1 
ATOM   362  N NE  . ARG A 1 55  ? -53.042 44.537  -8.808  1.00 101.07 ? 47  ARG A NE  1 
ATOM   363  C CZ  . ARG A 1 55  ? -53.875 44.935  -9.760  1.00 107.89 ? 47  ARG A CZ  1 
ATOM   364  N NH1 . ARG A 1 55  ? -53.452 45.750  -10.716 1.00 118.49 ? 47  ARG A NH1 1 
ATOM   365  N NH2 . ARG A 1 55  ? -55.129 44.515  -9.758  1.00 109.04 ? 47  ARG A NH2 1 
ATOM   366  N N   . VAL A 1 56  ? -46.314 42.412  -6.906  1.00 105.39 ? 48  VAL A N   1 
ATOM   367  C CA  . VAL A 1 56  ? -45.244 42.549  -5.925  1.00 114.02 ? 48  VAL A CA  1 
ATOM   368  C C   . VAL A 1 56  ? -43.880 42.484  -6.612  1.00 112.13 ? 48  VAL A C   1 
ATOM   369  O O   . VAL A 1 56  ? -43.725 41.784  -7.613  1.00 87.66  ? 48  VAL A O   1 
ATOM   370  C CB  . VAL A 1 56  ? -45.338 41.456  -4.833  1.00 109.60 ? 48  VAL A CB  1 
ATOM   371  C CG1 . VAL A 1 56  ? -46.629 41.601  -4.046  1.00 112.99 ? 48  VAL A CG1 1 
ATOM   372  C CG2 . VAL A 1 56  ? -45.274 40.079  -5.461  1.00 102.25 ? 48  VAL A CG2 1 
ATOM   373  N N   . PRO A 1 57  ? -42.891 43.230  -6.085  1.00 118.81 ? 49  PRO A N   1 
ATOM   374  C CA  . PRO A 1 57  ? -41.527 43.249  -6.626  1.00 113.18 ? 49  PRO A CA  1 
ATOM   375  C C   . PRO A 1 57  ? -40.938 41.852  -6.789  1.00 116.26 ? 49  PRO A C   1 
ATOM   376  O O   . PRO A 1 57  ? -41.136 40.996  -5.927  1.00 118.20 ? 49  PRO A O   1 
ATOM   377  C CB  . PRO A 1 57  ? -40.746 44.044  -5.577  1.00 111.94 ? 49  PRO A CB  1 
ATOM   378  C CG  . PRO A 1 57  ? -41.755 44.951  -4.980  1.00 114.59 ? 49  PRO A CG  1 
ATOM   379  C CD  . PRO A 1 57  ? -43.041 44.164  -4.954  1.00 123.42 ? 49  PRO A CD  1 
ATOM   380  N N   . ASP A 1 58  ? -40.222 41.629  -7.886  1.00 123.85 ? 50  ASP A N   1 
ATOM   381  C CA  . ASP A 1 58  ? -39.640 40.323  -8.153  1.00 120.15 ? 50  ASP A CA  1 
ATOM   382  C C   . ASP A 1 58  ? -38.438 40.085  -7.248  1.00 110.34 ? 50  ASP A C   1 
ATOM   383  O O   . ASP A 1 58  ? -37.768 41.028  -6.826  1.00 109.85 ? 50  ASP A O   1 
ATOM   384  C CB  . ASP A 1 58  ? -39.236 40.199  -9.623  1.00 133.07 ? 50  ASP A CB  1 
ATOM   385  C CG  . ASP A 1 58  ? -39.371 38.783  -10.145 1.00 138.79 ? 50  ASP A CG  1 
ATOM   386  O OD1 . ASP A 1 58  ? -39.503 37.854  -9.319  1.00 132.64 ? 50  ASP A OD1 1 
ATOM   387  O OD2 . ASP A 1 58  ? -39.349 38.597  -11.380 1.00 148.31 ? 50  ASP A OD2 1 
ATOM   388  N N   . LEU A 1 59  ? -38.171 38.819  -6.949  1.00 108.44 ? 51  LEU A N   1 
ATOM   389  C CA  . LEU A 1 59  ? -37.101 38.463  -6.029  1.00 112.07 ? 51  LEU A CA  1 
ATOM   390  C C   . LEU A 1 59  ? -35.763 38.362  -6.759  1.00 120.17 ? 51  LEU A C   1 
ATOM   391  O O   . LEU A 1 59  ? -35.662 37.713  -7.800  1.00 115.93 ? 51  LEU A O   1 
ATOM   392  C CB  . LEU A 1 59  ? -37.433 37.149  -5.321  1.00 100.18 ? 51  LEU A CB  1 
ATOM   393  C CG  . LEU A 1 59  ? -36.691 36.828  -4.023  1.00 94.11  ? 51  LEU A CG  1 
ATOM   394  C CD1 . LEU A 1 59  ? -36.647 38.035  -3.099  1.00 93.79  ? 51  LEU A CD1 1 
ATOM   395  C CD2 . LEU A 1 59  ? -37.349 35.646  -3.331  1.00 83.78  ? 51  LEU A CD2 1 
ATOM   396  N N   . ASP A 1 60  ? -34.746 39.019  -6.205  1.00 130.09 ? 52  ASP A N   1 
ATOM   397  C CA  . ASP A 1 60  ? -33.413 39.055  -6.804  1.00 139.05 ? 52  ASP A CA  1 
ATOM   398  C C   . ASP A 1 60  ? -32.837 37.658  -7.026  1.00 128.84 ? 52  ASP A C   1 
ATOM   399  O O   . ASP A 1 60  ? -32.421 37.315  -8.133  1.00 124.93 ? 52  ASP A O   1 
ATOM   400  C CB  . ASP A 1 60  ? -32.466 39.882  -5.928  1.00 151.58 ? 52  ASP A CB  1 
ATOM   401  C CG  . ASP A 1 60  ? -32.633 39.590  -4.446  1.00 147.59 ? 52  ASP A CG  1 
ATOM   402  O OD1 . ASP A 1 60  ? -32.985 38.444  -4.095  1.00 129.89 ? 52  ASP A OD1 1 
ATOM   403  O OD2 . ASP A 1 60  ? -32.414 40.509  -3.629  1.00 151.59 ? 52  ASP A OD2 1 
ATOM   404  N N   . LYS A 1 61  ? -32.815 36.859  -5.964  1.00 125.32 ? 53  LYS A N   1 
ATOM   405  C CA  . LYS A 1 61  ? -32.371 35.473  -6.048  1.00 118.13 ? 53  LYS A CA  1 
ATOM   406  C C   . LYS A 1 61  ? -33.518 34.560  -5.624  1.00 112.32 ? 53  LYS A C   1 
ATOM   407  O O   . LYS A 1 61  ? -34.282 34.904  -4.727  1.00 120.47 ? 53  LYS A O   1 
ATOM   408  C CB  . LYS A 1 61  ? -31.141 35.241  -5.169  1.00 113.99 ? 53  LYS A CB  1 
ATOM   409  C CG  . LYS A 1 61  ? -30.164 36.410  -5.130  1.00 120.88 ? 53  LYS A CG  1 
ATOM   410  C CD  . LYS A 1 61  ? -29.522 36.655  -6.488  1.00 129.19 ? 53  LYS A CD  1 
ATOM   411  N N   . ARG A 1 62  ? -33.640 33.401  -6.263  1.00 103.22 ? 54  ARG A N   1 
ATOM   412  C CA  . ARG A 1 62  ? -34.798 32.542  -6.031  1.00 92.96  ? 54  ARG A CA  1 
ATOM   413  C C   . ARG A 1 62  ? -34.434 31.157  -5.498  1.00 88.42  ? 54  ARG A C   1 
ATOM   414  O O   . ARG A 1 62  ? -35.316 30.365  -5.165  1.00 84.49  ? 54  ARG A O   1 
ATOM   415  C CB  . ARG A 1 62  ? -35.609 32.406  -7.322  1.00 98.58  ? 54  ARG A CB  1 
ATOM   416  C CG  . ARG A 1 62  ? -34.844 31.791  -8.480  1.00 103.25 ? 54  ARG A CG  1 
ATOM   417  C CD  . ARG A 1 62  ? -35.400 32.267  -9.811  1.00 125.20 ? 54  ARG A CD  1 
ATOM   418  N NE  . ARG A 1 62  ? -34.709 31.657  -10.943 1.00 152.26 ? 54  ARG A NE  1 
ATOM   419  C CZ  . ARG A 1 62  ? -35.214 30.677  -11.683 1.00 150.05 ? 54  ARG A CZ  1 
ATOM   420  N NH1 . ARG A 1 62  ? -36.421 30.199  -11.416 1.00 139.51 ? 54  ARG A NH1 1 
ATOM   421  N NH2 . ARG A 1 62  ? -34.516 30.179  -12.695 1.00 152.97 ? 54  ARG A NH2 1 
ATOM   422  N N   . LYS A 1 63  ? -33.140 30.867  -5.415  1.00 98.34  ? 55  LYS A N   1 
ATOM   423  C CA  . LYS A 1 63  ? -32.678 29.588  -4.883  1.00 98.79  ? 55  LYS A CA  1 
ATOM   424  C C   . LYS A 1 63  ? -32.192 29.746  -3.444  1.00 95.76  ? 55  LYS A C   1 
ATOM   425  O O   . LYS A 1 63  ? -31.282 30.529  -3.172  1.00 94.99  ? 55  LYS A O   1 
ATOM   426  C CB  . LYS A 1 63  ? -31.569 29.013  -5.768  1.00 97.63  ? 55  LYS A CB  1 
ATOM   427  C CG  . LYS A 1 63  ? -32.081 28.343  -7.036  1.00 105.95 ? 55  LYS A CG  1 
ATOM   428  C CD  . LYS A 1 63  ? -30.957 28.081  -8.028  1.00 127.33 ? 55  LYS A CD  1 
ATOM   429  C CE  . LYS A 1 63  ? -29.828 27.283  -7.398  1.00 143.41 ? 55  LYS A CE  1 
ATOM   430  N NZ  . LYS A 1 63  ? -28.715 27.051  -8.361  1.00 149.51 ? 55  LYS A NZ  1 
ATOM   431  N N   . TYR A 1 64  ? -32.801 29.000  -2.525  1.00 83.76  ? 56  TYR A N   1 
ATOM   432  C CA  . TYR A 1 64  ? -32.524 29.169  -1.099  1.00 85.41  ? 56  TYR A CA  1 
ATOM   433  C C   . TYR A 1 64  ? -32.230 27.862  -0.364  1.00 84.72  ? 56  TYR A C   1 
ATOM   434  O O   . TYR A 1 64  ? -32.904 26.853  -0.569  1.00 90.85  ? 56  TYR A O   1 
ATOM   435  C CB  . TYR A 1 64  ? -33.702 29.872  -0.418  1.00 84.37  ? 56  TYR A CB  1 
ATOM   436  C CG  . TYR A 1 64  ? -33.895 31.305  -0.854  1.00 94.42  ? 56  TYR A CG  1 
ATOM   437  C CD1 . TYR A 1 64  ? -34.649 31.614  -1.978  1.00 89.78  ? 56  TYR A CD1 1 
ATOM   438  C CD2 . TYR A 1 64  ? -33.320 32.350  -0.143  1.00 101.27 ? 56  TYR A CD2 1 
ATOM   439  C CE1 . TYR A 1 64  ? -34.826 32.924  -2.381  1.00 83.71  ? 56  TYR A CE1 1 
ATOM   440  C CE2 . TYR A 1 64  ? -33.491 33.662  -0.538  1.00 93.74  ? 56  TYR A CE2 1 
ATOM   441  C CZ  . TYR A 1 64  ? -34.244 33.944  -1.658  1.00 83.23  ? 56  TYR A CZ  1 
ATOM   442  O OH  . TYR A 1 64  ? -34.415 35.251  -2.053  1.00 82.75  ? 56  TYR A OH  1 
ATOM   443  N N   . LEU A 1 65  ? -31.217 27.898  0.498   1.00 77.83  ? 57  LEU A N   1 
ATOM   444  C CA  . LEU A 1 65  ? -30.920 26.790  1.400   1.00 86.26  ? 57  LEU A CA  1 
ATOM   445  C C   . LEU A 1 65  ? -31.343 27.161  2.818   1.00 103.42 ? 57  LEU A C   1 
ATOM   446  O O   . LEU A 1 65  ? -30.699 27.980  3.474   1.00 119.13 ? 57  LEU A O   1 
ATOM   447  C CB  . LEU A 1 65  ? -29.433 26.432  1.359   1.00 83.54  ? 57  LEU A CB  1 
ATOM   448  C CG  . LEU A 1 65  ? -28.953 25.703  0.103   1.00 88.84  ? 57  LEU A CG  1 
ATOM   449  C CD1 . LEU A 1 65  ? -27.456 25.441  0.164   1.00 89.55  ? 57  LEU A CD1 1 
ATOM   450  C CD2 . LEU A 1 65  ? -29.721 24.405  -0.077  1.00 108.43 ? 57  LEU A CD2 1 
ATOM   451  N N   . VAL A 1 66  ? -32.428 26.551  3.282   1.00 93.94  ? 58  VAL A N   1 
ATOM   452  C CA  . VAL A 1 66  ? -33.051 26.936  4.544   1.00 79.31  ? 58  VAL A CA  1 
ATOM   453  C C   . VAL A 1 66  ? -32.883 25.860  5.616   1.00 95.55  ? 58  VAL A C   1 
ATOM   454  O O   . VAL A 1 66  ? -33.098 24.679  5.347   1.00 109.53 ? 58  VAL A O   1 
ATOM   455  C CB  . VAL A 1 66  ? -34.555 27.224  4.340   1.00 71.66  ? 58  VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 66  ? -35.214 27.644  5.644   1.00 80.95  ? 58  VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 66  ? -34.746 28.291  3.273   1.00 67.47  ? 58  VAL A CG2 1 
ATOM   458  N N   . PRO A 1 67  ? -32.483 26.270  6.833   1.00 96.19  ? 59  PRO A N   1 
ATOM   459  C CA  . PRO A 1 67  ? -32.378 25.370  7.989   1.00 98.06  ? 59  PRO A CA  1 
ATOM   460  C C   . PRO A 1 67  ? -33.664 24.582  8.231   1.00 97.11  ? 59  PRO A C   1 
ATOM   461  O O   . PRO A 1 67  ? -34.756 25.131  8.089   1.00 96.79  ? 59  PRO A O   1 
ATOM   462  C CB  . PRO A 1 67  ? -32.097 26.327  9.150   1.00 90.07  ? 59  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 67  ? -31.393 27.473  8.517   1.00 87.00  ? 59  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 67  ? -32.011 27.630  7.153   1.00 89.12  ? 59  PRO A CD  1 
ATOM   465  N N   . SER A 1 68  ? -33.529 23.312  8.597   1.00 108.67 ? 60  SER A N   1 
ATOM   466  C CA  . SER A 1 68  ? -34.680 22.426  8.742   1.00 105.14 ? 60  SER A CA  1 
ATOM   467  C C   . SER A 1 68  ? -35.557 22.778  9.942   1.00 100.94 ? 60  SER A C   1 
ATOM   468  O O   . SER A 1 68  ? -36.736 22.428  9.978   1.00 84.76  ? 60  SER A O   1 
ATOM   469  C CB  . SER A 1 68  ? -34.215 20.972  8.854   1.00 105.92 ? 60  SER A CB  1 
ATOM   470  N N   . ASP A 1 69  ? -34.984 23.468  10.924  1.00 117.74 ? 61  ASP A N   1 
ATOM   471  C CA  . ASP A 1 69  ? -35.721 23.803  12.138  1.00 108.52 ? 61  ASP A CA  1 
ATOM   472  C C   . ASP A 1 69  ? -36.141 25.271  12.181  1.00 97.70  ? 61  ASP A C   1 
ATOM   473  O O   . ASP A 1 69  ? -36.387 25.823  13.253  1.00 88.25  ? 61  ASP A O   1 
ATOM   474  C CB  . ASP A 1 69  ? -34.892 23.458  13.378  1.00 96.75  ? 61  ASP A CB  1 
ATOM   475  C CG  . ASP A 1 69  ? -33.452 23.923  13.269  1.00 116.61 ? 61  ASP A CG  1 
ATOM   476  O OD1 . ASP A 1 69  ? -33.169 24.815  12.442  1.00 116.02 ? 61  ASP A OD1 1 
ATOM   477  O OD2 . ASP A 1 69  ? -32.601 23.395  14.016  1.00 135.33 ? 61  ASP A OD2 1 
ATOM   478  N N   . LEU A 1 70  ? -36.220 25.896  11.010  1.00 88.37  ? 62  LEU A N   1 
ATOM   479  C CA  . LEU A 1 70  ? -36.717 27.263  10.900  1.00 77.42  ? 62  LEU A CA  1 
ATOM   480  C C   . LEU A 1 70  ? -38.197 27.234  10.533  1.00 88.85  ? 62  LEU A C   1 
ATOM   481  O O   . LEU A 1 70  ? -38.602 26.494  9.638   1.00 100.04 ? 62  LEU A O   1 
ATOM   482  C CB  . LEU A 1 70  ? -35.918 28.051  9.859   1.00 62.97  ? 62  LEU A CB  1 
ATOM   483  C CG  . LEU A 1 70  ? -36.248 29.539  9.699   1.00 68.86  ? 62  LEU A CG  1 
ATOM   484  C CD1 . LEU A 1 70  ? -35.702 30.342  10.869  1.00 58.73  ? 62  LEU A CD1 1 
ATOM   485  C CD2 . LEU A 1 70  ? -35.711 30.079  8.381   1.00 68.08  ? 62  LEU A CD2 1 
ATOM   486  N N   . THR A 1 71  ? -39.006 28.027  11.227  1.00 94.99  ? 63  THR A N   1 
ATOM   487  C CA  . THR A 1 71  ? -40.447 28.022  10.991  1.00 99.86  ? 63  THR A CA  1 
ATOM   488  C C   . THR A 1 71  ? -40.806 28.724  9.684   1.00 86.59  ? 63  THR A C   1 
ATOM   489  O O   . THR A 1 71  ? -40.056 29.570  9.196   1.00 79.49  ? 63  THR A O   1 
ATOM   490  C CB  . THR A 1 71  ? -41.214 28.692  12.146  1.00 80.38  ? 63  THR A CB  1 
ATOM   491  O OG1 . THR A 1 71  ? -40.804 30.059  12.269  1.00 81.48  ? 63  THR A OG1 1 
ATOM   492  C CG2 . THR A 1 71  ? -40.946 27.965  13.453  1.00 77.17  ? 63  THR A CG2 1 
ATOM   493  N N   . VAL A 1 72  ? -41.956 28.357  9.126   1.00 70.17  ? 64  VAL A N   1 
ATOM   494  C CA  . VAL A 1 72  ? -42.453 28.956  7.890   1.00 65.85  ? 64  VAL A CA  1 
ATOM   495  C C   . VAL A 1 72  ? -42.654 30.458  8.063   1.00 59.69  ? 64  VAL A C   1 
ATOM   496  O O   . VAL A 1 72  ? -42.349 31.247  7.167   1.00 58.73  ? 64  VAL A O   1 
ATOM   497  C CB  . VAL A 1 72  ? -43.779 28.303  7.446   1.00 64.52  ? 64  VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 72  ? -44.411 29.080  6.300   1.00 61.32  ? 64  VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 72  ? -43.551 26.848  7.056   1.00 55.20  ? 64  VAL A CG2 1 
ATOM   500  N N   . GLY A 1 73  ? -43.155 30.846  9.231   1.00 73.78  ? 65  GLY A N   1 
ATOM   501  C CA  . GLY A 1 73  ? -43.386 32.245  9.536   1.00 73.09  ? 65  GLY A CA  1 
ATOM   502  C C   . GLY A 1 73  ? -42.117 33.077  9.538   1.00 67.80  ? 65  GLY A C   1 
ATOM   503  O O   . GLY A 1 73  ? -42.114 34.216  9.071   1.00 65.33  ? 65  GLY A O   1 
ATOM   504  N N   . GLN A 1 74  ? -41.037 32.508  10.064  1.00 76.16  ? 66  GLN A N   1 
ATOM   505  C CA  . GLN A 1 74  ? -39.755 33.204  10.111  1.00 69.22  ? 66  GLN A CA  1 
ATOM   506  C C   . GLN A 1 74  ? -39.165 33.373  8.714   1.00 83.22  ? 66  GLN A C   1 
ATOM   507  O O   . GLN A 1 74  ? -38.509 34.374  8.426   1.00 112.58 ? 66  GLN A O   1 
ATOM   508  C CB  . GLN A 1 74  ? -38.772 32.457  11.017  1.00 81.00  ? 66  GLN A CB  1 
ATOM   509  C CG  . GLN A 1 74  ? -39.005 32.685  12.504  1.00 93.93  ? 66  GLN A CG  1 
ATOM   510  C CD  . GLN A 1 74  ? -38.111 31.825  13.378  1.00 112.93 ? 66  GLN A CD  1 
ATOM   511  O OE1 . GLN A 1 74  ? -38.008 30.615  13.181  1.00 121.64 ? 66  GLN A OE1 1 
ATOM   512  N NE2 . GLN A 1 74  ? -37.456 32.451  14.350  1.00 113.75 ? 66  GLN A NE2 1 
ATOM   513  N N   . PHE A 1 75  ? -39.403 32.392  7.849   1.00 78.55  ? 67  PHE A N   1 
ATOM   514  C CA  . PHE A 1 75  ? -38.948 32.470  6.465   1.00 77.73  ? 67  PHE A CA  1 
ATOM   515  C C   . PHE A 1 75  ? -39.774 33.495  5.691   1.00 68.77  ? 67  PHE A C   1 
ATOM   516  O O   . PHE A 1 75  ? -39.289 34.114  4.745   1.00 67.02  ? 67  PHE A O   1 
ATOM   517  C CB  . PHE A 1 75  ? -39.030 31.098  5.793   1.00 68.15  ? 67  PHE A CB  1 
ATOM   518  C CG  . PHE A 1 75  ? -38.439 31.061  4.412   1.00 63.69  ? 67  PHE A CG  1 
ATOM   519  C CD1 . PHE A 1 75  ? -37.099 31.351  4.210   1.00 63.71  ? 67  PHE A CD1 1 
ATOM   520  C CD2 . PHE A 1 75  ? -39.219 30.725  3.318   1.00 63.58  ? 67  PHE A CD2 1 
ATOM   521  C CE1 . PHE A 1 75  ? -36.550 31.315  2.941   1.00 65.49  ? 67  PHE A CE1 1 
ATOM   522  C CE2 . PHE A 1 75  ? -38.675 30.686  2.046   1.00 57.78  ? 67  PHE A CE2 1 
ATOM   523  C CZ  . PHE A 1 75  ? -37.339 30.981  1.858   1.00 61.29  ? 67  PHE A CZ  1 
ATOM   524  N N   . TYR A 1 76  ? -41.024 33.669  6.109   1.00 67.27  ? 68  TYR A N   1 
ATOM   525  C CA  . TYR A 1 76  ? -41.922 34.643  5.499   1.00 62.63  ? 68  TYR A CA  1 
ATOM   526  C C   . TYR A 1 76  ? -41.435 36.071  5.725   1.00 75.37  ? 68  TYR A C   1 
ATOM   527  O O   . TYR A 1 76  ? -41.423 36.885  4.802   1.00 83.94  ? 68  TYR A O   1 
ATOM   528  C CB  . TYR A 1 76  ? -43.338 34.471  6.052   1.00 65.59  ? 68  TYR A CB  1 
ATOM   529  C CG  . TYR A 1 76  ? -44.289 35.593  5.700   1.00 77.70  ? 68  TYR A CG  1 
ATOM   530  C CD1 . TYR A 1 76  ? -44.700 35.799  4.390   1.00 66.12  ? 68  TYR A CD1 1 
ATOM   531  C CD2 . TYR A 1 76  ? -44.794 36.434  6.685   1.00 83.88  ? 68  TYR A CD2 1 
ATOM   532  C CE1 . TYR A 1 76  ? -45.576 36.820  4.067   1.00 75.50  ? 68  TYR A CE1 1 
ATOM   533  C CE2 . TYR A 1 76  ? -45.671 37.456  6.372   1.00 85.73  ? 68  TYR A CE2 1 
ATOM   534  C CZ  . TYR A 1 76  ? -46.059 37.645  5.062   1.00 83.80  ? 68  TYR A CZ  1 
ATOM   535  O OH  . TYR A 1 76  ? -46.931 38.662  4.748   1.00 80.79  ? 68  TYR A OH  1 
ATOM   536  N N   . PHE A 1 77  ? -41.034 36.369  6.957   1.00 83.36  ? 69  PHE A N   1 
ATOM   537  C CA  . PHE A 1 77  ? -40.500 37.685  7.292   1.00 83.40  ? 69  PHE A CA  1 
ATOM   538  C C   . PHE A 1 77  ? -39.136 37.897  6.651   1.00 75.79  ? 69  PHE A C   1 
ATOM   539  O O   . PHE A 1 77  ? -38.736 39.028  6.374   1.00 88.98  ? 69  PHE A O   1 
ATOM   540  C CB  . PHE A 1 77  ? -40.401 37.854  8.808   1.00 86.05  ? 69  PHE A CB  1 
ATOM   541  C CG  . PHE A 1 77  ? -41.726 38.047  9.481   1.00 78.24  ? 69  PHE A CG  1 
ATOM   542  C CD1 . PHE A 1 77  ? -42.695 38.855  8.910   1.00 89.73  ? 69  PHE A CD1 1 
ATOM   543  C CD2 . PHE A 1 77  ? -42.008 37.414  10.678  1.00 84.78  ? 69  PHE A CD2 1 
ATOM   544  C CE1 . PHE A 1 77  ? -43.919 39.033  9.526   1.00 97.08  ? 69  PHE A CE1 1 
ATOM   545  C CE2 . PHE A 1 77  ? -43.229 37.587  11.297  1.00 90.35  ? 69  PHE A CE2 1 
ATOM   546  C CZ  . PHE A 1 77  ? -44.186 38.399  10.721  1.00 87.14  ? 69  PHE A CZ  1 
ATOM   547  N N   . LEU A 1 78  ? -38.427 36.797  6.422   1.00 78.10  ? 70  LEU A N   1 
ATOM   548  C CA  . LEU A 1 78  ? -37.116 36.838  5.788   1.00 86.74  ? 70  LEU A CA  1 
ATOM   549  C C   . LEU A 1 78  ? -37.241 37.268  4.329   1.00 97.76  ? 70  LEU A C   1 
ATOM   550  O O   . LEU A 1 78  ? -36.445 38.068  3.836   1.00 111.46 ? 70  LEU A O   1 
ATOM   551  C CB  . LEU A 1 78  ? -36.436 35.470  5.883   1.00 80.46  ? 70  LEU A CB  1 
ATOM   552  C CG  . LEU A 1 78  ? -34.910 35.453  5.978   1.00 87.48  ? 70  LEU A CG  1 
ATOM   553  C CD1 . LEU A 1 78  ? -34.449 36.090  7.281   1.00 92.73  ? 70  LEU A CD1 1 
ATOM   554  C CD2 . LEU A 1 78  ? -34.379 34.032  5.853   1.00 83.97  ? 70  LEU A CD2 1 
ATOM   555  N N   . ILE A 1 79  ? -38.251 36.734  3.649   1.00 91.73  ? 71  ILE A N   1 
ATOM   556  C CA  . ILE A 1 79  ? -38.498 37.052  2.247   1.00 78.82  ? 71  ILE A CA  1 
ATOM   557  C C   . ILE A 1 79  ? -39.010 38.482  2.084   1.00 73.45  ? 71  ILE A C   1 
ATOM   558  O O   . ILE A 1 79  ? -38.613 39.186  1.155   1.00 90.49  ? 71  ILE A O   1 
ATOM   559  C CB  . ILE A 1 79  ? -39.505 36.064  1.619   1.00 76.11  ? 71  ILE A CB  1 
ATOM   560  C CG1 . ILE A 1 79  ? -38.901 34.659  1.556   1.00 79.13  ? 71  ILE A CG1 1 
ATOM   561  C CG2 . ILE A 1 79  ? -39.913 36.515  0.225   1.00 70.02  ? 71  ILE A CG2 1 
ATOM   562  C CD1 . ILE A 1 79  ? -37.629 34.576  0.736   1.00 65.71  ? 71  ILE A CD1 1 
ATOM   563  N N   . ARG A 1 80  ? -39.883 38.909  2.995   1.00 65.16  ? 72  ARG A N   1 
ATOM   564  C CA  . ARG A 1 80  ? -40.408 40.273  2.978   1.00 71.93  ? 72  ARG A CA  1 
ATOM   565  C C   . ARG A 1 80  ? -39.285 41.305  3.016   1.00 82.59  ? 72  ARG A C   1 
ATOM   566  O O   . ARG A 1 80  ? -39.332 42.313  2.312   1.00 92.37  ? 72  ARG A O   1 
ATOM   567  C CB  . ARG A 1 80  ? -41.359 40.504  4.155   1.00 60.78  ? 72  ARG A CB  1 
ATOM   568  C CG  . ARG A 1 80  ? -42.707 39.819  4.019   1.00 63.97  ? 72  ARG A CG  1 
ATOM   569  C CD  . ARG A 1 80  ? -43.592 40.115  5.219   1.00 62.70  ? 72  ARG A CD  1 
ATOM   570  N NE  . ARG A 1 80  ? -43.936 41.531  5.318   1.00 76.97  ? 72  ARG A NE  1 
ATOM   571  C CZ  . ARG A 1 80  ? -45.113 42.042  4.970   1.00 80.32  ? 72  ARG A CZ  1 
ATOM   572  N NH1 . ARG A 1 80  ? -46.069 41.251  4.502   1.00 85.48  ? 72  ARG A NH1 1 
ATOM   573  N NH2 . ARG A 1 80  ? -45.337 43.343  5.095   1.00 88.41  ? 72  ARG A NH2 1 
ATOM   574  N N   . LYS A 1 81  ? -38.275 41.043  3.840   1.00 90.90  ? 73  LYS A N   1 
ATOM   575  C CA  . LYS A 1 81  ? -37.133 41.943  3.960   1.00 95.24  ? 73  LYS A CA  1 
ATOM   576  C C   . LYS A 1 81  ? -36.300 41.948  2.681   1.00 93.74  ? 73  LYS A C   1 
ATOM   577  O O   . LYS A 1 81  ? -35.614 42.925  2.382   1.00 100.27 ? 73  LYS A O   1 
ATOM   578  C CB  . LYS A 1 81  ? -36.264 41.551  5.157   1.00 74.17  ? 73  LYS A CB  1 
ATOM   579  N N   . ARG A 1 82  ? -36.365 40.853  1.929   1.00 81.02  ? 74  ARG A N   1 
ATOM   580  C CA  . ARG A 1 82  ? -35.647 40.749  0.663   1.00 87.84  ? 74  ARG A CA  1 
ATOM   581  C C   . ARG A 1 82  ? -36.427 41.408  -0.473  1.00 95.90  ? 74  ARG A C   1 
ATOM   582  O O   . ARG A 1 82  ? -35.841 41.999  -1.378  1.00 114.47 ? 74  ARG A O   1 
ATOM   583  C CB  . ARG A 1 82  ? -35.357 39.285  0.327   1.00 79.41  ? 74  ARG A CB  1 
ATOM   584  C CG  . ARG A 1 82  ? -34.278 38.658  1.195   1.00 72.67  ? 74  ARG A CG  1 
ATOM   585  C CD  . ARG A 1 82  ? -33.866 37.295  0.667   1.00 70.16  ? 74  ARG A CD  1 
ATOM   586  N NE  . ARG A 1 82  ? -32.426 37.086  0.779   1.00 83.17  ? 74  ARG A NE  1 
ATOM   587  C CZ  . ARG A 1 82  ? -31.554 37.384  -0.180  1.00 102.91 ? 74  ARG A CZ  1 
ATOM   588  N NH1 . ARG A 1 82  ? -31.978 37.901  -1.325  1.00 108.00 ? 74  ARG A NH1 1 
ATOM   589  N NH2 . ARG A 1 82  ? -30.260 37.165  0.005   1.00 110.95 ? 74  ARG A NH2 1 
ATOM   590  N N   . ILE A 1 83  ? -37.752 41.299  -0.416  1.00 101.11 ? 75  ILE A N   1 
ATOM   591  C CA  . ILE A 1 83  ? -38.632 41.962  -1.375  1.00 100.60 ? 75  ILE A CA  1 
ATOM   592  C C   . ILE A 1 83  ? -38.626 43.470  -1.108  1.00 96.41  ? 75  ILE A C   1 
ATOM   593  O O   . ILE A 1 83  ? -38.955 44.274  -1.985  1.00 109.39 ? 75  ILE A O   1 
ATOM   594  C CB  . ILE A 1 83  ? -40.077 41.399  -1.292  1.00 104.38 ? 75  ILE A CB  1 
ATOM   595  C CG1 . ILE A 1 83  ? -40.091 39.913  -1.646  1.00 106.06 ? 75  ILE A CG1 1 
ATOM   596  C CG2 . ILE A 1 83  ? -41.021 42.134  -2.233  1.00 106.92 ? 75  ILE A CG2 1 
ATOM   597  C CD1 . ILE A 1 83  ? -39.865 39.639  -3.117  1.00 118.18 ? 75  ILE A CD1 1 
ATOM   598  N N   . HIS A 1 84  ? -38.217 43.830  0.108   1.00 90.15  ? 76  HIS A N   1 
ATOM   599  C CA  . HIS A 1 84  ? -38.187 45.211  0.592   1.00 98.81  ? 76  HIS A CA  1 
ATOM   600  C C   . HIS A 1 84  ? -39.599 45.770  0.741   1.00 96.92  ? 76  HIS A C   1 
ATOM   601  O O   . HIS A 1 84  ? -39.851 46.939  0.446   1.00 97.25  ? 76  HIS A O   1 
ATOM   602  C CB  . HIS A 1 84  ? -37.356 46.115  -0.329  1.00 111.43 ? 76  HIS A CB  1 
ATOM   603  C CG  . HIS A 1 84  ? -35.984 45.589  -0.620  1.00 123.07 ? 76  HIS A CG  1 
ATOM   604  N ND1 . HIS A 1 84  ? -35.622 45.097  -1.855  1.00 128.30 ? 76  HIS A ND1 1 
ATOM   605  C CD2 . HIS A 1 84  ? -34.885 45.482  0.164   1.00 127.66 ? 76  HIS A CD2 1 
ATOM   606  C CE1 . HIS A 1 84  ? -34.360 44.709  -1.821  1.00 131.99 ? 76  HIS A CE1 1 
ATOM   607  N NE2 . HIS A 1 84  ? -33.890 44.931  -0.607  1.00 133.27 ? 76  HIS A NE2 1 
ATOM   608  N N   . LEU A 1 85  ? -40.517 44.925  1.201   1.00 91.98  ? 77  LEU A N   1 
ATOM   609  C CA  . LEU A 1 85  ? -41.869 45.364  1.522   1.00 89.32  ? 77  LEU A CA  1 
ATOM   610  C C   . LEU A 1 85  ? -41.845 46.238  2.767   1.00 97.06  ? 77  LEU A C   1 
ATOM   611  O O   . LEU A 1 85  ? -41.012 46.042  3.652   1.00 88.61  ? 77  LEU A O   1 
ATOM   612  C CB  . LEU A 1 85  ? -42.796 44.168  1.748   1.00 70.90  ? 77  LEU A CB  1 
ATOM   613  C CG  . LEU A 1 85  ? -43.132 43.267  0.560   1.00 81.43  ? 77  LEU A CG  1 
ATOM   614  C CD1 . LEU A 1 85  ? -44.040 42.134  1.009   1.00 87.25  ? 77  LEU A CD1 1 
ATOM   615  C CD2 . LEU A 1 85  ? -43.780 44.065  -0.562  1.00 79.55  ? 77  LEU A CD2 1 
ATOM   616  N N   . ARG A 1 86  ? -42.754 47.202  2.839   1.00 107.85 ? 78  ARG A N   1 
ATOM   617  C CA  . ARG A 1 86  ? -42.882 48.002  4.047   1.00 107.77 ? 78  ARG A CA  1 
ATOM   618  C C   . ARG A 1 86  ? -43.870 47.326  4.989   1.00 107.72 ? 78  ARG A C   1 
ATOM   619  O O   . ARG A 1 86  ? -44.525 46.352  4.617   1.00 89.84  ? 78  ARG A O   1 
ATOM   620  C CB  . ARG A 1 86  ? -43.310 49.436  3.721   1.00 116.44 ? 78  ARG A CB  1 
ATOM   621  C CG  . ARG A 1 86  ? -44.693 49.582  3.117   1.00 124.02 ? 78  ARG A CG  1 
ATOM   622  C CD  . ARG A 1 86  ? -44.949 51.038  2.756   1.00 142.77 ? 78  ARG A CD  1 
ATOM   623  N NE  . ARG A 1 86  ? -46.295 51.260  2.238   1.00 164.35 ? 78  ARG A NE  1 
ATOM   624  C CZ  . ARG A 1 86  ? -46.647 51.089  0.968   1.00 167.55 ? 78  ARG A CZ  1 
ATOM   625  N NH1 . ARG A 1 86  ? -45.750 50.691  0.075   1.00 163.93 ? 78  ARG A NH1 1 
ATOM   626  N NH2 . ARG A 1 86  ? -47.897 51.318  0.589   1.00 168.20 ? 78  ARG A NH2 1 
ATOM   627  N N   . PRO A 1 87  ? -43.975 47.845  6.208   1.00 110.69 ? 79  PRO A N   1 
ATOM   628  C CA  . PRO A 1 87  ? -44.719 47.178  7.274   1.00 108.03 ? 79  PRO A CA  1 
ATOM   629  C C   . PRO A 1 87  ? -46.221 47.065  7.004   1.00 119.41 ? 79  PRO A C   1 
ATOM   630  O O   . PRO A 1 87  ? -46.943 46.420  7.763   1.00 130.15 ? 79  PRO A O   1 
ATOM   631  C CB  . PRO A 1 87  ? -44.485 47.901  8.592   1.00 103.26 ? 79  PRO A CB  1 
ATOM   632  N N   . GLU A 1 88  ? -46.686 47.680  5.921   1.00 120.72 ? 80  GLU A N   1 
ATOM   633  C CA  . GLU A 1 88  ? -48.114 47.732  5.628   1.00 111.48 ? 80  GLU A CA  1 
ATOM   634  C C   . GLU A 1 88  ? -48.522 46.790  4.498   1.00 112.85 ? 80  GLU A C   1 
ATOM   635  O O   . GLU A 1 88  ? -49.698 46.451  4.359   1.00 103.83 ? 80  GLU A O   1 
ATOM   636  C CB  . GLU A 1 88  ? -48.518 49.163  5.274   1.00 107.51 ? 80  GLU A CB  1 
ATOM   637  C CG  . GLU A 1 88  ? -47.993 50.207  6.244   1.00 123.73 ? 80  GLU A CG  1 
ATOM   638  C CD  . GLU A 1 88  ? -47.912 51.586  5.624   1.00 139.09 ? 80  GLU A CD  1 
ATOM   639  O OE1 . GLU A 1 88  ? -47.578 51.680  4.425   1.00 119.65 ? 80  GLU A OE1 1 
ATOM   640  O OE2 . GLU A 1 88  ? -48.180 52.578  6.335   1.00 164.76 ? 80  GLU A OE2 1 
ATOM   641  N N   . ASP A 1 89  ? -47.549 46.369  3.696   1.00 123.52 ? 81  ASP A N   1 
ATOM   642  C CA  . ASP A 1 89  ? -47.827 45.575  2.502   1.00 120.14 ? 81  ASP A CA  1 
ATOM   643  C C   . ASP A 1 89  ? -48.322 44.169  2.825   1.00 118.31 ? 81  ASP A C   1 
ATOM   644  O O   . ASP A 1 89  ? -47.995 43.605  3.869   1.00 120.79 ? 81  ASP A O   1 
ATOM   645  C CB  . ASP A 1 89  ? -46.579 45.493  1.622   1.00 112.22 ? 81  ASP A CB  1 
ATOM   646  C CG  . ASP A 1 89  ? -46.205 46.831  1.019   1.00 120.02 ? 81  ASP A CG  1 
ATOM   647  O OD1 . ASP A 1 89  ? -47.113 47.664  0.813   1.00 114.06 ? 81  ASP A OD1 1 
ATOM   648  O OD2 . ASP A 1 89  ? -45.006 47.051  0.750   1.00 134.78 ? 81  ASP A OD2 1 
ATOM   649  N N   . ALA A 1 90  ? -49.113 43.612  1.913   1.00 114.85 ? 82  ALA A N   1 
ATOM   650  C CA  . ALA A 1 90  ? -49.649 42.266  2.073   1.00 93.77  ? 82  ALA A CA  1 
ATOM   651  C C   . ALA A 1 90  ? -48.871 41.263  1.228   1.00 95.32  ? 82  ALA A C   1 
ATOM   652  O O   . ALA A 1 90  ? -48.584 41.512  0.057   1.00 107.38 ? 82  ALA A O   1 
ATOM   653  C CB  . ALA A 1 90  ? -51.126 42.236  1.705   1.00 79.11  ? 82  ALA A CB  1 
ATOM   654  N N   . LEU A 1 91  ? -48.530 40.130  1.833   1.00 81.76  ? 83  LEU A N   1 
ATOM   655  C CA  . LEU A 1 91  ? -47.808 39.070  1.139   1.00 73.94  ? 83  LEU A CA  1 
ATOM   656  C C   . LEU A 1 91  ? -48.264 37.706  1.643   1.00 74.86  ? 83  LEU A C   1 
ATOM   657  O O   . LEU A 1 91  ? -48.511 37.531  2.836   1.00 71.48  ? 83  LEU A O   1 
ATOM   658  C CB  . LEU A 1 91  ? -46.299 39.227  1.331   1.00 69.68  ? 83  LEU A CB  1 
ATOM   659  C CG  . LEU A 1 91  ? -45.422 38.360  0.426   1.00 73.90  ? 83  LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 91  ? -45.428 38.904  -0.994  1.00 80.33  ? 83  LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 91  ? -44.003 38.261  0.966   1.00 67.00  ? 83  LEU A CD2 1 
ATOM   662  N N   . PHE A 1 92  ? -48.377 36.740  0.735   1.00 76.47  ? 84  PHE A N   1 
ATOM   663  C CA  . PHE A 1 92  ? -48.858 35.412  1.103   1.00 72.82  ? 84  PHE A CA  1 
ATOM   664  C C   . PHE A 1 92  ? -48.119 34.305  0.363   1.00 70.45  ? 84  PHE A C   1 
ATOM   665  O O   . PHE A 1 92  ? -47.940 34.371  -0.851  1.00 73.18  ? 84  PHE A O   1 
ATOM   666  C CB  . PHE A 1 92  ? -50.361 35.303  0.839   1.00 74.67  ? 84  PHE A CB  1 
ATOM   667  C CG  . PHE A 1 92  ? -51.172 36.338  1.558   1.00 78.40  ? 84  PHE A CG  1 
ATOM   668  C CD1 . PHE A 1 92  ? -51.383 36.243  2.923   1.00 96.37  ? 84  PHE A CD1 1 
ATOM   669  C CD2 . PHE A 1 92  ? -51.709 37.414  0.874   1.00 77.78  ? 84  PHE A CD2 1 
ATOM   670  C CE1 . PHE A 1 92  ? -52.117 37.200  3.592   1.00 102.31 ? 84  PHE A CE1 1 
ATOM   671  C CE2 . PHE A 1 92  ? -52.449 38.373  1.536   1.00 84.67  ? 84  PHE A CE2 1 
ATOM   672  C CZ  . PHE A 1 92  ? -52.651 38.268  2.897   1.00 99.21  ? 84  PHE A CZ  1 
ATOM   673  N N   . PHE A 1 93  ? -47.694 33.287  1.104   1.00 72.01  ? 85  PHE A N   1 
ATOM   674  C CA  . PHE A 1 93  ? -47.023 32.136  0.513   1.00 59.93  ? 85  PHE A CA  1 
ATOM   675  C C   . PHE A 1 93  ? -48.027 31.105  0.014   1.00 61.76  ? 85  PHE A C   1 
ATOM   676  O O   . PHE A 1 93  ? -49.078 30.900  0.621   1.00 68.20  ? 85  PHE A O   1 
ATOM   677  C CB  . PHE A 1 93  ? -46.071 31.484  1.520   1.00 61.36  ? 85  PHE A CB  1 
ATOM   678  C CG  . PHE A 1 93  ? -44.740 32.172  1.633   1.00 80.21  ? 85  PHE A CG  1 
ATOM   679  C CD1 . PHE A 1 93  ? -44.410 33.220  0.789   1.00 86.83  ? 85  PHE A CD1 1 
ATOM   680  C CD2 . PHE A 1 93  ? -43.812 31.759  2.577   1.00 69.12  ? 85  PHE A CD2 1 
ATOM   681  C CE1 . PHE A 1 93  ? -43.183 33.851  0.890   1.00 77.33  ? 85  PHE A CE1 1 
ATOM   682  C CE2 . PHE A 1 93  ? -42.583 32.385  2.682   1.00 70.97  ? 85  PHE A CE2 1 
ATOM   683  C CZ  . PHE A 1 93  ? -42.268 33.433  1.837   1.00 73.65  ? 85  PHE A CZ  1 
ATOM   684  N N   . PHE A 1 94  ? -47.696 30.464  -1.102  1.00 67.63  ? 86  PHE A N   1 
ATOM   685  C CA  . PHE A 1 94  ? -48.499 29.369  -1.629  1.00 53.15  ? 86  PHE A CA  1 
ATOM   686  C C   . PHE A 1 94  ? -47.623 28.154  -1.896  1.00 63.34  ? 86  PHE A C   1 
ATOM   687  O O   . PHE A 1 94  ? -46.789 28.165  -2.801  1.00 69.79  ? 86  PHE A O   1 
ATOM   688  C CB  . PHE A 1 94  ? -49.221 29.786  -2.909  1.00 61.56  ? 86  PHE A CB  1 
ATOM   689  C CG  . PHE A 1 94  ? -50.272 30.833  -2.698  1.00 59.18  ? 86  PHE A CG  1 
ATOM   690  C CD1 . PHE A 1 94  ? -51.555 30.476  -2.315  1.00 58.83  ? 86  PHE A CD1 1 
ATOM   691  C CD2 . PHE A 1 94  ? -49.979 32.174  -2.887  1.00 60.95  ? 86  PHE A CD2 1 
ATOM   692  C CE1 . PHE A 1 94  ? -52.527 31.440  -2.121  1.00 63.32  ? 86  PHE A CE1 1 
ATOM   693  C CE2 . PHE A 1 94  ? -50.946 33.142  -2.695  1.00 70.13  ? 86  PHE A CE2 1 
ATOM   694  C CZ  . PHE A 1 94  ? -52.221 32.774  -2.311  1.00 69.33  ? 86  PHE A CZ  1 
ATOM   695  N N   . VAL A 1 95  ? -47.811 27.112  -1.096  1.00 60.76  ? 87  VAL A N   1 
ATOM   696  C CA  . VAL A 1 95  ? -47.080 25.869  -1.284  1.00 71.02  ? 87  VAL A CA  1 
ATOM   697  C C   . VAL A 1 95  ? -48.048 24.798  -1.772  1.00 76.29  ? 87  VAL A C   1 
ATOM   698  O O   . VAL A 1 95  ? -48.935 24.371  -1.031  1.00 80.11  ? 87  VAL A O   1 
ATOM   699  C CB  . VAL A 1 95  ? -46.388 25.417  0.012   1.00 65.69  ? 87  VAL A CB  1 
ATOM   700  C CG1 . VAL A 1 95  ? -45.417 24.294  -0.278  1.00 62.56  ? 87  VAL A CG1 1 
ATOM   701  C CG2 . VAL A 1 95  ? -45.657 26.586  0.648   1.00 59.73  ? 87  VAL A CG2 1 
ATOM   702  N N   . ASN A 1 96  ? -47.866 24.379  -3.022  1.00 82.29  ? 88  ASN A N   1 
ATOM   703  C CA  . ASN A 1 96  ? -48.822 23.519  -3.718  1.00 77.67  ? 88  ASN A CA  1 
ATOM   704  C C   . ASN A 1 96  ? -50.222 24.122  -3.697  1.00 76.72  ? 88  ASN A C   1 
ATOM   705  O O   . ASN A 1 96  ? -51.197 23.448  -3.358  1.00 67.23  ? 88  ASN A O   1 
ATOM   706  C CB  . ASN A 1 96  ? -48.838 22.110  -3.118  1.00 66.17  ? 88  ASN A CB  1 
ATOM   707  C CG  . ASN A 1 96  ? -47.599 21.308  -3.476  1.00 70.32  ? 88  ASN A CG  1 
ATOM   708  O OD1 . ASN A 1 96  ? -46.969 20.699  -2.612  1.00 81.54  ? 88  ASN A OD1 1 
ATOM   709  N ND2 . ASN A 1 96  ? -47.244 21.306  -4.756  1.00 65.09  ? 88  ASN A ND2 1 
ATOM   710  N N   . ASN A 1 97  ? -50.297 25.403  -4.052  1.00 87.57  ? 89  ASN A N   1 
ATOM   711  C CA  . ASN A 1 97  ? -51.556 26.140  -4.160  1.00 91.73  ? 89  ASN A CA  1 
ATOM   712  C C   . ASN A 1 97  ? -52.371 26.162  -2.869  1.00 74.01  ? 89  ASN A C   1 
ATOM   713  O O   . ASN A 1 97  ? -53.593 26.304  -2.899  1.00 71.62  ? 89  ASN A O   1 
ATOM   714  C CB  . ASN A 1 97  ? -52.404 25.567  -5.298  1.00 111.68 ? 89  ASN A CB  1 
ATOM   715  C CG  . ASN A 1 97  ? -51.689 25.613  -6.634  1.00 127.15 ? 89  ASN A CG  1 
ATOM   716  O OD1 . ASN A 1 97  ? -51.048 24.645  -7.042  1.00 129.30 ? 89  ASN A OD1 1 
ATOM   717  N ND2 . ASN A 1 97  ? -51.791 26.746  -7.320  1.00 134.14 ? 89  ASN A ND2 1 
ATOM   718  N N   . THR A 1 98  ? -51.688 26.023  -1.738  1.00 83.43  ? 90  THR A N   1 
ATOM   719  C CA  . THR A 1 98  ? -52.326 26.141  -0.432  1.00 84.12  ? 90  THR A CA  1 
ATOM   720  C C   . THR A 1 98  ? -51.451 26.964  0.505   1.00 78.09  ? 90  THR A C   1 
ATOM   721  O O   . THR A 1 98  ? -50.235 26.783  0.548   1.00 89.13  ? 90  THR A O   1 
ATOM   722  C CB  . THR A 1 98  ? -52.603 24.763  0.204   1.00 94.92  ? 90  THR A CB  1 
ATOM   723  O OG1 . THR A 1 98  ? -51.437 23.938  0.089   1.00 113.70 ? 90  THR A OG1 1 
ATOM   724  C CG2 . THR A 1 98  ? -53.772 24.076  -0.487  1.00 111.81 ? 90  THR A CG2 1 
ATOM   725  N N   . ILE A 1 99  ? -52.074 27.874  1.247   1.00 78.53  ? 91  ILE A N   1 
ATOM   726  C CA  . ILE A 1 99  ? -51.349 28.719  2.188   1.00 71.15  ? 91  ILE A CA  1 
ATOM   727  C C   . ILE A 1 99  ? -50.896 27.911  3.402   1.00 67.45  ? 91  ILE A C   1 
ATOM   728  O O   . ILE A 1 99  ? -51.724 27.401  4.159   1.00 68.12  ? 91  ILE A O   1 
ATOM   729  C CB  . ILE A 1 99  ? -52.210 29.910  2.648   1.00 76.77  ? 91  ILE A CB  1 
ATOM   730  C CG1 . ILE A 1 99  ? -52.472 30.858  1.475   1.00 66.29  ? 91  ILE A CG1 1 
ATOM   731  C CG2 . ILE A 1 99  ? -51.532 30.654  3.785   1.00 83.44  ? 91  ILE A CG2 1 
ATOM   732  C CD1 . ILE A 1 99  ? -53.314 32.063  1.837   1.00 75.54  ? 91  ILE A CD1 1 
ATOM   733  N N   . PRO A 1 100 ? -49.572 27.791  3.588   1.00 68.63  ? 92  PRO A N   1 
ATOM   734  C CA  . PRO A 1 100 ? -48.983 26.970  4.652   1.00 67.81  ? 92  PRO A CA  1 
ATOM   735  C C   . PRO A 1 100 ? -49.139 27.585  6.040   1.00 73.89  ? 92  PRO A C   1 
ATOM   736  O O   . PRO A 1 100 ? -49.178 28.810  6.163   1.00 79.71  ? 92  PRO A O   1 
ATOM   737  C CB  . PRO A 1 100 ? -47.507 26.900  4.255   1.00 64.34  ? 92  PRO A CB  1 
ATOM   738  C CG  . PRO A 1 100 ? -47.267 28.176  3.527   1.00 56.35  ? 92  PRO A CG  1 
ATOM   739  C CD  . PRO A 1 100 ? -48.540 28.458  2.773   1.00 67.18  ? 92  PRO A CD  1 
ATOM   740  N N   . PRO A 1 101 ? -49.229 26.739  7.078   1.00 81.92  ? 93  PRO A N   1 
ATOM   741  C CA  . PRO A 1 101 ? -49.307 27.206  8.467   1.00 80.20  ? 93  PRO A CA  1 
ATOM   742  C C   . PRO A 1 101 ? -48.000 27.844  8.928   1.00 84.16  ? 93  PRO A C   1 
ATOM   743  O O   . PRO A 1 101 ? -46.922 27.398  8.532   1.00 67.12  ? 93  PRO A O   1 
ATOM   744  C CB  . PRO A 1 101 ? -49.601 25.924  9.253   1.00 76.55  ? 93  PRO A CB  1 
ATOM   745  C CG  . PRO A 1 101 ? -49.066 24.828  8.399   1.00 81.36  ? 93  PRO A CG  1 
ATOM   746  C CD  . PRO A 1 101 ? -49.294 25.270  6.984   1.00 77.50  ? 93  PRO A CD  1 
ATOM   747  N N   . THR A 1 102 ? -48.101 28.878  9.757   1.00 90.58  ? 94  THR A N   1 
ATOM   748  C CA  . THR A 1 102 ? -46.926 29.609  10.218  1.00 79.64  ? 94  THR A CA  1 
ATOM   749  C C   . THR A 1 102 ? -46.130 28.818  11.252  1.00 84.99  ? 94  THR A C   1 
ATOM   750  O O   . THR A 1 102 ? -44.899 28.864  11.266  1.00 75.69  ? 94  THR A O   1 
ATOM   751  C CB  . THR A 1 102 ? -47.316 30.969  10.825  1.00 76.98  ? 94  THR A CB  1 
ATOM   752  O OG1 . THR A 1 102 ? -48.135 30.762  11.982  1.00 100.52 ? 94  THR A OG1 1 
ATOM   753  C CG2 . THR A 1 102 ? -48.081 31.803  9.811   1.00 79.81  ? 94  THR A CG2 1 
ATOM   754  N N   . SER A 1 103 ? -46.838 28.093  12.113  1.00 96.63  ? 95  SER A N   1 
ATOM   755  C CA  . SER A 1 103 ? -46.205 27.342  13.191  1.00 97.80  ? 95  SER A CA  1 
ATOM   756  C C   . SER A 1 103 ? -45.341 26.199  12.665  1.00 92.21  ? 95  SER A C   1 
ATOM   757  O O   . SER A 1 103 ? -44.401 25.764  13.331  1.00 114.77 ? 95  SER A O   1 
ATOM   758  C CB  . SER A 1 103 ? -47.264 26.792  14.149  1.00 109.81 ? 95  SER A CB  1 
ATOM   759  O OG  . SER A 1 103 ? -48.133 25.890  13.486  1.00 107.95 ? 95  SER A OG  1 
ATOM   760  N N   . ALA A 1 104 ? -45.666 25.718  11.470  1.00 79.90  ? 96  ALA A N   1 
ATOM   761  C CA  . ALA A 1 104 ? -44.949 24.599  10.868  1.00 79.24  ? 96  ALA A CA  1 
ATOM   762  C C   . ALA A 1 104 ? -43.492 24.948  10.583  1.00 87.79  ? 96  ALA A C   1 
ATOM   763  O O   . ALA A 1 104 ? -43.161 26.101  10.304  1.00 93.05  ? 96  ALA A O   1 
ATOM   764  C CB  . ALA A 1 104 ? -45.643 24.155  9.589   1.00 65.67  ? 96  ALA A CB  1 
ATOM   765  N N   . THR A 1 105 ? -42.626 23.943  10.660  1.00 92.31  ? 97  THR A N   1 
ATOM   766  C CA  . THR A 1 105 ? -41.214 24.120  10.345  1.00 87.26  ? 97  THR A CA  1 
ATOM   767  C C   . THR A 1 105 ? -40.972 23.847  8.865   1.00 80.81  ? 97  THR A C   1 
ATOM   768  O O   . THR A 1 105 ? -41.761 23.156  8.220   1.00 91.03  ? 97  THR A O   1 
ATOM   769  C CB  . THR A 1 105 ? -40.320 23.192  11.191  1.00 98.98  ? 97  THR A CB  1 
ATOM   770  O OG1 . THR A 1 105 ? -40.555 21.828  10.822  1.00 113.79 ? 97  THR A OG1 1 
ATOM   771  C CG2 . THR A 1 105 ? -40.615 23.369  12.673  1.00 97.48  ? 97  THR A CG2 1 
ATOM   772  N N   . MET A 1 106 ? -39.883 24.391  8.329   1.00 85.15  ? 98  MET A N   1 
ATOM   773  C CA  . MET A 1 106 ? -39.552 24.200  6.919   1.00 88.17  ? 98  MET A CA  1 
ATOM   774  C C   . MET A 1 106 ? -39.218 22.740  6.626   1.00 97.44  ? 98  MET A C   1 
ATOM   775  O O   . MET A 1 106 ? -39.331 22.287  5.487   1.00 107.86 ? 98  MET A O   1 
ATOM   776  C CB  . MET A 1 106 ? -38.385 25.102  6.509   1.00 83.49  ? 98  MET A CB  1 
ATOM   777  C CG  . MET A 1 106 ? -38.712 26.590  6.510   1.00 84.24  ? 98  MET A CG  1 
ATOM   778  S SD  . MET A 1 106 ? -40.016 27.044  5.349   1.00 71.41  ? 98  MET A SD  1 
ATOM   779  C CE  . MET A 1 106 ? -39.197 26.745  3.785   1.00 62.96  ? 98  MET A CE  1 
ATOM   780  N N   . GLY A 1 107 ? -38.808 22.009  7.657   1.00 91.26  ? 99  GLY A N   1 
ATOM   781  C CA  . GLY A 1 107 ? -38.559 20.585  7.530   1.00 76.54  ? 99  GLY A CA  1 
ATOM   782  C C   . GLY A 1 107 ? -39.858 19.817  7.383   1.00 84.74  ? 99  GLY A C   1 
ATOM   783  O O   . GLY A 1 107 ? -39.964 18.907  6.560   1.00 107.95 ? 99  GLY A O   1 
ATOM   784  N N   . GLN A 1 108 ? -40.851 20.189  8.186   1.00 79.74  ? 100 GLN A N   1 
ATOM   785  C CA  . GLN A 1 108 ? -42.177 19.586  8.111   1.00 84.75  ? 100 GLN A CA  1 
ATOM   786  C C   . GLN A 1 108 ? -42.862 19.943  6.797   1.00 97.40  ? 100 GLN A C   1 
ATOM   787  O O   . GLN A 1 108 ? -43.574 19.127  6.213   1.00 122.37 ? 100 GLN A O   1 
ATOM   788  C CB  . GLN A 1 108 ? -43.041 20.036  9.292   1.00 98.58  ? 100 GLN A CB  1 
ATOM   789  C CG  . GLN A 1 108 ? -42.711 19.351  10.610  1.00 131.31 ? 100 GLN A CG  1 
ATOM   790  C CD  . GLN A 1 108 ? -43.323 20.058  11.806  1.00 127.02 ? 100 GLN A CD  1 
ATOM   791  O OE1 . GLN A 1 108 ? -43.785 21.195  11.703  1.00 96.46  ? 100 GLN A OE1 1 
ATOM   792  N NE2 . GLN A 1 108 ? -43.336 19.381  12.949  1.00 139.56 ? 100 GLN A NE2 1 
ATOM   793  N N   . LEU A 1 109 ? -42.641 21.171  6.339   1.00 83.09  ? 101 LEU A N   1 
ATOM   794  C CA  . LEU A 1 109 ? -43.250 21.645  5.104   1.00 75.54  ? 101 LEU A CA  1 
ATOM   795  C C   . LEU A 1 109 ? -42.620 20.968  3.892   1.00 88.26  ? 101 LEU A C   1 
ATOM   796  O O   . LEU A 1 109 ? -43.312 20.635  2.929   1.00 108.00 ? 101 LEU A O   1 
ATOM   797  C CB  . LEU A 1 109 ? -43.120 23.165  4.987   1.00 61.50  ? 101 LEU A CB  1 
ATOM   798  C CG  . LEU A 1 109 ? -44.003 23.819  3.922   1.00 66.86  ? 101 LEU A CG  1 
ATOM   799  C CD1 . LEU A 1 109 ? -45.471 23.741  4.319   1.00 60.93  ? 101 LEU A CD1 1 
ATOM   800  C CD2 . LEU A 1 109 ? -43.583 25.260  3.674   1.00 66.83  ? 101 LEU A CD2 1 
ATOM   801  N N   . TYR A 1 110 ? -41.306 20.769  3.945   1.00 88.90  ? 102 TYR A N   1 
ATOM   802  C CA  . TYR A 1 110 ? -40.591 20.098  2.865   1.00 87.00  ? 102 TYR A CA  1 
ATOM   803  C C   . TYR A 1 110 ? -41.040 18.649  2.738   1.00 90.08  ? 102 TYR A C   1 
ATOM   804  O O   . TYR A 1 110 ? -41.298 18.168  1.639   1.00 94.34  ? 102 TYR A O   1 
ATOM   805  C CB  . TYR A 1 110 ? -39.077 20.160  3.091   1.00 89.91  ? 102 TYR A CB  1 
ATOM   806  C CG  . TYR A 1 110 ? -38.269 19.411  2.050   1.00 97.37  ? 102 TYR A CG  1 
ATOM   807  C CD1 . TYR A 1 110 ? -37.973 19.991  0.823   1.00 95.45  ? 102 TYR A CD1 1 
ATOM   808  C CD2 . TYR A 1 110 ? -37.802 18.125  2.296   1.00 95.91  ? 102 TYR A CD2 1 
ATOM   809  C CE1 . TYR A 1 110 ? -37.234 19.314  -0.129  1.00 96.92  ? 102 TYR A CE1 1 
ATOM   810  C CE2 . TYR A 1 110 ? -37.065 17.439  1.349   1.00 95.85  ? 102 TYR A CE2 1 
ATOM   811  C CZ  . TYR A 1 110 ? -36.785 18.039  0.138   1.00 105.10 ? 102 TYR A CZ  1 
ATOM   812  O OH  . TYR A 1 110 ? -36.053 17.362  -0.809  1.00 111.47 ? 102 TYR A OH  1 
ATOM   813  N N   . GLU A 1 111 ? -41.140 17.961  3.871   1.00 91.19  ? 103 GLU A N   1 
ATOM   814  C CA  . GLU A 1 111 ? -41.515 16.551  3.885   1.00 95.70  ? 103 GLU A CA  1 
ATOM   815  C C   . GLU A 1 111 ? -42.914 16.321  3.314   1.00 103.72 ? 103 GLU A C   1 
ATOM   816  O O   . GLU A 1 111 ? -43.217 15.242  2.804   1.00 115.01 ? 103 GLU A O   1 
ATOM   817  C CB  . GLU A 1 111 ? -41.441 15.999  5.311   1.00 94.74  ? 103 GLU A CB  1 
ATOM   818  C CG  . GLU A 1 111 ? -41.544 14.485  5.398   1.00 117.00 ? 103 GLU A CG  1 
ATOM   819  C CD  . GLU A 1 111 ? -41.806 13.999  6.809   1.00 134.70 ? 103 GLU A CD  1 
ATOM   820  O OE1 . GLU A 1 111 ? -41.955 14.848  7.713   1.00 145.40 ? 103 GLU A OE1 1 
ATOM   821  O OE2 . GLU A 1 111 ? -41.863 12.769  7.015   1.00 140.67 ? 103 GLU A OE2 1 
ATOM   822  N N   . ASP A 1 112 ? -43.760 17.343  3.391   1.00 100.34 ? 104 ASP A N   1 
ATOM   823  C CA  . ASP A 1 112 ? -45.149 17.216  2.965   1.00 94.70  ? 104 ASP A CA  1 
ATOM   824  C C   . ASP A 1 112 ? -45.401 17.754  1.559   1.00 104.34 ? 104 ASP A C   1 
ATOM   825  O O   . ASP A 1 112 ? -46.336 17.321  0.886   1.00 124.39 ? 104 ASP A O   1 
ATOM   826  C CB  . ASP A 1 112 ? -46.071 17.932  3.955   1.00 93.78  ? 104 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 112 ? -46.129 17.242  5.303   1.00 106.05 ? 104 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 112 ? -45.171 16.518  5.645   1.00 124.60 ? 104 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 112 ? -47.135 17.424  6.021   1.00 109.03 ? 104 ASP A OD2 1 
ATOM   830  N N   . ASN A 1 113 ? -44.572 18.693  1.113   1.00 98.03  ? 105 ASN A N   1 
ATOM   831  C CA  . ASN A 1 113 ? -44.858 19.402  -0.130  1.00 94.65  ? 105 ASN A CA  1 
ATOM   832  C C   . ASN A 1 113 ? -43.702 19.488  -1.127  1.00 92.74  ? 105 ASN A C   1 
ATOM   833  O O   . ASN A 1 113 ? -43.754 20.285  -2.065  1.00 101.31 ? 105 ASN A O   1 
ATOM   834  C CB  . ASN A 1 113 ? -45.344 20.815  0.193   1.00 77.24  ? 105 ASN A CB  1 
ATOM   835  C CG  . ASN A 1 113 ? -46.754 20.834  0.749   1.00 88.43  ? 105 ASN A CG  1 
ATOM   836  O OD1 . ASN A 1 113 ? -47.539 19.915  0.515   1.00 126.02 ? 105 ASN A OD1 1 
ATOM   837  N ND2 . ASN A 1 113 ? -47.085 21.885  1.488   1.00 99.16  ? 105 ASN A ND2 1 
ATOM   838  N N   . HIS A 1 114 ? -42.667 18.677  -0.940  1.00 85.55  ? 106 HIS A N   1 
ATOM   839  C CA  . HIS A 1 114 ? -41.563 18.669  -1.895  1.00 93.70  ? 106 HIS A CA  1 
ATOM   840  C C   . HIS A 1 114 ? -41.952 17.872  -3.134  1.00 96.66  ? 106 HIS A C   1 
ATOM   841  O O   . HIS A 1 114 ? -42.589 16.823  -3.033  1.00 98.85  ? 106 HIS A O   1 
ATOM   842  C CB  . HIS A 1 114 ? -40.287 18.094  -1.270  1.00 95.98  ? 106 HIS A CB  1 
ATOM   843  C CG  . HIS A 1 114 ? -40.301 16.604  -1.109  1.00 93.61  ? 106 HIS A CG  1 
ATOM   844  N ND1 . HIS A 1 114 ? -39.940 15.743  -2.122  1.00 110.00 ? 106 HIS A ND1 1 
ATOM   845  C CD2 . HIS A 1 114 ? -40.625 15.825  -0.050  1.00 90.69  ? 106 HIS A CD2 1 
ATOM   846  C CE1 . HIS A 1 114 ? -40.046 14.496  -1.696  1.00 120.07 ? 106 HIS A CE1 1 
ATOM   847  N NE2 . HIS A 1 114 ? -40.459 14.518  -0.443  1.00 107.83 ? 106 HIS A NE2 1 
ATOM   848  N N   . GLU A 1 115 ? -41.578 18.378  -4.304  1.00 91.07  ? 107 GLU A N   1 
ATOM   849  C CA  . GLU A 1 115 ? -41.841 17.665  -5.545  1.00 92.31  ? 107 GLU A CA  1 
ATOM   850  C C   . GLU A 1 115 ? -40.846 16.521  -5.712  1.00 98.98  ? 107 GLU A C   1 
ATOM   851  O O   . GLU A 1 115 ? -39.995 16.297  -4.852  1.00 103.53 ? 107 GLU A O   1 
ATOM   852  C CB  . GLU A 1 115 ? -41.779 18.612  -6.745  1.00 92.38  ? 107 GLU A CB  1 
ATOM   853  C CG  . GLU A 1 115 ? -42.908 19.631  -6.789  1.00 87.15  ? 107 GLU A CG  1 
ATOM   854  C CD  . GLU A 1 115 ? -43.073 20.261  -8.159  1.00 109.86 ? 107 GLU A CD  1 
ATOM   855  O OE1 . GLU A 1 115 ? -42.370 19.836  -9.099  1.00 127.51 ? 107 GLU A OE1 1 
ATOM   856  O OE2 . GLU A 1 115 ? -43.909 21.179  -8.297  1.00 112.88 ? 107 GLU A OE2 1 
ATOM   857  N N   . GLU A 1 116 ? -40.954 15.802  -6.823  1.00 114.36 ? 108 GLU A N   1 
ATOM   858  C CA  . GLU A 1 116 ? -40.122 14.626  -7.053  1.00 122.33 ? 108 GLU A CA  1 
ATOM   859  C C   . GLU A 1 116 ? -38.669 14.979  -7.357  1.00 133.84 ? 108 GLU A C   1 
ATOM   860  O O   . GLU A 1 116 ? -37.809 14.100  -7.400  1.00 150.78 ? 108 GLU A O   1 
ATOM   861  C CB  . GLU A 1 116 ? -40.703 13.786  -8.191  1.00 113.79 ? 108 GLU A CB  1 
ATOM   862  C CG  . GLU A 1 116 ? -41.940 12.997  -7.798  1.00 126.52 ? 108 GLU A CG  1 
ATOM   863  C CD  . GLU A 1 116 ? -41.647 11.938  -6.751  1.00 132.75 ? 108 GLU A CD  1 
ATOM   864  O OE1 . GLU A 1 116 ? -41.323 10.795  -7.137  1.00 137.09 ? 108 GLU A OE1 1 
ATOM   865  O OE2 . GLU A 1 116 ? -41.740 12.246  -5.544  1.00 128.07 ? 108 GLU A OE2 1 
ATOM   866  N N   . ASP A 1 117 ? -38.397 16.263  -7.564  1.00 124.13 ? 109 ASP A N   1 
ATOM   867  C CA  . ASP A 1 117 ? -37.032 16.717  -7.806  1.00 118.57 ? 109 ASP A CA  1 
ATOM   868  C C   . ASP A 1 117 ? -36.367 17.144  -6.501  1.00 120.00 ? 109 ASP A C   1 
ATOM   869  O O   . ASP A 1 117 ? -35.318 17.789  -6.511  1.00 128.96 ? 109 ASP A O   1 
ATOM   870  C CB  . ASP A 1 117 ? -37.016 17.866  -8.818  1.00 99.77  ? 109 ASP A CB  1 
ATOM   871  C CG  . ASP A 1 117 ? -37.824 19.062  -8.358  1.00 102.88 ? 109 ASP A CG  1 
ATOM   872  O OD1 . ASP A 1 117 ? -38.630 18.915  -7.416  1.00 118.10 ? 109 ASP A OD1 1 
ATOM   873  O OD2 . ASP A 1 117 ? -37.655 20.152  -8.944  1.00 103.73 ? 109 ASP A OD2 1 
ATOM   874  N N   . TYR A 1 118 ? -36.996 16.777  -5.385  1.00 108.22 ? 110 TYR A N   1 
ATOM   875  C CA  . TYR A 1 118 ? -36.493 17.073  -4.044  1.00 113.60 ? 110 TYR A CA  1 
ATOM   876  C C   . TYR A 1 118 ? -36.335 18.575  -3.814  1.00 110.65 ? 110 TYR A C   1 
ATOM   877  O O   . TYR A 1 118 ? -35.462 19.015  -3.065  1.00 108.01 ? 110 TYR A O   1 
ATOM   878  C CB  . TYR A 1 118 ? -35.163 16.350  -3.796  1.00 124.50 ? 110 TYR A CB  1 
ATOM   879  C CG  . TYR A 1 118 ? -35.310 14.861  -3.562  1.00 127.85 ? 110 TYR A CG  1 
ATOM   880  C CD1 . TYR A 1 118 ? -35.786 14.022  -4.563  1.00 109.41 ? 110 TYR A CD1 1 
ATOM   881  C CD2 . TYR A 1 118 ? -34.969 14.293  -2.341  1.00 144.18 ? 110 TYR A CD2 1 
ATOM   882  C CE1 . TYR A 1 118 ? -35.922 12.662  -4.352  1.00 127.61 ? 110 TYR A CE1 1 
ATOM   883  C CE2 . TYR A 1 118 ? -35.101 12.933  -2.122  1.00 152.67 ? 110 TYR A CE2 1 
ATOM   884  C CZ  . TYR A 1 118 ? -35.578 12.123  -3.131  1.00 145.18 ? 110 TYR A CZ  1 
ATOM   885  O OH  . TYR A 1 118 ? -35.711 10.770  -2.919  1.00 145.96 ? 110 TYR A OH  1 
ATOM   886  N N   . PHE A 1 119 ? -37.196 19.353  -4.463  1.00 106.95 ? 111 PHE A N   1 
ATOM   887  C CA  . PHE A 1 119 ? -37.224 20.799  -4.287  1.00 95.43  ? 111 PHE A CA  1 
ATOM   888  C C   . PHE A 1 119 ? -38.553 21.241  -3.687  1.00 78.87  ? 111 PHE A C   1 
ATOM   889  O O   . PHE A 1 119 ? -39.609 20.732  -4.058  1.00 92.78  ? 111 PHE A O   1 
ATOM   890  C CB  . PHE A 1 119 ? -36.997 21.514  -5.622  1.00 106.10 ? 111 PHE A CB  1 
ATOM   891  C CG  . PHE A 1 119 ? -35.552 21.643  -6.009  1.00 117.61 ? 111 PHE A CG  1 
ATOM   892  C CD1 . PHE A 1 119 ? -34.587 21.922  -5.056  1.00 120.27 ? 111 PHE A CD1 1 
ATOM   893  C CD2 . PHE A 1 119 ? -35.159 21.493  -7.329  1.00 123.17 ? 111 PHE A CD2 1 
ATOM   894  C CE1 . PHE A 1 119 ? -33.257 22.044  -5.412  1.00 127.05 ? 111 PHE A CE1 1 
ATOM   895  C CE2 . PHE A 1 119 ? -33.830 21.614  -7.691  1.00 123.93 ? 111 PHE A CE2 1 
ATOM   896  C CZ  . PHE A 1 119 ? -32.878 21.890  -6.731  1.00 131.06 ? 111 PHE A CZ  1 
ATOM   897  N N   . LEU A 1 120 ? -38.496 22.187  -2.756  1.00 73.38  ? 112 LEU A N   1 
ATOM   898  C CA  . LEU A 1 120 ? -39.707 22.780  -2.206  1.00 63.25  ? 112 LEU A CA  1 
ATOM   899  C C   . LEU A 1 120 ? -40.022 24.074  -2.945  1.00 61.29  ? 112 LEU A C   1 
ATOM   900  O O   . LEU A 1 120 ? -39.171 24.957  -3.057  1.00 70.81  ? 112 LEU A O   1 
ATOM   901  C CB  . LEU A 1 120 ? -39.558 23.045  -0.707  1.00 72.18  ? 112 LEU A CB  1 
ATOM   902  C CG  . LEU A 1 120 ? -40.759 23.723  -0.043  1.00 61.51  ? 112 LEU A CG  1 
ATOM   903  C CD1 . LEU A 1 120 ? -42.010 22.873  -0.208  1.00 58.89  ? 112 LEU A CD1 1 
ATOM   904  C CD2 . LEU A 1 120 ? -40.485 23.998  1.425   1.00 66.42  ? 112 LEU A CD2 1 
ATOM   905  N N   . TYR A 1 121 ? -41.245 24.182  -3.453  1.00 58.59  ? 113 TYR A N   1 
ATOM   906  C CA  . TYR A 1 121 ? -41.629 25.339  -4.251  1.00 70.90  ? 113 TYR A CA  1 
ATOM   907  C C   . TYR A 1 121 ? -42.594 26.254  -3.506  1.00 72.57  ? 113 TYR A C   1 
ATOM   908  O O   . TYR A 1 121 ? -43.702 25.853  -3.149  1.00 88.63  ? 113 TYR A O   1 
ATOM   909  C CB  . TYR A 1 121 ? -42.246 24.887  -5.576  1.00 76.11  ? 113 TYR A CB  1 
ATOM   910  C CG  . TYR A 1 121 ? -41.254 24.228  -6.509  1.00 76.77  ? 113 TYR A CG  1 
ATOM   911  C CD1 . TYR A 1 121 ? -40.530 24.979  -7.425  1.00 81.70  ? 113 TYR A CD1 1 
ATOM   912  C CD2 . TYR A 1 121 ? -41.037 22.856  -6.469  1.00 68.49  ? 113 TYR A CD2 1 
ATOM   913  C CE1 . TYR A 1 121 ? -39.620 24.384  -8.278  1.00 80.61  ? 113 TYR A CE1 1 
ATOM   914  C CE2 . TYR A 1 121 ? -40.129 22.252  -7.318  1.00 86.18  ? 113 TYR A CE2 1 
ATOM   915  C CZ  . TYR A 1 121 ? -39.423 23.021  -8.221  1.00 87.45  ? 113 TYR A CZ  1 
ATOM   916  O OH  . TYR A 1 121 ? -38.518 22.425  -9.070  1.00 83.86  ? 113 TYR A OH  1 
ATOM   917  N N   . VAL A 1 122 ? -42.157 27.488  -3.277  1.00 65.26  ? 114 VAL A N   1 
ATOM   918  C CA  . VAL A 1 122 ? -42.970 28.483  -2.591  1.00 67.81  ? 114 VAL A CA  1 
ATOM   919  C C   . VAL A 1 122 ? -43.275 29.661  -3.511  1.00 65.00  ? 114 VAL A C   1 
ATOM   920  O O   . VAL A 1 122 ? -42.363 30.288  -4.048  1.00 75.87  ? 114 VAL A O   1 
ATOM   921  C CB  . VAL A 1 122 ? -42.270 29.004  -1.316  1.00 65.97  ? 114 VAL A CB  1 
ATOM   922  C CG1 . VAL A 1 122 ? -43.099 30.099  -0.660  1.00 50.82  ? 114 VAL A CG1 1 
ATOM   923  C CG2 . VAL A 1 122 ? -42.014 27.864  -0.341  1.00 47.02  ? 114 VAL A CG2 1 
ATOM   924  N N   . ALA A 1 123 ? -44.558 29.953  -3.697  1.00 68.69  ? 115 ALA A N   1 
ATOM   925  C CA  . ALA A 1 123 ? -44.971 31.099  -4.500  1.00 67.80  ? 115 ALA A CA  1 
ATOM   926  C C   . ALA A 1 123 ? -45.562 32.186  -3.610  1.00 71.53  ? 115 ALA A C   1 
ATOM   927  O O   . ALA A 1 123 ? -46.237 31.888  -2.626  1.00 77.18  ? 115 ALA A O   1 
ATOM   928  C CB  . ALA A 1 123 ? -45.974 30.676  -5.561  1.00 51.40  ? 115 ALA A CB  1 
ATOM   929  N N   . TYR A 1 124 ? -45.309 33.446  -3.953  1.00 76.23  ? 116 TYR A N   1 
ATOM   930  C CA  . TYR A 1 124 ? -45.820 34.554  -3.154  1.00 66.09  ? 116 TYR A CA  1 
ATOM   931  C C   . TYR A 1 124 ? -46.617 35.560  -3.984  1.00 73.25  ? 116 TYR A C   1 
ATOM   932  O O   . TYR A 1 124 ? -46.300 35.818  -5.145  1.00 78.27  ? 116 TYR A O   1 
ATOM   933  C CB  . TYR A 1 124 ? -44.673 35.261  -2.420  1.00 76.80  ? 116 TYR A CB  1 
ATOM   934  C CG  . TYR A 1 124 ? -43.651 35.934  -3.311  1.00 74.90  ? 116 TYR A CG  1 
ATOM   935  C CD1 . TYR A 1 124 ? -42.547 35.237  -3.788  1.00 85.40  ? 116 TYR A CD1 1 
ATOM   936  C CD2 . TYR A 1 124 ? -43.776 37.273  -3.656  1.00 77.89  ? 116 TYR A CD2 1 
ATOM   937  C CE1 . TYR A 1 124 ? -41.606 35.855  -4.595  1.00 101.57 ? 116 TYR A CE1 1 
ATOM   938  C CE2 . TYR A 1 124 ? -42.841 37.895  -4.460  1.00 88.59  ? 116 TYR A CE2 1 
ATOM   939  C CZ  . TYR A 1 124 ? -41.761 37.184  -4.928  1.00 92.15  ? 116 TYR A CZ  1 
ATOM   940  O OH  . TYR A 1 124 ? -40.834 37.811  -5.730  1.00 78.50  ? 116 TYR A OH  1 
ATOM   941  N N   . SER A 1 125 ? -47.655 36.119  -3.369  1.00 84.52  ? 117 SER A N   1 
ATOM   942  C CA  . SER A 1 125 ? -48.526 37.092  -4.021  1.00 86.37  ? 117 SER A CA  1 
ATOM   943  C C   . SER A 1 125 ? -49.046 38.112  -3.010  1.00 84.80  ? 117 SER A C   1 
ATOM   944  O O   . SER A 1 125 ? -48.751 38.018  -1.820  1.00 81.10  ? 117 SER A O   1 
ATOM   945  C CB  . SER A 1 125 ? -49.697 36.389  -4.710  1.00 92.05  ? 117 SER A CB  1 
ATOM   946  O OG  . SER A 1 125 ? -50.590 37.325  -5.287  1.00 86.98  ? 117 SER A OG  1 
ATOM   947  N N   . ASP A 1 126 ? -49.818 39.084  -3.487  1.00 101.34 ? 118 ASP A N   1 
ATOM   948  C CA  . ASP A 1 126 ? -50.408 40.087  -2.605  1.00 97.90  ? 118 ASP A CA  1 
ATOM   949  C C   . ASP A 1 126 ? -51.874 39.766  -2.326  1.00 94.67  ? 118 ASP A C   1 
ATOM   950  O O   . ASP A 1 126 ? -52.513 40.402  -1.487  1.00 82.16  ? 118 ASP A O   1 
ATOM   951  C CB  . ASP A 1 126 ? -50.273 41.489  -3.209  1.00 107.00 ? 118 ASP A CB  1 
ATOM   952  C CG  . ASP A 1 126 ? -51.005 41.632  -4.530  1.00 115.31 ? 118 ASP A CG  1 
ATOM   953  O OD1 . ASP A 1 126 ? -51.049 40.648  -5.298  1.00 112.25 ? 118 ASP A OD1 1 
ATOM   954  O OD2 . ASP A 1 126 ? -51.533 42.731  -4.802  1.00 115.70 ? 118 ASP A OD2 1 
ATOM   955  N N   . GLU A 1 127 ? -52.397 38.772  -3.037  1.00 109.02 ? 119 GLU A N   1 
ATOM   956  C CA  . GLU A 1 127 ? -53.757 38.292  -2.821  1.00 106.12 ? 119 GLU A CA  1 
ATOM   957  C C   . GLU A 1 127 ? -53.751 36.774  -2.683  1.00 107.95 ? 119 GLU A C   1 
ATOM   958  O O   . GLU A 1 127 ? -52.699 36.144  -2.783  1.00 120.55 ? 119 GLU A O   1 
ATOM   959  C CB  . GLU A 1 127 ? -54.675 38.723  -3.967  1.00 100.16 ? 119 GLU A CB  1 
ATOM   960  N N   . SER A 1 128 ? -54.921 36.188  -2.456  1.00 112.10 ? 120 SER A N   1 
ATOM   961  C CA  . SER A 1 128 ? -55.019 34.741  -2.301  1.00 116.40 ? 120 SER A CA  1 
ATOM   962  C C   . SER A 1 128 ? -55.576 34.068  -3.556  1.00 127.98 ? 120 SER A C   1 
ATOM   963  O O   . SER A 1 128 ? -56.786 33.883  -3.687  1.00 124.30 ? 120 SER A O   1 
ATOM   964  C CB  . SER A 1 128 ? -55.885 34.390  -1.089  1.00 105.04 ? 120 SER A CB  1 
ATOM   965  O OG  . SER A 1 128 ? -57.258 34.601  -1.363  1.00 131.30 ? 120 SER A OG  1 
ATOM   966  N N   . VAL A 1 129 ? -54.685 33.704  -4.474  1.00 119.24 ? 121 VAL A N   1 
ATOM   967  C CA  . VAL A 1 129 ? -55.079 33.013  -5.698  1.00 124.81 ? 121 VAL A CA  1 
ATOM   968  C C   . VAL A 1 129 ? -54.467 31.617  -5.759  1.00 111.35 ? 121 VAL A C   1 
ATOM   969  O O   . VAL A 1 129 ? -55.161 30.616  -5.578  1.00 105.94 ? 121 VAL A O   1 
ATOM   970  C CB  . VAL A 1 129 ? -54.661 33.799  -6.957  1.00 130.87 ? 121 VAL A CB  1 
ATOM   971  C CG1 . VAL A 1 129 ? -53.146 33.921  -7.029  1.00 132.41 ? 121 VAL A CG1 1 
ATOM   972  C CG2 . VAL A 1 129 ? -55.204 33.122  -8.209  1.00 101.34 ? 121 VAL A CG2 1 
ATOM   973  N N   . ASP B 1 9   ? -47.202 -8.837  10.868  1.00 149.42 ? 1   ASP B N   1 
ATOM   974  C CA  . ASP B 1 9   ? -46.086 -8.272  10.118  1.00 154.19 ? 1   ASP B CA  1 
ATOM   975  C C   . ASP B 1 9   ? -46.492 -8.065  8.661   1.00 155.35 ? 1   ASP B C   1 
ATOM   976  O O   . ASP B 1 9   ? -47.596 -8.435  8.267   1.00 156.74 ? 1   ASP B O   1 
ATOM   977  C CB  . ASP B 1 9   ? -44.860 -9.179  10.214  1.00 164.27 ? 1   ASP B CB  1 
ATOM   978  C CG  . ASP B 1 9   ? -43.575 -8.459  9.862   1.00 166.03 ? 1   ASP B CG  1 
ATOM   979  O OD1 . ASP B 1 9   ? -43.186 -8.486  8.676   1.00 157.67 ? 1   ASP B OD1 1 
ATOM   980  O OD2 . ASP B 1 9   ? -42.959 -7.863  10.770  1.00 169.40 ? 1   ASP B OD2 1 
ATOM   981  N N   . GLU B 1 10  ? -45.613 -7.477  7.857   1.00 148.83 ? 2   GLU B N   1 
ATOM   982  C CA  . GLU B 1 10  ? -45.972 -7.205  6.475   1.00 137.95 ? 2   GLU B CA  1 
ATOM   983  C C   . GLU B 1 10  ? -45.323 -8.165  5.490   1.00 136.65 ? 2   GLU B C   1 
ATOM   984  O O   . GLU B 1 10  ? -44.194 -8.627  5.682   1.00 137.59 ? 2   GLU B O   1 
ATOM   985  C CB  . GLU B 1 10  ? -45.618 -5.762  6.096   1.00 136.07 ? 2   GLU B CB  1 
ATOM   986  C CG  . GLU B 1 10  ? -46.696 -4.703  6.403   1.00 150.89 ? 2   GLU B CG  1 
ATOM   987  C CD  . GLU B 1 10  ? -48.057 -4.939  5.732   1.00 162.89 ? 2   GLU B CD  1 
ATOM   988  O OE1 . GLU B 1 10  ? -48.336 -6.047  5.225   1.00 167.80 ? 2   GLU B OE1 1 
ATOM   989  O OE2 . GLU B 1 10  ? -48.863 -3.985  5.707   1.00 163.82 ? 2   GLU B OE2 1 
ATOM   990  N N   . TRP B 1 11  ? -46.067 -8.442  4.425   1.00 130.52 ? 3   TRP B N   1 
ATOM   991  C CA  . TRP B 1 11  ? -45.638 -9.332  3.362   1.00 112.34 ? 3   TRP B CA  1 
ATOM   992  C C   . TRP B 1 11  ? -44.758 -8.609  2.356   1.00 111.31 ? 3   TRP B C   1 
ATOM   993  O O   . TRP B 1 11  ? -45.031 -7.468  1.980   1.00 110.97 ? 3   TRP B O   1 
ATOM   994  C CB  . TRP B 1 11  ? -46.855 -9.922  2.651   1.00 109.48 ? 3   TRP B CB  1 
ATOM   995  C CG  . TRP B 1 11  ? -47.682 -10.813 3.516   1.00 119.25 ? 3   TRP B CG  1 
ATOM   996  C CD1 . TRP B 1 11  ? -48.817 -10.479 4.200   1.00 125.28 ? 3   TRP B CD1 1 
ATOM   997  C CD2 . TRP B 1 11  ? -47.437 -12.193 3.795   1.00 131.33 ? 3   TRP B CD2 1 
ATOM   998  N NE1 . TRP B 1 11  ? -49.293 -11.571 4.886   1.00 133.59 ? 3   TRP B NE1 1 
ATOM   999  C CE2 . TRP B 1 11  ? -48.463 -12.635 4.653   1.00 131.80 ? 3   TRP B CE2 1 
ATOM   1000 C CE3 . TRP B 1 11  ? -46.449 -13.099 3.400   1.00 131.06 ? 3   TRP B CE3 1 
ATOM   1001 C CZ2 . TRP B 1 11  ? -48.527 -13.944 5.123   1.00 136.18 ? 3   TRP B CZ2 1 
ATOM   1002 C CZ3 . TRP B 1 11  ? -46.514 -14.394 3.867   1.00 128.62 ? 3   TRP B CZ3 1 
ATOM   1003 C CH2 . TRP B 1 11  ? -47.545 -14.806 4.719   1.00 143.28 ? 3   TRP B CH2 1 
ATOM   1004 N N   . VAL B 1 12  ? -43.700 -9.283  1.922   1.00 112.95 ? 4   VAL B N   1 
ATOM   1005 C CA  . VAL B 1 12  ? -42.861 -8.772  0.848   1.00 110.11 ? 4   VAL B CA  1 
ATOM   1006 C C   . VAL B 1 12  ? -43.446 -9.207  -0.488  1.00 115.98 ? 4   VAL B C   1 
ATOM   1007 O O   . VAL B 1 12  ? -43.371 -10.379 -0.864  1.00 107.59 ? 4   VAL B O   1 
ATOM   1008 C CB  . VAL B 1 12  ? -41.409 -9.264  0.971   1.00 108.32 ? 4   VAL B CB  1 
ATOM   1009 C CG1 . VAL B 1 12  ? -40.588 -8.820  -0.233  1.00 97.06  ? 4   VAL B CG1 1 
ATOM   1010 C CG2 . VAL B 1 12  ? -40.785 -8.761  2.260   1.00 120.60 ? 4   VAL B CG2 1 
ATOM   1011 N N   . ASN B 1 13  ? -44.050 -8.256  -1.190  1.00 121.67 ? 5   ASN B N   1 
ATOM   1012 C CA  . ASN B 1 13  ? -44.678 -8.530  -2.475  1.00 116.80 ? 5   ASN B CA  1 
ATOM   1013 C C   . ASN B 1 13  ? -43.646 -8.711  -3.588  1.00 109.33 ? 5   ASN B C   1 
ATOM   1014 O O   . ASN B 1 13  ? -42.594 -8.068  -3.581  1.00 106.85 ? 5   ASN B O   1 
ATOM   1015 C CB  . ASN B 1 13  ? -45.657 -7.399  -2.824  1.00 122.29 ? 5   ASN B CB  1 
ATOM   1016 C CG  . ASN B 1 13  ? -46.322 -7.583  -4.181  1.00 124.82 ? 5   ASN B CG  1 
ATOM   1017 O OD1 . ASN B 1 13  ? -46.850 -8.652  -4.491  1.00 133.61 ? 5   ASN B OD1 1 
ATOM   1018 N ND2 . ASN B 1 13  ? -46.321 -6.527  -4.986  1.00 113.04 ? 5   ASN B ND2 1 
ATOM   1019 N N   . VAL B 1 14  ? -43.941 -9.606  -4.528  1.00 103.88 ? 6   VAL B N   1 
ATOM   1020 C CA  . VAL B 1 14  ? -43.096 -9.819  -5.700  1.00 106.15 ? 6   VAL B CA  1 
ATOM   1021 C C   . VAL B 1 14  ? -43.956 -9.478  -6.934  1.00 124.18 ? 6   VAL B C   1 
ATOM   1022 O O   . VAL B 1 14  ? -44.005 -10.212 -7.925  1.00 120.87 ? 6   VAL B O   1 
ATOM   1023 C CB  . VAL B 1 14  ? -42.547 -11.273 -5.764  1.00 116.80 ? 6   VAL B CB  1 
ATOM   1024 C CG1 . VAL B 1 14  ? -41.523 -11.418 -6.894  1.00 114.82 ? 6   VAL B CG1 1 
ATOM   1025 C CG2 . VAL B 1 14  ? -41.895 -11.648 -4.443  1.00 99.50  ? 6   VAL B CG2 1 
ATOM   1026 N N   . GLY B 1 15  ? -44.654 -8.352  -6.850  1.00 136.65 ? 7   GLY B N   1 
ATOM   1027 C CA  . GLY B 1 15  ? -45.477 -7.886  -7.944  1.00 125.26 ? 7   GLY B CA  1 
ATOM   1028 C C   . GLY B 1 15  ? -44.660 -7.119  -8.976  1.00 139.60 ? 7   GLY B C   1 
ATOM   1029 O O   . GLY B 1 15  ? -43.445 -7.039  -8.810  1.00 151.38 ? 7   GLY B O   1 
ATOM   1030 N N   . SER B 1 16  ? -45.256 -6.553  -10.035 1.00 145.01 ? 8   SER B N   1 
ATOM   1031 C CA  . SER B 1 16  ? -46.693 -6.515  -10.339 1.00 132.80 ? 8   SER B CA  1 
ATOM   1032 C C   . SER B 1 16  ? -47.528 -6.009  -9.169  1.00 131.79 ? 8   SER B C   1 
ATOM   1033 O O   . SER B 1 16  ? -48.476 -6.673  -8.746  1.00 124.61 ? 8   SER B O   1 
ATOM   1034 C CB  . SER B 1 16  ? -47.192 -7.895  -10.793 1.00 117.99 ? 8   SER B CB  1 
ATOM   1035 O OG  . SER B 1 16  ? -48.589 -7.879  -11.018 1.00 122.54 ? 8   SER B OG  1 
ATOM   1036 N N   . LYS B 1 17  ? -47.148 -4.842  -8.654  1.00 125.98 ? 9   LYS B N   1 
ATOM   1037 C CA  . LYS B 1 17  ? -47.687 -4.311  -7.403  1.00 109.57 ? 9   LYS B CA  1 
ATOM   1038 C C   . LYS B 1 17  ? -49.207 -4.376  -7.346  1.00 106.39 ? 9   LYS B C   1 
ATOM   1039 O O   . LYS B 1 17  ? -49.889 -4.005  -8.300  1.00 101.92 ? 9   LYS B O   1 
ATOM   1040 C CB  . LYS B 1 17  ? -47.224 -2.867  -7.194  1.00 86.36  ? 9   LYS B CB  1 
ATOM   1041 N N   . PHE B 1 18  ? -49.726 -4.873  -6.228  1.00 121.13 ? 10  PHE B N   1 
ATOM   1042 C CA  . PHE B 1 18  ? -51.163 -5.021  -6.051  1.00 124.31 ? 10  PHE B CA  1 
ATOM   1043 C C   . PHE B 1 18  ? -51.844 -3.663  -6.139  1.00 119.80 ? 10  PHE B C   1 
ATOM   1044 O O   . PHE B 1 18  ? -51.275 -2.648  -5.735  1.00 106.18 ? 10  PHE B O   1 
ATOM   1045 C CB  . PHE B 1 18  ? -51.476 -5.694  -4.713  1.00 116.37 ? 10  PHE B CB  1 
ATOM   1046 N N   . GLN B 1 19  ? -53.056 -3.649  -6.683  1.00 125.07 ? 11  GLN B N   1 
ATOM   1047 C CA  . GLN B 1 19  ? -53.805 -2.410  -6.841  1.00 114.82 ? 11  GLN B CA  1 
ATOM   1048 C C   . GLN B 1 19  ? -54.142 -1.799  -5.485  1.00 107.37 ? 11  GLN B C   1 
ATOM   1049 O O   . GLN B 1 19  ? -54.078 -2.472  -4.456  1.00 108.35 ? 11  GLN B O   1 
ATOM   1050 C CB  . GLN B 1 19  ? -55.079 -2.654  -7.651  1.00 121.70 ? 11  GLN B CB  1 
ATOM   1051 C CG  . GLN B 1 19  ? -54.816 -3.045  -9.097  1.00 132.41 ? 11  GLN B CG  1 
ATOM   1052 C CD  . GLN B 1 19  ? -56.067 -2.999  -9.952  1.00 137.85 ? 11  GLN B CD  1 
ATOM   1053 O OE1 . GLN B 1 19  ? -57.024 -3.737  -9.715  1.00 132.20 ? 11  GLN B OE1 1 
ATOM   1054 N NE2 . GLN B 1 19  ? -56.065 -2.128  -10.955 1.00 136.60 ? 11  GLN B NE2 1 
ATOM   1055 N N   . TYR B 1 20  ? -54.500 -0.519  -5.494  1.00 98.95  ? 12  TYR B N   1 
ATOM   1056 C CA  . TYR B 1 20  ? -54.693 0.233   -4.260  1.00 84.86  ? 12  TYR B CA  1 
ATOM   1057 C C   . TYR B 1 20  ? -55.862 -0.284  -3.425  1.00 94.09  ? 12  TYR B C   1 
ATOM   1058 O O   . TYR B 1 20  ? -55.803 -0.273  -2.196  1.00 105.67 ? 12  TYR B O   1 
ATOM   1059 C CB  . TYR B 1 20  ? -54.897 1.715   -4.573  1.00 80.57  ? 12  TYR B CB  1 
ATOM   1060 C CG  . TYR B 1 20  ? -55.016 2.581   -3.342  1.00 93.51  ? 12  TYR B CG  1 
ATOM   1061 C CD1 . TYR B 1 20  ? -53.906 2.856   -2.554  1.00 104.75 ? 12  TYR B CD1 1 
ATOM   1062 C CD2 . TYR B 1 20  ? -56.237 3.125   -2.967  1.00 101.64 ? 12  TYR B CD2 1 
ATOM   1063 C CE1 . TYR B 1 20  ? -54.009 3.646   -1.425  1.00 102.05 ? 12  TYR B CE1 1 
ATOM   1064 C CE2 . TYR B 1 20  ? -56.349 3.918   -1.842  1.00 107.30 ? 12  TYR B CE2 1 
ATOM   1065 C CZ  . TYR B 1 20  ? -55.233 4.175   -1.074  1.00 105.61 ? 12  TYR B CZ  1 
ATOM   1066 O OH  . TYR B 1 20  ? -55.342 4.963   0.049   1.00 111.94 ? 12  TYR B OH  1 
ATOM   1067 N N   . LYS B 1 21  ? -56.921 -0.736  -4.088  1.00 95.03  ? 13  LYS B N   1 
ATOM   1068 C CA  . LYS B 1 21  ? -58.081 -1.262  -3.377  1.00 97.99  ? 13  LYS B CA  1 
ATOM   1069 C C   . LYS B 1 21  ? -57.859 -2.707  -2.943  1.00 107.39 ? 13  LYS B C   1 
ATOM   1070 O O   . LYS B 1 21  ? -58.606 -3.240  -2.122  1.00 105.87 ? 13  LYS B O   1 
ATOM   1071 C CB  . LYS B 1 21  ? -59.339 -1.165  -4.241  1.00 95.00  ? 13  LYS B CB  1 
ATOM   1072 C CG  . LYS B 1 21  ? -59.367 0.027   -5.178  1.00 107.23 ? 13  LYS B CG  1 
ATOM   1073 C CD  . LYS B 1 21  ? -60.772 0.256   -5.707  1.00 116.09 ? 13  LYS B CD  1 
ATOM   1074 C CE  . LYS B 1 21  ? -60.750 0.847   -7.105  1.00 124.87 ? 13  LYS B CE  1 
ATOM   1075 N NZ  . LYS B 1 21  ? -62.090 1.362   -7.502  1.00 131.20 ? 13  LYS B NZ  1 
ATOM   1076 N N   . GLU B 1 22  ? -56.828 -3.336  -3.498  1.00 112.36 ? 14  GLU B N   1 
ATOM   1077 C CA  . GLU B 1 22  ? -56.490 -4.708  -3.141  1.00 114.33 ? 14  GLU B CA  1 
ATOM   1078 C C   . GLU B 1 22  ? -55.740 -4.751  -1.813  1.00 122.60 ? 14  GLU B C   1 
ATOM   1079 O O   . GLU B 1 22  ? -55.898 -5.687  -1.029  1.00 125.03 ? 14  GLU B O   1 
ATOM   1080 C CB  . GLU B 1 22  ? -55.655 -5.362  -4.245  1.00 89.93  ? 14  GLU B CB  1 
ATOM   1081 N N   . ASP B 1 23  ? -54.925 -3.729  -1.569  1.00 115.67 ? 15  ASP B N   1 
ATOM   1082 C CA  . ASP B 1 23  ? -54.157 -3.636  -0.333  1.00 110.48 ? 15  ASP B CA  1 
ATOM   1083 C C   . ASP B 1 23  ? -55.009 -3.123  0.823   1.00 116.50 ? 15  ASP B C   1 
ATOM   1084 O O   . ASP B 1 23  ? -55.093 -3.756  1.875   1.00 130.15 ? 15  ASP B O   1 
ATOM   1085 C CB  . ASP B 1 23  ? -52.944 -2.721  -0.520  1.00 114.24 ? 15  ASP B CB  1 
ATOM   1086 C CG  . ASP B 1 23  ? -51.887 -3.328  -1.420  1.00 125.79 ? 15  ASP B CG  1 
ATOM   1087 O OD1 . ASP B 1 23  ? -51.832 -4.572  -1.519  1.00 141.03 ? 15  ASP B OD1 1 
ATOM   1088 O OD2 . ASP B 1 23  ? -51.109 -2.561  -2.026  1.00 115.08 ? 15  ASP B OD2 1 
ATOM   1089 N N   . HIS B 1 24  ? -55.640 -1.972  0.617   1.00 112.50 ? 16  HIS B N   1 
ATOM   1090 C CA  . HIS B 1 24  ? -56.371 -1.299  1.683   1.00 111.98 ? 16  HIS B CA  1 
ATOM   1091 C C   . HIS B 1 24  ? -57.883 -1.444  1.535   1.00 107.26 ? 16  HIS B C   1 
ATOM   1092 O O   . HIS B 1 24  ? -58.416 -1.339  0.430   1.00 96.41  ? 16  HIS B O   1 
ATOM   1093 C CB  . HIS B 1 24  ? -55.992 0.182   1.719   1.00 105.58 ? 16  HIS B CB  1 
ATOM   1094 C CG  . HIS B 1 24  ? -54.516 0.427   1.712   1.00 116.10 ? 16  HIS B CG  1 
ATOM   1095 N ND1 . HIS B 1 24  ? -53.733 0.296   2.840   1.00 129.08 ? 16  HIS B ND1 1 
ATOM   1096 C CD2 . HIS B 1 24  ? -53.677 0.791   0.714   1.00 116.58 ? 16  HIS B CD2 1 
ATOM   1097 C CE1 . HIS B 1 24  ? -52.478 0.571   2.537   1.00 133.91 ? 16  HIS B CE1 1 
ATOM   1098 N NE2 . HIS B 1 24  ? -52.416 0.875   1.253   1.00 128.18 ? 16  HIS B NE2 1 
ATOM   1099 N N   . PRO B 1 25  ? -58.578 -1.694  2.656   1.00 127.47 ? 17  PRO B N   1 
ATOM   1100 C CA  . PRO B 1 25  ? -60.042 -1.784  2.681   1.00 134.93 ? 17  PRO B CA  1 
ATOM   1101 C C   . PRO B 1 25  ? -60.703 -0.409  2.610   1.00 129.10 ? 17  PRO B C   1 
ATOM   1102 O O   . PRO B 1 25  ? -60.019 0.608   2.716   1.00 111.82 ? 17  PRO B O   1 
ATOM   1103 C CB  . PRO B 1 25  ? -60.326 -2.460  4.023   1.00 145.32 ? 17  PRO B CB  1 
ATOM   1104 C CG  . PRO B 1 25  ? -59.180 -2.063  4.882   1.00 152.00 ? 17  PRO B CG  1 
ATOM   1105 C CD  . PRO B 1 25  ? -57.985 -1.995  3.971   1.00 140.26 ? 17  PRO B CD  1 
ATOM   1106 N N   . PHE B 1 26  ? -62.022 -0.391  2.441   1.00 135.21 ? 18  PHE B N   1 
ATOM   1107 C CA  . PHE B 1 26  ? -62.768 0.854   2.277   1.00 137.98 ? 18  PHE B CA  1 
ATOM   1108 C C   . PHE B 1 26  ? -62.691 1.751   3.511   1.00 141.47 ? 18  PHE B C   1 
ATOM   1109 O O   . PHE B 1 26  ? -62.735 2.976   3.398   1.00 132.25 ? 18  PHE B O   1 
ATOM   1110 C CB  . PHE B 1 26  ? -64.231 0.548   1.944   1.00 144.74 ? 18  PHE B CB  1 
ATOM   1111 C CG  . PHE B 1 26  ? -65.083 1.773   1.762   1.00 130.44 ? 18  PHE B CG  1 
ATOM   1112 C CD1 . PHE B 1 26  ? -65.001 2.524   0.601   1.00 114.70 ? 18  PHE B CD1 1 
ATOM   1113 C CD2 . PHE B 1 26  ? -65.973 2.168   2.748   1.00 119.69 ? 18  PHE B CD2 1 
ATOM   1114 C CE1 . PHE B 1 26  ? -65.785 3.649   0.429   1.00 109.83 ? 18  PHE B CE1 1 
ATOM   1115 C CE2 . PHE B 1 26  ? -66.760 3.292   2.583   1.00 111.80 ? 18  PHE B CE2 1 
ATOM   1116 C CZ  . PHE B 1 26  ? -66.665 4.033   1.422   1.00 120.80 ? 18  PHE B CZ  1 
ATOM   1117 N N   . GLU B 1 27  ? -62.575 1.138   4.686   1.00 152.54 ? 19  GLU B N   1 
ATOM   1118 C CA  . GLU B 1 27  ? -62.515 1.887   5.938   1.00 145.48 ? 19  GLU B CA  1 
ATOM   1119 C C   . GLU B 1 27  ? -61.233 2.711   6.040   1.00 138.36 ? 19  GLU B C   1 
ATOM   1120 O O   . GLU B 1 27  ? -61.263 3.873   6.444   1.00 130.91 ? 19  GLU B O   1 
ATOM   1121 C CB  . GLU B 1 27  ? -62.626 0.938   7.134   1.00 127.14 ? 19  GLU B CB  1 
ATOM   1122 N N   . TYR B 1 28  ? -60.111 2.101   5.671   1.00 132.47 ? 20  TYR B N   1 
ATOM   1123 C CA  . TYR B 1 28  ? -58.820 2.783   5.701   1.00 125.19 ? 20  TYR B CA  1 
ATOM   1124 C C   . TYR B 1 28  ? -58.724 3.827   4.594   1.00 124.52 ? 20  TYR B C   1 
ATOM   1125 O O   . TYR B 1 28  ? -58.132 4.891   4.780   1.00 116.56 ? 20  TYR B O   1 
ATOM   1126 C CB  . TYR B 1 28  ? -57.677 1.771   5.573   1.00 117.51 ? 20  TYR B CB  1 
ATOM   1127 C CG  . TYR B 1 28  ? -56.304 2.397   5.443   1.00 129.64 ? 20  TYR B CG  1 
ATOM   1128 C CD1 . TYR B 1 28  ? -55.578 2.767   6.567   1.00 141.53 ? 20  TYR B CD1 1 
ATOM   1129 C CD2 . TYR B 1 28  ? -55.731 2.610   4.195   1.00 134.28 ? 20  TYR B CD2 1 
ATOM   1130 C CE1 . TYR B 1 28  ? -54.322 3.337   6.451   1.00 144.10 ? 20  TYR B CE1 1 
ATOM   1131 C CE2 . TYR B 1 28  ? -54.479 3.180   4.069   1.00 132.74 ? 20  TYR B CE2 1 
ATOM   1132 C CZ  . TYR B 1 28  ? -53.778 3.541   5.199   1.00 135.44 ? 20  TYR B CZ  1 
ATOM   1133 O OH  . TYR B 1 28  ? -52.530 4.108   5.075   1.00 125.98 ? 20  TYR B OH  1 
ATOM   1134 N N   . ARG B 1 29  ? -59.307 3.511   3.442   1.00 122.06 ? 21  ARG B N   1 
ATOM   1135 C CA  . ARG B 1 29  ? -59.258 4.392   2.279   1.00 108.72 ? 21  ARG B CA  1 
ATOM   1136 C C   . ARG B 1 29  ? -60.015 5.696   2.506   1.00 100.83 ? 21  ARG B C   1 
ATOM   1137 O O   . ARG B 1 29  ? -59.504 6.775   2.206   1.00 93.42  ? 21  ARG B O   1 
ATOM   1138 C CB  . ARG B 1 29  ? -59.817 3.673   1.050   1.00 118.77 ? 21  ARG B CB  1 
ATOM   1139 C CG  . ARG B 1 29  ? -58.806 2.788   0.340   1.00 111.65 ? 21  ARG B CG  1 
ATOM   1140 C CD  . ARG B 1 29  ? -59.473 1.584   -0.300  1.00 106.43 ? 21  ARG B CD  1 
ATOM   1141 N NE  . ARG B 1 29  ? -60.586 1.955   -1.168  1.00 111.52 ? 21  ARG B NE  1 
ATOM   1142 C CZ  . ARG B 1 29  ? -61.377 1.078   -1.777  1.00 125.05 ? 21  ARG B CZ  1 
ATOM   1143 N NH1 . ARG B 1 29  ? -61.179 -0.223  -1.610  1.00 128.95 ? 21  ARG B NH1 1 
ATOM   1144 N NH2 . ARG B 1 29  ? -62.368 1.500   -2.550  1.00 130.67 ? 21  ARG B NH2 1 
ATOM   1145 N N   . LYS B 1 30  ? -61.232 5.593   3.033   1.00 113.76 ? 22  LYS B N   1 
ATOM   1146 C CA  . LYS B 1 30  ? -62.053 6.771   3.286   1.00 109.09 ? 22  LYS B CA  1 
ATOM   1147 C C   . LYS B 1 30  ? -61.402 7.675   4.325   1.00 116.48 ? 22  LYS B C   1 
ATOM   1148 O O   . LYS B 1 30  ? -61.488 8.897   4.233   1.00 114.60 ? 22  LYS B O   1 
ATOM   1149 C CB  . LYS B 1 30  ? -63.457 6.368   3.743   1.00 104.52 ? 22  LYS B CB  1 
ATOM   1150 C CG  . LYS B 1 30  ? -64.417 7.540   3.908   1.00 102.10 ? 22  LYS B CG  1 
ATOM   1151 C CD  . LYS B 1 30  ? -65.807 7.072   4.310   1.00 109.16 ? 22  LYS B CD  1 
ATOM   1152 N N   . LYS B 1 31  ? -60.744 7.066   5.307   1.00 126.95 ? 23  LYS B N   1 
ATOM   1153 C CA  . LYS B 1 31  ? -60.084 7.815   6.372   1.00 131.81 ? 23  LYS B CA  1 
ATOM   1154 C C   . LYS B 1 31  ? -58.928 8.658   5.837   1.00 123.31 ? 23  LYS B C   1 
ATOM   1155 O O   . LYS B 1 31  ? -58.714 9.785   6.283   1.00 120.37 ? 23  LYS B O   1 
ATOM   1156 C CB  . LYS B 1 31  ? -59.578 6.862   7.458   1.00 136.38 ? 23  LYS B CB  1 
ATOM   1157 N N   . GLU B 1 32  ? -58.189 8.108   4.879   1.00 128.07 ? 24  GLU B N   1 
ATOM   1158 C CA  . GLU B 1 32  ? -57.054 8.813   4.293   1.00 127.28 ? 24  GLU B CA  1 
ATOM   1159 C C   . GLU B 1 32  ? -57.524 9.908   3.338   1.00 116.84 ? 24  GLU B C   1 
ATOM   1160 O O   . GLU B 1 32  ? -56.942 10.991  3.289   1.00 123.60 ? 24  GLU B O   1 
ATOM   1161 C CB  . GLU B 1 32  ? -56.130 7.834   3.565   1.00 120.27 ? 24  GLU B CB  1 
ATOM   1162 C CG  . GLU B 1 32  ? -54.788 8.428   3.161   1.00 112.04 ? 24  GLU B CG  1 
ATOM   1163 C CD  . GLU B 1 32  ? -53.854 7.399   2.553   1.00 111.87 ? 24  GLU B CD  1 
ATOM   1164 O OE1 . GLU B 1 32  ? -54.274 6.234   2.392   1.00 116.61 ? 24  GLU B OE1 1 
ATOM   1165 O OE2 . GLU B 1 32  ? -52.697 7.754   2.241   1.00 109.73 ? 24  GLU B OE2 1 
ATOM   1166 N N   . GLY B 1 33  ? -58.580 9.618   2.582   1.00 96.54  ? 25  GLY B N   1 
ATOM   1167 C CA  . GLY B 1 33  ? -59.157 10.588  1.669   1.00 91.08  ? 25  GLY B CA  1 
ATOM   1168 C C   . GLY B 1 33  ? -59.872 11.706  2.405   1.00 104.84 ? 25  GLY B C   1 
ATOM   1169 O O   . GLY B 1 33  ? -59.861 12.858  1.968   1.00 89.97  ? 25  GLY B O   1 
ATOM   1170 N N   . GLU B 1 34  ? -60.497 11.356  3.526   1.00 111.20 ? 26  GLU B N   1 
ATOM   1171 C CA  . GLU B 1 34  ? -61.168 12.326  4.384   1.00 101.99 ? 26  GLU B CA  1 
ATOM   1172 C C   . GLU B 1 34  ? -60.194 13.386  4.878   1.00 106.99 ? 26  GLU B C   1 
ATOM   1173 O O   . GLU B 1 34  ? -60.471 14.584  4.815   1.00 100.46 ? 26  GLU B O   1 
ATOM   1174 C CB  . GLU B 1 34  ? -61.810 11.627  5.586   1.00 129.00 ? 26  GLU B CB  1 
ATOM   1175 C CG  . GLU B 1 34  ? -63.326 11.699  5.646   1.00 139.31 ? 26  GLU B CG  1 
ATOM   1176 C CD  . GLU B 1 34  ? -63.884 11.050  6.901   1.00 139.79 ? 26  GLU B CD  1 
ATOM   1177 O OE1 . GLU B 1 34  ? -64.074 9.816   6.901   1.00 123.67 ? 26  GLU B OE1 1 
ATOM   1178 O OE2 . GLU B 1 34  ? -64.127 11.775  7.889   1.00 150.80 ? 26  GLU B OE2 1 
ATOM   1179 N N   . LYS B 1 35  ? -59.048 12.926  5.369   1.00 114.30 ? 27  LYS B N   1 
ATOM   1180 C CA  . LYS B 1 35  ? -58.081 13.795  6.027   1.00 119.61 ? 27  LYS B CA  1 
ATOM   1181 C C   . LYS B 1 35  ? -57.240 14.602  5.043   1.00 116.78 ? 27  LYS B C   1 
ATOM   1182 O O   . LYS B 1 35  ? -56.850 15.732  5.338   1.00 106.43 ? 27  LYS B O   1 
ATOM   1183 C CB  . LYS B 1 35  ? -57.164 12.968  6.931   1.00 114.98 ? 27  LYS B CB  1 
ATOM   1184 N N   . ILE B 1 36  ? -56.962 14.025  3.878   1.00 120.83 ? 28  ILE B N   1 
ATOM   1185 C CA  . ILE B 1 36  ? -56.070 14.666  2.918   1.00 107.72 ? 28  ILE B CA  1 
ATOM   1186 C C   . ILE B 1 36  ? -56.730 15.874  2.249   1.00 101.34 ? 28  ILE B C   1 
ATOM   1187 O O   . ILE B 1 36  ? -56.050 16.835  1.890   1.00 117.07 ? 28  ILE B O   1 
ATOM   1188 C CB  . ILE B 1 36  ? -55.585 13.666  1.835   1.00 93.22  ? 28  ILE B CB  1 
ATOM   1189 C CG1 . ILE B 1 36  ? -54.439 14.269  1.018   1.00 97.90  ? 28  ILE B CG1 1 
ATOM   1190 C CG2 . ILE B 1 36  ? -56.729 13.229  0.930   1.00 99.14  ? 28  ILE B CG2 1 
ATOM   1191 C CD1 . ILE B 1 36  ? -53.221 14.624  1.844   1.00 116.50 ? 28  ILE B CD1 1 
ATOM   1192 N N   . ARG B 1 37  ? -58.051 15.839  2.101   1.00 88.98  ? 29  ARG B N   1 
ATOM   1193 C CA  . ARG B 1 37  ? -58.753 16.946  1.462   1.00 112.90 ? 29  ARG B CA  1 
ATOM   1194 C C   . ARG B 1 37  ? -59.185 17.980  2.497   1.00 113.60 ? 29  ARG B C   1 
ATOM   1195 O O   . ARG B 1 37  ? -59.387 19.147  2.172   1.00 119.90 ? 29  ARG B O   1 
ATOM   1196 C CB  . ARG B 1 37  ? -59.960 16.445  0.665   1.00 131.14 ? 29  ARG B CB  1 
ATOM   1197 C CG  . ARG B 1 37  ? -60.583 17.520  -0.213  1.00 135.06 ? 29  ARG B CG  1 
ATOM   1198 C CD  . ARG B 1 37  ? -61.585 16.960  -1.204  1.00 115.90 ? 29  ARG B CD  1 
ATOM   1199 N NE  . ARG B 1 37  ? -62.246 18.031  -1.945  1.00 115.49 ? 29  ARG B NE  1 
ATOM   1200 C CZ  . ARG B 1 37  ? -61.717 18.651  -2.995  1.00 115.06 ? 29  ARG B CZ  1 
ATOM   1201 N NH1 . ARG B 1 37  ? -60.514 18.306  -3.435  1.00 91.61  ? 29  ARG B NH1 1 
ATOM   1202 N NH2 . ARG B 1 37  ? -62.389 19.617  -3.605  1.00 142.12 ? 29  ARG B NH2 1 
ATOM   1203 N N   . LYS B 1 38  ? -59.319 17.553  3.747   1.00 121.60 ? 30  LYS B N   1 
ATOM   1204 C CA  . LYS B 1 38  ? -59.577 18.490  4.832   1.00 112.31 ? 30  LYS B CA  1 
ATOM   1205 C C   . LYS B 1 38  ? -58.324 19.322  5.084   1.00 109.66 ? 30  LYS B C   1 
ATOM   1206 O O   . LYS B 1 38  ? -58.396 20.448  5.578   1.00 127.91 ? 30  LYS B O   1 
ATOM   1207 C CB  . LYS B 1 38  ? -60.001 17.754  6.104   1.00 118.28 ? 30  LYS B CB  1 
ATOM   1208 N N   . LYS B 1 39  ? -57.176 18.753  4.729   1.00 101.65 ? 31  LYS B N   1 
ATOM   1209 C CA  . LYS B 1 39  ? -55.889 19.421  4.885   1.00 106.63 ? 31  LYS B CA  1 
ATOM   1210 C C   . LYS B 1 39  ? -55.542 20.243  3.643   1.00 115.45 ? 31  LYS B C   1 
ATOM   1211 O O   . LYS B 1 39  ? -54.924 21.303  3.742   1.00 105.30 ? 31  LYS B O   1 
ATOM   1212 C CB  . LYS B 1 39  ? -54.793 18.390  5.168   1.00 100.14 ? 31  LYS B CB  1 
ATOM   1213 C CG  . LYS B 1 39  ? -53.447 18.986  5.541   1.00 129.68 ? 31  LYS B CG  1 
ATOM   1214 C CD  . LYS B 1 39  ? -52.506 17.915  6.069   1.00 127.75 ? 31  LYS B CD  1 
ATOM   1215 C CE  . LYS B 1 39  ? -51.206 18.520  6.573   1.00 140.75 ? 31  LYS B CE  1 
ATOM   1216 N NZ  . LYS B 1 39  ? -50.692 17.811  7.778   1.00 148.25 ? 31  LYS B NZ  1 
ATOM   1217 N N   . TYR B 1 40  ? -55.943 19.745  2.476   1.00 113.82 ? 32  TYR B N   1 
ATOM   1218 C CA  . TYR B 1 40  ? -55.730 20.454  1.217   1.00 102.13 ? 32  TYR B CA  1 
ATOM   1219 C C   . TYR B 1 40  ? -57.021 20.487  0.398   1.00 103.91 ? 32  TYR B C   1 
ATOM   1220 O O   . TYR B 1 40  ? -57.195 19.692  -0.527  1.00 91.42  ? 32  TYR B O   1 
ATOM   1221 C CB  . TYR B 1 40  ? -54.607 19.798  0.410   1.00 96.46  ? 32  TYR B CB  1 
ATOM   1222 C CG  . TYR B 1 40  ? -53.326 19.591  1.188   1.00 103.39 ? 32  TYR B CG  1 
ATOM   1223 C CD1 . TYR B 1 40  ? -52.501 20.663  1.505   1.00 103.80 ? 32  TYR B CD1 1 
ATOM   1224 C CD2 . TYR B 1 40  ? -52.940 18.322  1.601   1.00 81.79  ? 32  TYR B CD2 1 
ATOM   1225 C CE1 . TYR B 1 40  ? -51.329 20.477  2.216   1.00 97.37  ? 32  TYR B CE1 1 
ATOM   1226 C CE2 . TYR B 1 40  ? -51.770 18.127  2.311   1.00 102.32 ? 32  TYR B CE2 1 
ATOM   1227 C CZ  . TYR B 1 40  ? -50.969 19.208  2.616   1.00 104.87 ? 32  TYR B CZ  1 
ATOM   1228 O OH  . TYR B 1 40  ? -49.803 19.019  3.324   1.00 124.83 ? 32  TYR B OH  1 
ATOM   1229 N N   . PRO B 1 41  ? -57.928 21.417  0.736   1.00 116.52 ? 33  PRO B N   1 
ATOM   1230 C CA  . PRO B 1 41  ? -59.271 21.495  0.144   1.00 116.75 ? 33  PRO B CA  1 
ATOM   1231 C C   . PRO B 1 41  ? -59.287 21.928  -1.319  1.00 111.26 ? 33  PRO B C   1 
ATOM   1232 O O   . PRO B 1 41  ? -60.328 21.825  -1.969  1.00 106.75 ? 33  PRO B O   1 
ATOM   1233 C CB  . PRO B 1 41  ? -59.974 22.536  1.021   1.00 120.35 ? 33  PRO B CB  1 
ATOM   1234 C CG  . PRO B 1 41  ? -58.874 23.391  1.536   1.00 99.57  ? 33  PRO B CG  1 
ATOM   1235 C CD  . PRO B 1 41  ? -57.711 22.467  1.747   1.00 96.42  ? 33  PRO B CD  1 
ATOM   1236 N N   . ASP B 1 42  ? -58.157 22.407  -1.827  1.00 118.61 ? 34  ASP B N   1 
ATOM   1237 C CA  . ASP B 1 42  ? -58.073 22.819  -3.223  1.00 113.26 ? 34  ASP B CA  1 
ATOM   1238 C C   . ASP B 1 42  ? -57.003 22.025  -3.962  1.00 90.80  ? 34  ASP B C   1 
ATOM   1239 O O   . ASP B 1 42  ? -56.426 22.495  -4.942  1.00 89.67  ? 34  ASP B O   1 
ATOM   1240 C CB  . ASP B 1 42  ? -57.799 24.319  -3.324  1.00 123.89 ? 34  ASP B CB  1 
ATOM   1241 C CG  . ASP B 1 42  ? -58.976 25.155  -2.857  1.00 147.60 ? 34  ASP B CG  1 
ATOM   1242 O OD1 . ASP B 1 42  ? -60.130 24.743  -3.100  1.00 155.70 ? 34  ASP B OD1 1 
ATOM   1243 O OD2 . ASP B 1 42  ? -58.749 26.219  -2.245  1.00 154.12 ? 34  ASP B OD2 1 
ATOM   1244 N N   . ARG B 1 43  ? -56.744 20.816  -3.474  1.00 83.73  ? 35  ARG B N   1 
ATOM   1245 C CA  . ARG B 1 43  ? -55.871 19.872  -4.157  1.00 73.98  ? 35  ARG B CA  1 
ATOM   1246 C C   . ARG B 1 43  ? -56.638 18.574  -4.388  1.00 71.07  ? 35  ARG B C   1 
ATOM   1247 O O   . ARG B 1 43  ? -57.590 18.275  -3.669  1.00 77.35  ? 35  ARG B O   1 
ATOM   1248 C CB  . ARG B 1 43  ? -54.597 19.618  -3.349  1.00 65.67  ? 35  ARG B CB  1 
ATOM   1249 C CG  . ARG B 1 43  ? -53.727 20.854  -3.163  1.00 89.92  ? 35  ARG B CG  1 
ATOM   1250 C CD  . ARG B 1 43  ? -52.462 20.535  -2.381  1.00 92.17  ? 35  ARG B CD  1 
ATOM   1251 N NE  . ARG B 1 43  ? -51.595 19.599  -3.092  1.00 105.66 ? 35  ARG B NE  1 
ATOM   1252 C CZ  . ARG B 1 43  ? -50.474 19.091  -2.590  1.00 107.00 ? 35  ARG B CZ  1 
ATOM   1253 N NH1 . ARG B 1 43  ? -50.082 19.423  -1.368  1.00 116.67 ? 35  ARG B NH1 1 
ATOM   1254 N NH2 . ARG B 1 43  ? -49.747 18.246  -3.307  1.00 104.39 ? 35  ARG B NH2 1 
ATOM   1255 N N   . VAL B 1 44  ? -56.227 17.808  -5.393  1.00 78.87  ? 36  VAL B N   1 
ATOM   1256 C CA  . VAL B 1 44  ? -56.968 16.613  -5.778  1.00 77.39  ? 36  VAL B CA  1 
ATOM   1257 C C   . VAL B 1 44  ? -56.150 15.334  -5.614  1.00 83.01  ? 36  VAL B C   1 
ATOM   1258 O O   . VAL B 1 44  ? -55.116 15.167  -6.259  1.00 86.56  ? 36  VAL B O   1 
ATOM   1259 C CB  . VAL B 1 44  ? -57.452 16.705  -7.238  1.00 58.27  ? 36  VAL B CB  1 
ATOM   1260 C CG1 . VAL B 1 44  ? -58.121 15.408  -7.657  1.00 68.22  ? 36  VAL B CG1 1 
ATOM   1261 C CG2 . VAL B 1 44  ? -58.402 17.880  -7.409  1.00 56.58  ? 36  VAL B CG2 1 
ATOM   1262 N N   . PRO B 1 45  ? -56.618 14.428  -4.742  1.00 77.36  ? 37  PRO B N   1 
ATOM   1263 C CA  . PRO B 1 45  ? -56.004 13.110  -4.545  1.00 65.93  ? 37  PRO B CA  1 
ATOM   1264 C C   . PRO B 1 45  ? -56.410 12.113  -5.632  1.00 73.90  ? 37  PRO B C   1 
ATOM   1265 O O   . PRO B 1 45  ? -57.590 11.787  -5.761  1.00 73.33  ? 37  PRO B O   1 
ATOM   1266 C CB  . PRO B 1 45  ? -56.536 12.681  -3.176  1.00 70.47  ? 37  PRO B CB  1 
ATOM   1267 C CG  . PRO B 1 45  ? -57.853 13.369  -3.059  1.00 69.90  ? 37  PRO B CG  1 
ATOM   1268 C CD  . PRO B 1 45  ? -57.717 14.677  -3.791  1.00 68.13  ? 37  PRO B CD  1 
ATOM   1269 N N   . VAL B 1 46  ? -55.437 11.637  -6.402  1.00 85.62  ? 38  VAL B N   1 
ATOM   1270 C CA  . VAL B 1 46  ? -55.717 10.747  -7.526  1.00 70.06  ? 38  VAL B CA  1 
ATOM   1271 C C   . VAL B 1 46  ? -54.972 9.417   -7.412  1.00 73.06  ? 38  VAL B C   1 
ATOM   1272 O O   . VAL B 1 46  ? -53.798 9.382   -7.044  1.00 77.00  ? 38  VAL B O   1 
ATOM   1273 C CB  . VAL B 1 46  ? -55.343 11.411  -8.871  1.00 53.25  ? 38  VAL B CB  1 
ATOM   1274 C CG1 . VAL B 1 46  ? -55.720 10.512  -10.039 1.00 54.65  ? 38  VAL B CG1 1 
ATOM   1275 C CG2 . VAL B 1 46  ? -56.020 12.762  -9.004  1.00 64.11  ? 38  VAL B CG2 1 
ATOM   1276 N N   . ILE B 1 47  ? -55.666 8.325   -7.723  1.00 66.80  ? 39  ILE B N   1 
ATOM   1277 C CA  . ILE B 1 47  ? -55.041 7.010   -7.795  1.00 65.79  ? 39  ILE B CA  1 
ATOM   1278 C C   . ILE B 1 47  ? -54.893 6.580   -9.251  1.00 76.89  ? 39  ILE B C   1 
ATOM   1279 O O   . ILE B 1 47  ? -55.885 6.437   -9.967  1.00 79.56  ? 39  ILE B O   1 
ATOM   1280 C CB  . ILE B 1 47  ? -55.854 5.946   -7.033  1.00 90.03  ? 39  ILE B CB  1 
ATOM   1281 C CG1 . ILE B 1 47  ? -56.156 6.417   -5.608  1.00 96.46  ? 39  ILE B CG1 1 
ATOM   1282 C CG2 . ILE B 1 47  ? -55.112 4.616   -7.023  1.00 94.01  ? 39  ILE B CG2 1 
ATOM   1283 C CD1 . ILE B 1 47  ? -54.923 6.642   -4.763  1.00 87.21  ? 39  ILE B CD1 1 
ATOM   1284 N N   . VAL B 1 48  ? -53.654 6.379   -9.687  1.00 73.58  ? 40  VAL B N   1 
ATOM   1285 C CA  . VAL B 1 48  ? -53.387 6.001   -11.071 1.00 62.38  ? 40  VAL B CA  1 
ATOM   1286 C C   . VAL B 1 48  ? -52.811 4.592   -11.164 1.00 73.36  ? 40  VAL B C   1 
ATOM   1287 O O   . VAL B 1 48  ? -51.735 4.314   -10.634 1.00 92.54  ? 40  VAL B O   1 
ATOM   1288 C CB  . VAL B 1 48  ? -52.414 6.987   -11.745 1.00 71.55  ? 40  VAL B CB  1 
ATOM   1289 C CG1 . VAL B 1 48  ? -52.252 6.647   -13.218 1.00 70.40  ? 40  VAL B CG1 1 
ATOM   1290 C CG2 . VAL B 1 48  ? -52.906 8.417   -11.577 1.00 62.05  ? 40  VAL B CG2 1 
ATOM   1291 N N   . GLU B 1 49  ? -53.533 3.705   -11.841 1.00 69.87  ? 41  GLU B N   1 
ATOM   1292 C CA  . GLU B 1 49  ? -53.085 2.329   -12.014 1.00 85.23  ? 41  GLU B CA  1 
ATOM   1293 C C   . GLU B 1 49  ? -53.579 1.751   -13.336 1.00 93.53  ? 41  GLU B C   1 
ATOM   1294 O O   . GLU B 1 49  ? -54.581 2.204   -13.887 1.00 92.81  ? 41  GLU B O   1 
ATOM   1295 C CB  . GLU B 1 49  ? -53.553 1.465   -10.841 1.00 99.89  ? 41  GLU B CB  1 
ATOM   1296 C CG  . GLU B 1 49  ? -55.005 1.675   -10.450 1.00 112.76 ? 41  GLU B CG  1 
ATOM   1297 C CD  . GLU B 1 49  ? -55.309 1.151   -9.060  1.00 121.78 ? 41  GLU B CD  1 
ATOM   1298 O OE1 . GLU B 1 49  ? -54.354 0.949   -8.280  1.00 105.39 ? 41  GLU B OE1 1 
ATOM   1299 O OE2 . GLU B 1 49  ? -56.500 0.944   -8.745  1.00 132.84 ? 41  GLU B OE2 1 
ATOM   1300 N N   . LYS B 1 50  ? -52.864 0.749   -13.838 1.00 86.64  ? 42  LYS B N   1 
ATOM   1301 C CA  . LYS B 1 50  ? -53.149 0.174   -15.148 1.00 75.62  ? 42  LYS B CA  1 
ATOM   1302 C C   . LYS B 1 50  ? -54.503 -0.526  -15.206 1.00 81.50  ? 42  LYS B C   1 
ATOM   1303 O O   . LYS B 1 50  ? -54.902 -1.216  -14.268 1.00 90.59  ? 42  LYS B O   1 
ATOM   1304 C CB  . LYS B 1 50  ? -52.045 -0.810  -15.544 1.00 84.28  ? 42  LYS B CB  1 
ATOM   1305 N N   . ALA B 1 51  ? -55.204 -0.337  -16.319 1.00 91.73  ? 43  ALA B N   1 
ATOM   1306 C CA  . ALA B 1 51  ? -56.466 -1.020  -16.574 1.00 99.96  ? 43  ALA B CA  1 
ATOM   1307 C C   . ALA B 1 51  ? -56.219 -2.513  -16.777 1.00 115.27 ? 43  ALA B C   1 
ATOM   1308 O O   . ALA B 1 51  ? -55.087 -2.920  -17.039 1.00 117.75 ? 43  ALA B O   1 
ATOM   1309 C CB  . ALA B 1 51  ? -57.155 -0.413  -17.792 1.00 83.52  ? 43  ALA B CB  1 
ATOM   1310 N N   . PRO B 1 52  ? -57.269 -3.342  -16.643 1.00 119.92 ? 44  PRO B N   1 
ATOM   1311 C CA  . PRO B 1 52  ? -57.083 -4.771  -16.920 1.00 123.12 ? 44  PRO B CA  1 
ATOM   1312 C C   . PRO B 1 52  ? -56.689 -5.035  -18.372 1.00 124.31 ? 44  PRO B C   1 
ATOM   1313 O O   . PRO B 1 52  ? -57.114 -4.301  -19.266 1.00 108.49 ? 44  PRO B O   1 
ATOM   1314 C CB  . PRO B 1 52  ? -58.458 -5.376  -16.605 1.00 114.29 ? 44  PRO B CB  1 
ATOM   1315 C CG  . PRO B 1 52  ? -59.411 -4.225  -16.645 1.00 103.82 ? 44  PRO B CG  1 
ATOM   1316 C CD  . PRO B 1 52  ? -58.627 -3.053  -16.150 1.00 108.79 ? 44  PRO B CD  1 
ATOM   1317 N N   . LYS B 1 53  ? -55.875 -6.068  -18.583 1.00 131.91 ? 45  LYS B N   1 
ATOM   1318 C CA  . LYS B 1 53  ? -55.403 -6.459  -19.911 1.00 125.31 ? 45  LYS B CA  1 
ATOM   1319 C C   . LYS B 1 53  ? -54.625 -5.343  -20.608 1.00 114.42 ? 45  LYS B C   1 
ATOM   1320 O O   . LYS B 1 53  ? -54.650 -5.231  -21.834 1.00 115.83 ? 45  LYS B O   1 
ATOM   1321 C CB  . LYS B 1 53  ? -56.577 -6.903  -20.790 1.00 119.39 ? 45  LYS B CB  1 
ATOM   1322 N N   . ALA B 1 54  ? -53.929 -4.525  -19.824 1.00 105.13 ? 46  ALA B N   1 
ATOM   1323 C CA  . ALA B 1 54  ? -53.105 -3.457  -20.379 1.00 106.92 ? 46  ALA B CA  1 
ATOM   1324 C C   . ALA B 1 54  ? -51.695 -3.960  -20.672 1.00 113.50 ? 46  ALA B C   1 
ATOM   1325 O O   . ALA B 1 54  ? -51.126 -4.726  -19.894 1.00 123.82 ? 46  ALA B O   1 
ATOM   1326 C CB  . ALA B 1 54  ? -53.058 -2.270  -19.430 1.00 96.67  ? 46  ALA B CB  1 
ATOM   1327 N N   . ARG B 1 55  ? -51.137 -3.528  -21.798 1.00 110.04 ? 47  ARG B N   1 
ATOM   1328 C CA  . ARG B 1 55  ? -49.792 -3.931  -22.192 1.00 117.34 ? 47  ARG B CA  1 
ATOM   1329 C C   . ARG B 1 55  ? -48.796 -2.797  -21.973 1.00 126.03 ? 47  ARG B C   1 
ATOM   1330 O O   . ARG B 1 55  ? -47.788 -2.695  -22.672 1.00 144.45 ? 47  ARG B O   1 
ATOM   1331 C CB  . ARG B 1 55  ? -49.773 -4.375  -23.656 1.00 113.20 ? 47  ARG B CB  1 
ATOM   1332 N N   . VAL B 1 56  ? -49.088 -1.951  -20.991 1.00 119.07 ? 48  VAL B N   1 
ATOM   1333 C CA  . VAL B 1 56  ? -48.266 -0.783  -20.696 1.00 118.33 ? 48  VAL B CA  1 
ATOM   1334 C C   . VAL B 1 56  ? -47.584 -0.930  -19.336 1.00 113.64 ? 48  VAL B C   1 
ATOM   1335 O O   . VAL B 1 56  ? -48.212 -1.380  -18.376 1.00 106.01 ? 48  VAL B O   1 
ATOM   1336 C CB  . VAL B 1 56  ? -49.120 0.511   -20.734 1.00 127.15 ? 48  VAL B CB  1 
ATOM   1337 C CG1 . VAL B 1 56  ? -48.487 1.628   -19.913 1.00 106.63 ? 48  VAL B CG1 1 
ATOM   1338 C CG2 . VAL B 1 56  ? -49.346 0.951   -22.172 1.00 137.60 ? 48  VAL B CG2 1 
ATOM   1339 N N   . PRO B 1 57  ? -46.287 -0.572  -19.260 1.00 115.71 ? 49  PRO B N   1 
ATOM   1340 C CA  . PRO B 1 57  ? -45.487 -0.592  -18.029 1.00 105.02 ? 49  PRO B CA  1 
ATOM   1341 C C   . PRO B 1 57  ? -46.222 -0.016  -16.821 1.00 111.57 ? 49  PRO B C   1 
ATOM   1342 O O   . PRO B 1 57  ? -46.980 0.944   -16.961 1.00 116.81 ? 49  PRO B O   1 
ATOM   1343 C CB  . PRO B 1 57  ? -44.283 0.278   -18.390 1.00 97.46  ? 49  PRO B CB  1 
ATOM   1344 C CG  . PRO B 1 57  ? -44.105 0.053   -19.848 1.00 116.23 ? 49  PRO B CG  1 
ATOM   1345 C CD  . PRO B 1 57  ? -45.486 -0.147  -20.423 1.00 121.84 ? 49  PRO B CD  1 
ATOM   1346 N N   . ASP B 1 58  ? -45.998 -0.601  -15.649 1.00 115.02 ? 50  ASP B N   1 
ATOM   1347 C CA  . ASP B 1 58  ? -46.682 -0.157  -14.441 1.00 102.14 ? 50  ASP B CA  1 
ATOM   1348 C C   . ASP B 1 58  ? -45.981 1.054   -13.834 1.00 95.15  ? 50  ASP B C   1 
ATOM   1349 O O   . ASP B 1 58  ? -44.791 1.276   -14.060 1.00 97.11  ? 50  ASP B O   1 
ATOM   1350 C CB  . ASP B 1 58  ? -46.768 -1.294  -13.421 1.00 110.00 ? 50  ASP B CB  1 
ATOM   1351 C CG  . ASP B 1 58  ? -48.046 -1.246  -12.603 1.00 131.99 ? 50  ASP B CG  1 
ATOM   1352 O OD1 . ASP B 1 58  ? -48.723 -0.195  -12.613 1.00 147.64 ? 50  ASP B OD1 1 
ATOM   1353 O OD2 . ASP B 1 58  ? -48.377 -2.262  -11.956 1.00 130.08 ? 50  ASP B OD2 1 
ATOM   1354 N N   . LEU B 1 59  ? -46.730 1.830   -13.060 1.00 92.46  ? 51  LEU B N   1 
ATOM   1355 C CA  . LEU B 1 59  ? -46.239 3.090   -12.517 1.00 82.54  ? 51  LEU B CA  1 
ATOM   1356 C C   . LEU B 1 59  ? -45.485 2.882   -11.205 1.00 97.41  ? 51  LEU B C   1 
ATOM   1357 O O   . LEU B 1 59  ? -45.923 2.118   -10.344 1.00 104.71 ? 51  LEU B O   1 
ATOM   1358 C CB  . LEU B 1 59  ? -47.409 4.055   -12.316 1.00 82.67  ? 51  LEU B CB  1 
ATOM   1359 C CG  . LEU B 1 59  ? -47.141 5.558   -12.368 1.00 77.38  ? 51  LEU B CG  1 
ATOM   1360 C CD1 . LEU B 1 59  ? -46.268 5.910   -13.557 1.00 69.71  ? 51  LEU B CD1 1 
ATOM   1361 C CD2 . LEU B 1 59  ? -48.461 6.306   -12.437 1.00 84.06  ? 51  LEU B CD2 1 
ATOM   1362 N N   . ASP B 1 60  ? -44.352 3.564   -11.062 1.00 102.65 ? 52  ASP B N   1 
ATOM   1363 C CA  . ASP B 1 60  ? -43.514 3.442   -9.871  1.00 105.92 ? 52  ASP B CA  1 
ATOM   1364 C C   . ASP B 1 60  ? -44.256 3.885   -8.613  1.00 102.58 ? 52  ASP B C   1 
ATOM   1365 O O   . ASP B 1 60  ? -44.169 3.238   -7.569  1.00 107.21 ? 52  ASP B O   1 
ATOM   1366 C CB  . ASP B 1 60  ? -42.230 4.258   -10.035 1.00 114.90 ? 52  ASP B CB  1 
ATOM   1367 N N   . LYS B 1 61  ? -44.981 4.993   -8.721  1.00 96.35  ? 53  LYS B N   1 
ATOM   1368 C CA  . LYS B 1 61  ? -45.808 5.488   -7.626  1.00 92.49  ? 53  LYS B CA  1 
ATOM   1369 C C   . LYS B 1 61  ? -47.225 5.751   -8.134  1.00 88.07  ? 53  LYS B C   1 
ATOM   1370 O O   . LYS B 1 61  ? -47.408 6.299   -9.221  1.00 72.31  ? 53  LYS B O   1 
ATOM   1371 C CB  . LYS B 1 61  ? -45.199 6.754   -7.018  1.00 96.43  ? 53  LYS B CB  1 
ATOM   1372 C CG  . LYS B 1 61  ? -43.785 6.559   -6.479  1.00 106.18 ? 53  LYS B CG  1 
ATOM   1373 C CD  . LYS B 1 61  ? -43.238 7.830   -5.847  1.00 102.24 ? 53  LYS B CD  1 
ATOM   1374 N N   . ARG B 1 62  ? -48.225 5.358   -7.348  1.00 86.30  ? 54  ARG B N   1 
ATOM   1375 C CA  . ARG B 1 62  ? -49.611 5.376   -7.813  1.00 79.02  ? 54  ARG B CA  1 
ATOM   1376 C C   . ARG B 1 62  ? -50.454 6.504   -7.217  1.00 87.57  ? 54  ARG B C   1 
ATOM   1377 O O   . ARG B 1 62  ? -51.472 6.892   -7.792  1.00 87.23  ? 54  ARG B O   1 
ATOM   1378 C CB  . ARG B 1 62  ? -50.279 4.031   -7.511  1.00 76.74  ? 54  ARG B CB  1 
ATOM   1379 N N   . LYS B 1 63  ? -50.037 7.026   -6.067  1.00 91.44  ? 55  LYS B N   1 
ATOM   1380 C CA  . LYS B 1 63  ? -50.798 8.071   -5.386  1.00 85.99  ? 55  LYS B CA  1 
ATOM   1381 C C   . LYS B 1 63  ? -50.308 9.468   -5.764  1.00 84.74  ? 55  LYS B C   1 
ATOM   1382 O O   . LYS B 1 63  ? -49.116 9.764   -5.671  1.00 92.33  ? 55  LYS B O   1 
ATOM   1383 C CB  . LYS B 1 63  ? -50.722 7.876   -3.870  1.00 91.83  ? 55  LYS B CB  1 
ATOM   1384 C CG  . LYS B 1 63  ? -51.466 6.648   -3.370  1.00 93.48  ? 55  LYS B CG  1 
ATOM   1385 C CD  . LYS B 1 63  ? -51.071 6.297   -1.944  1.00 98.91  ? 55  LYS B CD  1 
ATOM   1386 C CE  . LYS B 1 63  ? -51.304 7.462   -0.999  1.00 91.88  ? 55  LYS B CE  1 
ATOM   1387 N NZ  . LYS B 1 63  ? -50.925 7.125   0.401   1.00 104.09 ? 55  LYS B NZ  1 
ATOM   1388 N N   . TYR B 1 64  ? -51.236 10.323  -6.187  1.00 66.83  ? 56  TYR B N   1 
ATOM   1389 C CA  . TYR B 1 64  ? -50.895 11.672  -6.631  1.00 76.06  ? 56  TYR B CA  1 
ATOM   1390 C C   . TYR B 1 64  ? -51.800 12.734  -6.009  1.00 89.08  ? 56  TYR B C   1 
ATOM   1391 O O   . TYR B 1 64  ? -53.013 12.552  -5.909  1.00 101.48 ? 56  TYR B O   1 
ATOM   1392 C CB  . TYR B 1 64  ? -50.967 11.764  -8.159  1.00 70.68  ? 56  TYR B CB  1 
ATOM   1393 C CG  . TYR B 1 64  ? -49.913 10.946  -8.869  1.00 69.06  ? 56  TYR B CG  1 
ATOM   1394 C CD1 . TYR B 1 64  ? -50.114 9.597   -9.135  1.00 70.39  ? 56  TYR B CD1 1 
ATOM   1395 C CD2 . TYR B 1 64  ? -48.716 11.522  -9.273  1.00 69.75  ? 56  TYR B CD2 1 
ATOM   1396 C CE1 . TYR B 1 64  ? -49.151 8.845   -9.782  1.00 70.39  ? 56  TYR B CE1 1 
ATOM   1397 C CE2 . TYR B 1 64  ? -47.747 10.779  -9.921  1.00 80.12  ? 56  TYR B CE2 1 
ATOM   1398 C CZ  . TYR B 1 64  ? -47.969 9.441   -10.173 1.00 77.33  ? 56  TYR B CZ  1 
ATOM   1399 O OH  . TYR B 1 64  ? -47.005 8.701   -10.816 1.00 73.48  ? 56  TYR B OH  1 
ATOM   1400 N N   . LEU B 1 65  ? -51.196 13.844  -5.594  1.00 73.81  ? 57  LEU B N   1 
ATOM   1401 C CA  . LEU B 1 65  ? -51.937 14.971  -5.041  1.00 63.14  ? 57  LEU B CA  1 
ATOM   1402 C C   . LEU B 1 65  ? -51.736 16.192  -5.936  1.00 63.44  ? 57  LEU B C   1 
ATOM   1403 O O   . LEU B 1 65  ? -50.718 16.881  -5.843  1.00 62.10  ? 57  LEU B O   1 
ATOM   1404 C CB  . LEU B 1 65  ? -51.487 15.260  -3.606  1.00 67.45  ? 57  LEU B CB  1 
ATOM   1405 C CG  . LEU B 1 65  ? -52.452 16.024  -2.696  1.00 71.21  ? 57  LEU B CG  1 
ATOM   1406 C CD1 . LEU B 1 65  ? -53.782 15.300  -2.600  1.00 71.38  ? 57  LEU B CD1 1 
ATOM   1407 C CD2 . LEU B 1 65  ? -51.849 16.209  -1.312  1.00 85.49  ? 57  LEU B CD2 1 
ATOM   1408 N N   . VAL B 1 66  ? -52.711 16.452  -6.803  1.00 61.65  ? 58  VAL B N   1 
ATOM   1409 C CA  . VAL B 1 66  ? -52.556 17.437  -7.872  1.00 70.78  ? 58  VAL B CA  1 
ATOM   1410 C C   . VAL B 1 66  ? -53.411 18.689  -7.657  1.00 77.05  ? 58  VAL B C   1 
ATOM   1411 O O   . VAL B 1 66  ? -54.406 18.646  -6.931  1.00 72.32  ? 58  VAL B O   1 
ATOM   1412 C CB  . VAL B 1 66  ? -52.908 16.810  -9.241  1.00 61.02  ? 58  VAL B CB  1 
ATOM   1413 C CG1 . VAL B 1 66  ? -52.137 15.514  -9.439  1.00 55.21  ? 58  VAL B CG1 1 
ATOM   1414 C CG2 . VAL B 1 66  ? -54.402 16.559  -9.349  1.00 60.39  ? 58  VAL B CG2 1 
ATOM   1415 N N   . PRO B 1 67  ? -53.013 19.816  -8.278  1.00 84.30  ? 59  PRO B N   1 
ATOM   1416 C CA  . PRO B 1 67  ? -53.812 21.046  -8.219  1.00 82.52  ? 59  PRO B CA  1 
ATOM   1417 C C   . PRO B 1 67  ? -55.183 20.874  -8.864  1.00 80.28  ? 59  PRO B C   1 
ATOM   1418 O O   . PRO B 1 67  ? -55.315 20.140  -9.844  1.00 94.18  ? 59  PRO B O   1 
ATOM   1419 C CB  . PRO B 1 67  ? -52.965 22.055  -9.003  1.00 79.60  ? 59  PRO B CB  1 
ATOM   1420 C CG  . PRO B 1 67  ? -51.577 21.531  -8.918  1.00 70.70  ? 59  PRO B CG  1 
ATOM   1421 C CD  . PRO B 1 67  ? -51.717 20.040  -8.943  1.00 81.80  ? 59  PRO B CD  1 
ATOM   1422 N N   . SER B 1 68  ? -56.187 21.552  -8.320  1.00 78.93  ? 60  SER B N   1 
ATOM   1423 C CA  . SER B 1 68  ? -57.558 21.409  -8.798  1.00 82.37  ? 60  SER B CA  1 
ATOM   1424 C C   . SER B 1 68  ? -57.765 22.029  -10.178 1.00 72.63  ? 60  SER B C   1 
ATOM   1425 O O   . SER B 1 68  ? -58.668 21.630  -10.914 1.00 69.07  ? 60  SER B O   1 
ATOM   1426 C CB  . SER B 1 68  ? -58.534 22.031  -7.796  1.00 91.22  ? 60  SER B CB  1 
ATOM   1427 O OG  . SER B 1 68  ? -58.196 23.380  -7.521  1.00 109.60 ? 60  SER B OG  1 
ATOM   1428 N N   . ASP B 1 69  ? -56.929 23.002  -10.530 1.00 73.82  ? 61  ASP B N   1 
ATOM   1429 C CA  . ASP B 1 69  ? -57.075 23.700  -11.804 1.00 81.67  ? 61  ASP B CA  1 
ATOM   1430 C C   . ASP B 1 69  ? -56.105 23.186  -12.868 1.00 87.08  ? 61  ASP B C   1 
ATOM   1431 O O   . ASP B 1 69  ? -55.923 23.817  -13.910 1.00 91.76  ? 61  ASP B O   1 
ATOM   1432 C CB  . ASP B 1 69  ? -56.895 25.209  -11.612 1.00 83.81  ? 61  ASP B CB  1 
ATOM   1433 C CG  . ASP B 1 69  ? -55.709 25.554  -10.730 1.00 103.40 ? 61  ASP B CG  1 
ATOM   1434 O OD1 . ASP B 1 69  ? -54.745 24.761  -10.675 1.00 98.50  ? 61  ASP B OD1 1 
ATOM   1435 O OD2 . ASP B 1 69  ? -55.743 26.626  -10.089 1.00 128.60 ? 61  ASP B OD2 1 
ATOM   1436 N N   . LEU B 1 70  ? -55.485 22.041  -12.602 1.00 75.72  ? 62  LEU B N   1 
ATOM   1437 C CA  . LEU B 1 70  ? -54.654 21.378  -13.600 1.00 78.34  ? 62  LEU B CA  1 
ATOM   1438 C C   . LEU B 1 70  ? -55.551 20.575  -14.536 1.00 74.66  ? 62  LEU B C   1 
ATOM   1439 O O   . LEU B 1 70  ? -56.454 19.874  -14.082 1.00 68.51  ? 62  LEU B O   1 
ATOM   1440 C CB  . LEU B 1 70  ? -53.617 20.471  -12.933 1.00 75.78  ? 62  LEU B CB  1 
ATOM   1441 C CG  . LEU B 1 70  ? -52.593 19.787  -13.844 1.00 65.17  ? 62  LEU B CG  1 
ATOM   1442 C CD1 . LEU B 1 70  ? -51.580 20.792  -14.373 1.00 69.08  ? 62  LEU B CD1 1 
ATOM   1443 C CD2 . LEU B 1 70  ? -51.891 18.654  -13.111 1.00 50.03  ? 62  LEU B CD2 1 
ATOM   1444 N N   . THR B 1 71  ? -55.316 20.685  -15.839 1.00 76.65  ? 63  THR B N   1 
ATOM   1445 C CA  . THR B 1 71  ? -56.155 19.994  -16.813 1.00 67.30  ? 63  THR B CA  1 
ATOM   1446 C C   . THR B 1 71  ? -55.805 18.514  -16.894 1.00 62.25  ? 63  THR B C   1 
ATOM   1447 O O   . THR B 1 71  ? -54.682 18.114  -16.579 1.00 62.20  ? 63  THR B O   1 
ATOM   1448 C CB  . THR B 1 71  ? -56.029 20.615  -18.219 1.00 66.10  ? 63  THR B CB  1 
ATOM   1449 O OG1 . THR B 1 71  ? -54.677 20.499  -18.678 1.00 76.72  ? 63  THR B OG1 1 
ATOM   1450 C CG2 . THR B 1 71  ? -56.431 22.082  -18.194 1.00 66.91  ? 63  THR B CG2 1 
ATOM   1451 N N   . VAL B 1 72  ? -56.777 17.708  -17.311 1.00 54.38  ? 64  VAL B N   1 
ATOM   1452 C CA  . VAL B 1 72  ? -56.565 16.281  -17.524 1.00 61.87  ? 64  VAL B CA  1 
ATOM   1453 C C   . VAL B 1 72  ? -55.467 16.066  -18.562 1.00 76.54  ? 64  VAL B C   1 
ATOM   1454 O O   . VAL B 1 72  ? -54.630 15.173  -18.425 1.00 71.26  ? 64  VAL B O   1 
ATOM   1455 C CB  . VAL B 1 72  ? -57.863 15.580  -17.983 1.00 66.02  ? 64  VAL B CB  1 
ATOM   1456 C CG1 . VAL B 1 72  ? -57.587 14.141  -18.397 1.00 68.95  ? 64  VAL B CG1 1 
ATOM   1457 C CG2 . VAL B 1 72  ? -58.909 15.630  -16.883 1.00 69.63  ? 64  VAL B CG2 1 
ATOM   1458 N N   . GLY B 1 73  ? -55.471 16.906  -19.593 1.00 85.18  ? 65  GLY B N   1 
ATOM   1459 C CA  . GLY B 1 73  ? -54.480 16.829  -20.649 1.00 77.37  ? 65  GLY B CA  1 
ATOM   1460 C C   . GLY B 1 73  ? -53.061 17.054  -20.163 1.00 74.35  ? 65  GLY B C   1 
ATOM   1461 O O   . GLY B 1 73  ? -52.129 16.398  -20.629 1.00 70.82  ? 65  GLY B O   1 
ATOM   1462 N N   . GLN B 1 74  ? -52.894 17.983  -19.226 1.00 69.75  ? 66  GLN B N   1 
ATOM   1463 C CA  . GLN B 1 74  ? -51.582 18.267  -18.654 1.00 63.77  ? 66  GLN B CA  1 
ATOM   1464 C C   . GLN B 1 74  ? -51.119 17.137  -17.741 1.00 73.45  ? 66  GLN B C   1 
ATOM   1465 O O   . GLN B 1 74  ? -49.932 16.814  -17.689 1.00 87.51  ? 66  GLN B O   1 
ATOM   1466 C CB  . GLN B 1 74  ? -51.603 19.587  -17.881 1.00 79.25  ? 66  GLN B CB  1 
ATOM   1467 C CG  . GLN B 1 74  ? -51.422 20.822  -18.748 1.00 109.03 ? 66  GLN B CG  1 
ATOM   1468 C CD  . GLN B 1 74  ? -51.481 22.109  -17.948 1.00 128.52 ? 66  GLN B CD  1 
ATOM   1469 O OE1 . GLN B 1 74  ? -52.404 22.323  -17.162 1.00 117.74 ? 66  GLN B OE1 1 
ATOM   1470 N NE2 . GLN B 1 74  ? -50.489 22.970  -18.139 1.00 147.06 ? 66  GLN B NE2 1 
ATOM   1471 N N   . PHE B 1 75  ? -52.062 16.541  -17.018 1.00 67.86  ? 67  PHE B N   1 
ATOM   1472 C CA  . PHE B 1 75  ? -51.753 15.423  -16.136 1.00 71.77  ? 67  PHE B CA  1 
ATOM   1473 C C   . PHE B 1 75  ? -51.424 14.181  -16.959 1.00 80.00  ? 67  PHE B C   1 
ATOM   1474 O O   . PHE B 1 75  ? -50.650 13.325  -16.530 1.00 81.08  ? 67  PHE B O   1 
ATOM   1475 C CB  . PHE B 1 75  ? -52.924 15.148  -15.188 1.00 61.69  ? 67  PHE B CB  1 
ATOM   1476 C CG  . PHE B 1 75  ? -52.634 14.102  -14.149 1.00 65.26  ? 67  PHE B CG  1 
ATOM   1477 C CD1 . PHE B 1 75  ? -51.663 14.316  -13.183 1.00 77.80  ? 67  PHE B CD1 1 
ATOM   1478 C CD2 . PHE B 1 75  ? -53.340 12.911  -14.130 1.00 55.20  ? 67  PHE B CD2 1 
ATOM   1479 C CE1 . PHE B 1 75  ? -51.396 13.356  -12.223 1.00 64.94  ? 67  PHE B CE1 1 
ATOM   1480 C CE2 . PHE B 1 75  ? -53.079 11.948  -13.171 1.00 60.48  ? 67  PHE B CE2 1 
ATOM   1481 C CZ  . PHE B 1 75  ? -52.105 12.171  -12.217 1.00 62.43  ? 67  PHE B CZ  1 
ATOM   1482 N N   . TYR B 1 76  ? -52.014 14.101  -18.148 1.00 79.51  ? 68  TYR B N   1 
ATOM   1483 C CA  . TYR B 1 76  ? -51.780 12.990  -19.064 1.00 67.42  ? 68  TYR B CA  1 
ATOM   1484 C C   . TYR B 1 76  ? -50.335 12.959  -19.552 1.00 75.52  ? 68  TYR B C   1 
ATOM   1485 O O   . TYR B 1 76  ? -49.721 11.895  -19.634 1.00 71.82  ? 68  TYR B O   1 
ATOM   1486 C CB  . TYR B 1 76  ? -52.741 13.078  -20.253 1.00 77.42  ? 68  TYR B CB  1 
ATOM   1487 C CG  . TYR B 1 76  ? -52.449 12.098  -21.367 1.00 71.14  ? 68  TYR B CG  1 
ATOM   1488 C CD1 . TYR B 1 76  ? -52.692 10.740  -21.206 1.00 74.98  ? 68  TYR B CD1 1 
ATOM   1489 C CD2 . TYR B 1 76  ? -51.944 12.534  -22.585 1.00 70.44  ? 68  TYR B CD2 1 
ATOM   1490 C CE1 . TYR B 1 76  ? -52.429 9.842   -22.224 1.00 73.03  ? 68  TYR B CE1 1 
ATOM   1491 C CE2 . TYR B 1 76  ? -51.679 11.643  -23.609 1.00 76.27  ? 68  TYR B CE2 1 
ATOM   1492 C CZ  . TYR B 1 76  ? -51.923 10.299  -23.423 1.00 74.64  ? 68  TYR B CZ  1 
ATOM   1493 O OH  . TYR B 1 76  ? -51.662 9.409   -24.439 1.00 81.53  ? 68  TYR B OH  1 
ATOM   1494 N N   . PHE B 1 77  ? -49.795 14.131  -19.869 1.00 71.93  ? 69  PHE B N   1 
ATOM   1495 C CA  . PHE B 1 77  ? -48.418 14.233  -20.337 1.00 68.88  ? 69  PHE B CA  1 
ATOM   1496 C C   . PHE B 1 77  ? -47.426 13.995  -19.208 1.00 65.21  ? 69  PHE B C   1 
ATOM   1497 O O   . PHE B 1 77  ? -46.318 13.512  -19.437 1.00 89.40  ? 69  PHE B O   1 
ATOM   1498 C CB  . PHE B 1 77  ? -48.172 15.599  -20.976 1.00 94.19  ? 69  PHE B CB  1 
ATOM   1499 C CG  . PHE B 1 77  ? -48.782 15.744  -22.338 1.00 95.72  ? 69  PHE B CG  1 
ATOM   1500 C CD1 . PHE B 1 77  ? -48.748 14.692  -23.239 1.00 80.22  ? 69  PHE B CD1 1 
ATOM   1501 C CD2 . PHE B 1 77  ? -49.399 16.924  -22.714 1.00 97.18  ? 69  PHE B CD2 1 
ATOM   1502 C CE1 . PHE B 1 77  ? -49.312 14.816  -24.493 1.00 87.94  ? 69  PHE B CE1 1 
ATOM   1503 C CE2 . PHE B 1 77  ? -49.965 17.054  -23.966 1.00 97.93  ? 69  PHE B CE2 1 
ATOM   1504 C CZ  . PHE B 1 77  ? -49.922 16.000  -24.858 1.00 93.34  ? 69  PHE B CZ  1 
ATOM   1505 N N   . LEU B 1 78  ? -47.828 14.339  -17.989 1.00 86.43  ? 70  LEU B N   1 
ATOM   1506 C CA  . LEU B 1 78  ? -46.986 14.118  -16.822 1.00 86.89  ? 70  LEU B CA  1 
ATOM   1507 C C   . LEU B 1 78  ? -46.824 12.623  -16.578 1.00 90.62  ? 70  LEU B C   1 
ATOM   1508 O O   . LEU B 1 78  ? -45.716 12.139  -16.356 1.00 102.41 ? 70  LEU B O   1 
ATOM   1509 C CB  . LEU B 1 78  ? -47.577 14.808  -15.588 1.00 83.15  ? 70  LEU B CB  1 
ATOM   1510 C CG  . LEU B 1 78  ? -46.717 14.885  -14.322 1.00 84.89  ? 70  LEU B CG  1 
ATOM   1511 C CD1 . LEU B 1 78  ? -47.000 16.179  -13.578 1.00 93.57  ? 70  LEU B CD1 1 
ATOM   1512 C CD2 . LEU B 1 78  ? -46.959 13.691  -13.409 1.00 85.05  ? 70  LEU B CD2 1 
ATOM   1513 N N   . ILE B 1 79  ? -47.940 11.901  -16.633 1.00 71.92  ? 71  ILE B N   1 
ATOM   1514 C CA  . ILE B 1 79  ? -47.943 10.458  -16.415 1.00 63.27  ? 71  ILE B CA  1 
ATOM   1515 C C   . ILE B 1 79  ? -47.108 9.725   -17.464 1.00 67.73  ? 71  ILE B C   1 
ATOM   1516 O O   . ILE B 1 79  ? -46.361 8.803   -17.134 1.00 71.72  ? 71  ILE B O   1 
ATOM   1517 C CB  . ILE B 1 79  ? -49.380 9.901   -16.417 1.00 62.23  ? 71  ILE B CB  1 
ATOM   1518 C CG1 . ILE B 1 79  ? -50.137 10.402  -15.186 1.00 60.79  ? 71  ILE B CG1 1 
ATOM   1519 C CG2 . ILE B 1 79  ? -49.372 8.382   -16.436 1.00 61.22  ? 71  ILE B CG2 1 
ATOM   1520 C CD1 . ILE B 1 79  ? -49.488 10.012  -13.871 1.00 51.32  ? 71  ILE B CD1 1 
ATOM   1521 N N   . ARG B 1 80  ? -47.225 10.147  -18.721 1.00 77.87  ? 72  ARG B N   1 
ATOM   1522 C CA  . ARG B 1 80  ? -46.450 9.552   -19.809 1.00 70.76  ? 72  ARG B CA  1 
ATOM   1523 C C   . ARG B 1 80  ? -44.949 9.620   -19.540 1.00 76.06  ? 72  ARG B C   1 
ATOM   1524 O O   . ARG B 1 80  ? -44.216 8.674   -19.830 1.00 95.59  ? 72  ARG B O   1 
ATOM   1525 C CB  . ARG B 1 80  ? -46.766 10.242  -21.137 1.00 74.32  ? 72  ARG B CB  1 
ATOM   1526 C CG  . ARG B 1 80  ? -48.116 9.878   -21.731 1.00 66.60  ? 72  ARG B CG  1 
ATOM   1527 C CD  . ARG B 1 80  ? -48.341 10.591  -23.057 1.00 76.65  ? 72  ARG B CD  1 
ATOM   1528 N NE  . ARG B 1 80  ? -47.345 10.222  -24.061 1.00 94.24  ? 72  ARG B NE  1 
ATOM   1529 C CZ  . ARG B 1 80  ? -47.548 9.325   -25.021 1.00 87.63  ? 72  ARG B CZ  1 
ATOM   1530 N NH1 . ARG B 1 80  ? -48.715 8.702   -25.113 1.00 85.03  ? 72  ARG B NH1 1 
ATOM   1531 N NH2 . ARG B 1 80  ? -46.585 9.053   -25.891 1.00 92.24  ? 72  ARG B NH2 1 
ATOM   1532 N N   . LYS B 1 81  ? -44.499 10.740  -18.983 1.00 74.72  ? 73  LYS B N   1 
ATOM   1533 C CA  . LYS B 1 81  ? -43.089 10.917  -18.654 1.00 87.76  ? 73  LYS B CA  1 
ATOM   1534 C C   . LYS B 1 81  ? -42.678 10.036  -17.476 1.00 90.71  ? 73  LYS B C   1 
ATOM   1535 O O   . LYS B 1 81  ? -41.509 9.675   -17.339 1.00 107.78 ? 73  LYS B O   1 
ATOM   1536 C CB  . LYS B 1 81  ? -42.791 12.386  -18.342 1.00 58.05  ? 73  LYS B CB  1 
ATOM   1537 N N   . ARG B 1 82  ? -43.646 9.692   -16.632 1.00 77.00  ? 74  ARG B N   1 
ATOM   1538 C CA  . ARG B 1 82  ? -43.392 8.846   -15.469 1.00 72.01  ? 74  ARG B CA  1 
ATOM   1539 C C   . ARG B 1 82  ? -43.304 7.371   -15.861 1.00 82.67  ? 74  ARG B C   1 
ATOM   1540 O O   . ARG B 1 82  ? -42.492 6.623   -15.317 1.00 84.08  ? 74  ARG B O   1 
ATOM   1541 C CB  . ARG B 1 82  ? -44.483 9.045   -14.414 1.00 69.57  ? 74  ARG B CB  1 
ATOM   1542 C CG  . ARG B 1 82  ? -44.631 10.480  -13.933 1.00 70.19  ? 74  ARG B CG  1 
ATOM   1543 C CD  . ARG B 1 82  ? -43.579 10.843  -12.900 1.00 89.32  ? 74  ARG B CD  1 
ATOM   1544 N NE  . ARG B 1 82  ? -43.799 10.151  -11.633 1.00 108.05 ? 74  ARG B NE  1 
ATOM   1545 C CZ  . ARG B 1 82  ? -43.066 10.342  -10.542 1.00 126.47 ? 74  ARG B CZ  1 
ATOM   1546 N NH1 . ARG B 1 82  ? -42.059 11.205  -10.561 1.00 128.76 ? 74  ARG B NH1 1 
ATOM   1547 N NH2 . ARG B 1 82  ? -43.337 9.670   -9.431  1.00 127.98 ? 74  ARG B NH2 1 
ATOM   1548 N N   . ILE B 1 83  ? -44.145 6.960   -16.807 1.00 95.90  ? 75  ILE B N   1 
ATOM   1549 C CA  . ILE B 1 83  ? -44.135 5.589   -17.311 1.00 97.71  ? 75  ILE B CA  1 
ATOM   1550 C C   . ILE B 1 83  ? -42.939 5.389   -18.244 1.00 93.26  ? 75  ILE B C   1 
ATOM   1551 O O   . ILE B 1 83  ? -42.589 4.260   -18.600 1.00 90.63  ? 75  ILE B O   1 
ATOM   1552 C CB  . ILE B 1 83  ? -45.452 5.250   -18.056 1.00 82.38  ? 75  ILE B CB  1 
ATOM   1553 C CG1 . ILE B 1 83  ? -46.664 5.672   -17.225 1.00 95.82  ? 75  ILE B CG1 1 
ATOM   1554 C CG2 . ILE B 1 83  ? -45.550 3.762   -18.360 1.00 95.08  ? 75  ILE B CG2 1 
ATOM   1555 C CD1 . ILE B 1 83  ? -47.989 5.290   -17.849 1.00 107.83 ? 75  ILE B CD1 1 
ATOM   1556 N N   . HIS B 1 84  ? -42.311 6.502   -18.617 1.00 90.12  ? 76  HIS B N   1 
ATOM   1557 C CA  . HIS B 1 84  ? -41.174 6.516   -19.536 1.00 88.80  ? 76  HIS B CA  1 
ATOM   1558 C C   . HIS B 1 84  ? -41.566 5.975   -20.906 1.00 89.28  ? 76  HIS B C   1 
ATOM   1559 O O   . HIS B 1 84  ? -40.797 5.256   -21.544 1.00 106.60 ? 76  HIS B O   1 
ATOM   1560 C CB  . HIS B 1 84  ? -39.994 5.718   -18.968 1.00 94.38  ? 76  HIS B CB  1 
ATOM   1561 C CG  . HIS B 1 84  ? -39.480 6.244   -17.664 1.00 97.88  ? 76  HIS B CG  1 
ATOM   1562 N ND1 . HIS B 1 84  ? -38.883 7.477   -17.542 1.00 101.58 ? 76  HIS B ND1 1 
ATOM   1563 C CD2 . HIS B 1 84  ? -39.473 5.697   -16.422 1.00 99.00  ? 76  HIS B CD2 1 
ATOM   1564 C CE1 . HIS B 1 84  ? -38.530 7.674   -16.282 1.00 113.05 ? 76  HIS B CE1 1 
ATOM   1565 N NE2 . HIS B 1 84  ? -38.878 6.607   -15.585 1.00 109.20 ? 76  HIS B NE2 1 
ATOM   1566 N N   . LEU B 1 85  ? -42.769 6.325   -21.352 1.00 87.92  ? 77  LEU B N   1 
ATOM   1567 C CA  . LEU B 1 85  ? -43.227 5.950   -22.684 1.00 92.61  ? 77  LEU B CA  1 
ATOM   1568 C C   . LEU B 1 85  ? -42.622 6.871   -23.736 1.00 102.57 ? 77  LEU B C   1 
ATOM   1569 O O   . LEU B 1 85  ? -42.111 7.945   -23.415 1.00 96.38  ? 77  LEU B O   1 
ATOM   1570 C CB  . LEU B 1 85  ? -44.755 5.983   -22.765 1.00 78.29  ? 77  LEU B CB  1 
ATOM   1571 C CG  . LEU B 1 85  ? -45.511 4.934   -21.949 1.00 95.47  ? 77  LEU B CG  1 
ATOM   1572 C CD1 . LEU B 1 85  ? -47.012 5.122   -22.103 1.00 108.66 ? 77  LEU B CD1 1 
ATOM   1573 C CD2 . LEU B 1 85  ? -45.096 3.531   -22.365 1.00 91.27  ? 77  LEU B CD2 1 
ATOM   1574 N N   . ARG B 1 86  ? -42.683 6.445   -24.992 1.00 107.96 ? 78  ARG B N   1 
ATOM   1575 C CA  . ARG B 1 86  ? -42.090 7.195   -26.093 1.00 123.48 ? 78  ARG B CA  1 
ATOM   1576 C C   . ARG B 1 86  ? -43.134 7.559   -27.140 1.00 136.55 ? 78  ARG B C   1 
ATOM   1577 O O   . ARG B 1 86  ? -44.049 6.784   -27.399 1.00 141.55 ? 78  ARG B O   1 
ATOM   1578 C CB  . ARG B 1 86  ? -40.965 6.381   -26.743 1.00 116.63 ? 78  ARG B CB  1 
ATOM   1579 C CG  . ARG B 1 86  ? -41.436 5.035   -27.291 1.00 117.85 ? 78  ARG B CG  1 
ATOM   1580 C CD  . ARG B 1 86  ? -40.369 4.281   -28.067 1.00 141.61 ? 78  ARG B CD  1 
ATOM   1581 N NE  . ARG B 1 86  ? -40.465 2.842   -27.824 1.00 158.28 ? 78  ARG B NE  1 
ATOM   1582 C CZ  . ARG B 1 86  ? -41.190 2.002   -28.557 1.00 164.19 ? 78  ARG B CZ  1 
ATOM   1583 N NH1 . ARG B 1 86  ? -41.215 0.711   -28.255 1.00 160.68 ? 78  ARG B NH1 1 
ATOM   1584 N NH2 . ARG B 1 86  ? -41.892 2.450   -29.589 1.00 162.53 ? 78  ARG B NH2 1 
ATOM   1585 N N   . PRO B 1 87  ? -43.018 8.753   -27.735 1.00 134.16 ? 79  PRO B N   1 
ATOM   1586 C CA  . PRO B 1 87  ? -43.807 8.950   -28.952 1.00 133.08 ? 79  PRO B CA  1 
ATOM   1587 C C   . PRO B 1 87  ? -43.211 8.098   -30.072 1.00 149.16 ? 79  PRO B C   1 
ATOM   1588 O O   . PRO B 1 87  ? -42.026 8.242   -30.374 1.00 155.82 ? 79  PRO B O   1 
ATOM   1589 C CB  . PRO B 1 87  ? -43.670 10.450  -29.232 1.00 123.84 ? 79  PRO B CB  1 
ATOM   1590 C CG  . PRO B 1 87  ? -42.411 10.861  -28.536 1.00 123.66 ? 79  PRO B CG  1 
ATOM   1591 C CD  . PRO B 1 87  ? -42.297 9.971   -27.326 1.00 125.64 ? 79  PRO B CD  1 
ATOM   1592 N N   . GLU B 1 88  ? -44.011 7.227   -30.680 1.00 142.51 ? 80  GLU B N   1 
ATOM   1593 C CA  . GLU B 1 88  ? -45.449 7.180   -30.443 1.00 119.68 ? 80  GLU B CA  1 
ATOM   1594 C C   . GLU B 1 88  ? -45.923 5.936   -29.690 1.00 115.62 ? 80  GLU B C   1 
ATOM   1595 O O   . GLU B 1 88  ? -46.102 4.875   -30.289 1.00 127.15 ? 80  GLU B O   1 
ATOM   1596 C CB  . GLU B 1 88  ? -46.182 7.265   -31.780 1.00 149.43 ? 80  GLU B CB  1 
ATOM   1597 N N   . ASP B 1 89  ? -46.131 6.070   -28.382 1.00 116.98 ? 81  ASP B N   1 
ATOM   1598 C CA  . ASP B 1 89  ? -46.813 5.034   -27.608 1.00 130.93 ? 81  ASP B CA  1 
ATOM   1599 C C   . ASP B 1 89  ? -48.236 5.470   -27.292 1.00 131.51 ? 81  ASP B C   1 
ATOM   1600 O O   . ASP B 1 89  ? -48.457 6.549   -26.742 1.00 129.90 ? 81  ASP B O   1 
ATOM   1601 C CB  . ASP B 1 89  ? -46.076 4.717   -26.303 1.00 138.24 ? 81  ASP B CB  1 
ATOM   1602 C CG  . ASP B 1 89  ? -44.785 3.958   -26.526 1.00 142.03 ? 81  ASP B CG  1 
ATOM   1603 O OD1 . ASP B 1 89  ? -44.682 3.235   -27.540 1.00 139.45 ? 81  ASP B OD1 1 
ATOM   1604 O OD2 . ASP B 1 89  ? -43.884 4.062   -25.667 1.00 144.16 ? 81  ASP B OD2 1 
ATOM   1605 N N   . ALA B 1 90  ? -49.200 4.625   -27.639 1.00 133.96 ? 82  ALA B N   1 
ATOM   1606 C CA  . ALA B 1 90  ? -50.601 4.925   -27.377 1.00 128.76 ? 82  ALA B CA  1 
ATOM   1607 C C   . ALA B 1 90  ? -50.925 4.779   -25.894 1.00 118.86 ? 82  ALA B C   1 
ATOM   1608 O O   . ALA B 1 90  ? -50.660 3.739   -25.291 1.00 114.27 ? 82  ALA B O   1 
ATOM   1609 C CB  . ALA B 1 90  ? -51.500 4.023   -28.208 1.00 122.47 ? 82  ALA B CB  1 
ATOM   1610 N N   . LEU B 1 91  ? -51.491 5.831   -25.311 1.00 99.35  ? 83  LEU B N   1 
ATOM   1611 C CA  . LEU B 1 91  ? -51.931 5.793   -23.921 1.00 84.04  ? 83  LEU B CA  1 
ATOM   1612 C C   . LEU B 1 91  ? -53.252 6.537   -23.760 1.00 85.29  ? 83  LEU B C   1 
ATOM   1613 O O   . LEU B 1 91  ? -53.424 7.637   -24.284 1.00 87.29  ? 83  LEU B O   1 
ATOM   1614 C CB  . LEU B 1 91  ? -50.873 6.393   -22.995 1.00 76.71  ? 83  LEU B CB  1 
ATOM   1615 C CG  . LEU B 1 91  ? -51.133 6.195   -21.499 1.00 70.30  ? 83  LEU B CG  1 
ATOM   1616 C CD1 . LEU B 1 91  ? -50.869 4.751   -21.099 1.00 75.25  ? 83  LEU B CD1 1 
ATOM   1617 C CD2 . LEU B 1 91  ? -50.299 7.150   -20.661 1.00 71.34  ? 83  LEU B CD2 1 
ATOM   1618 N N   . PHE B 1 92  ? -54.184 5.930   -23.032 1.00 83.66  ? 84  PHE B N   1 
ATOM   1619 C CA  . PHE B 1 92  ? -55.493 6.532   -22.817 1.00 77.47  ? 84  PHE B CA  1 
ATOM   1620 C C   . PHE B 1 92  ? -55.899 6.478   -21.348 1.00 69.33  ? 84  PHE B C   1 
ATOM   1621 O O   . PHE B 1 92  ? -55.676 5.477   -20.670 1.00 68.29  ? 84  PHE B O   1 
ATOM   1622 C CB  . PHE B 1 92  ? -56.551 5.835   -23.674 1.00 84.59  ? 84  PHE B CB  1 
ATOM   1623 C CG  . PHE B 1 92  ? -56.330 5.984   -25.152 1.00 99.36  ? 84  PHE B CG  1 
ATOM   1624 C CD1 . PHE B 1 92  ? -56.784 7.107   -25.824 1.00 94.95  ? 84  PHE B CD1 1 
ATOM   1625 C CD2 . PHE B 1 92  ? -55.676 4.997   -25.872 1.00 98.86  ? 84  PHE B CD2 1 
ATOM   1626 C CE1 . PHE B 1 92  ? -56.585 7.246   -27.185 1.00 90.23  ? 84  PHE B CE1 1 
ATOM   1627 C CE2 . PHE B 1 92  ? -55.475 5.130   -27.233 1.00 84.43  ? 84  PHE B CE2 1 
ATOM   1628 C CZ  . PHE B 1 92  ? -55.930 6.256   -27.890 1.00 85.81  ? 84  PHE B CZ  1 
ATOM   1629 N N   . PHE B 1 93  ? -56.500 7.560   -20.866 1.00 66.94  ? 85  PHE B N   1 
ATOM   1630 C CA  . PHE B 1 93  ? -56.996 7.619   -19.497 1.00 63.76  ? 85  PHE B CA  1 
ATOM   1631 C C   . PHE B 1 93  ? -58.454 7.194   -19.421 1.00 71.19  ? 85  PHE B C   1 
ATOM   1632 O O   . PHE B 1 93  ? -59.251 7.511   -20.304 1.00 87.26  ? 85  PHE B O   1 
ATOM   1633 C CB  . PHE B 1 93  ? -56.839 9.028   -18.925 1.00 62.91  ? 85  PHE B CB  1 
ATOM   1634 C CG  . PHE B 1 93  ? -55.473 9.311   -18.377 1.00 66.96  ? 85  PHE B CG  1 
ATOM   1635 C CD1 . PHE B 1 93  ? -54.503 8.323   -18.351 1.00 76.55  ? 85  PHE B CD1 1 
ATOM   1636 C CD2 . PHE B 1 93  ? -55.161 10.563  -17.875 1.00 68.08  ? 85  PHE B CD2 1 
ATOM   1637 C CE1 . PHE B 1 93  ? -53.244 8.581   -17.844 1.00 77.42  ? 85  PHE B CE1 1 
ATOM   1638 C CE2 . PHE B 1 93  ? -53.907 10.827  -17.364 1.00 68.89  ? 85  PHE B CE2 1 
ATOM   1639 C CZ  . PHE B 1 93  ? -52.946 9.835   -17.349 1.00 69.88  ? 85  PHE B CZ  1 
ATOM   1640 N N   . PHE B 1 94  ? -58.797 6.478   -18.356 1.00 89.62  ? 86  PHE B N   1 
ATOM   1641 C CA  . PHE B 1 94  ? -60.169 6.045   -18.138 1.00 91.39  ? 86  PHE B CA  1 
ATOM   1642 C C   . PHE B 1 94  ? -60.638 6.390   -16.732 1.00 88.78  ? 86  PHE B C   1 
ATOM   1643 O O   . PHE B 1 94  ? -60.136 5.849   -15.748 1.00 90.35  ? 86  PHE B O   1 
ATOM   1644 C CB  . PHE B 1 94  ? -60.307 4.540   -18.378 1.00 91.83  ? 86  PHE B CB  1 
ATOM   1645 C CG  . PHE B 1 94  ? -59.995 4.118   -19.783 1.00 88.77  ? 86  PHE B CG  1 
ATOM   1646 C CD1 . PHE B 1 94  ? -60.971 4.158   -20.764 1.00 88.90  ? 86  PHE B CD1 1 
ATOM   1647 C CD2 . PHE B 1 94  ? -58.726 3.680   -20.122 1.00 96.73  ? 86  PHE B CD2 1 
ATOM   1648 C CE1 . PHE B 1 94  ? -60.687 3.770   -22.058 1.00 88.49  ? 86  PHE B CE1 1 
ATOM   1649 C CE2 . PHE B 1 94  ? -58.436 3.291   -21.414 1.00 115.75 ? 86  PHE B CE2 1 
ATOM   1650 C CZ  . PHE B 1 94  ? -59.417 3.336   -22.382 1.00 109.10 ? 86  PHE B CZ  1 
ATOM   1651 N N   . VAL B 1 95  ? -61.598 7.305   -16.647 1.00 94.09  ? 87  VAL B N   1 
ATOM   1652 C CA  . VAL B 1 95  ? -62.247 7.623   -15.384 1.00 92.34  ? 87  VAL B CA  1 
ATOM   1653 C C   . VAL B 1 95  ? -63.703 7.178   -15.462 1.00 97.00  ? 87  VAL B C   1 
ATOM   1654 O O   . VAL B 1 95  ? -64.463 7.678   -16.293 1.00 91.25  ? 87  VAL B O   1 
ATOM   1655 C CB  . VAL B 1 95  ? -62.170 9.124   -15.058 1.00 80.35  ? 87  VAL B CB  1 
ATOM   1656 C CG1 . VAL B 1 95  ? -62.787 9.398   -13.699 1.00 78.85  ? 87  VAL B CG1 1 
ATOM   1657 C CG2 . VAL B 1 95  ? -60.726 9.600   -15.097 1.00 81.92  ? 87  VAL B CG2 1 
ATOM   1658 N N   . ASN B 1 96  ? -64.076 6.239   -14.596 1.00 104.78 ? 88  ASN B N   1 
ATOM   1659 C CA  . ASN B 1 96  ? -65.374 5.569   -14.668 1.00 106.90 ? 88  ASN B CA  1 
ATOM   1660 C C   . ASN B 1 96  ? -65.596 4.945   -16.042 1.00 106.03 ? 88  ASN B C   1 
ATOM   1661 O O   . ASN B 1 96  ? -66.663 5.098   -16.639 1.00 112.65 ? 88  ASN B O   1 
ATOM   1662 C CB  . ASN B 1 96  ? -66.515 6.537   -14.338 1.00 112.48 ? 88  ASN B CB  1 
ATOM   1663 C CG  . ASN B 1 96  ? -66.789 6.631   -12.849 1.00 107.12 ? 88  ASN B CG  1 
ATOM   1664 O OD1 . ASN B 1 96  ? -66.427 5.739   -12.081 1.00 91.55  ? 88  ASN B OD1 1 
ATOM   1665 N ND2 . ASN B 1 96  ? -67.435 7.715   -12.434 1.00 123.84 ? 88  ASN B ND2 1 
ATOM   1666 N N   . ASN B 1 97  ? -64.568 4.254   -16.534 1.00 104.98 ? 89  ASN B N   1 
ATOM   1667 C CA  . ASN B 1 97  ? -64.603 3.560   -17.822 1.00 110.86 ? 89  ASN B CA  1 
ATOM   1668 C C   . ASN B 1 97  ? -64.882 4.478   -19.013 1.00 105.22 ? 89  ASN B C   1 
ATOM   1669 O O   . ASN B 1 97  ? -65.293 4.015   -20.077 1.00 105.89 ? 89  ASN B O   1 
ATOM   1670 C CB  . ASN B 1 97  ? -65.641 2.434   -17.790 1.00 121.66 ? 89  ASN B CB  1 
ATOM   1671 C CG  . ASN B 1 97  ? -65.239 1.297   -16.871 1.00 133.59 ? 89  ASN B CG  1 
ATOM   1672 O OD1 . ASN B 1 97  ? -65.858 1.075   -15.830 1.00 138.89 ? 89  ASN B OD1 1 
ATOM   1673 N ND2 . ASN B 1 97  ? -64.199 0.566   -17.254 1.00 139.90 ? 89  ASN B ND2 1 
ATOM   1674 N N   . THR B 1 98  ? -64.647 5.774   -18.836 1.00 98.69  ? 90  THR B N   1 
ATOM   1675 C CA  . THR B 1 98  ? -64.872 6.745   -19.901 1.00 89.35  ? 90  THR B CA  1 
ATOM   1676 C C   . THR B 1 98  ? -63.673 7.674   -20.059 1.00 96.91  ? 90  THR B C   1 
ATOM   1677 O O   . THR B 1 98  ? -63.175 8.229   -19.079 1.00 88.27  ? 90  THR B O   1 
ATOM   1678 C CB  . THR B 1 98  ? -66.134 7.591   -19.638 1.00 89.87  ? 90  THR B CB  1 
ATOM   1679 O OG1 . THR B 1 98  ? -67.281 6.736   -19.563 1.00 119.59 ? 90  THR B OG1 1 
ATOM   1680 C CG2 . THR B 1 98  ? -66.341 8.609   -20.751 1.00 76.36  ? 90  THR B CG2 1 
ATOM   1681 N N   . ILE B 1 99  ? -63.211 7.833   -21.295 1.00 102.59 ? 91  ILE B N   1 
ATOM   1682 C CA  . ILE B 1 99  ? -62.112 8.744   -21.589 1.00 85.74  ? 91  ILE B CA  1 
ATOM   1683 C C   . ILE B 1 99  ? -62.544 10.189  -21.363 1.00 87.02  ? 91  ILE B C   1 
ATOM   1684 O O   . ILE B 1 99  ? -63.441 10.687  -22.044 1.00 84.64  ? 91  ILE B O   1 
ATOM   1685 C CB  . ILE B 1 99  ? -61.610 8.582   -23.034 1.00 80.85  ? 91  ILE B CB  1 
ATOM   1686 C CG1 . ILE B 1 99  ? -61.094 7.160   -23.263 1.00 74.38  ? 91  ILE B CG1 1 
ATOM   1687 C CG2 . ILE B 1 99  ? -60.521 9.597   -23.333 1.00 79.29  ? 91  ILE B CG2 1 
ATOM   1688 C CD1 . ILE B 1 99  ? -60.633 6.899   -24.681 1.00 84.16  ? 91  ILE B CD1 1 
ATOM   1689 N N   . PRO B 1 100 ? -61.904 10.865  -20.397 1.00 78.54  ? 92  PRO B N   1 
ATOM   1690 C CA  . PRO B 1 100 ? -62.257 12.240  -20.036 1.00 67.66  ? 92  PRO B CA  1 
ATOM   1691 C C   . PRO B 1 100 ? -61.755 13.257  -21.055 1.00 71.56  ? 92  PRO B C   1 
ATOM   1692 O O   . PRO B 1 100 ? -60.745 13.009  -21.714 1.00 76.50  ? 92  PRO B O   1 
ATOM   1693 C CB  . PRO B 1 100 ? -61.559 12.431  -18.688 1.00 73.95  ? 92  PRO B CB  1 
ATOM   1694 C CG  . PRO B 1 100 ? -60.360 11.551  -18.777 1.00 67.65  ? 92  PRO B CG  1 
ATOM   1695 C CD  . PRO B 1 100 ? -60.787 10.351  -19.584 1.00 75.44  ? 92  PRO B CD  1 
ATOM   1696 N N   . PRO B 1 101 ? -62.458 14.392  -21.185 1.00 77.22  ? 93  PRO B N   1 
ATOM   1697 C CA  . PRO B 1 101 ? -62.000 15.475  -22.061 1.00 76.37  ? 93  PRO B CA  1 
ATOM   1698 C C   . PRO B 1 101 ? -60.699 16.084  -21.550 1.00 75.81  ? 93  PRO B C   1 
ATOM   1699 O O   . PRO B 1 101 ? -60.546 16.284  -20.345 1.00 67.85  ? 93  PRO B O   1 
ATOM   1700 C CB  . PRO B 1 101 ? -63.149 16.488  -22.002 1.00 76.22  ? 93  PRO B CB  1 
ATOM   1701 C CG  . PRO B 1 101 ? -63.833 16.208  -20.707 1.00 87.90  ? 93  PRO B CG  1 
ATOM   1702 C CD  . PRO B 1 101 ? -63.718 14.727  -20.500 1.00 80.89  ? 93  PRO B CD  1 
ATOM   1703 N N   . THR B 1 102 ? -59.773 16.368  -22.460 1.00 75.58  ? 94  THR B N   1 
ATOM   1704 C CA  . THR B 1 102 ? -58.461 16.884  -22.083 1.00 81.03  ? 94  THR B CA  1 
ATOM   1705 C C   . THR B 1 102 ? -58.552 18.274  -21.463 1.00 73.18  ? 94  THR B C   1 
ATOM   1706 O O   . THR B 1 102 ? -57.696 18.667  -20.671 1.00 63.71  ? 94  THR B O   1 
ATOM   1707 C CB  . THR B 1 102 ? -57.513 16.941  -23.295 1.00 71.96  ? 94  THR B CB  1 
ATOM   1708 O OG1 . THR B 1 102 ? -58.012 17.884  -24.251 1.00 77.06  ? 94  THR B OG1 1 
ATOM   1709 C CG2 . THR B 1 102 ? -57.404 15.573  -23.949 1.00 75.87  ? 94  THR B CG2 1 
ATOM   1710 N N   . SER B 1 103 ? -59.597 19.011  -21.825 1.00 76.83  ? 95  SER B N   1 
ATOM   1711 C CA  . SER B 1 103 ? -59.778 20.378  -21.349 1.00 69.67  ? 95  SER B CA  1 
ATOM   1712 C C   . SER B 1 103 ? -60.367 20.426  -19.940 1.00 71.30  ? 95  SER B C   1 
ATOM   1713 O O   . SER B 1 103 ? -60.384 21.479  -19.303 1.00 74.39  ? 95  SER B O   1 
ATOM   1714 C CB  . SER B 1 103 ? -60.670 21.159  -22.316 1.00 70.20  ? 95  SER B CB  1 
ATOM   1715 O OG  . SER B 1 103 ? -61.855 20.439  -22.610 1.00 76.13  ? 95  SER B OG  1 
ATOM   1716 N N   . ALA B 1 104 ? -60.849 19.284  -19.459 1.00 71.96  ? 96  ALA B N   1 
ATOM   1717 C CA  . ALA B 1 104 ? -61.428 19.202  -18.123 1.00 66.18  ? 96  ALA B CA  1 
ATOM   1718 C C   . ALA B 1 104 ? -60.357 19.346  -17.049 1.00 74.54  ? 96  ALA B C   1 
ATOM   1719 O O   . ALA B 1 104 ? -59.258 18.811  -17.183 1.00 85.32  ? 96  ALA B O   1 
ATOM   1720 C CB  . ALA B 1 104 ? -62.174 17.889  -17.948 1.00 60.47  ? 96  ALA B CB  1 
ATOM   1721 N N   . THR B 1 105 ? -60.680 20.074  -15.986 1.00 88.21  ? 97  THR B N   1 
ATOM   1722 C CA  . THR B 1 105 ? -59.759 20.235  -14.867 1.00 68.74  ? 97  THR B CA  1 
ATOM   1723 C C   . THR B 1 105 ? -59.874 19.050  -13.916 1.00 64.28  ? 97  THR B C   1 
ATOM   1724 O O   . THR B 1 105 ? -60.930 18.422  -13.823 1.00 59.51  ? 97  THR B O   1 
ATOM   1725 C CB  . THR B 1 105 ? -60.022 21.537  -14.089 1.00 71.56  ? 97  THR B CB  1 
ATOM   1726 O OG1 . THR B 1 105 ? -61.283 21.450  -13.415 1.00 76.86  ? 97  THR B OG1 1 
ATOM   1727 C CG2 . THR B 1 105 ? -60.033 22.731  -15.032 1.00 70.96  ? 97  THR B CG2 1 
ATOM   1728 N N   . MET B 1 106 ? -58.785 18.749  -13.214 1.00 59.67  ? 98  MET B N   1 
ATOM   1729 C CA  . MET B 1 106 ? -58.773 17.651  -12.253 1.00 65.29  ? 98  MET B CA  1 
ATOM   1730 C C   . MET B 1 106 ? -59.770 17.900  -11.126 1.00 72.96  ? 98  MET B C   1 
ATOM   1731 O O   . MET B 1 106 ? -60.329 16.960  -10.566 1.00 79.73  ? 98  MET B O   1 
ATOM   1732 C CB  . MET B 1 106 ? -57.369 17.449  -11.676 1.00 63.35  ? 98  MET B CB  1 
ATOM   1733 C CG  . MET B 1 106 ? -56.320 17.051  -12.703 1.00 54.52  ? 98  MET B CG  1 
ATOM   1734 S SD  . MET B 1 106 ? -56.741 15.546  -13.603 1.00 61.09  ? 98  MET B SD  1 
ATOM   1735 C CE  . MET B 1 106 ? -56.656 14.326  -12.296 1.00 49.81  ? 98  MET B CE  1 
ATOM   1736 N N   . GLY B 1 107 ? -59.989 19.170  -10.802 1.00 64.28  ? 99  GLY B N   1 
ATOM   1737 C CA  . GLY B 1 107 ? -60.962 19.542  -9.792  1.00 65.86  ? 99  GLY B CA  1 
ATOM   1738 C C   . GLY B 1 107 ? -62.380 19.247  -10.239 1.00 71.16  ? 99  GLY B C   1 
ATOM   1739 O O   . GLY B 1 107 ? -63.185 18.718  -9.473  1.00 73.90  ? 99  GLY B O   1 
ATOM   1740 N N   . GLN B 1 108 ? -62.687 19.592  -11.486 1.00 80.95  ? 100 GLN B N   1 
ATOM   1741 C CA  . GLN B 1 108 ? -64.008 19.335  -12.047 1.00 74.38  ? 100 GLN B CA  1 
ATOM   1742 C C   . GLN B 1 108 ? -64.206 17.841  -12.270 1.00 74.37  ? 100 GLN B C   1 
ATOM   1743 O O   . GLN B 1 108 ? -65.313 17.320  -12.126 1.00 74.30  ? 100 GLN B O   1 
ATOM   1744 C CB  . GLN B 1 108 ? -64.198 20.097  -13.360 1.00 77.25  ? 100 GLN B CB  1 
ATOM   1745 C CG  . GLN B 1 108 ? -65.597 19.988  -13.944 1.00 84.90  ? 100 GLN B CG  1 
ATOM   1746 C CD  . GLN B 1 108 ? -66.664 20.501  -12.996 1.00 98.62  ? 100 GLN B CD  1 
ATOM   1747 O OE1 . GLN B 1 108 ? -66.514 21.562  -12.389 1.00 104.41 ? 100 GLN B OE1 1 
ATOM   1748 N NE2 . GLN B 1 108 ? -67.749 19.746  -12.862 1.00 100.07 ? 100 GLN B NE2 1 
ATOM   1749 N N   . LEU B 1 109 ? -63.123 17.157  -12.620 1.00 75.40  ? 101 LEU B N   1 
ATOM   1750 C CA  . LEU B 1 109 ? -63.166 15.718  -12.839 1.00 70.72  ? 101 LEU B CA  1 
ATOM   1751 C C   . LEU B 1 109 ? -63.336 14.987  -11.512 1.00 79.05  ? 101 LEU B C   1 
ATOM   1752 O O   . LEU B 1 109 ? -63.981 13.941  -11.445 1.00 92.00  ? 101 LEU B O   1 
ATOM   1753 C CB  . LEU B 1 109 ? -61.899 15.243  -13.552 1.00 68.21  ? 101 LEU B CB  1 
ATOM   1754 C CG  . LEU B 1 109 ? -61.981 13.858  -14.195 1.00 69.91  ? 101 LEU B CG  1 
ATOM   1755 C CD1 . LEU B 1 109 ? -62.916 13.886  -15.393 1.00 66.03  ? 101 LEU B CD1 1 
ATOM   1756 C CD2 . LEU B 1 109 ? -60.600 13.359  -14.592 1.00 61.08  ? 101 LEU B CD2 1 
ATOM   1757 N N   . TYR B 1 110 ? -62.751 15.549  -10.459 1.00 84.89  ? 102 TYR B N   1 
ATOM   1758 C CA  . TYR B 1 110 ? -62.878 14.998  -9.115  1.00 77.02  ? 102 TYR B CA  1 
ATOM   1759 C C   . TYR B 1 110 ? -64.301 15.171  -8.597  1.00 82.08  ? 102 TYR B C   1 
ATOM   1760 O O   . TYR B 1 110 ? -64.911 14.227  -8.101  1.00 81.06  ? 102 TYR B O   1 
ATOM   1761 C CB  . TYR B 1 110 ? -61.883 15.670  -8.163  1.00 67.19  ? 102 TYR B CB  1 
ATOM   1762 C CG  . TYR B 1 110 ? -61.934 15.170  -6.736  1.00 71.92  ? 102 TYR B CG  1 
ATOM   1763 C CD1 . TYR B 1 110 ? -62.747 15.785  -5.791  1.00 76.52  ? 102 TYR B CD1 1 
ATOM   1764 C CD2 . TYR B 1 110 ? -61.161 14.090  -6.330  1.00 72.07  ? 102 TYR B CD2 1 
ATOM   1765 C CE1 . TYR B 1 110 ? -62.795 15.334  -4.485  1.00 75.42  ? 102 TYR B CE1 1 
ATOM   1766 C CE2 . TYR B 1 110 ? -61.201 13.632  -5.026  1.00 76.01  ? 102 TYR B CE2 1 
ATOM   1767 C CZ  . TYR B 1 110 ? -62.019 14.257  -4.109  1.00 76.86  ? 102 TYR B CZ  1 
ATOM   1768 O OH  . TYR B 1 110 ? -62.062 13.805  -2.810  1.00 85.02  ? 102 TYR B OH  1 
ATOM   1769 N N   . GLU B 1 111 ? -64.825 16.386  -8.732  1.00 71.31  ? 103 GLU B N   1 
ATOM   1770 C CA  . GLU B 1 111 ? -66.144 16.734  -8.210  1.00 74.91  ? 103 GLU B CA  1 
ATOM   1771 C C   . GLU B 1 111 ? -67.264 15.912  -8.855  1.00 83.31  ? 103 GLU B C   1 
ATOM   1772 O O   . GLU B 1 111 ? -68.371 15.831  -8.322  1.00 93.35  ? 103 GLU B O   1 
ATOM   1773 C CB  . GLU B 1 111 ? -66.400 18.233  -8.409  1.00 95.14  ? 103 GLU B CB  1 
ATOM   1774 C CG  . GLU B 1 111 ? -67.647 18.772  -7.718  1.00 123.67 ? 103 GLU B CG  1 
ATOM   1775 C CD  . GLU B 1 111 ? -67.706 20.289  -7.717  1.00 137.75 ? 103 GLU B CD  1 
ATOM   1776 O OE1 . GLU B 1 111 ? -66.632 20.927  -7.742  1.00 137.42 ? 103 GLU B OE1 1 
ATOM   1777 O OE2 . GLU B 1 111 ? -68.826 20.842  -7.695  1.00 142.69 ? 103 GLU B OE2 1 
ATOM   1778 N N   . ASP B 1 112 ? -66.971 15.289  -9.992  1.00 89.08  ? 104 ASP B N   1 
ATOM   1779 C CA  . ASP B 1 112 ? -67.980 14.520  -10.714 1.00 83.85  ? 104 ASP B CA  1 
ATOM   1780 C C   . ASP B 1 112 ? -67.787 13.010  -10.597 1.00 94.80  ? 104 ASP B C   1 
ATOM   1781 O O   . ASP B 1 112 ? -68.752 12.251  -10.694 1.00 105.65 ? 104 ASP B O   1 
ATOM   1782 C CB  . ASP B 1 112 ? -67.990 14.918  -12.191 1.00 78.71  ? 104 ASP B CB  1 
ATOM   1783 C CG  . ASP B 1 112 ? -68.485 16.333  -12.410 1.00 92.20  ? 104 ASP B CG  1 
ATOM   1784 O OD1 . ASP B 1 112 ? -69.329 16.797  -11.615 1.00 105.62 ? 104 ASP B OD1 1 
ATOM   1785 O OD2 . ASP B 1 112 ? -68.030 16.981  -13.376 1.00 101.37 ? 104 ASP B OD2 1 
ATOM   1786 N N   . ASN B 1 113 ? -66.549 12.571  -10.384 1.00 89.38  ? 105 ASN B N   1 
ATOM   1787 C CA  . ASN B 1 113 ? -66.246 11.144  -10.448 1.00 96.75  ? 105 ASN B CA  1 
ATOM   1788 C C   . ASN B 1 113 ? -65.491 10.573  -9.248  1.00 91.69  ? 105 ASN B C   1 
ATOM   1789 O O   . ASN B 1 113 ? -64.974 9.457   -9.320  1.00 109.75 ? 105 ASN B O   1 
ATOM   1790 C CB  . ASN B 1 113 ? -65.447 10.849  -11.720 1.00 103.69 ? 105 ASN B CB  1 
ATOM   1791 C CG  . ASN B 1 113 ? -66.274 11.011  -12.980 1.00 111.72 ? 105 ASN B CG  1 
ATOM   1792 O OD1 . ASN B 1 113 ? -67.495 10.854  -12.961 1.00 139.23 ? 105 ASN B OD1 1 
ATOM   1793 N ND2 . ASN B 1 113 ? -65.610 11.330  -14.085 1.00 98.52  ? 105 ASN B ND2 1 
ATOM   1794 N N   . HIS B 1 114 ? -65.423 11.318  -8.149  1.00 76.49  ? 106 HIS B N   1 
ATOM   1795 C CA  . HIS B 1 114 ? -64.737 10.813  -6.962  1.00 78.93  ? 106 HIS B CA  1 
ATOM   1796 C C   . HIS B 1 114 ? -65.581 9.736   -6.286  1.00 89.97  ? 106 HIS B C   1 
ATOM   1797 O O   . HIS B 1 114 ? -66.784 9.909   -6.089  1.00 99.74  ? 106 HIS B O   1 
ATOM   1798 C CB  . HIS B 1 114 ? -64.417 11.947  -5.980  1.00 85.63  ? 106 HIS B CB  1 
ATOM   1799 C CG  . HIS B 1 114 ? -65.615 12.495  -5.263  1.00 96.59  ? 106 HIS B CG  1 
ATOM   1800 N ND1 . HIS B 1 114 ? -66.132 11.910  -4.129  1.00 93.58  ? 106 HIS B ND1 1 
ATOM   1801 C CD2 . HIS B 1 114 ? -66.387 13.576  -5.519  1.00 102.76 ? 106 HIS B CD2 1 
ATOM   1802 C CE1 . HIS B 1 114 ? -67.178 12.608  -3.717  1.00 92.79  ? 106 HIS B CE1 1 
ATOM   1803 N NE2 . HIS B 1 114 ? -67.354 13.622  -4.541  1.00 92.88  ? 106 HIS B NE2 1 
ATOM   1804 N N   . GLU B 1 115 ? -64.947 8.619   -5.944  1.00 92.04  ? 107 GLU B N   1 
ATOM   1805 C CA  . GLU B 1 115 ? -65.654 7.512   -5.307  1.00 102.94 ? 107 GLU B CA  1 
ATOM   1806 C C   . GLU B 1 115 ? -65.955 7.823   -3.843  1.00 103.18 ? 107 GLU B C   1 
ATOM   1807 O O   . GLU B 1 115 ? -65.627 8.901   -3.347  1.00 101.01 ? 107 GLU B O   1 
ATOM   1808 C CB  . GLU B 1 115 ? -64.847 6.216   -5.429  1.00 95.79  ? 107 GLU B CB  1 
ATOM   1809 C CG  . GLU B 1 115 ? -64.689 5.727   -6.863  1.00 92.05  ? 107 GLU B CG  1 
ATOM   1810 C CD  . GLU B 1 115 ? -64.100 4.331   -6.950  1.00 100.31 ? 107 GLU B CD  1 
ATOM   1811 O OE1 . GLU B 1 115 ? -63.865 3.714   -5.890  1.00 101.40 ? 107 GLU B OE1 1 
ATOM   1812 O OE2 . GLU B 1 115 ? -63.871 3.851   -8.082  1.00 100.53 ? 107 GLU B OE2 1 
ATOM   1813 N N   . GLU B 1 116 ? -66.577 6.870   -3.155  1.00 101.27 ? 108 GLU B N   1 
ATOM   1814 C CA  . GLU B 1 116 ? -67.068 7.088   -1.796  1.00 106.18 ? 108 GLU B CA  1 
ATOM   1815 C C   . GLU B 1 116 ? -65.956 7.317   -0.771  1.00 121.55 ? 108 GLU B C   1 
ATOM   1816 O O   . GLU B 1 116 ? -66.220 7.760   0.347   1.00 125.95 ? 108 GLU B O   1 
ATOM   1817 C CB  . GLU B 1 116 ? -67.932 5.903   -1.358  1.00 91.46  ? 108 GLU B CB  1 
ATOM   1818 N N   . ASP B 1 117 ? -64.717 7.017   -1.152  1.00 126.34 ? 109 ASP B N   1 
ATOM   1819 C CA  . ASP B 1 117 ? -63.581 7.189   -0.251  1.00 118.94 ? 109 ASP B CA  1 
ATOM   1820 C C   . ASP B 1 117 ? -62.847 8.501   -0.514  1.00 109.45 ? 109 ASP B C   1 
ATOM   1821 O O   . ASP B 1 117 ? -61.720 8.693   -0.054  1.00 102.36 ? 109 ASP B O   1 
ATOM   1822 C CB  . ASP B 1 117 ? -62.615 6.008   -0.381  1.00 113.99 ? 109 ASP B CB  1 
ATOM   1823 C CG  . ASP B 1 117 ? -62.114 5.817   -1.799  1.00 114.18 ? 109 ASP B CG  1 
ATOM   1824 O OD1 . ASP B 1 117 ? -62.713 6.398   -2.728  1.00 114.44 ? 109 ASP B OD1 1 
ATOM   1825 O OD2 . ASP B 1 117 ? -61.122 5.081   -1.985  1.00 120.61 ? 109 ASP B OD2 1 
ATOM   1826 N N   . TYR B 1 118 ? -63.501 9.394   -1.254  1.00 112.08 ? 110 TYR B N   1 
ATOM   1827 C CA  . TYR B 1 118 ? -62.945 10.697  -1.621  1.00 105.77 ? 110 TYR B CA  1 
ATOM   1828 C C   . TYR B 1 118 ? -61.628 10.566  -2.385  1.00 101.45 ? 110 TYR B C   1 
ATOM   1829 O O   . TYR B 1 118 ? -60.713 11.374  -2.214  1.00 100.01 ? 110 TYR B O   1 
ATOM   1830 C CB  . TYR B 1 118 ? -62.757 11.573  -0.378  1.00 101.47 ? 110 TYR B CB  1 
ATOM   1831 C CG  . TYR B 1 118 ? -64.049 11.881  0.346   1.00 110.94 ? 110 TYR B CG  1 
ATOM   1832 C CD1 . TYR B 1 118 ? -64.962 12.786  -0.179  1.00 116.22 ? 110 TYR B CD1 1 
ATOM   1833 C CD2 . TYR B 1 118 ? -64.356 11.266  1.553   1.00 115.19 ? 110 TYR B CD2 1 
ATOM   1834 C CE1 . TYR B 1 118 ? -66.146 13.070  0.477   1.00 118.00 ? 110 TYR B CE1 1 
ATOM   1835 C CE2 . TYR B 1 118 ? -65.536 11.544  2.217   1.00 122.77 ? 110 TYR B CE2 1 
ATOM   1836 C CZ  . TYR B 1 118 ? -66.427 12.447  1.675   1.00 129.29 ? 110 TYR B CZ  1 
ATOM   1837 O OH  . TYR B 1 118 ? -67.603 12.726  2.332   1.00 150.27 ? 110 TYR B OH  1 
ATOM   1838 N N   . PHE B 1 119 ? -61.546 9.542   -3.228  1.00 94.98  ? 111 PHE B N   1 
ATOM   1839 C CA  . PHE B 1 119 ? -60.399 9.343   -4.107  1.00 84.87  ? 111 PHE B CA  1 
ATOM   1840 C C   . PHE B 1 119 ? -60.837 9.350   -5.568  1.00 76.28  ? 111 PHE B C   1 
ATOM   1841 O O   . PHE B 1 119 ? -61.897 8.824   -5.907  1.00 83.64  ? 111 PHE B O   1 
ATOM   1842 C CB  . PHE B 1 119 ? -59.685 8.027   -3.785  1.00 84.22  ? 111 PHE B CB  1 
ATOM   1843 C CG  . PHE B 1 119 ? -58.723 8.118   -2.633  1.00 93.61  ? 111 PHE B CG  1 
ATOM   1844 C CD1 . PHE B 1 119 ? -58.017 9.284   -2.391  1.00 109.21 ? 111 PHE B CD1 1 
ATOM   1845 C CD2 . PHE B 1 119 ? -58.519 7.031   -1.799  1.00 102.59 ? 111 PHE B CD2 1 
ATOM   1846 C CE1 . PHE B 1 119 ? -57.129 9.366   -1.333  1.00 108.64 ? 111 PHE B CE1 1 
ATOM   1847 C CE2 . PHE B 1 119 ? -57.633 7.108   -0.740  1.00 106.52 ? 111 PHE B CE2 1 
ATOM   1848 C CZ  . PHE B 1 119 ? -56.937 8.277   -0.507  1.00 96.70  ? 111 PHE B CZ  1 
ATOM   1849 N N   . LEU B 1 120 ? -60.022 9.950   -6.428  1.00 71.23  ? 112 LEU B N   1 
ATOM   1850 C CA  . LEU B 1 120 ? -60.279 9.923   -7.864  1.00 71.49  ? 112 LEU B CA  1 
ATOM   1851 C C   . LEU B 1 120 ? -59.429 8.846   -8.526  1.00 66.30  ? 112 LEU B C   1 
ATOM   1852 O O   . LEU B 1 120 ? -58.201 8.896   -8.476  1.00 71.52  ? 112 LEU B O   1 
ATOM   1853 C CB  . LEU B 1 120 ? -59.994 11.287  -8.496  1.00 70.28  ? 112 LEU B CB  1 
ATOM   1854 C CG  . LEU B 1 120 ? -60.118 11.348  -10.021 1.00 60.07  ? 112 LEU B CG  1 
ATOM   1855 C CD1 . LEU B 1 120 ? -61.532 11.002  -10.464 1.00 60.31  ? 112 LEU B CD1 1 
ATOM   1856 C CD2 . LEU B 1 120 ? -59.708 12.717  -10.541 1.00 58.01  ? 112 LEU B CD2 1 
ATOM   1857 N N   . TYR B 1 121 ? -60.085 7.871   -9.144  1.00 64.73  ? 113 TYR B N   1 
ATOM   1858 C CA  . TYR B 1 121 ? -59.375 6.756   -9.757  1.00 64.78  ? 113 TYR B CA  1 
ATOM   1859 C C   . TYR B 1 121 ? -59.232 6.929   -11.265 1.00 66.85  ? 113 TYR B C   1 
ATOM   1860 O O   . TYR B 1 121 ? -60.221 7.068   -11.985 1.00 65.55  ? 113 TYR B O   1 
ATOM   1861 C CB  . TYR B 1 121 ? -60.085 5.438   -9.440  1.00 64.65  ? 113 TYR B CB  1 
ATOM   1862 C CG  . TYR B 1 121 ? -59.978 5.031   -7.987  1.00 76.85  ? 113 TYR B CG  1 
ATOM   1863 C CD1 . TYR B 1 121 ? -60.894 5.488   -7.047  1.00 75.11  ? 113 TYR B CD1 1 
ATOM   1864 C CD2 . TYR B 1 121 ? -58.959 4.192   -7.554  1.00 85.86  ? 113 TYR B CD2 1 
ATOM   1865 C CE1 . TYR B 1 121 ? -60.798 5.120   -5.718  1.00 80.78  ? 113 TYR B CE1 1 
ATOM   1866 C CE2 . TYR B 1 121 ? -58.855 3.819   -6.227  1.00 95.08  ? 113 TYR B CE2 1 
ATOM   1867 C CZ  . TYR B 1 121 ? -59.777 4.285   -5.314  1.00 93.88  ? 113 TYR B CZ  1 
ATOM   1868 O OH  . TYR B 1 121 ? -59.678 3.915   -3.992  1.00 87.29  ? 113 TYR B OH  1 
ATOM   1869 N N   . VAL B 1 122 ? -57.987 6.926   -11.732 1.00 64.12  ? 114 VAL B N   1 
ATOM   1870 C CA  . VAL B 1 122 ? -57.691 7.038   -13.154 1.00 55.85  ? 114 VAL B CA  1 
ATOM   1871 C C   . VAL B 1 122 ? -56.966 5.795   -13.654 1.00 63.63  ? 114 VAL B C   1 
ATOM   1872 O O   . VAL B 1 122 ? -55.900 5.443   -13.149 1.00 77.80  ? 114 VAL B O   1 
ATOM   1873 C CB  . VAL B 1 122 ? -56.828 8.279   -13.461 1.00 64.55  ? 114 VAL B CB  1 
ATOM   1874 C CG1 . VAL B 1 122 ? -56.433 8.301   -14.931 1.00 50.81  ? 114 VAL B CG1 1 
ATOM   1875 C CG2 . VAL B 1 122 ? -57.569 9.551   -13.081 1.00 54.65  ? 114 VAL B CG2 1 
ATOM   1876 N N   . ALA B 1 123 ? -57.550 5.130   -14.644 1.00 81.57  ? 115 ALA B N   1 
ATOM   1877 C CA  . ALA B 1 123 ? -56.938 3.947   -15.234 1.00 81.57  ? 115 ALA B CA  1 
ATOM   1878 C C   . ALA B 1 123 ? -56.322 4.283   -16.586 1.00 81.09  ? 115 ALA B C   1 
ATOM   1879 O O   . ALA B 1 123 ? -56.867 5.089   -17.339 1.00 87.82  ? 115 ALA B O   1 
ATOM   1880 C CB  . ALA B 1 123 ? -57.961 2.831   -15.376 1.00 74.17  ? 115 ALA B CB  1 
ATOM   1881 N N   . TYR B 1 124 ? -55.184 3.668   -16.890 1.00 79.50  ? 116 TYR B N   1 
ATOM   1882 C CA  . TYR B 1 124 ? -54.528 3.899   -18.170 1.00 78.94  ? 116 TYR B CA  1 
ATOM   1883 C C   . TYR B 1 124 ? -54.274 2.593   -18.916 1.00 86.84  ? 116 TYR B C   1 
ATOM   1884 O O   . TYR B 1 124 ? -54.019 1.554   -18.307 1.00 73.77  ? 116 TYR B O   1 
ATOM   1885 C CB  . TYR B 1 124 ? -53.215 4.665   -17.973 1.00 70.71  ? 116 TYR B CB  1 
ATOM   1886 C CG  . TYR B 1 124 ? -52.188 3.949   -17.125 1.00 83.44  ? 116 TYR B CG  1 
ATOM   1887 C CD1 . TYR B 1 124 ? -51.230 3.126   -17.704 1.00 91.78  ? 116 TYR B CD1 1 
ATOM   1888 C CD2 . TYR B 1 124 ? -52.168 4.105   -15.745 1.00 82.89  ? 116 TYR B CD2 1 
ATOM   1889 C CE1 . TYR B 1 124 ? -50.288 2.473   -16.933 1.00 102.06 ? 116 TYR B CE1 1 
ATOM   1890 C CE2 . TYR B 1 124 ? -51.228 3.457   -14.966 1.00 86.09  ? 116 TYR B CE2 1 
ATOM   1891 C CZ  . TYR B 1 124 ? -50.292 2.642   -15.565 1.00 97.94  ? 116 TYR B CZ  1 
ATOM   1892 O OH  . TYR B 1 124 ? -49.355 1.993   -14.794 1.00 102.25 ? 116 TYR B OH  1 
ATOM   1893 N N   . SER B 1 125 ? -54.357 2.658   -20.241 1.00 103.94 ? 117 SER B N   1 
ATOM   1894 C CA  . SER B 1 125 ? -54.109 1.503   -21.097 1.00 111.36 ? 117 SER B CA  1 
ATOM   1895 C C   . SER B 1 125 ? -53.622 1.962   -22.467 1.00 98.91  ? 117 SER B C   1 
ATOM   1896 O O   . SER B 1 125 ? -53.607 3.158   -22.757 1.00 93.78  ? 117 SER B O   1 
ATOM   1897 C CB  . SER B 1 125 ? -55.373 0.652   -21.241 1.00 111.33 ? 117 SER B CB  1 
ATOM   1898 O OG  . SER B 1 125 ? -55.158 -0.442  -22.117 1.00 108.51 ? 117 SER B OG  1 
ATOM   1899 N N   . ASP B 1 126 ? -53.220 1.013   -23.306 1.00 106.90 ? 118 ASP B N   1 
ATOM   1900 C CA  . ASP B 1 126 ? -52.771 1.342   -24.654 1.00 99.57  ? 118 ASP B CA  1 
ATOM   1901 C C   . ASP B 1 126 ? -53.899 1.143   -25.662 1.00 105.56 ? 118 ASP B C   1 
ATOM   1902 O O   . ASP B 1 126 ? -53.725 1.368   -26.859 1.00 120.14 ? 118 ASP B O   1 
ATOM   1903 C CB  . ASP B 1 126 ? -51.548 0.506   -25.036 1.00 82.65  ? 118 ASP B CB  1 
ATOM   1904 C CG  . ASP B 1 126 ? -51.760 -0.975  -24.816 1.00 99.88  ? 118 ASP B CG  1 
ATOM   1905 O OD1 . ASP B 1 126 ? -51.669 -1.427  -23.655 1.00 105.65 ? 118 ASP B OD1 1 
ATOM   1906 O OD2 . ASP B 1 126 ? -52.012 -1.692  -25.808 1.00 114.69 ? 118 ASP B OD2 1 
ATOM   1907 N N   . GLU B 1 127 ? -55.057 0.724   -25.162 1.00 101.01 ? 119 GLU B N   1 
ATOM   1908 C CA  . GLU B 1 127 ? -56.257 0.608   -25.982 1.00 95.65  ? 119 GLU B CA  1 
ATOM   1909 C C   . GLU B 1 127 ? -57.298 1.627   -25.526 1.00 86.78  ? 119 GLU B C   1 
ATOM   1910 O O   . GLU B 1 127 ? -57.082 2.351   -24.555 1.00 97.27  ? 119 GLU B O   1 
ATOM   1911 C CB  . GLU B 1 127 ? -56.828 -0.810  -25.911 1.00 101.44 ? 119 GLU B CB  1 
ATOM   1912 N N   . SER B 1 128 ? -58.425 1.682   -26.228 1.00 90.20  ? 120 SER B N   1 
ATOM   1913 C CA  . SER B 1 128 ? -59.503 2.600   -25.873 1.00 104.01 ? 120 SER B CA  1 
ATOM   1914 C C   . SER B 1 128 ? -60.588 1.873   -25.081 1.00 130.28 ? 120 SER B C   1 
ATOM   1915 O O   . SER B 1 128 ? -61.682 2.400   -24.871 1.00 130.67 ? 120 SER B O   1 
ATOM   1916 C CB  . SER B 1 128 ? -60.099 3.236   -27.130 1.00 118.59 ? 120 SER B CB  1 
ATOM   1917 O OG  . SER B 1 128 ? -59.091 3.841   -27.923 1.00 124.54 ? 120 SER B OG  1 
ATOM   1918 N N   . VAL B 1 129 ? -60.256 0.664   -24.635 1.00 146.71 ? 121 VAL B N   1 
ATOM   1919 C CA  . VAL B 1 129 ? -61.188 -0.263  -23.995 1.00 150.98 ? 121 VAL B CA  1 
ATOM   1920 C C   . VAL B 1 129 ? -60.385 -1.137  -23.021 1.00 151.94 ? 121 VAL B C   1 
ATOM   1921 O O   . VAL B 1 129 ? -59.314 -1.617  -23.391 1.00 170.74 ? 121 VAL B O   1 
ATOM   1922 C CB  . VAL B 1 129 ? -61.919 -1.138  -25.063 1.00 127.32 ? 121 VAL B CB  1 
ATOM   1923 C CG1 . VAL B 1 129 ? -62.575 -2.360  -24.451 1.00 141.03 ? 121 VAL B CG1 1 
ATOM   1924 C CG2 . VAL B 1 129 ? -62.946 -0.317  -25.839 1.00 116.13 ? 121 VAL B CG2 1 
ATOM   1925 N N   . TYR B 1 130 ? -60.861 -1.349  -21.790 1.00 126.57 ? 122 TYR B N   1 
ATOM   1926 C CA  . TYR B 1 130 ? -62.152 -0.873  -21.295 1.00 118.30 ? 122 TYR B CA  1 
ATOM   1927 C C   . TYR B 1 130 ? -62.031 -0.103  -19.983 1.00 135.62 ? 122 TYR B C   1 
ATOM   1928 O O   . TYR B 1 130 ? -63.007 0.476   -19.506 1.00 145.87 ? 122 TYR B O   1 
ATOM   1929 C CB  . TYR B 1 130 ? -63.108 -2.051  -21.089 1.00 108.85 ? 122 TYR B CB  1 
ATOM   1930 N N   . GLY B 1 131 ? -60.842 -0.115  -19.391 1.00 142.80 ? 123 GLY B N   1 
ATOM   1931 C CA  . GLY B 1 131 ? -60.627 0.542   -18.115 1.00 131.45 ? 123 GLY B CA  1 
ATOM   1932 C C   . GLY B 1 131 ? -61.202 -0.249  -16.955 1.00 122.26 ? 123 GLY B C   1 
ATOM   1933 O O   . GLY B 1 131 ? -60.573 -0.385  -15.905 1.00 112.47 ? 123 GLY B O   1 
HETATM 1934 C C1  . MPD C 2 .   ? -47.709 44.320  12.219  1.00 63.86  ? 201 MPD A C1  1 
HETATM 1935 C C2  . MPD C 2 .   ? -46.700 43.245  11.836  1.00 88.64  ? 201 MPD A C2  1 
HETATM 1936 O O2  . MPD C 2 .   ? -45.531 43.883  11.262  1.00 117.08 ? 201 MPD A O2  1 
HETATM 1937 C CM  . MPD C 2 .   ? -46.277 42.480  13.085  1.00 79.20  ? 201 MPD A CM  1 
HETATM 1938 C C3  . MPD C 2 .   ? -47.303 42.283  10.816  1.00 89.97  ? 201 MPD A C3  1 
HETATM 1939 C C4  . MPD C 2 .   ? -47.049 42.695  9.367   1.00 88.71  ? 201 MPD A C4  1 
HETATM 1940 O O4  . MPD C 2 .   ? -46.717 44.063  9.279   1.00 94.84  ? 201 MPD A O4  1 
HETATM 1941 C C5  . MPD C 2 .   ? -45.925 41.867  8.753   1.00 84.23  ? 201 MPD A C5  1 
HETATM 1942 C C1  . MPD D 2 .   ? -47.908 15.997  -29.363 1.00 74.43  ? 201 MPD B C1  1 
HETATM 1943 C C2  . MPD D 2 .   ? -46.907 15.046  -30.005 1.00 89.74  ? 201 MPD B C2  1 
HETATM 1944 O O2  . MPD D 2 .   ? -47.563 14.321  -31.075 1.00 82.07  ? 201 MPD B O2  1 
HETATM 1945 C CM  . MPD D 2 .   ? -45.750 15.845  -30.592 1.00 106.97 ? 201 MPD B CM  1 
HETATM 1946 C C3  . MPD D 2 .   ? -46.401 14.042  -28.976 1.00 85.30  ? 201 MPD B C3  1 
HETATM 1947 C C4  . MPD D 2 .   ? -47.381 12.886  -28.822 1.00 84.44  ? 201 MPD B C4  1 
HETATM 1948 O O4  . MPD D 2 .   ? -46.855 11.736  -29.446 1.00 95.62  ? 201 MPD B O4  1 
HETATM 1949 C C5  . MPD D 2 .   ? -47.649 12.589  -27.351 1.00 86.26  ? 201 MPD B C5  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 8   ? 2.1531 1.5064 1.9187 0.1884  -0.4161 -0.1045 0   GLU A N   
2    C CA  . GLU A 8   ? 2.2474 1.4951 1.9943 0.2116  -0.4417 -0.1199 0   GLU A CA  
3    C C   . GLU A 8   ? 2.1942 1.4018 1.9456 0.1876  -0.4482 -0.1551 0   GLU A C   
4    O O   . GLU A 8   ? 2.2388 1.4112 1.9797 0.2247  -0.4599 -0.1970 0   GLU A O   
5    C CB  . GLU A 8   ? 2.2046 1.3494 1.9198 0.2032  -0.4549 -0.0697 0   GLU A CB  
6    C CG  . GLU A 8   ? 2.2784 1.2967 1.9718 0.2288  -0.4833 -0.0808 0   GLU A CG  
7    C CD  . GLU A 8   ? 2.4130 1.3216 2.0682 0.2185  -0.4933 -0.0241 0   GLU A CD  
8    O OE1 . GLU A 8   ? 2.4380 1.3734 2.0799 0.1898  -0.4742 0.0228  0   GLU A OE1 
9    O OE2 . GLU A 8   ? 2.4774 1.2672 2.1111 0.2391  -0.5175 -0.0263 0   GLU A OE2 
10   N N   . ASP A 9   ? 2.0830 1.2938 1.8494 0.1312  -0.4439 -0.1449 1   ASP A N   
11   C CA  . ASP A 9   ? 2.0802 1.3322 1.8720 0.0804  -0.4263 -0.1020 1   ASP A CA  
12   C C   . ASP A 9   ? 1.9201 1.2876 1.7274 0.0840  -0.3990 -0.0926 1   ASP A C   
13   O O   . ASP A 9   ? 1.8760 1.2629 1.6843 0.0698  -0.3823 -0.0528 1   ASP A O   
14   C CB  . ASP A 9   ? 2.2921 1.4624 2.0711 0.0629  -0.4276 -0.0518 1   ASP A CB  
15   C CG  . ASP A 9   ? 2.3449 1.5225 2.1616 -0.0015 -0.4127 -0.0192 1   ASP A CG  
16   O OD1 . ASP A 9   ? 2.3258 1.5394 2.1805 -0.0321 -0.4179 -0.0417 1   ASP A OD1 
17   O OD2 . ASP A 9   ? 2.3648 1.5127 2.1732 -0.0207 -0.3955 0.0290  1   ASP A OD2 
18   N N   . GLU A 10  ? 1.8361 1.2736 1.6501 0.1018  -0.3921 -0.1301 2   GLU A N   
19   C CA  . GLU A 10  ? 1.6778 1.2193 1.5097 0.1019  -0.3668 -0.1266 2   GLU A CA  
20   C C   . GLU A 10  ? 1.7079 1.3009 1.5560 0.0792  -0.3587 -0.1485 2   GLU A C   
21   O O   . GLU A 10  ? 1.8512 1.4234 1.6818 0.0891  -0.3691 -0.1839 2   GLU A O   
22   C CB  . GLU A 10  ? 1.5049 1.0870 1.3307 0.1517  -0.3636 -0.1468 2   GLU A CB  
23   N N   . TRP A 11  ? 1.4973 1.1518 1.3724 0.0511  -0.3403 -0.1273 3   TRP A N   
24   C CA  . TRP A 11  ? 1.3576 1.0549 1.2478 0.0295  -0.3368 -0.1398 3   TRP A CA  
25   C C   . TRP A 11  ? 1.3006 1.0390 1.1701 0.0552  -0.3257 -0.1746 3   TRP A C   
26   O O   . TRP A 11  ? 1.2532 1.0315 1.1236 0.0816  -0.3086 -0.1821 3   TRP A O   
27   C CB  . TRP A 11  ? 1.3726 1.1290 1.3017 0.0022  -0.3163 -0.1100 3   TRP A CB  
28   C CG  . TRP A 11  ? 1.4628 1.1907 1.4253 -0.0336 -0.3211 -0.0792 3   TRP A CG  
29   C CD1 . TRP A 11  ? 1.4352 1.1527 1.4057 -0.0434 -0.3039 -0.0453 3   TRP A CD1 
30   C CD2 . TRP A 11  ? 1.6527 1.3609 1.6473 -0.0663 -0.3434 -0.0799 3   TRP A CD2 
31   N NE1 . TRP A 11  ? 1.4932 1.1888 1.5060 -0.0827 -0.3070 -0.0238 3   TRP A NE1 
32   C CE2 . TRP A 11  ? 1.6564 1.3498 1.6922 -0.0976 -0.3345 -0.0460 3   TRP A CE2 
33   C CE3 . TRP A 11  ? 1.7253 1.4265 1.7150 -0.0728 -0.3714 -0.1064 3   TRP A CE3 
34   C CZ2 . TRP A 11  ? 1.7958 1.4766 1.8860 -0.1369 -0.3533 -0.0399 3   TRP A CZ2 
35   C CZ3 . TRP A 11  ? 1.7200 1.4043 1.7534 -0.1090 -0.3976 -0.1011 3   TRP A CZ3 
36   C CH2 . TRP A 11  ? 1.7956 1.4744 1.8876 -0.1416 -0.3889 -0.0691 3   TRP A CH2 
37   N N   . VAL A 12  ? 1.3052 1.0328 1.1552 0.0457  -0.3357 -0.1957 4   VAL A N   
38   C CA  . VAL A 12  ? 1.2905 1.0524 1.1125 0.0631  -0.3180 -0.2244 4   VAL A CA  
39   C C   . VAL A 12  ? 1.2983 1.1166 1.1352 0.0415  -0.3036 -0.2088 4   VAL A C   
40   O O   . VAL A 12  ? 1.4126 1.2209 1.2572 0.0155  -0.3228 -0.1957 4   VAL A O   
41   C CB  . VAL A 12  ? 1.2518 0.9560 1.0201 0.0703  -0.3354 -0.2591 4   VAL A CB  
42   C CG1 . VAL A 12  ? 1.0764 0.8151 0.8074 0.0842  -0.3081 -0.2842 4   VAL A CG1 
43   C CG2 . VAL A 12  ? 1.3902 1.0316 1.1451 0.0969  -0.3482 -0.2788 4   VAL A CG2 
44   N N   . ASN A 13  ? 1.3312 1.2079 1.1780 0.0527  -0.2724 -0.2114 5   ASN A N   
45   C CA  . ASN A 13  ? 1.2264 1.1498 1.0894 0.0348  -0.2561 -0.1953 5   ASN A CA  
46   C C   . ASN A 13  ? 1.3386 1.2585 1.1560 0.0334  -0.2486 -0.2105 5   ASN A C   
47   O O   . ASN A 13  ? 1.4897 1.4179 1.2793 0.0506  -0.2254 -0.2349 5   ASN A O   
48   C CB  . ASN A 13  ? 1.1608 1.1419 1.0569 0.0425  -0.2273 -0.1903 5   ASN A CB  
49   C CG  . ASN A 13  ? 1.2287 1.2109 1.1544 0.0409  -0.2335 -0.1688 5   ASN A CG  
50   O OD1 . ASN A 13  ? 1.1319 1.0985 1.0748 0.0206  -0.2441 -0.1449 5   ASN A OD1 
51   N ND2 . ASN A 13  ? 1.2343 1.2354 1.1657 0.0624  -0.2267 -0.1771 5   ASN A ND2 
52   N N   . VAL A 14  ? 1.1860 1.0936 0.9961 0.0134  -0.2680 -0.1948 6   VAL A N   
53   C CA  . VAL A 14  ? 1.0929 0.9901 0.8481 0.0110  -0.2645 -0.2004 6   VAL A CA  
54   C C   . VAL A 14  ? 1.2058 1.1414 0.9908 -0.0012 -0.2499 -0.1743 6   VAL A C   
55   O O   . VAL A 14  ? 1.1249 1.0768 0.9639 -0.0137 -0.2648 -0.1514 6   VAL A O   
56   C CB  . VAL A 14  ? 1.0815 0.9230 0.7909 0.0022  -0.3093 -0.2061 6   VAL A CB  
57   C CG1 . VAL A 14  ? 1.1481 0.9717 0.7836 0.0015  -0.3084 -0.2071 6   VAL A CG1 
58   C CG2 . VAL A 14  ? 1.1516 0.9436 0.8273 0.0148  -0.3232 -0.2365 6   VAL A CG2 
59   N N   . GLY A 15  ? 1.3832 1.3316 1.1366 0.0023  -0.2170 -0.1784 7   GLY A N   
60   C CA  . GLY A 15  ? 1.3641 1.3378 1.1411 -0.0078 -0.2005 -0.1555 7   GLY A CA  
61   C C   . GLY A 15  ? 1.4689 1.4064 1.1783 -0.0119 -0.2066 -0.1453 7   GLY A C   
62   O O   . GLY A 15  ? 1.5967 1.4908 1.2323 -0.0076 -0.2229 -0.1581 7   GLY A O   
63   N N   . SER A 16  ? 1.5000 1.4482 1.2271 -0.0188 -0.1944 -0.1222 8   SER A N   
64   C CA  . SER A 16  ? 1.4749 1.3811 1.1321 -0.0209 -0.2002 -0.1054 8   SER A CA  
65   C C   . SER A 16  ? 1.4020 1.2903 0.9852 -0.0210 -0.1550 -0.1190 8   SER A C   
66   O O   . SER A 16  ? 1.3200 1.2384 0.9223 -0.0180 -0.1213 -0.1441 8   SER A O   
67   C CB  . SER A 16  ? 1.5738 1.4901 1.2762 -0.0253 -0.1978 -0.0763 8   SER A CB  
68   O OG  . SER A 16  ? 1.7594 1.6973 1.5354 -0.0244 -0.2345 -0.0646 8   SER A OG  
69   N N   . LYS A 17  ? 1.5178 1.3574 1.0180 -0.0237 -0.1536 -0.1012 9   LYS A N   
70   C CA  . LYS A 17  ? 1.6675 1.4842 1.0881 -0.0274 -0.1036 -0.1102 9   LYS A CA  
71   C C   . LYS A 17  ? 1.5572 1.4117 1.0330 -0.0405 -0.0461 -0.1072 9   LYS A C   
72   O O   . LYS A 17  ? 1.4912 1.3347 0.9849 -0.0493 -0.0421 -0.0797 9   LYS A O   
73   C CB  . LYS A 17  ? 1.5401 1.2819 0.8392 -0.0274 -0.1201 -0.0868 9   LYS A CB  
74   N N   . PHE A 18  ? 1.4659 1.3646 0.9746 -0.0408 -0.0045 -0.1378 10  PHE A N   
75   C CA  . PHE A 18  ? 1.4581 1.3954 1.0179 -0.0568 0.0510  -0.1419 10  PHE A CA  
76   C C   . PHE A 18  ? 1.4894 1.4039 0.9736 -0.0662 0.1065  -0.1482 10  PHE A C   
77   O O   . PHE A 18  ? 1.5571 1.4486 0.9699 -0.0538 0.1082  -0.1653 10  PHE A O   
78   C CB  . PHE A 18  ? 1.3622 1.3752 1.0256 -0.0512 0.0575  -0.1720 10  PHE A CB  
79   C CG  . PHE A 18  ? 1.2884 1.3262 1.0272 -0.0500 0.0241  -0.1618 10  PHE A CG  
80   C CD1 . PHE A 18  ? 1.3051 1.3339 1.0505 -0.0363 -0.0254 -0.1570 10  PHE A CD1 
81   C CD2 . PHE A 18  ? 1.1831 1.2509 0.9852 -0.0647 0.0454  -0.1590 10  PHE A CD2 
82   C CE1 . PHE A 18  ? 1.2278 1.2801 1.0391 -0.0363 -0.0468 -0.1472 10  PHE A CE1 
83   C CE2 . PHE A 18  ? 1.1307 1.2176 0.9913 -0.0621 0.0201  -0.1527 10  PHE A CE2 
84   C CZ  . PHE A 18  ? 1.1666 1.2472 1.0305 -0.0474 -0.0229 -0.1457 10  PHE A CZ  
85   N N   . GLN A 19  ? 1.4550 1.3711 0.9524 -0.0894 0.1548  -0.1352 11  GLN A N   
86   C CA  . GLN A 19  ? 1.5917 1.4841 1.0183 -0.1042 0.2178  -0.1360 11  GLN A CA  
87   C C   . GLN A 19  ? 1.6482 1.6053 1.1173 -0.0972 0.2582  -0.1811 11  GLN A C   
88   O O   . GLN A 19  ? 1.7186 1.6522 1.1073 -0.0944 0.2961  -0.1923 11  GLN A O   
89   C CB  . GLN A 19  ? 1.5320 1.4135 0.9813 -0.1359 0.2632  -0.1122 11  GLN A CB  
90   C CG  . GLN A 19  ? 1.8554 1.7034 1.2256 -0.1573 0.3355  -0.1053 11  GLN A CG  
91   C CD  . GLN A 19  ? 2.1206 1.8694 1.3252 -0.1479 0.3221  -0.0757 11  GLN A CD  
92   O OE1 . GLN A 19  ? 2.2310 1.9095 1.3777 -0.1476 0.2860  -0.0346 11  GLN A OE1 
93   N NE2 . GLN A 19  ? 2.1979 1.9390 1.3233 -0.1374 0.3486  -0.0982 11  GLN A NE2 
94   N N   . TYR A 20  ? 1.6296 1.6664 1.2222 -0.0916 0.2491  -0.2074 12  TYR A N   
95   C CA  . TYR A 20  ? 1.5223 1.6261 1.1720 -0.0765 0.2740  -0.2512 12  TYR A CA  
96   C C   . TYR A 20  ? 1.4838 1.5511 1.0602 -0.0451 0.2410  -0.2660 12  TYR A C   
97   O O   . TYR A 20  ? 1.5447 1.6348 1.1183 -0.0285 0.2700  -0.2998 12  TYR A O   
98   C CB  . TYR A 20  ? 1.3743 1.5596 1.1587 -0.0714 0.2527  -0.2717 12  TYR A CB  
99   C CG  . TYR A 20  ? 1.3604 1.6268 1.2272 -0.0575 0.2815  -0.3156 12  TYR A CG  
100  C CD1 . TYR A 20  ? 1.3899 1.7119 1.3183 -0.0806 0.3446  -0.3314 12  TYR A CD1 
101  C CD2 . TYR A 20  ? 1.2759 1.5636 1.1667 -0.0212 0.2452  -0.3408 12  TYR A CD2 
102  C CE1 . TYR A 20  ? 1.3483 1.7556 1.3692 -0.0651 0.3687  -0.3737 12  TYR A CE1 
103  C CE2 . TYR A 20  ? 1.1838 1.5461 1.1569 -0.0022 0.2671  -0.3809 12  TYR A CE2 
104  C CZ  . TYR A 20  ? 1.1997 1.6270 1.2423 -0.0228 0.3279  -0.3984 12  TYR A CZ  
105  O OH  . TYR A 20  ? 1.1253 1.6373 1.2658 -0.0011 0.3473  -0.4404 12  TYR A OH  
106  N N   . LYS A 21  ? 1.4492 1.4594 0.9714 -0.0376 0.1807  -0.2426 13  LYS A N   
107  C CA  . LYS A 21  ? 1.5002 1.4651 0.9497 -0.0137 0.1426  -0.2558 13  LYS A CA  
108  C C   . LYS A 21  ? 1.8671 1.7509 1.1684 -0.0167 0.1542  -0.2448 13  LYS A C   
109  O O   . LYS A 21  ? 2.0772 1.9107 1.3013 -0.0002 0.1169  -0.2559 13  LYS A O   
110  C CB  . LYS A 21  ? 1.4184 1.3702 0.8975 -0.0060 0.0694  -0.2408 13  LYS A CB  
111  C CG  . LYS A 21  ? 1.4993 1.5170 1.0973 0.0026  0.0540  -0.2541 13  LYS A CG  
112  C CD  . LYS A 21  ? 1.5403 1.5418 1.1619 0.0022  -0.0047 -0.2311 13  LYS A CD  
113  C CE  . LYS A 21  ? 1.6417 1.5910 1.2057 0.0160  -0.0502 -0.2384 13  LYS A CE  
114  N NZ  . LYS A 21  ? 1.6063 1.5490 1.2110 0.0124  -0.1035 -0.2173 13  LYS A NZ  
115  N N   . GLU A 22  ? 1.7657 1.6323 1.0221 -0.0389 0.2065  -0.2243 14  GLU A N   
116  C CA  . GLU A 22  ? 1.8436 1.6331 0.9462 -0.0418 0.2325  -0.2153 14  GLU A CA  
117  C C   . GLU A 22  ? 2.0402 1.8575 1.1301 -0.0491 0.3241  -0.2401 14  GLU A C   
118  O O   . GLU A 22  ? 2.1884 1.9550 1.1548 -0.0416 0.3540  -0.2525 14  GLU A O   
119  C CB  . GLU A 22  ? 1.7843 1.5083 0.8160 -0.0616 0.2195  -0.1625 14  GLU A CB  
120  N N   . ASP A 23  ? 1.9185 1.8197 1.1396 -0.0635 0.3687  -0.2506 15  ASP A N   
121  C CA  . ASP A 23  ? 1.9335 1.8743 1.1698 -0.0784 0.4616  -0.2696 15  ASP A CA  
122  C C   . ASP A 23  ? 2.0151 2.0171 1.2995 -0.0500 0.4930  -0.3262 15  ASP A C   
123  O O   . ASP A 23  ? 2.1956 2.2141 1.4574 -0.0571 0.5738  -0.3443 15  ASP A O   
124  C CB  . ASP A 23  ? 1.8482 1.8570 1.2171 -0.1107 0.4950  -0.2591 15  ASP A CB  
125  C CG  . ASP A 23  ? 1.8940 1.8381 1.2182 -0.1393 0.4807  -0.2057 15  ASP A CG  
126  O OD1 . ASP A 23  ? 2.0869 1.9422 1.2903 -0.1304 0.4357  -0.1749 15  ASP A OD1 
127  O OD2 . ASP A 23  ? 1.7546 1.7358 1.1693 -0.1696 0.5111  -0.1963 15  ASP A OD2 
128  N N   . HIS A 24  ? 1.7094 1.7394 1.0563 -0.0178 0.4330  -0.3524 16  HIS A N   
129  C CA  . HIS A 24  ? 1.7801 1.8892 1.2295 0.0116  0.4513  -0.4037 16  HIS A CA  
130  C C   . HIS A 24  ? 1.7083 1.7882 1.1349 0.0532  0.3925  -0.4315 16  HIS A C   
131  O O   . HIS A 24  ? 1.5105 1.6214 1.0253 0.0652  0.3372  -0.4317 16  HIS A O   
132  C CB  . HIS A 24  ? 1.7742 1.9808 1.3964 0.0058  0.4361  -0.4079 16  HIS A CB  
133  C CG  . HIS A 24  ? 1.7030 1.9776 1.4097 -0.0284 0.5038  -0.4061 16  HIS A CG  
134  N ND1 . HIS A 24  ? 1.5185 1.8418 1.3311 -0.0516 0.4833  -0.3910 16  HIS A ND1 
135  C CD2 . HIS A 24  ? 1.8104 2.1180 1.5237 -0.0444 0.5921  -0.4218 16  HIS A CD2 
136  C CE1 . HIS A 24  ? 1.6157 1.9951 1.4971 -0.0831 0.5513  -0.3969 16  HIS A CE1 
137  N NE2 . HIS A 24  ? 1.7763 2.1505 1.6039 -0.0807 0.6207  -0.4139 16  HIS A NE2 
138  N N   . PRO A 25  ? 1.9810 2.0018 1.2943 0.0750  0.4074  -0.4576 17  PRO A N   
139  C CA  . PRO A 25  ? 2.0909 2.0516 1.3516 0.1065  0.3412  -0.4770 17  PRO A CA  
140  C C   . PRO A 25  ? 2.0652 2.0718 1.4534 0.1304  0.2850  -0.4899 17  PRO A C   
141  O O   . PRO A 25  ? 2.0157 2.1115 1.5323 0.1399  0.3113  -0.5070 17  PRO A O   
142  C CB  . PRO A 25  ? 2.0377 1.9749 1.2223 0.1329  0.3965  -0.5248 17  PRO A CB  
143  C CG  . PRO A 25  ? 1.9025 1.9274 1.1672 0.1233  0.4884  -0.5378 17  PRO A CG  
144  C CD  . PRO A 25  ? 1.8958 1.9258 1.1610 0.0769  0.4979  -0.4852 17  PRO A CD  
145  N N   . PHE A 26  ? 2.0158 1.9610 1.3676 0.1399  0.2100  -0.4828 18  PHE A N   
146  C CA  . PHE A 26  ? 1.7865 1.7592 1.2422 0.1589  0.1560  -0.4866 18  PHE A CA  
147  C C   . PHE A 26  ? 1.8048 1.8330 1.3469 0.1971  0.1840  -0.5312 18  PHE A C   
148  O O   . PHE A 26  ? 1.6992 1.7884 1.3571 0.2082  0.1643  -0.5294 18  PHE A O   
149  C CB  . PHE A 26  ? 1.7052 1.5920 1.0968 0.1646  0.0834  -0.4821 18  PHE A CB  
150  C CG  . PHE A 26  ? 1.6036 1.5036 1.0870 0.1835  0.0339  -0.4840 18  PHE A CG  
151  C CD1 . PHE A 26  ? 1.3812 1.3169 0.9407 0.1658  0.0013  -0.4471 18  PHE A CD1 
152  C CD2 . PHE A 26  ? 1.7117 1.5800 1.1969 0.2201  0.0219  -0.5222 18  PHE A CD2 
153  C CE1 . PHE A 26  ? 1.4513 1.3905 1.0791 0.1821  -0.0406 -0.4447 18  PHE A CE1 
154  C CE2 . PHE A 26  ? 1.5656 1.4334 1.1246 0.2374  -0.0235 -0.5185 18  PHE A CE2 
155  C CZ  . PHE A 26  ? 1.5253 1.4281 1.1513 0.2174  -0.0540 -0.4779 18  PHE A CZ  
156  N N   . GLU A 27  ? 1.9707 1.9776 1.4545 0.2196  0.2298  -0.5718 19  GLU A N   
157  C CA  . GLU A 27  ? 1.9067 1.9691 1.4785 0.2619  0.2612  -0.6187 19  GLU A CA  
158  C C   . GLU A 27  ? 1.9857 2.1687 1.6884 0.2538  0.3132  -0.6200 19  GLU A C   
159  O O   . GLU A 27  ? 1.9926 2.2471 1.8165 0.2863  0.3153  -0.6470 19  GLU A O   
160  C CB  . GLU A 27  ? 1.8044 1.8113 1.2805 0.2840  0.3071  -0.6572 19  GLU A CB  
161  N N   . TYR A 28  ? 1.9126 2.1151 1.5927 0.2101  0.3512  -0.5905 20  TYR A N   
162  C CA  . TYR A 28  ? 1.5665 1.8778 1.3694 0.1916  0.4002  -0.5900 20  TYR A CA  
163  C C   . TYR A 28  ? 1.4521 1.8034 1.3438 0.1719  0.3458  -0.5563 20  TYR A C   
164  O O   . TYR A 28  ? 1.4550 1.8995 1.4824 0.1802  0.3468  -0.5705 20  TYR A O   
165  C CB  . TYR A 28  ? 1.5447 1.8486 1.2766 0.1521  0.4763  -0.5758 20  TYR A CB  
166  N N   . ARG A 29  ? 1.6094 1.8921 1.4261 0.1476  0.2974  -0.5144 21  ARG A N   
167  C CA  . ARG A 29  ? 1.4453 1.7544 1.3328 0.1336  0.2445  -0.4851 21  ARG A CA  
168  C C   . ARG A 29  ? 1.4330 1.7720 1.4030 0.1717  0.1956  -0.5031 21  ARG A C   
169  O O   . ARG A 29  ? 1.3980 1.8069 1.4714 0.1718  0.1796  -0.5022 21  ARG A O   
170  C CB  . ARG A 29  ? 1.2832 1.5098 1.0796 0.1112  0.1969  -0.4425 21  ARG A CB  
171  C CG  . ARG A 29  ? 1.2892 1.4849 1.0113 0.0745  0.2340  -0.4160 21  ARG A CG  
172  C CD  . ARG A 29  ? 1.3874 1.5112 1.0333 0.0546  0.1870  -0.3736 21  ARG A CD  
173  N NE  . ARG A 29  ? 2.0143 2.0940 1.5660 0.0291  0.2267  -0.3530 21  ARG A NE  
174  C CZ  . ARG A 29  ? 2.2604 2.2609 1.6808 0.0331  0.2236  -0.3506 21  ARG A CZ  
175  N NH1 . ARG A 29  ? 2.4465 2.4037 1.8222 0.0583  0.1793  -0.3694 21  ARG A NH1 
176  N NH2 . ARG A 29  ? 2.0637 2.0214 1.3917 0.0107  0.2614  -0.3281 21  ARG A NH2 
177  N N   . LYS A 30  ? 1.4707 1.7468 1.3856 0.2037  0.1680  -0.5185 22  LYS A N   
178  C CA  . LYS A 30  ? 1.3219 1.6027 1.2962 0.2425  0.1186  -0.5310 22  LYS A CA  
179  C C   . LYS A 30  ? 1.3171 1.7005 1.4191 0.2698  0.1423  -0.5637 22  LYS A C   
180  O O   . LYS A 30  ? 1.2953 1.7287 1.4811 0.2764  0.1067  -0.5553 22  LYS A O   
181  C CB  . LYS A 30  ? 1.2931 1.4863 1.1895 0.2734  0.0989  -0.5517 22  LYS A CB  
182  N N   . LYS A 31  ? 1.5352 2.0426 2.3462 0.3234  0.0043  -0.9503 23  LYS A N   
183  C CA  . LYS A 31  ? 1.5771 2.1445 2.4780 0.3744  -0.0010 -0.9629 23  LYS A CA  
184  C C   . LYS A 31  ? 1.5084 2.0894 2.4348 0.3850  -0.0220 -0.9086 23  LYS A C   
185  O O   . LYS A 31  ? 1.6482 2.1658 2.6373 0.4287  -0.0533 -0.8841 23  LYS A O   
186  C CB  . LYS A 31  ? 1.5413 2.2828 2.4572 0.3730  0.0346  -1.0161 23  LYS A CB  
187  N N   . GLU A 32  ? 1.4440 2.1090 2.3212 0.3444  -0.0059 -0.8861 24  GLU A N   
188  C CA  . GLU A 32  ? 1.5664 2.2519 2.4545 0.3358  -0.0270 -0.8212 24  GLU A CA  
189  C C   . GLU A 32  ? 1.5473 2.0588 2.3965 0.3277  -0.0708 -0.7531 24  GLU A C   
190  O O   . GLU A 32  ? 1.5736 2.0710 2.4374 0.3282  -0.1025 -0.6923 24  GLU A O   
191  C CB  . GLU A 32  ? 1.6434 2.4268 2.4508 0.2674  -0.0027 -0.7822 24  GLU A CB  
192  C CG  . GLU A 32  ? 1.7877 2.7085 2.5773 0.2536  0.0472  -0.8440 24  GLU A CG  
193  C CD  . GLU A 32  ? 1.7803 2.7906 2.4904 0.1861  0.0699  -0.7923 24  GLU A CD  
194  O OE1 . GLU A 32  ? 1.6343 2.6125 2.3198 0.1525  0.0490  -0.7180 24  GLU A OE1 
195  O OE2 . GLU A 32  ? 1.8352 2.9477 2.5063 0.1661  0.1086  -0.8268 24  GLU A OE2 
196  N N   . GLY A 33  ? 1.4604 1.8516 2.2603 0.3171  -0.0718 -0.7663 25  GLY A N   
197  C CA  . GLY A 33  ? 1.3015 1.5319 2.0645 0.3074  -0.1078 -0.7085 25  GLY A CA  
198  C C   . GLY A 33  ? 1.3545 1.5013 2.1989 0.3649  -0.1435 -0.6951 25  GLY A C   
199  O O   . GLY A 33  ? 1.2909 1.3952 2.1259 0.3616  -0.1782 -0.6230 25  GLY A O   
200  N N   . GLU A 34  ? 1.4521 1.5763 2.3535 0.4045  -0.1364 -0.7437 26  GLU A N   
201  C CA  . GLU A 34  ? 1.5906 1.6296 2.5541 0.4554  -0.1698 -0.7148 26  GLU A CA  
202  C C   . GLU A 34  ? 1.5312 1.6842 2.5789 0.5040  -0.1864 -0.7053 26  GLU A C   
203  O O   . GLU A 34  ? 1.6142 1.7116 2.7058 0.5457  -0.2232 -0.6610 26  GLU A O   
204  C CB  . GLU A 34  ? 1.8378 1.8188 2.8260 0.4770  -0.1553 -0.7589 26  GLU A CB  
205  C CG  . GLU A 34  ? 1.9509 2.0560 2.9532 0.4752  -0.1142 -0.8392 26  GLU A CG  
206  C CD  . GLU A 34  ? 2.0352 2.1373 2.9581 0.4166  -0.0870 -0.8652 26  GLU A CD  
207  O OE1 . GLU A 34  ? 1.9159 1.9363 2.7715 0.3749  -0.0970 -0.8217 26  GLU A OE1 
208  O OE2 . GLU A 34  ? 2.2091 2.3968 3.1362 0.4128  -0.0569 -0.9279 26  GLU A OE2 
209  N N   . LYS A 35  ? 1.4069 1.7300 2.4736 0.4945  -0.1583 -0.7416 27  LYS A N   
210  C CA  . LYS A 35  ? 1.3747 1.8380 2.5209 0.5274  -0.1694 -0.7324 27  LYS A CA  
211  C C   . LYS A 35  ? 1.3393 1.7942 2.4550 0.4991  -0.2079 -0.6461 27  LYS A C   
212  O O   . LYS A 35  ? 1.2836 1.7817 2.4653 0.5374  -0.2423 -0.6144 27  LYS A O   
213  C CB  . LYS A 35  ? 1.2175 1.8698 2.3733 0.5041  -0.1229 -0.7841 27  LYS A CB  
214  N N   . ILE A 36  ? 1.2753 1.6741 2.2775 0.4259  -0.2025 -0.6038 28  ILE A N   
215  C CA  . ILE A 36  ? 1.2528 1.6352 2.1979 0.3825  -0.2335 -0.5229 28  ILE A CA  
216  C C   . ILE A 36  ? 1.4779 1.7234 2.4200 0.4096  -0.2821 -0.4666 28  ILE A C   
217  O O   . ILE A 36  ? 1.7014 1.9790 2.6670 0.4211  -0.3198 -0.4177 28  ILE A O   
218  C CB  . ILE A 36  ? 1.1309 1.4819 1.9563 0.3039  -0.2127 -0.4983 28  ILE A CB  
219  C CG1 . ILE A 36  ? 1.1286 1.6189 1.9454 0.2697  -0.1686 -0.5339 28  ILE A CG1 
220  C CG2 . ILE A 36  ? 1.0939 1.4060 1.8594 0.2640  -0.2458 -0.4233 28  ILE A CG2 
221  C CD1 . ILE A 36  ? 1.2051 1.8466 2.0835 0.2665  -0.1708 -0.5273 28  ILE A CD1 
222  N N   . ARG A 37  ? 1.4875 1.5873 2.3993 0.4158  -0.2811 -0.4727 29  ARG A N   
223  C CA  . ARG A 37  ? 1.5801 1.5363 2.4728 0.4297  -0.3220 -0.4121 29  ARG A CA  
224  C C   . ARG A 37  ? 1.7101 1.6673 2.7036 0.5085  -0.3601 -0.3969 29  ARG A C   
225  O O   . ARG A 37  ? 1.8019 1.6763 2.7807 0.5209  -0.4025 -0.3280 29  ARG A O   
226  C CB  . ARG A 37  ? 1.6203 1.4299 2.4739 0.4173  -0.3071 -0.4320 29  ARG A CB  
227  C CG  . ARG A 37  ? 1.5001 1.3167 2.2607 0.3481  -0.2721 -0.4494 29  ARG A CG  
228  C CD  . ARG A 37  ? 1.4479 1.1469 2.1180 0.3014  -0.2871 -0.3901 29  ARG A CD  
229  N NE  . ARG A 37  ? 1.4743 1.1888 2.1063 0.2843  -0.3193 -0.3160 29  ARG A NE  
230  C CZ  . ARG A 37  ? 1.6458 1.2633 2.2426 0.2783  -0.3511 -0.2521 29  ARG A CZ  
231  N NH1 . ARG A 37  ? 1.7334 1.2226 2.3308 0.2849  -0.3541 -0.2475 29  ARG A NH1 
232  N NH2 . ARG A 37  ? 1.6895 1.3404 2.2483 0.2611  -0.3791 -0.1937 29  ARG A NH2 
233  N N   . LYS A 38  ? 1.6813 1.7389 2.7765 0.5642  -0.3451 -0.4603 30  LYS A N   
234  C CA  . LYS A 38  ? 1.7608 1.8429 2.9394 0.6341  -0.3739 -0.4433 30  LYS A CA  
235  C C   . LYS A 38  ? 1.7027 1.9553 2.9302 0.6419  -0.4003 -0.4184 30  LYS A C   
236  O O   . LYS A 38  ? 1.8435 2.1080 3.1024 0.6796  -0.4398 -0.3670 30  LYS A O   
237  C CB  . LYS A 38  ? 1.7889 1.8969 3.0236 0.6743  -0.3366 -0.5161 30  LYS A CB  
238  N N   . LYS A 39  ? 1.4453 1.8265 2.6459 0.5846  -0.3692 -0.4441 31  LYS A N   
239  C CA  . LYS A 39  ? 1.2586 1.8032 2.4827 0.5631  -0.3843 -0.4202 31  LYS A CA  
240  C C   . LYS A 39  ? 1.2923 1.7828 2.4195 0.5034  -0.4179 -0.3408 31  LYS A C   
241  O O   . LYS A 39  ? 1.4379 2.0154 2.5908 0.5055  -0.4555 -0.3024 31  LYS A O   
242  C CB  . LYS A 39  ? 1.0136 1.7064 2.2373 0.5145  -0.3326 -0.4735 31  LYS A CB  
243  N N   . TYR A 40  ? 1.2394 1.5968 2.2570 0.4505  -0.4040 -0.3215 32  TYR A N   
244  C CA  . TYR A 40  ? 1.2432 1.5408 2.1624 0.3953  -0.4307 -0.2545 32  TYR A CA  
245  C C   . TYR A 40  ? 1.4239 1.5389 2.2726 0.3921  -0.4383 -0.2223 32  TYR A C   
246  O O   . TYR A 40  ? 1.4461 1.4927 2.2223 0.3475  -0.4055 -0.2385 32  TYR A O   
247  C CB  . TYR A 40  ? 1.0600 1.4128 1.9039 0.3130  -0.3997 -0.2623 32  TYR A CB  
248  C CG  . TYR A 40  ? 1.1044 1.6323 2.0116 0.3008  -0.3800 -0.2985 32  TYR A CG  
249  C CD1 . TYR A 40  ? 1.1092 1.7577 2.0703 0.3041  -0.4133 -0.2785 32  TYR A CD1 
250  C CD2 . TYR A 40  ? 1.0463 1.6289 1.9571 0.2810  -0.3280 -0.3512 32  TYR A CD2 
251  C CE1 . TYR A 40  ? 1.0823 1.9003 2.1052 0.2846  -0.3929 -0.3117 32  TYR A CE1 
252  C CE2 . TYR A 40  ? 1.0922 1.8405 2.0577 0.2625  -0.3064 -0.3796 32  TYR A CE2 
253  C CZ  . TYR A 40  ? 1.1631 2.0278 2.1872 0.2624  -0.3377 -0.3604 32  TYR A CZ  
254  O OH  . TYR A 40  ? 1.1289 2.1674 2.2114 0.2362  -0.3140 -0.3890 32  TYR A OH  
255  N N   . PRO A 41  ? 1.5056 1.5471 2.3766 0.4387  -0.4822 -0.1733 33  PRO A N   
256  C CA  . PRO A 41  ? 1.6521 1.5211 2.4615 0.4327  -0.4911 -0.1343 33  PRO A CA  
257  C C   . PRO A 41  ? 1.7744 1.6057 2.4677 0.3664  -0.5046 -0.0759 33  PRO A C   
258  O O   . PRO A 41  ? 1.7703 1.4789 2.3947 0.3391  -0.4982 -0.0521 33  PRO A O   
259  C CB  . PRO A 41  ? 1.7360 1.5582 2.6206 0.5115  -0.5356 -0.0970 33  PRO A CB  
260  C CG  . PRO A 41  ? 1.6649 1.6466 2.6060 0.5365  -0.5679 -0.0823 33  PRO A CG  
261  C CD  . PRO A 41  ? 1.5245 1.6490 2.4864 0.5027  -0.5266 -0.1497 33  PRO A CD  
262  N N   . ASP A 42  ? 1.8194 1.7618 2.4943 0.3387  -0.5217 -0.0580 34  ASP A N   
263  C CA  . ASP A 42  ? 1.7310 1.6514 2.3001 0.2798  -0.5362 -0.0111 34  ASP A CA  
264  C C   . ASP A 42  ? 1.4913 1.4144 1.9867 0.2131  -0.4930 -0.0452 34  ASP A C   
265  O O   . ASP A 42  ? 1.5213 1.4214 1.9274 0.1640  -0.4970 -0.0189 34  ASP A O   
266  C CB  . ASP A 42  ? 1.7405 1.7762 2.3239 0.2807  -0.5798 0.0211  34  ASP A CB  
267  C CG  . ASP A 42  ? 1.7030 1.8907 2.3604 0.2803  -0.5676 -0.0280 34  ASP A CG  
268  O OD1 . ASP A 42  ? 1.5832 1.7892 2.2918 0.2941  -0.5285 -0.0824 34  ASP A OD1 
269  O OD2 . ASP A 42  ? 1.8075 2.1036 2.4706 0.2620  -0.5962 -0.0136 34  ASP A OD2 
270  N N   . ARG A 43  ? 1.2784 1.2335 1.8107 0.2145  -0.4522 -0.1038 35  ARG A N   
271  C CA  . ARG A 43  ? 1.1769 1.1440 1.6454 0.1580  -0.4133 -0.1317 35  ARG A CA  
272  C C   . ARG A 43  ? 1.2881 1.2026 1.7540 0.1610  -0.3720 -0.1753 35  ARG A C   
273  O O   . ARG A 43  ? 1.3401 1.2189 1.8646 0.2056  -0.3697 -0.1968 35  ARG A O   
274  C CB  . ARG A 43  ? 0.9408 1.0402 1.4430 0.1380  -0.4043 -0.1554 35  ARG A CB  
275  C CG  . ARG A 43  ? 1.1210 1.2926 1.6392 0.1345  -0.4475 -0.1218 35  ARG A CG  
276  C CD  . ARG A 43  ? 1.2065 1.4894 1.7304 0.0879  -0.4371 -0.1404 35  ARG A CD  
277  N NE  . ARG A 43  ? 1.4274 1.7863 1.9690 0.0824  -0.4823 -0.1131 35  ARG A NE  
278  C CZ  . ARG A 43  ? 1.5938 2.0420 2.1321 0.0314  -0.4847 -0.1219 35  ARG A CZ  
279  N NH1 . ARG A 43  ? 1.6589 2.1192 2.1748 -0.0175 -0.4433 -0.1504 35  ARG A NH1 
280  N NH2 . ARG A 43  ? 1.6316 2.1566 2.1874 0.0270  -0.5298 -0.1008 35  ARG A NH2 
281  N N   . VAL A 44  ? 1.3693 1.2795 1.7672 0.1147  -0.3412 -0.1899 36  VAL A N   
282  C CA  . VAL A 44  ? 1.3891 1.2549 1.7668 0.1100  -0.3061 -0.2261 36  VAL A CA  
283  C C   . VAL A 44  ? 1.1811 1.1257 1.5484 0.0866  -0.2692 -0.2624 36  VAL A C   
284  O O   . VAL A 44  ? 1.1469 1.1206 1.4659 0.0485  -0.2650 -0.2451 36  VAL A O   
285  C CB  . VAL A 44  ? 1.3441 1.1130 1.6355 0.0786  -0.3058 -0.1996 36  VAL A CB  
286  C CG1 . VAL A 44  ? 1.4689 1.2240 1.7301 0.0628  -0.2692 -0.2380 36  VAL A CG1 
287  C CG2 . VAL A 44  ? 1.3235 1.0038 1.6252 0.0993  -0.3332 -0.1666 36  VAL A CG2 
288  N N   . PRO A 45  ? 0.9859 0.9630 1.3965 0.1086  -0.2421 -0.3130 37  PRO A N   
289  C CA  . PRO A 45  ? 0.9742 1.0289 1.3670 0.0866  -0.2049 -0.3444 37  PRO A CA  
290  C C   . PRO A 45  ? 1.0036 1.0064 1.3093 0.0543  -0.1868 -0.3406 37  PRO A C   
291  O O   . PRO A 45  ? 1.1951 1.1374 1.4905 0.0628  -0.1832 -0.3585 37  PRO A O   
292  C CB  . PRO A 45  ? 0.9983 1.1054 1.4681 0.1273  -0.1860 -0.4041 37  PRO A CB  
293  C CG  . PRO A 45  ? 1.0489 1.0534 1.5476 0.1614  -0.2063 -0.4084 37  PRO A CG  
294  C CD  . PRO A 45  ? 1.0770 1.0208 1.5580 0.1574  -0.2460 -0.3447 37  PRO A CD  
295  N N   . VAL A 46  ? 0.8705 0.8970 1.1177 0.0177  -0.1763 -0.3177 38  VAL A N   
296  C CA  . VAL A 46  ? 0.8860 0.8684 1.0523 -0.0060 -0.1631 -0.3082 38  VAL A CA  
297  C C   . VAL A 46  ? 0.9599 1.0108 1.0959 -0.0250 -0.1329 -0.3157 38  VAL A C   
298  O O   . VAL A 46  ? 0.9772 1.0779 1.1180 -0.0443 -0.1275 -0.2997 38  VAL A O   
299  C CB  . VAL A 46  ? 1.0211 0.9348 1.1277 -0.0291 -0.1837 -0.2630 38  VAL A CB  
300  C CG1 . VAL A 46  ? 0.8960 0.7770 0.9264 -0.0462 -0.1689 -0.2556 38  VAL A CG1 
301  C CG2 . VAL A 46  ? 1.2649 1.1136 1.3865 -0.0148 -0.2122 -0.2477 38  VAL A CG2 
302  N N   . ILE A 47  ? 0.8935 0.9505 0.9972 -0.0227 -0.1139 -0.3378 39  ILE A N   
303  C CA  . ILE A 47  ? 0.9411 1.0586 1.0011 -0.0395 -0.0878 -0.3350 39  ILE A CA  
304  C C   . ILE A 47  ? 0.9102 0.9682 0.8892 -0.0558 -0.0915 -0.2971 39  ILE A C   
305  O O   . ILE A 47  ? 0.9511 0.9644 0.9052 -0.0478 -0.0985 -0.3032 39  ILE A O   
306  C CB  . ILE A 47  ? 1.0142 1.1993 1.0869 -0.0243 -0.0652 -0.3863 39  ILE A CB  
307  C CG1 . ILE A 47  ? 0.9669 1.1968 1.1274 0.0022  -0.0625 -0.4351 39  ILE A CG1 
308  C CG2 . ILE A 47  ? 0.9387 1.2036 0.9644 -0.0420 -0.0389 -0.3755 39  ILE A CG2 
309  C CD1 . ILE A 47  ? 0.9344 1.2429 1.1398 -0.0019 -0.0548 -0.4284 39  ILE A CD1 
310  N N   . VAL A 48  ? 0.8632 0.9207 0.8050 -0.0790 -0.0860 -0.2595 40  VAL A N   
311  C CA  . VAL A 48  ? 0.9262 0.9194 0.7957 -0.0878 -0.0898 -0.2241 40  VAL A CA  
312  C C   . VAL A 48  ? 1.1256 1.1590 0.9466 -0.0957 -0.0678 -0.2042 40  VAL A C   
313  O O   . VAL A 48  ? 1.2964 1.3679 1.1203 -0.1182 -0.0537 -0.1863 40  VAL A O   
314  C CB  . VAL A 48  ? 0.9989 0.9251 0.8560 -0.1083 -0.1065 -0.1927 40  VAL A CB  
315  C CG1 . VAL A 48  ? 0.9985 0.8502 0.7859 -0.1087 -0.1102 -0.1659 40  VAL A CG1 
316  C CG2 . VAL A 48  ? 0.8718 0.7723 0.7725 -0.1010 -0.1307 -0.2049 40  VAL A CG2 
317  N N   . GLU A 49  ? 1.2313 1.2629 1.0079 -0.0790 -0.0656 -0.2042 41  GLU A N   
318  C CA  . GLU A 49  ? 1.2981 1.3718 1.0222 -0.0800 -0.0489 -0.1789 41  GLU A CA  
319  C C   . GLU A 49  ? 1.2547 1.2695 0.9176 -0.0635 -0.0586 -0.1481 41  GLU A C   
320  O O   . GLU A 49  ? 1.2294 1.2008 0.8939 -0.0484 -0.0738 -0.1620 41  GLU A O   
321  C CB  . GLU A 49  ? 1.3158 1.4966 1.0521 -0.0689 -0.0336 -0.2192 41  GLU A CB  
322  C CG  . GLU A 49  ? 1.3254 1.5857 1.1169 -0.0799 -0.0168 -0.2501 41  GLU A CG  
323  C CD  . GLU A 49  ? 1.3088 1.6815 1.0999 -0.0703 0.0021  -0.2930 41  GLU A CD  
324  O OE1 . GLU A 49  ? 1.1835 1.5830 0.9185 -0.0622 0.0031  -0.2831 41  GLU A OE1 
325  O OE2 . GLU A 49  ? 1.3246 1.7653 1.1723 -0.0684 0.0151  -0.3398 41  GLU A OE2 
326  N N   . LYS A 50  ? 1.3165 1.3339 0.9265 -0.0652 -0.0491 -0.1040 42  LYS A N   
327  C CA  . LYS A 50  ? 1.3455 1.3156 0.8997 -0.0395 -0.0584 -0.0721 42  LYS A CA  
328  C C   . LYS A 50  ? 1.4091 1.4645 0.9506 -0.0114 -0.0601 -0.0959 42  LYS A C   
329  O O   . LYS A 50  ? 1.2899 1.4447 0.8349 -0.0161 -0.0476 -0.1145 42  LYS A O   
330  C CB  . LYS A 50  ? 1.4557 1.3873 0.9577 -0.0491 -0.0495 -0.0093 42  LYS A CB  
331  C CG  . LYS A 50  ? 1.4565 1.3396 0.9022 -0.0120 -0.0600 0.0286  42  LYS A CG  
332  C CD  . LYS A 50  ? 1.4940 1.3465 0.8854 -0.0200 -0.0499 0.0971  42  LYS A CD  
333  N N   . ALA A 51  ? 1.5040 1.5312 1.0327 0.0156  -0.0751 -0.1004 43  ALA A N   
334  C CA  . ALA A 51  ? 1.4757 1.5902 0.9915 0.0406  -0.0796 -0.1206 43  ALA A CA  
335  C C   . ALA A 51  ? 1.4629 1.6318 0.9226 0.0562  -0.0750 -0.0756 43  ALA A C   
336  O O   . ALA A 51  ? 1.4952 1.5959 0.9179 0.0578  -0.0730 -0.0182 43  ALA A O   
337  C CB  . ALA A 51  ? 1.5182 1.5973 1.0327 0.0655  -0.0951 -0.1279 43  ALA A CB  
338  N N   . PRO A 52  ? 1.4728 1.7638 0.9239 0.0650  -0.0740 -0.1008 44  PRO A N   
339  C CA  . PRO A 52  ? 1.6037 1.9713 0.9963 0.0785  -0.0708 -0.0580 44  PRO A CA  
340  C C   . PRO A 52  ? 1.7940 2.0948 1.1325 0.1140  -0.0836 0.0160  44  PRO A C   
341  O O   . PRO A 52  ? 1.8218 2.0761 1.1202 0.1061  -0.0751 0.0778  44  PRO A O   
342  C CB  . PRO A 52  ? 1.5337 2.0372 0.9324 0.0891  -0.0772 -0.1112 44  PRO A CB  
343  C CG  . PRO A 52  ? 1.2728 1.7725 0.7417 0.0619  -0.0707 -0.1857 44  PRO A CG  
344  C CD  . PRO A 52  ? 1.3141 1.6789 0.8100 0.0574  -0.0756 -0.1741 44  PRO A CD  
345  N N   . LYS A 53  ? 1.7912 2.0859 1.1315 0.1523  -0.1025 0.0096  45  LYS A N   
346  C CA  . LYS A 53  ? 1.6812 1.9263 0.9748 0.1997  -0.1170 0.0738  45  LYS A CA  
347  C C   . LYS A 53  ? 1.6450 1.7249 0.9426 0.2047  -0.1178 0.0994  45  LYS A C   
348  O O   . LYS A 53  ? 1.8361 1.8476 1.1007 0.2469  -0.1287 0.1485  45  LYS A O   
349  C CB  . LYS A 53  ? 1.5978 1.9361 0.8964 0.2446  -0.1372 0.0513  45  LYS A CB  
350  N N   . ALA A 54  ? 1.6173 1.6344 0.9553 0.1638  -0.1076 0.0643  46  ALA A N   
351  C CA  . ALA A 54  ? 1.5111 1.3852 0.8558 0.1619  -0.1094 0.0733  46  ALA A CA  
352  C C   . ALA A 54  ? 1.5539 1.3182 0.8562 0.1564  -0.1040 0.1402  46  ALA A C   
353  O O   . ALA A 54  ? 1.7088 1.4950 0.9936 0.1237  -0.0907 0.1710  46  ALA A O   
354  C CB  . ALA A 54  ? 1.1919 1.0437 0.5866 0.1167  -0.1024 0.0245  46  ALA A CB  
355  N N   . ARG A 55  ? 1.4793 1.1253 0.7664 0.1863  -0.1127 0.1598  47  ARG A N   
356  C CA  . ARG A 55  ? 1.6247 1.1382 0.8734 0.1802  -0.1085 0.2208  47  ARG A CA  
357  C C   . ARG A 55  ? 1.7138 1.1164 0.9853 0.1305  -0.1009 0.1998  47  ARG A C   
358  O O   . ARG A 55  ? 1.8036 1.0810 1.0666 0.1456  -0.1064 0.2009  47  ARG A O   
359  C CB  . ARG A 55  ? 1.6749 1.1126 0.8926 0.2493  -0.1235 0.2544  47  ARG A CB  
360  C CG  . ARG A 55  ? 1.7469 1.3046 0.9482 0.3084  -0.1376 0.2699  47  ARG A CG  
361  C CD  . ARG A 55  ? 1.7457 1.2159 0.9182 0.3818  -0.1531 0.3135  47  ARG A CD  
362  N NE  . ARG A 55  ? 1.6877 1.2755 0.8769 0.4459  -0.1704 0.2873  47  ARG A NE  
363  C CZ  . ARG A 55  ? 1.7625 1.4152 0.9218 0.5062  -0.1875 0.3361  47  ARG A CZ  
364  N NH1 . ARG A 55  ? 1.9320 1.5336 1.0366 0.5105  -0.1890 0.4196  47  ARG A NH1 
365  N NH2 . ARG A 55  ? 1.7277 1.5038 0.9115 0.5598  -0.2037 0.3042  47  ARG A NH2 
366  N N   . VAL A 56  ? 1.7488 1.2043 1.0511 0.0735  -0.0891 0.1767  48  VAL A N   
367  C CA  . VAL A 56  ? 1.8745 1.2540 1.2037 0.0225  -0.0846 0.1555  48  VAL A CA  
368  C C   . VAL A 56  ? 1.8352 1.2522 1.1731 -0.0373 -0.0670 0.1776  48  VAL A C   
369  O O   . VAL A 56  ? 1.4843 1.0202 0.8261 -0.0415 -0.0575 0.1799  48  VAL A O   
370  C CB  . VAL A 56  ? 1.7887 1.2098 1.1660 0.0181  -0.0928 0.0878  48  VAL A CB  
371  C CG1 . VAL A 56  ? 1.8454 1.2335 1.2144 0.0690  -0.1059 0.0648  48  VAL A CG1 
372  C CG2 . VAL A 56  ? 1.6383 1.1991 1.0478 0.0127  -0.0886 0.0595  48  VAL A CG2 
373  N N   . PRO A 57  ? 1.9495 1.2732 1.2915 -0.0858 -0.0613 0.1897  49  PRO A N   
374  C CA  . PRO A 57  ? 1.8593 1.2242 1.2168 -0.1496 -0.0427 0.2087  49  PRO A CA  
375  C C   . PRO A 57  ? 1.8314 1.3422 1.2437 -0.1647 -0.0374 0.1616  49  PRO A C   
376  O O   . PRO A 57  ? 1.8357 1.3686 1.2867 -0.1501 -0.0508 0.1086  49  PRO A O   
377  C CB  . PRO A 57  ? 1.8786 1.1260 1.2486 -0.1962 -0.0453 0.2019  49  PRO A CB  
378  C CG  . PRO A 57  ? 1.9704 1.0810 1.3026 -0.1538 -0.0588 0.2096  49  PRO A CG  
379  C CD  . PRO A 57  ? 2.0601 1.2372 1.3920 -0.0847 -0.0714 0.1824  49  PRO A CD  
380  N N   . ASP A 58  ? 1.8944 1.5024 1.3089 -0.1925 -0.0170 0.1815  50  ASP A N   
381  C CA  . ASP A 58  ? 1.7831 1.5298 1.2525 -0.2007 -0.0095 0.1330  50  ASP A CA  
382  C C   . ASP A 58  ? 1.6385 1.3847 1.1693 -0.2440 -0.0110 0.1015  50  ASP A C   
383  O O   . ASP A 58  ? 1.6589 1.3296 1.1853 -0.2872 -0.0086 0.1263  50  ASP A O   
384  C CB  . ASP A 58  ? 1.9139 1.7771 1.3650 -0.2157 0.0154  0.1585  50  ASP A CB  
385  C CG  . ASP A 58  ? 1.9279 1.9305 1.4149 -0.1913 0.0191  0.1017  50  ASP A CG  
386  O OD1 . ASP A 58  ? 1.8325 1.8370 1.3701 -0.1734 0.0042  0.0458  50  ASP A OD1 
387  O OD2 . ASP A 58  ? 2.0217 2.1295 1.4838 -0.1915 0.0371  0.1127  50  ASP A OD2 
388  N N   . LEU A 59  ? 1.5669 1.3970 1.1565 -0.2322 -0.0166 0.0467  51  LEU A N   
389  C CA  . LEU A 59  ? 1.5876 1.4304 1.2403 -0.2617 -0.0244 0.0159  51  LEU A CA  
390  C C   . LEU A 59  ? 1.6404 1.5916 1.3337 -0.3039 -0.0011 0.0178  51  LEU A C   
391  O O   . LEU A 59  ? 1.5468 1.6078 1.2503 -0.2922 0.0173  0.0060  51  LEU A O   
392  C CB  . LEU A 59  ? 1.4120 1.2845 1.1098 -0.2253 -0.0435 -0.0366 51  LEU A CB  
393  C CG  . LEU A 59  ? 1.3238 1.1794 1.0727 -0.2407 -0.0639 -0.0620 51  LEU A CG  
394  C CD1 . LEU A 59  ? 1.3673 1.1127 1.0835 -0.2697 -0.0751 -0.0405 51  LEU A CD1 
395  C CD2 . LEU A 59  ? 1.1853 1.0410 0.9571 -0.2002 -0.0837 -0.0980 51  LEU A CD2 
396  N N   . ASP A 60  ? 1.7657 1.6942 1.4830 -0.3551 -0.0010 0.0282  52  ASP A N   
397  C CA  . ASP A 60  ? 1.8276 1.8665 1.5890 -0.4036 0.0226  0.0314  52  ASP A CA  
398  C C   . ASP A 60  ? 1.6253 1.8071 1.4627 -0.3776 0.0256  -0.0223 52  ASP A C   
399  O O   . ASP A 60  ? 1.5321 1.8320 1.3827 -0.3816 0.0530  -0.0271 52  ASP A O   
400  C CB  . ASP A 60  ? 1.9935 1.9865 1.7795 -0.4638 0.0153  0.0396  52  ASP A CB  
401  C CG  . ASP A 60  ? 1.9566 1.8846 1.7665 -0.4459 -0.0207 0.0047  52  ASP A CG  
402  O OD1 . ASP A 60  ? 1.7098 1.6757 1.5499 -0.3954 -0.0370 -0.0320 52  ASP A OD1 
403  O OD2 . ASP A 60  ? 2.0421 1.8799 1.8379 -0.4851 -0.0322 0.0140  52  ASP A OD2 
404  N N   . LYS A 61  ? 1.5688 1.7382 1.4545 -0.3497 -0.0024 -0.0621 53  LYS A N   
405  C CA  . LYS A 61  ? 1.4171 1.6941 1.3772 -0.3142 -0.0050 -0.1129 53  LYS A CA  
406  C C   . LYS A 61  ? 1.3670 1.5855 1.3150 -0.2574 -0.0262 -0.1378 53  LYS A C   
407  O O   . LYS A 61  ? 1.5197 1.6283 1.4293 -0.2507 -0.0481 -0.1244 53  LYS A O   
408  C CB  . LYS A 61  ? 1.3208 1.6498 1.3606 -0.3332 -0.0209 -0.1330 53  LYS A CB  
409  C CG  . LYS A 61  ? 1.4007 1.7476 1.4444 -0.4041 -0.0094 -0.1038 53  LYS A CG  
410  C CD  . LYS A 61  ? 1.4649 1.9283 1.5154 -0.4355 0.0323  -0.0920 53  LYS A CD  
411  N N   . ARG A 62  ? 1.2155 1.5090 1.1973 -0.2196 -0.0180 -0.1774 54  ARG A N   
412  C CA  . ARG A 62  ? 1.1081 1.3487 1.0754 -0.1749 -0.0333 -0.2004 54  ARG A CA  
413  C C   . ARG A 62  ? 1.0165 1.2825 1.0604 -0.1405 -0.0498 -0.2457 54  ARG A C   
414  O O   . ARG A 62  ? 0.9857 1.1997 1.0249 -0.1102 -0.0638 -0.2637 54  ARG A O   
415  C CB  . ARG A 62  ? 1.1799 1.4626 1.1032 -0.1601 -0.0111 -0.2075 54  ARG A CB  
416  C CG  . ARG A 62  ? 1.1795 1.5989 1.1446 -0.1572 0.0167  -0.2437 54  ARG A CG  
417  C CD  . ARG A 62  ? 1.4622 1.9346 1.3603 -0.1646 0.0422  -0.2274 54  ARG A CD  
418  N NE  . ARG A 62  ? 1.7457 2.3620 1.6776 -0.1624 0.0716  -0.2688 54  ARG A NE  
419  C CZ  . ARG A 62  ? 1.6957 2.3719 1.6335 -0.1319 0.0796  -0.3232 54  ARG A CZ  
420  N NH1 . ARG A 62  ? 1.5937 2.1992 1.5078 -0.1056 0.0598  -0.3383 54  ARG A NH1 
421  N NH2 . ARG A 62  ? 1.6769 2.4901 1.6452 -0.1306 0.1089  -0.3669 54  ARG A NH2 
422  N N   . LYS A 63  ? 1.0912 1.4374 1.2080 -0.1452 -0.0483 -0.2619 55  LYS A N   
423  C CA  . LYS A 63  ? 1.0636 1.4305 1.2596 -0.1060 -0.0669 -0.2991 55  LYS A CA  
424  C C   . LYS A 63  ? 1.0332 1.3534 1.2520 -0.1135 -0.1017 -0.2767 55  LYS A C   
425  O O   . LYS A 63  ? 1.0041 1.3662 1.2388 -0.1485 -0.1031 -0.2589 55  LYS A O   
426  C CB  . LYS A 63  ? 0.9774 1.4818 1.2501 -0.0928 -0.0441 -0.3399 55  LYS A CB  
427  C CG  . LYS A 63  ? 1.0688 1.6229 1.3340 -0.0692 -0.0164 -0.3829 55  LYS A CG  
428  C CD  . LYS A 63  ? 1.2674 1.9756 1.5948 -0.0657 0.0146  -0.4220 55  LYS A CD  
429  C CE  . LYS A 63  ? 1.4186 2.1768 1.8534 -0.0327 -0.0020 -0.4509 55  LYS A CE  
430  N NZ  . LYS A 63  ? 1.4176 2.3428 1.9201 -0.0264 0.0310  -0.4944 55  LYS A NZ  
431  N N   . TYR A 64  ? 0.8241 1.2948 1.0637 0.0143  -0.0493 -0.2631 56  TYR A N   
432  C CA  . TYR A 64  ? 0.8455 1.3022 1.0977 0.0113  -0.0815 -0.2357 56  TYR A CA  
433  C C   . TYR A 64  ? 0.8153 1.2669 1.1369 0.0541  -0.1315 -0.2383 56  TYR A C   
434  O O   . TYR A 64  ? 0.9082 1.3091 1.2345 0.0823  -0.1478 -0.2388 56  TYR A O   
435  C CB  . TYR A 64  ? 0.8893 1.2603 1.0560 -0.0108 -0.0819 -0.1892 56  TYR A CB  
436  C CG  . TYR A 64  ? 1.0420 1.4024 1.1432 -0.0502 -0.0411 -0.1782 56  TYR A CG  
437  C CD1 . TYR A 64  ? 1.0067 1.3439 1.0607 -0.0540 -0.0150 -0.1751 56  TYR A CD1 
438  C CD2 . TYR A 64  ? 1.1322 1.5001 1.2154 -0.0853 -0.0320 -0.1697 56  TYR A CD2 
439  C CE1 . TYR A 64  ? 0.9588 1.2720 0.9496 -0.0868 0.0167  -0.1579 56  TYR A CE1 
440  C CE2 . TYR A 64  ? 1.0669 1.4065 1.0881 -0.1217 0.0049  -0.1584 56  TYR A CE2 
441  C CZ  . TYR A 64  ? 0.9597 1.2677 0.9351 -0.1199 0.0281  -0.1496 56  TYR A CZ  
442  O OH  . TYR A 64  ? 0.9892 1.2552 0.8997 -0.1529 0.0595  -0.1313 56  TYR A OH  
443  N N   . LEU A 65  ? 0.6941 1.1956 1.0676 0.0564  -0.1588 -0.2380 57  LEU A N   
444  C CA  . LEU A 65  ? 0.7878 1.2735 1.2164 0.0953  -0.2170 -0.2259 57  LEU A CA  
445  C C   . LEU A 65  ? 1.0458 1.4749 1.4089 0.0696  -0.2479 -0.1745 57  LEU A C   
446  O O   . LEU A 65  ? 1.2318 1.7059 1.5887 0.0399  -0.2520 -0.1687 57  LEU A O   
447  C CB  . LEU A 65  ? 0.6780 1.2722 1.2237 0.1235  -0.2356 -0.2631 57  LEU A CB  
448  C CG  . LEU A 65  ? 0.6988 1.3488 1.3280 0.1610  -0.2116 -0.3223 57  LEU A CG  
449  C CD1 . LEU A 65  ? 0.6228 1.3968 1.3830 0.1901  -0.2282 -0.3624 57  LEU A CD1 
450  C CD2 . LEU A 65  ? 0.9764 1.5345 1.6091 0.2041  -0.2349 -0.3203 57  LEU A CD2 
451  N N   . VAL A 66  ? 0.9748 1.3081 1.2863 0.0753  -0.2669 -0.1411 58  VAL A N   
452  C CA  . VAL A 66  ? 0.8360 1.1102 1.0671 0.0428  -0.2834 -0.0958 58  VAL A CA  
453  C C   . VAL A 66  ? 1.0519 1.2852 1.2933 0.0630  -0.3470 -0.0629 58  VAL A C   
454  O O   . VAL A 66  ? 1.2325 1.4215 1.5077 0.0994  -0.3705 -0.0616 58  VAL A O   
455  C CB  . VAL A 66  ? 0.7902 0.9899 0.9425 0.0219  -0.2494 -0.0794 58  VAL A CB  
456  C CG1 . VAL A 66  ? 0.9521 1.0992 1.0244 -0.0141 -0.2569 -0.0414 58  VAL A CG1 
457  C CG2 . VAL A 66  ? 0.7326 0.9620 0.8688 0.0055  -0.1950 -0.1029 58  VAL A CG2 
458  N N   . PRO A 67  ? 1.0687 1.3113 1.2750 0.0364  -0.3770 -0.0354 59  PRO A N   
459  C CA  . PRO A 67  ? 1.1135 1.3089 1.3034 0.0455  -0.4422 0.0080  59  PRO A CA  
460  C C   . PRO A 67  ? 1.1605 1.2436 1.2858 0.0407  -0.4444 0.0410  59  PRO A C   
461  O O   . PRO A 67  ? 1.1896 1.2378 1.2501 0.0084  -0.3971 0.0413  59  PRO A O   
462  C CB  . PRO A 67  ? 1.0266 1.2461 1.1494 -0.0051 -0.4520 0.0276  59  PRO A CB  
463  C CG  . PRO A 67  ? 0.9447 1.2556 1.1055 -0.0210 -0.4111 -0.0157 59  PRO A CG  
464  C CD  . PRO A 67  ? 0.9697 1.2693 1.1474 -0.0075 -0.3526 -0.0458 59  PRO A CD  
465  N N   . SER A 68  ? 1.3182 1.3455 1.4653 0.0721  -0.4996 0.0686  60  SER A N   
466  C CA  . SER A 68  ? 1.3278 1.2453 1.4216 0.0645  -0.5023 0.0977  60  SER A CA  
467  C C   . SER A 68  ? 1.3335 1.1962 1.3057 0.0040  -0.4984 0.1427  60  SER A C   
468  O O   . SER A 68  ? 1.1697 0.9626 1.0882 -0.0204 -0.4759 0.1573  60  SER A O   
469  C CB  . SER A 68  ? 1.3400 1.1973 1.4870 0.1131  -0.5657 0.1180  60  SER A CB  
470  N N   . ASP A 69  ? 1.5477 1.4486 1.4771 -0.0245 -0.5180 0.1601  61  ASP A N   
471  C CA  . ASP A 69  ? 1.4870 1.3416 1.2945 -0.0859 -0.5129 0.1974  61  ASP A CA  
472  C C   . ASP A 69  ? 1.3499 1.2504 1.1119 -0.1287 -0.4485 0.1671  61  ASP A C   
473  O O   . ASP A 69  ? 1.2641 1.1547 0.9344 -0.1798 -0.4431 0.1838  61  ASP A O   
474  C CB  . ASP A 69  ? 1.3530 1.2019 1.1211 -0.0962 -0.5842 0.2426  61  ASP A CB  
475  C CG  . ASP A 69  ? 1.5427 1.4950 1.3931 -0.0676 -0.6053 0.2158  61  ASP A CG  
476  O OD1 . ASP A 69  ? 1.4925 1.5199 1.3958 -0.0629 -0.5708 0.1692  61  ASP A OD1 
477  O OD2 . ASP A 69  ? 1.7727 1.7337 1.6354 -0.0523 -0.6517 0.2403  61  ASP A OD2 
478  N N   . LEU A 70  ? 1.1970 1.1417 1.0188 -0.1085 -0.3999 0.1223  62  LEU A N   
479  C CA  . LEU A 70  ? 1.0623 1.0317 0.8475 -0.1411 -0.3378 0.0951  62  LEU A CA  
480  C C   . LEU A 70  ? 1.2315 1.1546 0.9897 -0.1504 -0.2908 0.0930  62  LEU A C   
481  O O   . LEU A 70  ? 1.3630 1.2698 1.1684 -0.1200 -0.2897 0.0878  62  LEU A O   
482  C CB  . LEU A 70  ? 0.8315 0.8729 0.6883 -0.1194 -0.3146 0.0538  62  LEU A CB  
483  C CG  . LEU A 70  ? 0.9127 0.9688 0.7349 -0.1503 -0.2559 0.0281  62  LEU A CG  
484  C CD1 . LEU A 70  ? 0.7987 0.8701 0.5627 -0.1959 -0.2635 0.0298  62  LEU A CD1 
485  C CD2 . LEU A 70  ? 0.8638 0.9708 0.7523 -0.1275 -0.2288 -0.0057 62  LEU A CD2 
486  N N   . THR A 71  ? 1.3384 1.2458 1.0249 -0.1928 -0.2519 0.0925  63  THR A N   
487  C CA  . THR A 71  ? 1.4150 1.2937 1.0857 -0.2025 -0.2082 0.0889  63  THR A CA  
488  C C   . THR A 71  ? 1.2177 1.1268 0.9456 -0.1734 -0.1676 0.0561  63  THR A C   
489  O O   . THR A 71  ? 1.1079 1.0520 0.8603 -0.1622 -0.1577 0.0352  63  THR A O   
490  C CB  . THR A 71  ? 1.2021 1.0641 0.7879 -0.2543 -0.1733 0.0908  63  THR A CB  
491  O OG1 . THR A 71  ? 1.2108 1.1011 0.7839 -0.2654 -0.1434 0.0620  63  THR A OG1 
492  C CG2 . THR A 71  ? 1.1985 1.0262 0.7072 -0.2919 -0.2142 0.1291  63  THR A CG2 
493  N N   . VAL A 72  ? 1.0082 0.9045 0.7535 -0.1658 -0.1466 0.0540  64  VAL A N   
494  C CA  . VAL A 72  ? 0.9291 0.8524 0.7203 -0.1395 -0.1148 0.0298  64  VAL A CA  
495  C C   . VAL A 72  ? 0.8548 0.7892 0.6240 -0.1503 -0.0722 0.0131  64  VAL A C   
496  O O   . VAL A 72  ? 0.8280 0.7806 0.6229 -0.1303 -0.0573 -0.0022 64  VAL A O   
497  C CB  . VAL A 72  ? 0.9087 0.8242 0.7188 -0.1372 -0.1036 0.0315  64  VAL A CB  
498  C CG1 . VAL A 72  ? 0.8447 0.7928 0.6924 -0.1132 -0.0742 0.0113  64  VAL A CG1 
499  C CG2 . VAL A 72  ? 0.7895 0.6818 0.6260 -0.1243 -0.1433 0.0414  64  VAL A CG2 
500  N N   . GLY A 73  ? 1.0568 0.9736 0.7728 -0.1849 -0.0513 0.0153  65  GLY A N   
501  C CA  . GLY A 73  ? 1.0564 0.9709 0.7498 -0.1962 -0.0081 -0.0062 65  GLY A CA  
502  C C   . GLY A 73  ? 0.9920 0.9103 0.6736 -0.2014 -0.0136 -0.0170 65  GLY A C   
503  O O   . GLY A 73  ? 0.9605 0.8722 0.6494 -0.1936 0.0167  -0.0349 65  GLY A O   
504  N N   . GLN A 74  ? 1.1000 1.0284 0.7655 -0.2157 -0.0545 -0.0049 66  GLN A N   
505  C CA  . GLN A 74  ? 1.0060 0.9549 0.6691 -0.2268 -0.0642 -0.0172 66  GLN A CA  
506  C C   . GLN A 74  ? 1.1526 1.1303 0.8790 -0.1936 -0.0648 -0.0268 66  GLN A C   
507  O O   . GLN A 74  ? 1.5214 1.5083 1.2479 -0.2045 -0.0470 -0.0439 66  GLN A O   
508  C CB  . GLN A 74  ? 1.1563 1.1228 0.7983 -0.2458 -0.1166 0.0005  66  GLN A CB  
509  C CG  . GLN A 74  ? 1.3573 1.3004 0.9113 -0.2958 -0.1137 0.0053  66  GLN A CG  
510  C CD  . GLN A 74  ? 1.6021 1.5596 1.1293 -0.3121 -0.1769 0.0337  66  GLN A CD  
511  O OE1 . GLN A 74  ? 1.7036 1.6566 1.2615 -0.2856 -0.2197 0.0625  66  GLN A OE1 
512  N NE2 . GLN A 74  ? 1.6272 1.5985 1.0963 -0.3556 -0.1863 0.0256  66  GLN A NE2 
513  N N   . PHE A 75  ? 1.0737 1.0631 0.8476 -0.1592 -0.0825 -0.0179 67  PHE A N   
514  C CA  . PHE A 75  ? 1.0364 1.0558 0.8613 -0.1314 -0.0786 -0.0300 67  PHE A CA  
515  C C   . PHE A 75  ? 0.9329 0.9310 0.7490 -0.1247 -0.0366 -0.0364 67  PHE A C   
516  O O   . PHE A 75  ? 0.9020 0.9137 0.7305 -0.1193 -0.0228 -0.0453 67  PHE A O   
517  C CB  . PHE A 75  ? 0.8951 0.9274 0.7668 -0.0994 -0.1077 -0.0250 67  PHE A CB  
518  C CG  . PHE A 75  ? 0.8098 0.8814 0.7287 -0.0755 -0.1035 -0.0439 67  PHE A CG  
519  C CD1 . PHE A 75  ? 0.7848 0.9047 0.7312 -0.0793 -0.1086 -0.0603 67  PHE A CD1 
520  C CD2 . PHE A 75  ? 0.8043 0.8728 0.7386 -0.0541 -0.0935 -0.0482 67  PHE A CD2 
521  C CE1 . PHE A 75  ? 0.7801 0.9430 0.7653 -0.0638 -0.0975 -0.0819 67  PHE A CE1 
522  C CE2 . PHE A 75  ? 0.7084 0.8145 0.6725 -0.0388 -0.0868 -0.0680 67  PHE A CE2 
523  C CZ  . PHE A 75  ? 0.7294 0.8820 0.7174 -0.0443 -0.0857 -0.0856 67  PHE A CZ  
524  N N   . TYR A 76  ? 0.9315 0.8977 0.7267 -0.1259 -0.0170 -0.0307 68  TYR A N   
525  C CA  . TYR A 76  ? 0.8801 0.8245 0.6751 -0.1122 0.0171  -0.0338 68  TYR A CA  
526  C C   . TYR A 76  ? 1.0625 0.9756 0.8257 -0.1314 0.0455  -0.0451 68  TYR A C   
527  O O   . TYR A 76  ? 1.1758 1.0720 0.9417 -0.1196 0.0615  -0.0437 68  TYR A O   
528  C CB  . TYR A 76  ? 0.9221 0.8539 0.7162 -0.1092 0.0324  -0.0312 68  TYR A CB  
529  C CG  . TYR A 76  ? 1.0800 0.9902 0.8822 -0.0911 0.0665  -0.0368 68  TYR A CG  
530  C CD1 . TYR A 76  ? 0.9202 0.8391 0.7530 -0.0583 0.0629  -0.0278 68  TYR A CD1 
531  C CD2 . TYR A 76  ? 1.1759 1.0563 0.9548 -0.1052 0.1008  -0.0521 68  TYR A CD2 
532  C CE1 . TYR A 76  ? 1.0425 0.9384 0.8879 -0.0347 0.0858  -0.0271 68  TYR A CE1 
533  C CE2 . TYR A 76  ? 1.2005 1.0572 0.9994 -0.0796 0.1303  -0.0593 68  TYR A CE2 
534  C CZ  . TYR A 76  ? 1.1620 1.0253 0.9969 -0.0417 0.1193  -0.0433 68  TYR A CZ  
535  O OH  . TYR A 76  ? 1.1246 0.9611 0.9840 -0.0096 0.1407  -0.0448 68  TYR A OH  
536  N N   . PHE A 77  ? 1.1807 1.0803 0.9062 -0.1654 0.0504  -0.0554 69  PHE A N   
537  C CA  . PHE A 77  ? 1.2047 1.0691 0.8952 -0.1928 0.0772  -0.0724 69  PHE A CA  
538  C C   . PHE A 77  ? 1.0956 0.9874 0.7969 -0.2061 0.0647  -0.0751 69  PHE A C   
539  O O   . PHE A 77  ? 1.2802 1.1387 0.9619 -0.2242 0.0896  -0.0845 69  PHE A O   
540  C CB  . PHE A 77  ? 1.2593 1.1104 0.8997 -0.2331 0.0832  -0.0875 69  PHE A CB  
541  C CG  . PHE A 77  ? 1.1765 0.9970 0.7995 -0.2300 0.1146  -0.0965 69  PHE A CG  
542  C CD1 . PHE A 77  ? 1.3264 1.1108 0.9723 -0.1997 0.1493  -0.1033 69  PHE A CD1 
543  C CD2 . PHE A 77  ? 1.2682 1.0997 0.8535 -0.2576 0.1089  -0.0977 69  PHE A CD2 
544  C CE1 . PHE A 77  ? 1.4234 1.1949 1.0702 -0.1931 0.1814  -0.1183 69  PHE A CE1 
545  C CE2 . PHE A 77  ? 1.3484 1.1637 0.9208 -0.2600 0.1454  -0.1120 69  PHE A CE2 
546  C CZ  . PHE A 77  ? 1.3030 1.0941 0.9138 -0.2258 0.1834  -0.1260 69  PHE A CZ  
547  N N   . LEU A 78  ? 1.0934 1.0448 0.8291 -0.1981 0.0280  -0.0688 70  LEU A N   
548  C CA  . LEU A 78  ? 1.1775 1.1776 0.9406 -0.2080 0.0173  -0.0772 70  LEU A CA  
549  C C   . LEU A 78  ? 1.3154 1.3085 1.0906 -0.1908 0.0387  -0.0735 70  LEU A C   
550  O O   . LEU A 78  ? 1.4901 1.4874 1.2574 -0.2155 0.0566  -0.0819 70  LEU A O   
551  C CB  . LEU A 78  ? 1.0605 1.1258 0.8709 -0.1923 -0.0276 -0.0747 70  LEU A CB  
552  C CG  . LEU A 78  ? 1.1151 1.2497 0.9592 -0.2122 -0.0475 -0.0906 70  LEU A CG  
553  C CD1 . LEU A 78  ? 1.1975 1.3267 0.9993 -0.2575 -0.0530 -0.0974 70  LEU A CD1 
554  C CD2 . LEU A 78  ? 1.0299 1.2225 0.9378 -0.1790 -0.0923 -0.0882 70  LEU A CD2 
555  N N   . ILE A 79  ? 1.2376 1.2213 1.0265 -0.1541 0.0359  -0.0599 71  ILE A N   
556  C CA  . ILE A 79  ? 1.0757 1.0539 0.8653 -0.1376 0.0494  -0.0515 71  ILE A CA  
557  C C   . ILE A 79  ? 1.0466 0.9511 0.7933 -0.1457 0.0811  -0.0411 71  ILE A C   
558  O O   . ILE A 79  ? 1.2747 1.1633 1.0003 -0.1568 0.0963  -0.0339 71  ILE A O   
559  C CB  . ILE A 79  ? 1.0283 1.0207 0.8428 -0.0996 0.0323  -0.0416 71  ILE A CB  
560  C CG1 . ILE A 79  ? 1.0327 1.0834 0.8905 -0.0893 0.0025  -0.0540 71  ILE A CG1 
561  C CG2 . ILE A 79  ? 0.9592 0.9417 0.7595 -0.0857 0.0429  -0.0291 71  ILE A CG2 
562  C CD1 . ILE A 79  ? 0.8378 0.9420 0.7169 -0.0978 0.0043  -0.0721 71  ILE A CD1 
563  N N   . ARG A 80  ? 0.9626 0.8183 0.6950 -0.1413 0.0925  -0.0410 72  ARG A N   
564  C CA  . ARG A 80  ? 1.0859 0.8605 0.7864 -0.1419 0.1226  -0.0358 72  ARG A CA  
565  C C   . ARG A 80  ? 1.2448 0.9847 0.9085 -0.1867 0.1427  -0.0451 72  ARG A C   
566  O O   . ARG A 80  ? 1.3993 1.0757 1.0344 -0.1899 0.1614  -0.0309 72  ARG A O   
567  C CB  . ARG A 80  ? 0.9570 0.6971 0.6552 -0.1351 0.1375  -0.0483 72  ARG A CB  
568  C CG  . ARG A 80  ? 0.9771 0.7404 0.7131 -0.0934 0.1283  -0.0386 72  ARG A CG  
569  C CD  . ARG A 80  ? 0.9694 0.7082 0.7045 -0.0935 0.1526  -0.0579 72  ARG A CD  
570  N NE  . ARG A 80  ? 1.1815 0.8413 0.9018 -0.0864 0.1864  -0.0672 72  ARG A NE  
571  C CZ  . ARG A 80  ? 1.2213 0.8549 0.9756 -0.0424 0.1985  -0.0618 72  ARG A CZ  
572  N NH1 . ARG A 80  ? 1.2506 0.9425 1.0547 -0.0077 0.1797  -0.0482 72  ARG A NH1 
573  N NH2 . ARG A 80  ? 1.3556 0.9048 1.0989 -0.0327 0.2279  -0.0715 72  ARG A NH2 
574  N N   . LYS A 81  ? 1.3363 1.1174 0.9999 -0.2240 0.1357  -0.0669 73  LYS A N   
575  C CA  . LYS A 81  ? 1.4059 1.1713 1.0417 -0.2760 0.1530  -0.0816 73  LYS A CA  
576  C C   . LYS A 81  ? 1.3717 1.1744 1.0154 -0.2880 0.1544  -0.0723 73  LYS A C   
577  O O   . LYS A 81  ? 1.4767 1.2445 1.0888 -0.3302 0.1782  -0.0751 73  LYS A O   
578  C CB  . LYS A 81  ? 1.1187 0.9396 0.7600 -0.3119 0.1362  -0.1070 73  LYS A CB  
579  N N   . ARG A 82  ? 1.1747 1.0465 0.8570 -0.2558 0.1323  -0.0641 74  ARG A N   
580  C CA  . ARG A 82  ? 1.2442 1.1613 0.9320 -0.2666 0.1381  -0.0610 74  ARG A CA  
581  C C   . ARG A 82  ? 1.3845 1.2319 1.0274 -0.2516 0.1528  -0.0292 74  ARG A C   
582  O O   . ARG A 82  ? 1.6342 1.4720 1.2432 -0.2827 0.1723  -0.0205 74  ARG A O   
583  C CB  . ARG A 82  ? 1.0845 1.1011 0.8316 -0.2387 0.1102  -0.0733 74  ARG A CB  
584  C CG  . ARG A 82  ? 0.9559 1.0521 0.7532 -0.2544 0.0903  -0.1007 74  ARG A CG  
585  C CD  . ARG A 82  ? 0.8728 1.0582 0.7349 -0.2235 0.0662  -0.1153 74  ARG A CD  
586  N NE  . ARG A 82  ? 0.9880 1.2677 0.9043 -0.2470 0.0614  -0.1445 74  ARG A NE  
587  C CZ  . ARG A 82  ? 1.2146 1.5507 1.1448 -0.2730 0.0879  -0.1628 74  ARG A CZ  
588  N NH1 . ARG A 82  ? 1.3095 1.6060 1.1880 -0.2812 0.1185  -0.1492 74  ARG A NH1 
589  N NH2 . ARG A 82  ? 1.2607 1.6985 1.2564 -0.2926 0.0830  -0.1941 74  ARG A NH2 
590  N N   . ILE A 83  ? 1.4652 1.2686 1.1078 -0.2063 0.1419  -0.0105 75  ILE A N   
591  C CA  . ILE A 83  ? 1.4939 1.2292 1.0992 -0.1839 0.1461  0.0246  75  ILE A CA  
592  C C   . ILE A 83  ? 1.4950 1.1173 1.0508 -0.2074 0.1730  0.0366  75  ILE A C   
593  O O   . ILE A 83  ? 1.6986 1.2486 1.2091 -0.2037 0.1787  0.0707  75  ILE A O   
594  C CB  . ILE A 83  ? 1.5311 1.2672 1.1677 -0.1273 0.1241  0.0362  75  ILE A CB  
595  C CG1 . ILE A 83  ? 1.5064 1.3384 1.1849 -0.1095 0.0982  0.0241  75  ILE A CG1 
596  C CG2 . ILE A 83  ? 1.5946 1.2666 1.2012 -0.0986 0.1200  0.0751  75  ILE A CG2 
597  C CD1 . ILE A 83  ? 1.6561 1.5216 1.3125 -0.1110 0.0918  0.0363  75  ILE A CD1 
598  N N   . HIS A 84  ? 1.4206 1.0241 0.9805 -0.2343 0.1873  0.0086  76  HIS A N   
599  C CA  . HIS A 84  ? 1.5825 1.0725 1.0991 -0.2606 0.2158  0.0071  76  HIS A CA  
600  C C   . HIS A 84  ? 1.5877 0.9890 1.1060 -0.2079 0.2180  0.0236  76  HIS A C   
601  O O   . HIS A 84  ? 1.6426 0.9297 1.1227 -0.2078 0.2347  0.0429  76  HIS A O   
602  C CB  . HIS A 84  ? 1.7783 1.2165 1.2390 -0.3084 0.2358  0.0265  76  HIS A CB  
603  C CG  . HIS A 84  ? 1.8876 1.4295 1.3589 -0.3591 0.2382  0.0069  76  HIS A CG  
604  N ND1 . HIS A 84  ? 1.9351 1.5387 1.4011 -0.3627 0.2337  0.0229  76  HIS A ND1 
605  C CD2 . HIS A 84  ? 1.9181 1.5216 1.4106 -0.4077 0.2447  -0.0309 76  HIS A CD2 
606  C CE1 . HIS A 84  ? 1.9407 1.6415 1.4328 -0.4080 0.2416  -0.0076 76  HIS A CE1 
607  N NE2 . HIS A 84  ? 1.9487 1.6540 1.4610 -0.4344 0.2449  -0.0382 76  HIS A NE2 
608  N N   . LEU A 85  ? 1.4910 0.9454 1.0583 -0.1630 0.2013  0.0154  77  LEU A N   
609  C CA  . LEU A 85  ? 1.4691 0.8658 1.0587 -0.1125 0.2065  0.0195  77  LEU A CA  
610  C C   . LEU A 85  ? 1.5969 0.9195 1.1713 -0.1337 0.2403  -0.0163 77  LEU A C   
611  O O   . LEU A 85  ? 1.4847 0.8382 1.0441 -0.1814 0.2491  -0.0484 77  LEU A O   
612  C CB  . LEU A 85  ? 1.1865 0.6731 0.8341 -0.0716 0.1847  0.0144  77  LEU A CB  
613  C CG  . LEU A 85  ? 1.2899 0.8457 0.9584 -0.0435 0.1509  0.0432  77  LEU A CG  
614  C CD1 . LEU A 85  ? 1.3187 0.9526 1.0438 -0.0145 0.1348  0.0307  77  LEU A CD1 
615  C CD2 . LEU A 85  ? 1.2918 0.7859 0.9449 -0.0096 0.1414  0.0840  77  LEU A CD2 
616  N N   . ARG A 86  ? 1.7639 0.9902 1.3437 -0.0974 0.2575  -0.0130 78  ARG A N   
617  C CA  . ARG A 86  ? 1.7903 0.9447 1.3596 -0.1124 0.2946  -0.0567 78  ARG A CA  
618  C C   . ARG A 86  ? 1.7507 0.9711 1.3710 -0.0818 0.3004  -0.0873 78  ARG A C   
619  O O   . ARG A 86  ? 1.4799 0.7872 1.1465 -0.0461 0.2747  -0.0695 78  ARG A O   
620  C CB  . ARG A 86  ? 1.9553 0.9605 1.5082 -0.0885 0.3155  -0.0453 78  ARG A CB  
621  C CG  . ARG A 86  ? 2.0387 1.0249 1.6485 -0.0052 0.3005  -0.0169 78  ARG A CG  
622  C CD  . ARG A 86  ? 2.3377 1.1602 1.9269 0.0185  0.3151  0.0006  78  ARG A CD  
623  N NE  . ARG A 86  ? 2.5948 1.3997 2.2500 0.1059  0.2959  0.0274  78  ARG A NE  
624  C CZ  . ARG A 86  ? 2.6291 1.4485 2.2886 0.1428  0.2517  0.0896  78  ARG A CZ  
625  N NH1 . ARG A 86  ? 2.5947 1.4427 2.1911 0.0975  0.2293  0.1277  78  ARG A NH1 
626  N NH2 . ARG A 86  ? 2.6167 1.4290 2.3453 0.2242  0.2300  0.1110  78  ARG A NH2 
627  N N   . PRO A 87  ? 1.8068 0.9857 1.4133 -0.1023 0.3368  -0.1359 79  PRO A N   
628  C CA  . PRO A 87  ? 1.7401 0.9882 1.3763 -0.0945 0.3498  -0.1711 79  PRO A CA  
629  C C   . PRO A 87  ? 1.8512 1.1214 1.5643 -0.0219 0.3520  -0.1651 79  PRO A C   
630  O O   . PRO A 87  ? 1.9533 1.2941 1.6978 -0.0160 0.3640  -0.1907 79  PRO A O   
631  C CB  . PRO A 87  ? 1.7135 0.9044 1.3056 -0.1382 0.3937  -0.2291 79  PRO A CB  
632  N N   . GLU A 88  ? 1.8764 1.0914 1.6190 0.0300  0.3386  -0.1295 80  GLU A N   
633  C CA  . GLU A 88  ? 1.7241 0.9607 1.5510 0.1040  0.3366  -0.1243 80  GLU A CA  
634  C C   . GLU A 88  ? 1.6981 1.0253 1.5643 0.1364  0.2865  -0.0750 80  GLU A C   
635  O O   . GLU A 88  ? 1.5367 0.9278 1.4806 0.1867  0.2781  -0.0744 80  GLU A O   
636  C CB  . GLU A 88  ? 1.7132 0.8174 1.5542 0.1498  0.3519  -0.1195 80  GLU A CB  
637  C CG  . GLU A 88  ? 1.9731 0.9638 1.7643 0.1121  0.4016  -0.1695 80  GLU A CG  
638  C CD  . GLU A 88  ? 2.2272 1.0566 2.0008 0.1383  0.4060  -0.1481 80  GLU A CD  
639  O OE1 . GLU A 88  ? 1.9997 0.7982 1.7483 0.1461  0.3670  -0.0851 80  GLU A OE1 
640  O OE2 . GLU A 88  ? 2.5736 1.3290 2.3576 0.1452  0.4397  -0.1905 80  GLU A OE2 
641  N N   . ASP A 89  ? 1.8464 1.1854 1.6614 0.1044  0.2554  -0.0391 81  ASP A N   
642  C CA  . ASP A 89  ? 1.7722 1.1830 1.6095 0.1295  0.2093  0.0048  81  ASP A CA  
643  C C   . ASP A 89  ? 1.6921 1.2293 1.5740 0.1277  0.1958  -0.0089 81  ASP A C   
644  O O   . ASP A 89  ? 1.7162 1.2880 1.5853 0.0890  0.2142  -0.0414 81  ASP A O   
645  C CB  . ASP A 89  ? 1.7009 1.0945 1.4682 0.0887  0.1894  0.0361  81  ASP A CB  
646  C CG  . ASP A 89  ? 1.8586 1.1250 1.5768 0.0890  0.1962  0.0636  81  ASP A CG  
647  O OD1 . ASP A 89  ? 1.7954 0.9942 1.5441 0.1419  0.1960  0.0778  81  ASP A OD1 
648  O OD2 . ASP A 89  ? 2.0783 1.3118 1.7309 0.0361  0.2015  0.0712  81  ASP A OD2 
649  N N   . ALA A 90  ? 1.6113 1.2125 1.5400 0.1659  0.1609  0.0183  82  ALA A N   
650  C CA  . ALA A 90  ? 1.2926 1.0061 1.2642 0.1618  0.1456  0.0081  82  ALA A CA  
651  C C   . ALA A 90  ? 1.3093 1.0677 1.2447 0.1349  0.1108  0.0301  82  ALA A C   
652  O O   . ALA A 90  ? 1.4773 1.2168 1.3858 0.1447  0.0857  0.0629  82  ALA A O   
653  C CB  . ALA A 90  ? 1.0591 0.8288 1.1181 0.2176  0.1316  0.0135  82  ALA A CB  
654  N N   . LEU A 91  ? 1.1203 0.9342 1.0521 0.1004  0.1101  0.0110  83  LEU A N   
655  C CA  . LEU A 91  ? 1.0140 0.8715 0.9238 0.0789  0.0804  0.0220  83  LEU A CA  
656  C C   . LEU A 91  ? 0.9913 0.9192 0.9340 0.0665  0.0706  0.0068  83  LEU A C   
657  O O   . LEU A 91  ? 0.9451 0.8765 0.8944 0.0493  0.0926  -0.0138 83  LEU A O   
658  C CB  . LEU A 91  ? 0.9915 0.8133 0.8428 0.0390  0.0883  0.0174  83  LEU A CB  
659  C CG  . LEU A 91  ? 1.0372 0.8995 0.8713 0.0237  0.0625  0.0251  83  LEU A CG  
660  C CD1 . LEU A 91  ? 1.1312 0.9782 0.9428 0.0395  0.0497  0.0526  83  LEU A CD1 
661  C CD2 . LEU A 91  ? 0.9623 0.8186 0.7649 -0.0160 0.0705  0.0099  83  LEU A CD2 
662  N N   . PHE A 92  ? 0.9904 0.9686 0.9463 0.0701  0.0389  0.0163  84  PHE A N   
663  C CA  . PHE A 92  ? 0.9163 0.9487 0.9018 0.0557  0.0276  0.0040  84  PHE A CA  
664  C C   . PHE A 92  ? 0.8846 0.9383 0.8539 0.0416  -0.0009 0.0046  84  PHE A C   
665  O O   . PHE A 92  ? 0.9192 0.9835 0.8779 0.0538  -0.0190 0.0144  84  PHE A O   
666  C CB  . PHE A 92  ? 0.9006 0.9872 0.9493 0.0807  0.0214  0.0042  84  PHE A CB  
667  C CG  . PHE A 92  ? 0.9399 1.0160 1.0229 0.1021  0.0524  -0.0042 84  PHE A CG  
668  C CD1 . PHE A 92  ? 1.1670 1.2416 1.2531 0.0782  0.0866  -0.0279 84  PHE A CD1 
669  C CD2 . PHE A 92  ? 0.9275 0.9911 1.0366 0.1464  0.0475  0.0108  84  PHE A CD2 
670  C CE1 . PHE A 92  ? 1.2331 1.3007 1.3534 0.0978  0.1221  -0.0456 84  PHE A CE1 
671  C CE2 . PHE A 92  ? 1.0053 1.0548 1.1569 0.1734  0.0777  -0.0027 84  PHE A CE2 
672  C CZ  . PHE A 92  ? 1.1850 1.2396 1.3450 0.1490  0.1185  -0.0356 84  PHE A CZ  
673  N N   . PHE A 93  ? 0.9052 0.9614 0.8696 0.0156  -0.0047 -0.0066 85  PHE A N   
674  C CA  . PHE A 93  ? 0.7486 0.8191 0.7093 0.0072  -0.0303 -0.0125 85  PHE A CA  
675  C C   . PHE A 93  ? 0.7472 0.8568 0.7425 0.0082  -0.0496 -0.0178 85  PHE A C   
676  O O   . PHE A 93  ? 0.8135 0.9410 0.8366 0.0012  -0.0424 -0.0186 85  PHE A O   
677  C CB  . PHE A 93  ? 0.7803 0.8272 0.7237 -0.0159 -0.0334 -0.0181 85  PHE A CB  
678  C CG  . PHE A 93  ? 1.0351 1.0624 0.9501 -0.0211 -0.0265 -0.0194 85  PHE A CG  
679  C CD1 . PHE A 93  ? 1.1254 1.1485 1.0251 -0.0112 -0.0147 -0.0158 85  PHE A CD1 
680  C CD2 . PHE A 93  ? 0.9031 0.9176 0.8055 -0.0395 -0.0345 -0.0222 85  PHE A CD2 
681  C CE1 . PHE A 93  ? 1.0176 1.0275 0.8931 -0.0250 -0.0051 -0.0195 85  PHE A CE1 
682  C CE2 . PHE A 93  ? 0.9332 0.9448 0.8187 -0.0483 -0.0300 -0.0269 85  PHE A CE2 
683  C CZ  . PHE A 93  ? 0.9712 0.9822 0.8449 -0.0438 -0.0123 -0.0280 85  PHE A CZ  
684  N N   . PHE A 94  ? 0.8165 0.9435 0.8098 0.0121  -0.0711 -0.0261 86  PHE A N   
685  C CA  . PHE A 94  ? 0.6134 0.7724 0.6336 0.0054  -0.0916 -0.0378 86  PHE A CA  
686  C C   . PHE A 94  ? 0.7508 0.8917 0.7641 -0.0048 -0.1072 -0.0576 86  PHE A C   
687  O O   . PHE A 94  ? 0.8364 0.9827 0.8326 0.0036  -0.1115 -0.0698 86  PHE A O   
688  C CB  . PHE A 94  ? 0.7029 0.9070 0.7292 0.0218  -0.1058 -0.0342 86  PHE A CB  
689  C CG  . PHE A 94  ? 0.6564 0.8829 0.7091 0.0407  -0.0978 -0.0158 86  PHE A CG  
690  C CD1 . PHE A 94  ? 0.6190 0.8910 0.7250 0.0360  -0.0999 -0.0207 86  PHE A CD1 
691  C CD2 . PHE A 94  ? 0.6946 0.8965 0.7246 0.0631  -0.0871 0.0041  86  PHE A CD2 
692  C CE1 . PHE A 94  ? 0.6519 0.9548 0.7991 0.0605  -0.0913 -0.0096 86  PHE A CE1 
693  C CE2 . PHE A 94  ? 0.7956 1.0099 0.8590 0.0889  -0.0810 0.0187  86  PHE A CE2 
694  C CZ  . PHE A 94  ? 0.7455 1.0156 0.8732 0.0913  -0.0831 0.0100  86  PHE A CZ  
695  N N   . VAL A 95  ? 0.7218 0.8383 0.7484 -0.0237 -0.1139 -0.0614 87  VAL A N   
696  C CA  . VAL A 95  ? 0.8610 0.9472 0.8902 -0.0280 -0.1322 -0.0802 87  VAL A CA  
697  C C   . VAL A 95  ? 0.9185 1.0125 0.9678 -0.0454 -0.1473 -0.0965 87  VAL A C   
698  O O   . VAL A 95  ? 0.9660 1.0513 1.0265 -0.0699 -0.1462 -0.0867 87  VAL A O   
699  C CB  . VAL A 95  ? 0.8138 0.8471 0.8349 -0.0369 -0.1361 -0.0671 87  VAL A CB  
700  C CG1 . VAL A 95  ? 0.7811 0.7809 0.8149 -0.0269 -0.1580 -0.0863 87  VAL A CG1 
701  C CG2 . VAL A 95  ? 0.7450 0.7793 0.7451 -0.0298 -0.1199 -0.0518 87  VAL A CG2 
702  N N   . ASN A 96  ? 0.9880 1.1009 1.0377 -0.0389 -0.1586 -0.1245 88  ASN A N   
703  C CA  . ASN A 96  ? 0.9184 1.0501 0.9824 -0.0591 -0.1735 -0.1465 88  ASN A CA  
704  C C   . ASN A 96  ? 0.8803 1.0716 0.9631 -0.0697 -0.1721 -0.1301 88  ASN A C   
705  O O   . ASN A 96  ? 0.7492 0.9482 0.8570 -0.0985 -0.1769 -0.1337 88  ASN A O   
706  C CB  . ASN A 96  ? 0.7907 0.8567 0.8668 -0.0817 -0.1846 -0.1573 88  ASN A CB  
707  C CG  . ASN A 96  ? 0.8605 0.8758 0.9355 -0.0641 -0.1932 -0.1856 88  ASN A CG  
708  O OD1 . ASN A 96  ? 1.0230 0.9718 1.1033 -0.0602 -0.2007 -0.1758 88  ASN A OD1 
709  N ND2 . ASN A 96  ? 0.7851 0.8343 0.8536 -0.0526 -0.1929 -0.2215 88  ASN A ND2 
710  N N   . ASN A 97  ? 1.0066 1.2395 1.0812 -0.0463 -0.1652 -0.1122 89  ASN A N   
711  C CA  . ASN A 97  ? 1.0284 1.3251 1.1319 -0.0421 -0.1675 -0.0967 89  ASN A CA  
712  C C   . ASN A 97  ? 0.7902 1.0911 0.9307 -0.0571 -0.1498 -0.0846 89  ASN A C   
713  O O   . ASN A 97  ? 0.7232 1.0886 0.9093 -0.0629 -0.1525 -0.0844 89  ASN A O   
714  C CB  . ASN A 97  ? 1.2570 1.6122 1.3741 -0.0563 -0.1951 -0.1172 89  ASN A CB  
715  C CG  . ASN A 97  ? 1.4673 1.8272 1.5364 -0.0471 -0.2092 -0.1319 89  ASN A CG  
716  O OD1 . ASN A 97  ? 1.5117 1.8402 1.5608 -0.0617 -0.2121 -0.1643 89  ASN A OD1 
717  N ND2 . ASN A 97  ? 1.5513 1.9462 1.5991 -0.0237 -0.2165 -0.1086 89  ASN A ND2 
718  N N   . THR A 98  ? 0.9363 1.1762 1.0574 -0.0654 -0.1317 -0.0760 90  THR A N   
719  C CA  . THR A 98  ? 0.9396 1.1791 1.0775 -0.0850 -0.1083 -0.0645 90  THR A CA  
720  C C   . THR A 98  ? 0.8899 1.0835 0.9935 -0.0728 -0.0867 -0.0482 90  THR A C   
721  O O   . THR A 98  ? 1.0586 1.2013 1.1267 -0.0669 -0.0943 -0.0461 90  THR A O   
722  C CB  . THR A 98  ? 1.0886 1.2929 1.2251 -0.1306 -0.1119 -0.0702 90  THR A CB  
723  O OG1 . THR A 98  ? 1.3631 1.4928 1.4642 -0.1299 -0.1298 -0.0738 90  THR A OG1 
724  C CG2 . THR A 98  ? 1.2689 1.5312 1.4482 -0.1550 -0.1255 -0.0891 90  THR A CG2 
725  N N   . ILE A 99  ? 0.8823 1.0999 1.0017 -0.0695 -0.0594 -0.0414 91  ILE A N   
726  C CA  . ILE A 99  ? 0.8148 0.9905 0.8981 -0.0645 -0.0360 -0.0318 91  ILE A CA  
727  C C   . ILE A 99  ? 0.7984 0.9227 0.8417 -0.1028 -0.0321 -0.0249 91  ILE A C   
728  O O   . ILE A 99  ? 0.8012 0.9364 0.8508 -0.1371 -0.0180 -0.0251 91  ILE A O   
729  C CB  . ILE A 99  ? 0.8639 1.0753 0.9775 -0.0497 -0.0039 -0.0345 91  ILE A CB  
730  C CG1 . ILE A 99  ? 0.7109 0.9538 0.8540 -0.0046 -0.0152 -0.0309 91  ILE A CG1 
731  C CG2 . ILE A 99  ? 0.9796 1.1423 1.0483 -0.0572 0.0243  -0.0322 91  ILE A CG2 
732  C CD1 . ILE A 99  ? 0.8049 1.0750 0.9901 0.0221  0.0122  -0.0342 91  ILE A CD1 
733  N N   . PRO A 100 ? 0.8446 0.9165 0.8464 -0.0989 -0.0462 -0.0172 92  PRO A N   
734  C CA  . PRO A 100 ? 0.8663 0.8837 0.8263 -0.1292 -0.0562 -0.0034 92  PRO A CA  
735  C C   . PRO A 100 ? 0.9599 0.9667 0.8809 -0.1558 -0.0272 0.0047  92  PRO A C   
736  O O   . PRO A 100 ? 1.0271 1.0527 0.9487 -0.1412 -0.0009 -0.0042 92  PRO A O   
737  C CB  . PRO A 100 ? 0.8367 0.8250 0.7830 -0.1057 -0.0814 -0.0025 92  PRO A CB  
738  C CG  . PRO A 100 ? 0.7214 0.7417 0.6781 -0.0765 -0.0658 -0.0120 92  PRO A CG  
739  C CD  . PRO A 100 ? 0.8306 0.8975 0.8246 -0.0666 -0.0550 -0.0198 92  PRO A CD  
740  N N   . PRO A 101 ? 1.0873 1.0574 0.9678 -0.1976 -0.0315 0.0211  93  PRO A N   
741  C CA  . PRO A 101 ? 1.0883 1.0458 0.9132 -0.2330 -0.0046 0.0282  93  PRO A CA  
742  C C   . PRO A 101 ? 1.1627 1.0913 0.9435 -0.2236 -0.0160 0.0341  93  PRO A C   
743  O O   . PRO A 101 ? 0.9548 0.8585 0.7370 -0.2037 -0.0548 0.0442  93  PRO A O   
744  C CB  . PRO A 101 ? 1.0706 0.9852 0.8530 -0.2828 -0.0180 0.0525  93  PRO A CB  
745  C CG  . PRO A 101 ? 1.1361 1.0130 0.9423 -0.2627 -0.0644 0.0620  93  PRO A CG  
746  C CD  . PRO A 101 ? 1.0456 0.9760 0.9229 -0.2182 -0.0617 0.0344  93  PRO A CD  
747  N N   . THR A 102 ? 1.2524 1.1895 0.9996 -0.2391 0.0191  0.0228  94  THR A N   
748  C CA  . THR A 102 ? 1.1346 1.0514 0.8398 -0.2379 0.0117  0.0226  94  THR A CA  
749  C C   . THR A 102 ? 1.2393 1.1150 0.8751 -0.2730 -0.0236 0.0514  94  THR A C   
750  O O   . THR A 102 ? 1.1288 0.9933 0.7538 -0.2615 -0.0574 0.0596  94  THR A O   
751  C CB  . THR A 102 ? 1.1033 1.0327 0.7889 -0.2481 0.0625  -0.0045 94  THR A CB  
752  O OG1 . THR A 102 ? 1.4164 1.3474 1.0556 -0.2960 0.0929  -0.0071 94  THR A OG1 
753  C CG2 . THR A 102 ? 1.1044 1.0665 0.8616 -0.2058 0.0901  -0.0269 94  THR A CG2 
754  N N   . SER A 103 ? 1.4083 1.2652 0.9981 -0.3177 -0.0173 0.0684  95  SER A N   
755  C CA  . SER A 103 ? 1.4661 1.2751 0.9746 -0.3565 -0.0537 0.1046  95  SER A CA  
756  C C   . SER A 103 ? 1.3996 1.1705 0.9334 -0.3283 -0.1178 0.1340  95  SER A C   
757  O O   . SER A 103 ? 1.7124 1.4488 1.1996 -0.3377 -0.1635 0.1639  95  SER A O   
758  C CB  . SER A 103 ? 1.6440 1.4371 1.0911 -0.4174 -0.0277 0.1188  95  SER A CB  
759  O OG  . SER A 103 ? 1.6046 1.3957 1.1012 -0.4154 -0.0270 0.1239  95  SER A OG  
760  N N   . ALA A 104 ? 1.2156 0.9948 0.8254 -0.2926 -0.1222 0.1229  96  ALA A N   
761  C CA  . ALA A 104 ? 1.2086 0.9495 0.8527 -0.2623 -0.1753 0.1397  96  ALA A CA  
762  C C   . ALA A 104 ? 1.3024 1.0602 0.9732 -0.2223 -0.2081 0.1342  96  ALA A C   
763  O O   . ALA A 104 ? 1.3473 1.1540 1.0341 -0.2088 -0.1836 0.1085  96  ALA A O   
764  C CB  . ALA A 104 ? 1.0080 0.7635 0.7237 -0.2371 -0.1656 0.1175  96  ALA A CB  
765  N N   . THR A 105 ? 1.3705 1.0870 1.0501 -0.2041 -0.2634 0.1580  97  THR A N   
766  C CA  . THR A 105 ? 1.2816 1.0279 1.0059 -0.1633 -0.2974 0.1492  97  THR A CA  
767  C C   . THR A 105 ? 1.1614 0.9332 0.9757 -0.1134 -0.2951 0.1151  97  THR A C   
768  O O   . THR A 105 ? 1.2929 1.0378 1.1281 -0.1095 -0.2868 0.1080  97  THR A O   
769  C CB  . THR A 105 ? 1.4539 1.1519 1.1550 -0.1605 -0.3638 0.1906  97  THR A CB  
770  O OG1 . THR A 105 ? 1.6560 1.2844 1.3830 -0.1425 -0.3933 0.2065  97  THR A OG1 
771  C CG2 . THR A 105 ? 1.4812 1.1490 1.0735 -0.2192 -0.3684 0.2285  97  THR A CG2 
772  N N   . MET A 106 ? 1.1812 1.0091 1.0449 -0.0815 -0.3005 0.0910  98  MET A N   
773  C CA  . MET A 106 ? 1.1828 1.0439 1.1234 -0.0395 -0.2932 0.0542  98  MET A CA  
774  C C   . MET A 106 ? 1.3013 1.1144 1.2867 -0.0077 -0.3353 0.0569  98  MET A C   
775  O O   . MET A 106 ? 1.4148 1.2334 1.4500 0.0181  -0.3253 0.0248  98  MET A O   
776  C CB  . MET A 106 ? 1.0858 1.0215 1.0650 -0.0216 -0.2864 0.0281  98  MET A CB  
777  C CG  . MET A 106 ? 1.0960 1.0666 1.0382 -0.0486 -0.2397 0.0179  98  MET A CG  
778  S SD  . MET A 106 ? 0.9326 0.9057 0.8751 -0.0471 -0.1908 -0.0009 98  MET A SD  
779  C CE  . MET A 106 ? 0.7868 0.8068 0.7987 -0.0085 -0.1913 -0.0376 98  MET A CE  
780  N N   . GLY A 107 ? 1.2480 1.0084 1.2112 -0.0104 -0.3837 0.0953  99  GLY A N   
781  C CA  . GLY A 107 ? 1.0727 0.7630 1.0724 0.0201  -0.4280 0.1052  99  GLY A CA  
782  C C   . GLY A 107 ? 1.2139 0.8266 1.1791 -0.0073 -0.4140 0.1147  99  GLY A C   
783  O O   . GLY A 107 ? 1.5052 1.0795 1.5171 0.0177  -0.4205 0.0917  99  GLY A O   
784  N N   . GLN A 108 ? 1.1836 0.7777 1.0686 -0.0624 -0.3918 0.1434  100 GLN A N   
785  C CA  . GLN A 108 ? 1.2756 0.8153 1.1292 -0.0999 -0.3715 0.1503  100 GLN A CA  
786  C C   . GLN A 108 ? 1.4010 0.9972 1.3023 -0.0905 -0.3280 0.1008  100 GLN A C   
787  O O   . GLN A 108 ? 1.7250 1.2828 1.6416 -0.0985 -0.3249 0.0880  100 GLN A O   
788  C CB  . GLN A 108 ? 1.4840 1.0141 1.2475 -0.1631 -0.3493 0.1849  100 GLN A CB  
789  C CG  . GLN A 108 ? 1.9505 1.3983 1.6402 -0.1906 -0.3950 0.2437  100 GLN A CG  
790  C CD  . GLN A 108 ? 1.9234 1.3854 1.5174 -0.2538 -0.3667 0.2686  100 GLN A CD  
791  O OE1 . GLN A 108 ? 1.5104 1.0493 1.1052 -0.2661 -0.3154 0.2380  100 GLN A OE1 
792  N NE2 . GLN A 108 ? 2.1375 1.5202 1.6449 -0.2950 -0.3996 0.3238  100 GLN A NE2 
793  N N   . LEU A 109 ? 1.1846 0.8684 1.1040 -0.0770 -0.2972 0.0747  101 LEU A N   
794  C CA  . LEU A 109 ? 1.0585 0.7989 1.0127 -0.0679 -0.2613 0.0352  101 LEU A CA  
795  C C   . LEU A 109 ? 1.1985 0.9410 1.2141 -0.0265 -0.2755 -0.0022 101 LEU A C   
796  O O   . LEU A 109 ? 1.4400 1.1893 1.4741 -0.0283 -0.2618 -0.0296 101 LEU A O   
797  C CB  . LEU A 109 ? 0.8575 0.6734 0.8056 -0.0654 -0.2279 0.0243  101 LEU A CB  
798  C CG  . LEU A 109 ? 0.9021 0.7703 0.8679 -0.0634 -0.1927 -0.0017 101 LEU A CG  
799  C CD1 . LEU A 109 ? 0.8360 0.6981 0.7809 -0.0995 -0.1733 0.0099  101 LEU A CD1 
800  C CD2 . LEU A 109 ? 0.8845 0.8077 0.8472 -0.0523 -0.1672 -0.0107 101 LEU A CD2 
801  N N   . TYR A 110 ? 1.1946 0.9389 1.2444 0.0095  -0.3024 -0.0073 102 TYR A N   
802  C CA  . TYR A 110 ? 1.1464 0.8973 1.2618 0.0517  -0.3119 -0.0502 102 TYR A CA  
803  C C   . TYR A 110 ? 1.2131 0.8713 1.3383 0.0523  -0.3353 -0.0528 102 TYR A C   
804  O O   . TYR A 110 ? 1.2571 0.9161 1.4112 0.0617  -0.3229 -0.0960 102 TYR A O   
805  C CB  . TYR A 110 ? 1.1568 0.9388 1.3206 0.0914  -0.3371 -0.0557 102 TYR A CB  
806  C CG  . TYR A 110 ? 1.2207 1.0152 1.4636 0.1388  -0.3435 -0.1070 102 TYR A CG  
807  C CD1 . TYR A 110 ? 1.1592 1.0364 1.4310 0.1494  -0.3057 -0.1575 102 TYR A CD1 
808  C CD2 . TYR A 110 ? 1.2129 0.9323 1.4990 0.1722  -0.3859 -0.1058 102 TYR A CD2 
809  C CE1 . TYR A 110 ? 1.1482 1.0444 1.4897 0.1887  -0.3039 -0.2124 102 TYR A CE1 
810  C CE2 . TYR A 110 ? 1.1813 0.9128 1.5479 0.2194  -0.3868 -0.1618 102 TYR A CE2 
811  C CZ  . TYR A 110 ? 1.2578 1.0836 1.6521 0.2259  -0.3426 -0.2185 102 TYR A CZ  
812  O OH  . TYR A 110 ? 1.3061 1.1513 1.7779 0.2689  -0.3361 -0.2820 102 TYR A OH  
813  N N   . GLU A 111 ? 1.2666 0.8391 1.3593 0.0369  -0.3691 -0.0060 103 GLU A N   
814  C CA  . GLU A 111 ? 1.3602 0.8215 1.4545 0.0327  -0.3951 -0.0005 103 GLU A CA  
815  C C   . GLU A 111 ? 1.4735 0.9236 1.5437 -0.0118 -0.3645 -0.0175 103 GLU A C   
816  O O   . GLU A 111 ? 1.6347 1.0134 1.7219 -0.0134 -0.3742 -0.0390 103 GLU A O   
817  C CB  . GLU A 111 ? 1.3966 0.7644 1.4389 0.0132  -0.4369 0.0656  103 GLU A CB  
818  C CG  . GLU A 111 ? 1.7229 0.9533 1.7692 0.0169  -0.4739 0.0786  103 GLU A CG  
819  C CD  . GLU A 111 ? 2.0077 1.1371 1.9732 -0.0234 -0.5087 0.1541  103 GLU A CD  
820  O OE1 . GLU A 111 ? 2.1481 1.3239 2.0527 -0.0573 -0.4998 0.1904  103 GLU A OE1 
821  O OE2 . GLU A 111 ? 2.1301 1.1279 2.0870 -0.0242 -0.5441 0.1767  103 GLU A OE2 
822  N N   . ASP A 112 ? 1.4178 0.9406 1.4541 -0.0470 -0.3286 -0.0110 104 ASP A N   
823  C CA  . ASP A 112 ? 1.3482 0.8804 1.3696 -0.0909 -0.3029 -0.0232 104 ASP A CA  
824  C C   . ASP A 112 ? 1.4293 1.0498 1.4854 -0.0757 -0.2767 -0.0748 104 ASP A C   
825  O O   . ASP A 112 ? 1.6804 1.3040 1.7417 -0.1013 -0.2677 -0.0987 104 ASP A O   
826  C CB  . ASP A 112 ? 1.3443 0.9041 1.3146 -0.1393 -0.2801 0.0146  104 ASP A CB  
827  C CG  . ASP A 112 ? 1.5497 1.0151 1.4646 -0.1746 -0.3024 0.0670  104 ASP A CG  
828  O OD1 . ASP A 112 ? 1.8105 1.1979 1.7259 -0.1483 -0.3432 0.0855  104 ASP A OD1 
829  O OD2 . ASP A 112 ? 1.6001 1.0715 1.4711 -0.2288 -0.2796 0.0902  104 ASP A OD2 
830  N N   . ASN A 113 ? 1.3191 1.0117 1.3939 -0.0396 -0.2660 -0.0905 105 ASN A N   
831  C CA  . ASN A 113 ? 1.2437 1.0212 1.3314 -0.0323 -0.2406 -0.1272 105 ASN A CA  
832  C C   . ASN A 113 ? 1.1965 1.0097 1.3175 0.0093  -0.2382 -0.1691 105 ASN A C   
833  O O   . ASN A 113 ? 1.2821 1.1683 1.3989 0.0133  -0.2164 -0.1905 105 ASN A O   
834  C CB  . ASN A 113 ? 1.0084 0.8548 1.0717 -0.0443 -0.2155 -0.1031 105 ASN A CB  
835  C CG  . ASN A 113 ? 1.1562 1.0032 1.2004 -0.0865 -0.2049 -0.0813 105 ASN A CG  
836  O OD1 . ASN A 113 ? 1.6394 1.4590 1.6899 -0.1125 -0.2119 -0.0918 105 ASN A OD1 
837  N ND2 . ASN A 113 ? 1.2872 1.1686 1.3117 -0.0962 -0.1851 -0.0557 105 ASN A ND2 
838  N N   . HIS A 114 ? 1.1104 0.8746 1.2654 0.0398  -0.2602 -0.1807 106 HIS A N   
839  C CA  . HIS A 114 ? 1.1846 0.9927 1.3829 0.0785  -0.2523 -0.2299 106 HIS A CA  
840  C C   . HIS A 114 ? 1.2216 1.0205 1.4305 0.0755  -0.2439 -0.2859 106 HIS A C   
841  O O   . HIS A 114 ? 1.2762 0.9966 1.4832 0.0596  -0.2597 -0.2903 106 HIS A O   
842  C CB  . HIS A 114 ? 1.2085 0.9812 1.4571 0.1197  -0.2804 -0.2280 106 HIS A CB  
843  C CG  . HIS A 114 ? 1.2052 0.8708 1.4806 0.1337  -0.3110 -0.2374 106 HIS A CG  
844  N ND1 . HIS A 114 ? 1.4029 1.0512 1.7252 0.1604  -0.3066 -0.3007 106 HIS A ND1 
845  C CD2 . HIS A 114 ? 1.2093 0.7707 1.4660 0.1222  -0.3455 -0.1917 106 HIS A CD2 
846  C CE1 . HIS A 114 ? 1.5648 1.0952 1.9020 0.1687  -0.3384 -0.2943 106 HIS A CE1 
847  N NE2 . HIS A 114 ? 1.4428 0.9166 1.7376 0.1443  -0.3639 -0.2245 106 HIS A NE2 
848  N N   . GLU A 115 ? 1.1240 1.0004 1.3359 0.0843  -0.2177 -0.3293 107 GLU A N   
849  C CA  . GLU A 115 ? 1.1391 1.0157 1.3525 0.0785  -0.2074 -0.3904 107 GLU A CA  
850  C C   . GLU A 115 ? 1.2201 1.0454 1.4953 0.1181  -0.2159 -0.4400 107 GLU A C   
851  O O   . GLU A 115 ? 1.2733 1.0668 1.5935 0.1523  -0.2356 -0.4202 107 GLU A O   
852  C CB  . GLU A 115 ? 1.1177 1.0938 1.2986 0.0688  -0.1764 -0.4170 107 GLU A CB  
853  C CG  . GLU A 115 ? 1.0558 1.0745 1.1811 0.0350  -0.1728 -0.3740 107 GLU A CG  
854  C CD  . GLU A 115 ? 1.3328 1.4276 1.4139 0.0200  -0.1527 -0.4012 107 GLU A CD  
855  O OE1 . GLU A 115 ? 1.5479 1.6634 1.6337 0.0278  -0.1366 -0.4590 107 GLU A OE1 
856  O OE2 . GLU A 115 ? 1.3717 1.5052 1.4122 0.0007  -0.1533 -0.3649 107 GLU A OE2 
857  N N   . GLU A 116 ? 1.4157 1.2347 1.6948 0.1147  -0.2029 -0.5068 108 GLU A N   
858  C CA  . GLU A 116 ? 1.5148 1.2746 1.8587 0.1547  -0.2078 -0.5645 108 GLU A CA  
859  C C   . GLU A 116 ? 1.6147 1.4516 2.0189 0.2016  -0.1877 -0.6012 108 GLU A C   
860  O O   . GLU A 116 ? 1.8162 1.6195 2.2934 0.2461  -0.1923 -0.6420 108 GLU A O   
861  C CB  . GLU A 116 ? 1.4221 1.1544 1.7469 0.1312  -0.1943 -0.6348 108 GLU A CB  
862  C CG  . GLU A 116 ? 1.6271 1.2599 1.9202 0.0903  -0.2190 -0.6110 108 GLU A CG  
863  C CD  . GLU A 116 ? 1.7350 1.2392 2.0698 0.1156  -0.2501 -0.5802 108 GLU A CD  
864  O OE1 . GLU A 116 ? 1.8019 1.2446 2.1625 0.1316  -0.2450 -0.6144 108 GLU A OE1 
865  O OE2 . GLU A 116 ? 1.6888 1.1572 2.0201 0.1163  -0.2774 -0.5127 108 GLU A OE2 
866  N N   . ASP A 117 ? 1.4657 1.4087 1.8420 0.1892  -0.1639 -0.5826 109 ASP A N   
867  C CA  . ASP A 117 ? 1.3475 1.3779 1.7797 0.2224  -0.1408 -0.6140 109 ASP A CA  
868  C C   . ASP A 117 ? 1.3510 1.3836 1.8247 0.2475  -0.1685 -0.5552 109 ASP A C   
869  O O   . ASP A 117 ? 1.4217 1.5418 1.9363 0.2643  -0.1524 -0.5654 109 ASP A O   
870  C CB  . ASP A 117 ? 1.0932 1.2322 1.4654 0.1878  -0.0975 -0.6286 109 ASP A CB  
871  C CG  . ASP A 117 ? 1.1527 1.3063 1.4499 0.1503  -0.1038 -0.5520 109 ASP A CG  
872  O OD1 . ASP A 117 ? 1.3734 1.4581 1.6559 0.1427  -0.1356 -0.4982 109 ASP A OD1 
873  O OD2 . ASP A 117 ? 1.1527 1.3837 1.4048 0.1274  -0.0749 -0.5470 109 ASP A OD2 
874  N N   . TYR A 118 ? 1.2381 1.1777 1.6960 0.2433  -0.2094 -0.4950 110 TYR A N   
875  C CA  . TYR A 118 ? 1.3027 1.2303 1.7834 0.2601  -0.2430 -0.4345 110 TYR A CA  
876  C C   . TYR A 118 ? 1.2482 1.2664 1.6898 0.2338  -0.2229 -0.3994 110 TYR A C   
877  O O   . TYR A 118 ? 1.1903 1.2463 1.6672 0.2506  -0.2371 -0.3768 110 TYR A O   
878  C CB  . TYR A 118 ? 1.4042 1.3341 1.9920 0.3226  -0.2653 -0.4644 110 TYR A CB  
879  C CG  . TYR A 118 ? 1.4762 1.2789 2.1024 0.3545  -0.3014 -0.4750 110 TYR A CG  
880  C CD1 . TYR A 118 ? 1.2594 1.0145 1.8831 0.3506  -0.2811 -0.5357 110 TYR A CD1 
881  C CD2 . TYR A 118 ? 1.6991 1.4226 2.3565 0.3846  -0.3576 -0.4226 110 TYR A CD2 
882  C CE1 . TYR A 118 ? 1.5224 1.1645 2.1617 0.3627  -0.3062 -0.5298 110 TYR A CE1 
883  C CE2 . TYR A 118 ? 1.8419 1.4471 2.5119 0.3992  -0.3859 -0.4154 110 TYR A CE2 
884  C CZ  . TYR A 118 ? 1.7631 1.3272 2.4257 0.3882  -0.3577 -0.4693 110 TYR A CZ  
885  O OH  . TYR A 118 ? 1.8105 1.2549 2.4806 0.3986  -0.3810 -0.4604 110 TYR A OH  
886  N N   . PHE A 119 ? 1.2151 1.2644 1.5841 0.1921  -0.1928 -0.3950 111 PHE A N   
887  C CA  . PHE A 119 ? 1.0639 1.1761 1.3859 0.1645  -0.1730 -0.3591 111 PHE A CA  
888  C C   . PHE A 119 ? 0.8928 0.9589 1.1450 0.1296  -0.1815 -0.3032 111 PHE A C   
889  O O   . PHE A 119 ? 1.0914 1.1183 1.3156 0.1128  -0.1842 -0.3072 111 PHE A O   
890  C CB  . PHE A 119 ? 1.1795 1.3748 1.4770 0.1485  -0.1289 -0.3991 111 PHE A CB  
891  C CG  . PHE A 119 ? 1.2774 1.5532 1.6381 0.1704  -0.1076 -0.4441 111 PHE A CG  
892  C CD1 . PHE A 119 ? 1.2839 1.5871 1.6989 0.1888  -0.1237 -0.4250 111 PHE A CD1 
893  C CD2 . PHE A 119 ? 1.3268 1.6607 1.6924 0.1681  -0.0704 -0.5085 111 PHE A CD2 
894  C CE1 . PHE A 119 ? 1.3155 1.7099 1.8021 0.2069  -0.1035 -0.4702 111 PHE A CE1 
895  C CE2 . PHE A 119 ? 1.2854 1.7072 1.7164 0.1843  -0.0440 -0.5557 111 PHE A CE2 
896  C CZ  . PHE A 119 ? 1.3417 1.7977 1.8401 0.2049  -0.0607 -0.5369 111 PHE A CZ  
897  N N   . LEU A 120 ? 0.8276 0.9044 1.0562 0.1168  -0.1840 -0.2564 112 LEU A N   
898  C CA  . LEU A 120 ? 0.7283 0.7774 0.8976 0.0853  -0.1827 -0.2108 112 LEU A CA  
899  C C   . LEU A 120 ? 0.6992 0.8040 0.8257 0.0666  -0.1501 -0.2083 112 LEU A C   
900  O O   . LEU A 120 ? 0.8043 0.9554 0.9306 0.0665  -0.1326 -0.2106 112 LEU A O   
901  C CB  . LEU A 120 ? 0.8549 0.8732 1.0142 0.0790  -0.2023 -0.1643 112 LEU A CB  
902  C CG  . LEU A 120 ? 0.7453 0.7431 0.8488 0.0464  -0.1930 -0.1244 112 LEU A CG  
903  C CD1 . LEU A 120 ? 0.7302 0.6843 0.8231 0.0314  -0.1997 -0.1230 112 LEU A CD1 
904  C CD2 . LEU A 120 ? 0.8225 0.7948 0.9065 0.0350  -0.2081 -0.0861 112 LEU A CD2 
905  N N   . TYR A 121 ? 0.6785 0.7776 0.7699 0.0493  -0.1447 -0.2018 113 TYR A N   
906  C CA  . TYR A 121 ? 0.8342 0.9765 0.8833 0.0364  -0.1221 -0.1943 113 TYR A CA  
907  C C   . TYR A 121 ? 0.8695 0.9973 0.8904 0.0232  -0.1194 -0.1497 113 TYR A C   
908  O O   . TYR A 121 ? 1.0796 1.1864 1.1016 0.0145  -0.1305 -0.1369 113 TYR A O   
909  C CB  . TYR A 121 ? 0.8987 1.0620 0.9312 0.0301  -0.1210 -0.2239 113 TYR A CB  
910  C CG  . TYR A 121 ? 0.8920 1.0812 0.9437 0.0404  -0.1111 -0.2779 113 TYR A CG  
911  C CD1 . TYR A 121 ? 0.9451 1.1890 0.9703 0.0342  -0.0844 -0.2944 113 TYR A CD1 
912  C CD2 . TYR A 121 ? 0.7838 0.9392 0.8795 0.0546  -0.1255 -0.3146 113 TYR A CD2 
913  C CE1 . TYR A 121 ? 0.9128 1.1917 0.9585 0.0409  -0.0675 -0.3514 113 TYR A CE1 
914  C CE2 . TYR A 121 ? 0.9902 1.1715 1.1127 0.0686  -0.1117 -0.3730 113 TYR A CE2 
915  C CZ  . TYR A 121 ? 0.9910 1.2416 1.0903 0.0611  -0.0804 -0.3940 113 TYR A CZ  
916  O OH  . TYR A 121 ? 0.9234 1.2110 1.0520 0.0721  -0.0591 -0.4594 113 TYR A OH  
917  N N   . VAL A 122 ? 0.7800 0.9204 0.7792 0.0199  -0.1016 -0.1305 114 VAL A N   
918  C CA  . VAL A 122 ? 0.8254 0.9493 0.8017 0.0118  -0.0932 -0.0957 114 VAL A CA  
919  C C   . VAL A 122 ? 0.7955 0.9378 0.7362 0.0112  -0.0776 -0.0836 114 VAL A C   
920  O O   . VAL A 122 ? 0.9357 1.0916 0.8555 0.0066  -0.0625 -0.0884 114 VAL A O   
921  C CB  . VAL A 122 ? 0.8097 0.9126 0.7841 0.0052  -0.0873 -0.0807 114 VAL A CB  
922  C CG1 . VAL A 122 ? 0.6327 0.7159 0.5823 -0.0029 -0.0712 -0.0546 114 VAL A CG1 
923  C CG2 . VAL A 122 ? 0.5701 0.6473 0.5691 0.0053  -0.1106 -0.0818 114 VAL A CG2 
924  N N   . ALA A 123 ? 0.8433 0.9874 0.7791 0.0147  -0.0827 -0.0662 115 ALA A N   
925  C CA  . ALA A 123 ? 0.8407 0.9919 0.7433 0.0200  -0.0765 -0.0452 115 ALA A CA  
926  C C   . ALA A 123 ? 0.8974 1.0185 0.8019 0.0272  -0.0640 -0.0179 115 ALA A C   
927  O O   . ALA A 123 ? 0.9606 1.0764 0.8954 0.0275  -0.0638 -0.0172 115 ALA A O   
928  C CB  . ALA A 123 ? 0.6218 0.8082 0.5229 0.0243  -0.0980 -0.0476 115 ALA A CB  
929  N N   . TYR A 124 ? 0.9766 1.0738 0.8460 0.0302  -0.0507 0.0025  116 TYR A N   
930  C CA  . TYR A 124 ? 0.8604 0.9180 0.7327 0.0402  -0.0352 0.0222  116 TYR A CA  
931  C C   . TYR A 124 ? 0.9605 1.0053 0.8173 0.0626  -0.0428 0.0518  116 TYR A C   
932  O O   . TYR A 124 ? 1.0378 1.0844 0.8516 0.0593  -0.0524 0.0654  116 TYR A O   
933  C CB  . TYR A 124 ? 1.0184 1.0345 0.8653 0.0210  -0.0102 0.0190  116 TYR A CB  
934  C CG  . TYR A 124 ? 1.0147 1.0172 0.8141 0.0055  -0.0003 0.0259  116 TYR A CG  
935  C CD1 . TYR A 124 ? 1.1364 1.1772 0.9313 -0.0128 -0.0006 0.0040  116 TYR A CD1 
936  C CD2 . TYR A 124 ? 1.0832 1.0324 0.8439 0.0076  0.0117  0.0530  116 TYR A CD2 
937  C CE1 . TYR A 124 ? 1.3561 1.3952 1.1080 -0.0348 0.0154  0.0066  116 TYR A CE1 
938  C CE2 . TYR A 124 ? 1.2422 1.1737 0.9500 -0.0166 0.0240  0.0625  116 TYR A CE2 
939  C CZ  . TYR A 124 ? 1.2718 1.2548 0.9747 -0.0410 0.0281  0.0380  116 TYR A CZ  
940  O OH  . TYR A 124 ? 1.1188 1.0944 0.7694 -0.0723 0.0468  0.0442  116 TYR A OH  
941  N N   . SER A 125 ? 1.0953 1.1284 0.9876 0.0857  -0.0389 0.0616  117 SER A N   
942  C CA  . SER A 125 ? 1.1227 1.1415 1.0174 0.1181  -0.0518 0.0920  117 SER A CA  
943  C C   . SER A 125 ? 1.1083 1.0806 1.0333 0.1397  -0.0273 0.0940  117 SER A C   
944  O O   . SER A 125 ? 1.0631 1.0204 0.9981 0.1227  0.0006  0.0700  117 SER A O   
945  C CB  . SER A 125 ? 1.1563 1.2486 1.0927 0.1364  -0.0867 0.0946  117 SER A CB  
946  O OG  . SER A 125 ? 1.0895 1.1762 1.0393 0.1745  -0.1072 0.1271  117 SER A OG  
947  N N   . ASP A 126 ? 1.3215 1.2694 1.2595 0.1779  -0.0391 0.1217  118 ASP A N   
948  C CA  . ASP A 126 ? 1.2801 1.1819 1.2577 0.2069  -0.0143 0.1176  118 ASP A CA  
949  C C   . ASP A 126 ? 1.1824 1.1603 1.2544 0.2423  -0.0240 0.1059  118 ASP A C   
950  O O   . ASP A 126 ? 1.0114 0.9746 1.1356 0.2677  0.0020  0.0899  118 ASP A O   
951  C CB  . ASP A 126 ? 1.4393 1.2482 1.3781 0.2314  -0.0182 0.1549  118 ASP A CB  
952  C CG  . ASP A 126 ? 1.5353 1.3690 1.4771 0.2665  -0.0674 0.1974  118 ASP A CG  
953  O OD1 . ASP A 126 ? 1.4746 1.3842 1.4060 0.2510  -0.0968 0.1995  118 ASP A OD1 
954  O OD2 . ASP A 126 ? 1.5568 1.3302 1.5090 0.3098  -0.0789 0.2286  118 ASP A OD2 
955  N N   . GLU A 127 ? 1.3274 1.3913 1.4237 0.2405  -0.0588 0.1086  119 GLU A N   
956  C CA  . GLU A 127 ? 1.2283 1.3848 1.4190 0.2625  -0.0694 0.0935  119 GLU A CA  
957  C C   . GLU A 127 ? 1.2260 1.4524 1.4231 0.2196  -0.0747 0.0682  119 GLU A C   
958  O O   . GLU A 127 ? 1.4158 1.6151 1.5495 0.1826  -0.0728 0.0632  119 GLU A O   
959  C CB  . GLU A 127 ? 1.1275 1.3240 1.3541 0.3089  -0.1177 0.1267  119 GLU A CB  
960  N N   . SER A 128 ? 1.2218 1.5375 1.5002 0.2244  -0.0809 0.0507  120 SER A N   
961  C CA  . SER A 128 ? 1.2556 1.6263 1.5407 0.1799  -0.0855 0.0277  120 SER A CA  
962  C C   . SER A 128 ? 1.3728 1.8165 1.6732 0.1797  -0.1350 0.0350  120 SER A C   
963  O O   . SER A 128 ? 1.2696 1.8030 1.6504 0.1918  -0.1516 0.0280  120 SER A O   
964  C CB  . SER A 128 ? 1.0722 1.4925 1.4265 0.1656  -0.0519 -0.0018 120 SER A CB  
965  O OG  . SER A 128 ? 1.3406 1.8554 1.7929 0.1965  -0.0659 -0.0059 120 SER A OG  
966  N N   . VAL A 129 ? 1.2978 1.7104 1.5224 0.1628  -0.1569 0.0446  121 VAL A N   
967  C CA  . VAL A 129 ? 1.3492 1.8244 1.5687 0.1536  -0.2019 0.0455  121 VAL A CA  
968  C C   . VAL A 129 ? 1.1922 1.6622 1.3765 0.1053  -0.1999 0.0156  121 VAL A C   
969  O O   . VAL A 129 ? 1.0911 1.6144 1.3199 0.0796  -0.2065 -0.0084 121 VAL A O   
970  C CB  . VAL A 129 ? 1.4569 1.9056 1.6100 0.1747  -0.2326 0.0805  121 VAL A CB  
971  C CG1 . VAL A 129 ? 1.5356 1.8981 1.5974 0.1538  -0.2086 0.0822  121 VAL A CG1 
972  C CG2 . VAL A 129 ? 1.0607 1.5849 1.2048 0.1623  -0.2819 0.0793  121 VAL A CG2 
973  N N   . ASP B 9   ? 2.2246 1.9893 1.4633 0.3458  0.1681  0.8529  1   ASP B N   
974  C CA  . ASP B 9   ? 2.2820 2.0447 1.5316 0.3515  0.1122  0.8039  1   ASP B CA  
975  C C   . ASP B 9   ? 2.2811 2.0025 1.6189 0.3162  0.1279  0.7663  1   ASP B C   
976  O O   . ASP B 9   ? 2.2903 1.9811 1.6838 0.2849  0.1766  0.7780  1   ASP B O   
977  C CB  . ASP B 9   ? 2.4037 2.1480 1.6900 0.3743  0.0791  0.8378  1   ASP B CB  
978  C CG  . ASP B 9   ? 2.4177 2.1930 1.6978 0.3907  0.0129  0.7945  1   ASP B CG  
979  O OD1 . ASP B 9   ? 2.2925 2.0409 1.6572 0.3794  0.0057  0.7698  1   ASP B OD1 
980  O OD2 . ASP B 9   ? 2.4708 2.2993 1.6664 0.4145  -0.0335 0.7841  1   ASP B OD2 
981  N N   . GLU B 10  ? 2.1912 1.9156 1.5481 0.3205  0.0853  0.7221  2   GLU B N   
982  C CA  . GLU B 10  ? 2.0338 1.7279 1.4798 0.2806  0.0946  0.6631  2   GLU B CA  
983  C C   . GLU B 10  ? 2.0020 1.6389 1.5511 0.2788  0.0910  0.6676  2   GLU B C   
984  O O   . GLU B 10  ? 2.0109 1.6504 1.5667 0.3129  0.0625  0.6956  2   GLU B O   
985  C CB  . GLU B 10  ? 2.0005 1.7448 1.4248 0.2693  0.0515  0.5789  2   GLU B CB  
986  C CG  . GLU B 10  ? 2.1989 1.9725 1.5618 0.2532  0.0685  0.5410  2   GLU B CG  
987  C CD  . GLU B 10  ? 2.3404 2.0836 1.7651 0.2152  0.1240  0.5365  2   GLU B CD  
988  O OE1 . GLU B 10  ? 2.3936 2.0849 1.8971 0.1998  0.1529  0.5718  2   GLU B OE1 
989  O OE2 . GLU B 10  ? 2.3521 2.1222 1.7501 0.2008  0.1349  0.4951  2   GLU B OE2 
990  N N   . TRP B 11  ? 1.9152 1.5015 1.5426 0.2420  0.1186  0.6370  3   TRP B N   
991  C CA  . TRP B 11  ? 1.6773 1.1965 1.3944 0.2412  0.1187  0.6270  3   TRP B CA  
992  C C   . TRP B 11  ? 1.6447 1.1946 1.3900 0.2441  0.0847  0.5575  3   TRP B C   
993  O O   . TRP B 11  ? 1.6299 1.2253 1.3612 0.2208  0.0739  0.5012  3   TRP B O   
994  C CB  . TRP B 11  ? 1.6421 1.0924 1.4254 0.2001  0.1552  0.6188  3   TRP B CB  
995  C CG  . TRP B 11  ? 1.7764 1.1911 1.5636 0.1940  0.1928  0.6998  3   TRP B CG  
996  C CD1 . TRP B 11  ? 1.8502 1.3009 1.6091 0.1722  0.2251  0.7270  3   TRP B CD1 
997  C CD2 . TRP B 11  ? 1.9344 1.2905 1.7651 0.2041  0.1966  0.7466  3   TRP B CD2 
998  N NE1 . TRP B 11  ? 1.9525 1.3817 1.7416 0.1640  0.2462  0.7824  3   TRP B NE1 
999  C CE2 . TRP B 11  ? 1.9366 1.3031 1.7683 0.1817  0.2277  0.7957  3   TRP B CE2 
1000 C CE3 . TRP B 11  ? 1.9359 1.2370 1.8068 0.2313  0.1763  0.7468  3   TRP B CE3 
1001 C CZ2 . TRP B 11  ? 1.9942 1.3135 1.8667 0.1823  0.2369  0.8478  3   TRP B CZ2 
1002 C CZ3 . TRP B 11  ? 1.9108 1.1599 1.8163 0.2333  0.1844  0.7944  3   TRP B CZ3 
1003 C CH2 . TRP B 11  ? 2.0937 1.3499 2.0005 0.2072  0.2135  0.8457  3   TRP B CH2 
1004 N N   . VAL B 12  ? 1.6586 1.1852 1.4479 0.2759  0.0708  0.5672  4   VAL B N   
1005 C CA  . VAL B 12  ? 1.5988 1.1546 1.4301 0.2833  0.0492  0.5121  4   VAL B CA  
1006 C C   . VAL B 12  ? 1.6781 1.1646 1.5639 0.2638  0.0729  0.4656  4   VAL B C   
1007 O O   . VAL B 12  ? 1.5859 0.9915 1.5105 0.2813  0.0874  0.4810  4   VAL B O   
1008 C CB  . VAL B 12  ? 1.5608 1.1367 1.4184 0.3341  0.0261  0.5454  4   VAL B CB  
1009 C CG1 . VAL B 12  ? 1.3881 0.9988 1.3010 0.3447  0.0150  0.4965  4   VAL B CG1 
1010 C CG2 . VAL B 12  ? 1.7097 1.3609 1.5115 0.3526  -0.0096 0.5854  4   VAL B CG2 
1011 N N   . ASN B 13  ? 1.7412 1.2553 1.6264 0.2293  0.0732  0.4073  5   ASN B N   
1012 C CA  . ASN B 13  ? 1.6851 1.1429 1.6099 0.2096  0.0885  0.3567  5   ASN B CA  
1013 C C   . ASN B 13  ? 1.5800 1.0357 1.5385 0.2450  0.0816  0.3253  5   ASN B C   
1014 O O   . ASN B 13  ? 1.5223 1.0537 1.4837 0.2684  0.0640  0.3275  5   ASN B O   
1015 C CB  . ASN B 13  ? 1.7460 1.2436 1.6567 0.1656  0.0898  0.3107  5   ASN B CB  
1016 C CG  . ASN B 13  ? 1.7825 1.2324 1.7278 0.1454  0.0981  0.2558  5   ASN B CG  
1017 O OD1 . ASN B 13  ? 1.9125 1.2774 1.8866 0.1389  0.1090  0.2576  5   ASN B OD1 
1018 N ND2 . ASN B 13  ? 1.6166 1.1189 1.5594 0.1347  0.0890  0.2074  5   ASN B ND2 
1019 N N   . VAL B 14  ? 1.5304 0.9000 1.5165 0.2511  0.0947  0.2976  6   VAL B N   
1020 C CA  . VAL B 14  ? 1.5552 0.9168 1.5611 0.2918  0.0956  0.2608  6   VAL B CA  
1021 C C   . VAL B 14  ? 1.7925 1.1312 1.7944 0.2643  0.0991  0.1920  6   VAL B C   
1022 O O   . VAL B 14  ? 1.7733 1.0381 1.7811 0.2849  0.1038  0.1526  6   VAL B O   
1023 C CB  . VAL B 14  ? 1.7135 0.9818 1.7425 0.3394  0.1038  0.2825  6   VAL B CB  
1024 C CG1 . VAL B 14  ? 1.6814 0.9583 1.7230 0.3958  0.1098  0.2484  6   VAL B CG1 
1025 C CG2 . VAL B 14  ? 1.4871 0.7753 1.5183 0.3620  0.0986  0.3588  6   VAL B CG2 
1026 N N   . GLY B 15  ? 1.9350 1.3353 1.9219 0.2206  0.0939  0.1760  7   GLY B N   
1027 C CA  . GLY B 15  ? 1.7938 1.1890 1.7766 0.1942  0.0934  0.1175  7   GLY B CA  
1028 C C   . GLY B 15  ? 1.9548 1.4166 1.9329 0.2225  0.0928  0.0866  7   GLY B C   
1029 O O   . GLY B 15  ? 2.0839 1.5941 2.0737 0.2614  0.0938  0.1136  7   GLY B O   
1030 N N   . SER B 16  ? 2.0232 1.4966 1.9898 0.2064  0.0916  0.0375  8   SER B N   
1031 C CA  . SER B 16  ? 1.8833 1.3167 1.8457 0.1596  0.0851  0.0040  8   SER B CA  
1032 C C   . SER B 16  ? 1.8591 1.3191 1.8293 0.1126  0.0839  0.0358  8   SER B C   
1033 O O   . SER B 16  ? 1.7820 1.1847 1.7681 0.0836  0.0858  0.0452  8   SER B O   
1034 C CB  . SER B 16  ? 1.7333 1.0486 1.7012 0.1642  0.0813  -0.0220 8   SER B CB  
1035 O OG  . SER B 16  ? 1.7970 1.0812 1.7776 0.1136  0.0693  -0.0483 8   SER B OG  
1036 N N   . LYS B 17  ? 1.7596 1.3060 1.7211 0.1079  0.0807  0.0534  9   LYS B N   
1037 C CA  . LYS B 17  ? 1.5448 1.1216 1.4969 0.0794  0.0805  0.0843  9   LYS B CA  
1038 C C   . LYS B 17  ? 1.5101 1.0602 1.4721 0.0372  0.0881  0.0737  9   LYS B C   
1039 O O   . LYS B 17  ? 1.4487 1.0026 1.4214 0.0189  0.0836  0.0336  9   LYS B O   
1040 C CB  . LYS B 17  ? 1.2257 0.8892 1.1663 0.0770  0.0678  0.0825  9   LYS B CB  
1041 N N   . PHE B 18  ? 1.7036 1.2330 1.6658 0.0241  0.1002  0.1155  10  PHE B N   
1042 C CA  . PHE B 18  ? 1.7403 1.2545 1.7282 -0.0154 0.1126  0.1198  10  PHE B CA  
1043 C C   . PHE B 18  ? 1.6633 1.2475 1.6412 -0.0354 0.1119  0.0960  10  PHE B C   
1044 O O   . PHE B 18  ? 1.4845 1.1237 1.4262 -0.0212 0.1054  0.0949  10  PHE B O   
1045 C CB  . PHE B 18  ? 1.6458 1.1428 1.6329 -0.0188 0.1332  0.1832  10  PHE B CB  
1046 N N   . GLN B 19  ? 1.7189 1.2982 1.7351 -0.0683 0.1144  0.0764  11  GLN B N   
1047 C CA  . GLN B 19  ? 1.5683 1.2106 1.5836 -0.0846 0.1148  0.0551  11  GLN B CA  
1048 C C   . GLN B 19  ? 1.4685 1.1562 1.4546 -0.0820 0.1356  0.0906  11  GLN B C   
1049 O O   . GLN B 19  ? 1.4907 1.1621 1.4641 -0.0748 0.1532  0.1370  11  GLN B O   
1050 C CB  . GLN B 19  ? 1.6403 1.2713 1.7125 -0.1196 0.1105  0.0332  11  GLN B CB  
1051 C CG  . GLN B 19  ? 1.7863 1.3775 1.8672 -0.1166 0.0836  -0.0155 11  GLN B CG  
1052 C CD  . GLN B 19  ? 1.8377 1.4335 1.9666 -0.1502 0.0680  -0.0450 11  GLN B CD  
1053 O OE1 . GLN B 19  ? 1.7551 1.3251 1.9429 -0.1826 0.0695  -0.0275 11  GLN B OE1 
1054 N NE2 . GLN B 19  ? 1.8154 1.4485 1.9264 -0.1433 0.0511  -0.0848 11  GLN B NE2 
1055 N N   . TYR B 20  ? 1.3491 1.0911 1.3194 -0.0834 0.1338  0.0689  12  TYR B N   
1056 C CA  . TYR B 20  ? 1.1730 0.9549 1.0966 -0.0699 0.1491  0.0889  12  TYR B CA  
1057 C C   . TYR B 20  ? 1.2805 1.0717 1.2229 -0.0814 0.1861  0.1318  12  TYR B C   
1058 O O   . TYR B 20  ? 1.4393 1.2454 1.3303 -0.0606 0.2059  0.1670  12  TYR B O   
1059 C CB  . TYR B 20  ? 1.1083 0.9340 1.0192 -0.0677 0.1373  0.0509  12  TYR B CB  
1060 C CG  . TYR B 20  ? 1.2824 1.1381 1.1325 -0.0464 0.1467  0.0581  12  TYR B CG  
1061 C CD1 . TYR B 20  ? 1.4472 1.2990 1.2340 -0.0211 0.1266  0.0610  12  TYR B CD1 
1062 C CD2 . TYR B 20  ? 1.3728 1.2618 1.2272 -0.0477 0.1731  0.0599  12  TYR B CD2 
1063 C CE1 . TYR B 20  ? 1.4298 1.3007 1.1469 0.0027  0.1282  0.0585  12  TYR B CE1 
1064 C CE2 . TYR B 20  ? 1.4605 1.3711 1.2454 -0.0189 0.1829  0.0599  12  TYR B CE2 
1065 C CZ  . TYR B 20  ? 1.4686 1.3653 1.1787 0.0064  0.1581  0.0557  12  TYR B CZ  
1066 O OH  . TYR B 20  ? 1.5717 1.4820 1.1993 0.0390  0.1611  0.0469  12  TYR B OH  
1067 N N   . LYS B 21  ? 1.2686 1.0560 1.2860 -0.1133 0.1945  0.1318  13  LYS B N   
1068 C CA  . LYS B 21  ? 1.2854 1.0915 1.3461 -0.1293 0.2319  0.1817  13  LYS B CA  
1069 C C   . LYS B 21  ? 1.4143 1.1666 1.4994 -0.1364 0.2430  0.2327  13  LYS B C   
1070 O O   . LYS B 21  ? 1.3799 1.1475 1.4950 -0.1446 0.2792  0.2919  13  LYS B O   
1071 C CB  . LYS B 21  ? 1.2097 1.0404 1.3594 -0.1652 0.2306  0.1662  13  LYS B CB  
1072 C CG  . LYS B 21  ? 1.3576 1.2181 1.4984 -0.1622 0.2049  0.1078  13  LYS B CG  
1073 C CD  . LYS B 21  ? 1.4269 1.3326 1.6516 -0.1907 0.2098  0.1054  13  LYS B CD  
1074 C CE  . LYS B 21  ? 1.5325 1.4405 1.7713 -0.1990 0.1702  0.0490  13  LYS B CE  
1075 N NZ  . LYS B 21  ? 1.5686 1.5368 1.8797 -0.2180 0.1731  0.0471  13  LYS B NZ  
1076 N N   . GLU B 22  ? 1.5007 1.1916 1.5768 -0.1302 0.2146  0.2141  14  GLU B N   
1077 C CA  . GLU B 22  ? 1.5395 1.1664 1.6380 -0.1313 0.2208  0.2594  14  GLU B CA  
1078 C C   . GLU B 22  ? 1.6655 1.3051 1.6877 -0.0939 0.2388  0.3083  14  GLU B C   
1079 O O   . GLU B 22  ? 1.6990 1.3153 1.7364 -0.0934 0.2632  0.3731  14  GLU B O   
1080 C CB  . GLU B 22  ? 1.2499 0.8047 1.3622 -0.1289 0.1852  0.2179  14  GLU B CB  
1081 N N   . ASP B 23  ? 1.5919 1.2683 1.5347 -0.0631 0.2232  0.2791  15  ASP B N   
1082 C CA  . ASP B 23  ? 1.5482 1.2416 1.4079 -0.0253 0.2280  0.3152  15  ASP B CA  
1083 C C   . ASP B 23  ? 1.6211 1.3706 1.4350 -0.0137 0.2646  0.3500  15  ASP B C   
1084 O O   . ASP B 23  ? 1.8029 1.5544 1.5878 0.0032  0.2926  0.4150  15  ASP B O   
1085 C CB  . ASP B 23  ? 1.6088 1.3200 1.4118 -0.0005 0.1888  0.2687  15  ASP B CB  
1086 C CG  . ASP B 23  ? 1.7592 1.4258 1.5944 0.0039  0.1612  0.2508  15  ASP B CG  
1087 O OD1 . ASP B 23  ? 1.9580 1.5693 1.8311 0.0015  0.1702  0.2822  15  ASP B OD1 
1088 O OD2 . ASP B 23  ? 1.6200 1.3066 1.4459 0.0121  0.1323  0.2079  15  ASP B OD2 
1089 N N   . HIS B 24  ? 1.5580 1.3538 1.3627 -0.0178 0.2667  0.3090  16  HIS B N   
1090 C CA  . HIS B 24  ? 1.5523 1.4041 1.2984 0.0053  0.3010  0.3296  16  HIS B CA  
1091 C C   . HIS B 24  ? 1.4544 1.3403 1.2805 -0.0210 0.3445  0.3560  16  HIS B C   
1092 O O   . HIS B 24  ? 1.2903 1.1728 1.2002 -0.0561 0.3321  0.3228  16  HIS B O   
1093 C CB  . HIS B 24  ? 1.4862 1.3647 1.1607 0.0281  0.2727  0.2663  16  HIS B CB  
1094 C CG  . HIS B 24  ? 1.6449 1.4989 1.2674 0.0453  0.2223  0.2379  16  HIS B CG  
1095 N ND1 . HIS B 24  ? 1.8389 1.6940 1.3717 0.0813  0.2119  0.2633  16  HIS B ND1 
1096 C CD2 . HIS B 24  ? 1.6466 1.4826 1.3003 0.0326  0.1795  0.1915  16  HIS B CD2 
1097 C CE1 . HIS B 24  ? 1.9087 1.7489 1.4301 0.0862  0.1613  0.2328  16  HIS B CE1 
1098 N NE2 . HIS B 24  ? 1.8146 1.6448 1.4108 0.0575  0.1446  0.1917  16  HIS B NE2 
1099 N N   . PRO B 25  ? 1.7051 1.6310 1.5071 -0.0020 0.3958  0.4203  17  PRO B N   
1100 C CA  . PRO B 25  ? 1.7547 1.7324 1.6397 -0.0221 0.4444  0.4582  17  PRO B CA  
1101 C C   . PRO B 25  ? 1.6698 1.7056 1.5298 -0.0043 0.4528  0.4105  17  PRO B C   
1102 O O   . PRO B 25  ? 1.4842 1.5139 1.2504 0.0265  0.4230  0.3524  17  PRO B O   
1103 C CB  . PRO B 25  ? 1.8892 1.8955 1.7370 0.0051  0.4997  0.5501  17  PRO B CB  
1104 C CG  . PRO B 25  ? 2.0282 2.0215 1.7256 0.0577  0.4794  0.5350  17  PRO B CG  
1105 C CD  . PRO B 25  ? 1.9006 1.8300 1.5987 0.0420  0.4116  0.4696  17  PRO B CD  
1106 N N   . PHE B 26  ? 1.6982 1.7891 1.6502 -0.0237 0.4912  0.4375  18  PHE B N   
1107 C CA  . PHE B 26  ? 1.7157 1.8629 1.6640 -0.0065 0.5018  0.3965  18  PHE B CA  
1108 C C   . PHE B 26  ? 1.7944 1.9768 1.6040 0.0615  0.5316  0.3927  18  PHE B C   
1109 O O   . PHE B 26  ? 1.6905 1.8838 1.4505 0.0880  0.5173  0.3317  18  PHE B O   
1110 C CB  . PHE B 26  ? 1.7331 1.9440 1.8223 -0.0393 0.5405  0.4407  18  PHE B CB  
1111 C CG  . PHE B 26  ? 1.5271 1.8024 1.6268 -0.0182 0.5554  0.4061  18  PHE B CG  
1112 C CD1 . PHE B 26  ? 1.3235 1.5809 1.4537 -0.0370 0.5055  0.3339  18  PHE B CD1 
1113 C CD2 . PHE B 26  ? 1.3752 1.7218 1.4507 0.0237  0.6051  0.4369  18  PHE B CD2 
1114 C CE1 . PHE B 26  ? 1.2385 1.5515 1.3829 -0.0148 0.5183  0.3061  18  PHE B CE1 
1115 C CE2 . PHE B 26  ? 1.2537 1.6536 1.3406 0.0483  0.6169  0.4034  18  PHE B CE2 
1116 C CZ  . PHE B 26  ? 1.3582 1.7467 1.4849 0.0299  0.5837  0.3461  18  PHE B CZ  
1117 N N   . GLU B 27  ? 1.9523 2.1473 1.6962 0.0921  0.5690  0.4558  19  GLU B N   
1118 C CA  . GLU B 27  ? 1.9004 2.1207 1.5065 0.1583  0.5799  0.4399  19  GLU B CA  
1119 C C   . GLU B 27  ? 1.8738 2.0429 1.3403 0.1917  0.5334  0.3744  19  GLU B C   
1120 O O   . GLU B 27  ? 1.8063 1.9827 1.1848 0.2344  0.5225  0.3178  19  GLU B O   
1121 C CB  . GLU B 27  ? 1.6711 1.9083 1.2515 0.1770  0.6061  0.5096  19  GLU B CB  
1122 N N   . TYR B 28  ? 1.8181 1.9272 1.2878 0.1653  0.4841  0.3681  20  TYR B N   
1123 C CA  . TYR B 28  ? 1.7734 1.8341 1.1493 0.1829  0.4175  0.3015  20  TYR B CA  
1124 C C   . TYR B 28  ? 1.7553 1.7971 1.1789 0.1595  0.3732  0.2215  20  TYR B C   
1125 O O   . TYR B 28  ? 1.6873 1.7093 1.0321 0.1849  0.3323  0.1603  20  TYR B O   
1126 C CB  . TYR B 28  ? 1.6887 1.7017 1.0742 0.1628  0.3822  0.3263  20  TYR B CB  
1127 C CG  . TYR B 28  ? 1.8765 1.8494 1.1997 0.1716  0.3098  0.2645  20  TYR B CG  
1128 C CD1 . TYR B 28  ? 2.0728 2.0442 1.2603 0.2198  0.2858  0.2559  20  TYR B CD1 
1129 C CD2 . TYR B 28  ? 1.9192 1.8607 1.3220 0.1325  0.2640  0.2179  20  TYR B CD2 
1130 C CE1 . TYR B 28  ? 2.1284 2.0690 1.2778 0.2222  0.2138  0.2032  20  TYR B CE1 
1131 C CE2 . TYR B 28  ? 1.9209 1.8369 1.2858 0.1380  0.2012  0.1718  20  TYR B CE2 
1132 C CZ  . TYR B 28  ? 1.9945 1.9105 1.2410 0.1796  0.1741  0.1651  20  TYR B CZ  
1133 O OH  . TYR B 28  ? 1.8881 1.7840 1.1148 0.1796  0.1059  0.1226  20  TYR B OH  
1134 N N   . ARG B 29  ? 1.6791 1.7252 1.2334 0.1108  0.3782  0.2243  21  ARG B N   
1135 C CA  . ARG B 29  ? 1.4968 1.5295 1.1047 0.0872  0.3394  0.1598  21  ARG B CA  
1136 C C   . ARG B 29  ? 1.3971 1.4614 0.9726 0.1193  0.3539  0.1220  21  ARG B C   
1137 O O   . ARG B 29  ? 1.3228 1.3607 0.8660 0.1283  0.3113  0.0610  21  ARG B O   
1138 C CB  . ARG B 29  ? 1.5780 1.6123 1.3225 0.0332  0.3420  0.1745  21  ARG B CB  
1139 C CG  . ARG B 29  ? 1.4947 1.4756 1.2717 0.0027  0.3039  0.1740  21  ARG B CG  
1140 C CD  . ARG B 29  ? 1.3939 1.3688 1.2812 -0.0400 0.3206  0.2127  21  ARG B CD  
1141 N NE  . ARG B 29  ? 1.4170 1.4264 1.3939 -0.0665 0.3262  0.1961  21  ARG B NE  
1142 C CZ  . ARG B 29  ? 1.5515 1.5634 1.6364 -0.1074 0.3337  0.2221  21  ARG B CZ  
1143 N NH1 . ARG B 29  ? 1.6030 1.5756 1.7208 -0.1268 0.3391  0.2656  21  ARG B NH1 
1144 N NH2 . ARG B 29  ? 1.5832 1.6342 1.7476 -0.1292 0.3316  0.2050  21  ARG B NH2 
1145 N N   . LYS B 30  ? 1.5364 1.6574 1.1284 0.1378  0.4154  0.1621  22  LYS B N   
1146 C CA  . LYS B 30  ? 1.4748 1.6302 1.0398 0.1769  0.4382  0.1309  22  LYS B CA  
1147 C C   . LYS B 30  ? 1.6307 1.7558 1.0394 0.2367  0.4193  0.0857  22  LYS B C   
1148 O O   . LYS B 30  ? 1.6230 1.7321 0.9991 0.2619  0.3992  0.0258  22  LYS B O   
1149 C CB  . LYS B 30  ? 1.3728 1.6080 0.9906 0.1905  0.5157  0.1949  22  LYS B CB  
1150 C CG  . LYS B 30  ? 1.3308 1.6102 0.9384 0.2348  0.5461  0.1669  22  LYS B CG  
1151 C CD  . LYS B 30  ? 1.3643 1.7265 1.0569 0.2365  0.6056  0.2315  22  LYS B CD  
1152 N N   . LYS B 31  ? 1.7993 1.9121 1.1121 0.2598  0.4210  0.1137  23  LYS B N   
1153 C CA  . LYS B 31  ? 1.9242 2.0068 1.0771 0.3178  0.3947  0.0702  23  LYS B CA  
1154 C C   . LYS B 31  ? 1.8439 1.8592 0.9820 0.3004  0.3090  -0.0055 23  LYS B C   
1155 O O   . LYS B 31  ? 1.8468 1.8303 0.8965 0.3389  0.2776  -0.0683 23  LYS B O   
1156 C CB  . LYS B 31  ? 2.0054 2.0924 1.0841 0.3352  0.4013  0.1219  23  LYS B CB  
1157 N N   . GLU B 32  ? 1.8817 1.8746 1.1099 0.2441  0.2716  0.0021  24  GLU B N   
1158 C CA  . GLU B 32  ? 1.8856 1.8280 1.1223 0.2229  0.1957  -0.0544 24  GLU B CA  
1159 C C   . GLU B 32  ? 1.7327 1.6670 1.0396 0.2083  0.1831  -0.1010 24  GLU B C   
1160 O O   . GLU B 32  ? 1.8415 1.7348 1.1201 0.2158  0.1309  -0.1574 24  GLU B O   
1161 C CB  . GLU B 32  ? 1.7767 1.7068 1.0864 0.1761  0.1692  -0.0252 24  GLU B CB  
1162 C CG  . GLU B 32  ? 1.6838 1.5755 0.9978 0.1602  0.0946  -0.0680 24  GLU B CG  
1163 C CD  . GLU B 32  ? 1.6623 1.5494 1.0390 0.1267  0.0765  -0.0345 24  GLU B CD  
1164 O OE1 . GLU B 32  ? 1.7044 1.6056 1.1208 0.1140  0.1180  0.0155  24  GLU B OE1 
1165 O OE2 . GLU B 32  ? 1.6360 1.5051 1.0281 0.1145  0.0208  -0.0568 24  GLU B OE2 
1166 N N   . GLY B 33  ? 1.4302 1.4035 0.8345 0.1863  0.2273  -0.0742 25  GLY B N   
1167 C CA  . GLY B 33  ? 1.3371 1.3123 0.8113 0.1761  0.2206  -0.1085 25  GLY B CA  
1168 C C   . GLY B 33  ? 1.5345 1.5096 0.9394 0.2314  0.2387  -0.1445 25  GLY B C   
1169 O O   . GLY B 33  ? 1.3515 1.2963 0.7708 0.2370  0.2081  -0.1928 25  GLY B O   
1170 N N   . GLU B 34  ? 1.6292 1.6375 0.9583 0.2763  0.2911  -0.1178 26  GLU B N   
1171 C CA  . GLU B 34  ? 1.5418 1.5514 0.7820 0.3434  0.3162  -0.1519 26  GLU B CA  
1172 C C   . GLU B 34  ? 1.6649 1.5954 0.8049 0.3684  0.2466  -0.2256 26  GLU B C   
1173 O O   . GLU B 34  ? 1.5913 1.4900 0.7358 0.3863  0.2258  -0.2750 26  GLU B O   
1174 C CB  . GLU B 34  ? 1.8853 1.9476 1.0685 0.3794  0.3760  -0.0995 26  GLU B CB  
1175 C CG  . GLU B 34  ? 1.9683 2.1027 1.2221 0.3961  0.4427  -0.0647 26  GLU B CG  
1176 C CD  . GLU B 34  ? 1.9734 2.1564 1.1818 0.4269  0.4911  -0.0101 26  GLU B CD  
1177 O OE1 . GLU B 34  ? 1.7367 1.9638 0.9984 0.3989  0.5262  0.0619  26  GLU B OE1 
1178 O OE2 . GLU B 34  ? 2.1449 2.3185 1.2664 0.4798  0.4929  -0.0380 26  GLU B OE2 
1179 N N   . LYS B 35  ? 1.7897 1.6897 0.8634 0.3602  0.2037  -0.2262 27  LYS B N   
1180 C CA  . LYS B 35  ? 1.9027 1.7382 0.9038 0.3723  0.1295  -0.2838 27  LYS B CA  
1181 C C   . LYS B 35  ? 1.8659 1.6439 0.9274 0.3352  0.0587  -0.3319 27  LYS B C   
1182 O O   . LYS B 35  ? 1.7578 1.4826 0.8033 0.3421  0.0058  -0.3835 27  LYS B O   
1183 C CB  . LYS B 35  ? 1.8708 1.7065 0.7913 0.3770  0.1073  -0.2598 27  LYS B CB  
1184 N N   . ILE B 36  ? 1.8744 1.6715 1.0451 0.2814  0.0569  -0.2998 28  ILE B N   
1185 C CA  . ILE B 36  ? 1.6933 1.4518 0.9476 0.2367  -0.0075 -0.3252 28  ILE B CA  
1186 C C   . ILE B 36  ? 1.6015 1.3370 0.9122 0.2406  -0.0098 -0.3603 28  ILE B C   
1187 O O   . ILE B 36  ? 1.8081 1.4909 1.1490 0.2251  -0.0699 -0.3978 28  ILE B O   
1188 C CB  . ILE B 36  ? 1.4613 1.2554 0.8252 0.1791  -0.0040 -0.2732 28  ILE B CB  
1189 C CG1 . ILE B 36  ? 1.5071 1.2702 0.9426 0.1402  -0.0701 -0.2912 28  ILE B CG1 
1190 C CG2 . ILE B 36  ? 1.4905 1.3333 0.9432 0.1618  0.0548  -0.2379 28  ILE B CG2 
1191 C CD1 . ILE B 36  ? 1.7775 1.4997 1.1493 0.1474  -0.1385 -0.3211 28  ILE B CD1 
1192 N N   . ARG B 37  ? 1.4238 1.2005 0.7564 0.2618  0.0542  -0.3436 29  ARG B N   
1193 C CA  . ARG B 37  ? 1.7130 1.4737 1.1032 0.2709  0.0557  -0.3707 29  ARG B CA  
1194 C C   . ARG B 37  ? 1.7678 1.4846 1.0640 0.3322  0.0542  -0.4222 29  ARG B C   
1195 O O   . ARG B 37  ? 1.8488 1.5239 1.1831 0.3380  0.0312  -0.4543 29  ARG B O   
1196 C CB  . ARG B 37  ? 1.8876 1.7227 1.3723 0.2584  0.1184  -0.3234 29  ARG B CB  
1197 C CG  . ARG B 37  ? 1.9140 1.7401 1.4778 0.2605  0.1134  -0.3414 29  ARG B CG  
1198 C CD  . ARG B 37  ? 1.6089 1.5125 1.2821 0.2355  0.1575  -0.2927 29  ARG B CD  
1199 N NE  . ARG B 37  ? 1.5827 1.4823 1.3231 0.2468  0.1536  -0.3072 29  ARG B NE  
1200 C CZ  . ARG B 37  ? 1.5651 1.4347 1.3721 0.2152  0.1087  -0.3130 29  ARG B CZ  
1201 N NH1 . ARG B 37  ? 1.2720 1.1185 1.0902 0.1711  0.0668  -0.3062 29  ARG B NH1 
1202 N NH2 . ARG B 37  ? 1.8889 1.7564 1.7545 0.2311  0.1085  -0.3199 29  ARG B NH2 
1203 N N   . LYS B 38  ? 1.8951 1.6298 1.0955 0.3650  0.0780  -0.4130 30  LYS B N   
1204 C CA  . LYS B 38  ? 1.8143 1.5136 0.9393 0.4103  0.0689  -0.4506 30  LYS B CA  
1205 C C   . LYS B 38  ? 1.8151 1.4335 0.9179 0.3929  -0.0192 -0.4986 30  LYS B C   
1206 O O   . LYS B 38  ? 2.0742 1.6391 1.1466 0.4188  -0.0465 -0.5430 30  LYS B O   
1207 C CB  . LYS B 38  ? 1.9071 1.6521 0.9350 0.4515  0.1161  -0.4233 30  LYS B CB  
1208 N N   . LYS B 39  ? 1.7079 1.3204 0.8338 0.3485  -0.0636 -0.4865 31  LYS B N   
1209 C CA  . LYS B 39  ? 1.7893 1.3413 0.9209 0.3226  -0.1485 -0.5191 31  LYS B CA  
1210 C C   . LYS B 39  ? 1.8722 1.3901 1.1244 0.2795  -0.1867 -0.5276 31  LYS B C   
1211 O O   . LYS B 39  ? 1.7552 1.2152 1.0305 0.2687  -0.2455 -0.5591 31  LYS B O   
1212 C CB  . LYS B 39  ? 1.7089 1.2817 0.8143 0.2987  -0.1770 -0.4945 31  LYS B CB  
1213 C CG  . LYS B 39  ? 2.0975 1.6228 1.2072 0.2764  -0.2635 -0.5226 31  LYS B CG  
1214 C CD  . LYS B 39  ? 2.0781 1.6327 1.1433 0.2674  -0.2849 -0.4966 31  LYS B CD  
1215 C CE  . LYS B 39  ? 2.2539 1.7698 1.3240 0.2498  -0.3711 -0.5241 31  LYS B CE  
1216 N NZ  . LYS B 39  ? 2.3780 1.9116 1.3433 0.2755  -0.3861 -0.5184 31  LYS B NZ  
1217 N N   . TYR B 40  ? 1.8127 1.3681 1.1439 0.2557  -0.1531 -0.4960 32  TYR B N   
1218 C CA  . TYR B 40  ? 1.6327 1.1662 1.0816 0.2183  -0.1806 -0.4940 32  TYR B CA  
1219 C C   . TYR B 40  ? 1.6291 1.1934 1.1256 0.2345  -0.1227 -0.4820 32  TYR B C   
1220 O O   . TYR B 40  ? 1.4288 1.0506 0.9940 0.2052  -0.0933 -0.4386 32  TYR B O   
1221 C CB  . TYR B 40  ? 1.5310 1.0836 1.0505 0.1641  -0.2147 -0.4636 32  TYR B CB  
1222 C CG  . TYR B 40  ? 1.6350 1.1748 1.1184 0.1494  -0.2686 -0.4670 32  TYR B CG  
1223 C CD1 . TYR B 40  ? 1.6481 1.1389 1.1571 0.1365  -0.3316 -0.4899 32  TYR B CD1 
1224 C CD2 . TYR B 40  ? 1.3672 0.9450 0.7954 0.1499  -0.2579 -0.4448 32  TYR B CD2 
1225 C CE1 . TYR B 40  ? 1.5763 1.0621 1.0613 0.1242  -0.3837 -0.4928 32  TYR B CE1 
1226 C CE2 . TYR B 40  ? 1.6389 1.2104 1.0385 0.1399  -0.3097 -0.4457 32  TYR B CE2 
1227 C CZ  . TYR B 40  ? 1.6752 1.2037 1.1059 0.1267  -0.3730 -0.4707 32  TYR B CZ  
1228 O OH  . TYR B 40  ? 1.9349 1.4629 1.3452 0.1172  -0.4270 -0.4714 32  TYR B OH  
1229 N N   . PRO B 41  ? 1.8023 1.3435 1.2814 0.2748  -0.1029 -0.5064 33  PRO B N   
1230 C CA  . PRO B 41  ? 1.7781 1.3584 1.2997 0.3015  -0.0441 -0.4941 33  PRO B CA  
1231 C C   . PRO B 41  ? 1.6670 1.2470 1.3134 0.2683  -0.0600 -0.4774 33  PRO B C   
1232 O O   . PRO B 41  ? 1.5700 1.2082 1.2778 0.2745  -0.0124 -0.4464 33  PRO B O   
1233 C CB  . PRO B 41  ? 1.8540 1.3972 1.3215 0.3530  -0.0332 -0.5280 33  PRO B CB  
1234 C CG  . PRO B 41  ? 1.6265 1.0891 1.0675 0.3383  -0.1065 -0.5638 33  PRO B CG  
1235 C CD  . PRO B 41  ? 1.5894 1.0667 1.0076 0.3010  -0.1383 -0.5488 33  PRO B CD  
1236 N N   . ASP B 42  ? 1.7587 1.2908 1.4571 0.2257  -0.1233 -0.4806 34  ASP B N   
1237 C CA  . ASP B 42  ? 1.6444 1.1908 1.4681 0.1869  -0.1343 -0.4435 34  ASP B CA  
1238 C C   . ASP B 42  ? 1.3275 0.9152 1.2072 0.1279  -0.1527 -0.3979 34  ASP B C   
1239 O O   . ASP B 42  ? 1.2850 0.8676 1.2545 0.0934  -0.1810 -0.3717 34  ASP B O   
1240 C CB  . ASP B 42  ? 1.7952 1.2557 1.6562 0.1913  -0.1836 -0.4709 34  ASP B CB  
1241 C CG  . ASP B 42  ? 2.1151 1.5502 1.9428 0.2478  -0.1540 -0.4986 34  ASP B CG  
1242 O OD1 . ASP B 42  ? 2.1976 1.6874 2.0310 0.2804  -0.0980 -0.4894 34  ASP B OD1 
1243 O OD2 . ASP B 42  ? 2.2295 1.5951 2.0313 0.2609  -0.1866 -0.5287 34  ASP B OD2 
1244 N N   . ARG B 43  ? 1.2418 0.8719 1.0677 0.1211  -0.1332 -0.3848 35  ARG B N   
1245 C CA  . ARG B 43  ? 1.0873 0.7644 0.9593 0.0752  -0.1383 -0.3403 35  ARG B CA  
1246 C C   . ARG B 43  ? 1.0281 0.7791 0.8932 0.0743  -0.0790 -0.3062 35  ARG B C   
1247 O O   . ARG B 43  ? 1.1207 0.8870 0.9311 0.1068  -0.0392 -0.3158 35  ARG B O   
1248 C CB  . ARG B 43  ? 1.0072 0.6548 0.8330 0.0636  -0.1845 -0.3549 35  ARG B CB  
1249 C CG  . ARG B 43  ? 1.3303 0.9043 1.1818 0.0540  -0.2551 -0.3866 35  ARG B CG  
1250 C CD  . ARG B 43  ? 1.3755 0.9346 1.1919 0.0394  -0.3056 -0.3961 35  ARG B CD  
1251 N NE  . ARG B 43  ? 1.5050 1.1260 1.3837 0.0014  -0.3019 -0.3429 35  ARG B NE  
1252 C CZ  . ARG B 43  ? 1.5233 1.1530 1.3894 -0.0130 -0.3383 -0.3365 35  ARG B CZ  
1253 N NH1 . ARG B 43  ? 1.6834 1.2728 1.4768 0.0045  -0.3786 -0.3734 35  ARG B NH1 
1254 N NH2 . ARG B 43  ? 1.4495 1.1396 1.3773 -0.0403 -0.3264 -0.2850 35  ARG B NH2 
1255 N N   . VAL B 44  ? 1.0923 0.8885 1.0158 0.0388  -0.0731 -0.2656 36  VAL B N   
1256 C CA  . VAL B 44  ? 1.0508 0.9065 0.9830 0.0322  -0.0261 -0.2363 36  VAL B CA  
1257 C C   . VAL B 44  ? 1.1240 0.9955 1.0345 0.0131  -0.0250 -0.2152 36  VAL B C   
1258 O O   . VAL B 44  ? 1.1563 1.0304 1.1021 -0.0105 -0.0494 -0.1990 36  VAL B O   
1259 C CB  . VAL B 44  ? 0.7683 0.6634 0.7824 0.0144  -0.0168 -0.2106 36  VAL B CB  
1260 C CG1 . VAL B 44  ? 0.8725 0.8205 0.8990 0.0021  0.0188  -0.1863 36  VAL B CG1 
1261 C CG2 . VAL B 44  ? 0.7407 0.6270 0.7821 0.0375  -0.0130 -0.2243 36  VAL B CG2 
1262 N N   . PRO B 45  ? 1.0662 0.9508 0.9222 0.0269  0.0068  -0.2102 37  PRO B N   
1263 C CA  . PRO B 45  ? 0.9237 0.8202 0.7611 0.0129  0.0136  -0.1852 37  PRO B CA  
1264 C C   . PRO B 45  ? 0.9927 0.9257 0.8894 -0.0118 0.0375  -0.1563 37  PRO B C   
1265 O O   . PRO B 45  ? 0.9691 0.9301 0.8869 -0.0109 0.0706  -0.1473 37  PRO B O   
1266 C CB  . PRO B 45  ? 1.0079 0.9034 0.7664 0.0419  0.0422  -0.1861 37  PRO B CB  
1267 C CG  . PRO B 45  ? 0.9941 0.9045 0.7572 0.0655  0.0724  -0.1988 37  PRO B CG  
1268 C CD  . PRO B 45  ? 0.9652 0.8521 0.7714 0.0628  0.0394  -0.2251 37  PRO B CD  
1269 N N   . VAL B 46  ? 1.1315 1.0651 1.0565 -0.0316 0.0189  -0.1429 38  VAL B N   
1270 C CA  . VAL B 46  ? 0.9117 0.8687 0.8816 -0.0501 0.0332  -0.1258 38  VAL B CA  
1271 C C   . VAL B 46  ? 0.9580 0.9051 0.9128 -0.0564 0.0366  -0.1078 38  VAL B C   
1272 O O   . VAL B 46  ? 1.0189 0.9526 0.9541 -0.0517 0.0165  -0.1034 38  VAL B O   
1273 C CB  . VAL B 46  ? 0.6780 0.6487 0.6967 -0.0592 0.0136  -0.1255 38  VAL B CB  
1274 C CG1 . VAL B 46  ? 0.6791 0.6711 0.7262 -0.0712 0.0245  -0.1166 38  VAL B CG1 
1275 C CG2 . VAL B 46  ? 0.8074 0.7813 0.8471 -0.0511 0.0076  -0.1386 38  VAL B CG2 
1276 N N   . ILE B 47  ? 0.8713 0.8237 0.8429 -0.0671 0.0590  -0.0965 39  ILE B N   
1277 C CA  . ILE B 47  ? 0.8668 0.7997 0.8331 -0.0718 0.0619  -0.0808 39  ILE B CA  
1278 C C   . ILE B 47  ? 0.9951 0.9304 0.9960 -0.0811 0.0536  -0.0876 39  ILE B C   
1279 O O   . ILE B 47  ? 1.0149 0.9619 1.0460 -0.0934 0.0581  -0.0959 39  ILE B O   
1280 C CB  . ILE B 47  ? 1.1785 1.1023 1.1400 -0.0771 0.0902  -0.0608 39  ILE B CB  
1281 C CG1 . ILE B 47  ? 1.2736 1.2040 1.1877 -0.0592 0.1056  -0.0527 39  ILE B CG1 
1282 C CG2 . ILE B 47  ? 1.2416 1.1325 1.1978 -0.0786 0.0902  -0.0430 39  ILE B CG2 
1283 C CD1 . ILE B 47  ? 1.1817 1.0942 1.0376 -0.0400 0.0849  -0.0523 39  ILE B CD1 
1284 N N   . VAL B 48  ? 0.9572 0.8859 0.9524 -0.0718 0.0404  -0.0836 40  VAL B N   
1285 C CA  . VAL B 48  ? 0.8087 0.7415 0.8201 -0.0692 0.0356  -0.0913 40  VAL B CA  
1286 C C   . VAL B 48  ? 0.9635 0.8613 0.9627 -0.0608 0.0409  -0.0865 40  VAL B C   
1287 O O   . VAL B 48  ? 1.2130 1.1033 1.1997 -0.0466 0.0395  -0.0701 40  VAL B O   
1288 C CB  . VAL B 48  ? 0.9105 0.8741 0.9339 -0.0578 0.0223  -0.0855 40  VAL B CB  
1289 C CG1 . VAL B 48  ? 0.8907 0.8668 0.9175 -0.0468 0.0236  -0.0915 40  VAL B CG1 
1290 C CG2 . VAL B 48  ? 0.7776 0.7623 0.8178 -0.0649 0.0135  -0.0888 40  VAL B CG2 
1291 N N   . GLU B 49  ? 0.9247 0.7985 0.9314 -0.0689 0.0429  -0.1019 41  GLU B N   
1292 C CA  . GLU B 49  ? 1.1388 0.9639 1.1357 -0.0592 0.0451  -0.1037 41  GLU B CA  
1293 C C   . GLU B 49  ? 1.2507 1.0550 1.2482 -0.0592 0.0335  -0.1361 41  GLU B C   
1294 O O   . GLU B 49  ? 1.2290 1.0550 1.2425 -0.0761 0.0235  -0.1524 41  GLU B O   
1295 C CB  . GLU B 49  ? 1.3342 1.1229 1.3381 -0.0737 0.0569  -0.0835 41  GLU B CB  
1296 C CG  . GLU B 49  ? 1.4826 1.2857 1.5160 -0.1027 0.0641  -0.0809 41  GLU B CG  
1297 C CD  . GLU B 49  ? 1.6011 1.3903 1.6356 -0.1098 0.0851  -0.0455 41  GLU B CD  
1298 O OE1 . GLU B 49  ? 1.4087 1.1856 1.4100 -0.0907 0.0895  -0.0246 41  GLU B OE1 
1299 O OE2 . GLU B 49  ? 1.7264 1.5235 1.7973 -0.1327 0.0976  -0.0339 41  GLU B OE2 
1300 N N   . LYS B 50  ? 1.1847 0.9459 1.1615 -0.0361 0.0320  -0.1472 42  LYS B N   
1301 C CA  . LYS B 50  ? 1.0608 0.7937 1.0188 -0.0256 0.0161  -0.1869 42  LYS B CA  
1302 C C   . LYS B 50  ? 1.1389 0.8305 1.1271 -0.0613 -0.0025 -0.2083 42  LYS B C   
1303 O O   . LYS B 50  ? 1.2552 0.9102 1.2766 -0.0846 0.0035  -0.1893 42  LYS B O   
1304 C CB  . LYS B 50  ? 1.1971 0.8835 1.1219 0.0148  0.0213  -0.1964 42  LYS B CB  
1305 N N   . ALA B 51  ? 1.2673 0.9699 1.2483 -0.0655 -0.0265 -0.2432 43  ALA B N   
1306 C CA  . ALA B 51  ? 1.3706 1.0379 1.3896 -0.1007 -0.0550 -0.2682 43  ALA B CA  
1307 C C   . ALA B 51  ? 1.6003 1.1697 1.6096 -0.0942 -0.0706 -0.2952 43  ALA B C   
1308 O O   . ALA B 51  ? 1.6598 1.1965 1.6178 -0.0519 -0.0602 -0.3040 43  ALA B O   
1309 C CB  . ALA B 51  ? 1.1535 0.8609 1.1588 -0.1005 -0.0844 -0.3010 43  ALA B CB  
1310 N N   . PRO B 52  ? 1.6559 1.1773 1.7230 -0.1356 -0.0957 -0.3056 44  PRO B N   
1311 C CA  . PRO B 52  ? 1.7341 1.1467 1.7971 -0.1310 -0.1184 -0.3369 44  PRO B CA  
1312 C C   . PRO B 52  ? 1.7882 1.1634 1.7716 -0.0897 -0.1501 -0.4040 44  PRO B C   
1313 O O   . PRO B 52  ? 1.5791 1.0082 1.5348 -0.0855 -0.1706 -0.4301 44  PRO B O   
1314 C CB  . PRO B 52  ? 1.5993 0.9849 1.7582 -0.1925 -0.1458 -0.3318 44  PRO B CB  
1315 C CG  . PRO B 52  ? 1.4204 0.9082 1.6159 -0.2187 -0.1468 -0.3174 44  PRO B CG  
1316 C CD  . PRO B 52  ? 1.4736 1.0363 1.6237 -0.1875 -0.1021 -0.2832 44  PRO B CD  
1317 N N   . LYS B 53  ? 1.9269 1.2172 1.8680 -0.0542 -0.1493 -0.4253 45  LYS B N   
1318 C CA  . LYS B 53  ? 1.8812 1.1470 1.7331 -0.0057 -0.1630 -0.4755 45  LYS B CA  
1319 C C   . LYS B 53  ? 1.7425 1.0852 1.5197 0.0468  -0.1447 -0.4831 45  LYS B C   
1320 O O   . LYS B 53  ? 1.7758 1.1388 1.4866 0.0754  -0.1594 -0.5169 45  LYS B O   
1321 C CB  . LYS B 53  ? 1.8087 1.0604 1.6673 -0.0379 -0.2092 -0.5109 45  LYS B CB  
1322 N N   . ALA B 54  ? 1.5978 1.0052 1.3916 0.0551  -0.1035 -0.4311 46  ALA B N   
1323 C CA  . ALA B 54  ? 1.6072 1.1049 1.3502 0.0984  -0.0754 -0.4137 46  ALA B CA  
1324 C C   . ALA B 54  ? 1.7161 1.1922 1.4040 0.1659  -0.0466 -0.4153 46  ALA B C   
1325 O O   . ALA B 54  ? 1.8561 1.2801 1.5683 0.1723  -0.0319 -0.3980 46  ALA B O   
1326 C CB  . ALA B 54  ? 1.4295 1.0161 1.2273 0.0695  -0.0477 -0.3509 46  ALA B CB  
1327 N N   . ARG B 55  ? 1.6811 1.2031 1.2967 0.2199  -0.0360 -0.4308 47  ARG B N   
1328 C CA  . ARG B 55  ? 1.7915 1.3110 1.3559 0.2929  -0.0020 -0.4283 47  ARG B CA  
1329 C C   . ARG B 55  ? 1.8538 1.4903 1.4446 0.3104  0.0426  -0.3596 47  ARG B C   
1330 O O   . ARG B 55  ? 2.0868 1.7673 1.6344 0.3740  0.0743  -0.3490 47  ARG B O   
1331 C CB  . ARG B 55  ? 1.7723 1.2783 1.2507 0.3381  -0.0135 -0.4756 47  ARG B CB  
1332 N N   . VAL B 56  ? 1.7241 1.4104 1.3898 0.2547  0.0442  -0.3125 48  VAL B N   
1333 C CA  . VAL B 56  ? 1.6671 1.4562 1.3727 0.2581  0.0743  -0.2496 48  VAL B CA  
1334 C C   . VAL B 56  ? 1.5872 1.3743 1.3563 0.2415  0.0868  -0.2063 48  VAL B C   
1335 O O   . VAL B 56  ? 1.4993 1.2312 1.2973 0.2003  0.0702  -0.2105 48  VAL B O   
1336 C CB  . VAL B 56  ? 1.7491 1.5999 1.4821 0.2135  0.0609  -0.2334 48  VAL B CB  
1337 C CG1 . VAL B 56  ? 1.4421 1.3668 1.2427 0.1934  0.0784  -0.1712 48  VAL B CG1 
1338 C CG2 . VAL B 56  ? 1.8890 1.7796 1.5596 0.2463  0.0587  -0.2524 48  VAL B CG2 
1339 N N   . PRO B 57  ? 1.5838 1.4362 1.3765 0.2756  0.1157  -0.1606 49  PRO B N   
1340 C CA  . PRO B 57  ? 1.4234 1.2908 1.2763 0.2652  0.1225  -0.1151 49  PRO B CA  
1341 C C   . PRO B 57  ? 1.4935 1.3573 1.3885 0.2010  0.1007  -0.1006 49  PRO B C   
1342 O O   . PRO B 57  ? 1.5472 1.4418 1.4493 0.1679  0.0897  -0.1033 49  PRO B O   
1343 C CB  . PRO B 57  ? 1.2806 1.2532 1.1692 0.2949  0.1477  -0.0642 49  PRO B CB  
1344 C CG  . PRO B 57  ? 1.5342 1.5212 1.3609 0.3516  0.1697  -0.0863 49  PRO B CG  
1345 C CD  . PRO B 57  ? 1.6470 1.5710 1.4113 0.3308  0.1437  -0.1461 49  PRO B CD  
1346 N N   . ASP B 58  ? 1.5417 1.3691 1.4596 0.1895  0.0962  -0.0838 50  ASP B N   
1347 C CA  . ASP B 58  ? 1.3721 1.1941 1.3147 0.1386  0.0799  -0.0705 50  ASP B CA  
1348 C C   . ASP B 58  ? 1.2441 1.1436 1.2276 0.1268  0.0754  -0.0305 50  ASP B C   
1349 O O   . ASP B 58  ? 1.2423 1.1948 1.2527 0.1554  0.0841  -0.0016 50  ASP B O   
1350 C CB  . ASP B 58  ? 1.4949 1.2470 1.4376 0.1341  0.0775  -0.0638 50  ASP B CB  
1351 C CG  . ASP B 58  ? 1.7826 1.5032 1.7291 0.0856  0.0668  -0.0685 50  ASP B CG  
1352 O OD1 . ASP B 58  ? 1.9652 1.7264 1.9182 0.0572  0.0604  -0.0733 50  ASP B OD1 
1353 O OD2 . ASP B 58  ? 1.7792 1.4363 1.7268 0.0785  0.0675  -0.0628 50  ASP B OD2 
1354 N N   . LEU B 59  ? 1.2051 1.1104 1.1975 0.0859  0.0604  -0.0293 51  LEU B N   
1355 C CA  . LEU B 59  ? 1.0482 1.0122 1.0757 0.0702  0.0468  -0.0031 51  LEU B CA  
1356 C C   . LEU B 59  ? 1.2327 1.1966 1.2719 0.0707  0.0334  0.0237  51  LEU B C   
1357 O O   . LEU B 59  ? 1.3504 1.2656 1.3624 0.0652  0.0331  0.0213  51  LEU B O   
1358 C CB  . LEU B 59  ? 1.0512 1.0153 1.0745 0.0343  0.0359  -0.0204 51  LEU B CB  
1359 C CG  . LEU B 59  ? 0.9545 0.9712 1.0143 0.0202  0.0215  -0.0061 51  LEU B CG  
1360 C CD1 . LEU B 59  ? 0.8288 0.8996 0.9203 0.0425  0.0322  0.0153  51  LEU B CD1 
1361 C CD2 . LEU B 59  ? 1.0457 1.0526 1.0957 -0.0047 0.0172  -0.0291 51  LEU B CD2 
1362 N N   . ASP B 60  ? 1.2644 1.2870 1.3488 0.0770  0.0203  0.0536  52  ASP B N   
1363 C CA  . ASP B 60  ? 1.2974 1.3306 1.3966 0.0795  -0.0019 0.0798  52  ASP B CA  
1364 C C   . ASP B 60  ? 1.2768 1.2811 1.3398 0.0510  -0.0246 0.0670  52  ASP B C   
1365 O O   . ASP B 60  ? 1.3539 1.3325 1.3869 0.0573  -0.0319 0.0774  52  ASP B O   
1366 C CB  . ASP B 60  ? 1.3611 1.4714 1.5330 0.0838  -0.0194 0.1140  52  ASP B CB  
1367 N N   . LYS B 61  ? 1.1962 1.2060 1.2586 0.0253  -0.0335 0.0469  53  LYS B N   
1368 C CA  . LYS B 61  ? 1.1707 1.1531 1.1905 0.0062  -0.0485 0.0291  53  LYS B CA  
1369 C C   . LYS B 61  ? 1.1284 1.0887 1.1292 -0.0090 -0.0278 0.0013  53  LYS B C   
1370 O O   . LYS B 61  ? 0.9122 0.8928 0.9424 -0.0140 -0.0217 -0.0059 53  LYS B O   
1371 C CB  . LYS B 61  ? 1.2037 1.2133 1.2468 -0.0067 -0.0905 0.0301  53  LYS B CB  
1372 C CG  . LYS B 61  ? 1.3059 1.3475 1.3808 0.0045  -0.1206 0.0595  53  LYS B CG  
1373 C CD  . LYS B 61  ? 1.2404 1.3008 1.3433 -0.0142 -0.1738 0.0544  53  LYS B CD  
1374 N N   . ARG B 62  ? 1.1325 1.0583 1.0881 -0.0145 -0.0161 -0.0084 54  ARG B N   
1375 C CA  . ARG B 62  ? 1.0470 0.9583 0.9973 -0.0282 0.0055  -0.0285 54  ARG B CA  
1376 C C   . ARG B 62  ? 1.1590 1.0752 1.0930 -0.0386 -0.0005 -0.0457 54  ARG B C   
1377 O O   . ARG B 62  ? 1.1484 1.0696 1.0964 -0.0490 0.0113  -0.0609 54  ARG B O   
1378 C CB  . ARG B 62  ? 1.0369 0.9108 0.9682 -0.0281 0.0295  -0.0207 54  ARG B CB  
1379 N N   . LYS B 63  ? 1.2194 1.1335 1.1213 -0.0320 -0.0211 -0.0453 55  LYS B N   
1380 C CA  . LYS B 63  ? 1.1618 1.0709 1.0344 -0.0322 -0.0268 -0.0676 55  LYS B CA  
1381 C C   . LYS B 63  ? 1.1315 1.0502 1.0379 -0.0391 -0.0604 -0.0838 55  LYS B C   
1382 O O   . LYS B 63  ? 1.2175 1.1449 1.1455 -0.0405 -0.0936 -0.0756 55  LYS B O   
1383 C CB  . LYS B 63  ? 1.2645 1.1584 1.0661 -0.0149 -0.0324 -0.0644 55  LYS B CB  
1384 C CG  . LYS B 63  ? 1.2986 1.1832 1.0701 -0.0086 0.0072  -0.0406 55  LYS B CG  
1385 C CD  . LYS B 63  ? 1.3948 1.2709 1.0925 0.0142  0.0003  -0.0246 55  LYS B CD  
1386 C CE  . LYS B 63  ? 1.3282 1.2013 0.9614 0.0317  -0.0186 -0.0548 55  LYS B CE  
1387 N NZ  . LYS B 63  ? 1.5146 1.3818 1.0584 0.0601  -0.0285 -0.0413 55  LYS B NZ  
1388 N N   . TYR B 64  ? 0.8999 0.8184 0.8208 -0.0441 -0.0528 -0.1023 56  TYR B N   
1389 C CA  . TYR B 64  ? 1.0023 0.9224 0.9651 -0.0519 -0.0823 -0.1130 56  TYR B CA  
1390 C C   . TYR B 64  ? 1.1853 1.0796 1.1196 -0.0427 -0.0873 -0.1442 56  TYR B C   
1391 O O   . TYR B 64  ? 1.3490 1.2454 1.2615 -0.0338 -0.0544 -0.1519 56  TYR B O   
1392 C CB  . TYR B 64  ? 0.9039 0.8528 0.9287 -0.0625 -0.0694 -0.0973 56  TYR B CB  
1393 C CG  . TYR B 64  ? 0.8652 0.8401 0.9185 -0.0630 -0.0664 -0.0694 56  TYR B CG  
1394 C CD1 . TYR B 64  ? 0.8892 0.8638 0.9213 -0.0563 -0.0391 -0.0631 56  TYR B CD1 
1395 C CD2 . TYR B 64  ? 0.8477 0.8470 0.9555 -0.0682 -0.0903 -0.0477 56  TYR B CD2 
1396 C CE1 . TYR B 64  ? 0.8765 0.8694 0.9285 -0.0477 -0.0341 -0.0420 56  TYR B CE1 
1397 C CE2 . TYR B 64  ? 0.9588 0.9908 1.0945 -0.0607 -0.0810 -0.0190 56  TYR B CE2 
1398 C CZ  . TYR B 64  ? 0.9369 0.9632 1.0382 -0.0469 -0.0520 -0.0193 56  TYR B CZ  
1399 O OH  . TYR B 64  ? 0.8718 0.9254 0.9948 -0.0309 -0.0406 0.0051  56  TYR B OH  
1400 N N   . LEU B 65  ? 0.9980 0.8677 0.9387 -0.0437 -0.1302 -0.1620 57  LEU B N   
1401 C CA  . LEU B 65  ? 0.8843 0.7171 0.7975 -0.0292 -0.1408 -0.1982 57  LEU B CA  
1402 C C   . LEU B 65  ? 0.8650 0.6891 0.8565 -0.0444 -0.1658 -0.1969 57  LEU B C   
1403 O O   . LEU B 65  ? 0.8417 0.6472 0.8705 -0.0586 -0.2131 -0.1977 57  LEU B O   
1404 C CB  . LEU B 65  ? 0.9774 0.7702 0.8152 -0.0116 -0.1771 -0.2297 57  LEU B CB  
1405 C CG  . LEU B 65  ? 1.0628 0.8148 0.8279 0.0213  -0.1732 -0.2739 57  LEU B CG  
1406 C CD1 . LEU B 65  ? 1.0665 0.8487 0.7971 0.0414  -0.1077 -0.2628 57  LEU B CD1 
1407 C CD2 . LEU B 65  ? 1.2868 0.9993 0.9619 0.0424  -0.2158 -0.3075 57  LEU B CD2 
1408 N N   . VAL B 66  ? 0.8262 0.6665 0.8495 -0.0426 -0.1360 -0.1902 58  VAL B N   
1409 C CA  . VAL B 66  ? 0.9141 0.7576 1.0175 -0.0562 -0.1506 -0.1731 58  VAL B CA  
1410 C C   . VAL B 66  ? 1.0071 0.8077 1.1129 -0.0397 -0.1591 -0.2016 58  VAL B C   
1411 O O   . VAL B 66  ? 0.9715 0.7576 1.0188 -0.0134 -0.1376 -0.2308 58  VAL B O   
1412 C CB  . VAL B 66  ? 0.7590 0.6584 0.9009 -0.0637 -0.1156 -0.1378 58  VAL B CB  
1413 C CG1 . VAL B 66  ? 0.6780 0.6100 0.8096 -0.0716 -0.1041 -0.1162 58  VAL B CG1 
1414 C CG2 . VAL B 66  ? 0.7547 0.6671 0.8727 -0.0484 -0.0799 -0.1501 58  VAL B CG2 
1415 N N   . PRO B 67  ? 1.0813 0.8621 1.2595 -0.0523 -0.1883 -0.1889 59  PRO B N   
1416 C CA  . PRO B 67  ? 1.0698 0.8034 1.2620 -0.0344 -0.1969 -0.2117 59  PRO B CA  
1417 C C   . PRO B 67  ? 1.0281 0.8007 1.2214 -0.0154 -0.1504 -0.2023 59  PRO B C   
1418 O O   . PRO B 67  ? 1.1756 1.0098 1.3930 -0.0270 -0.1244 -0.1669 59  PRO B O   
1419 C CB  . PRO B 67  ? 1.0053 0.7233 1.2956 -0.0599 -0.2335 -0.1793 59  PRO B CB  
1420 C CG  . PRO B 67  ? 0.8778 0.6177 1.1907 -0.0880 -0.2578 -0.1575 59  PRO B CG  
1421 C CD  . PRO B 67  ? 1.0180 0.8159 1.2739 -0.0821 -0.2167 -0.1495 59  PRO B CD  
1422 N N   . SER B 68  ? 1.0312 0.7688 1.1989 0.0164  -0.1427 -0.2355 60  SER B N   
1423 C CA  . SER B 68  ? 1.0571 0.8390 1.2337 0.0371  -0.1007 -0.2265 60  SER B CA  
1424 C C   . SER B 68  ? 0.8978 0.7051 1.1569 0.0282  -0.1033 -0.1865 60  SER B C   
1425 O O   . SER B 68  ? 0.8267 0.6931 1.1046 0.0336  -0.0748 -0.1658 60  SER B O   
1426 C CB  . SER B 68  ? 1.1977 0.9401 1.3283 0.0815  -0.0885 -0.2700 60  SER B CB  
1427 O OG  . SER B 68  ? 1.4530 1.1128 1.5985 0.0939  -0.1287 -0.2967 60  SER B OG  
1428 N N   . ASP B 69  ? 0.9092 0.6745 1.2212 0.0142  -0.1401 -0.1721 61  ASP B N   
1429 C CA  . ASP B 69  ? 0.9755 0.7624 1.3651 0.0097  -0.1422 -0.1257 61  ASP B CA  
1430 C C   . ASP B 69  ? 1.0135 0.8549 1.4402 -0.0213 -0.1429 -0.0728 61  ASP B C   
1431 O O   . ASP B 69  ? 1.0458 0.9047 1.5360 -0.0266 -0.1479 -0.0252 61  ASP B O   
1432 C CB  . ASP B 69  ? 1.0135 0.7180 1.4527 0.0174  -0.1782 -0.1329 61  ASP B CB  
1433 C CG  . ASP B 69  ? 1.2864 0.9204 1.7218 -0.0026 -0.2238 -0.1594 61  ASP B CG  
1434 O OD1 . ASP B 69  ? 1.2169 0.8825 1.6431 -0.0302 -0.2298 -0.1466 61  ASP B OD1 
1435 O OD2 . ASP B 69  ? 1.6327 1.1775 2.0761 0.0113  -0.2574 -0.1950 61  ASP B OD2 
1436 N N   . LEU B 70  ? 0.8741 0.7437 1.2594 -0.0364 -0.1350 -0.0778 62  LEU B N   
1437 C CA  . LEU B 70  ? 0.8804 0.8086 1.2876 -0.0551 -0.1266 -0.0322 62  LEU B CA  
1438 C C   . LEU B 70  ? 0.8201 0.8123 1.2043 -0.0438 -0.0944 -0.0202 62  LEU B C   
1439 O O   . LEU B 70  ? 0.7547 0.7547 1.0938 -0.0344 -0.0769 -0.0517 62  LEU B O   
1440 C CB  . LEU B 70  ? 0.8583 0.7872 1.2337 -0.0706 -0.1329 -0.0431 62  LEU B CB  
1441 C CG  . LEU B 70  ? 0.6970 0.6835 1.0955 -0.0832 -0.1228 0.0021  62  LEU B CG  
1442 C CD1 . LEU B 70  ? 0.7164 0.7057 1.2027 -0.0991 -0.1449 0.0510  62  LEU B CD1 
1443 C CD2 . LEU B 70  ? 0.5189 0.5090 0.8732 -0.0891 -0.1215 -0.0153 62  LEU B CD2 
1444 N N   . THR B 71  ? 0.8187 0.8583 1.2353 -0.0441 -0.0885 0.0272  63  THR B N   
1445 C CA  . THR B 71  ? 0.6898 0.7870 1.0802 -0.0319 -0.0685 0.0345  63  THR B CA  
1446 C C   . THR B 71  ? 0.6346 0.7589 0.9718 -0.0378 -0.0543 0.0204  63  THR B C   
1447 O O   . THR B 71  ? 0.6384 0.7548 0.9703 -0.0481 -0.0555 0.0253  63  THR B O   
1448 C CB  . THR B 71  ? 0.6481 0.7887 1.0748 -0.0223 -0.0678 0.0905  63  THR B CB  
1449 O OG1 . THR B 71  ? 0.7702 0.9316 1.2133 -0.0311 -0.0647 0.1299  63  THR B OG1 
1450 C CG2 . THR B 71  ? 0.6492 0.7569 1.1364 -0.0148 -0.0825 0.1099  63  THR B CG2 
1451 N N   . VAL B 72  ? 0.5355 0.6899 0.8407 -0.0312 -0.0442 0.0032  64  VAL B N   
1452 C CA  . VAL B 72  ? 0.6408 0.8115 0.8984 -0.0352 -0.0344 -0.0125 64  VAL B CA  
1453 C C   . VAL B 72  ? 0.8196 1.0209 1.0676 -0.0269 -0.0299 0.0205  64  VAL B C   
1454 O O   . VAL B 72  ? 0.7631 0.9604 0.9842 -0.0283 -0.0220 0.0151  64  VAL B O   
1455 C CB  . VAL B 72  ? 0.6901 0.8877 0.9305 -0.0327 -0.0341 -0.0338 64  VAL B CB  
1456 C CG1 . VAL B 72  ? 0.7409 0.9442 0.9347 -0.0357 -0.0310 -0.0509 64  VAL B CG1 
1457 C CG2 . VAL B 72  ? 0.7367 0.9166 0.9925 -0.0385 -0.0293 -0.0598 64  VAL B CG2 
1458 N N   . GLY B 73  ? 0.9099 1.1451 1.1813 -0.0137 -0.0318 0.0596  65  GLY B N   
1459 C CA  . GLY B 73  ? 0.8000 1.0767 1.0630 0.0018  -0.0203 0.1014  65  GLY B CA  
1460 C C   . GLY B 73  ? 0.7518 1.0201 1.0532 -0.0084 -0.0151 0.1289  65  GLY B C   
1461 O O   . GLY B 73  ? 0.7035 1.0017 0.9855 0.0038  0.0012  0.1463  65  GLY B O   
1462 N N   . GLN B 74  ? 0.6881 0.9162 1.0460 -0.0284 -0.0315 0.1314  66  GLN B N   
1463 C CA  . GLN B 74  ? 0.5992 0.8171 1.0067 -0.0443 -0.0386 0.1545  66  GLN B CA  
1464 C C   . GLN B 74  ? 0.7418 0.9395 1.1096 -0.0509 -0.0379 0.1166  66  GLN B C   
1465 O O   . GLN B 74  ? 0.9057 1.1243 1.2951 -0.0528 -0.0342 0.1403  66  GLN B O   
1466 C CB  . GLN B 74  ? 0.7902 0.9573 1.2635 -0.0637 -0.0670 0.1573  66  GLN B CB  
1467 C CG  . GLN B 74  ? 1.1364 1.3228 1.6836 -0.0629 -0.0699 0.2196  66  GLN B CG  
1468 C CD  . GLN B 74  ? 1.3840 1.5018 1.9974 -0.0815 -0.1040 0.2140  66  GLN B CD  
1469 O OE1 . GLN B 74  ? 1.2753 1.3387 1.8595 -0.0779 -0.1170 0.1615  66  GLN B OE1 
1470 N NE2 . GLN B 74  ? 1.5872 1.7065 2.2938 -0.0999 -0.1188 0.2688  66  GLN B NE2 
1471 N N   . PHE B 75  ? 0.6998 0.8622 1.0166 -0.0528 -0.0400 0.0642  67  PHE B N   
1472 C CA  . PHE B 75  ? 0.7702 0.9109 1.0459 -0.0569 -0.0374 0.0329  67  PHE B CA  
1473 C C   . PHE B 75  ? 0.8774 1.0499 1.1122 -0.0399 -0.0157 0.0364  67  PHE B C   
1474 O O   . PHE B 75  ? 0.8982 1.0651 1.1176 -0.0378 -0.0109 0.0322  67  PHE B O   
1475 C CB  . PHE B 75  ? 0.6681 0.7693 0.9065 -0.0615 -0.0394 -0.0134 67  PHE B CB  
1476 C CG  . PHE B 75  ? 0.7350 0.8107 0.9339 -0.0655 -0.0365 -0.0374 67  PHE B CG  
1477 C CD1 . PHE B 75  ? 0.8979 0.9519 1.1062 -0.0729 -0.0541 -0.0356 67  PHE B CD1 
1478 C CD2 . PHE B 75  ? 0.6227 0.6950 0.7795 -0.0629 -0.0203 -0.0590 67  PHE B CD2 
1479 C CE1 . PHE B 75  ? 0.7553 0.7892 0.9230 -0.0726 -0.0523 -0.0519 67  PHE B CE1 
1480 C CE2 . PHE B 75  ? 0.7087 0.7557 0.8334 -0.0655 -0.0157 -0.0723 67  PHE B CE2 
1481 C CZ  . PHE B 75  ? 0.7389 0.7687 0.8645 -0.0679 -0.0300 -0.0673 67  PHE B CZ  
1482 N N   . TYR B 76  ? 0.8680 1.0713 1.0818 -0.0239 -0.0055 0.0425  68  TYR B N   
1483 C CA  . TYR B 76  ? 0.7242 0.9508 0.8868 -0.0005 0.0110  0.0378  68  TYR B CA  
1484 C C   . TYR B 76  ? 0.8072 1.0737 0.9885 0.0177  0.0280  0.0811  68  TYR B C   
1485 O O   . TYR B 76  ? 0.7715 1.0382 0.9192 0.0352  0.0416  0.0717  68  TYR B O   
1486 C CB  . TYR B 76  ? 0.8523 1.1055 0.9836 0.0154  0.0099  0.0339  68  TYR B CB  
1487 C CG  . TYR B 76  ? 0.7867 1.0626 0.8537 0.0476  0.0223  0.0268  68  TYR B CG  
1488 C CD1 . TYR B 76  ? 0.8646 1.1030 0.8811 0.0501  0.0193  -0.0206 68  TYR B CD1 
1489 C CD2 . TYR B 76  ? 0.7637 1.0952 0.8177 0.0790  0.0370  0.0680  68  TYR B CD2 
1490 C CE1 . TYR B 76  ? 0.8597 1.1058 0.8093 0.0846  0.0263  -0.0366 68  TYR B CE1 
1491 C CE2 . TYR B 76  ? 0.8563 1.2064 0.8351 0.1180  0.0493  0.0558  68  TYR B CE2 
1492 C CZ  . TYR B 76  ? 0.8699 1.1722 0.7939 0.1214  0.0416  -0.0016 68  TYR B CZ  
1493 O OH  . TYR B 76  ? 0.9827 1.2908 0.8244 0.1649  0.0496  -0.0229 68  TYR B OH  
1494 N N   . PHE B 77  ? 0.7294 1.0306 0.9730 0.0147  0.0283  0.1326  69  PHE B N   
1495 C CA  . PHE B 77  ? 0.6595 1.0140 0.9437 0.0298  0.0475  0.1875  69  PHE B CA  
1496 C C   . PHE B 77  ? 0.6036 0.9424 0.9317 0.0118  0.0368  0.1886  69  PHE B C   
1497 O O   . PHE B 77  ? 0.8903 1.2704 1.2361 0.0300  0.0554  0.2184  69  PHE B O   
1498 C CB  . PHE B 77  ? 0.9423 1.3389 1.2978 0.0262  0.0492  0.2516  69  PHE B CB  
1499 C CG  . PHE B 77  ? 0.9637 1.4009 1.2726 0.0572  0.0671  0.2705  69  PHE B CG  
1500 C CD1 . PHE B 77  ? 0.7867 1.2524 1.0089 0.0982  0.0909  0.2557  69  PHE B CD1 
1501 C CD2 . PHE B 77  ? 0.9679 1.4104 1.3141 0.0494  0.0568  0.3006  69  PHE B CD2 
1502 C CE1 . PHE B 77  ? 0.8909 1.3943 1.0563 0.1308  0.1013  0.2689  69  PHE B CE1 
1503 C CE2 . PHE B 77  ? 0.9795 1.4642 1.2773 0.0811  0.0699  0.3213  69  PHE B CE2 
1504 C CZ  . PHE B 77  ? 0.9419 1.4594 1.1451 0.1220  0.0907  0.3044  69  PHE B CZ  
1505 N N   . LEU B 78  ? 0.8860 1.1693 1.2288 -0.0193 0.0067  0.1568  70  LEU B N   
1506 C CA  . LEU B 78  ? 0.8885 1.1528 1.2602 -0.0355 -0.0121 0.1517  70  LEU B CA  
1507 C C   . LEU B 78  ? 0.9604 1.2134 1.2693 -0.0164 0.0034  0.1234  70  LEU B C   
1508 O O   . LEU B 78  ? 1.0931 1.3708 1.4272 -0.0076 0.0073  0.1449  70  LEU B O   
1509 C CB  . LEU B 78  ? 0.8597 1.0625 1.2372 -0.0641 -0.0475 0.1167  70  LEU B CB  
1510 C CG  . LEU B 78  ? 0.8791 1.0600 1.2863 -0.0824 -0.0799 0.1112  70  LEU B CG  
1511 C CD1 . LEU B 78  ? 0.9927 1.1274 1.4351 -0.1068 -0.1193 0.0968  70  LEU B CD1 
1512 C CD2 . LEU B 78  ? 0.9170 1.0645 1.2499 -0.0747 -0.0770 0.0702  70  LEU B CD2 
1513 N N   . ILE B 79  ? 0.7600 0.9760 0.9968 -0.0104 0.0107  0.0785  71  ILE B N   
1514 C CA  . ILE B 79  ? 0.6777 0.8679 0.8582 0.0049  0.0226  0.0498  71  ILE B CA  
1515 C C   . ILE B 79  ? 0.7258 0.9556 0.8921 0.0427  0.0500  0.0702  71  ILE B C   
1516 O O   . ILE B 79  ? 0.7811 1.0049 0.9392 0.0588  0.0581  0.0703  71  ILE B O   
1517 C CB  . ILE B 79  ? 0.6978 0.8448 0.8220 -0.0008 0.0222  0.0036  71  ILE B CB  
1518 C CG1 . ILE B 79  ? 0.6894 0.7995 0.8207 -0.0287 0.0040  -0.0161 71  ILE B CG1 
1519 C CG2 . ILE B 79  ? 0.7118 0.8273 0.7868 0.0153  0.0336  -0.0217 71  ILE B CG2 
1520 C CD1 . ILE B 79  ? 0.5786 0.6631 0.7085 -0.0355 -0.0055 -0.0176 71  ILE B CD1 
1521 N N   . ARG B 80  ? 0.8424 1.1144 1.0020 0.0622  0.0656  0.0894  72  ARG B N   
1522 C CA  . ARG B 80  ? 0.7459 1.0625 0.8802 0.1083  0.0970  0.1100  72  ARG B CA  
1523 C C   . ARG B 80  ? 0.7736 1.1407 0.9758 0.1191  0.1100  0.1609  72  ARG B C   
1524 O O   . ARG B 80  ? 1.0237 1.4051 1.2032 0.1575  0.1337  0.1636  72  ARG B O   
1525 C CB  . ARG B 80  ? 0.7798 1.1454 0.8985 0.1287  0.1113  0.1347  72  ARG B CB  
1526 C CG  . ARG B 80  ? 0.7202 1.0503 0.7599 0.1335  0.0999  0.0839  72  ARG B CG  
1527 C CD  . ARG B 80  ? 0.8356 1.2223 0.8543 0.1594  0.1119  0.1149  72  ARG B CD  
1528 N NE  . ARG B 80  ? 1.0503 1.4938 1.0364 0.2138  0.1489  0.1468  72  ARG B NE  
1529 C CZ  . ARG B 80  ? 1.0023 1.4404 0.8870 0.2612  0.1591  0.1112  72  ARG B CZ  
1530 N NH1 . ARG B 80  ? 1.0116 1.3892 0.8298 0.2527  0.1285  0.0435  72  ARG B NH1 
1531 N NH2 . ARG B 80  ? 1.0527 1.5473 0.9045 0.3187  0.1987  0.1432  72  ARG B NH2 
1532 N N   . LYS B 81  ? 0.7184 1.1111 1.0094 0.0861  0.0916  0.2003  73  LYS B N   
1533 C CA  . LYS B 81  ? 0.8361 1.2839 1.2144 0.0871  0.0941  0.2530  73  LYS B CA  
1534 C C   . LYS B 81  ? 0.8882 1.2980 1.2604 0.0819  0.0766  0.2271  73  LYS B C   
1535 O O   . LYS B 81  ? 1.0722 1.5285 1.4943 0.0993  0.0855  0.2623  73  LYS B O   
1536 C CB  . LYS B 81  ? 0.4168 0.8899 0.8990 0.0463  0.0673  0.2967  73  LYS B CB  
1537 N N   . ARG B 82  ? 0.7597 1.0917 1.0744 0.0605  0.0538  0.1716  74  ARG B N   
1538 C CA  . ARG B 82  ? 0.7155 1.0071 1.0133 0.0568  0.0379  0.1500  74  ARG B CA  
1539 C C   . ARG B 82  ? 0.8779 1.1490 1.1141 0.0980  0.0667  0.1307  74  ARG B C   
1540 O O   . ARG B 82  ? 0.8910 1.1641 1.1397 0.1144  0.0672  0.1417  74  ARG B O   
1541 C CB  . ARG B 82  ? 0.7207 0.9430 0.9795 0.0231  0.0093  0.1059  74  ARG B CB  
1542 C CG  . ARG B 82  ? 0.7115 0.9354 1.0198 -0.0121 -0.0230 0.1132  74  ARG B CG  
1543 C CD  . ARG B 82  ? 0.9301 1.1672 1.2965 -0.0284 -0.0589 0.1333  74  ARG B CD  
1544 N NE  . ARG B 82  ? 1.2027 1.3897 1.5130 -0.0307 -0.0765 0.1012  74  ARG B NE  
1545 C CZ  . ARG B 82  ? 1.4280 1.6148 1.7624 -0.0423 -0.1154 0.1067  74  ARG B CZ  
1546 N NH1 . ARG B 82  ? 1.4114 1.6434 1.8377 -0.0583 -0.1454 0.1408  74  ARG B NH1 
1547 N NH2 . ARG B 82  ? 1.4830 1.6270 1.7527 -0.0383 -0.1266 0.0815  74  ARG B NH2 
1548 N N   . ILE B 83  ? 1.0750 1.3229 1.2458 0.1160  0.0860  0.1005  75  ILE B N   
1549 C CA  . ILE B 83  ? 1.1303 1.3447 1.2377 0.1569  0.1082  0.0731  75  ILE B CA  
1550 C C   . ILE B 83  ? 1.0452 1.3278 1.1705 0.2090  0.1426  0.1113  75  ILE B C   
1551 O O   . ILE B 83  ? 1.0336 1.2943 1.1157 0.2540  0.1633  0.0949  75  ILE B O   
1552 C CB  . ILE B 83  ? 0.9771 1.1430 1.0100 0.1574  0.1077  0.0230  75  ILE B CB  
1553 C CG1 . ILE B 83  ? 1.1617 1.2838 1.1950 0.1072  0.0801  -0.0023 75  ILE B CG1 
1554 C CG2 . ILE B 83  ? 1.1796 1.2845 1.1486 0.1912  0.1175  -0.0168 75  ILE B CG2 
1555 C CD1 . ILE B 83  ? 1.3458 1.4266 1.3248 0.1021  0.0736  -0.0479 75  ILE B CD1 
1556 N N   . HIS B 84  ? 0.9550 1.3197 1.1496 0.2044  0.1498  0.1652  76  HIS B N   
1557 C CA  . HIS B 84  ? 0.8981 1.3499 1.1261 0.2532  0.1892  0.2171  76  HIS B CA  
1558 C C   . HIS B 84  ? 0.9370 1.3861 1.0692 0.3069  0.2230  0.1918  76  HIS B C   
1559 O O   . HIS B 84  ? 1.1539 1.6340 1.2623 0.3679  0.2598  0.2027  76  HIS B O   
1560 C CB  . HIS B 84  ? 0.9478 1.4204 1.2179 0.2803  0.1985  0.2398  76  HIS B CB  
1561 C CG  . HIS B 84  ? 0.9575 1.4427 1.3187 0.2331  0.1597  0.2668  76  HIS B CG  
1562 N ND1 . HIS B 84  ? 0.9445 1.5025 1.4124 0.2012  0.1448  0.3228  76  HIS B ND1 
1563 C CD2 . HIS B 84  ? 0.9906 1.4223 1.3486 0.2138  0.1287  0.2450  76  HIS B CD2 
1564 C CE1 . HIS B 84  ? 1.0759 1.6214 1.5980 0.1642  0.1010  0.3265  76  HIS B CE1 
1565 N NE2 . HIS B 84  ? 1.0749 1.5480 1.5261 0.1737  0.0927  0.2814  76  HIS B NE2 
1566 N N   . LEU B 85  ? 0.9510 1.3638 1.0256 0.2881  0.2082  0.1561  77  LEU B N   
1567 C CA  . LEU B 85  ? 1.0432 1.4553 1.0203 0.3362  0.2293  0.1291  77  LEU B CA  
1568 C C   . LEU B 85  ? 1.1253 1.6432 1.1288 0.3669  0.2649  0.1967  77  LEU B C   
1569 O O   . LEU B 85  ? 0.9914 1.5715 1.0993 0.3352  0.2646  0.2610  77  LEU B O   
1570 C CB  . LEU B 85  ? 0.9055 1.2485 0.8208 0.3035  0.1947  0.0700  77  LEU B CB  
1571 C CG  . LEU B 85  ? 1.1690 1.4088 1.0495 0.2793  0.1653  0.0045  77  LEU B CG  
1572 C CD1 . LEU B 85  ? 1.3636 1.5586 1.2066 0.2449  0.1330  -0.0404 77  LEU B CD1 
1573 C CD2 . LEU B 85  ? 1.1535 1.3485 0.9657 0.3343  0.1812  -0.0326 77  LEU B CD2 
1574 N N   . ARG B 86  ? 1.2194 1.7555 1.1272 0.4297  0.2940  0.1828  78  ARG B N   
1575 C CA  . ARG B 86  ? 1.3809 2.0132 1.2977 0.4655  0.3298  0.2511  78  ARG B CA  
1576 C C   . ARG B 86  ? 1.5790 2.2058 1.4036 0.4779  0.3204  0.2283  78  ARG B C   
1577 O O   . ARG B 86  ? 1.7013 2.2571 1.4198 0.4919  0.2993  0.1494  78  ARG B O   
1578 C CB  . ARG B 86  ? 1.3011 1.9471 1.1833 0.5257  0.3575  0.2649  78  ARG B CB  
1579 C CG  . ARG B 86  ? 1.3901 1.9517 1.1359 0.5731  0.3508  0.1787  78  ARG B CG  
1580 C CD  . ARG B 86  ? 1.6992 2.2772 1.4041 0.6391  0.3800  0.1927  78  ARG B CD  
1581 N NE  . ARG B 86  ? 1.9651 2.4474 1.6015 0.6645  0.3692  0.1165  78  ARG B NE  
1582 C CZ  . ARG B 86  ? 2.1059 2.5099 1.6227 0.6936  0.3492  0.0400  78  ARG B CZ  
1583 N NH1 . ARG B 86  ? 2.1072 2.4173 1.5807 0.7100  0.3363  -0.0234 78  ARG B NH1 
1584 N NH2 . ARG B 86  ? 2.1039 2.5212 1.5503 0.7048  0.3378  0.0282  78  ARG B NH2 
1585 N N   . PRO B 87  ? 1.5097 2.2073 1.3804 0.4702  0.3294  0.2985  79  PRO B N   
1586 C CA  . PRO B 87  ? 1.5277 2.2296 1.2990 0.5006  0.3236  0.2830  79  PRO B CA  
1587 C C   . PRO B 87  ? 1.7615 2.4658 1.4404 0.5733  0.3424  0.2699  79  PRO B C   
1588 O O   . PRO B 87  ? 1.8100 2.5731 1.5375 0.6012  0.3740  0.3340  79  PRO B O   
1589 C CB  . PRO B 87  ? 1.3552 2.1329 1.2173 0.4767  0.3314  0.3730  79  PRO B CB  
1590 C CG  . PRO B 87  ? 1.2948 2.1125 1.2912 0.4524  0.3461  0.4417  79  PRO B CG  
1591 C CD  . PRO B 87  ? 1.3323 2.0960 1.3454 0.4302  0.3354  0.3884  79  PRO B CD  
1592 N N   . GLU B 88  ? 1.7408 2.3810 1.2929 0.6028  0.3198  0.1884  80  GLU B N   
1593 C CA  . GLU B 88  ? 1.4886 2.0683 0.9904 0.5677  0.2766  0.1209  80  GLU B CA  
1594 C C   . GLU B 88  ? 1.4861 1.9602 0.9467 0.5525  0.2476  0.0293  80  GLU B C   
1595 O O   . GLU B 88  ? 1.6835 2.0949 1.0527 0.5863  0.2301  -0.0341 80  GLU B O   
1596 C CB  . GLU B 88  ? 1.8973 2.4832 1.2973 0.6030  0.2579  0.0989  80  GLU B CB  
1597 N N   . ASP B 89  ? 1.4864 1.9385 1.0196 0.5017  0.2408  0.0243  81  ASP B N   
1598 C CA  . ASP B 89  ? 1.7062 2.0474 1.2212 0.4698  0.2003  -0.0565 81  ASP B CA  
1599 C C   . ASP B 89  ? 1.7209 2.0234 1.2525 0.4062  0.1488  -0.0871 81  ASP B C   
1600 O O   . ASP B 89  ? 1.6599 1.9972 1.2784 0.3579  0.1436  -0.0414 81  ASP B O   
1601 C CB  . ASP B 89  ? 1.7754 2.0930 1.3842 0.4394  0.2086  -0.0386 81  ASP B CB  
1602 C CG  . ASP B 89  ? 1.8226 2.1604 1.4135 0.5051  0.2526  -0.0242 81  ASP B CG  
1603 O OD1 . ASP B 89  ? 1.8282 2.1401 1.3301 0.5537  0.2531  -0.0560 81  ASP B OD1 
1604 O OD2 . ASP B 89  ? 1.8093 2.1745 1.4936 0.4905  0.2694  0.0216  81  ASP B OD2 
1605 N N   . ALA B 90  ? 1.8023 2.0317 1.2559 0.4075  0.1089  -0.1650 82  ALA B N   
1606 C CA  . ALA B 90  ? 1.7387 1.9383 1.2152 0.3501  0.0595  -0.1942 82  ALA B CA  
1607 C C   . ALA B 90  ? 1.5986 1.7469 1.1707 0.2833  0.0449  -0.1981 82  ALA B C   
1608 O O   . ALA B 90  ? 1.5625 1.6440 1.1352 0.2806  0.0437  -0.2291 82  ALA B O   
1609 C CB  . ALA B 90  ? 1.7122 1.8531 1.0882 0.3692  0.0153  -0.2748 82  ALA B CB  
1610 N N   . LEU B 91  ? 1.3159 1.4947 0.9643 0.2346  0.0356  -0.1646 83  LEU B N   
1611 C CA  . LEU B 91  ? 1.1100 1.2470 0.8362 0.1767  0.0227  -0.1684 83  LEU B CA  
1612 C C   . LEU B 91  ? 1.1094 1.2576 0.8738 0.1347  -0.0064 -0.1717 83  LEU B C   
1613 O O   . LEU B 91  ? 1.1115 1.3179 0.8873 0.1400  -0.0044 -0.1373 83  LEU B O   
1614 C CB  . LEU B 91  ? 0.9842 1.1493 0.7811 0.1662  0.0518  -0.1137 83  LEU B CB  
1615 C CG  . LEU B 91  ? 0.8992 1.0175 0.7544 0.1190  0.0418  -0.1201 83  LEU B CG  
1616 C CD1 . LEU B 91  ? 0.9936 1.0442 0.8213 0.1277  0.0419  -0.1548 83  LEU B CD1 
1617 C CD2 . LEU B 91  ? 0.8772 1.0317 0.8019 0.1037  0.0561  -0.0680 83  LEU B CD2 
1618 N N   . PHE B 92  ? 1.0974 1.1930 0.8881 0.0953  -0.0311 -0.2075 84  PHE B N   
1619 C CA  . PHE B 92  ? 0.9986 1.1098 0.8349 0.0583  -0.0560 -0.2101 84  PHE B CA  
1620 C C   . PHE B 92  ? 0.8821 0.9643 0.7877 0.0143  -0.0518 -0.2049 84  PHE B C   
1621 O O   . PHE B 92  ? 0.8863 0.9154 0.7931 0.0043  -0.0478 -0.2214 84  PHE B O   
1622 C CB  . PHE B 92  ? 1.1076 1.2005 0.9060 0.0573  -0.0977 -0.2605 84  PHE B CB  
1623 C CG  . PHE B 92  ? 1.3113 1.4382 1.0257 0.1054  -0.1070 -0.2687 84  PHE B CG  
1624 C CD1 . PHE B 92  ? 1.2322 1.4268 0.9488 0.1142  -0.1142 -0.2390 84  PHE B CD1 
1625 C CD2 . PHE B 92  ? 1.3460 1.4364 0.9738 0.1476  -0.1073 -0.3050 84  PHE B CD2 
1626 C CE1 . PHE B 92  ? 1.1889 1.4205 0.8187 0.1634  -0.1208 -0.2405 84  PHE B CE1 
1627 C CE2 . PHE B 92  ? 1.1827 1.3078 0.7175 0.2005  -0.1128 -0.3132 84  PHE B CE2 
1628 C CZ  . PHE B 92  ? 1.1758 1.3749 0.7096 0.2080  -0.1192 -0.2785 84  PHE B CZ  
1629 N N   . PHE B 93  ? 0.8226 0.9389 0.7817 -0.0068 -0.0510 -0.1800 85  PHE B N   
1630 C CA  . PHE B 93  ? 0.7706 0.8676 0.7843 -0.0402 -0.0441 -0.1750 85  PHE B CA  
1631 C C   . PHE B 93  ? 0.8544 0.9487 0.9018 -0.0680 -0.0662 -0.1980 85  PHE B C   
1632 O O   . PHE B 93  ? 1.0455 1.1737 1.0962 -0.0660 -0.0901 -0.2065 85  PHE B O   
1633 C CB  . PHE B 93  ? 0.7367 0.8647 0.7888 -0.0427 -0.0308 -0.1401 85  PHE B CB  
1634 C CG  . PHE B 93  ? 0.7916 0.9112 0.8413 -0.0328 -0.0122 -0.1157 85  PHE B CG  
1635 C CD1 . PHE B 93  ? 0.9321 1.0261 0.9505 -0.0201 -0.0030 -0.1210 85  PHE B CD1 
1636 C CD2 . PHE B 93  ? 0.7886 0.9242 0.8740 -0.0360 -0.0080 -0.0881 85  PHE B CD2 
1637 C CE1 . PHE B 93  ? 0.9386 1.0357 0.9672 -0.0118 0.0103  -0.0946 85  PHE B CE1 
1638 C CE2 . PHE B 93  ? 0.7973 0.9279 0.8923 -0.0320 0.0000  -0.0660 85  PHE B CE2 
1639 C CZ  . PHE B 93  ? 0.8226 0.9402 0.8922 -0.0205 0.0093  -0.0669 85  PHE B CZ  
1640 N N   . PHE B 94  ? 1.0890 1.1492 1.1671 -0.0934 -0.0584 -0.2022 86  PHE B N   
1641 C CA  . PHE B 94  ? 1.0916 1.1572 1.2236 -0.1243 -0.0743 -0.2128 86  PHE B CA  
1642 C C   . PHE B 94  ? 1.0386 1.1141 1.2204 -0.1416 -0.0467 -0.1871 86  PHE B C   
1643 O O   . PHE B 94  ? 1.0730 1.1126 1.2473 -0.1460 -0.0255 -0.1773 86  PHE B O   
1644 C CB  . PHE B 94  ? 1.1177 1.1281 1.2435 -0.1391 -0.0949 -0.2430 86  PHE B CB  
1645 C CG  . PHE B 94  ? 1.1045 1.0992 1.1692 -0.1162 -0.1263 -0.2791 86  PHE B CG  
1646 C CD1 . PHE B 94  ? 1.0943 1.1159 1.1676 -0.1231 -0.1679 -0.3032 86  PHE B CD1 
1647 C CD2 . PHE B 94  ? 1.2408 1.1981 1.2363 -0.0829 -0.1147 -0.2890 86  PHE B CD2 
1648 C CE1 . PHE B 94  ? 1.1192 1.1249 1.1182 -0.0951 -0.1992 -0.3411 86  PHE B CE1 
1649 C CE2 . PHE B 94  ? 1.5093 1.4535 1.4351 -0.0520 -0.1387 -0.3241 86  PHE B CE2 
1650 C CZ  . PHE B 94  ? 1.4198 1.3853 1.3400 -0.0570 -0.1819 -0.3526 86  PHE B CZ  
1651 N N   . VAL B 95  ? 1.0736 1.2001 1.3012 -0.1456 -0.0462 -0.1749 87  VAL B N   
1652 C CA  . VAL B 95  ? 1.0311 1.1744 1.3030 -0.1547 -0.0181 -0.1535 87  VAL B CA  
1653 C C   . VAL B 95  ? 1.0519 1.2324 1.4012 -0.1809 -0.0289 -0.1508 87  VAL B C   
1654 O O   . VAL B 95  ? 0.9527 1.1796 1.3349 -0.1805 -0.0529 -0.1551 87  VAL B O   
1655 C CB  . VAL B 95  ? 0.8709 1.0417 1.1405 -0.1315 -0.0035 -0.1395 87  VAL B CB  
1656 C CG1 . VAL B 95  ? 0.8390 1.0212 1.1356 -0.1307 0.0287  -0.1238 87  VAL B CG1 
1657 C CG2 . VAL B 95  ? 0.9201 1.0599 1.1325 -0.1121 -0.0012 -0.1384 87  VAL B CG2 
1658 N N   . ASN B 96  ? 1.1437 1.3086 1.5288 -0.2037 -0.0120 -0.1379 88  ASN B N   
1659 C CA  . ASN B 96  ? 1.1291 1.3267 1.6057 -0.2370 -0.0248 -0.1293 88  ASN B CA  
1660 C C   . ASN B 96  ? 1.1196 1.3051 1.6038 -0.2542 -0.0809 -0.1635 88  ASN B C   
1661 O O   . ASN B 96  ? 1.1639 1.4023 1.7142 -0.2695 -0.1101 -0.1654 88  ASN B O   
1662 C CB  . ASN B 96  ? 1.1504 1.4284 1.6949 -0.2308 -0.0073 -0.1050 88  ASN B CB  
1663 C CG  . ASN B 96  ? 1.0707 1.3652 1.6343 -0.2235 0.0475  -0.0692 88  ASN B CG  
1664 O OD1 . ASN B 96  ? 0.8905 1.1461 1.4420 -0.2353 0.0679  -0.0549 88  ASN B OD1 
1665 N ND2 . ASN B 96  ? 1.2551 1.6066 1.8437 -0.1987 0.0728  -0.0536 88  ASN B ND2 
1666 N N   . ASN B 97  ? 1.1531 1.2701 1.5657 -0.2470 -0.0972 -0.1916 89  ASN B N   
1667 C CA  . ASN B 97  ? 1.2441 1.3321 1.6361 -0.2535 -0.1510 -0.2341 89  ASN B CA  
1668 C C   . ASN B 97  ? 1.1630 1.3037 1.5312 -0.2328 -0.1826 -0.2501 89  ASN B C   
1669 O O   . ASN B 97  ? 1.1745 1.3111 1.5376 -0.2400 -0.2345 -0.2844 89  ASN B O   
1670 C CB  . ASN B 97  ? 1.3548 1.4299 1.8378 -0.3005 -0.1821 -0.2392 89  ASN B CB  
1671 C CG  . ASN B 97  ? 1.5247 1.5297 2.0215 -0.3192 -0.1596 -0.2255 89  ASN B CG  
1672 O OD1 . ASN B 97  ? 1.5579 1.5851 2.1340 -0.3444 -0.1295 -0.1826 89  ASN B OD1 
1673 N ND2 . ASN B 97  ? 1.6577 1.5807 2.0772 -0.3024 -0.1710 -0.2573 89  ASN B ND2 
1674 N N   . THR B 98  ? 1.0712 1.2566 1.4221 -0.2057 -0.1545 -0.2256 90  THR B N   
1675 C CA  . THR B 98  ? 0.9422 1.1792 1.2734 -0.1825 -0.1786 -0.2286 90  THR B CA  
1676 C C   . THR B 98  ? 1.0648 1.2957 1.3216 -0.1438 -0.1525 -0.2155 90  THR B C   
1677 O O   . THR B 98  ? 0.9571 1.1798 1.2169 -0.1373 -0.1133 -0.1918 90  THR B O   
1678 C CB  . THR B 98  ? 0.8933 1.2072 1.3142 -0.1908 -0.1772 -0.2016 90  THR B CB  
1679 O OG1 . THR B 98  ? 1.2338 1.5672 1.7428 -0.2301 -0.2042 -0.2066 90  THR B OG1 
1680 C CG2 . THR B 98  ? 0.7119 1.0772 1.1124 -0.1634 -0.2032 -0.1987 90  THR B CG2 
1681 N N   . ILE B 99  ? 1.1567 1.3933 1.3479 -0.1175 -0.1762 -0.2294 91  ILE B N   
1682 C CA  . ILE B 99  ? 0.9593 1.2026 1.0957 -0.0824 -0.1524 -0.2068 91  ILE B CA  
1683 C C   . ILE B 99  ? 0.9434 1.2365 1.1266 -0.0743 -0.1394 -0.1701 91  ILE B C   
1684 O O   . ILE B 99  ? 0.8880 1.2309 1.0968 -0.0697 -0.1647 -0.1646 91  ILE B O   
1685 C CB  . ILE B 99  ? 0.9227 1.1726 0.9768 -0.0502 -0.1761 -0.2227 91  ILE B CB  
1686 C CG1 . ILE B 99  ? 0.8799 1.0678 0.8784 -0.0492 -0.1879 -0.2653 91  ILE B CG1 
1687 C CG2 . ILE B 99  ? 0.9081 1.1788 0.9259 -0.0162 -0.1464 -0.1843 91  ILE B CG2 
1688 C CD1 . ILE B 99  ? 1.0353 1.2258 0.9366 -0.0084 -0.2102 -0.2892 91  ILE B CD1 
1689 N N   . PRO B 100 ? 0.8377 1.1139 1.0325 -0.0707 -0.1039 -0.1468 92  PRO B N   
1690 C CA  . PRO B 100 ? 0.6757 0.9801 0.9149 -0.0610 -0.0916 -0.1177 92  PRO B CA  
1691 C C   . PRO B 100 ? 0.7239 1.0542 0.9409 -0.0331 -0.0978 -0.0898 92  PRO B C   
1692 O O   . PRO B 100 ? 0.8075 1.1294 0.9699 -0.0187 -0.0960 -0.0854 92  PRO B O   
1693 C CB  . PRO B 100 ? 0.7688 1.0305 1.0103 -0.0658 -0.0600 -0.1124 92  PRO B CB  
1694 C CG  . PRO B 100 ? 0.7197 0.9439 0.9068 -0.0660 -0.0553 -0.1221 92  PRO B CG  
1695 C CD  . PRO B 100 ? 0.8253 1.0501 0.9908 -0.0736 -0.0786 -0.1493 92  PRO B CD  
1696 N N   . PRO B 101 ? 0.7690 1.1332 1.0318 -0.0220 -0.1019 -0.0659 93  PRO B N   
1697 C CA  . PRO B 101 ? 0.7537 1.1403 1.0077 0.0042  -0.1045 -0.0274 93  PRO B CA  
1698 C C   . PRO B 101 ? 0.7606 1.1085 1.0112 0.0074  -0.0802 -0.0045 93  PRO B C   
1699 O O   . PRO B 101 ? 0.6645 0.9731 0.9403 -0.0051 -0.0658 -0.0145 93  PRO B O   
1700 C CB  . PRO B 101 ? 0.7193 1.1387 1.0382 0.0130  -0.1124 -0.0095 93  PRO B CB  
1701 C CG  . PRO B 101 ? 0.8587 1.2603 1.2209 -0.0051 -0.0981 -0.0340 93  PRO B CG  
1702 C CD  . PRO B 101 ? 0.7857 1.1714 1.1166 -0.0297 -0.1007 -0.0680 93  PRO B CD  
1703 N N   . THR B 102 ? 0.7625 1.1260 0.9833 0.0252  -0.0771 0.0276  94  THR B N   
1704 C CA  . THR B 102 ? 0.8363 1.1737 1.0689 0.0242  -0.0581 0.0560  94  THR B CA  
1705 C C   . THR B 102 ? 0.7222 1.0362 1.0221 0.0215  -0.0577 0.0811  94  THR B C   
1706 O O   . THR B 102 ? 0.6074 0.8816 0.9319 0.0098  -0.0511 0.0870  94  THR B O   
1707 C CB  . THR B 102 ? 0.7204 1.0956 0.9180 0.0479  -0.0496 0.0972  94  THR B CB  
1708 O OG1 . THR B 102 ? 0.7660 1.1834 0.9784 0.0690  -0.0581 0.1395  94  THR B OG1 
1709 C CG2 . THR B 102 ? 0.7920 1.1802 0.9103 0.0596  -0.0518 0.0641  94  THR B CG2 
1710 N N   . SER B 103 ? 0.7508 1.0868 1.0817 0.0339  -0.0691 0.0936  95  SER B N   
1711 C CA  . SER B 103 ? 0.6487 0.9552 1.0431 0.0386  -0.0709 0.1160  95  SER B CA  
1712 C C   . SER B 103 ? 0.6782 0.9387 1.0922 0.0294  -0.0675 0.0719  95  SER B C   
1713 O O   . SER B 103 ? 0.7183 0.9347 1.1735 0.0351  -0.0695 0.0759  95  SER B O   
1714 C CB  . SER B 103 ? 0.6321 0.9820 1.0532 0.0627  -0.0830 0.1514  95  SER B CB  
1715 O OG  . SER B 103 ? 0.6985 1.0925 1.1016 0.0667  -0.0949 0.1231  95  SER B OG  
1716 N N   . ALA B 104 ? 0.6943 0.9628 1.0771 0.0179  -0.0621 0.0311  96  ALA B N   
1717 C CA  . ALA B 104 ? 0.6284 0.8653 1.0208 0.0139  -0.0512 -0.0047 96  ALA B CA  
1718 C C   . ALA B 104 ? 0.7608 0.9349 1.1364 0.0042  -0.0459 -0.0187 96  ALA B C   
1719 O O   . ALA B 104 ? 0.9090 1.0751 1.2579 -0.0095 -0.0467 -0.0132 96  ALA B O   
1720 C CB  . ALA B 104 ? 0.5522 0.8192 0.9262 0.0009  -0.0457 -0.0328 96  ALA B CB  
1721 N N   . THR B 105 ? 0.9437 1.0747 1.3331 0.0151  -0.0425 -0.0382 97  THR B N   
1722 C CA  . THR B 105 ? 0.7258 0.7944 1.0917 0.0082  -0.0459 -0.0595 97  THR B CA  
1723 C C   . THR B 105 ? 0.6859 0.7541 1.0025 0.0000  -0.0288 -0.0905 97  THR B C   
1724 O O   . THR B 105 ? 0.6135 0.7184 0.9294 0.0039  -0.0111 -0.0992 97  THR B O   
1725 C CB  . THR B 105 ? 0.7739 0.7843 1.1607 0.0295  -0.0543 -0.0754 97  THR B CB  
1726 O OG1 . THR B 105 ? 0.8402 0.8626 1.2176 0.0532  -0.0328 -0.1013 97  THR B OG1 
1727 C CG2 . THR B 105 ? 0.7476 0.7541 1.1946 0.0388  -0.0705 -0.0381 97  THR B CG2 
1728 N N   . MET B 106 ? 0.6509 0.6816 0.9346 -0.0120 -0.0355 -0.1016 98  MET B N   
1729 C CA  . MET B 106 ? 0.7403 0.7661 0.9744 -0.0174 -0.0199 -0.1239 98  MET B CA  
1730 C C   . MET B 106 ? 0.8484 0.8608 1.0630 0.0055  -0.0014 -0.1499 98  MET B C   
1731 O O   . MET B 106 ? 0.9350 0.9688 1.1258 0.0053  0.0231  -0.1558 98  MET B O   
1732 C CB  . MET B 106 ? 0.7373 0.7265 0.9432 -0.0296 -0.0363 -0.1276 98  MET B CB  
1733 C CG  . MET B 106 ? 0.6112 0.6242 0.8360 -0.0465 -0.0453 -0.0976 98  MET B CG  
1734 S SD  . MET B 106 ? 0.6840 0.7462 0.8910 -0.0530 -0.0245 -0.0905 98  MET B SD  
1735 C CE  . MET B 106 ? 0.5659 0.6043 0.7225 -0.0582 -0.0106 -0.1124 98  MET B CE  
1736 N N   . GLY B 107 ? 0.7464 0.7226 0.9734 0.0281  -0.0114 -0.1627 99  GLY B N   
1737 C CA  . GLY B 107 ? 0.7777 0.7424 0.9822 0.0617  0.0100  -0.1886 99  GLY B CA  
1738 C C   . GLY B 107 ? 0.8081 0.8410 1.0546 0.0721  0.0395  -0.1728 99  GLY B C   
1739 O O   . GLY B 107 ? 0.8391 0.8997 1.0690 0.0867  0.0722  -0.1788 99  GLY B O   
1740 N N   . GLN B 108 ? 0.9013 0.9677 1.2067 0.0652  0.0271  -0.1476 100 GLN B N   
1741 C CA  . GLN B 108 ? 0.7767 0.9156 1.1337 0.0716  0.0440  -0.1303 100 GLN B CA  
1742 C C   . GLN B 108 ? 0.7607 0.9487 1.1164 0.0408  0.0538  -0.1213 100 GLN B C   
1743 O O   . GLN B 108 ? 0.7297 0.9728 1.1206 0.0423  0.0748  -0.1138 100 GLN B O   
1744 C CB  . GLN B 108 ? 0.7876 0.9487 1.1990 0.0742  0.0211  -0.1041 100 GLN B CB  
1745 C CG  . GLN B 108 ? 0.8382 1.0776 1.3099 0.0844  0.0296  -0.0863 100 GLN B CG  
1746 C CD  . GLN B 108 ? 1.0009 1.2513 1.4949 0.1229  0.0598  -0.0973 100 GLN B CD  
1747 O OE1 . GLN B 108 ? 1.0985 1.2908 1.5778 0.1559  0.0626  -0.1140 100 GLN B OE1 
1748 N NE2 . GLN B 108 ? 0.9813 1.3063 1.5147 0.1206  0.0821  -0.0876 100 GLN B NE2 
1749 N N   . LEU B 109 ? 0.7917 0.9587 1.1144 0.0134  0.0378  -0.1201 101 LEU B N   
1750 C CA  . LEU B 109 ? 0.7255 0.9195 1.0421 -0.0145 0.0423  -0.1163 101 LEU B CA  
1751 C C   . LEU B 109 ? 0.8441 1.0278 1.1317 -0.0141 0.0716  -0.1247 101 LEU B C   
1752 O O   . LEU B 109 ? 0.9891 1.2069 1.2995 -0.0312 0.0855  -0.1155 101 LEU B O   
1753 C CB  . LEU B 109 ? 0.7120 0.8827 0.9969 -0.0336 0.0211  -0.1133 101 LEU B CB  
1754 C CG  . LEU B 109 ? 0.7270 0.9198 1.0095 -0.0575 0.0161  -0.1129 101 LEU B CG  
1755 C CD1 . LEU B 109 ? 0.6463 0.8915 0.9712 -0.0598 -0.0015 -0.1057 101 LEU B CD1 
1756 C CD2 . LEU B 109 ? 0.6397 0.8021 0.8789 -0.0653 0.0050  -0.1129 101 LEU B CD2 
1757 N N   . TYR B 110 ? 0.9507 1.0861 1.1886 0.0056  0.0780  -0.1402 102 TYR B N   
1758 C CA  . TYR B 110 ? 0.8687 0.9949 1.0627 0.0160  0.1074  -0.1457 102 TYR B CA  
1759 C C   . TYR B 110 ? 0.9054 1.0806 1.1328 0.0405  0.1441  -0.1377 102 TYR B C   
1760 O O   . TYR B 110 ? 0.8758 1.0882 1.1158 0.0332  0.1744  -0.1190 102 TYR B O   
1761 C CB  . TYR B 110 ? 0.7895 0.8505 0.9129 0.0357  0.0956  -0.1701 102 TYR B CB  
1762 C CG  . TYR B 110 ? 0.8749 0.9252 0.9327 0.0545  0.1233  -0.1761 102 TYR B CG  
1763 C CD1 . TYR B 110 ? 0.9408 0.9953 0.9711 0.0973  0.1521  -0.1890 102 TYR B CD1 
1764 C CD2 . TYR B 110 ? 0.8941 0.9316 0.9125 0.0357  0.1227  -0.1664 102 TYR B CD2 
1765 C CE1 . TYR B 110 ? 0.9523 1.0029 0.9102 0.1214  0.1811  -0.1904 102 TYR B CE1 
1766 C CE2 . TYR B 110 ? 0.9678 0.9993 0.9208 0.0563  0.1484  -0.1648 102 TYR B CE2 
1767 C CZ  . TYR B 110 ? 0.9870 1.0271 0.9060 0.0994  0.1783  -0.1760 102 TYR B CZ  
1768 O OH  . TYR B 110 ? 1.1163 1.1560 0.9581 0.1265  0.2075  -0.1705 102 TYR B OH  
1769 N N   . GLU B 111 ? 0.7606 0.9380 1.0110 0.0710  0.1428  -0.1468 103 GLU B N   
1770 C CA  . GLU B 111 ? 0.7785 1.0052 1.0626 0.1059  0.1810  -0.1394 103 GLU B CA  
1771 C C   . GLU B 111 ? 0.8249 1.1398 1.2007 0.0818  0.1942  -0.1052 103 GLU B C   
1772 O O   . GLU B 111 ? 0.9180 1.2930 1.3358 0.1027  0.2335  -0.0867 103 GLU B O   
1773 C CB  . GLU B 111 ? 1.0379 1.2409 1.3361 0.1446  0.1701  -0.1564 103 GLU B CB  
1774 C CG  . GLU B 111 ? 1.3782 1.6221 1.6985 0.1961  0.2132  -0.1549 103 GLU B CG  
1775 C CD  . GLU B 111 ? 1.5754 1.7679 1.8908 0.2420  0.2004  -0.1807 103 GLU B CD  
1776 O OE1 . GLU B 111 ? 1.6155 1.7216 1.8842 0.2379  0.1627  -0.2077 103 GLU B OE1 
1777 O OE2 . GLU B 111 ? 1.6054 1.8439 1.9724 0.2821  0.2268  -0.1716 103 GLU B OE2 
1778 N N   . ASP B 112 ? 0.8841 1.2086 1.2920 0.0393  0.1602  -0.0968 104 ASP B N   
1779 C CA  . ASP B 112 ? 0.7634 1.1629 1.2596 0.0117  0.1571  -0.0719 104 ASP B CA  
1780 C C   . ASP B 112 ? 0.9015 1.3010 1.3993 -0.0301 0.1585  -0.0611 104 ASP B C   
1781 O O   . ASP B 112 ? 0.9929 1.4523 1.5691 -0.0522 0.1669  -0.0372 104 ASP B O   
1782 C CB  . ASP B 112 ? 0.6815 1.0956 1.2134 -0.0004 0.1120  -0.0729 104 ASP B CB  
1783 C CG  . ASP B 112 ? 0.8385 1.2667 1.3980 0.0395  0.1112  -0.0713 104 ASP B CG  
1784 O OD1 . ASP B 112 ? 0.9889 1.4476 1.5765 0.0732  0.1467  -0.0649 104 ASP B OD1 
1785 O OD2 . ASP B 112 ? 0.9628 1.3723 1.5163 0.0411  0.0779  -0.0729 104 ASP B OD2 
1786 N N   . ASN B 113 ? 0.8807 1.2132 1.3022 -0.0414 0.1485  -0.0760 105 ASN B N   
1787 C CA  . ASN B 113 ? 0.9782 1.2971 1.4007 -0.0792 0.1430  -0.0679 105 ASN B CA  
1788 C C   . ASN B 113 ? 0.9519 1.2257 1.3060 -0.0742 0.1687  -0.0638 105 ASN B C   
1789 O O   . ASN B 113 ? 1.1940 1.4389 1.5373 -0.1011 0.1604  -0.0590 105 ASN B O   
1790 C CB  . ASN B 113 ? 1.0823 1.3700 1.4873 -0.1011 0.0972  -0.0862 105 ASN B CB  
1791 C CG  . ASN B 113 ? 1.1457 1.4834 1.6158 -0.1123 0.0662  -0.0863 105 ASN B CG  
1792 O OD1 . ASN B 113 ? 1.4474 1.8458 1.9971 -0.1207 0.0729  -0.0694 105 ASN B OD1 
1793 N ND2 . ASN B 113 ? 0.9952 1.3146 1.4337 -0.1105 0.0320  -0.1013 105 ASN B ND2 
1794 N N   . HIS B 114 ? 0.7795 1.0438 1.0828 -0.0364 0.1973  -0.0672 106 HIS B N   
1795 C CA  . HIS B 114 ? 0.8478 1.0749 1.0764 -0.0264 0.2186  -0.0620 106 HIS B CA  
1796 C C   . HIS B 114 ? 0.9593 1.2298 1.2294 -0.0378 0.2598  -0.0201 106 HIS B C   
1797 O O   . HIS B 114 ? 1.0400 1.3762 1.3735 -0.0276 0.2912  0.0029  106 HIS B O   
1798 C CB  . HIS B 114 ? 0.9683 1.1675 1.1179 0.0215  0.2301  -0.0848 106 HIS B CB  
1799 C CG  . HIS B 114 ? 1.0847 1.3345 1.2507 0.0603  0.2747  -0.0741 106 HIS B CG  
1800 N ND1 . HIS B 114 ? 1.0426 1.3248 1.1881 0.0792  0.3251  -0.0442 106 HIS B ND1 
1801 C CD2 . HIS B 114 ? 1.1420 1.4187 1.3436 0.0890  0.2801  -0.0853 106 HIS B CD2 
1802 C CE1 . HIS B 114 ? 1.0090 1.3411 1.1757 0.1201  0.3629  -0.0384 106 HIS B CE1 
1803 N NE2 . HIS B 114 ? 0.9999 1.3270 1.2021 0.1272  0.3352  -0.0650 106 HIS B NE2 
1804 N N   . GLU B 115 ? 1.0054 1.2426 1.2492 -0.0583 0.2608  -0.0042 107 GLU B N   
1805 C CA  . GLU B 115 ? 1.1164 1.3875 1.4072 -0.0739 0.2989  0.0449  107 GLU B CA  
1806 C C   . GLU B 115 ? 1.1303 1.4269 1.3632 -0.0283 0.3532  0.0688  107 GLU B C   
1807 O O   . GLU B 115 ? 1.1352 1.4152 1.2874 0.0156  0.3550  0.0376  107 GLU B O   
1808 C CB  . GLU B 115 ? 1.0469 1.2644 1.3283 -0.1068 0.2811  0.0561  107 GLU B CB  
1809 C CG  . GLU B 115 ? 0.9892 1.1832 1.3250 -0.1470 0.2323  0.0331  107 GLU B CG  
1810 C CD  . GLU B 115 ? 1.1107 1.2504 1.4502 -0.1759 0.2199  0.0459  107 GLU B CD  
1811 O OE1 . GLU B 115 ? 1.1389 1.2642 1.4496 -0.1684 0.2506  0.0811  107 GLU B OE1 
1812 O OE2 . GLU B 115 ? 1.1148 1.2240 1.4810 -0.2016 0.1795  0.0208  107 GLU B OE2 
1813 N N   . GLU B 116 ? 1.0799 1.4147 1.3533 -0.0371 0.3964  0.1250  108 GLU B N   
1814 C CA  . GLU B 116 ? 1.1438 1.5220 1.3688 0.0112  0.4586  0.1589  108 GLU B CA  
1815 C C   . GLU B 116 ? 1.4080 1.7286 1.4818 0.0521  0.4589  0.1396  108 GLU B C   
1816 O O   . GLU B 116 ? 1.4807 1.8263 1.4785 0.1060  0.5023  0.1497  108 GLU B O   
1817 C CB  . GLU B 116 ? 0.9077 1.3437 1.2238 -0.0134 0.5057  0.2366  108 GLU B CB  
1818 N N   . ASP B 117 ? 1.5080 1.7556 1.5370 0.0303  0.4094  0.1116  109 ASP B N   
1819 C CA  . ASP B 117 ? 1.4753 1.6709 1.3728 0.0632  0.3977  0.0935  109 ASP B CA  
1820 C C   . ASP B 117 ? 1.3911 1.5426 1.2250 0.0848  0.3518  0.0251  109 ASP B C   
1821 O O   . ASP B 117 ? 1.3481 1.4489 1.0921 0.0995  0.3208  0.0004  109 ASP B O   
1822 C CB  . ASP B 117 ? 1.4296 1.5776 1.3237 0.0303  0.3738  0.1134  109 ASP B CB  
1823 C CG  . ASP B 117 ? 1.4220 1.5346 1.3818 -0.0146 0.3228  0.0835  109 ASP B CG  
1824 O OD1 . ASP B 117 ? 1.3959 1.5314 1.4207 -0.0285 0.3105  0.0603  109 ASP B OD1 
1825 O OD2 . ASP B 117 ? 1.5248 1.5899 1.4678 -0.0311 0.2966  0.0851  109 ASP B OD2 
1826 N N   . TYR B 118 ? 1.3984 1.5713 1.2888 0.0853  0.3454  -0.0007 110 TYR B N   
1827 C CA  . TYR B 118 ? 1.3445 1.4755 1.1989 0.1017  0.3029  -0.0587 110 TYR B CA  
1828 C C   . TYR B 118 ? 1.3088 1.3851 1.1606 0.0679  0.2456  -0.0804 110 TYR B C   
1829 O O   . TYR B 118 ? 1.3256 1.3549 1.1196 0.0823  0.2083  -0.1177 110 TYR B O   
1830 C CB  . TYR B 118 ? 1.3374 1.4437 1.0741 0.1611  0.3113  -0.0884 110 TYR B CB  
1831 C CG  . TYR B 118 ? 1.4402 1.6041 1.1711 0.2081  0.3729  -0.0712 110 TYR B CG  
1832 C CD1 . TYR B 118 ? 1.4770 1.6697 1.2692 0.2238  0.3831  -0.0867 110 TYR B CD1 
1833 C CD2 . TYR B 118 ? 1.5052 1.7005 1.1709 0.2413  0.4243  -0.0338 110 TYR B CD2 
1834 C CE1 . TYR B 118 ? 1.4785 1.7325 1.2725 0.2727  0.4441  -0.0678 110 TYR B CE1 
1835 C CE2 . TYR B 118 ? 1.5812 1.8403 1.2433 0.2905  0.4886  -0.0117 110 TYR B CE2 
1836 C CZ  . TYR B 118 ? 1.6314 1.9208 1.3603 0.3067  0.4989  -0.0301 110 TYR B CZ  
1837 O OH  . TYR B 118 ? 1.8722 2.2256 1.6117 0.3508  0.5540  -0.0070 110 TYR B OH  
1838 N N   . PHE B 119 ? 1.2019 1.2856 1.1214 0.0245  0.2384  -0.0564 111 PHE B N   
1839 C CA  . PHE B 119 ? 1.0843 1.1284 1.0118 -0.0030 0.1926  -0.0721 111 PHE B CA  
1840 C C   . PHE B 119 ? 0.9402 1.0039 0.9544 -0.0329 0.1766  -0.0767 111 PHE B C   
1841 O O   . PHE B 119 ? 0.9983 1.1012 1.0785 -0.0494 0.1968  -0.0562 111 PHE B O   
1842 C CB  . PHE B 119 ? 1.0901 1.1118 0.9980 -0.0181 0.1937  -0.0448 111 PHE B CB  
1843 C CG  . PHE B 119 ? 1.2506 1.2423 1.0637 0.0091  0.1852  -0.0479 111 PHE B CG  
1844 C CD1 . PHE B 119 ? 1.4738 1.4404 1.2354 0.0296  0.1515  -0.0866 111 PHE B CD1 
1845 C CD2 . PHE B 119 ? 1.3774 1.3641 1.1565 0.0133  0.2058  -0.0104 111 PHE B CD2 
1846 C CE1 . PHE B 119 ? 1.5044 1.4442 1.1791 0.0532  0.1333  -0.0935 111 PHE B CE1 
1847 C CE2 . PHE B 119 ? 1.4656 1.4296 1.1521 0.0411  0.1926  -0.0121 111 PHE B CE2 
1848 C CZ  . PHE B 119 ? 1.3667 1.3084 0.9991 0.0607  0.1535  -0.0566 111 PHE B CZ  
1849 N N   . LEU B 120 ? 0.8832 0.9240 0.8993 -0.0393 0.1387  -0.1005 112 LEU B N   
1850 C CA  . LEU B 120 ? 0.8594 0.9178 0.9389 -0.0620 0.1204  -0.1041 112 LEU B CA  
1851 C C   . LEU B 120 ? 0.8014 0.8360 0.8816 -0.0837 0.1033  -0.0994 112 LEU B C   
1852 O O   . LEU B 120 ? 0.8895 0.8948 0.9330 -0.0784 0.0856  -0.1044 112 LEU B O   
1853 C CB  . LEU B 120 ? 0.8433 0.8983 0.9288 -0.0507 0.0953  -0.1244 112 LEU B CB  
1854 C CG  . LEU B 120 ? 0.6905 0.7663 0.8257 -0.0671 0.0745  -0.1245 112 LEU B CG  
1855 C CD1 . LEU B 120 ? 0.6583 0.7810 0.8522 -0.0775 0.0867  -0.1161 112 LEU B CD1 
1856 C CD2 . LEU B 120 ? 0.6644 0.7339 0.8059 -0.0544 0.0527  -0.1330 112 LEU B CD2 
1857 N N   . TYR B 121 ? 0.7622 0.8088 0.8885 -0.1066 0.1063  -0.0907 113 TYR B N   
1858 C CA  . TYR B 121 ? 0.7750 0.7890 0.8976 -0.1214 0.0912  -0.0917 113 TYR B CA  
1859 C C   . TYR B 121 ? 0.7932 0.8140 0.9328 -0.1265 0.0630  -0.1118 113 TYR B C   
1860 O O   . TYR B 121 ? 0.7520 0.8035 0.9350 -0.1374 0.0545  -0.1180 113 TYR B O   
1861 C CB  . TYR B 121 ? 0.7641 0.7702 0.9222 -0.1432 0.1066  -0.0720 113 TYR B CB  
1862 C CG  . TYR B 121 ? 0.9319 0.9275 1.0606 -0.1339 0.1372  -0.0425 113 TYR B CG  
1863 C CD1 . TYR B 121 ? 0.8943 0.9291 1.0303 -0.1236 0.1694  -0.0230 113 TYR B CD1 
1864 C CD2 . TYR B 121 ? 1.0741 1.0247 1.1635 -0.1294 0.1360  -0.0311 113 TYR B CD2 
1865 C CE1 . TYR B 121 ? 0.9812 1.0114 1.0765 -0.1082 0.2002  0.0072  113 TYR B CE1 
1866 C CE2 . TYR B 121 ? 1.2044 1.1489 1.2594 -0.1171 0.1624  0.0008  113 TYR B CE2 
1867 C CZ  . TYR B 121 ? 1.1764 1.1610 1.2295 -0.1061 0.1948  0.0200  113 TYR B CZ  
1868 O OH  . TYR B 121 ? 1.1092 1.0925 1.1149 -0.0874 0.2238  0.0548  113 TYR B OH  
1869 N N   . VAL B 122 ? 0.7776 0.7763 0.8826 -0.1152 0.0490  -0.1183 114 VAL B N   
1870 C CA  . VAL B 122 ? 0.6696 0.6774 0.7750 -0.1110 0.0282  -0.1323 114 VAL B CA  
1871 C C   . VAL B 122 ? 0.7885 0.7587 0.8706 -0.1083 0.0220  -0.1406 114 VAL B C   
1872 O O   . VAL B 122 ? 0.9847 0.9306 1.0409 -0.0967 0.0289  -0.1308 114 VAL B O   
1873 C CB  . VAL B 122 ? 0.7780 0.8037 0.8711 -0.0932 0.0211  -0.1264 114 VAL B CB  
1874 C CG1 . VAL B 122 ? 0.6010 0.6429 0.6865 -0.0824 0.0073  -0.1311 114 VAL B CG1 
1875 C CG2 . VAL B 122 ? 0.6365 0.6870 0.7530 -0.0916 0.0232  -0.1236 114 VAL B CG2 
1876 N N   . ALA B 123 ? 1.0148 0.9785 1.1061 -0.1162 0.0054  -0.1610 115 ALA B N   
1877 C CA  . ALA B 123 ? 1.0395 0.9571 1.1025 -0.1075 -0.0038 -0.1785 115 ALA B CA  
1878 C C   . ALA B 123 ? 1.0405 0.9756 1.0650 -0.0798 -0.0163 -0.1939 115 ALA B C   
1879 O O   . ALA B 123 ? 1.1099 1.0872 1.1398 -0.0783 -0.0284 -0.1980 115 ALA B O   
1880 C CB  . ALA B 123 ? 0.9464 0.8305 1.0413 -0.1340 -0.0195 -0.1960 115 ALA B CB  
1881 N N   . TYR B 124 ? 1.0426 0.9501 1.0279 -0.0531 -0.0105 -0.1978 116 TYR B N   
1882 C CA  . TYR B 124 ? 1.0425 0.9722 0.9845 -0.0182 -0.0140 -0.2071 116 TYR B CA  
1883 C C   . TYR B 124 ? 1.1763 1.0510 1.0721 0.0042  -0.0245 -0.2436 116 TYR B C   
1884 O O   . TYR B 124 ? 1.0292 0.8454 0.9284 0.0010  -0.0208 -0.2495 116 TYR B O   
1885 C CB  . TYR B 124 ? 0.9262 0.8931 0.8672 0.0049  0.0082  -0.1706 116 TYR B CB  
1886 C CG  . TYR B 124 ? 1.0980 1.0334 1.0390 0.0145  0.0230  -0.1570 116 TYR B CG  
1887 C CD1 . TYR B 124 ? 1.2211 1.1383 1.1277 0.0521  0.0325  -0.1635 116 TYR B CD1 
1888 C CD2 . TYR B 124 ? 1.0843 1.0105 1.0548 -0.0080 0.0276  -0.1370 116 TYR B CD2 
1889 C CE1 . TYR B 124 ? 1.3573 1.2501 1.2705 0.0644  0.0450  -0.1468 116 TYR B CE1 
1890 C CE2 . TYR B 124 ? 1.1334 1.0356 1.1019 0.0032  0.0369  -0.1209 116 TYR B CE2 
1891 C CZ  . TYR B 124 ? 1.2963 1.1829 1.2420 0.0380  0.0450  -0.1240 116 TYR B CZ  
1892 O OH  . TYR B 124 ? 1.3561 1.2228 1.3062 0.0524  0.0532  -0.1041 116 TYR B OH  
1893 N N   . SER B 125 ? 1.4037 1.2938 1.2516 0.0307  -0.0389 -0.2685 117 SER B N   
1894 C CA  . SER B 125 ? 1.5369 1.3708 1.3233 0.0621  -0.0527 -0.3135 117 SER B CA  
1895 C C   . SER B 125 ? 1.3878 1.2672 1.1032 0.1126  -0.0492 -0.3201 117 SER B C   
1896 O O   . SER B 125 ? 1.2946 1.2481 1.0203 0.1154  -0.0390 -0.2858 117 SER B O   
1897 C CB  . SER B 125 ? 1.5510 1.3277 1.3513 0.0287  -0.0950 -0.3593 117 SER B CB  
1898 O OG  . SER B 125 ? 1.5597 1.2690 1.2941 0.0609  -0.1170 -0.4127 117 SER B OG  
1899 N N   . ASP B 126 ? 1.5294 1.3622 1.1702 0.1564  -0.0561 -0.3625 118 ASP B N   
1900 C CA  . ASP B 126 ? 1.4501 1.3269 1.0062 0.2144  -0.0492 -0.3702 118 ASP B CA  
1901 C C   . ASP B 126 ? 1.5493 1.4095 1.0519 0.2131  -0.0999 -0.4252 118 ASP B C   
1902 O O   . ASP B 126 ? 1.7514 1.6456 1.1676 0.2632  -0.1023 -0.4385 118 ASP B O   
1903 C CB  . ASP B 126 ? 1.2674 1.1132 0.7597 0.2784  -0.0211 -0.3832 118 ASP B CB  
1904 C CG  . ASP B 126 ? 1.5308 1.2600 1.0041 0.2771  -0.0472 -0.4433 118 ASP B CG  
1905 O OD1 . ASP B 126 ? 1.5953 1.2818 1.1373 0.2425  -0.0412 -0.4269 118 ASP B OD1 
1906 O OD2 . ASP B 126 ? 1.7525 1.4412 1.1639 0.2987  -0.0715 -0.4870 118 ASP B OD2 
1907 N N   . GLU B 127 ? 1.4889 1.3029 1.0461 0.1565  -0.1412 -0.4530 119 GLU B N   
1908 C CA  . GLU B 127 ? 1.4303 1.2383 0.9658 0.1413  -0.1979 -0.4979 119 GLU B CA  
1909 C C   . GLU B 127 ? 1.2673 1.1410 0.8890 0.0895  -0.2098 -0.4634 119 GLU B C   
1910 O O   . GLU B 127 ? 1.3646 1.2757 1.0557 0.0665  -0.1729 -0.4089 119 GLU B O   
1911 C CB  . GLU B 127 ? 1.5285 1.2399 1.0858 0.1104  -0.2319 -0.5371 119 GLU B CB  
1912 N N   . SER B 128 ? 1.3072 1.1949 0.9250 0.0739  -0.2627 -0.4947 120 SER B N   
1913 C CA  . SER B 128 ? 1.4311 1.3847 1.1360 0.0298  -0.2756 -0.4622 120 SER B CA  
1914 C C   . SER B 128 ? 1.7445 1.6569 1.5484 -0.0336 -0.3075 -0.4793 120 SER B C   
1915 O O   . SER B 128 ? 1.7062 1.6698 1.5889 -0.0705 -0.3270 -0.4618 120 SER B O   
1916 C CB  . SER B 128 ? 1.6131 1.6274 1.2655 0.0537  -0.3136 -0.4734 120 SER B CB  
1917 O OG  . SER B 128 ? 1.7057 1.7611 1.2652 0.1156  -0.2804 -0.4507 120 SER B OG  
1918 N N   . VAL B 129 ? 1.9803 1.8059 1.7883 -0.0442 -0.3015 -0.4953 121 VAL B N   
1919 C CA  . VAL B 129 ? 2.0206 1.7991 1.9170 -0.1009 -0.3220 -0.4956 121 VAL B CA  
1920 C C   . VAL B 129 ? 2.0536 1.7566 1.9627 -0.1040 -0.2894 -0.4887 121 VAL B C   
1921 O O   . VAL B 129 ? 2.3344 1.9899 2.1631 -0.0592 -0.2745 -0.5087 121 VAL B O   
1922 C CB  . VAL B 129 ? 1.7423 1.4835 1.6118 -0.1070 -0.3747 -0.5359 121 VAL B CB  
1923 C CG1 . VAL B 129 ? 1.9116 1.5869 1.8601 -0.1572 -0.3912 -0.5388 121 VAL B CG1 
1924 C CG2 . VAL B 129 ? 1.5703 1.3902 1.4521 -0.1149 -0.4123 -0.5348 121 VAL B CG2 
1925 N N   . TYR B 130 ? 1.7020 1.3977 1.7094 -0.1509 -0.2746 -0.4560 122 TYR B N   
1926 C CA  . TYR B 130 ? 1.5424 1.2996 1.6528 -0.2001 -0.2840 -0.4257 122 TYR B CA  
1927 C C   . TYR B 130 ? 1.7254 1.5288 1.8989 -0.2143 -0.2360 -0.3777 122 TYR B C   
1928 O O   . TYR B 130 ? 1.8068 1.6744 2.0611 -0.2442 -0.2311 -0.3465 122 TYR B O   
1929 C CB  . TYR B 130 ? 1.4149 1.1266 1.5944 -0.2460 -0.3094 -0.4239 122 TYR B CB  
1930 N N   . GLY B 131 ? 1.8409 1.6179 1.9671 -0.1864 -0.1918 -0.3580 123 GLY B N   
1931 C CA  . GLY B 131 ? 1.6735 1.4886 1.8325 -0.1918 -0.1410 -0.3035 123 GLY B CA  
1932 C C   . GLY B 131 ? 1.5403 1.3268 1.7783 -0.2315 -0.1275 -0.2746 123 GLY B C   
1933 O O   . GLY B 131 ? 1.4240 1.1935 1.6558 -0.2251 -0.0892 -0.2414 123 GLY B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -7  ?   ?   ?   A . n 
A 1 2   SER 2   -6  ?   ?   ?   A . n 
A 1 3   VAL 3   -5  ?   ?   ?   A . n 
A 1 4   ARG 4   -4  ?   ?   ?   A . n 
A 1 5   PRO 5   -3  ?   ?   ?   A . n 
A 1 6   GLN 6   -2  ?   ?   ?   A . n 
A 1 7   GLN 7   -1  ?   ?   ?   A . n 
A 1 8   GLU 8   0   0   GLU GLU A . n 
A 1 9   ASP 9   1   1   ASP ASP A . n 
A 1 10  GLU 10  2   2   GLU GLU A . n 
A 1 11  TRP 11  3   3   TRP TRP A . n 
A 1 12  VAL 12  4   4   VAL VAL A . n 
A 1 13  ASN 13  5   5   ASN ASN A . n 
A 1 14  VAL 14  6   6   VAL VAL A . n 
A 1 15  GLY 15  7   7   GLY GLY A . n 
A 1 16  SER 16  8   8   SER SER A . n 
A 1 17  LYS 17  9   9   LYS LYS A . n 
A 1 18  PHE 18  10  10  PHE PHE A . n 
A 1 19  GLN 19  11  11  GLN GLN A . n 
A 1 20  TYR 20  12  12  TYR TYR A . n 
A 1 21  LYS 21  13  13  LYS LYS A . n 
A 1 22  GLU 22  14  14  GLU GLU A . n 
A 1 23  ASP 23  15  15  ASP ASP A . n 
A 1 24  HIS 24  16  16  HIS HIS A . n 
A 1 25  PRO 25  17  17  PRO PRO A . n 
A 1 26  PHE 26  18  18  PHE PHE A . n 
A 1 27  GLU 27  19  19  GLU GLU A . n 
A 1 28  TYR 28  20  20  TYR TYR A . n 
A 1 29  ARG 29  21  21  ARG ARG A . n 
A 1 30  LYS 30  22  22  LYS LYS A . n 
A 1 31  LYS 31  23  23  LYS LYS A . n 
A 1 32  GLU 32  24  24  GLU GLU A . n 
A 1 33  GLY 33  25  25  GLY GLY A . n 
A 1 34  GLU 34  26  26  GLU GLU A . n 
A 1 35  LYS 35  27  27  LYS LYS A . n 
A 1 36  ILE 36  28  28  ILE ILE A . n 
A 1 37  ARG 37  29  29  ARG ARG A . n 
A 1 38  LYS 38  30  30  LYS LYS A . n 
A 1 39  LYS 39  31  31  LYS LYS A . n 
A 1 40  TYR 40  32  32  TYR TYR A . n 
A 1 41  PRO 41  33  33  PRO PRO A . n 
A 1 42  ASP 42  34  34  ASP ASP A . n 
A 1 43  ARG 43  35  35  ARG ARG A . n 
A 1 44  VAL 44  36  36  VAL VAL A . n 
A 1 45  PRO 45  37  37  PRO PRO A . n 
A 1 46  VAL 46  38  38  VAL VAL A . n 
A 1 47  ILE 47  39  39  ILE ILE A . n 
A 1 48  VAL 48  40  40  VAL VAL A . n 
A 1 49  GLU 49  41  41  GLU GLU A . n 
A 1 50  LYS 50  42  42  LYS LYS A . n 
A 1 51  ALA 51  43  43  ALA ALA A . n 
A 1 52  PRO 52  44  44  PRO PRO A . n 
A 1 53  LYS 53  45  45  LYS LYS A . n 
A 1 54  ALA 54  46  46  ALA ALA A . n 
A 1 55  ARG 55  47  47  ARG ARG A . n 
A 1 56  VAL 56  48  48  VAL VAL A . n 
A 1 57  PRO 57  49  49  PRO PRO A . n 
A 1 58  ASP 58  50  50  ASP ASP A . n 
A 1 59  LEU 59  51  51  LEU LEU A . n 
A 1 60  ASP 60  52  52  ASP ASP A . n 
A 1 61  LYS 61  53  53  LYS LYS A . n 
A 1 62  ARG 62  54  54  ARG ARG A . n 
A 1 63  LYS 63  55  55  LYS LYS A . n 
A 1 64  TYR 64  56  56  TYR TYR A . n 
A 1 65  LEU 65  57  57  LEU LEU A . n 
A 1 66  VAL 66  58  58  VAL VAL A . n 
A 1 67  PRO 67  59  59  PRO PRO A . n 
A 1 68  SER 68  60  60  SER SER A . n 
A 1 69  ASP 69  61  61  ASP ASP A . n 
A 1 70  LEU 70  62  62  LEU LEU A . n 
A 1 71  THR 71  63  63  THR THR A . n 
A 1 72  VAL 72  64  64  VAL VAL A . n 
A 1 73  GLY 73  65  65  GLY GLY A . n 
A 1 74  GLN 74  66  66  GLN GLN A . n 
A 1 75  PHE 75  67  67  PHE PHE A . n 
A 1 76  TYR 76  68  68  TYR TYR A . n 
A 1 77  PHE 77  69  69  PHE PHE A . n 
A 1 78  LEU 78  70  70  LEU LEU A . n 
A 1 79  ILE 79  71  71  ILE ILE A . n 
A 1 80  ARG 80  72  72  ARG ARG A . n 
A 1 81  LYS 81  73  73  LYS LYS A . n 
A 1 82  ARG 82  74  74  ARG ARG A . n 
A 1 83  ILE 83  75  75  ILE ILE A . n 
A 1 84  HIS 84  76  76  HIS HIS A . n 
A 1 85  LEU 85  77  77  LEU LEU A . n 
A 1 86  ARG 86  78  78  ARG ARG A . n 
A 1 87  PRO 87  79  79  PRO ALA A . n 
A 1 88  GLU 88  80  80  GLU GLU A . n 
A 1 89  ASP 89  81  81  ASP ASP A . n 
A 1 90  ALA 90  82  82  ALA ALA A . n 
A 1 91  LEU 91  83  83  LEU LEU A . n 
A 1 92  PHE 92  84  84  PHE PHE A . n 
A 1 93  PHE 93  85  85  PHE PHE A . n 
A 1 94  PHE 94  86  86  PHE PHE A . n 
A 1 95  VAL 95  87  87  VAL VAL A . n 
A 1 96  ASN 96  88  88  ASN ASN A . n 
A 1 97  ASN 97  89  89  ASN ASN A . n 
A 1 98  THR 98  90  90  THR THR A . n 
A 1 99  ILE 99  91  91  ILE ILE A . n 
A 1 100 PRO 100 92  92  PRO PRO A . n 
A 1 101 PRO 101 93  93  PRO PRO A . n 
A 1 102 THR 102 94  94  THR THR A . n 
A 1 103 SER 103 95  95  SER SER A . n 
A 1 104 ALA 104 96  96  ALA ALA A . n 
A 1 105 THR 105 97  97  THR THR A . n 
A 1 106 MET 106 98  98  MET MET A . n 
A 1 107 GLY 107 99  99  GLY GLY A . n 
A 1 108 GLN 108 100 100 GLN GLN A . n 
A 1 109 LEU 109 101 101 LEU LEU A . n 
A 1 110 TYR 110 102 102 TYR TYR A . n 
A 1 111 GLU 111 103 103 GLU GLU A . n 
A 1 112 ASP 112 104 104 ASP ASP A . n 
A 1 113 ASN 113 105 105 ASN ASN A . n 
A 1 114 HIS 114 106 106 HIS HIS A . n 
A 1 115 GLU 115 107 107 GLU GLU A . n 
A 1 116 GLU 116 108 108 GLU GLU A . n 
A 1 117 ASP 117 109 109 ASP ASP A . n 
A 1 118 TYR 118 110 110 TYR TYR A . n 
A 1 119 PHE 119 111 111 PHE PHE A . n 
A 1 120 LEU 120 112 112 LEU LEU A . n 
A 1 121 TYR 121 113 113 TYR TYR A . n 
A 1 122 VAL 122 114 114 VAL VAL A . n 
A 1 123 ALA 123 115 115 ALA ALA A . n 
A 1 124 TYR 124 116 116 TYR TYR A . n 
A 1 125 SER 125 117 117 SER SER A . n 
A 1 126 ASP 126 118 118 ASP ASP A . n 
A 1 127 GLU 127 119 119 GLU GLU A . n 
A 1 128 SER 128 120 120 SER SER A . n 
A 1 129 VAL 129 121 121 VAL VAL A . n 
A 1 130 TYR 130 122 ?   ?   ?   A . n 
A 1 131 GLY 131 123 ?   ?   ?   A . n 
A 1 132 LYS 132 124 ?   ?   ?   A . n 
B 1 1   GLY 1   -7  ?   ?   ?   B . n 
B 1 2   SER 2   -6  ?   ?   ?   B . n 
B 1 3   VAL 3   -5  ?   ?   ?   B . n 
B 1 4   ARG 4   -4  ?   ?   ?   B . n 
B 1 5   PRO 5   -3  ?   ?   ?   B . n 
B 1 6   GLN 6   -2  ?   ?   ?   B . n 
B 1 7   GLN 7   -1  ?   ?   ?   B . n 
B 1 8   GLU 8   0   ?   ?   ?   B . n 
B 1 9   ASP 9   1   1   ASP ASP B . n 
B 1 10  GLU 10  2   2   GLU GLU B . n 
B 1 11  TRP 11  3   3   TRP TRP B . n 
B 1 12  VAL 12  4   4   VAL VAL B . n 
B 1 13  ASN 13  5   5   ASN ASN B . n 
B 1 14  VAL 14  6   6   VAL VAL B . n 
B 1 15  GLY 15  7   7   GLY GLY B . n 
B 1 16  SER 16  8   8   SER SER B . n 
B 1 17  LYS 17  9   9   LYS LYS B . n 
B 1 18  PHE 18  10  10  PHE PHE B . n 
B 1 19  GLN 19  11  11  GLN GLN B . n 
B 1 20  TYR 20  12  12  TYR TYR B . n 
B 1 21  LYS 21  13  13  LYS LYS B . n 
B 1 22  GLU 22  14  14  GLU GLU B . n 
B 1 23  ASP 23  15  15  ASP ASP B . n 
B 1 24  HIS 24  16  16  HIS HIS B . n 
B 1 25  PRO 25  17  17  PRO PRO B . n 
B 1 26  PHE 26  18  18  PHE PHE B . n 
B 1 27  GLU 27  19  19  GLU GLU B . n 
B 1 28  TYR 28  20  20  TYR TYR B . n 
B 1 29  ARG 29  21  21  ARG ARG B . n 
B 1 30  LYS 30  22  22  LYS LYS B . n 
B 1 31  LYS 31  23  23  LYS LYS B . n 
B 1 32  GLU 32  24  24  GLU GLU B . n 
B 1 33  GLY 33  25  25  GLY GLY B . n 
B 1 34  GLU 34  26  26  GLU GLU B . n 
B 1 35  LYS 35  27  27  LYS LYS B . n 
B 1 36  ILE 36  28  28  ILE ILE B . n 
B 1 37  ARG 37  29  29  ARG ARG B . n 
B 1 38  LYS 38  30  30  LYS LYS B . n 
B 1 39  LYS 39  31  31  LYS LYS B . n 
B 1 40  TYR 40  32  32  TYR TYR B . n 
B 1 41  PRO 41  33  33  PRO PRO B . n 
B 1 42  ASP 42  34  34  ASP ASP B . n 
B 1 43  ARG 43  35  35  ARG ARG B . n 
B 1 44  VAL 44  36  36  VAL VAL B . n 
B 1 45  PRO 45  37  37  PRO PRO B . n 
B 1 46  VAL 46  38  38  VAL VAL B . n 
B 1 47  ILE 47  39  39  ILE ILE B . n 
B 1 48  VAL 48  40  40  VAL VAL B . n 
B 1 49  GLU 49  41  41  GLU GLU B . n 
B 1 50  LYS 50  42  42  LYS LYS B . n 
B 1 51  ALA 51  43  43  ALA ALA B . n 
B 1 52  PRO 52  44  44  PRO PRO B . n 
B 1 53  LYS 53  45  45  LYS LYS B . n 
B 1 54  ALA 54  46  46  ALA ALA B . n 
B 1 55  ARG 55  47  47  ARG ARG B . n 
B 1 56  VAL 56  48  48  VAL VAL B . n 
B 1 57  PRO 57  49  49  PRO PRO B . n 
B 1 58  ASP 58  50  50  ASP ASP B . n 
B 1 59  LEU 59  51  51  LEU LEU B . n 
B 1 60  ASP 60  52  52  ASP ASP B . n 
B 1 61  LYS 61  53  53  LYS LYS B . n 
B 1 62  ARG 62  54  54  ARG ARG B . n 
B 1 63  LYS 63  55  55  LYS LYS B . n 
B 1 64  TYR 64  56  56  TYR TYR B . n 
B 1 65  LEU 65  57  57  LEU LEU B . n 
B 1 66  VAL 66  58  58  VAL VAL B . n 
B 1 67  PRO 67  59  59  PRO PRO B . n 
B 1 68  SER 68  60  60  SER SER B . n 
B 1 69  ASP 69  61  61  ASP ASP B . n 
B 1 70  LEU 70  62  62  LEU LEU B . n 
B 1 71  THR 71  63  63  THR THR B . n 
B 1 72  VAL 72  64  64  VAL VAL B . n 
B 1 73  GLY 73  65  65  GLY GLY B . n 
B 1 74  GLN 74  66  66  GLN GLN B . n 
B 1 75  PHE 75  67  67  PHE PHE B . n 
B 1 76  TYR 76  68  68  TYR TYR B . n 
B 1 77  PHE 77  69  69  PHE PHE B . n 
B 1 78  LEU 78  70  70  LEU LEU B . n 
B 1 79  ILE 79  71  71  ILE ILE B . n 
B 1 80  ARG 80  72  72  ARG ARG B . n 
B 1 81  LYS 81  73  73  LYS LYS B . n 
B 1 82  ARG 82  74  74  ARG ARG B . n 
B 1 83  ILE 83  75  75  ILE ILE B . n 
B 1 84  HIS 84  76  76  HIS HIS B . n 
B 1 85  LEU 85  77  77  LEU LEU B . n 
B 1 86  ARG 86  78  78  ARG ARG B . n 
B 1 87  PRO 87  79  79  PRO PRO B . n 
B 1 88  GLU 88  80  80  GLU GLU B . n 
B 1 89  ASP 89  81  81  ASP ASP B . n 
B 1 90  ALA 90  82  82  ALA ALA B . n 
B 1 91  LEU 91  83  83  LEU LEU B . n 
B 1 92  PHE 92  84  84  PHE PHE B . n 
B 1 93  PHE 93  85  85  PHE PHE B . n 
B 1 94  PHE 94  86  86  PHE PHE B . n 
B 1 95  VAL 95  87  87  VAL VAL B . n 
B 1 96  ASN 96  88  88  ASN ASN B . n 
B 1 97  ASN 97  89  89  ASN ASN B . n 
B 1 98  THR 98  90  90  THR THR B . n 
B 1 99  ILE 99  91  91  ILE ILE B . n 
B 1 100 PRO 100 92  92  PRO PRO B . n 
B 1 101 PRO 101 93  93  PRO PRO B . n 
B 1 102 THR 102 94  94  THR THR B . n 
B 1 103 SER 103 95  95  SER SER B . n 
B 1 104 ALA 104 96  96  ALA ALA B . n 
B 1 105 THR 105 97  97  THR THR B . n 
B 1 106 MET 106 98  98  MET MET B . n 
B 1 107 GLY 107 99  99  GLY GLY B . n 
B 1 108 GLN 108 100 100 GLN GLN B . n 
B 1 109 LEU 109 101 101 LEU LEU B . n 
B 1 110 TYR 110 102 102 TYR TYR B . n 
B 1 111 GLU 111 103 103 GLU GLU B . n 
B 1 112 ASP 112 104 104 ASP ASP B . n 
B 1 113 ASN 113 105 105 ASN ASN B . n 
B 1 114 HIS 114 106 106 HIS HIS B . n 
B 1 115 GLU 115 107 107 GLU GLU B . n 
B 1 116 GLU 116 108 108 GLU GLU B . n 
B 1 117 ASP 117 109 109 ASP ASP B . n 
B 1 118 TYR 118 110 110 TYR TYR B . n 
B 1 119 PHE 119 111 111 PHE PHE B . n 
B 1 120 LEU 120 112 112 LEU LEU B . n 
B 1 121 TYR 121 113 113 TYR TYR B . n 
B 1 122 VAL 122 114 114 VAL VAL B . n 
B 1 123 ALA 123 115 115 ALA ALA B . n 
B 1 124 TYR 124 116 116 TYR TYR B . n 
B 1 125 SER 125 117 117 SER SER B . n 
B 1 126 ASP 126 118 118 ASP ASP B . n 
B 1 127 GLU 127 119 119 GLU GLU B . n 
B 1 128 SER 128 120 120 SER SER B . n 
B 1 129 VAL 129 121 121 VAL VAL B . n 
B 1 130 TYR 130 122 122 TYR TYR B . n 
B 1 131 GLY 131 123 123 GLY GLY B . n 
B 1 132 LYS 132 124 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MPD 1 201 2 MPD MPD A . 
D 2 MPD 1 201 3 MPD MPD B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-09-28 
2 'Structure model' 1 1 2018-06-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' diffrn_source         
4 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                         
2  2 'Structure model' '_citation.journal_abbrev'                  
3  2 'Structure model' '_citation.journal_id_CSD'                  
4  2 'Structure model' '_citation.journal_id_ISSN'                 
5  2 'Structure model' '_citation.journal_volume'                  
6  2 'Structure model' '_citation.page_first'                      
7  2 'Structure model' '_citation.page_last'                       
8  2 'Structure model' '_citation.pdbx_database_id_DOI'            
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'         
10 2 'Structure model' '_citation.title'                           
11 2 'Structure model' '_citation.year'                            
12 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
13 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined -41.2169 19.0140 -9.8339  0.9850 ? 0.0793  ? -0.0636 ? 0.9923 ? -0.3169 ? 0.6708 ? 5.5499  ? 
-0.4136 ? 0.1382  ? 9.4166 ? 1.1956  ? 5.9543 ? 0.3429  ? 0.8761  ? -0.4493 ? -1.7844 ? 0.4018  ? -0.6272 ? 0.6397  ? 0.9560  ? 
-0.6731 ? 
2 'X-RAY DIFFRACTION' ? refined -35.3508 28.1489 -3.8730  0.7240 ? -0.0529 ? -0.1025 ? 0.8853 ? -0.3105 ? 0.8555 ? 10.6193 ? 
0.9269  ? -0.0024 ? 3.9455 ? 1.3217  ? 9.8168 ? 0.1041  ? 1.5992  ? -1.0728 ? -0.0383 ? 0.0652  ? -1.2770 ? -0.0781 ? 1.4820  ? 
-0.4166 ? 
3 'X-RAY DIFFRACTION' ? refined -42.6158 30.0686 2.0076   0.5081 ? -0.0305 ? -0.0752 ? 0.5434 ? -0.0356 ? 0.4421 ? 8.3763  ? 
3.5532  ? 0.1384  ? 7.6400 ? 2.0839  ? 9.1831 ? 0.6173  ? 0.1703  ? -0.5070 ? 0.3586  ? -0.1274 ? -0.0747 ? 0.0171  ? 0.2089  ? 
-0.4943 ? 
4 'X-RAY DIFFRACTION' ? refined -55.0391 7.7926  -10.4149 0.4975 ? -0.0814 ? 0.0384  ? 0.4636 ? -0.1020 ? 0.5267 ? 9.6469  ? 
-3.6962 ? 1.6040  ? 8.1905 ? -3.1922 ? 6.3824 ? -0.1803 ? -0.2042 ? -0.2702 ? 0.5060  ? -0.0568 ? 0.3445  ? 0.4217  ? -0.2068 ? 
0.2409  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 0:22)'   
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 23:55)'  
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 56:121)' 
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? '(chain B and resid 1:123)'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP  ? ? ? .        4 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    PRO 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     17 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -37.88 
_pdbx_validate_torsion.psi             148.59 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 2   ? CG  ? A GLU 10  CG  
2   1 Y 1 A GLU 2   ? CD  ? A GLU 10  CD  
3   1 Y 1 A GLU 2   ? OE1 ? A GLU 10  OE1 
4   1 Y 1 A GLU 2   ? OE2 ? A GLU 10  OE2 
5   1 Y 1 A LYS 9   ? CG  ? A LYS 17  CG  
6   1 Y 1 A LYS 9   ? CD  ? A LYS 17  CD  
7   1 Y 1 A LYS 9   ? CE  ? A LYS 17  CE  
8   1 Y 1 A LYS 9   ? NZ  ? A LYS 17  NZ  
9   1 Y 1 A GLU 14  ? CG  ? A GLU 22  CG  
10  1 Y 1 A GLU 14  ? CD  ? A GLU 22  CD  
11  1 Y 1 A GLU 14  ? OE1 ? A GLU 22  OE1 
12  1 Y 1 A GLU 14  ? OE2 ? A GLU 22  OE2 
13  1 Y 1 A GLU 19  ? CG  ? A GLU 27  CG  
14  1 Y 1 A GLU 19  ? CD  ? A GLU 27  CD  
15  1 Y 1 A GLU 19  ? OE1 ? A GLU 27  OE1 
16  1 Y 1 A GLU 19  ? OE2 ? A GLU 27  OE2 
17  1 Y 1 A TYR 20  ? CG  ? A TYR 28  CG  
18  1 Y 1 A TYR 20  ? CD1 ? A TYR 28  CD1 
19  1 Y 1 A TYR 20  ? CD2 ? A TYR 28  CD2 
20  1 Y 1 A TYR 20  ? CE1 ? A TYR 28  CE1 
21  1 Y 1 A TYR 20  ? CE2 ? A TYR 28  CE2 
22  1 Y 1 A TYR 20  ? CZ  ? A TYR 28  CZ  
23  1 Y 1 A TYR 20  ? OH  ? A TYR 28  OH  
24  1 Y 1 A LYS 22  ? CG  ? A LYS 30  CG  
25  1 Y 1 A LYS 22  ? CD  ? A LYS 30  CD  
26  1 Y 1 A LYS 22  ? CE  ? A LYS 30  CE  
27  1 Y 1 A LYS 22  ? NZ  ? A LYS 30  NZ  
28  1 Y 1 A LYS 23  ? CG  ? A LYS 31  CG  
29  1 Y 1 A LYS 23  ? CD  ? A LYS 31  CD  
30  1 Y 1 A LYS 23  ? CE  ? A LYS 31  CE  
31  1 Y 1 A LYS 23  ? NZ  ? A LYS 31  NZ  
32  1 Y 1 A LYS 27  ? CG  ? A LYS 35  CG  
33  1 Y 1 A LYS 27  ? CD  ? A LYS 35  CD  
34  1 Y 1 A LYS 27  ? CE  ? A LYS 35  CE  
35  1 Y 1 A LYS 27  ? NZ  ? A LYS 35  NZ  
36  1 Y 1 A LYS 30  ? CG  ? A LYS 38  CG  
37  1 Y 1 A LYS 30  ? CD  ? A LYS 38  CD  
38  1 Y 1 A LYS 30  ? CE  ? A LYS 38  CE  
39  1 Y 1 A LYS 30  ? NZ  ? A LYS 38  NZ  
40  1 Y 1 A LYS 31  ? CG  ? A LYS 39  CG  
41  1 Y 1 A LYS 31  ? CD  ? A LYS 39  CD  
42  1 Y 1 A LYS 31  ? CE  ? A LYS 39  CE  
43  1 Y 1 A LYS 31  ? NZ  ? A LYS 39  NZ  
44  1 Y 1 A LYS 42  ? CE  ? A LYS 50  CE  
45  1 Y 1 A LYS 42  ? NZ  ? A LYS 50  NZ  
46  1 Y 1 A LYS 45  ? CG  ? A LYS 53  CG  
47  1 Y 1 A LYS 45  ? CD  ? A LYS 53  CD  
48  1 Y 1 A LYS 45  ? CE  ? A LYS 53  CE  
49  1 Y 1 A LYS 45  ? NZ  ? A LYS 53  NZ  
50  1 Y 1 A LYS 53  ? CE  ? A LYS 61  CE  
51  1 Y 1 A LYS 53  ? NZ  ? A LYS 61  NZ  
52  1 Y 1 A SER 60  ? OG  ? A SER 68  OG  
53  1 Y 1 A LYS 73  ? CG  ? A LYS 81  CG  
54  1 Y 1 A LYS 73  ? CD  ? A LYS 81  CD  
55  1 Y 1 A LYS 73  ? CE  ? A LYS 81  CE  
56  1 Y 1 A LYS 73  ? NZ  ? A LYS 81  NZ  
57  1 Y 1 A PRO 79  ? CG  ? A PRO 87  CG  
58  1 Y 1 A PRO 79  ? CD  ? A PRO 87  CD  
59  1 Y 1 A GLU 119 ? CG  ? A GLU 127 CG  
60  1 Y 1 A GLU 119 ? CD  ? A GLU 127 CD  
61  1 Y 1 A GLU 119 ? OE1 ? A GLU 127 OE1 
62  1 Y 1 A GLU 119 ? OE2 ? A GLU 127 OE2 
63  1 Y 1 B LYS 9   ? CG  ? B LYS 17  CG  
64  1 Y 1 B LYS 9   ? CD  ? B LYS 17  CD  
65  1 Y 1 B LYS 9   ? CE  ? B LYS 17  CE  
66  1 Y 1 B LYS 9   ? NZ  ? B LYS 17  NZ  
67  1 Y 1 B PHE 10  ? CG  ? B PHE 18  CG  
68  1 Y 1 B PHE 10  ? CD1 ? B PHE 18  CD1 
69  1 Y 1 B PHE 10  ? CD2 ? B PHE 18  CD2 
70  1 Y 1 B PHE 10  ? CE1 ? B PHE 18  CE1 
71  1 Y 1 B PHE 10  ? CE2 ? B PHE 18  CE2 
72  1 Y 1 B PHE 10  ? CZ  ? B PHE 18  CZ  
73  1 Y 1 B GLU 14  ? CG  ? B GLU 22  CG  
74  1 Y 1 B GLU 14  ? CD  ? B GLU 22  CD  
75  1 Y 1 B GLU 14  ? OE1 ? B GLU 22  OE1 
76  1 Y 1 B GLU 14  ? OE2 ? B GLU 22  OE2 
77  1 Y 1 B GLU 19  ? CG  ? B GLU 27  CG  
78  1 Y 1 B GLU 19  ? CD  ? B GLU 27  CD  
79  1 Y 1 B GLU 19  ? OE1 ? B GLU 27  OE1 
80  1 Y 1 B GLU 19  ? OE2 ? B GLU 27  OE2 
81  1 Y 1 B LYS 22  ? CE  ? B LYS 30  CE  
82  1 Y 1 B LYS 22  ? NZ  ? B LYS 30  NZ  
83  1 Y 1 B LYS 23  ? CG  ? B LYS 31  CG  
84  1 Y 1 B LYS 23  ? CD  ? B LYS 31  CD  
85  1 Y 1 B LYS 23  ? CE  ? B LYS 31  CE  
86  1 Y 1 B LYS 23  ? NZ  ? B LYS 31  NZ  
87  1 Y 1 B LYS 27  ? CG  ? B LYS 35  CG  
88  1 Y 1 B LYS 27  ? CD  ? B LYS 35  CD  
89  1 Y 1 B LYS 27  ? CE  ? B LYS 35  CE  
90  1 Y 1 B LYS 27  ? NZ  ? B LYS 35  NZ  
91  1 Y 1 B LYS 30  ? CG  ? B LYS 38  CG  
92  1 Y 1 B LYS 30  ? CD  ? B LYS 38  CD  
93  1 Y 1 B LYS 30  ? CE  ? B LYS 38  CE  
94  1 Y 1 B LYS 30  ? NZ  ? B LYS 38  NZ  
95  1 Y 1 B LYS 42  ? CG  ? B LYS 50  CG  
96  1 Y 1 B LYS 42  ? CD  ? B LYS 50  CD  
97  1 Y 1 B LYS 42  ? CE  ? B LYS 50  CE  
98  1 Y 1 B LYS 42  ? NZ  ? B LYS 50  NZ  
99  1 Y 1 B LYS 45  ? CG  ? B LYS 53  CG  
100 1 Y 1 B LYS 45  ? CD  ? B LYS 53  CD  
101 1 Y 1 B LYS 45  ? CE  ? B LYS 53  CE  
102 1 Y 1 B LYS 45  ? NZ  ? B LYS 53  NZ  
103 1 Y 1 B ARG 47  ? CG  ? B ARG 55  CG  
104 1 Y 1 B ARG 47  ? CD  ? B ARG 55  CD  
105 1 Y 1 B ARG 47  ? NE  ? B ARG 55  NE  
106 1 Y 1 B ARG 47  ? CZ  ? B ARG 55  CZ  
107 1 Y 1 B ARG 47  ? NH1 ? B ARG 55  NH1 
108 1 Y 1 B ARG 47  ? NH2 ? B ARG 55  NH2 
109 1 Y 1 B ASP 52  ? CG  ? B ASP 60  CG  
110 1 Y 1 B ASP 52  ? OD1 ? B ASP 60  OD1 
111 1 Y 1 B ASP 52  ? OD2 ? B ASP 60  OD2 
112 1 Y 1 B LYS 53  ? CE  ? B LYS 61  CE  
113 1 Y 1 B LYS 53  ? NZ  ? B LYS 61  NZ  
114 1 Y 1 B ARG 54  ? CG  ? B ARG 62  CG  
115 1 Y 1 B ARG 54  ? CD  ? B ARG 62  CD  
116 1 Y 1 B ARG 54  ? NE  ? B ARG 62  NE  
117 1 Y 1 B ARG 54  ? CZ  ? B ARG 62  CZ  
118 1 Y 1 B ARG 54  ? NH1 ? B ARG 62  NH1 
119 1 Y 1 B ARG 54  ? NH2 ? B ARG 62  NH2 
120 1 Y 1 B LYS 73  ? CG  ? B LYS 81  CG  
121 1 Y 1 B LYS 73  ? CD  ? B LYS 81  CD  
122 1 Y 1 B LYS 73  ? CE  ? B LYS 81  CE  
123 1 Y 1 B LYS 73  ? NZ  ? B LYS 81  NZ  
124 1 Y 1 B GLU 80  ? CG  ? B GLU 88  CG  
125 1 Y 1 B GLU 80  ? CD  ? B GLU 88  CD  
126 1 Y 1 B GLU 80  ? OE1 ? B GLU 88  OE1 
127 1 Y 1 B GLU 80  ? OE2 ? B GLU 88  OE2 
128 1 Y 1 B GLU 108 ? CG  ? B GLU 116 CG  
129 1 Y 1 B GLU 108 ? CD  ? B GLU 116 CD  
130 1 Y 1 B GLU 108 ? OE1 ? B GLU 116 OE1 
131 1 Y 1 B GLU 108 ? OE2 ? B GLU 116 OE2 
132 1 Y 1 B GLU 119 ? CG  ? B GLU 127 CG  
133 1 Y 1 B GLU 119 ? CD  ? B GLU 127 CD  
134 1 Y 1 B GLU 119 ? OE1 ? B GLU 127 OE1 
135 1 Y 1 B GLU 119 ? OE2 ? B GLU 127 OE2 
136 1 Y 1 B TYR 122 ? CG  ? B TYR 130 CG  
137 1 Y 1 B TYR 122 ? CD1 ? B TYR 130 CD1 
138 1 Y 1 B TYR 122 ? CD2 ? B TYR 130 CD2 
139 1 Y 1 B TYR 122 ? CE1 ? B TYR 130 CE1 
140 1 Y 1 B TYR 122 ? CE2 ? B TYR 130 CE2 
141 1 Y 1 B TYR 122 ? CZ  ? B TYR 130 CZ  
142 1 Y 1 B TYR 122 ? OH  ? B TYR 130 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -7  ? A GLY 1   
2  1 Y 1 A SER -6  ? A SER 2   
3  1 Y 1 A VAL -5  ? A VAL 3   
4  1 Y 1 A ARG -4  ? A ARG 4   
5  1 Y 1 A PRO -3  ? A PRO 5   
6  1 Y 1 A GLN -2  ? A GLN 6   
7  1 Y 1 A GLN -1  ? A GLN 7   
8  1 Y 1 A TYR 122 ? A TYR 130 
9  1 Y 1 A GLY 123 ? A GLY 131 
10 1 Y 1 A LYS 124 ? A LYS 132 
11 1 Y 1 B GLY -7  ? B GLY 1   
12 1 Y 1 B SER -6  ? B SER 2   
13 1 Y 1 B VAL -5  ? B VAL 3   
14 1 Y 1 B ARG -4  ? B ARG 4   
15 1 Y 1 B PRO -3  ? B PRO 5   
16 1 Y 1 B GLN -2  ? B GLN 6   
17 1 Y 1 B GLN -1  ? B GLN 7   
18 1 Y 1 B GLU 0   ? B GLU 8   
19 1 Y 1 B LYS 124 ? B LYS 132 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        '(4S)-2-METHYL-2,4-PENTANEDIOL' 
_pdbx_entity_nonpoly.comp_id     MPD 
#