data_5DQE
# 
_entry.id   5DQE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DQE         
WWPDB D_1000213664 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '5DQ8 contains the same protein complexed with flufenamic acid' 5DQ8 unspecified 
PDB '3L15 contains the same protein without bound inhibitor'        3L15 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DQE 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Han, X.' 1 
'Luo, X.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            23 
_citation.language                  ? 
_citation.page_first                2076 
_citation.page_last                 2086 
_citation.title                     
'Targeting the Central Pocket in Human Transcription Factor TEAD as a Potential Cancer Therapeutic Strategy.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2015.09.009 
_citation.pdbx_database_id_PubMed   26592798 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pobbati, A.V.' 1  ? 
primary 'Han, X.'       2  ? 
primary 'Hung, A.W.'    3  ? 
primary 'Weiguang, S.'  4  ? 
primary 'Huda, N.'      5  ? 
primary 'Chen, G.Y.'    6  ? 
primary 'Kang, C.'      7  ? 
primary 'Chia, C.S.'    8  ? 
primary 'Luo, X.'       9  ? 
primary 'Hong, W.'      10 ? 
primary 'Poulsen, A.'   11 ? 
# 
_cell.entry_id           5DQE 
_cell.length_a           121.470 
_cell.length_b           61.582 
_cell.length_c           80.419 
_cell.angle_alpha        90.00 
_cell.angle_beta         117.70 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5DQE 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcriptional enhancer factor TEF-4' 27489.096 2   ? ? 'residues 217-447' ? 
2 non-polymer syn '2-[(3-bromophenyl)amino]benzoic acid'  292.128   3   ? ? ?                  ? 
3 water       nat water                                   18.015    107 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TEA domain family member 2,TEAD-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPH
AFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLL
RSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRDVEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPH
AFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLL
RSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRDVEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   TRP n 
1 4   GLN n 
1 5   ALA n 
1 6   ARG n 
1 7   GLY n 
1 8   LEU n 
1 9   GLY n 
1 10  THR n 
1 11  ALA n 
1 12  ARG n 
1 13  LEU n 
1 14  GLN n 
1 15  LEU n 
1 16  VAL n 
1 17  GLU n 
1 18  PHE n 
1 19  SER n 
1 20  ALA n 
1 21  PHE n 
1 22  VAL n 
1 23  GLU n 
1 24  PRO n 
1 25  PRO n 
1 26  ASP n 
1 27  ALA n 
1 28  VAL n 
1 29  ASP n 
1 30  SER n 
1 31  TYR n 
1 32  GLN n 
1 33  ARG n 
1 34  HIS n 
1 35  LEU n 
1 36  PHE n 
1 37  VAL n 
1 38  HIS n 
1 39  ILE n 
1 40  SER n 
1 41  GLN n 
1 42  HIS n 
1 43  CYS n 
1 44  PRO n 
1 45  SER n 
1 46  PRO n 
1 47  GLY n 
1 48  ALA n 
1 49  PRO n 
1 50  PRO n 
1 51  LEU n 
1 52  GLU n 
1 53  SER n 
1 54  VAL n 
1 55  ASP n 
1 56  VAL n 
1 57  ARG n 
1 58  GLN n 
1 59  ILE n 
1 60  TYR n 
1 61  ASP n 
1 62  LYS n 
1 63  PHE n 
1 64  PRO n 
1 65  GLU n 
1 66  LYS n 
1 67  LYS n 
1 68  GLY n 
1 69  GLY n 
1 70  LEU n 
1 71  ARG n 
1 72  GLU n 
1 73  LEU n 
1 74  TYR n 
1 75  ASP n 
1 76  ARG n 
1 77  GLY n 
1 78  PRO n 
1 79  PRO n 
1 80  HIS n 
1 81  ALA n 
1 82  PHE n 
1 83  PHE n 
1 84  LEU n 
1 85  VAL n 
1 86  LYS n 
1 87  PHE n 
1 88  TRP n 
1 89  ALA n 
1 90  ASP n 
1 91  LEU n 
1 92  ASN n 
1 93  TRP n 
1 94  GLY n 
1 95  PRO n 
1 96  SER n 
1 97  GLY n 
1 98  GLU n 
1 99  GLU n 
1 100 ALA n 
1 101 GLY n 
1 102 ALA n 
1 103 GLY n 
1 104 GLY n 
1 105 SER n 
1 106 ILE n 
1 107 SER n 
1 108 SER n 
1 109 GLY n 
1 110 GLY n 
1 111 PHE n 
1 112 TYR n 
1 113 GLY n 
1 114 VAL n 
1 115 SER n 
1 116 SER n 
1 117 GLN n 
1 118 TYR n 
1 119 GLU n 
1 120 SER n 
1 121 LEU n 
1 122 GLU n 
1 123 HIS n 
1 124 MET n 
1 125 THR n 
1 126 LEU n 
1 127 THR n 
1 128 CYS n 
1 129 SER n 
1 130 SER n 
1 131 LYS n 
1 132 VAL n 
1 133 CYS n 
1 134 SER n 
1 135 PHE n 
1 136 GLY n 
1 137 LYS n 
1 138 GLN n 
1 139 VAL n 
1 140 VAL n 
1 141 GLU n 
1 142 LYS n 
1 143 VAL n 
1 144 GLU n 
1 145 THR n 
1 146 GLU n 
1 147 ARG n 
1 148 ALA n 
1 149 GLN n 
1 150 LEU n 
1 151 GLU n 
1 152 ASP n 
1 153 GLY n 
1 154 ARG n 
1 155 PHE n 
1 156 VAL n 
1 157 TYR n 
1 158 ARG n 
1 159 LEU n 
1 160 LEU n 
1 161 ARG n 
1 162 SER n 
1 163 PRO n 
1 164 MET n 
1 165 CYS n 
1 166 GLU n 
1 167 TYR n 
1 168 LEU n 
1 169 VAL n 
1 170 ASN n 
1 171 PHE n 
1 172 LEU n 
1 173 HIS n 
1 174 LYS n 
1 175 LEU n 
1 176 ARG n 
1 177 GLN n 
1 178 LEU n 
1 179 PRO n 
1 180 GLU n 
1 181 ARG n 
1 182 TYR n 
1 183 MET n 
1 184 MET n 
1 185 ASN n 
1 186 SER n 
1 187 VAL n 
1 188 LEU n 
1 189 GLU n 
1 190 ASN n 
1 191 PHE n 
1 192 THR n 
1 193 ILE n 
1 194 LEU n 
1 195 GLN n 
1 196 VAL n 
1 197 VAL n 
1 198 THR n 
1 199 ASN n 
1 200 ARG n 
1 201 ASP n 
1 202 THR n 
1 203 GLN n 
1 204 GLU n 
1 205 LEU n 
1 206 LEU n 
1 207 LEU n 
1 208 CYS n 
1 209 THR n 
1 210 ALA n 
1 211 TYR n 
1 212 VAL n 
1 213 PHE n 
1 214 GLU n 
1 215 VAL n 
1 216 SER n 
1 217 THR n 
1 218 SER n 
1 219 GLU n 
1 220 ARG n 
1 221 GLY n 
1 222 ALA n 
1 223 GLN n 
1 224 HIS n 
1 225 HIS n 
1 226 ILE n 
1 227 TYR n 
1 228 ARG n 
1 229 LEU n 
1 230 VAL n 
1 231 ARG n 
1 232 ASP n 
1 233 VAL n 
1 234 GLU n 
1 235 HIS n 
1 236 HIS n 
1 237 HIS n 
1 238 HIS n 
1 239 HIS n 
1 240 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   240 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TEAD2, TEF4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET29 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TEAD2_HUMAN 
_struct_ref.pdbx_db_accession          Q15562 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHA
FFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLR
SPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRD
;
_struct_ref.pdbx_align_begin           217 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DQE A 2 ? 232 ? Q15562 217 ? 447 ? 217 447 
2 1 5DQE B 2 ? 232 ? Q15562 217 ? 447 ? 217 447 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DQE MET A 1   ? UNP Q15562 ? ? 'initiating methionine' 216 1  
1 5DQE VAL A 233 ? UNP Q15562 ? ? 'expression tag'        448 2  
1 5DQE GLU A 234 ? UNP Q15562 ? ? 'expression tag'        449 3  
1 5DQE HIS A 235 ? UNP Q15562 ? ? 'expression tag'        450 4  
1 5DQE HIS A 236 ? UNP Q15562 ? ? 'expression tag'        451 5  
1 5DQE HIS A 237 ? UNP Q15562 ? ? 'expression tag'        452 6  
1 5DQE HIS A 238 ? UNP Q15562 ? ? 'expression tag'        453 7  
1 5DQE HIS A 239 ? UNP Q15562 ? ? 'expression tag'        454 8  
1 5DQE HIS A 240 ? UNP Q15562 ? ? 'expression tag'        455 9  
2 5DQE MET B 1   ? UNP Q15562 ? ? 'initiating methionine' 216 10 
2 5DQE VAL B 233 ? UNP Q15562 ? ? 'expression tag'        448 11 
2 5DQE GLU B 234 ? UNP Q15562 ? ? 'expression tag'        449 12 
2 5DQE HIS B 235 ? UNP Q15562 ? ? 'expression tag'        450 13 
2 5DQE HIS B 236 ? UNP Q15562 ? ? 'expression tag'        451 14 
2 5DQE HIS B 237 ? UNP Q15562 ? ? 'expression tag'        452 15 
2 5DQE HIS B 238 ? UNP Q15562 ? ? 'expression tag'        453 16 
2 5DQE HIS B 239 ? UNP Q15562 ? ? 'expression tag'        454 17 
2 5DQE HIS B 240 ? UNP Q15562 ? ? 'expression tag'        455 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5E4 non-polymer         . '2-[(3-bromophenyl)amino]benzoic acid' ? 'C13 H10 Br N O2' 292.128 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DQE 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.42 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.21 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES pH 7.2 and 2.4 M sodium formate.' 
_exptl_crystal_grow.pdbx_pH_range   7.0-7.4 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91925 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.91925 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DQE 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.18 
_reflns.d_resolution_low                 40 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24263 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            24.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.18 
_reflns_shell.d_res_low                   2.22 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.14 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        86.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5DQE 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     24260 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.49 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.669 
_refine.ls_d_res_high                            2.183 
_refine.ls_percent_reflns_obs                    88.10 
_refine.ls_R_factor_obs                          0.1812 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1789 
_refine.ls_R_factor_R_free                       0.2274 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1213 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3L15 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 23.98 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3301 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         51 
_refine_hist.number_atoms_solvent             107 
_refine_hist.number_atoms_total               3459 
_refine_hist.d_res_high                       2.183 
_refine_hist.d_res_low                        38.669 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.015  ? ? 3434 'X-RAY DIFFRACTION' ? 
f_angle_d          1.498  ? ? 4633 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.104 ? ? 1275 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.061  ? ? 493  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 594  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.1826 2.2700  1586 0.2119 55.00  0.2680 . . 83  . . . . 
'X-RAY DIFFRACTION' . 2.2700 2.3733  1966 0.2006 68.00  0.2638 . . 104 . . . . 
'X-RAY DIFFRACTION' . 2.3733 2.4984  2261 0.2068 79.00  0.2687 . . 119 . . . . 
'X-RAY DIFFRACTION' . 2.4984 2.6549  2634 0.2081 91.00  0.2598 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.6549 2.8598  2885 0.2050 100.00 0.2735 . . 152 . . . . 
'X-RAY DIFFRACTION' . 2.8598 3.1475  2907 0.1980 100.00 0.2841 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.1475 3.6027  2922 0.1656 100.00 0.2084 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.6027 4.5379  2923 0.1438 100.00 0.1828 . . 155 . . . . 
'X-RAY DIFFRACTION' . 4.5379 38.6755 2963 0.1827 99.00  0.2132 . . 155 . . . . 
# 
_struct.entry_id                     5DQE 
_struct.title                        'Crystal structure of human transcription factor TEAD2 in complex with bromo-fenamic acid' 
_struct.pdbx_descriptor              'Transcriptional enhancer factor TEF-4' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DQE 
_struct_keywords.text            'flufenamates, Hippo pathway, cancer therapy, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 57  ? PHE A 63  ? ARG A 272 PHE A 278 5 ? 7  
HELX_P HELX_P2  AA2 GLY A 69  ? GLY A 77  ? GLY A 284 GLY A 292 1 ? 9  
HELX_P HELX_P3  AA3 PRO A 78  ? HIS A 80  ? PRO A 293 HIS A 295 5 ? 3  
HELX_P HELX_P4  AA4 CYS A 165 ? LEU A 178 ? CYS A 380 LEU A 393 1 ? 14 
HELX_P HELX_P5  AA5 GLU A 180 ? GLU A 189 ? GLU A 395 GLU A 404 1 ? 10 
HELX_P HELX_P6  AA6 PRO B 24  ? ASP B 29  ? PRO B 239 ASP B 244 5 ? 6  
HELX_P HELX_P7  AA7 ARG B 57  ? PHE B 63  ? ARG B 272 PHE B 278 5 ? 7  
HELX_P HELX_P8  AA8 GLY B 69  ? GLY B 77  ? GLY B 284 GLY B 292 1 ? 9  
HELX_P HELX_P9  AA9 PRO B 78  ? HIS B 80  ? PRO B 293 HIS B 295 5 ? 3  
HELX_P HELX_P10 AB1 CYS B 165 ? LEU B 178 ? CYS B 380 LEU B 393 1 ? 14 
HELX_P HELX_P11 AB2 GLU B 180 ? GLU B 189 ? GLU B 395 GLU B 404 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 66 A . ? LYS 281 A LYS 67 A ? LYS 282 A 1 1.00  
2 GLY 77 A . ? GLY 292 A PRO 78 A ? PRO 293 A 1 3.69  
3 GLU 65 B . ? GLU 280 B LYS 66 B ? LYS 281 B 1 -3.21 
4 GLY 77 B . ? GLY 292 B PRO 78 B ? PRO 293 B 1 5.00  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5  ? 
AA2 ? 14 ? 
AA3 ? 5  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA2 1  2  ? parallel      
AA2 2  3  ? anti-parallel 
AA2 3  4  ? parallel      
AA2 4  5  ? anti-parallel 
AA2 5  6  ? anti-parallel 
AA2 6  7  ? anti-parallel 
AA2 7  8  ? parallel      
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA2 11 12 ? parallel      
AA2 12 13 ? anti-parallel 
AA2 13 14 ? parallel      
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? anti-parallel 
AA3 4  5  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  HIS A 34  ? SER A 40  ? HIS A 249 SER A 255 
AA1 2  GLN A 14  ? GLU A 23  ? GLN A 229 GLU A 238 
AA1 3  PHE A 111 ? SER A 120 ? PHE A 326 SER A 335 
AA1 4  ARG A 154 ? PRO A 163 ? ARG A 369 PRO A 378 
AA1 5  GLN A 149 ? GLU A 151 ? GLN A 364 GLU A 366 
AA2 1  SER A 53  ? ASP A 55  ? SER A 268 ASP A 270 
AA2 2  GLN A 223 ? VAL A 230 ? GLN A 438 VAL A 445 
AA2 3  PHE A 82  ? ALA A 89  ? PHE A 297 ALA A 304 
AA2 4  LEU A 205 ? VAL A 215 ? LEU A 420 VAL A 430 
AA2 5  PHE A 191 ? ASN A 199 ? PHE A 406 ASN A 414 
AA2 6  THR A 125 ? SER A 134 ? THR A 340 SER A 349 
AA2 7  LYS A 137 ? ARG A 147 ? LYS A 352 ARG A 362 
AA2 8  LYS B 137 ? ARG B 147 ? LYS B 352 ARG B 362 
AA2 9  THR B 125 ? SER B 134 ? THR B 340 SER B 349 
AA2 10 PHE B 191 ? ASN B 199 ? PHE B 406 ASN B 414 
AA2 11 LEU B 205 ? VAL B 215 ? LEU B 420 VAL B 430 
AA2 12 PHE B 82  ? ALA B 89  ? PHE B 297 ALA B 304 
AA2 13 GLN B 223 ? VAL B 230 ? GLN B 438 VAL B 445 
AA2 14 SER B 53  ? ASP B 55  ? SER B 268 ASP B 270 
AA3 1  HIS B 34  ? SER B 40  ? HIS B 249 SER B 255 
AA3 2  GLN B 14  ? GLU B 23  ? GLN B 229 GLU B 238 
AA3 3  PHE B 111 ? SER B 120 ? PHE B 326 SER B 335 
AA3 4  ARG B 154 ? PRO B 163 ? ARG B 369 PRO B 378 
AA3 5  GLN B 149 ? GLU B 151 ? GLN B 364 GLU B 366 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O ILE A 39  ? O ILE A 254 N PHE A 18  ? N PHE A 233 
AA1 2  3  N VAL A 16  ? N VAL A 231 O GLN A 117 ? O GLN A 332 
AA1 3  4  N SER A 120 ? N SER A 335 O PHE A 155 ? O PHE A 370 
AA1 4  5  O VAL A 156 ? O VAL A 371 N GLN A 149 ? N GLN A 364 
AA2 1  2  N VAL A 54  ? N VAL A 269 O VAL A 230 ? O VAL A 445 
AA2 2  3  O GLN A 223 ? O GLN A 438 N TRP A 88  ? N TRP A 303 
AA2 3  4  N ALA A 89  ? N ALA A 304 O GLU A 214 ? O GLU A 429 
AA2 4  5  O LEU A 207 ? O LEU A 422 N VAL A 197 ? N VAL A 412 
AA2 5  6  O THR A 192 ? O THR A 407 N CYS A 133 ? N CYS A 348 
AA2 6  7  N SER A 134 ? N SER A 349 O LYS A 137 ? O LYS A 352 
AA2 7  8  N GLU A 141 ? N GLU A 356 O VAL B 143 ? O VAL B 358 
AA2 8  9  O GLU B 144 ? O GLU B 359 N CYS B 128 ? N CYS B 343 
AA2 9  10 N CYS B 133 ? N CYS B 348 O THR B 192 ? O THR B 407 
AA2 10 11 N ILE B 193 ? N ILE B 408 O TYR B 211 ? O TYR B 426 
AA2 11 12 O ALA B 210 ? O ALA B 425 N VAL B 85  ? N VAL B 300 
AA2 12 13 N TRP B 88  ? N TRP B 303 O GLN B 223 ? O GLN B 438 
AA2 13 14 O VAL B 230 ? O VAL B 445 N VAL B 54  ? N VAL B 269 
AA3 1  2  O ILE B 39  ? O ILE B 254 N PHE B 18  ? N PHE B 233 
AA3 2  3  N VAL B 16  ? N VAL B 231 O GLN B 117 ? O GLN B 332 
AA3 3  4  N SER B 120 ? N SER B 335 O PHE B 155 ? O PHE B 370 
AA3 4  5  O VAL B 156 ? O VAL B 371 N GLN B 149 ? N GLN B 364 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 5E4 501 ? 10 'binding site for residue 5E4 A 501' 
AC2 Software B 5E4 501 ? 8  'binding site for residue 5E4 B 501' 
AC3 Software B 5E4 502 ? 6  'binding site for residue 5E4 B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 PHE A 18  ? PHE A 233 . ? 1_555 ? 
2  AC1 10 ALA A 20  ? ALA A 235 . ? 1_555 ? 
3  AC1 10 VAL A 114 ? VAL A 329 . ? 1_555 ? 
4  AC1 10 SER A 130 ? SER A 345 . ? 1_555 ? 
5  AC1 10 VAL A 132 ? VAL A 347 . ? 1_555 ? 
6  AC1 10 LYS A 142 ? LYS A 357 . ? 1_555 ? 
7  AC1 10 MET A 164 ? MET A 379 . ? 1_555 ? 
8  AC1 10 CYS A 165 ? CYS A 380 . ? 1_555 ? 
9  AC1 10 LEU A 168 ? LEU A 383 . ? 1_555 ? 
10 AC1 10 TYR A 211 ? TYR A 426 . ? 1_555 ? 
11 AC2 8  PHE B 18  ? PHE B 233 . ? 1_555 ? 
12 AC2 8  SER B 130 ? SER B 345 . ? 1_555 ? 
13 AC2 8  VAL B 132 ? VAL B 347 . ? 1_555 ? 
14 AC2 8  LYS B 142 ? LYS B 357 . ? 1_555 ? 
15 AC2 8  MET B 164 ? MET B 379 . ? 1_555 ? 
16 AC2 8  CYS B 165 ? CYS B 380 . ? 1_555 ? 
17 AC2 8  LEU B 168 ? LEU B 383 . ? 1_555 ? 
18 AC2 8  TYR B 211 ? TYR B 426 . ? 1_555 ? 
19 AC3 6  LYS B 62  ? LYS B 277 . ? 1_555 ? 
20 AC3 6  LYS B 86  ? LYS B 301 . ? 1_555 ? 
21 AC3 6  TRP B 88  ? TRP B 303 . ? 1_555 ? 
22 AC3 6  GLU B 189 ? GLU B 404 . ? 1_555 ? 
23 AC3 6  VAL B 212 ? VAL B 427 . ? 1_555 ? 
24 AC3 6  GLU B 214 ? GLU B 429 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DQE 
_atom_sites.fract_transf_matrix[1][1]   0.008232 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004321 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016239 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014044 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . GLY A 1 7   ? 33.167 60.727 -9.818  1.00 73.73  ? 222 GLY A N    1 
ATOM   2    C  CA   . GLY A 1 7   ? 33.736 59.651 -9.014  1.00 78.00  ? 222 GLY A CA   1 
ATOM   3    C  C    . GLY A 1 7   ? 33.489 58.271 -9.595  1.00 69.42  ? 222 GLY A C    1 
ATOM   4    O  O    . GLY A 1 7   ? 32.435 58.016 -10.166 1.00 67.31  ? 222 GLY A O    1 
ATOM   5    H  HA2  . GLY A 1 7   ? 34.694 59.781 -8.938  1.00 93.60  ? 222 GLY A HA2  1 
ATOM   6    H  HA3  . GLY A 1 7   ? 33.353 59.679 -8.124  1.00 93.60  ? 222 GLY A HA3  1 
ATOM   7    N  N    . LEU A 1 8   ? 34.460 57.374 -9.461  1.00 51.24  ? 223 LEU A N    1 
ATOM   8    C  CA   . LEU A 1 8   ? 34.250 55.986 -9.844  1.00 48.20  ? 223 LEU A CA   1 
ATOM   9    C  C    . LEU A 1 8   ? 33.656 55.169 -8.691  1.00 44.21  ? 223 LEU A C    1 
ATOM   10   O  O    . LEU A 1 8   ? 34.374 54.648 -7.837  1.00 41.93  ? 223 LEU A O    1 
ATOM   11   C  CB   . LEU A 1 8   ? 35.561 55.364 -10.295 1.00 49.32  ? 223 LEU A CB   1 
ATOM   12   C  CG   . LEU A 1 8   ? 35.397 54.354 -11.422 1.00 51.56  ? 223 LEU A CG   1 
ATOM   13   C  CD1  . LEU A 1 8   ? 36.768 53.960 -11.950 1.00 51.82  ? 223 LEU A CD1  1 
ATOM   14   C  CD2  . LEU A 1 8   ? 34.610 53.165 -10.950 1.00 55.91  ? 223 LEU A CD2  1 
ATOM   15   H  H    . LEU A 1 8   ? 35.245 57.543 -9.152  1.00 61.49  ? 223 LEU A H    1 
ATOM   16   H  HA   . LEU A 1 8   ? 33.629 55.953 -10.588 1.00 57.85  ? 223 LEU A HA   1 
ATOM   17   H  HB2  . LEU A 1 8   ? 36.150 56.068 -10.609 1.00 59.18  ? 223 LEU A HB2  1 
ATOM   18   H  HB3  . LEU A 1 8   ? 35.966 54.907 -9.542  1.00 59.18  ? 223 LEU A HB3  1 
ATOM   19   H  HG   . LEU A 1 8   ? 34.905 54.769 -12.148 1.00 61.88  ? 223 LEU A HG   1 
ATOM   20   H  HD11 . LEU A 1 8   ? 36.656 53.316 -12.667 1.00 62.19  ? 223 LEU A HD11 1 
ATOM   21   H  HD12 . LEU A 1 8   ? 37.217 54.752 -12.283 1.00 62.19  ? 223 LEU A HD12 1 
ATOM   22   H  HD13 . LEU A 1 8   ? 37.282 53.565 -11.228 1.00 62.19  ? 223 LEU A HD13 1 
ATOM   23   H  HD21 . LEU A 1 8   ? 34.518 52.536 -11.682 1.00 67.09  ? 223 LEU A HD21 1 
ATOM   24   H  HD22 . LEU A 1 8   ? 35.081 52.747 -10.212 1.00 67.09  ? 223 LEU A HD22 1 
ATOM   25   H  HD23 . LEU A 1 8   ? 33.734 53.462 -10.657 1.00 67.09  ? 223 LEU A HD23 1 
ATOM   26   N  N    . GLY A 1 9   ? 32.338 55.033 -8.661  1.00 43.42  ? 224 GLY A N    1 
ATOM   27   C  CA   . GLY A 1 9   ? 31.734 54.292 -7.580  1.00 47.97  ? 224 GLY A CA   1 
ATOM   28   C  C    . GLY A 1 9   ? 30.227 54.377 -7.521  1.00 50.10  ? 224 GLY A C    1 
ATOM   29   O  O    . GLY A 1 9   ? 29.585 54.924 -8.406  1.00 54.40  ? 224 GLY A O    1 
ATOM   30   H  H    . GLY A 1 9   ? 31.789 55.352 -9.241  1.00 52.11  ? 224 GLY A H    1 
ATOM   31   H  HA2  . GLY A 1 9   ? 31.978 53.357 -7.663  1.00 57.56  ? 224 GLY A HA2  1 
ATOM   32   H  HA3  . GLY A 1 9   ? 32.085 54.621 -6.737  1.00 57.56  ? 224 GLY A HA3  1 
ATOM   33   N  N    . THR A 1 10  ? 29.673 53.815 -6.458  1.00 48.50  ? 225 THR A N    1 
ATOM   34   C  CA   . THR A 1 10  ? 28.237 53.794 -6.239  1.00 64.12  ? 225 THR A CA   1 
ATOM   35   C  C    . THR A 1 10  ? 27.988 53.987 -4.740  1.00 60.57  ? 225 THR A C    1 
ATOM   36   O  O    . THR A 1 10  ? 28.928 54.222 -3.978  1.00 46.15  ? 225 THR A O    1 
ATOM   37   C  CB   . THR A 1 10  ? 27.609 52.480 -6.735  1.00 45.48  ? 225 THR A CB   1 
ATOM   38   O  OG1  . THR A 1 10  ? 27.957 51.409 -5.841  1.00 43.73  ? 225 THR A OG1  1 
ATOM   39   C  CG2  . THR A 1 10  ? 28.123 52.147 -8.115  1.00 46.73  ? 225 THR A CG2  1 
ATOM   40   H  H    . THR A 1 10  ? 30.120 53.429 -5.834  1.00 58.20  ? 225 THR A H    1 
ATOM   41   H  HA   . THR A 1 10  ? 27.826 54.531 -6.717  1.00 76.95  ? 225 THR A HA   1 
ATOM   42   H  HB   . THR A 1 10  ? 26.645 52.572 -6.776  1.00 54.57  ? 225 THR A HB   1 
ATOM   43   H  HG1  . THR A 1 10  ? 27.616 50.689 -6.109  1.00 52.48  ? 225 THR A HG1  1 
ATOM   44   H  HG21 . THR A 1 10  ? 27.725 51.318 -8.425  1.00 56.08  ? 225 THR A HG21 1 
ATOM   45   H  HG22 . THR A 1 10  ? 27.893 52.857 -8.734  1.00 56.08  ? 225 THR A HG22 1 
ATOM   46   H  HG23 . THR A 1 10  ? 29.087 52.046 -8.094  1.00 56.08  ? 225 THR A HG23 1 
ATOM   47   N  N    . ALA A 1 11  ? 26.738 53.897 -4.310  1.00 59.06  ? 226 ALA A N    1 
ATOM   48   C  CA   . ALA A 1 11  ? 26.439 54.072 -2.897  1.00 59.87  ? 226 ALA A CA   1 
ATOM   49   C  C    . ALA A 1 11  ? 27.132 52.981 -2.105  1.00 48.54  ? 226 ALA A C    1 
ATOM   50   O  O    . ALA A 1 11  ? 27.673 53.235 -1.030  1.00 53.78  ? 226 ALA A O    1 
ATOM   51   C  CB   . ALA A 1 11  ? 24.977 54.037 -2.662  1.00 64.92  ? 226 ALA A CB   1 
ATOM   52   H  H    . ALA A 1 11  ? 26.054 53.737 -4.806  1.00 70.87  ? 226 ALA A H    1 
ATOM   53   H  HA   . ALA A 1 11  ? 26.778 54.931 -2.599  1.00 71.84  ? 226 ALA A HA   1 
ATOM   54   H  HB1  . ALA A 1 11  ? 24.806 54.156 -1.715  1.00 77.90  ? 226 ALA A HB1  1 
ATOM   55   H  HB2  . ALA A 1 11  ? 24.559 54.752 -3.167  1.00 77.90  ? 226 ALA A HB2  1 
ATOM   56   H  HB3  . ALA A 1 11  ? 24.631 53.179 -2.956  1.00 77.90  ? 226 ALA A HB3  1 
ATOM   57   N  N    . ARG A 1 12  ? 27.148 51.780 -2.679  1.00 44.99  ? 227 ARG A N    1 
ATOM   58   C  CA   . ARG A 1 12  ? 27.643 50.607 -2.016  1.00 43.34  ? 227 ARG A CA   1 
ATOM   59   C  C    . ARG A 1 12  ? 29.150 50.445 -1.991  1.00 40.45  ? 227 ARG A C    1 
ATOM   60   O  O    . ARG A 1 12  ? 29.667 49.889 -1.036  1.00 39.84  ? 227 ARG A O    1 
ATOM   61   C  CB   . ARG A 1 12  ? 27.043 49.376 -2.671  1.00 43.30  ? 227 ARG A CB   1 
ATOM   62   C  CG   . ARG A 1 12  ? 25.555 49.289 -2.495  1.00 49.30  ? 227 ARG A CG   1 
ATOM   63   C  CD   . ARG A 1 12  ? 25.041 47.954 -2.950  1.00 51.11  ? 227 ARG A CD   1 
ATOM   64   N  NE   . ARG A 1 12  ? 25.384 46.905 -2.008  1.00 46.17  ? 227 ARG A NE   1 
ATOM   65   C  CZ   . ARG A 1 12  ? 24.932 45.662 -2.098  1.00 51.70  ? 227 ARG A CZ   1 
ATOM   66   N  NH1  . ARG A 1 12  ? 24.107 45.324 -3.088  1.00 64.51  ? 227 ARG A NH1  1 
ATOM   67   N  NH2  . ARG A 1 12  ? 25.290 44.763 -1.190  1.00 52.33  ? 227 ARG A NH2  1 
ATOM   68   H  H    . ARG A 1 12  ? 26.865 51.629 -3.477  1.00 53.99  ? 227 ARG A H    1 
ATOM   69   H  HA   . ARG A 1 12  ? 27.339 50.625 -1.095  1.00 52.00  ? 227 ARG A HA   1 
ATOM   70   H  HB2  . ARG A 1 12  ? 27.231 49.401 -3.623  1.00 51.96  ? 227 ARG A HB2  1 
ATOM   71   H  HB3  . ARG A 1 12  ? 27.438 48.583 -2.276  1.00 51.96  ? 227 ARG A HB3  1 
ATOM   72   H  HG2  . ARG A 1 12  ? 25.335 49.398 -1.557  1.00 59.16  ? 227 ARG A HG2  1 
ATOM   73   H  HG3  . ARG A 1 12  ? 25.127 49.979 -3.025  1.00 59.16  ? 227 ARG A HG3  1 
ATOM   74   H  HD2  . ARG A 1 12  ? 24.075 47.992 -3.025  1.00 61.33  ? 227 ARG A HD2  1 
ATOM   75   H  HD3  . ARG A 1 12  ? 25.436 47.734 -3.808  1.00 61.33  ? 227 ARG A HD3  1 
ATOM   76   H  HE   . ARG A 1 12  ? 25.811 47.127 -1.296  1.00 55.41  ? 227 ARG A HE   1 
ATOM   77   H  HH11 . ARG A 1 12  ? 23.874 45.910 -3.673  1.00 77.42  ? 227 ARG A HH11 1 
ATOM   78   H  HH12 . ARG A 1 12  ? 23.812 44.519 -3.146  1.00 77.42  ? 227 ARG A HH12 1 
ATOM   79   H  HH21 . ARG A 1 12  ? 25.822 44.985 -0.552  1.00 62.80  ? 227 ARG A HH21 1 
ATOM   80   H  HH22 . ARG A 1 12  ? 24.997 43.957 -1.245  1.00 62.80  ? 227 ARG A HH22 1 
ATOM   81   N  N    . LEU A 1 13  ? 29.848 50.831 -3.069  1.00 38.97  ? 228 LEU A N    1 
ATOM   82   C  CA   . LEU A 1 13  ? 31.297 50.620 -3.172  1.00 36.49  ? 228 LEU A CA   1 
ATOM   83   C  C    . LEU A 1 13  ? 31.945 51.738 -3.978  1.00 36.21  ? 228 LEU A C    1 
ATOM   84   O  O    . LEU A 1 13  ? 31.487 52.039 -5.051  1.00 36.81  ? 228 LEU A O    1 
ATOM   85   C  CB   . LEU A 1 13  ? 31.582 49.258 -3.807  1.00 34.84  ? 228 LEU A CB   1 
ATOM   86   C  CG   . LEU A 1 13  ? 33.043 48.801 -3.798  1.00 32.65  ? 228 LEU A CG   1 
ATOM   87   C  CD1  . LEU A 1 13  ? 33.486 48.392 -2.405  1.00 32.66  ? 228 LEU A CD1  1 
ATOM   88   C  CD2  . LEU A 1 13  ? 33.278 47.657 -4.764  1.00 31.50  ? 228 LEU A CD2  1 
ATOM   89   H  H    . LEU A 1 13  ? 29.502 51.217 -3.756  1.00 46.76  ? 228 LEU A H    1 
ATOM   90   H  HA   . LEU A 1 13  ? 31.683 50.626 -2.282  1.00 43.79  ? 228 LEU A HA   1 
ATOM   91   H  HB2  . LEU A 1 13  ? 31.067 48.587 -3.333  1.00 41.80  ? 228 LEU A HB2  1 
ATOM   92   H  HB3  . LEU A 1 13  ? 31.295 49.288 -4.733  1.00 41.80  ? 228 LEU A HB3  1 
ATOM   93   H  HG   . LEU A 1 13  ? 33.602 49.543 -4.078  1.00 39.18  ? 228 LEU A HG   1 
ATOM   94   H  HD11 . LEU A 1 13  ? 34.413 48.110 -2.440  1.00 39.20  ? 228 LEU A HD11 1 
ATOM   95   H  HD12 . LEU A 1 13  ? 33.392 49.152 -1.809  1.00 39.20  ? 228 LEU A HD12 1 
ATOM   96   H  HD13 . LEU A 1 13  ? 32.928 47.661 -2.099  1.00 39.20  ? 228 LEU A HD13 1 
ATOM   97   H  HD21 . LEU A 1 13  ? 34.212 47.399 -4.727  1.00 37.80  ? 228 LEU A HD21 1 
ATOM   98   H  HD22 . LEU A 1 13  ? 32.717 46.908 -4.508  1.00 37.80  ? 228 LEU A HD22 1 
ATOM   99   H  HD23 . LEU A 1 13  ? 33.051 47.950 -5.660  1.00 37.80  ? 228 LEU A HD23 1 
ATOM   100  N  N    . GLN A 1 14  ? 32.985 52.373 -3.447  1.00 35.75  ? 229 GLN A N    1 
ATOM   101  C  CA   . GLN A 1 14  ? 33.701 53.409 -4.168  1.00 35.77  ? 229 GLN A CA   1 
ATOM   102  C  C    . GLN A 1 14  ? 35.141 53.003 -4.387  1.00 35.59  ? 229 GLN A C    1 
ATOM   103  O  O    . GLN A 1 14  ? 35.773 52.439 -3.474  1.00 33.46  ? 229 GLN A O    1 
ATOM   104  C  CB   . GLN A 1 14  ? 33.703 54.757 -3.430  1.00 38.11  ? 229 GLN A CB   1 
ATOM   105  C  CG   . GLN A 1 14  ? 32.364 55.419 -3.204  1.00 52.38  ? 229 GLN A CG   1 
ATOM   106  C  CD   . GLN A 1 14  ? 31.803 55.122 -1.810  1.00 82.83  ? 229 GLN A CD   1 
ATOM   107  O  OE1  . GLN A 1 14  ? 32.278 55.678 -0.813  1.00 90.36  ? 229 GLN A OE1  1 
ATOM   108  N  NE2  . GLN A 1 14  ? 30.791 54.242 -1.735  1.00 87.70  ? 229 GLN A NE2  1 
ATOM   109  H  H    . GLN A 1 14  ? 33.297 52.217 -2.660  1.00 42.90  ? 229 GLN A H    1 
ATOM   110  H  HA   . GLN A 1 14  ? 33.286 53.538 -5.036  1.00 42.92  ? 229 GLN A HA   1 
ATOM   111  H  HB2  . GLN A 1 14  ? 34.106 54.622 -2.558  1.00 45.73  ? 229 GLN A HB2  1 
ATOM   112  H  HB3  . GLN A 1 14  ? 34.246 55.378 -3.940  1.00 45.73  ? 229 GLN A HB3  1 
ATOM   113  H  HG2  . GLN A 1 14  ? 32.466 56.380 -3.289  1.00 62.86  ? 229 GLN A HG2  1 
ATOM   114  H  HG3  . GLN A 1 14  ? 31.731 55.090 -3.861  1.00 62.86  ? 229 GLN A HG3  1 
ATOM   115  H  HE21 . GLN A 1 14  ? 30.487 53.873 -2.450  1.00 105.23 ? 229 GLN A HE21 1 
ATOM   116  H  HE22 . GLN A 1 14  ? 30.447 54.046 -0.971  1.00 105.23 ? 229 GLN A HE22 1 
ATOM   117  N  N    . LEU A 1 15  ? 35.661 53.306 -5.584  1.00 39.13  ? 230 LEU A N    1 
ATOM   118  C  CA   . LEU A 1 15  ? 37.083 53.175 -5.862  1.00 36.52  ? 230 LEU A CA   1 
ATOM   119  C  C    . LEU A 1 15  ? 37.806 54.320 -5.226  1.00 34.21  ? 230 LEU A C    1 
ATOM   120  O  O    . LEU A 1 15  ? 37.418 55.468 -5.406  1.00 37.96  ? 230 LEU A O    1 
ATOM   121  C  CB   . LEU A 1 15  ? 37.393 53.185 -7.361  1.00 47.96  ? 230 LEU A CB   1 
ATOM   122  C  CG   . LEU A 1 15  ? 38.898 53.132 -7.727  1.00 44.16  ? 230 LEU A CG   1 
ATOM   123  C  CD1  . LEU A 1 15  ? 39.487 51.790 -7.419  1.00 33.15  ? 230 LEU A CD1  1 
ATOM   124  C  CD2  . LEU A 1 15  ? 39.169 53.434 -9.209  1.00 46.02  ? 230 LEU A CD2  1 
ATOM   125  H  H    . LEU A 1 15  ? 35.201 53.591 -6.252  1.00 46.96  ? 230 LEU A H    1 
ATOM   126  H  HA   . LEU A 1 15  ? 37.416 52.347 -5.481  1.00 43.82  ? 230 LEU A HA   1 
ATOM   127  H  HB2  . LEU A 1 15  ? 36.967 52.414 -7.768  1.00 57.55  ? 230 LEU A HB2  1 
ATOM   128  H  HB3  . LEU A 1 15  ? 37.028 53.997 -7.745  1.00 57.55  ? 230 LEU A HB3  1 
ATOM   129  H  HG   . LEU A 1 15  ? 39.372 53.793 -7.198  1.00 52.99  ? 230 LEU A HG   1 
ATOM   130  H  HD11 . LEU A 1 15  ? 40.426 51.795 -7.661  1.00 39.78  ? 230 LEU A HD11 1 
ATOM   131  H  HD12 . LEU A 1 15  ? 39.389 51.613 -6.471  1.00 39.78  ? 230 LEU A HD12 1 
ATOM   132  H  HD13 . LEU A 1 15  ? 39.017 51.114 -7.933  1.00 39.78  ? 230 LEU A HD13 1 
ATOM   133  H  HD21 . LEU A 1 15  ? 40.124 53.386 -9.371  1.00 55.22  ? 230 LEU A HD21 1 
ATOM   134  H  HD22 . LEU A 1 15  ? 38.706 52.779 -9.754  1.00 55.22  ? 230 LEU A HD22 1 
ATOM   135  H  HD23 . LEU A 1 15  ? 38.842 54.325 -9.414  1.00 55.22  ? 230 LEU A HD23 1 
ATOM   136  N  N    . VAL A 1 16  ? 38.872 54.031 -4.497  1.00 38.20  ? 231 VAL A N    1 
ATOM   137  C  CA   . VAL A 1 16  ? 39.537 55.086 -3.743  1.00 43.32  ? 231 VAL A CA   1 
ATOM   138  C  C    . VAL A 1 16  ? 40.880 55.359 -4.372  1.00 45.63  ? 231 VAL A C    1 
ATOM   139  O  O    . VAL A 1 16  ? 41.268 56.512 -4.531  1.00 45.25  ? 231 VAL A O    1 
ATOM   140  C  CB   . VAL A 1 16  ? 39.649 54.715 -2.252  1.00 47.23  ? 231 VAL A CB   1 
ATOM   141  C  CG1  . VAL A 1 16  ? 40.821 55.412 -1.605  1.00 49.66  ? 231 VAL A CG1  1 
ATOM   142  C  CG2  . VAL A 1 16  ? 38.352 55.078 -1.552  1.00 59.91  ? 231 VAL A CG2  1 
ATOM   143  H  H    . VAL A 1 16  ? 39.225 53.250 -4.420  1.00 45.84  ? 231 VAL A H    1 
ATOM   144  H  HA   . VAL A 1 16  ? 39.009 55.897 -3.808  1.00 51.98  ? 231 VAL A HA   1 
ATOM   145  H  HB   . VAL A 1 16  ? 39.782 53.758 -2.170  1.00 56.68  ? 231 VAL A HB   1 
ATOM   146  H  HG11 . VAL A 1 16  ? 40.863 55.158 -0.670  1.00 59.60  ? 231 VAL A HG11 1 
ATOM   147  H  HG12 . VAL A 1 16  ? 41.636 55.145 -2.057  1.00 59.60  ? 231 VAL A HG12 1 
ATOM   148  H  HG13 . VAL A 1 16  ? 40.700 56.372 -1.682  1.00 59.60  ? 231 VAL A HG13 1 
ATOM   149  H  HG21 . VAL A 1 16  ? 38.424 54.843 -0.614  1.00 71.89  ? 231 VAL A HG21 1 
ATOM   150  H  HG22 . VAL A 1 16  ? 38.200 56.031 -1.645  1.00 71.89  ? 231 VAL A HG22 1 
ATOM   151  H  HG23 . VAL A 1 16  ? 37.625 54.584 -1.962  1.00 71.89  ? 231 VAL A HG23 1 
ATOM   152  N  N    . GLU A 1 17  ? 41.585 54.301 -4.754  1.00 40.09  ? 232 GLU A N    1 
ATOM   153  C  CA   . GLU A 1 17  ? 42.833 54.473 -5.472  1.00 40.47  ? 232 GLU A CA   1 
ATOM   154  C  C    . GLU A 1 17  ? 43.179 53.306 -6.365  1.00 38.76  ? 232 GLU A C    1 
ATOM   155  O  O    . GLU A 1 17  ? 43.027 52.165 -5.986  1.00 39.44  ? 232 GLU A O    1 
ATOM   156  C  CB   . GLU A 1 17  ? 43.981 54.688 -4.510  1.00 43.93  ? 232 GLU A CB   1 
ATOM   157  C  CG   . GLU A 1 17  ? 45.050 55.581 -5.128  1.00 65.04  ? 232 GLU A CG   1 
ATOM   158  C  CD   . GLU A 1 17  ? 46.131 55.975 -4.155  1.00 73.81  ? 232 GLU A CD   1 
ATOM   159  O  OE1  . GLU A 1 17  ? 46.166 55.404 -3.035  1.00 73.69  ? 232 GLU A OE1  1 
ATOM   160  O  OE2  . GLU A 1 17  ? 46.931 56.869 -4.514  1.00 71.63  ? 232 GLU A OE2  1 
ATOM   161  H  H    . GLU A 1 17  ? 41.363 53.483 -4.611  1.00 48.11  ? 232 GLU A H    1 
ATOM   162  H  HA   . GLU A 1 17  ? 42.764 55.262 -6.031  1.00 48.56  ? 232 GLU A HA   1 
ATOM   163  H  HB2  . GLU A 1 17  ? 43.651 55.118 -3.706  1.00 52.72  ? 232 GLU A HB2  1 
ATOM   164  H  HB3  . GLU A 1 17  ? 44.385 53.833 -4.294  1.00 52.72  ? 232 GLU A HB3  1 
ATOM   165  H  HG2  . GLU A 1 17  ? 45.469 55.108 -5.864  1.00 78.04  ? 232 GLU A HG2  1 
ATOM   166  H  HG3  . GLU A 1 17  ? 44.631 56.394 -5.454  1.00 78.04  ? 232 GLU A HG3  1 
ATOM   167  N  N    . PHE A 1 18  ? 43.697 53.619 -7.548  1.00 33.04  ? 233 PHE A N    1 
ATOM   168  C  CA   . PHE A 1 18  ? 44.171 52.602 -8.458  1.00 32.23  ? 233 PHE A CA   1 
ATOM   169  C  C    . PHE A 1 18  ? 45.473 53.061 -9.066  1.00 35.45  ? 233 PHE A C    1 
ATOM   170  O  O    . PHE A 1 18  ? 45.643 54.232 -9.407  1.00 39.07  ? 233 PHE A O    1 
ATOM   171  C  CB   . PHE A 1 18  ? 43.154 52.319 -9.549  1.00 32.25  ? 233 PHE A CB   1 
ATOM   172  C  CG   . PHE A 1 18  ? 43.602 51.282 -10.493 1.00 32.29  ? 233 PHE A CG   1 
ATOM   173  C  CD1  . PHE A 1 18  ? 43.389 49.971 -10.217 1.00 32.86  ? 233 PHE A CD1  1 
ATOM   174  C  CD2  . PHE A 1 18  ? 44.281 51.621 -11.643 1.00 33.64  ? 233 PHE A CD2  1 
ATOM   175  C  CE1  . PHE A 1 18  ? 43.823 48.990 -11.108 1.00 39.74  ? 233 PHE A CE1  1 
ATOM   176  C  CE2  . PHE A 1 18  ? 44.726 50.656 -12.537 1.00 35.73  ? 233 PHE A CE2  1 
ATOM   177  C  CZ   . PHE A 1 18  ? 44.505 49.347 -12.272 1.00 32.82  ? 233 PHE A CZ   1 
ATOM   178  H  H    . PHE A 1 18  ? 43.783 54.422 -7.843  1.00 39.65  ? 233 PHE A H    1 
ATOM   179  H  HA   . PHE A 1 18  ? 44.333 51.781 -7.969  1.00 38.67  ? 233 PHE A HA   1 
ATOM   180  H  HB2  . PHE A 1 18  ? 42.328 52.016 -9.140  1.00 38.71  ? 233 PHE A HB2  1 
ATOM   181  H  HB3  . PHE A 1 18  ? 42.995 53.134 -10.052 1.00 38.71  ? 233 PHE A HB3  1 
ATOM   182  H  HD1  . PHE A 1 18  ? 42.935 49.727 -9.442  1.00 39.44  ? 233 PHE A HD1  1 
ATOM   183  H  HD2  . PHE A 1 18  ? 44.437 52.519 -11.830 1.00 40.37  ? 233 PHE A HD2  1 
ATOM   184  H  HE1  . PHE A 1 18  ? 43.669 48.092 -10.919 1.00 47.69  ? 233 PHE A HE1  1 
ATOM   185  H  HE2  . PHE A 1 18  ? 45.176 50.908 -13.311 1.00 42.88  ? 233 PHE A HE2  1 
ATOM   186  H  HZ   . PHE A 1 18  ? 44.795 48.692 -12.865 1.00 39.38  ? 233 PHE A HZ   1 
ATOM   187  N  N    . SER A 1 19  ? 46.397 52.125 -9.186  1.00 34.46  ? 234 SER A N    1 
ATOM   188  C  CA   . SER A 1 19  ? 47.679 52.415 -9.796  1.00 39.78  ? 234 SER A CA   1 
ATOM   189  C  C    . SER A 1 19  ? 48.304 51.151 -10.345 1.00 36.28  ? 234 SER A C    1 
ATOM   190  O  O    . SER A 1 19  ? 48.208 50.084 -9.743  1.00 32.53  ? 234 SER A O    1 
ATOM   191  C  CB   . SER A 1 19  ? 48.611 53.079 -8.759  1.00 37.90  ? 234 SER A CB   1 
ATOM   192  O  OG   . SER A 1 19  ? 49.134 52.098 -7.888  1.00 41.43  ? 234 SER A OG   1 
ATOM   193  H  H    . SER A 1 19  ? 46.307 51.311 -8.922  1.00 41.35  ? 234 SER A H    1 
ATOM   194  H  HA   . SER A 1 19  ? 47.551 53.035 -10.531 1.00 47.73  ? 234 SER A HA   1 
ATOM   195  H  HB2  . SER A 1 19  ? 49.342 53.518 -9.222  1.00 45.48  ? 234 SER A HB2  1 
ATOM   196  H  HB3  . SER A 1 19  ? 48.104 53.727 -8.244  1.00 45.48  ? 234 SER A HB3  1 
ATOM   197  H  HG   . SER A 1 19  ? 49.641 52.457 -7.322  1.00 49.71  ? 234 SER A HG   1 
ATOM   198  N  N    . ALA A 1 20  ? 48.965 51.286 -11.480 1.00 31.60  ? 235 ALA A N    1 
ATOM   199  C  CA   . ALA A 1 20  ? 49.748 50.215 -12.063 1.00 31.71  ? 235 ALA A CA   1 
ATOM   200  C  C    . ALA A 1 20  ? 51.131 50.796 -12.213 1.00 33.73  ? 235 ALA A C    1 
ATOM   201  O  O    . ALA A 1 20  ? 51.269 51.916 -12.700 1.00 37.76  ? 235 ALA A O    1 
ATOM   202  C  CB   . ALA A 1 20  ? 49.178 49.738 -13.425 1.00 31.63  ? 235 ALA A CB   1 
ATOM   203  H  H    . ALA A 1 20  ? 48.975 52.010 -11.945 1.00 37.93  ? 235 ALA A H    1 
ATOM   204  H  HA   . ALA A 1 20  ? 49.786 49.461 -11.454 1.00 38.05  ? 235 ALA A HA   1 
ATOM   205  H  HB1  . ALA A 1 20  ? 49.738 49.024 -13.768 1.00 37.95  ? 235 ALA A HB1  1 
ATOM   206  H  HB2  . ALA A 1 20  ? 48.273 49.415 -13.292 1.00 37.95  ? 235 ALA A HB2  1 
ATOM   207  H  HB3  . ALA A 1 20  ? 49.176 50.484 -14.044 1.00 37.95  ? 235 ALA A HB3  1 
ATOM   208  N  N    . PHE A 1 21  ? 52.137 50.045 -11.777 1.00 38.97  ? 236 PHE A N    1 
ATOM   209  C  CA   . PHE A 1 21  ? 53.486 50.576 -11.621 1.00 40.69  ? 236 PHE A CA   1 
ATOM   210  C  C    . PHE A 1 21  ? 54.591 49.546 -11.805 1.00 40.53  ? 236 PHE A C    1 
ATOM   211  O  O    . PHE A 1 21  ? 54.362 48.340 -11.806 1.00 38.71  ? 236 PHE A O    1 
ATOM   212  C  CB   . PHE A 1 21  ? 53.628 51.183 -10.227 1.00 42.42  ? 236 PHE A CB   1 
ATOM   213  C  CG   . PHE A 1 21  ? 53.315 50.219 -9.143  1.00 48.35  ? 236 PHE A CG   1 
ATOM   214  C  CD1  . PHE A 1 21  ? 54.282 49.336 -8.667  1.00 44.86  ? 236 PHE A CD1  1 
ATOM   215  C  CD2  . PHE A 1 21  ? 52.053 50.163 -8.624  1.00 51.55  ? 236 PHE A CD2  1 
ATOM   216  C  CE1  . PHE A 1 21  ? 53.985 48.427 -7.675  1.00 39.52  ? 236 PHE A CE1  1 
ATOM   217  C  CE2  . PHE A 1 21  ? 51.756 49.264 -7.636  1.00 41.11  ? 236 PHE A CE2  1 
ATOM   218  C  CZ   . PHE A 1 21  ? 52.720 48.386 -7.172  1.00 38.45  ? 236 PHE A CZ   1 
ATOM   219  H  H    . PHE A 1 21  ? 52.062 49.216 -11.562 1.00 46.76  ? 236 PHE A H    1 
ATOM   220  H  HA   . PHE A 1 21  ? 53.624 51.282 -12.272 1.00 48.82  ? 236 PHE A HA   1 
ATOM   221  H  HB2  . PHE A 1 21  ? 54.542 51.484 -10.106 1.00 50.91  ? 236 PHE A HB2  1 
ATOM   222  H  HB3  . PHE A 1 21  ? 53.019 51.933 -10.147 1.00 50.91  ? 236 PHE A HB3  1 
ATOM   223  H  HD1  . PHE A 1 21  ? 55.141 49.363 -9.022  1.00 53.83  ? 236 PHE A HD1  1 
ATOM   224  H  HD2  . PHE A 1 21  ? 51.397 50.743 -8.937  1.00 61.87  ? 236 PHE A HD2  1 
ATOM   225  H  HE1  . PHE A 1 21  ? 54.638 47.843 -7.361  1.00 47.42  ? 236 PHE A HE1  1 
ATOM   226  H  HE2  . PHE A 1 21  ? 50.895 49.232 -7.284  1.00 49.33  ? 236 PHE A HE2  1 
ATOM   227  H  HZ   . PHE A 1 21  ? 52.510 47.783 -6.495  1.00 46.13  ? 236 PHE A HZ   1 
ATOM   228  N  N    . VAL A 1 22  ? 55.810 50.042 -11.935 1.00 42.17  ? 237 VAL A N    1 
ATOM   229  C  CA   . VAL A 1 22  ? 56.983 49.181 -11.852 1.00 46.14  ? 237 VAL A CA   1 
ATOM   230  C  C    . VAL A 1 22  ? 57.968 49.782 -10.842 1.00 49.76  ? 237 VAL A C    1 
ATOM   231  O  O    . VAL A 1 22  ? 58.039 51.005 -10.666 1.00 46.22  ? 237 VAL A O    1 
ATOM   232  C  CB   . VAL A 1 22  ? 57.642 48.968 -13.239 1.00 46.52  ? 237 VAL A CB   1 
ATOM   233  C  CG1  . VAL A 1 22  ? 57.885 50.296 -13.936 1.00 48.81  ? 237 VAL A CG1  1 
ATOM   234  C  CG2  . VAL A 1 22  ? 58.935 48.123 -13.114 1.00 45.85  ? 237 VAL A CG2  1 
ATOM   235  H  H    . VAL A 1 22  ? 55.989 50.873 -12.071 1.00 50.61  ? 237 VAL A H    1 
ATOM   236  H  HA   . VAL A 1 22  ? 56.710 48.312 -11.518 1.00 55.37  ? 237 VAL A HA   1 
ATOM   237  H  HB   . VAL A 1 22  ? 57.024 48.464 -13.792 1.00 55.82  ? 237 VAL A HB   1 
ATOM   238  H  HG11 . VAL A 1 22  ? 58.296 50.129 -14.798 1.00 58.57  ? 237 VAL A HG11 1 
ATOM   239  H  HG12 . VAL A 1 22  ? 57.035 50.749 -14.056 1.00 58.57  ? 237 VAL A HG12 1 
ATOM   240  H  HG13 . VAL A 1 22  ? 58.474 50.837 -13.387 1.00 58.57  ? 237 VAL A HG13 1 
ATOM   241  H  HG21 . VAL A 1 22  ? 59.322 48.008 -13.996 1.00 55.02  ? 237 VAL A HG21 1 
ATOM   242  H  HG22 . VAL A 1 22  ? 59.560 48.588 -12.536 1.00 55.02  ? 237 VAL A HG22 1 
ATOM   243  H  HG23 . VAL A 1 22  ? 58.711 47.259 -12.735 1.00 55.02  ? 237 VAL A HG23 1 
ATOM   244  N  N    . GLU A 1 23  ? 58.689 48.891 -10.166 1.00 57.66  ? 238 GLU A N    1 
ATOM   245  C  CA   . GLU A 1 23  ? 59.660 49.259 -9.151  1.00 54.15  ? 238 GLU A CA   1 
ATOM   246  C  C    . GLU A 1 23  ? 61.003 48.694 -9.521  1.00 68.88  ? 238 GLU A C    1 
ATOM   247  O  O    . GLU A 1 23  ? 61.087 47.662 -10.208 1.00 61.34  ? 238 GLU A O    1 
ATOM   248  C  CB   . GLU A 1 23  ? 59.249 48.748 -7.779  1.00 53.78  ? 238 GLU A CB   1 
ATOM   249  C  CG   . GLU A 1 23  ? 58.198 49.603 -7.162  1.00 57.91  ? 238 GLU A CG   1 
ATOM   250  C  CD   . GLU A 1 23  ? 57.519 48.947 -5.963  1.00 62.46  ? 238 GLU A CD   1 
ATOM   251  O  OE1  . GLU A 1 23  ? 57.748 47.740 -5.715  1.00 57.80  ? 238 GLU A OE1  1 
ATOM   252  O  OE2  . GLU A 1 23  ? 56.757 49.655 -5.267  1.00 53.84  ? 238 GLU A OE2  1 
ATOM   253  H  H    . GLU A 1 23  ? 58.628 48.041 -10.285 1.00 69.20  ? 238 GLU A H    1 
ATOM   254  H  HA   . GLU A 1 23  ? 59.734 50.225 -9.109  1.00 64.99  ? 238 GLU A HA   1 
ATOM   255  H  HB2  . GLU A 1 23  ? 58.896 47.849 -7.866  1.00 64.53  ? 238 GLU A HB2  1 
ATOM   256  H  HB3  . GLU A 1 23  ? 60.022 48.749 -7.194  1.00 64.53  ? 238 GLU A HB3  1 
ATOM   257  H  HG2  . GLU A 1 23  ? 58.603 50.431 -6.861  1.00 69.49  ? 238 GLU A HG2  1 
ATOM   258  H  HG3  . GLU A 1 23  ? 57.516 49.791 -7.826  1.00 69.49  ? 238 GLU A HG3  1 
ATOM   259  N  N    . PRO A 1 24  ? 62.073 49.366 -9.074  1.00 77.85  ? 239 PRO A N    1 
ATOM   260  C  CA   . PRO A 1 24  ? 63.396 48.880 -9.443  1.00 75.04  ? 239 PRO A CA   1 
ATOM   261  C  C    . PRO A 1 24  ? 63.700 47.524 -8.823  1.00 74.82  ? 239 PRO A C    1 
ATOM   262  O  O    . PRO A 1 24  ? 64.443 46.783 -9.470  1.00 93.33  ? 239 PRO A O    1 
ATOM   263  C  CB   . PRO A 1 24  ? 64.323 49.972 -8.906  1.00 82.80  ? 239 PRO A CB   1 
ATOM   264  C  CG   . PRO A 1 24  ? 63.459 51.182 -8.746  1.00 73.37  ? 239 PRO A CG   1 
ATOM   265  C  CD   . PRO A 1 24  ? 62.145 50.636 -8.330  1.00 64.07  ? 239 PRO A CD   1 
ATOM   266  H  HA   . PRO A 1 24  ? 63.482 48.825 -10.408 1.00 90.04  ? 239 PRO A HA   1 
ATOM   267  H  HB2  . PRO A 1 24  ? 64.690 49.698 -8.051  1.00 99.36  ? 239 PRO A HB2  1 
ATOM   268  H  HB3  . PRO A 1 24  ? 65.033 50.141 -9.546  1.00 99.36  ? 239 PRO A HB3  1 
ATOM   269  H  HG2  . PRO A 1 24  ? 63.827 51.761 -8.059  1.00 88.04  ? 239 PRO A HG2  1 
ATOM   270  H  HG3  . PRO A 1 24  ? 63.387 51.651 -9.592  1.00 88.04  ? 239 PRO A HG3  1 
ATOM   271  H  HD2  . PRO A 1 24  ? 62.132 50.471 -7.374  1.00 76.88  ? 239 PRO A HD2  1 
ATOM   272  H  HD3  . PRO A 1 24  ? 61.428 51.231 -8.601  1.00 76.88  ? 239 PRO A HD3  1 
ATOM   273  N  N    . GLN A 1 32  ? 62.041 54.510 -5.939  1.00 89.27  ? 247 GLN A N    1 
ATOM   274  C  CA   . GLN A 1 32  ? 60.659 54.962 -6.057  1.00 88.74  ? 247 GLN A CA   1 
ATOM   275  C  C    . GLN A 1 32  ? 59.861 54.083 -7.024  1.00 93.25  ? 247 GLN A C    1 
ATOM   276  O  O    . GLN A 1 32  ? 60.303 53.002 -7.411  1.00 97.25  ? 247 GLN A O    1 
ATOM   277  C  CB   . GLN A 1 32  ? 60.617 56.415 -6.526  1.00 86.95  ? 247 GLN A CB   1 
ATOM   278  C  CG   . GLN A 1 32  ? 61.415 57.356 -5.655  1.00 98.07  ? 247 GLN A CG   1 
ATOM   279  C  CD   . GLN A 1 32  ? 62.891 57.362 -6.009  1.00 97.10  ? 247 GLN A CD   1 
ATOM   280  O  OE1  . GLN A 1 32  ? 63.349 56.558 -6.831  1.00 90.19  ? 247 GLN A OE1  1 
ATOM   281  N  NE2  . GLN A 1 32  ? 63.643 58.277 -5.400  1.00 96.29  ? 247 GLN A NE2  1 
ATOM   282  H  HA   . GLN A 1 32  ? 60.234 54.914 -5.186  1.00 106.49 ? 247 GLN A HA   1 
ATOM   283  H  HB2  . GLN A 1 32  ? 60.977 56.464 -7.425  1.00 104.35 ? 247 GLN A HB2  1 
ATOM   284  H  HB3  . GLN A 1 32  ? 59.695 56.718 -6.524  1.00 104.35 ? 247 GLN A HB3  1 
ATOM   285  H  HG2  . GLN A 1 32  ? 61.075 58.258 -5.769  1.00 117.68 ? 247 GLN A HG2  1 
ATOM   286  H  HG3  . GLN A 1 32  ? 61.329 57.082 -4.729  1.00 117.68 ? 247 GLN A HG3  1 
ATOM   287  H  HE21 . GLN A 1 32  ? 63.286 58.824 -4.840  1.00 115.54 ? 247 GLN A HE21 1 
ATOM   288  H  HE22 . GLN A 1 32  ? 64.486 58.322 -5.566  1.00 115.54 ? 247 GLN A HE22 1 
ATOM   289  N  N    . ARG A 1 33  ? 58.686 54.568 -7.415  1.00 77.97  ? 248 ARG A N    1 
ATOM   290  C  CA   . ARG A 1 33  ? 57.821 53.871 -8.350  1.00 70.93  ? 248 ARG A CA   1 
ATOM   291  C  C    . ARG A 1 33  ? 57.689 54.640 -9.638  1.00 64.30  ? 248 ARG A C    1 
ATOM   292  O  O    . ARG A 1 33  ? 57.715 55.868 -9.633  1.00 76.11  ? 248 ARG A O    1 
ATOM   293  C  CB   . ARG A 1 33  ? 56.426 53.690 -7.766  1.00 68.41  ? 248 ARG A CB   1 
ATOM   294  C  CG   . ARG A 1 33  ? 56.338 52.707 -6.641  1.00 68.60  ? 248 ARG A CG   1 
ATOM   295  C  CD   . ARG A 1 33  ? 54.889 52.488 -6.281  1.00 64.60  ? 248 ARG A CD   1 
ATOM   296  N  NE   . ARG A 1 33  ? 54.712 51.363 -5.366  1.00 78.03  ? 248 ARG A NE   1 
ATOM   297  C  CZ   . ARG A 1 33  ? 53.540 50.978 -4.865  1.00 75.54  ? 248 ARG A CZ   1 
ATOM   298  N  NH1  . ARG A 1 33  ? 52.425 51.628 -5.185  1.00 72.15  ? 248 ARG A NH1  1 
ATOM   299  N  NH2  . ARG A 1 33  ? 53.488 49.939 -4.033  1.00 71.91  ? 248 ARG A NH2  1 
ATOM   300  H  H    . ARG A 1 33  ? 58.365 55.318 -7.144  1.00 93.56  ? 248 ARG A H    1 
ATOM   301  H  HA   . ARG A 1 33  ? 58.191 52.997 -8.547  1.00 85.11  ? 248 ARG A HA   1 
ATOM   302  H  HB2  . ARG A 1 33  ? 56.117 54.546 -7.432  1.00 82.09  ? 248 ARG A HB2  1 
ATOM   303  H  HB3  . ARG A 1 33  ? 55.834 53.382 -8.471  1.00 82.09  ? 248 ARG A HB3  1 
ATOM   304  H  HG2  . ARG A 1 33  ? 56.721 51.860 -6.916  1.00 82.32  ? 248 ARG A HG2  1 
ATOM   305  H  HG3  . ARG A 1 33  ? 56.801 53.057 -5.864  1.00 82.32  ? 248 ARG A HG3  1 
ATOM   306  H  HD2  . ARG A 1 33  ? 54.545 53.286 -5.850  1.00 77.52  ? 248 ARG A HD2  1 
ATOM   307  H  HD3  . ARG A 1 33  ? 54.385 52.302 -7.089  1.00 77.52  ? 248 ARG A HD3  1 
ATOM   308  H  HE   . ARG A 1 33  ? 55.412 50.920 -5.136  1.00 93.64  ? 248 ARG A HE   1 
ATOM   309  H  HH11 . ARG A 1 33  ? 52.457 52.300 -5.720  1.00 86.58  ? 248 ARG A HH11 1 
ATOM   310  H  HH12 . ARG A 1 33  ? 51.671 51.375 -4.858  1.00 86.58  ? 248 ARG A HH12 1 
ATOM   311  H  HH21 . ARG A 1 33  ? 54.208 49.518 -3.825  1.00 86.29  ? 248 ARG A HH21 1 
ATOM   312  H  HH22 . ARG A 1 33  ? 52.733 49.687 -3.707  1.00 86.29  ? 248 ARG A HH22 1 
ATOM   313  N  N    . HIS A 1 34  ? 57.534 53.923 -10.745 1.00 58.02  ? 249 HIS A N    1 
ATOM   314  C  CA   . HIS A 1 34  ? 57.025 54.557 -11.952 1.00 56.47  ? 249 HIS A CA   1 
ATOM   315  C  C    . HIS A 1 34  ? 55.590 54.113 -12.200 1.00 58.31  ? 249 HIS A C    1 
ATOM   316  O  O    . HIS A 1 34  ? 55.303 52.923 -12.339 1.00 54.17  ? 249 HIS A O    1 
ATOM   317  C  CB   . HIS A 1 34  ? 57.856 54.247 -13.191 1.00 57.06  ? 249 HIS A CB   1 
ATOM   318  C  CG   . HIS A 1 34  ? 57.204 54.713 -14.449 1.00 60.92  ? 249 HIS A CG   1 
ATOM   319  N  ND1  . HIS A 1 34  ? 57.265 56.021 -14.888 1.00 76.13  ? 249 HIS A ND1  1 
ATOM   320  C  CD2  . HIS A 1 34  ? 56.408 54.065 -15.338 1.00 62.02  ? 249 HIS A CD2  1 
ATOM   321  C  CE1  . HIS A 1 34  ? 56.576 56.151 -15.998 1.00 73.44  ? 249 HIS A CE1  1 
ATOM   322  N  NE2  . HIS A 1 34  ? 56.037 54.974 -16.300 1.00 63.05  ? 249 HIS A NE2  1 
ATOM   323  H  H    . HIS A 1 34  ? 57.713 53.085 -10.822 1.00 69.62  ? 249 HIS A H    1 
ATOM   324  H  HA   . HIS A 1 34  ? 57.024 55.518 -11.826 1.00 67.76  ? 249 HIS A HA   1 
ATOM   325  H  HB2  . HIS A 1 34  ? 58.715 54.691 -13.115 1.00 68.47  ? 249 HIS A HB2  1 
ATOM   326  H  HB3  . HIS A 1 34  ? 57.983 53.287 -13.255 1.00 68.47  ? 249 HIS A HB3  1 
ATOM   327  H  HD2  . HIS A 1 34  ? 56.172 53.166 -15.310 1.00 74.43  ? 249 HIS A HD2  1 
ATOM   328  H  HE1  . HIS A 1 34  ? 56.478 56.936 -16.489 1.00 88.13  ? 249 HIS A HE1  1 
ATOM   329  H  HE2  . HIS A 1 34  ? 55.543 54.808 -16.985 1.00 75.66  ? 249 HIS A HE2  1 
ATOM   330  N  N    . LEU A 1 35  ? 54.707 55.096 -12.279 1.00 51.08  ? 250 LEU A N    1 
ATOM   331  C  CA   . LEU A 1 35  ? 53.290 54.862 -12.447 1.00 54.60  ? 250 LEU A CA   1 
ATOM   332  C  C    . LEU A 1 35  ? 52.872 54.939 -13.905 1.00 51.25  ? 250 LEU A C    1 
ATOM   333  O  O    . LEU A 1 35  ? 53.012 55.984 -14.527 1.00 56.59  ? 250 LEU A O    1 
ATOM   334  C  CB   . LEU A 1 35  ? 52.489 55.888 -11.660 1.00 53.98  ? 250 LEU A CB   1 
ATOM   335  C  CG   . LEU A 1 35  ? 52.685 55.964 -10.159 1.00 56.52  ? 250 LEU A CG   1 
ATOM   336  C  CD1  . LEU A 1 35  ? 51.816 57.109 -9.663  1.00 54.43  ? 250 LEU A CD1  1 
ATOM   337  C  CD2  . LEU A 1 35  ? 52.307 54.667 -9.510  1.00 50.20  ? 250 LEU A CD2  1 
ATOM   338  H  H    . LEU A 1 35  ? 54.913 55.930 -12.235 1.00 61.30  ? 250 LEU A H    1 
ATOM   339  H  HA   . LEU A 1 35  ? 53.068 53.979 -12.112 1.00 65.52  ? 250 LEU A HA   1 
ATOM   340  H  HB2  . LEU A 1 35  ? 52.703 56.765 -12.015 1.00 64.78  ? 250 LEU A HB2  1 
ATOM   341  H  HB3  . LEU A 1 35  ? 51.548 55.708 -11.811 1.00 64.78  ? 250 LEU A HB3  1 
ATOM   342  H  HG   . LEU A 1 35  ? 53.613 56.161 -9.955  1.00 67.83  ? 250 LEU A HG   1 
ATOM   343  H  HD11 . LEU A 1 35  ? 51.916 57.188 -8.702  1.00 65.32  ? 250 LEU A HD11 1 
ATOM   344  H  HD12 . LEU A 1 35  ? 52.100 57.930 -10.095 1.00 65.32  ? 250 LEU A HD12 1 
ATOM   345  H  HD13 . LEU A 1 35  ? 50.891 56.921 -9.886  1.00 65.32  ? 250 LEU A HD13 1 
ATOM   346  H  HD21 . LEU A 1 35  ? 52.441 54.742 -8.552  1.00 60.24  ? 250 LEU A HD21 1 
ATOM   347  H  HD22 . LEU A 1 35  ? 51.374 54.480 -9.700  1.00 60.24  ? 250 LEU A HD22 1 
ATOM   348  H  HD23 . LEU A 1 35  ? 52.866 53.960 -9.869  1.00 60.24  ? 250 LEU A HD23 1 
ATOM   349  N  N    . PHE A 1 36  ? 52.339 53.841 -14.438 1.00 50.11  ? 251 PHE A N    1 
ATOM   350  C  CA   . PHE A 1 36  ? 51.829 53.833 -15.820 1.00 50.76  ? 251 PHE A CA   1 
ATOM   351  C  C    . PHE A 1 36  ? 50.511 54.571 -15.881 1.00 51.58  ? 251 PHE A C    1 
ATOM   352  O  O    . PHE A 1 36  ? 50.255 55.370 -16.787 1.00 50.93  ? 251 PHE A O    1 
ATOM   353  C  CB   . PHE A 1 36  ? 51.634 52.416 -16.316 1.00 45.48  ? 251 PHE A CB   1 
ATOM   354  C  CG   . PHE A 1 36  ? 52.887 51.615 -16.323 1.00 46.07  ? 251 PHE A CG   1 
ATOM   355  C  CD1  . PHE A 1 36  ? 53.930 51.971 -17.148 1.00 47.66  ? 251 PHE A CD1  1 
ATOM   356  C  CD2  . PHE A 1 36  ? 53.017 50.503 -15.506 1.00 48.14  ? 251 PHE A CD2  1 
ATOM   357  C  CE1  . PHE A 1 36  ? 55.092 51.239 -17.159 1.00 50.01  ? 251 PHE A CE1  1 
ATOM   358  C  CE2  . PHE A 1 36  ? 54.171 49.757 -15.511 1.00 45.52  ? 251 PHE A CE2  1 
ATOM   359  C  CZ   . PHE A 1 36  ? 55.219 50.126 -16.351 1.00 60.55  ? 251 PHE A CZ   1 
ATOM   360  H  H    . PHE A 1 36  ? 52.258 53.089 -14.028 1.00 60.14  ? 251 PHE A H    1 
ATOM   361  H  HA   . PHE A 1 36  ? 52.461 54.281 -16.403 1.00 60.91  ? 251 PHE A HA   1 
ATOM   362  H  HB2  . PHE A 1 36  ? 50.996 51.967 -15.740 1.00 54.58  ? 251 PHE A HB2  1 
ATOM   363  H  HB3  . PHE A 1 36  ? 51.295 52.446 -17.225 1.00 54.58  ? 251 PHE A HB3  1 
ATOM   364  H  HD1  . PHE A 1 36  ? 53.849 52.717 -17.697 1.00 57.20  ? 251 PHE A HD1  1 
ATOM   365  H  HD2  . PHE A 1 36  ? 52.314 50.257 -14.949 1.00 57.77  ? 251 PHE A HD2  1 
ATOM   366  H  HE1  . PHE A 1 36  ? 55.790 51.487 -17.721 1.00 60.01  ? 251 PHE A HE1  1 
ATOM   367  H  HE2  . PHE A 1 36  ? 54.250 49.012 -14.960 1.00 54.63  ? 251 PHE A HE2  1 
ATOM   368  H  HZ   . PHE A 1 36  ? 56.006 49.631 -16.358 1.00 72.66  ? 251 PHE A HZ   1 
ATOM   369  N  N    . VAL A 1 37  ? 49.687 54.280 -14.884 1.00 43.81  ? 252 VAL A N    1 
ATOM   370  C  CA   . VAL A 1 37  ? 48.381 54.870 -14.743 1.00 48.16  ? 252 VAL A CA   1 
ATOM   371  C  C    . VAL A 1 37  ? 48.106 54.998 -13.229 1.00 45.42  ? 252 VAL A C    1 
ATOM   372  O  O    . VAL A 1 37  ? 48.614 54.216 -12.406 1.00 42.45  ? 252 VAL A O    1 
ATOM   373  C  CB   . VAL A 1 37  ? 47.288 54.035 -15.503 1.00 46.52  ? 252 VAL A CB   1 
ATOM   374  C  CG1  . VAL A 1 37  ? 47.609 53.941 -17.047 1.00 49.51  ? 252 VAL A CG1  1 
ATOM   375  C  CG2  . VAL A 1 37  ? 47.124 52.643 -14.906 1.00 47.99  ? 252 VAL A CG2  1 
ATOM   376  H  H    . VAL A 1 37  ? 49.878 53.723 -14.257 1.00 52.57  ? 252 VAL A H    1 
ATOM   377  H  HA   . VAL A 1 37  ? 48.393 55.762 -15.123 1.00 57.79  ? 252 VAL A HA   1 
ATOM   378  H  HB   . VAL A 1 37  ? 46.437 54.491 -15.411 1.00 55.82  ? 252 VAL A HB   1 
ATOM   379  H  HG11 . VAL A 1 37  ? 46.916 53.420 -17.483 1.00 59.41  ? 252 VAL A HG11 1 
ATOM   380  H  HG12 . VAL A 1 37  ? 47.634 54.837 -17.419 1.00 59.41  ? 252 VAL A HG12 1 
ATOM   381  H  HG13 . VAL A 1 37  ? 48.470 53.510 -17.165 1.00 59.41  ? 252 VAL A HG13 1 
ATOM   382  H  HG21 . VAL A 1 37  ? 46.442 52.165 -15.404 1.00 57.58  ? 252 VAL A HG21 1 
ATOM   383  H  HG22 . VAL A 1 37  ? 47.969 52.172 -14.966 1.00 57.58  ? 252 VAL A HG22 1 
ATOM   384  H  HG23 . VAL A 1 37  ? 46.857 52.728 -13.977 1.00 57.58  ? 252 VAL A HG23 1 
ATOM   385  N  N    . HIS A 1 38  ? 47.336 56.015 -12.865 1.00 41.28  ? 253 HIS A N    1 
ATOM   386  C  CA   . HIS A 1 38  ? 47.081 56.313 -11.467 1.00 43.89  ? 253 HIS A CA   1 
ATOM   387  C  C    . HIS A 1 38  ? 45.747 57.063 -11.373 1.00 44.41  ? 253 HIS A C    1 
ATOM   388  O  O    . HIS A 1 38  ? 45.471 57.970 -12.154 1.00 47.84  ? 253 HIS A O    1 
ATOM   389  C  CB   . HIS A 1 38  ? 48.234 57.125 -10.864 1.00 44.10  ? 253 HIS A CB   1 
ATOM   390  C  CG   . HIS A 1 38  ? 48.093 57.397 -9.392  1.00 49.06  ? 253 HIS A CG   1 
ATOM   391  N  ND1  . HIS A 1 38  ? 48.586 58.531 -8.795  1.00 75.84  ? 253 HIS A ND1  1 
ATOM   392  C  CD2  . HIS A 1 38  ? 47.526 56.660 -8.403  1.00 47.10  ? 253 HIS A CD2  1 
ATOM   393  C  CE1  . HIS A 1 38  ? 48.317 58.498 -7.497  1.00 63.88  ? 253 HIS A CE1  1 
ATOM   394  N  NE2  . HIS A 1 38  ? 47.671 57.381 -7.234  1.00 52.75  ? 253 HIS A NE2  1 
ATOM   395  H  H    . HIS A 1 38  ? 46.947 56.550 -13.414 1.00 49.54  ? 253 HIS A H    1 
ATOM   396  H  HA   . HIS A 1 38  ? 47.000 55.484 -10.971 1.00 52.67  ? 253 HIS A HA   1 
ATOM   397  H  HB2  . HIS A 1 38  ? 49.062 56.636 -10.996 1.00 52.91  ? 253 HIS A HB2  1 
ATOM   398  H  HB3  . HIS A 1 38  ? 48.284 57.981 -11.319 1.00 52.91  ? 253 HIS A HB3  1 
ATOM   399  H  HD2  . HIS A 1 38  ? 47.103 55.837 -8.497  1.00 56.52  ? 253 HIS A HD2  1 
ATOM   400  H  HE1  . HIS A 1 38  ? 48.545 59.153 -6.877  1.00 76.66  ? 253 HIS A HE1  1 
ATOM   401  H  HE2  . HIS A 1 38  ? 47.397 57.134 -6.457  1.00 63.30  ? 253 HIS A HE2  1 
ATOM   402  N  N    . ILE A 1 39  ? 44.903 56.590 -10.468 1.00 36.54  ? 254 ILE A N    1 
ATOM   403  C  CA   . ILE A 1 39  ? 43.642 57.225 -10.103 1.00 39.11  ? 254 ILE A CA   1 
ATOM   404  C  C    . ILE A 1 39  ? 43.658 57.352 -8.605  1.00 37.19  ? 254 ILE A C    1 
ATOM   405  O  O    . ILE A 1 39  ? 43.833 56.343 -7.918  1.00 36.23  ? 254 ILE A O    1 
ATOM   406  C  CB   . ILE A 1 39  ? 42.405 56.410 -10.520 1.00 39.61  ? 254 ILE A CB   1 
ATOM   407  C  CG1  . ILE A 1 39  ? 42.376 56.133 -12.016 1.00 39.25  ? 254 ILE A CG1  1 
ATOM   408  C  CG2  . ILE A 1 39  ? 41.114 57.149 -10.123 1.00 38.56  ? 254 ILE A CG2  1 
ATOM   409  C  CD1  . ILE A 1 39  ? 41.258 55.143 -12.428 1.00 37.53  ? 254 ILE A CD1  1 
ATOM   410  H  H    . ILE A 1 39  ? 45.047 55.865 -10.030 1.00 43.84  ? 254 ILE A H    1 
ATOM   411  H  HA   . ILE A 1 39  ? 43.587 58.110 -10.497 1.00 46.93  ? 254 ILE A HA   1 
ATOM   412  H  HB   . ILE A 1 39  ? 42.427 55.561 -10.052 1.00 47.53  ? 254 ILE A HB   1 
ATOM   413  H  HG12 . ILE A 1 39  ? 42.225 56.967 -12.488 1.00 47.10  ? 254 ILE A HG12 1 
ATOM   414  H  HG13 . ILE A 1 39  ? 43.226 55.751 -12.283 1.00 47.10  ? 254 ILE A HG13 1 
ATOM   415  H  HG21 . ILE A 1 39  ? 40.350 56.617 -10.395 1.00 46.28  ? 254 ILE A HG21 1 
ATOM   416  H  HG22 . ILE A 1 39  ? 41.105 57.273 -9.161  1.00 46.28  ? 254 ILE A HG22 1 
ATOM   417  H  HG23 . ILE A 1 39  ? 41.094 58.010 -10.569 1.00 46.28  ? 254 ILE A HG23 1 
ATOM   418  H  HD11 . ILE A 1 39  ? 41.293 55.010 -13.389 1.00 45.04  ? 254 ILE A HD11 1 
ATOM   419  H  HD12 . ILE A 1 39  ? 41.400 54.300 -11.971 1.00 45.04  ? 254 ILE A HD12 1 
ATOM   420  H  HD13 . ILE A 1 39  ? 40.399 55.516 -12.177 1.00 45.04  ? 254 ILE A HD13 1 
ATOM   421  N  N    . SER A 1 40  ? 43.462 58.560 -8.091  1.00 50.35  ? 255 SER A N    1 
ATOM   422  C  CA   . SER A 1 40  ? 43.321 58.759 -6.646  1.00 56.57  ? 255 SER A CA   1 
ATOM   423  C  C    . SER A 1 40  ? 42.081 59.587 -6.370  1.00 53.12  ? 255 SER A C    1 
ATOM   424  O  O    . SER A 1 40  ? 41.845 60.568 -7.060  1.00 60.34  ? 255 SER A O    1 
ATOM   425  C  CB   . SER A 1 40  ? 44.554 59.446 -6.068  1.00 64.47  ? 255 SER A CB   1 
ATOM   426  O  OG   . SER A 1 40  ? 44.543 59.363 -4.653  1.00 57.13  ? 255 SER A OG   1 
ATOM   427  H  H    . SER A 1 40  ? 43.406 59.283 -8.553  1.00 60.42  ? 255 SER A H    1 
ATOM   428  H  HA   . SER A 1 40  ? 43.218 57.898 -6.210  1.00 67.88  ? 255 SER A HA   1 
ATOM   429  H  HB2  . SER A 1 40  ? 45.350 59.007 -6.406  1.00 77.36  ? 255 SER A HB2  1 
ATOM   430  H  HB3  . SER A 1 40  ? 44.550 60.379 -6.332  1.00 77.36  ? 255 SER A HB3  1 
ATOM   431  H  HG   . SER A 1 40  ? 45.223 59.743 -4.338  1.00 68.56  ? 255 SER A HG   1 
ATOM   432  N  N    . GLN A 1 41  ? 41.280 59.206 -5.378  1.00 65.17  ? 256 GLN A N    1 
ATOM   433  C  CA   . GLN A 1 41  ? 40.041 59.950 -5.106  1.00 69.57  ? 256 GLN A CA   1 
ATOM   434  C  C    . GLN A 1 41  ? 39.846 60.295 -3.626  1.00 56.08  ? 256 GLN A C    1 
ATOM   435  O  O    . GLN A 1 41  ? 39.523 59.436 -2.811  1.00 64.08  ? 256 GLN A O    1 
ATOM   436  C  CB   . GLN A 1 41  ? 38.848 59.154 -5.642  1.00 65.95  ? 256 GLN A CB   1 
ATOM   437  C  CG   . GLN A 1 41  ? 39.126 58.561 -7.046  1.00 59.18  ? 256 GLN A CG   1 
ATOM   438  C  CD   . GLN A 1 41  ? 37.872 58.302 -7.896  1.00 74.14  ? 256 GLN A CD   1 
ATOM   439  O  OE1  . GLN A 1 41  ? 37.052 57.424 -7.586  1.00 70.46  ? 256 GLN A OE1  1 
ATOM   440  N  NE2  . GLN A 1 41  ? 37.737 59.054 -8.986  1.00 83.97  ? 256 GLN A NE2  1 
ATOM   441  H  H    . GLN A 1 41  ? 41.422 58.538 -4.856  1.00 78.20  ? 256 GLN A H    1 
ATOM   442  H  HA   . GLN A 1 41  ? 40.074 60.787 -5.595  1.00 83.48  ? 256 GLN A HA   1 
ATOM   443  H  HB2  . GLN A 1 41  ? 38.657 58.420 -5.037  1.00 79.14  ? 256 GLN A HB2  1 
ATOM   444  H  HB3  . GLN A 1 41  ? 38.079 59.741 -5.709  1.00 79.14  ? 256 GLN A HB3  1 
ATOM   445  H  HG2  . GLN A 1 41  ? 39.690 59.180 -7.536  1.00 71.02  ? 256 GLN A HG2  1 
ATOM   446  H  HG3  . GLN A 1 41  ? 39.588 57.715 -6.938  1.00 71.02  ? 256 GLN A HG3  1 
ATOM   447  H  HE21 . GLN A 1 41  ? 38.333 59.644 -9.178  1.00 100.76 ? 256 GLN A HE21 1 
ATOM   448  H  HE22 . GLN A 1 41  ? 37.054 58.951 -9.498  1.00 100.76 ? 256 GLN A HE22 1 
ATOM   449  N  N    . LEU A 1 51  ? 30.166 64.329 -14.713 1.00 92.32  ? 266 LEU A N    1 
ATOM   450  C  CA   . LEU A 1 51  ? 30.680 63.058 -15.226 1.00 72.25  ? 266 LEU A CA   1 
ATOM   451  C  C    . LEU A 1 51  ? 30.058 62.728 -16.585 1.00 75.06  ? 266 LEU A C    1 
ATOM   452  O  O    . LEU A 1 51  ? 28.930 62.239 -16.643 1.00 77.19  ? 266 LEU A O    1 
ATOM   453  C  CB   . LEU A 1 51  ? 30.397 61.934 -14.235 1.00 67.10  ? 266 LEU A CB   1 
ATOM   454  C  CG   . LEU A 1 51  ? 31.457 60.828 -14.186 1.00 62.68  ? 266 LEU A CG   1 
ATOM   455  C  CD1  . LEU A 1 51  ? 32.625 61.164 -13.255 1.00 60.75  ? 266 LEU A CD1  1 
ATOM   456  C  CD2  . LEU A 1 51  ? 30.827 59.523 -13.770 1.00 64.47  ? 266 LEU A CD2  1 
ATOM   457  H  HA   . LEU A 1 51  ? 31.640 63.126 -15.341 1.00 86.70  ? 266 LEU A HA   1 
ATOM   458  H  HB2  . LEU A 1 51  ? 30.333 62.316 -13.346 1.00 80.52  ? 266 LEU A HB2  1 
ATOM   459  H  HB3  . LEU A 1 51  ? 29.553 61.519 -14.472 1.00 80.52  ? 266 LEU A HB3  1 
ATOM   460  H  HG   . LEU A 1 51  ? 31.818 60.707 -15.078 1.00 75.22  ? 266 LEU A HG   1 
ATOM   461  H  HD11 . LEU A 1 51  ? 33.259 60.430 -13.267 1.00 72.89  ? 266 LEU A HD11 1 
ATOM   462  H  HD12 . LEU A 1 51  ? 33.053 61.976 -13.568 1.00 72.89  ? 266 LEU A HD12 1 
ATOM   463  H  HD13 . LEU A 1 51  ? 32.285 61.293 -12.356 1.00 72.89  ? 266 LEU A HD13 1 
ATOM   464  H  HD21 . LEU A 1 51  ? 31.511 58.836 -13.745 1.00 77.36  ? 266 LEU A HD21 1 
ATOM   465  H  HD22 . LEU A 1 51  ? 30.432 59.630 -12.890 1.00 77.36  ? 266 LEU A HD22 1 
ATOM   466  H  HD23 . LEU A 1 51  ? 30.141 59.284 -14.413 1.00 77.36  ? 266 LEU A HD23 1 
ATOM   467  N  N    . GLU A 1 52  ? 30.788 63.007 -17.665 1.00 67.64  ? 267 GLU A N    1 
ATOM   468  C  CA   . GLU A 1 52  ? 30.346 62.686 -19.027 1.00 71.68  ? 267 GLU A CA   1 
ATOM   469  C  C    . GLU A 1 52  ? 29.868 61.215 -19.112 1.00 72.02  ? 267 GLU A C    1 
ATOM   470  O  O    . GLU A 1 52  ? 30.126 60.423 -18.220 1.00 70.10  ? 267 GLU A O    1 
ATOM   471  C  CB   . GLU A 1 52  ? 31.489 62.956 -20.047 1.00 77.01  ? 267 GLU A CB   1 
ATOM   472  C  CG   . GLU A 1 52  ? 31.665 64.441 -20.515 1.00 81.94  ? 267 GLU A CG   1 
ATOM   473  C  CD   . GLU A 1 52  ? 32.728 64.640 -21.623 1.00 90.64  ? 267 GLU A CD   1 
ATOM   474  O  OE1  . GLU A 1 52  ? 32.672 63.965 -22.678 1.00 86.74  ? 267 GLU A OE1  1 
ATOM   475  O  OE2  . GLU A 1 52  ? 33.625 65.493 -21.444 1.00 100.58 ? 267 GLU A OE2  1 
ATOM   476  H  H    . GLU A 1 52  ? 31.558 63.389 -17.636 1.00 81.17  ? 267 GLU A H    1 
ATOM   477  H  HA   . GLU A 1 52  ? 29.597 63.258 -19.258 1.00 86.02  ? 267 GLU A HA   1 
ATOM   478  H  HB2  . GLU A 1 52  ? 32.327 62.680 -19.644 1.00 92.41  ? 267 GLU A HB2  1 
ATOM   479  H  HB3  . GLU A 1 52  ? 31.321 62.422 -20.839 1.00 92.41  ? 267 GLU A HB3  1 
ATOM   480  H  HG2  . GLU A 1 52  ? 30.816 64.761 -20.861 1.00 98.33  ? 267 GLU A HG2  1 
ATOM   481  H  HG3  . GLU A 1 52  ? 31.930 64.978 -19.752 1.00 98.33  ? 267 GLU A HG3  1 
ATOM   482  N  N    . SER A 1 53  ? 29.171 60.857 -20.186 1.00 72.26  ? 268 SER A N    1 
ATOM   483  C  CA   . SER A 1 53  ? 28.719 59.481 -20.389 1.00 71.94  ? 268 SER A CA   1 
ATOM   484  C  C    . SER A 1 53  ? 29.058 58.962 -21.788 1.00 75.11  ? 268 SER A C    1 
ATOM   485  O  O    . SER A 1 53  ? 29.391 59.739 -22.687 1.00 81.42  ? 268 SER A O    1 
ATOM   486  C  CB   . SER A 1 53  ? 27.217 59.376 -20.183 1.00 74.46  ? 268 SER A CB   1 
ATOM   487  O  OG   . SER A 1 53  ? 26.664 58.474 -21.127 1.00 78.38  ? 268 SER A OG   1 
ATOM   488  H  H    . SER A 1 53  ? 28.944 61.396 -20.817 1.00 86.71  ? 268 SER A H    1 
ATOM   489  H  HA   . SER A 1 53  ? 29.154 58.906 -19.741 1.00 86.32  ? 268 SER A HA   1 
ATOM   490  H  HB2  . SER A 1 53  ? 27.040 59.049 -19.287 1.00 89.35  ? 268 SER A HB2  1 
ATOM   491  H  HB3  . SER A 1 53  ? 26.816 60.251 -20.305 1.00 89.35  ? 268 SER A HB3  1 
ATOM   492  H  HG   . SER A 1 53  ? 25.834 58.414 -21.015 1.00 94.05  ? 268 SER A HG   1 
ATOM   493  N  N    . VAL A 1 54  ? 28.940 57.648 -21.969 1.00 65.78  ? 269 VAL A N    1 
ATOM   494  C  CA   . VAL A 1 54  ? 29.276 56.988 -23.229 1.00 66.84  ? 269 VAL A CA   1 
ATOM   495  C  C    . VAL A 1 54  ? 28.308 55.847 -23.493 1.00 74.68  ? 269 VAL A C    1 
ATOM   496  O  O    . VAL A 1 54  ? 28.009 55.074 -22.581 1.00 81.40  ? 269 VAL A O    1 
ATOM   497  C  CB   . VAL A 1 54  ? 30.717 56.440 -23.219 1.00 63.10  ? 269 VAL A CB   1 
ATOM   498  C  CG1  . VAL A 1 54  ? 31.034 55.789 -24.566 1.00 64.83  ? 269 VAL A CG1  1 
ATOM   499  C  CG2  . VAL A 1 54  ? 31.754 57.550 -22.875 1.00 63.02  ? 269 VAL A CG2  1 
ATOM   500  H  H    . VAL A 1 54  ? 28.660 57.105 -21.363 1.00 78.94  ? 269 VAL A H    1 
ATOM   501  H  HA   . VAL A 1 54  ? 29.199 57.627 -23.955 1.00 80.21  ? 269 VAL A HA   1 
ATOM   502  H  HB   . VAL A 1 54  ? 30.784 55.754 -22.537 1.00 75.72  ? 269 VAL A HB   1 
ATOM   503  H  HG11 . VAL A 1 54  ? 31.942 55.449 -24.546 1.00 77.80  ? 269 VAL A HG11 1 
ATOM   504  H  HG12 . VAL A 1 54  ? 30.411 55.061 -24.718 1.00 77.80  ? 269 VAL A HG12 1 
ATOM   505  H  HG13 . VAL A 1 54  ? 30.944 56.454 -25.266 1.00 77.80  ? 269 VAL A HG13 1 
ATOM   506  H  HG21 . VAL A 1 54  ? 32.643 57.164 -22.880 1.00 75.62  ? 269 VAL A HG21 1 
ATOM   507  H  HG22 . VAL A 1 54  ? 31.695 58.254 -23.541 1.00 75.62  ? 269 VAL A HG22 1 
ATOM   508  H  HG23 . VAL A 1 54  ? 31.553 57.908 -21.996 1.00 75.62  ? 269 VAL A HG23 1 
ATOM   509  N  N    . ASP A 1 55  ? 27.834 55.706 -24.728 1.00 88.74  ? 270 ASP A N    1 
ATOM   510  C  CA   . ASP A 1 55  ? 26.857 54.658 -25.007 1.00 96.76  ? 270 ASP A CA   1 
ATOM   511  C  C    . ASP A 1 55  ? 27.581 53.337 -25.207 1.00 91.53  ? 270 ASP A C    1 
ATOM   512  O  O    . ASP A 1 55  ? 28.449 53.228 -26.070 1.00 89.94  ? 270 ASP A O    1 
ATOM   513  C  CB   . ASP A 1 55  ? 25.991 54.988 -26.234 1.00 106.29 ? 270 ASP A CB   1 
ATOM   514  C  CG   . ASP A 1 55  ? 24.740 54.090 -26.337 1.00 107.10 ? 270 ASP A CG   1 
ATOM   515  O  OD1  . ASP A 1 55  ? 24.893 52.871 -26.576 1.00 109.21 ? 270 ASP A OD1  1 
ATOM   516  O  OD2  . ASP A 1 55  ? 23.602 54.603 -26.189 1.00 105.06 ? 270 ASP A OD2  1 
ATOM   517  H  H    . ASP A 1 55  ? 28.054 56.189 -25.405 1.00 106.49 ? 270 ASP A H    1 
ATOM   518  H  HA   . ASP A 1 55  ? 26.268 54.564 -24.242 1.00 116.11 ? 270 ASP A HA   1 
ATOM   519  H  HB2  . ASP A 1 55  ? 25.695 55.910 -26.173 1.00 127.55 ? 270 ASP A HB2  1 
ATOM   520  H  HB3  . ASP A 1 55  ? 26.519 54.862 -27.037 1.00 127.55 ? 270 ASP A HB3  1 
ATOM   521  N  N    . VAL A 1 56  ? 27.207 52.348 -24.393 1.00 115.93 ? 271 VAL A N    1 
ATOM   522  C  CA   . VAL A 1 56  ? 27.784 51.005 -24.444 1.00 120.66 ? 271 VAL A CA   1 
ATOM   523  C  C    . VAL A 1 56  ? 28.025 50.581 -25.881 1.00 126.44 ? 271 VAL A C    1 
ATOM   524  O  O    . VAL A 1 56  ? 29.089 50.064 -26.218 1.00 126.35 ? 271 VAL A O    1 
ATOM   525  C  CB   . VAL A 1 56  ? 26.877 49.954 -23.752 1.00 120.83 ? 271 VAL A CB   1 
ATOM   526  C  CG1  . VAL A 1 56  ? 27.594 48.628 -23.692 1.00 110.27 ? 271 VAL A CG1  1 
ATOM   527  C  CG2  . VAL A 1 56  ? 26.481 50.381 -22.347 1.00 124.67 ? 271 VAL A CG2  1 
ATOM   528  H  H    . VAL A 1 56  ? 26.603 52.435 -23.787 1.00 139.12 ? 271 VAL A H    1 
ATOM   529  H  HA   . VAL A 1 56  ? 28.639 51.012 -23.985 1.00 144.79 ? 271 VAL A HA   1 
ATOM   530  H  HB   . VAL A 1 56  ? 26.068 49.838 -24.274 1.00 144.99 ? 271 VAL A HB   1 
ATOM   531  H  HG11 . VAL A 1 56  ? 27.020 47.978 -23.259 1.00 132.33 ? 271 VAL A HG11 1 
ATOM   532  H  HG12 . VAL A 1 56  ? 27.799 48.339 -24.596 1.00 132.33 ? 271 VAL A HG12 1 
ATOM   533  H  HG13 . VAL A 1 56  ? 28.414 48.736 -23.186 1.00 132.33 ? 271 VAL A HG13 1 
ATOM   534  H  HG21 . VAL A 1 56  ? 25.917 49.695 -21.956 1.00 149.60 ? 271 VAL A HG21 1 
ATOM   535  H  HG22 . VAL A 1 56  ? 27.283 50.493 -21.813 1.00 149.60 ? 271 VAL A HG22 1 
ATOM   536  H  HG23 . VAL A 1 56  ? 25.996 51.219 -22.397 1.00 149.60 ? 271 VAL A HG23 1 
ATOM   537  N  N    . ARG A 1 57  ? 27.019 50.805 -26.722 1.00 118.31 ? 272 ARG A N    1 
ATOM   538  C  CA   . ARG A 1 57  ? 27.042 50.358 -28.110 1.00 117.95 ? 272 ARG A CA   1 
ATOM   539  C  C    . ARG A 1 57  ? 28.256 50.907 -28.881 1.00 115.86 ? 272 ARG A C    1 
ATOM   540  O  O    . ARG A 1 57  ? 28.598 50.392 -29.946 1.00 115.35 ? 272 ARG A O    1 
ATOM   541  C  CB   . ARG A 1 57  ? 25.720 50.755 -28.789 1.00 121.53 ? 272 ARG A CB   1 
ATOM   542  C  CG   . ARG A 1 57  ? 24.484 50.077 -28.158 1.00 122.51 ? 272 ARG A CG   1 
ATOM   543  C  CD   . ARG A 1 57  ? 23.158 50.559 -28.750 1.00 124.03 ? 272 ARG A CD   1 
ATOM   544  N  NE   . ARG A 1 57  ? 22.234 49.443 -28.966 1.00 131.67 ? 272 ARG A NE   1 
ATOM   545  C  CZ   . ARG A 1 57  ? 21.098 49.514 -29.661 1.00 136.28 ? 272 ARG A CZ   1 
ATOM   546  N  NH1  . ARG A 1 57  ? 20.717 50.655 -30.221 1.00 139.55 ? 272 ARG A NH1  1 
ATOM   547  N  NH2  . ARG A 1 57  ? 20.335 48.437 -29.798 1.00 134.90 ? 272 ARG A NH2  1 
ATOM   548  H  H    . ARG A 1 57  ? 26.299 51.222 -26.507 1.00 141.97 ? 272 ARG A H    1 
ATOM   549  H  HA   . ARG A 1 57  ? 27.100 49.390 -28.123 1.00 141.55 ? 272 ARG A HA   1 
ATOM   550  H  HB2  . ARG A 1 57  ? 25.604 51.715 -28.715 1.00 145.83 ? 272 ARG A HB2  1 
ATOM   551  H  HB3  . ARG A 1 57  ? 25.757 50.498 -29.724 1.00 145.83 ? 272 ARG A HB3  1 
ATOM   552  H  HG2  . ARG A 1 57  ? 24.543 49.119 -28.302 1.00 147.01 ? 272 ARG A HG2  1 
ATOM   553  H  HG3  . ARG A 1 57  ? 24.472 50.267 -27.207 1.00 147.01 ? 272 ARG A HG3  1 
ATOM   554  H  HD2  . ARG A 1 57  ? 22.742 51.185 -28.137 1.00 148.84 ? 272 ARG A HD2  1 
ATOM   555  H  HD3  . ARG A 1 57  ? 23.325 50.986 -29.605 1.00 148.84 ? 272 ARG A HD3  1 
ATOM   556  H  HE   . ARG A 1 57  ? 22.440 48.684 -28.619 1.00 158.00 ? 272 ARG A HE   1 
ATOM   557  H  HH11 . ARG A 1 57  ? 21.205 51.358 -30.139 1.00 167.46 ? 272 ARG A HH11 1 
ATOM   558  H  HH12 . ARG A 1 57  ? 19.982 50.691 -30.667 1.00 167.46 ? 272 ARG A HH12 1 
ATOM   559  H  HH21 . ARG A 1 57  ? 20.573 47.693 -29.437 1.00 161.88 ? 272 ARG A HH21 1 
ATOM   560  H  HH22 . ARG A 1 57  ? 19.601 48.483 -30.244 1.00 161.88 ? 272 ARG A HH22 1 
ATOM   561  N  N    . GLN A 1 58  ? 28.919 51.924 -28.324 1.00 119.70 ? 273 GLN A N    1 
ATOM   562  C  CA   . GLN A 1 58  ? 30.119 52.518 -28.934 1.00 117.93 ? 273 GLN A CA   1 
ATOM   563  C  C    . GLN A 1 58  ? 31.365 51.623 -28.882 1.00 111.73 ? 273 GLN A C    1 
ATOM   564  O  O    . GLN A 1 58  ? 32.276 51.758 -29.701 1.00 110.37 ? 273 GLN A O    1 
ATOM   565  C  CB   . GLN A 1 58  ? 30.450 53.851 -28.249 1.00 114.52 ? 273 GLN A CB   1 
ATOM   566  C  CG   . GLN A 1 58  ? 29.421 54.946 -28.468 1.00 122.58 ? 273 GLN A CG   1 
ATOM   567  C  CD   . GLN A 1 58  ? 30.008 56.335 -28.300 1.00 120.60 ? 273 GLN A CD   1 
ATOM   568  O  OE1  . GLN A 1 58  ? 31.070 56.646 -28.852 1.00 119.56 ? 273 GLN A OE1  1 
ATOM   569  N  NE2  . GLN A 1 58  ? 29.318 57.181 -27.536 1.00 112.57 ? 273 GLN A NE2  1 
ATOM   570  H  H    . GLN A 1 58  ? 28.693 52.293 -27.582 1.00 143.64 ? 273 GLN A H    1 
ATOM   571  H  HA   . GLN A 1 58  ? 29.930 52.706 -29.867 1.00 141.52 ? 273 GLN A HA   1 
ATOM   572  H  HB2  . GLN A 1 58  ? 30.519 53.700 -27.293 1.00 137.43 ? 273 GLN A HB2  1 
ATOM   573  H  HB3  . GLN A 1 58  ? 31.299 54.172 -28.591 1.00 137.43 ? 273 GLN A HB3  1 
ATOM   574  H  HG2  . GLN A 1 58  ? 29.070 54.875 -29.370 1.00 147.10 ? 273 GLN A HG2  1 
ATOM   575  H  HG3  . GLN A 1 58  ? 28.705 54.842 -27.823 1.00 147.10 ? 273 GLN A HG3  1 
ATOM   576  H  HE21 . GLN A 1 58  ? 28.582 56.928 -27.169 1.00 135.08 ? 273 GLN A HE21 1 
ATOM   577  H  HE22 . GLN A 1 58  ? 29.609 57.981 -27.409 1.00 135.08 ? 273 GLN A HE22 1 
ATOM   578  N  N    . ILE A 1 59  ? 31.410 50.720 -27.912 1.00 115.80 ? 274 ILE A N    1 
ATOM   579  C  CA   . ILE A 1 59  ? 32.608 49.929 -27.668 1.00 109.94 ? 274 ILE A CA   1 
ATOM   580  C  C    . ILE A 1 59  ? 32.305 48.428 -27.716 1.00 114.01 ? 274 ILE A C    1 
ATOM   581  O  O    . ILE A 1 59  ? 33.176 47.614 -27.416 1.00 110.46 ? 274 ILE A O    1 
ATOM   582  C  CB   . ILE A 1 59  ? 33.241 50.331 -26.317 1.00 106.83 ? 274 ILE A CB   1 
ATOM   583  C  CG1  . ILE A 1 59  ? 32.260 50.078 -25.160 1.00 109.05 ? 274 ILE A CG1  1 
ATOM   584  C  CG2  . ILE A 1 59  ? 33.636 51.806 -26.343 1.00 101.21 ? 274 ILE A CG2  1 
ATOM   585  C  CD1  . ILE A 1 59  ? 32.902 50.060 -23.769 1.00 97.94  ? 274 ILE A CD1  1 
ATOM   586  H  H    . ILE A 1 59  ? 30.758 50.545 -27.379 1.00 138.96 ? 274 ILE A H    1 
ATOM   587  H  HA   . ILE A 1 59  ? 33.255 50.122 -28.365 1.00 131.93 ? 274 ILE A HA   1 
ATOM   588  H  HB   . ILE A 1 59  ? 34.037 49.796 -26.173 1.00 128.20 ? 274 ILE A HB   1 
ATOM   589  H  HG12 . ILE A 1 59  ? 31.589 50.778 -25.165 1.00 130.86 ? 274 ILE A HG12 1 
ATOM   590  H  HG13 . ILE A 1 59  ? 31.835 49.217 -25.298 1.00 130.86 ? 274 ILE A HG13 1 
ATOM   591  H  HG21 . ILE A 1 59  ? 34.031 52.042 -25.489 1.00 121.45 ? 274 ILE A HG21 1 
ATOM   592  H  HG22 . ILE A 1 59  ? 34.278 51.947 -27.056 1.00 121.45 ? 274 ILE A HG22 1 
ATOM   593  H  HG23 . ILE A 1 59  ? 32.843 52.342 -26.501 1.00 121.45 ? 274 ILE A HG23 1 
ATOM   594  H  HD11 . ILE A 1 59  ? 32.213 49.896 -23.106 1.00 117.53 ? 274 ILE A HD11 1 
ATOM   595  H  HD12 . ILE A 1 59  ? 33.568 49.355 -23.737 1.00 117.53 ? 274 ILE A HD12 1 
ATOM   596  H  HD13 . ILE A 1 59  ? 33.321 50.919 -23.604 1.00 117.53 ? 274 ILE A HD13 1 
ATOM   597  N  N    . TYR A 1 60  ? 31.075 48.079 -28.109 1.00 101.71 ? 275 TYR A N    1 
ATOM   598  C  CA   . TYR A 1 60  ? 30.584 46.694 -28.088 1.00 101.24 ? 275 TYR A CA   1 
ATOM   599  C  C    . TYR A 1 60  ? 31.593 45.718 -28.701 1.00 99.15  ? 275 TYR A C    1 
ATOM   600  O  O    . TYR A 1 60  ? 31.807 44.620 -28.173 1.00 94.30  ? 275 TYR A O    1 
ATOM   601  C  CB   . TYR A 1 60  ? 29.233 46.587 -28.839 1.00 108.77 ? 275 TYR A CB   1 
ATOM   602  C  CG   . TYR A 1 60  ? 28.002 46.254 -27.992 1.00 104.99 ? 275 TYR A CG   1 
ATOM   603  C  CD1  . TYR A 1 60  ? 27.942 46.573 -26.637 1.00 106.48 ? 275 TYR A CD1  1 
ATOM   604  C  CD2  . TYR A 1 60  ? 26.899 45.616 -28.558 1.00 102.74 ? 275 TYR A CD2  1 
ATOM   605  C  CE1  . TYR A 1 60  ? 26.820 46.266 -25.868 1.00 108.26 ? 275 TYR A CE1  1 
ATOM   606  C  CE2  . TYR A 1 60  ? 25.771 45.306 -27.799 1.00 104.98 ? 275 TYR A CE2  1 
ATOM   607  C  CZ   . TYR A 1 60  ? 25.737 45.635 -26.452 1.00 108.76 ? 275 TYR A CZ   1 
ATOM   608  O  OH   . TYR A 1 60  ? 24.629 45.339 -25.674 1.00 103.47 ? 275 TYR A OH   1 
ATOM   609  H  H    . TYR A 1 60  ? 30.493 48.641 -28.399 1.00 122.05 ? 275 TYR A H    1 
ATOM   610  H  HA   . TYR A 1 60  ? 30.435 46.429 -27.167 1.00 121.49 ? 275 TYR A HA   1 
ATOM   611  H  HB2  . TYR A 1 60  ? 29.060 47.436 -29.275 1.00 130.52 ? 275 TYR A HB2  1 
ATOM   612  H  HB3  . TYR A 1 60  ? 29.315 45.893 -29.512 1.00 130.52 ? 275 TYR A HB3  1 
ATOM   613  H  HD1  . TYR A 1 60  ? 28.666 46.998 -26.236 1.00 127.78 ? 275 TYR A HD1  1 
ATOM   614  H  HD2  . TYR A 1 60  ? 26.915 45.393 -29.461 1.00 123.29 ? 275 TYR A HD2  1 
ATOM   615  H  HE1  . TYR A 1 60  ? 26.799 46.488 -24.965 1.00 129.91 ? 275 TYR A HE1  1 
ATOM   616  H  HE2  . TYR A 1 60  ? 25.045 44.881 -28.194 1.00 125.98 ? 275 TYR A HE2  1 
ATOM   617  H  HH   . TYR A 1 60  ? 24.044 44.959 -26.141 1.00 124.16 ? 275 TYR A HH   1 
ATOM   618  N  N    . ASP A 1 61  ? 32.215 46.134 -29.804 1.00 116.06 ? 276 ASP A N    1 
ATOM   619  C  CA   . ASP A 1 61  ? 33.111 45.276 -30.577 1.00 114.11 ? 276 ASP A CA   1 
ATOM   620  C  C    . ASP A 1 61  ? 34.490 45.083 -29.918 1.00 116.27 ? 276 ASP A C    1 
ATOM   621  O  O    . ASP A 1 61  ? 35.211 44.129 -30.241 1.00 111.23 ? 276 ASP A O    1 
ATOM   622  C  CB   . ASP A 1 61  ? 33.287 45.864 -31.974 1.00 110.76 ? 276 ASP A CB   1 
ATOM   623  C  CG   . ASP A 1 61  ? 34.046 47.169 -31.957 1.00 108.70 ? 276 ASP A CG   1 
ATOM   624  O  OD1  . ASP A 1 61  ? 34.856 47.395 -32.878 1.00 114.15 ? 276 ASP A OD1  1 
ATOM   625  O  OD2  . ASP A 1 61  ? 33.838 47.964 -31.018 1.00 107.11 ? 276 ASP A OD2  1 
ATOM   626  H  H    . ASP A 1 61  ? 32.132 46.926 -30.130 1.00 139.27 ? 276 ASP A H    1 
ATOM   627  H  HA   . ASP A 1 61  ? 32.702 44.401 -30.671 1.00 136.93 ? 276 ASP A HA   1 
ATOM   628  H  HB2  . ASP A 1 61  ? 33.781 45.235 -32.523 1.00 132.91 ? 276 ASP A HB2  1 
ATOM   629  H  HB3  . ASP A 1 61  ? 32.413 46.029 -32.361 1.00 132.91 ? 276 ASP A HB3  1 
ATOM   630  N  N    . LYS A 1 62  ? 34.847 45.989 -29.002 1.00 106.69 ? 277 LYS A N    1 
ATOM   631  C  CA   . LYS A 1 62  ? 36.133 45.942 -28.286 1.00 99.05  ? 277 LYS A CA   1 
ATOM   632  C  C    . LYS A 1 62  ? 36.222 44.759 -27.297 1.00 95.08  ? 277 LYS A C    1 
ATOM   633  O  O    . LYS A 1 62  ? 37.322 44.304 -26.958 1.00 87.20  ? 277 LYS A O    1 
ATOM   634  C  CB   . LYS A 1 62  ? 36.371 47.272 -27.544 1.00 93.23  ? 277 LYS A CB   1 
ATOM   635  C  CG   . LYS A 1 62  ? 37.575 48.088 -28.054 1.00 96.12  ? 277 LYS A CG   1 
ATOM   636  C  CD   . LYS A 1 62  ? 37.554 49.552 -27.570 1.00 91.59  ? 277 LYS A CD   1 
ATOM   637  C  CE   . LYS A 1 62  ? 38.734 50.358 -28.113 1.00 89.36  ? 277 LYS A CE   1 
ATOM   638  N  NZ   . LYS A 1 62  ? 38.823 50.296 -29.611 1.00 101.47 ? 277 LYS A NZ   1 
ATOM   639  H  H    . LYS A 1 62  ? 34.353 46.654 -28.772 1.00 128.02 ? 277 LYS A H    1 
ATOM   640  H  HA   . LYS A 1 62  ? 36.845 45.835 -28.936 1.00 118.86 ? 277 LYS A HA   1 
ATOM   641  H  HB2  . LYS A 1 62  ? 35.580 47.826 -27.640 1.00 111.87 ? 277 LYS A HB2  1 
ATOM   642  H  HB3  . LYS A 1 62  ? 36.523 47.080 -26.605 1.00 111.87 ? 277 LYS A HB3  1 
ATOM   643  H  HG2  . LYS A 1 62  ? 38.393 47.678 -27.733 1.00 115.34 ? 277 LYS A HG2  1 
ATOM   644  H  HG3  . LYS A 1 62  ? 37.565 48.093 -29.024 1.00 115.34 ? 277 LYS A HG3  1 
ATOM   645  H  HD2  . LYS A 1 62  ? 36.735 49.975 -27.872 1.00 109.91 ? 277 LYS A HD2  1 
ATOM   646  H  HD3  . LYS A 1 62  ? 37.599 49.567 -26.601 1.00 109.91 ? 277 LYS A HD3  1 
ATOM   647  H  HE2  . LYS A 1 62  ? 38.630 51.287 -27.855 1.00 107.23 ? 277 LYS A HE2  1 
ATOM   648  H  HE3  . LYS A 1 62  ? 39.558 50.000 -27.747 1.00 107.23 ? 277 LYS A HE3  1 
ATOM   649  H  HZ1  . LYS A 1 62  ? 39.518 50.774 -29.894 1.00 121.77 ? 277 LYS A HZ1  1 
ATOM   650  H  HZ2  . LYS A 1 62  ? 38.925 49.452 -29.875 1.00 121.77 ? 277 LYS A HZ2  1 
ATOM   651  H  HZ3  . LYS A 1 62  ? 38.079 50.625 -29.973 1.00 121.77 ? 277 LYS A HZ3  1 
ATOM   652  N  N    . PHE A 1 63  ? 35.064 44.280 -26.835 1.00 92.87  ? 278 PHE A N    1 
ATOM   653  C  CA   . PHE A 1 63  ? 34.966 43.066 -26.015 1.00 88.28  ? 278 PHE A CA   1 
ATOM   654  C  C    . PHE A 1 63  ? 34.313 41.929 -26.789 1.00 95.22  ? 278 PHE A C    1 
ATOM   655  O  O    . PHE A 1 63  ? 33.621 42.158 -27.792 1.00 92.63  ? 278 PHE A O    1 
ATOM   656  C  CB   . PHE A 1 63  ? 34.156 43.322 -24.751 1.00 88.76  ? 278 PHE A CB   1 
ATOM   657  C  CG   . PHE A 1 63  ? 34.851 44.187 -23.763 1.00 85.34  ? 278 PHE A CG   1 
ATOM   658  C  CD1  . PHE A 1 63  ? 35.718 43.627 -22.844 1.00 83.29  ? 278 PHE A CD1  1 
ATOM   659  C  CD2  . PHE A 1 63  ? 34.642 45.560 -23.749 1.00 81.12  ? 278 PHE A CD2  1 
ATOM   660  C  CE1  . PHE A 1 63  ? 36.377 44.412 -21.935 1.00 80.61  ? 278 PHE A CE1  1 
ATOM   661  C  CE2  . PHE A 1 63  ? 35.297 46.356 -22.841 1.00 79.30  ? 278 PHE A CE2  1 
ATOM   662  C  CZ   . PHE A 1 63  ? 36.167 45.780 -21.922 1.00 80.73  ? 278 PHE A CZ   1 
ATOM   663  H  H    . PHE A 1 63  ? 34.303 44.650 -26.986 1.00 111.44 ? 278 PHE A H    1 
ATOM   664  H  HA   . PHE A 1 63  ? 35.857 42.784 -25.753 1.00 105.94 ? 278 PHE A HA   1 
ATOM   665  H  HB2  . PHE A 1 63  ? 33.325 43.758 -24.995 1.00 106.51 ? 278 PHE A HB2  1 
ATOM   666  H  HB3  . PHE A 1 63  ? 33.969 42.472 -24.322 1.00 106.51 ? 278 PHE A HB3  1 
ATOM   667  H  HD1  . PHE A 1 63  ? 35.864 42.708 -22.851 1.00 99.95  ? 278 PHE A HD1  1 
ATOM   668  H  HD2  . PHE A 1 63  ? 34.061 45.945 -24.366 1.00 97.35  ? 278 PHE A HD2  1 
ATOM   669  H  HE1  . PHE A 1 63  ? 36.958 44.024 -21.320 1.00 96.73  ? 278 PHE A HE1  1 
ATOM   670  H  HE2  . PHE A 1 63  ? 35.153 47.274 -22.836 1.00 95.16  ? 278 PHE A HE2  1 
ATOM   671  H  HZ   . PHE A 1 63  ? 36.610 46.314 -21.302 1.00 96.88  ? 278 PHE A HZ   1 
ATOM   672  N  N    . PRO A 1 64  ? 34.517 40.691 -26.321 1.00 139.97 ? 279 PRO A N    1 
ATOM   673  C  CA   . PRO A 1 64  ? 33.845 39.588 -27.013 1.00 138.92 ? 279 PRO A CA   1 
ATOM   674  C  C    . PRO A 1 64  ? 32.338 39.553 -26.763 1.00 137.85 ? 279 PRO A C    1 
ATOM   675  O  O    . PRO A 1 64  ? 31.769 40.420 -26.094 1.00 135.58 ? 279 PRO A O    1 
ATOM   676  C  CB   . PRO A 1 64  ? 34.524 38.340 -26.429 1.00 137.38 ? 279 PRO A CB   1 
ATOM   677  C  CG   . PRO A 1 64  ? 35.060 38.769 -25.098 1.00 132.79 ? 279 PRO A CG   1 
ATOM   678  C  CD   . PRO A 1 64  ? 35.402 40.225 -25.234 1.00 135.23 ? 279 PRO A CD   1 
ATOM   679  H  HA   . PRO A 1 64  ? 34.014 39.633 -27.967 1.00 166.71 ? 279 PRO A HA   1 
ATOM   680  H  HB2  . PRO A 1 64  ? 33.870 37.632 -26.322 1.00 164.86 ? 279 PRO A HB2  1 
ATOM   681  H  HB3  . PRO A 1 64  ? 35.244 38.057 -27.013 1.00 164.86 ? 279 PRO A HB3  1 
ATOM   682  H  HG2  . PRO A 1 64  ? 34.380 38.642 -24.418 1.00 159.35 ? 279 PRO A HG2  1 
ATOM   683  H  HG3  . PRO A 1 64  ? 35.854 38.253 -24.887 1.00 159.35 ? 279 PRO A HG3  1 
ATOM   684  H  HD2  . PRO A 1 64  ? 35.202 40.697 -24.411 1.00 162.28 ? 279 PRO A HD2  1 
ATOM   685  H  HD3  . PRO A 1 64  ? 36.332 40.331 -25.488 1.00 162.28 ? 279 PRO A HD3  1 
ATOM   686  N  N    . GLU A 1 65  ? 31.697 38.544 -27.333 1.00 108.23 ? 280 GLU A N    1 
ATOM   687  C  CA   . GLU A 1 65  ? 30.368 38.157 -26.909 1.00 105.42 ? 280 GLU A CA   1 
ATOM   688  C  C    . GLU A 1 65  ? 30.422 36.675 -26.567 1.00 108.37 ? 280 GLU A C    1 
ATOM   689  O  O    . GLU A 1 65  ? 29.746 35.849 -27.194 1.00 113.77 ? 280 GLU A O    1 
ATOM   690  C  CB   . GLU A 1 65  ? 29.333 38.453 -27.987 1.00 107.77 ? 280 GLU A CB   1 
ATOM   691  C  CG   . GLU A 1 65  ? 29.048 39.931 -28.149 1.00 106.37 ? 280 GLU A CG   1 
ATOM   692  C  CD   . GLU A 1 65  ? 27.969 40.193 -29.171 1.00 115.12 ? 280 GLU A CD   1 
ATOM   693  O  OE1  . GLU A 1 65  ? 27.756 39.324 -30.044 1.00 122.68 ? 280 GLU A OE1  1 
ATOM   694  O  OE2  . GLU A 1 65  ? 27.328 41.262 -29.099 1.00 113.61 ? 280 GLU A OE2  1 
ATOM   695  H  H    . GLU A 1 65  ? 32.016 38.065 -27.972 1.00 129.87 ? 280 GLU A H    1 
ATOM   696  H  HA   . GLU A 1 65  ? 30.127 38.649 -26.109 1.00 126.51 ? 280 GLU A HA   1 
ATOM   697  H  HB2  . GLU A 1 65  ? 29.658 38.117 -28.837 1.00 129.33 ? 280 GLU A HB2  1 
ATOM   698  H  HB3  . GLU A 1 65  ? 28.501 38.012 -27.754 1.00 129.33 ? 280 GLU A HB3  1 
ATOM   699  H  HG2  . GLU A 1 65  ? 28.753 40.293 -27.298 1.00 127.65 ? 280 GLU A HG2  1 
ATOM   700  H  HG3  . GLU A 1 65  ? 29.856 40.381 -28.440 1.00 127.65 ? 280 GLU A HG3  1 
ATOM   701  N  N    . LYS A 1 66  ? 31.245 36.357 -25.562 1.00 123.22 ? 281 LYS A N    1 
ATOM   702  C  CA   . LYS A 1 66  ? 31.388 34.988 -25.057 1.00 123.78 ? 281 LYS A CA   1 
ATOM   703  C  C    . LYS A 1 66  ? 30.091 34.344 -24.489 1.00 123.93 ? 281 LYS A C    1 
ATOM   704  O  O    . LYS A 1 66  ? 29.966 33.129 -24.617 1.00 122.08 ? 281 LYS A O    1 
ATOM   705  C  CB   . LYS A 1 66  ? 32.498 34.924 -23.983 1.00 119.67 ? 281 LYS A CB   1 
ATOM   706  C  CG   . LYS A 1 66  ? 33.924 34.842 -24.507 1.00 118.09 ? 281 LYS A CG   1 
ATOM   707  C  CD   . LYS A 1 66  ? 34.247 33.447 -25.029 1.00 114.46 ? 281 LYS A CD   1 
ATOM   708  C  CE   . LYS A 1 66  ? 35.736 33.272 -25.276 1.00 103.72 ? 281 LYS A CE   1 
ATOM   709  N  NZ   . LYS A 1 66  ? 36.513 33.416 -24.022 1.00 97.74  ? 281 LYS A NZ   1 
ATOM   710  H  H    . LYS A 1 66  ? 31.739 36.927 -25.150 1.00 147.86 ? 281 LYS A H    1 
ATOM   711  H  HA   . LYS A 1 66  ? 31.677 34.430 -25.795 1.00 148.53 ? 281 LYS A HA   1 
ATOM   712  H  HB2  . LYS A 1 66  ? 32.437 35.721 -23.432 1.00 143.60 ? 281 LYS A HB2  1 
ATOM   713  H  HB3  . LYS A 1 66  ? 32.346 34.140 -23.433 1.00 143.60 ? 281 LYS A HB3  1 
ATOM   714  H  HG2  . LYS A 1 66  ? 34.033 35.472 -25.236 1.00 141.70 ? 281 LYS A HG2  1 
ATOM   715  H  HG3  . LYS A 1 66  ? 34.542 35.048 -23.789 1.00 141.70 ? 281 LYS A HG3  1 
ATOM   716  H  HD2  . LYS A 1 66  ? 33.968 32.789 -24.374 1.00 137.36 ? 281 LYS A HD2  1 
ATOM   717  H  HD3  . LYS A 1 66  ? 33.781 33.304 -25.868 1.00 137.36 ? 281 LYS A HD3  1 
ATOM   718  H  HE2  . LYS A 1 66  ? 35.899 32.385 -25.634 1.00 124.47 ? 281 LYS A HE2  1 
ATOM   719  H  HE3  . LYS A 1 66  ? 36.040 33.948 -25.901 1.00 124.47 ? 281 LYS A HE3  1 
ATOM   720  H  HZ1  . LYS A 1 66  ? 37.381 33.310 -24.189 1.00 117.29 ? 281 LYS A HZ1  1 
ATOM   721  H  HZ2  . LYS A 1 66  ? 36.382 34.225 -23.675 1.00 117.29 ? 281 LYS A HZ2  1 
ATOM   722  H  HZ3  . LYS A 1 66  ? 36.255 32.802 -23.432 1.00 117.29 ? 281 LYS A HZ3  1 
ATOM   723  N  N    . LYS A 1 67  ? 29.120 35.062 -23.889 1.00 142.64 ? 282 LYS A N    1 
ATOM   724  C  CA   . LYS A 1 67  ? 29.062 36.519 -23.670 1.00 142.71 ? 282 LYS A CA   1 
ATOM   725  C  C    . LYS A 1 67  ? 29.652 36.919 -22.317 1.00 144.20 ? 282 LYS A C    1 
ATOM   726  O  O    . LYS A 1 67  ? 28.931 37.176 -21.350 1.00 144.85 ? 282 LYS A O    1 
ATOM   727  C  CB   . LYS A 1 67  ? 27.614 37.005 -23.774 1.00 135.88 ? 282 LYS A CB   1 
ATOM   728  C  CG   . LYS A 1 67  ? 26.914 36.690 -25.090 1.00 136.65 ? 282 LYS A CG   1 
ATOM   729  C  CD   . LYS A 1 67  ? 25.466 37.148 -25.041 1.00 137.96 ? 282 LYS A CD   1 
ATOM   730  C  CE   . LYS A 1 67  ? 24.682 36.756 -26.278 1.00 142.00 ? 282 LYS A CE   1 
ATOM   731  N  NZ   . LYS A 1 67  ? 23.221 36.916 -26.039 1.00 142.83 ? 282 LYS A NZ   1 
ATOM   732  H  H    . LYS A 1 67  ? 28.418 34.679 -23.572 1.00 171.16 ? 282 LYS A H    1 
ATOM   733  H  HA   . LYS A 1 67  ? 29.576 36.962 -24.363 1.00 171.25 ? 282 LYS A HA   1 
ATOM   734  H  HB2  . LYS A 1 67  ? 27.099 36.590 -23.064 1.00 163.06 ? 282 LYS A HB2  1 
ATOM   735  H  HB3  . LYS A 1 67  ? 27.604 37.968 -23.661 1.00 163.06 ? 282 LYS A HB3  1 
ATOM   736  H  HG2  . LYS A 1 67  ? 27.360 37.158 -25.814 1.00 163.98 ? 282 LYS A HG2  1 
ATOM   737  H  HG3  . LYS A 1 67  ? 26.929 35.733 -25.245 1.00 163.98 ? 282 LYS A HG3  1 
ATOM   738  H  HD2  . LYS A 1 67  ? 25.034 36.744 -24.272 1.00 165.55 ? 282 LYS A HD2  1 
ATOM   739  H  HD3  . LYS A 1 67  ? 25.443 38.114 -24.966 1.00 165.55 ? 282 LYS A HD3  1 
ATOM   740  H  HE2  . LYS A 1 67  ? 24.937 37.328 -27.018 1.00 170.41 ? 282 LYS A HE2  1 
ATOM   741  H  HE3  . LYS A 1 67  ? 24.858 35.826 -26.492 1.00 170.41 ? 282 LYS A HE3  1 
ATOM   742  H  HZ1  . LYS A 1 67  ? 22.767 36.684 -26.769 1.00 171.40 ? 282 LYS A HZ1  1 
ATOM   743  H  HZ2  . LYS A 1 67  ? 22.965 36.398 -25.362 1.00 171.40 ? 282 LYS A HZ2  1 
ATOM   744  H  HZ3  . LYS A 1 67  ? 23.037 37.763 -25.840 1.00 171.40 ? 282 LYS A HZ3  1 
ATOM   745  N  N    . GLY A 1 68  ? 30.977 37.001 -22.296 1.00 135.69 ? 283 GLY A N    1 
ATOM   746  C  CA   . GLY A 1 68  ? 31.762 37.264 -21.105 1.00 125.80 ? 283 GLY A CA   1 
ATOM   747  C  C    . GLY A 1 68  ? 32.410 38.621 -21.292 1.00 124.81 ? 283 GLY A C    1 
ATOM   748  O  O    . GLY A 1 68  ? 33.116 39.144 -20.419 1.00 112.98 ? 283 GLY A O    1 
ATOM   749  H  H    . GLY A 1 68  ? 31.463 36.902 -22.998 1.00 162.83 ? 283 GLY A H    1 
ATOM   750  H  HA2  . GLY A 1 68  ? 31.193 37.282 -20.319 1.00 150.97 ? 283 GLY A HA2  1 
ATOM   751  H  HA3  . GLY A 1 68  ? 32.449 36.589 -20.993 1.00 150.97 ? 283 GLY A HA3  1 
ATOM   752  N  N    . GLY A 1 69  ? 32.192 39.161 -22.488 1.00 151.13 ? 284 GLY A N    1 
ATOM   753  C  CA   . GLY A 1 69  ? 32.305 40.577 -22.740 1.00 146.61 ? 284 GLY A CA   1 
ATOM   754  C  C    . GLY A 1 69  ? 30.964 41.237 -22.467 1.00 154.15 ? 284 GLY A C    1 
ATOM   755  O  O    . GLY A 1 69  ? 29.926 40.574 -22.369 1.00 160.44 ? 284 GLY A O    1 
ATOM   756  H  H    . GLY A 1 69  ? 31.971 38.706 -23.184 1.00 181.35 ? 284 GLY A H    1 
ATOM   757  H  HA2  . GLY A 1 69  ? 32.977 40.967 -22.159 1.00 175.93 ? 284 GLY A HA2  1 
ATOM   758  H  HA3  . GLY A 1 69  ? 32.554 40.733 -23.665 1.00 175.93 ? 284 GLY A HA3  1 
ATOM   759  N  N    . LEU A 1 70  ? 30.998 42.560 -22.387 1.00 103.88 ? 285 LEU A N    1 
ATOM   760  C  CA   . LEU A 1 70  ? 29.948 43.354 -21.762 1.00 97.81  ? 285 LEU A CA   1 
ATOM   761  C  C    . LEU A 1 70  ? 28.503 43.121 -22.225 1.00 92.97  ? 285 LEU A C    1 
ATOM   762  O  O    . LEU A 1 70  ? 27.567 43.418 -21.479 1.00 91.45  ? 285 LEU A O    1 
ATOM   763  C  CB   . LEU A 1 70  ? 30.288 44.831 -21.957 1.00 98.76  ? 285 LEU A CB   1 
ATOM   764  C  CG   . LEU A 1 70  ? 29.347 45.849 -21.306 1.00 101.29 ? 285 LEU A CG   1 
ATOM   765  C  CD1  . LEU A 1 70  ? 29.198 45.602 -19.813 1.00 89.17  ? 285 LEU A CD1  1 
ATOM   766  C  CD2  . LEU A 1 70  ? 29.873 47.242 -21.551 1.00 102.93 ? 285 LEU A CD2  1 
ATOM   767  H  H    . LEU A 1 70  ? 31.642 43.038 -22.698 1.00 124.66 ? 285 LEU A H    1 
ATOM   768  H  HA   . LEU A 1 70  ? 29.970 43.179 -20.808 1.00 117.37 ? 285 LEU A HA   1 
ATOM   769  H  HB2  . LEU A 1 70  ? 31.174 44.987 -21.594 1.00 118.51 ? 285 LEU A HB2  1 
ATOM   770  H  HB3  . LEU A 1 70  ? 30.295 45.016 -22.909 1.00 118.51 ? 285 LEU A HB3  1 
ATOM   771  H  HG   . LEU A 1 70  ? 28.470 45.781 -21.714 1.00 121.55 ? 285 LEU A HG   1 
ATOM   772  H  HD11 . LEU A 1 70  ? 28.597 46.267 -19.442 1.00 107.00 ? 285 LEU A HD11 1 
ATOM   773  H  HD12 . LEU A 1 70  ? 28.835 44.713 -19.676 1.00 107.00 ? 285 LEU A HD12 1 
ATOM   774  H  HD13 . LEU A 1 70  ? 30.070 45.673 -19.393 1.00 107.00 ? 285 LEU A HD13 1 
ATOM   775  H  HD21 . LEU A 1 70  ? 29.274 47.883 -21.136 1.00 123.52 ? 285 LEU A HD21 1 
ATOM   776  H  HD22 . LEU A 1 70  ? 30.759 47.318 -21.162 1.00 123.52 ? 285 LEU A HD22 1 
ATOM   777  H  HD23 . LEU A 1 70  ? 29.917 47.399 -22.507 1.00 123.52 ? 285 LEU A HD23 1 
ATOM   778  N  N    . ARG A 1 71  ? 28.300 42.605 -23.430 1.00 99.26  ? 286 ARG A N    1 
ATOM   779  C  CA   . ARG A 1 71  ? 26.946 42.584 -23.990 1.00 103.77 ? 286 ARG A CA   1 
ATOM   780  C  C    . ARG A 1 71  ? 25.951 41.872 -23.062 1.00 97.77  ? 286 ARG A C    1 
ATOM   781  O  O    . ARG A 1 71  ? 24.855 42.377 -22.808 1.00 93.17  ? 286 ARG A O    1 
ATOM   782  C  CB   . ARG A 1 71  ? 26.933 41.931 -25.380 1.00 103.68 ? 286 ARG A CB   1 
ATOM   783  C  CG   . ARG A 1 71  ? 25.718 42.344 -26.215 1.00 106.18 ? 286 ARG A CG   1 
ATOM   784  C  CD   . ARG A 1 71  ? 24.779 41.186 -26.502 1.00 108.12 ? 286 ARG A CD   1 
ATOM   785  N  NE   . ARG A 1 71  ? 23.471 41.646 -26.976 1.00 113.24 ? 286 ARG A NE   1 
ATOM   786  C  CZ   . ARG A 1 71  ? 22.462 40.838 -27.295 1.00 117.13 ? 286 ARG A CZ   1 
ATOM   787  N  NH1  . ARG A 1 71  ? 22.604 39.526 -27.195 1.00 120.18 ? 286 ARG A NH1  1 
ATOM   788  N  NH2  . ARG A 1 71  ? 21.307 41.340 -27.716 1.00 117.24 ? 286 ARG A NH2  1 
ATOM   789  H  H    . ARG A 1 71  ? 28.908 42.267 -23.936 1.00 119.11 ? 286 ARG A H    1 
ATOM   790  H  HA   . ARG A 1 71  ? 26.643 43.500 -24.095 1.00 124.52 ? 286 ARG A HA   1 
ATOM   791  H  HB2  . ARG A 1 71  ? 27.733 42.196 -25.862 1.00 124.42 ? 286 ARG A HB2  1 
ATOM   792  H  HB3  . ARG A 1 71  ? 26.912 40.967 -25.277 1.00 124.42 ? 286 ARG A HB3  1 
ATOM   793  H  HG2  . ARG A 1 71  ? 25.220 43.022 -25.732 1.00 127.42 ? 286 ARG A HG2  1 
ATOM   794  H  HG3  . ARG A 1 71  ? 26.025 42.700 -27.064 1.00 127.42 ? 286 ARG A HG3  1 
ATOM   795  H  HD2  . ARG A 1 71  ? 25.169 40.623 -27.189 1.00 129.75 ? 286 ARG A HD2  1 
ATOM   796  H  HD3  . ARG A 1 71  ? 24.644 40.676 -25.688 1.00 129.75 ? 286 ARG A HD3  1 
ATOM   797  H  HE   . ARG A 1 71  ? 23.347 42.493 -27.053 1.00 135.89 ? 286 ARG A HE   1 
ATOM   798  H  HH11 . ARG A 1 71  ? 23.349 39.194 -26.922 1.00 144.21 ? 286 ARG A HH11 1 
ATOM   799  H  HH12 . ARG A 1 71  ? 21.952 39.005 -27.401 1.00 144.21 ? 286 ARG A HH12 1 
ATOM   800  H  HH21 . ARG A 1 71  ? 21.208 42.191 -27.784 1.00 140.68 ? 286 ARG A HH21 1 
ATOM   801  H  HH22 . ARG A 1 71  ? 20.659 40.813 -27.921 1.00 140.68 ? 286 ARG A HH22 1 
ATOM   802  N  N    . GLU A 1 72  ? 26.334 40.713 -22.543 1.00 109.66 ? 287 GLU A N    1 
ATOM   803  C  CA   . GLU A 1 72  ? 25.433 39.942 -21.692 1.00 110.81 ? 287 GLU A CA   1 
ATOM   804  C  C    . GLU A 1 72  ? 25.403 40.465 -20.262 1.00 109.49 ? 287 GLU A C    1 
ATOM   805  O  O    . GLU A 1 72  ? 24.417 40.281 -19.548 1.00 110.34 ? 287 GLU A O    1 
ATOM   806  C  CB   . GLU A 1 72  ? 25.845 38.469 -21.697 1.00 115.31 ? 287 GLU A CB   1 
ATOM   807  C  CG   . GLU A 1 72  ? 25.136 37.573 -20.676 1.00 121.16 ? 287 GLU A CG   1 
ATOM   808  C  CD   . GLU A 1 72  ? 25.601 36.119 -20.751 1.00 121.91 ? 287 GLU A CD   1 
ATOM   809  O  OE1  . GLU A 1 72  ? 26.828 35.887 -20.637 1.00 108.08 ? 287 GLU A OE1  1 
ATOM   810  O  OE2  . GLU A 1 72  ? 24.745 35.215 -20.933 1.00 119.04 ? 287 GLU A OE2  1 
ATOM   811  H  H    . GLU A 1 72  ? 27.105 40.351 -22.667 1.00 131.59 ? 287 GLU A H    1 
ATOM   812  H  HA   . GLU A 1 72  ? 24.534 40.002 -22.051 1.00 132.97 ? 287 GLU A HA   1 
ATOM   813  H  HB2  . GLU A 1 72  ? 25.664 38.105 -22.578 1.00 138.37 ? 287 GLU A HB2  1 
ATOM   814  H  HB3  . GLU A 1 72  ? 26.797 38.418 -21.516 1.00 138.37 ? 287 GLU A HB3  1 
ATOM   815  H  HG2  . GLU A 1 72  ? 25.321 37.902 -19.783 1.00 145.39 ? 287 GLU A HG2  1 
ATOM   816  H  HG3  . GLU A 1 72  ? 24.181 37.592 -20.847 1.00 145.39 ? 287 GLU A HG3  1 
ATOM   817  N  N    . LEU A 1 73  ? 26.481 41.117 -19.844 1.00 84.22  ? 288 LEU A N    1 
ATOM   818  C  CA   . LEU A 1 73  ? 26.636 41.471 -18.438 1.00 75.87  ? 288 LEU A CA   1 
ATOM   819  C  C    . LEU A 1 73  ? 25.903 42.752 -18.052 1.00 74.78  ? 288 LEU A C    1 
ATOM   820  O  O    . LEU A 1 73  ? 25.408 42.859 -16.934 1.00 72.20  ? 288 LEU A O    1 
ATOM   821  C  CB   . LEU A 1 73  ? 28.121 41.610 -18.087 1.00 71.37  ? 288 LEU A CB   1 
ATOM   822  C  CG   . LEU A 1 73  ? 28.408 41.895 -16.616 1.00 71.11  ? 288 LEU A CG   1 
ATOM   823  C  CD1  . LEU A 1 73  ? 27.761 40.822 -15.736 1.00 72.90  ? 288 LEU A CD1  1 
ATOM   824  C  CD2  . LEU A 1 73  ? 29.888 41.979 -16.340 1.00 71.61  ? 288 LEU A CD2  1 
ATOM   825  H  H    . LEU A 1 73  ? 27.132 41.365 -20.348 1.00 101.07 ? 288 LEU A H    1 
ATOM   826  H  HA   . LEU A 1 73  ? 26.273 40.752 -17.897 1.00 91.05  ? 288 LEU A HA   1 
ATOM   827  H  HB2  . LEU A 1 73  ? 28.572 40.783 -18.318 1.00 85.64  ? 288 LEU A HB2  1 
ATOM   828  H  HB3  . LEU A 1 73  ? 28.494 42.340 -18.605 1.00 85.64  ? 288 LEU A HB3  1 
ATOM   829  H  HG   . LEU A 1 73  ? 28.013 42.750 -16.380 1.00 85.33  ? 288 LEU A HG   1 
ATOM   830  H  HD11 . LEU A 1 73  ? 27.953 41.019 -14.806 1.00 87.48  ? 288 LEU A HD11 1 
ATOM   831  H  HD12 . LEU A 1 73  ? 26.803 40.828 -15.885 1.00 87.48  ? 288 LEU A HD12 1 
ATOM   832  H  HD13 . LEU A 1 73  ? 28.128 39.956 -15.974 1.00 87.48  ? 288 LEU A HD13 1 
ATOM   833  H  HD21 . LEU A 1 73  ? 30.024 42.161 -15.397 1.00 85.94  ? 288 LEU A HD21 1 
ATOM   834  H  HD22 . LEU A 1 73  ? 30.301 41.134 -16.577 1.00 85.94  ? 288 LEU A HD22 1 
ATOM   835  H  HD23 . LEU A 1 73  ? 30.269 42.694 -16.873 1.00 85.94  ? 288 LEU A HD23 1 
ATOM   836  N  N    . TYR A 1 74  ? 25.852 43.721 -18.965 1.00 103.02 ? 289 TYR A N    1 
ATOM   837  C  CA   . TYR A 1 74  ? 25.201 45.005 -18.696 1.00 105.94 ? 289 TYR A CA   1 
ATOM   838  C  C    . TYR A 1 74  ? 23.709 44.793 -18.456 1.00 113.60 ? 289 TYR A C    1 
ATOM   839  O  O    . TYR A 1 74  ? 23.103 45.438 -17.596 1.00 106.63 ? 289 TYR A O    1 
ATOM   840  C  CB   . TYR A 1 74  ? 25.431 45.982 -19.858 1.00 110.79 ? 289 TYR A CB   1 
ATOM   841  C  CG   . TYR A 1 74  ? 24.957 47.398 -19.589 1.00 112.83 ? 289 TYR A CG   1 
ATOM   842  C  CD1  . TYR A 1 74  ? 25.861 48.411 -19.297 1.00 108.99 ? 289 TYR A CD1  1 
ATOM   843  C  CD2  . TYR A 1 74  ? 23.606 47.722 -19.639 1.00 110.99 ? 289 TYR A CD2  1 
ATOM   844  C  CE1  . TYR A 1 74  ? 25.429 49.706 -19.056 1.00 110.44 ? 289 TYR A CE1  1 
ATOM   845  C  CE2  . TYR A 1 74  ? 23.167 49.009 -19.398 1.00 111.45 ? 289 TYR A CE2  1 
ATOM   846  C  CZ   . TYR A 1 74  ? 24.080 49.997 -19.109 1.00 109.77 ? 289 TYR A CZ   1 
ATOM   847  O  OH   . TYR A 1 74  ? 23.639 51.277 -18.868 1.00 106.41 ? 289 TYR A OH   1 
ATOM   848  H  H    . TYR A 1 74  ? 26.188 43.659 -19.754 1.00 123.62 ? 289 TYR A H    1 
ATOM   849  H  HA   . TYR A 1 74  ? 25.584 45.394 -17.894 1.00 127.13 ? 289 TYR A HA   1 
ATOM   850  H  HB2  . TYR A 1 74  ? 26.381 46.021 -20.048 1.00 132.95 ? 289 TYR A HB2  1 
ATOM   851  H  HB3  . TYR A 1 74  ? 24.955 45.655 -20.637 1.00 132.95 ? 289 TYR A HB3  1 
ATOM   852  H  HD1  . TYR A 1 74  ? 26.770 48.217 -19.261 1.00 130.78 ? 289 TYR A HD1  1 
ATOM   853  H  HD2  . TYR A 1 74  ? 22.985 47.058 -19.834 1.00 133.18 ? 289 TYR A HD2  1 
ATOM   854  H  HE1  . TYR A 1 74  ? 26.045 50.375 -18.858 1.00 132.53 ? 289 TYR A HE1  1 
ATOM   855  H  HE2  . TYR A 1 74  ? 22.259 49.207 -19.433 1.00 133.74 ? 289 TYR A HE2  1 
ATOM   856  H  HH   . TYR A 1 74  ? 24.292 51.779 -18.703 1.00 127.69 ? 289 TYR A HH   1 
ATOM   857  N  N    . ASP A 1 75  ? 23.133 43.877 -19.228 1.00 152.29 ? 290 ASP A N    1 
ATOM   858  C  CA   . ASP A 1 75  ? 21.720 43.539 -19.119 1.00 155.22 ? 290 ASP A CA   1 
ATOM   859  C  C    . ASP A 1 75  ? 21.355 43.187 -17.676 1.00 150.48 ? 290 ASP A C    1 
ATOM   860  O  O    . ASP A 1 75  ? 20.426 43.757 -17.098 1.00 150.77 ? 290 ASP A O    1 
ATOM   861  C  CB   . ASP A 1 75  ? 21.381 42.363 -20.044 1.00 160.48 ? 290 ASP A CB   1 
ATOM   862  C  CG   . ASP A 1 75  ? 21.926 42.542 -21.448 1.00 166.20 ? 290 ASP A CG   1 
ATOM   863  O  OD1  . ASP A 1 75  ? 22.832 43.380 -21.636 1.00 164.62 ? 290 ASP A OD1  1 
ATOM   864  O  OD2  . ASP A 1 75  ? 21.454 41.833 -22.361 1.00 170.78 ? 290 ASP A OD2  1 
ATOM   865  H  H    . ASP A 1 75  ? 23.548 43.430 -19.834 1.00 182.75 ? 290 ASP A H    1 
ATOM   866  H  HA   . ASP A 1 75  ? 21.186 44.302 -19.390 1.00 186.27 ? 290 ASP A HA   1 
ATOM   867  H  HB2  . ASP A 1 75  ? 21.763 41.551 -19.675 1.00 192.57 ? 290 ASP A HB2  1 
ATOM   868  H  HB3  . ASP A 1 75  ? 20.416 42.277 -20.105 1.00 192.57 ? 290 ASP A HB3  1 
ATOM   869  N  N    . ARG A 1 76  ? 22.108 42.253 -17.102 1.00 101.19 ? 291 ARG A N    1 
ATOM   870  C  CA   . ARG A 1 76  ? 21.820 41.720 -15.774 1.00 95.92  ? 291 ARG A CA   1 
ATOM   871  C  C    . ARG A 1 76  ? 21.748 42.857 -14.766 1.00 92.09  ? 291 ARG A C    1 
ATOM   872  O  O    . ARG A 1 76  ? 20.998 42.792 -13.782 1.00 92.54  ? 291 ARG A O    1 
ATOM   873  C  CB   . ARG A 1 76  ? 22.880 40.695 -15.386 1.00 87.08  ? 291 ARG A CB   1 
ATOM   874  C  CG   . ARG A 1 76  ? 23.000 39.569 -16.407 1.00 96.58  ? 291 ARG A CG   1 
ATOM   875  C  CD   . ARG A 1 76  ? 24.285 38.785 -16.237 1.00 92.40  ? 291 ARG A CD   1 
ATOM   876  N  NE   . ARG A 1 76  ? 24.027 37.347 -16.170 1.00 103.33 ? 291 ARG A NE   1 
ATOM   877  C  CZ   . ARG A 1 76  ? 24.811 36.469 -15.549 1.00 109.87 ? 291 ARG A CZ   1 
ATOM   878  N  NH1  . ARG A 1 76  ? 25.916 36.873 -14.927 1.00 100.39 ? 291 ARG A NH1  1 
ATOM   879  N  NH2  . ARG A 1 76  ? 24.482 35.183 -15.546 1.00 115.41 ? 291 ARG A NH2  1 
ATOM   880  H  H    . ARG A 1 76  ? 22.804 41.906 -17.469 1.00 121.43 ? 291 ARG A H    1 
ATOM   881  H  HA   . ARG A 1 76  ? 20.958 41.274 -15.789 1.00 115.11 ? 291 ARG A HA   1 
ATOM   882  H  HB2  . ARG A 1 76  ? 23.741 41.138 -15.323 1.00 104.50 ? 291 ARG A HB2  1 
ATOM   883  H  HB3  . ARG A 1 76  ? 22.644 40.303 -14.531 1.00 104.50 ? 291 ARG A HB3  1 
ATOM   884  H  HG2  . ARG A 1 76  ? 22.255 38.958 -16.295 1.00 115.90 ? 291 ARG A HG2  1 
ATOM   885  H  HG3  . ARG A 1 76  ? 22.992 39.947 -17.300 1.00 115.90 ? 291 ARG A HG3  1 
ATOM   886  H  HD2  . ARG A 1 76  ? 24.866 38.955 -16.994 1.00 110.88 ? 291 ARG A HD2  1 
ATOM   887  H  HD3  . ARG A 1 76  ? 24.718 39.056 -15.413 1.00 110.88 ? 291 ARG A HD3  1 
ATOM   888  H  HE   . ARG A 1 76  ? 23.320 37.048 -16.559 1.00 124.00 ? 291 ARG A HE   1 
ATOM   889  H  HH11 . ARG A 1 76  ? 26.129 37.707 -14.927 1.00 120.46 ? 291 ARG A HH11 1 
ATOM   890  H  HH12 . ARG A 1 76  ? 26.418 36.301 -14.527 1.00 120.46 ? 291 ARG A HH12 1 
ATOM   891  H  HH21 . ARG A 1 76  ? 23.768 34.921 -15.947 1.00 138.50 ? 291 ARG A HH21 1 
ATOM   892  H  HH22 . ARG A 1 76  ? 24.985 34.611 -15.146 1.00 138.50 ? 291 ARG A HH22 1 
ATOM   893  N  N    . GLY A 1 77  ? 22.520 43.906 -15.039 1.00 80.47  ? 292 GLY A N    1 
ATOM   894  C  CA   . GLY A 1 77  ? 22.404 45.156 -14.313 1.00 74.41  ? 292 GLY A CA   1 
ATOM   895  C  C    . GLY A 1 77  ? 23.108 45.134 -12.972 1.00 60.79  ? 292 GLY A C    1 
ATOM   896  O  O    . GLY A 1 77  ? 23.704 44.136 -12.600 1.00 58.25  ? 292 GLY A O    1 
ATOM   897  H  H    . GLY A 1 77  ? 23.126 43.913 -15.650 1.00 96.56  ? 292 GLY A H    1 
ATOM   898  H  HA2  . GLY A 1 77  ? 22.784 45.872 -14.845 1.00 89.29  ? 292 GLY A HA2  1 
ATOM   899  H  HA3  . GLY A 1 77  ? 21.466 45.353 -14.162 1.00 89.29  ? 292 GLY A HA3  1 
ATOM   900  N  N    . PRO A 1 78  ? 23.028 46.243 -12.231 1.00 55.43  ? 293 PRO A N    1 
ATOM   901  C  CA   . PRO A 1 78  ? 22.242 47.419 -12.616 1.00 58.39  ? 293 PRO A CA   1 
ATOM   902  C  C    . PRO A 1 78  ? 23.046 48.364 -13.498 1.00 61.30  ? 293 PRO A C    1 
ATOM   903  O  O    . PRO A 1 78  ? 24.269 48.360 -13.371 1.00 60.24  ? 293 PRO A O    1 
ATOM   904  C  CB   . PRO A 1 78  ? 21.932 48.065 -11.275 1.00 56.76  ? 293 PRO A CB   1 
ATOM   905  C  CG   . PRO A 1 78  ? 23.211 47.861 -10.489 1.00 57.03  ? 293 PRO A CG   1 
ATOM   906  C  CD   . PRO A 1 78  ? 23.749 46.470 -10.958 1.00 58.32  ? 293 PRO A CD   1 
ATOM   907  H  HA   . PRO A 1 78  ? 21.420 47.161 -13.061 1.00 70.06  ? 293 PRO A HA   1 
ATOM   908  H  HB2  . PRO A 1 78  ? 21.744 49.009 -11.396 1.00 68.12  ? 293 PRO A HB2  1 
ATOM   909  H  HB3  . PRO A 1 78  ? 21.186 47.611 -10.852 1.00 68.12  ? 293 PRO A HB3  1 
ATOM   910  H  HG2  . PRO A 1 78  ? 23.843 48.564 -10.703 1.00 68.44  ? 293 PRO A HG2  1 
ATOM   911  H  HG3  . PRO A 1 78  ? 23.014 47.851 -9.540  1.00 68.44  ? 293 PRO A HG3  1 
ATOM   912  H  HD2  . PRO A 1 78  ? 24.706 46.512 -11.113 1.00 69.98  ? 293 PRO A HD2  1 
ATOM   913  H  HD3  . PRO A 1 78  ? 23.522 45.783 -10.312 1.00 69.98  ? 293 PRO A HD3  1 
ATOM   914  N  N    . PRO A 1 79  ? 22.384 49.174 -14.350 1.00 77.81  ? 294 PRO A N    1 
ATOM   915  C  CA   . PRO A 1 79  ? 23.095 50.086 -15.270 1.00 67.15  ? 294 PRO A CA   1 
ATOM   916  C  C    . PRO A 1 79  ? 24.058 51.079 -14.589 1.00 54.75  ? 294 PRO A C    1 
ATOM   917  O  O    . PRO A 1 79  ? 25.082 51.388 -15.182 1.00 60.40  ? 294 PRO A O    1 
ATOM   918  C  CB   . PRO A 1 79  ? 21.952 50.845 -15.967 1.00 75.81  ? 294 PRO A CB   1 
ATOM   919  C  CG   . PRO A 1 79  ? 20.787 49.945 -15.869 1.00 82.11  ? 294 PRO A CG   1 
ATOM   920  C  CD   . PRO A 1 79  ? 20.923 49.228 -14.551 1.00 80.67  ? 294 PRO A CD   1 
ATOM   921  H  HA   . PRO A 1 79  ? 23.585 49.574 -15.932 1.00 80.58  ? 294 PRO A HA   1 
ATOM   922  H  HB2  . PRO A 1 79  ? 21.782 51.680 -15.503 1.00 90.97  ? 294 PRO A HB2  1 
ATOM   923  H  HB3  . PRO A 1 79  ? 22.185 51.007 -16.895 1.00 90.97  ? 294 PRO A HB3  1 
ATOM   924  H  HG2  . PRO A 1 79  ? 19.971 50.469 -15.889 1.00 98.53  ? 294 PRO A HG2  1 
ATOM   925  H  HG3  . PRO A 1 79  ? 20.804 49.312 -16.604 1.00 98.53  ? 294 PRO A HG3  1 
ATOM   926  H  HD2  . PRO A 1 79  ? 20.502 49.739 -13.842 1.00 96.81  ? 294 PRO A HD2  1 
ATOM   927  H  HD3  . PRO A 1 79  ? 20.555 48.333 -14.612 1.00 96.81  ? 294 PRO A HD3  1 
ATOM   928  N  N    . HIS A 1 80  ? 23.743 51.539 -13.375 1.00 55.99  ? 295 HIS A N    1 
ATOM   929  C  CA   . HIS A 1 80  ? 24.518 52.589 -12.697 1.00 51.86  ? 295 HIS A CA   1 
ATOM   930  C  C    . HIS A 1 80  ? 25.886 52.080 -12.178 1.00 65.02  ? 295 HIS A C    1 
ATOM   931  O  O    . HIS A 1 80  ? 26.712 52.856 -11.677 1.00 49.51  ? 295 HIS A O    1 
ATOM   932  C  CB   . HIS A 1 80  ? 23.701 53.162 -11.534 1.00 68.16  ? 295 HIS A CB   1 
ATOM   933  C  CG   . HIS A 1 80  ? 23.319 52.133 -10.511 1.00 77.82  ? 295 HIS A CG   1 
ATOM   934  N  ND1  . HIS A 1 80  ? 24.059 51.898 -9.376  1.00 78.49  ? 295 HIS A ND1  1 
ATOM   935  C  CD2  . HIS A 1 80  ? 22.285 51.258 -10.476 1.00 77.15  ? 295 HIS A CD2  1 
ATOM   936  C  CE1  . HIS A 1 80  ? 23.501 50.921 -8.679  1.00 76.32  ? 295 HIS A CE1  1 
ATOM   937  N  NE2  . HIS A 1 80  ? 22.425 50.517 -9.327  1.00 88.83  ? 295 HIS A NE2  1 
ATOM   938  H  H    . HIS A 1 80  ? 23.073 51.256 -12.915 1.00 67.19  ? 295 HIS A H    1 
ATOM   939  H  HA   . HIS A 1 80  ? 24.688 53.308 -13.325 1.00 62.24  ? 295 HIS A HA   1 
ATOM   940  H  HB2  . HIS A 1 80  ? 24.226 53.845 -11.088 1.00 81.79  ? 295 HIS A HB2  1 
ATOM   941  H  HB3  . HIS A 1 80  ? 22.885 53.550 -11.886 1.00 81.79  ? 295 HIS A HB3  1 
ATOM   942  H  HD1  . HIS A 1 80  ? 24.778 52.316 -9.157  1.00 94.19  ? 295 HIS A HD1  1 
ATOM   943  H  HD2  . HIS A 1 80  ? 21.612 51.171 -11.112 1.00 92.58  ? 295 HIS A HD2  1 
ATOM   944  H  HE1  . HIS A 1 80  ? 23.809 50.583 -7.868  1.00 91.59  ? 295 HIS A HE1  1 
ATOM   945  N  N    . ALA A 1 81  ? 26.132 50.778 -12.286 1.00 47.21  ? 296 ALA A N    1 
ATOM   946  C  CA   . ALA A 1 81  ? 27.376 50.244 -11.816 1.00 45.64  ? 296 ALA A CA   1 
ATOM   947  C  C    . ALA A 1 81  ? 28.479 50.195 -12.926 1.00 42.69  ? 296 ALA A C    1 
ATOM   948  O  O    . ALA A 1 81  ? 29.610 49.828 -12.648 1.00 36.26  ? 296 ALA A O    1 
ATOM   949  C  CB   . ALA A 1 81  ? 27.124 48.858 -11.228 1.00 43.02  ? 296 ALA A CB   1 
ATOM   950  H  H    . ALA A 1 81  ? 25.594 50.198 -12.625 1.00 56.65  ? 296 ALA A H    1 
ATOM   951  H  HA   . ALA A 1 81  ? 27.706 50.811 -11.101 1.00 54.77  ? 296 ALA A HA   1 
ATOM   952  H  HB1  . ALA A 1 81  ? 27.965 48.493 -10.908 1.00 51.63  ? 296 ALA A HB1  1 
ATOM   953  H  HB2  . ALA A 1 81  ? 26.496 48.937 -10.493 1.00 51.63  ? 296 ALA A HB2  1 
ATOM   954  H  HB3  . ALA A 1 81  ? 26.756 48.285 -11.918 1.00 51.63  ? 296 ALA A HB3  1 
ATOM   955  N  N    . PHE A 1 82  ? 28.160 50.604 -14.148 1.00 33.82  ? 297 PHE A N    1 
ATOM   956  C  CA   . PHE A 1 82  ? 29.072 50.461 -15.269 1.00 32.41  ? 297 PHE A CA   1 
ATOM   957  C  C    . PHE A 1 82  ? 29.837 51.745 -15.694 1.00 35.04  ? 297 PHE A C    1 
ATOM   958  O  O    . PHE A 1 82  ? 29.236 52.757 -16.043 1.00 34.72  ? 297 PHE A O    1 
ATOM   959  C  CB   . PHE A 1 82  ? 28.277 49.913 -16.448 1.00 32.92  ? 297 PHE A CB   1 
ATOM   960  C  CG   . PHE A 1 82  ? 27.796 48.502 -16.239 1.00 38.75  ? 297 PHE A CG   1 
ATOM   961  C  CD1  . PHE A 1 82  ? 26.692 48.249 -15.442 1.00 33.75  ? 297 PHE A CD1  1 
ATOM   962  C  CD2  . PHE A 1 82  ? 28.460 47.424 -16.814 1.00 32.52  ? 297 PHE A CD2  1 
ATOM   963  C  CE1  . PHE A 1 82  ? 26.238 46.959 -15.250 1.00 34.12  ? 297 PHE A CE1  1 
ATOM   964  C  CE2  . PHE A 1 82  ? 28.020 46.131 -16.608 1.00 41.31  ? 297 PHE A CE2  1 
ATOM   965  C  CZ   . PHE A 1 82  ? 26.899 45.901 -15.824 1.00 38.72  ? 297 PHE A CZ   1 
ATOM   966  H  H    . PHE A 1 82  ? 27.411 50.972 -14.354 1.00 40.58  ? 297 PHE A H    1 
ATOM   967  H  HA   . PHE A 1 82  ? 29.738 49.796 -15.036 1.00 38.90  ? 297 PHE A HA   1 
ATOM   968  H  HB2  . PHE A 1 82  ? 27.499 50.475 -16.591 1.00 39.50  ? 297 PHE A HB2  1 
ATOM   969  H  HB3  . PHE A 1 82  ? 28.840 49.922 -17.238 1.00 39.50  ? 297 PHE A HB3  1 
ATOM   970  H  HD1  . PHE A 1 82  ? 26.235 48.959 -15.053 1.00 40.50  ? 297 PHE A HD1  1 
ATOM   971  H  HD2  . PHE A 1 82  ? 29.208 47.575 -17.344 1.00 39.02  ? 297 PHE A HD2  1 
ATOM   972  H  HE1  . PHE A 1 82  ? 25.493 46.805 -14.715 1.00 40.94  ? 297 PHE A HE1  1 
ATOM   973  H  HE2  . PHE A 1 82  ? 28.466 45.417 -17.005 1.00 49.57  ? 297 PHE A HE2  1 
ATOM   974  H  HZ   . PHE A 1 82  ? 26.597 45.032 -15.685 1.00 46.46  ? 297 PHE A HZ   1 
ATOM   975  N  N    . PHE A 1 83  ? 31.169 51.679 -15.655 1.00 31.18  ? 298 PHE A N    1 
ATOM   976  C  CA   . PHE A 1 83  ? 32.026 52.812 -15.988 1.00 31.55  ? 298 PHE A CA   1 
ATOM   977  C  C    . PHE A 1 83  ? 33.031 52.503 -17.083 1.00 30.05  ? 298 PHE A C    1 
ATOM   978  O  O    . PHE A 1 83  ? 33.434 51.367 -17.266 1.00 28.40  ? 298 PHE A O    1 
ATOM   979  C  CB   . PHE A 1 83  ? 32.773 53.277 -14.765 1.00 31.58  ? 298 PHE A CB   1 
ATOM   980  C  CG   . PHE A 1 83  ? 31.865 53.787 -13.681 1.00 37.72  ? 298 PHE A CG   1 
ATOM   981  C  CD1  . PHE A 1 83  ? 31.486 55.125 -13.658 1.00 38.13  ? 298 PHE A CD1  1 
ATOM   982  C  CD2  . PHE A 1 83  ? 31.361 52.933 -12.705 1.00 36.05  ? 298 PHE A CD2  1 
ATOM   983  C  CE1  . PHE A 1 83  ? 30.628 55.622 -12.672 1.00 37.59  ? 298 PHE A CE1  1 
ATOM   984  C  CE2  . PHE A 1 83  ? 30.499 53.431 -11.719 1.00 35.84  ? 298 PHE A CE2  1 
ATOM   985  C  CZ   . PHE A 1 83  ? 30.142 54.782 -11.711 1.00 39.70  ? 298 PHE A CZ   1 
ATOM   986  H  H    . PHE A 1 83  ? 31.606 50.972 -15.433 1.00 37.41  ? 298 PHE A H    1 
ATOM   987  H  HA   . PHE A 1 83  ? 31.470 53.545 -16.294 1.00 37.86  ? 298 PHE A HA   1 
ATOM   988  H  HB2  . PHE A 1 83  ? 33.281 52.534 -14.405 1.00 37.90  ? 298 PHE A HB2  1 
ATOM   989  H  HB3  . PHE A 1 83  ? 33.372 53.997 -15.017 1.00 37.90  ? 298 PHE A HB3  1 
ATOM   990  H  HD1  . PHE A 1 83  ? 31.813 55.702 -14.310 1.00 45.75  ? 298 PHE A HD1  1 
ATOM   991  H  HD2  . PHE A 1 83  ? 31.597 52.033 -12.707 1.00 43.26  ? 298 PHE A HD2  1 
ATOM   992  H  HE1  . PHE A 1 83  ? 30.391 56.522 -12.669 1.00 45.11  ? 298 PHE A HE1  1 
ATOM   993  H  HE2  . PHE A 1 83  ? 30.168 52.861 -11.062 1.00 43.01  ? 298 PHE A HE2  1 
ATOM   994  H  HZ   . PHE A 1 83  ? 29.573 55.109 -11.053 1.00 47.64  ? 298 PHE A HZ   1 
ATOM   995  N  N    . LEU A 1 84  ? 33.444 53.538 -17.805 1.00 30.93  ? 299 LEU A N    1 
ATOM   996  C  CA   . LEU A 1 84  ? 34.517 53.416 -18.756 1.00 32.50  ? 299 LEU A CA   1 
ATOM   997  C  C    . LEU A 1 84  ? 35.609 54.385 -18.353 1.00 30.21  ? 299 LEU A C    1 
ATOM   998  O  O    . LEU A 1 84  ? 35.327 55.556 -18.044 1.00 32.03  ? 299 LEU A O    1 
ATOM   999  C  CB   . LEU A 1 84  ? 34.004 53.677 -20.153 1.00 30.37  ? 299 LEU A CB   1 
ATOM   1000 C  CG   . LEU A 1 84  ? 34.971 53.927 -21.301 1.00 39.62  ? 299 LEU A CG   1 
ATOM   1001 C  CD1  . LEU A 1 84  ? 35.463 52.640 -21.912 1.00 31.93  ? 299 LEU A CD1  1 
ATOM   1002 C  CD2  . LEU A 1 84  ? 34.221 54.761 -22.305 1.00 51.12  ? 299 LEU A CD2  1 
ATOM   1003 H  H    . LEU A 1 84  ? 33.108 54.329 -17.756 1.00 37.11  ? 299 LEU A H    1 
ATOM   1004 H  HA   . LEU A 1 84  ? 34.877 52.516 -18.723 1.00 39.00  ? 299 LEU A HA   1 
ATOM   1005 H  HB2  . LEU A 1 84  ? 33.467 52.911 -20.411 1.00 36.44  ? 299 LEU A HB2  1 
ATOM   1006 H  HB3  . LEU A 1 84  ? 33.428 54.456 -20.108 1.00 36.44  ? 299 LEU A HB3  1 
ATOM   1007 H  HG   . LEU A 1 84  ? 35.734 54.433 -20.982 1.00 47.54  ? 299 LEU A HG   1 
ATOM   1008 H  HD11 . LEU A 1 84  ? 36.074 52.848 -22.636 1.00 38.32  ? 299 LEU A HD11 1 
ATOM   1009 H  HD12 . LEU A 1 84  ? 35.920 52.122 -21.231 1.00 38.32  ? 299 LEU A HD12 1 
ATOM   1010 H  HD13 . LEU A 1 84  ? 34.703 52.142 -22.252 1.00 38.32  ? 299 LEU A HD13 1 
ATOM   1011 H  HD21 . LEU A 1 84  ? 34.803 54.946 -23.059 1.00 61.34  ? 299 LEU A HD21 1 
ATOM   1012 H  HD22 . LEU A 1 84  ? 33.439 54.270 -22.602 1.00 61.34  ? 299 LEU A HD22 1 
ATOM   1013 H  HD23 . LEU A 1 84  ? 33.950 55.592 -21.884 1.00 61.34  ? 299 LEU A HD23 1 
ATOM   1014 N  N    . VAL A 1 85  ? 36.847 53.891 -18.321 1.00 28.50  ? 300 VAL A N    1 
ATOM   1015 C  CA   . VAL A 1 85  ? 37.990 54.712 -18.020 1.00 28.95  ? 300 VAL A CA   1 
ATOM   1016 C  C    . VAL A 1 85  ? 38.913 54.742 -19.237 1.00 28.27  ? 300 VAL A C    1 
ATOM   1017 O  O    . VAL A 1 85  ? 39.327 53.694 -19.768 1.00 26.63  ? 300 VAL A O    1 
ATOM   1018 C  CB   . VAL A 1 85  ? 38.763 54.205 -16.813 1.00 28.17  ? 300 VAL A CB   1 
ATOM   1019 C  CG1  . VAL A 1 85  ? 39.974 55.072 -16.571 1.00 28.95  ? 300 VAL A CG1  1 
ATOM   1020 C  CG2  . VAL A 1 85  ? 37.905 54.140 -15.574 1.00 28.83  ? 300 VAL A CG2  1 
ATOM   1021 H  H    . VAL A 1 85  ? 37.042 53.067 -18.474 1.00 34.20  ? 300 VAL A H    1 
ATOM   1022 H  HA   . VAL A 1 85  ? 37.696 55.618 -17.836 1.00 34.74  ? 300 VAL A HA   1 
ATOM   1023 H  HB   . VAL A 1 85  ? 39.077 53.306 -17.001 1.00 33.80  ? 300 VAL A HB   1 
ATOM   1024 H  HG11 . VAL A 1 85  ? 40.454 54.735 -15.799 1.00 34.74  ? 300 VAL A HG11 1 
ATOM   1025 H  HG12 . VAL A 1 85  ? 40.545 55.043 -17.355 1.00 34.74  ? 300 VAL A HG12 1 
ATOM   1026 H  HG13 . VAL A 1 85  ? 39.682 55.983 -16.408 1.00 34.74  ? 300 VAL A HG13 1 
ATOM   1027 H  HG21 . VAL A 1 85  ? 38.442 53.812 -14.835 1.00 34.60  ? 300 VAL A HG21 1 
ATOM   1028 H  HG22 . VAL A 1 85  ? 37.574 55.029 -15.373 1.00 34.60  ? 300 VAL A HG22 1 
ATOM   1029 H  HG23 . VAL A 1 85  ? 37.162 53.538 -15.736 1.00 34.60  ? 300 VAL A HG23 1 
ATOM   1030 N  N    . LYS A 1 86  ? 39.274 55.935 -19.665 1.00 29.71  ? 301 LYS A N    1 
ATOM   1031 C  CA   . LYS A 1 86  ? 40.294 56.018 -20.665 1.00 29.20  ? 301 LYS A CA   1 
ATOM   1032 C  C    . LYS A 1 86  ? 41.585 56.535 -20.021 1.00 29.66  ? 301 LYS A C    1 
ATOM   1033 O  O    . LYS A 1 86  ? 41.605 57.536 -19.324 1.00 31.42  ? 301 LYS A O    1 
ATOM   1034 C  CB   . LYS A 1 86  ? 39.864 56.878 -21.842 1.00 30.51  ? 301 LYS A CB   1 
ATOM   1035 C  CG   . LYS A 1 86  ? 41.008 56.908 -22.897 1.00 56.15  ? 301 LYS A CG   1 
ATOM   1036 C  CD   . LYS A 1 86  ? 40.542 57.163 -24.338 1.00 52.26  ? 301 LYS A CD   1 
ATOM   1037 C  CE   . LYS A 1 86  ? 41.693 57.013 -25.336 1.00 60.41  ? 301 LYS A CE   1 
ATOM   1038 N  NZ   . LYS A 1 86  ? 41.254 57.389 -26.718 1.00 49.08  ? 301 LYS A NZ   1 
ATOM   1039 H  H    . LYS A 1 86  ? 38.951 56.686 -19.398 1.00 35.65  ? 301 LYS A H    1 
ATOM   1040 H  HA   . LYS A 1 86  ? 40.471 55.126 -21.002 1.00 35.04  ? 301 LYS A HA   1 
ATOM   1041 H  HB2  . LYS A 1 86  ? 39.072 56.498 -22.253 1.00 36.62  ? 301 LYS A HB2  1 
ATOM   1042 H  HB3  . LYS A 1 86  ? 39.694 57.784 -21.541 1.00 36.62  ? 301 LYS A HB3  1 
ATOM   1043 H  HG2  . LYS A 1 86  ? 41.629 57.615 -22.660 1.00 67.38  ? 301 LYS A HG2  1 
ATOM   1044 H  HG3  . LYS A 1 86  ? 41.465 56.053 -22.883 1.00 67.38  ? 301 LYS A HG3  1 
ATOM   1045 H  HD2  . LYS A 1 86  ? 39.853 56.520 -24.570 1.00 62.71  ? 301 LYS A HD2  1 
ATOM   1046 H  HD3  . LYS A 1 86  ? 40.195 58.066 -24.407 1.00 62.71  ? 301 LYS A HD3  1 
ATOM   1047 H  HE2  . LYS A 1 86  ? 42.422 57.598 -25.076 1.00 72.49  ? 301 LYS A HE2  1 
ATOM   1048 H  HE3  . LYS A 1 86  ? 41.990 56.090 -25.349 1.00 72.49  ? 301 LYS A HE3  1 
ATOM   1049 H  HZ1  . LYS A 1 86  ? 41.931 57.298 -27.288 1.00 58.89  ? 301 LYS A HZ1  1 
ATOM   1050 H  HZ2  . LYS A 1 86  ? 40.584 56.863 -26.978 1.00 58.89  ? 301 LYS A HZ2  1 
ATOM   1051 H  HZ3  . LYS A 1 86  ? 40.978 58.235 -26.730 1.00 58.89  ? 301 LYS A HZ3  1 
ATOM   1052 N  N    . PHE A 1 87  ? 42.658 55.791 -20.224 1.00 28.26  ? 302 PHE A N    1 
ATOM   1053 C  CA   . PHE A 1 87  ? 43.960 56.187 -19.726 1.00 31.89  ? 302 PHE A CA   1 
ATOM   1054 C  C    . PHE A 1 87  ? 44.889 56.676 -20.819 1.00 29.20  ? 302 PHE A C    1 
ATOM   1055 O  O    . PHE A 1 87  ? 44.997 56.029 -21.861 1.00 27.97  ? 302 PHE A O    1 
ATOM   1056 C  CB   . PHE A 1 87  ? 44.676 55.007 -19.081 1.00 34.27  ? 302 PHE A CB   1 
ATOM   1057 C  CG   . PHE A 1 87  ? 44.186 54.643 -17.750 1.00 27.52  ? 302 PHE A CG   1 
ATOM   1058 C  CD1  . PHE A 1 87  ? 44.237 55.541 -16.730 1.00 29.59  ? 302 PHE A CD1  1 
ATOM   1059 C  CD2  . PHE A 1 87  ? 43.734 53.350 -17.502 1.00 37.94  ? 302 PHE A CD2  1 
ATOM   1060 C  CE1  . PHE A 1 87  ? 43.817 55.194 -15.451 1.00 35.40  ? 302 PHE A CE1  1 
ATOM   1061 C  CE2  . PHE A 1 87  ? 43.307 52.987 -16.221 1.00 46.29  ? 302 PHE A CE2  1 
ATOM   1062 C  CZ   . PHE A 1 87  ? 43.355 53.908 -15.199 1.00 39.33  ? 302 PHE A CZ   1 
ATOM   1063 H  H    . PHE A 1 87  ? 42.658 55.045 -20.651 1.00 33.91  ? 302 PHE A H    1 
ATOM   1064 H  HA   . PHE A 1 87  ? 43.858 56.890 -19.065 1.00 38.27  ? 302 PHE A HA   1 
ATOM   1065 H  HB2  . PHE A 1 87  ? 44.571 54.231 -19.654 1.00 41.13  ? 302 PHE A HB2  1 
ATOM   1066 H  HB3  . PHE A 1 87  ? 45.618 55.225 -18.997 1.00 41.13  ? 302 PHE A HB3  1 
ATOM   1067 H  HD1  . PHE A 1 87  ? 44.554 56.400 -16.891 1.00 35.51  ? 302 PHE A HD1  1 
ATOM   1068 H  HD2  . PHE A 1 87  ? 43.710 52.727 -18.192 1.00 45.53  ? 302 PHE A HD2  1 
ATOM   1069 H  HE1  . PHE A 1 87  ? 43.846 55.821 -14.765 1.00 42.48  ? 302 PHE A HE1  1 
ATOM   1070 H  HE2  . PHE A 1 87  ? 42.994 52.126 -16.060 1.00 55.55  ? 302 PHE A HE2  1 
ATOM   1071 H  HZ   . PHE A 1 87  ? 43.062 53.675 -14.348 1.00 47.19  ? 302 PHE A HZ   1 
ATOM   1072 N  N    . TRP A 1 88  ? 45.640 57.727 -20.533 1.00 30.96  ? 303 TRP A N    1 
ATOM   1073 C  CA   . TRP A 1 88  ? 46.790 58.042 -21.348 1.00 31.75  ? 303 TRP A CA   1 
ATOM   1074 C  C    . TRP A 1 88  ? 48.000 57.712 -20.512 1.00 32.85  ? 303 TRP A C    1 
ATOM   1075 O  O    . TRP A 1 88  ? 48.363 58.447 -19.620 1.00 33.05  ? 303 TRP A O    1 
ATOM   1076 C  CB   . TRP A 1 88  ? 46.795 59.502 -21.833 1.00 33.70  ? 303 TRP A CB   1 
ATOM   1077 C  CG   . TRP A 1 88  ? 45.733 59.756 -22.820 1.00 33.80  ? 303 TRP A CG   1 
ATOM   1078 C  CD1  . TRP A 1 88  ? 45.868 59.804 -24.168 1.00 33.57  ? 303 TRP A CD1  1 
ATOM   1079 C  CD2  . TRP A 1 88  ? 44.338 59.980 -22.538 1.00 34.36  ? 303 TRP A CD2  1 
ATOM   1080 N  NE1  . TRP A 1 88  ? 44.644 60.071 -24.748 1.00 34.23  ? 303 TRP A NE1  1 
ATOM   1081 C  CE2  . TRP A 1 88  ? 43.687 60.143 -23.771 1.00 34.51  ? 303 TRP A CE2  1 
ATOM   1082 C  CE3  . TRP A 1 88  ? 43.579 60.040 -21.351 1.00 34.88  ? 303 TRP A CE3  1 
ATOM   1083 C  CZ2  . TRP A 1 88  ? 42.330 60.380 -23.869 1.00 35.31  ? 303 TRP A CZ2  1 
ATOM   1084 C  CZ3  . TRP A 1 88  ? 42.213 60.285 -21.451 1.00 37.46  ? 303 TRP A CZ3  1 
ATOM   1085 C  CH2  . TRP A 1 88  ? 41.608 60.476 -22.705 1.00 35.94  ? 303 TRP A CH2  1 
ATOM   1086 H  H    . TRP A 1 88  ? 45.504 58.268 -19.878 1.00 37.15  ? 303 TRP A H    1 
ATOM   1087 H  HA   . TRP A 1 88  ? 46.795 57.465 -22.128 1.00 38.09  ? 303 TRP A HA   1 
ATOM   1088 H  HB2  . TRP A 1 88  ? 46.650 60.091 -21.075 1.00 40.44  ? 303 TRP A HB2  1 
ATOM   1089 H  HB3  . TRP A 1 88  ? 47.649 59.697 -22.250 1.00 40.44  ? 303 TRP A HB3  1 
ATOM   1090 H  HD1  . TRP A 1 88  ? 46.667 59.692 -24.631 1.00 40.28  ? 303 TRP A HD1  1 
ATOM   1091 H  HE1  . TRP A 1 88  ? 44.496 60.127 -25.593 1.00 41.08  ? 303 TRP A HE1  1 
ATOM   1092 H  HE3  . TRP A 1 88  ? 43.983 59.922 -20.521 1.00 41.85  ? 303 TRP A HE3  1 
ATOM   1093 H  HZ2  . TRP A 1 88  ? 41.927 60.516 -24.696 1.00 42.37  ? 303 TRP A HZ2  1 
ATOM   1094 H  HZ3  . TRP A 1 88  ? 41.696 60.328 -20.679 1.00 44.95  ? 303 TRP A HZ3  1 
ATOM   1095 H  HH2  . TRP A 1 88  ? 40.690 60.623 -22.750 1.00 43.12  ? 303 TRP A HH2  1 
ATOM   1096 N  N    . ALA A 1 89  ? 48.609 56.578 -20.831 1.00 33.92  ? 304 ALA A N    1 
ATOM   1097 C  CA   . ALA A 1 89  ? 49.642 56.003 -20.015 1.00 35.26  ? 304 ALA A CA   1 
ATOM   1098 C  C    . ALA A 1 89  ? 50.965 56.682 -20.237 1.00 44.14  ? 304 ALA A C    1 
ATOM   1099 O  O    . ALA A 1 89  ? 51.340 57.037 -21.369 1.00 44.23  ? 304 ALA A O    1 
ATOM   1100 C  CB   . ALA A 1 89  ? 49.765 54.487 -20.308 1.00 33.25  ? 304 ALA A CB   1 
ATOM   1101 H  H    . ALA A 1 89  ? 48.429 56.118 -21.535 1.00 40.71  ? 304 ALA A H    1 
ATOM   1102 H  HA   . ALA A 1 89  ? 49.404 56.110 -19.081 1.00 42.31  ? 304 ALA A HA   1 
ATOM   1103 H  HB1  . ALA A 1 89  ? 50.466 54.114 -19.750 1.00 39.91  ? 304 ALA A HB1  1 
ATOM   1104 H  HB2  . ALA A 1 89  ? 48.919 54.058 -20.107 1.00 39.91  ? 304 ALA A HB2  1 
ATOM   1105 H  HB3  . ALA A 1 89  ? 49.986 54.364 -21.244 1.00 39.91  ? 304 ALA A HB3  1 
ATOM   1106 N  N    . ASP A 1 90  ? 51.693 56.850 -19.147 1.00 51.06  ? 305 ASP A N    1 
ATOM   1107 C  CA   . ASP A 1 90  ? 53.083 57.239 -19.250 1.00 64.05  ? 305 ASP A CA   1 
ATOM   1108 C  C    . ASP A 1 90  ? 54.003 55.999 -19.342 1.00 64.31  ? 305 ASP A C    1 
ATOM   1109 O  O    . ASP A 1 90  ? 54.218 55.308 -18.341 1.00 54.74  ? 305 ASP A O    1 
ATOM   1110 C  CB   . ASP A 1 90  ? 53.472 58.093 -18.063 1.00 57.17  ? 305 ASP A CB   1 
ATOM   1111 C  CG   . ASP A 1 90  ? 54.629 58.929 -18.368 1.00 65.04  ? 305 ASP A CG   1 
ATOM   1112 O  OD1  . ASP A 1 90  ? 55.356 58.483 -19.293 1.00 67.21  ? 305 ASP A OD1  1 
ATOM   1113 O  OD2  . ASP A 1 90  ? 54.783 60.012 -17.740 1.00 70.43  ? 305 ASP A OD2  1 
ATOM   1114 H  H    . ASP A 1 90  ? 51.408 56.746 -18.342 1.00 61.27  ? 305 ASP A H    1 
ATOM   1115 H  HA   . ASP A 1 90  ? 53.206 57.766 -20.054 1.00 76.86  ? 305 ASP A HA   1 
ATOM   1116 H  HB2  . ASP A 1 90  ? 52.731 58.673 -17.828 1.00 68.60  ? 305 ASP A HB2  1 
ATOM   1117 H  HB3  . ASP A 1 90  ? 53.700 57.519 -17.316 1.00 68.60  ? 305 ASP A HB3  1 
ATOM   1118 N  N    . LEU A 1 91  ? 54.534 55.718 -20.538 1.00 46.24  ? 306 LEU A N    1 
ATOM   1119 C  CA   . LEU A 1 91  ? 55.410 54.560 -20.743 1.00 58.63  ? 306 LEU A CA   1 
ATOM   1120 C  C    . LEU A 1 91  ? 56.927 54.862 -20.829 1.00 59.96  ? 306 LEU A C    1 
ATOM   1121 O  O    . LEU A 1 91  ? 57.675 53.994 -21.284 1.00 62.92  ? 306 LEU A O    1 
ATOM   1122 C  CB   . LEU A 1 91  ? 54.991 53.807 -22.029 1.00 42.69  ? 306 LEU A CB   1 
ATOM   1123 C  CG   . LEU A 1 91  ? 53.763 52.885 -22.036 1.00 50.97  ? 306 LEU A CG   1 
ATOM   1124 C  CD1  . LEU A 1 91  ? 53.805 51.944 -23.230 1.00 48.73  ? 306 LEU A CD1  1 
ATOM   1125 C  CD2  . LEU A 1 91  ? 53.638 52.064 -20.751 1.00 55.70  ? 306 LEU A CD2  1 
ATOM   1126 H  H    . LEU A 1 91  ? 54.402 56.185 -21.247 1.00 55.49  ? 306 LEU A H    1 
ATOM   1127 H  HA   . LEU A 1 91  ? 55.283 53.951 -19.999 1.00 70.36  ? 306 LEU A HA   1 
ATOM   1128 H  HB2  . LEU A 1 91  ? 54.833 54.475 -22.714 1.00 51.22  ? 306 LEU A HB2  1 
ATOM   1129 H  HB3  . LEU A 1 91  ? 55.744 53.259 -22.300 1.00 51.22  ? 306 LEU A HB3  1 
ATOM   1130 H  HG   . LEU A 1 91  ? 52.965 53.430 -22.117 1.00 61.16  ? 306 LEU A HG   1 
ATOM   1131 H  HD11 . LEU A 1 91  ? 53.020 51.374 -23.210 1.00 58.47  ? 306 LEU A HD11 1 
ATOM   1132 H  HD12 . LEU A 1 91  ? 53.812 52.469 -24.046 1.00 58.47  ? 306 LEU A HD12 1 
ATOM   1133 H  HD13 . LEU A 1 91  ? 54.608 51.403 -23.177 1.00 58.47  ? 306 LEU A HD13 1 
ATOM   1134 H  HD21 . LEU A 1 91  ? 52.850 51.503 -20.810 1.00 66.83  ? 306 LEU A HD21 1 
ATOM   1135 H  HD22 . LEU A 1 91  ? 54.431 51.513 -20.650 1.00 66.83  ? 306 LEU A HD22 1 
ATOM   1136 H  HD23 . LEU A 1 91  ? 53.558 52.669 -19.997 1.00 66.83  ? 306 LEU A HD23 1 
ATOM   1137 N  N    . ASN A 1 92  ? 57.396 56.046 -20.407 1.00 72.74  ? 307 ASN A N    1 
ATOM   1138 C  CA   . ASN A 1 92  ? 58.849 56.325 -20.440 1.00 78.75  ? 307 ASN A CA   1 
ATOM   1139 C  C    . ASN A 1 92  ? 59.478 56.132 -19.070 1.00 72.86  ? 307 ASN A C    1 
ATOM   1140 O  O    . ASN A 1 92  ? 59.428 57.029 -18.236 1.00 68.88  ? 307 ASN A O    1 
ATOM   1141 C  CB   . ASN A 1 92  ? 59.165 57.750 -20.942 1.00 88.97  ? 307 ASN A CB   1 
ATOM   1142 C  CG   . ASN A 1 92  ? 60.689 57.982 -21.168 1.00 92.45  ? 307 ASN A CG   1 
ATOM   1143 O  OD1  . ASN A 1 92  ? 61.519 57.619 -20.333 1.00 91.52  ? 307 ASN A OD1  1 
ATOM   1144 N  ND2  . ASN A 1 92  ? 61.044 58.581 -22.305 1.00 93.71  ? 307 ASN A ND2  1 
ATOM   1145 H  H    . ASN A 1 92  ? 56.912 56.689 -20.104 1.00 87.29  ? 307 ASN A H    1 
ATOM   1146 H  HA   . ASN A 1 92  ? 59.270 55.699 -21.049 1.00 94.50  ? 307 ASN A HA   1 
ATOM   1147 H  HB2  . ASN A 1 92  ? 58.711 57.897 -21.786 1.00 106.76 ? 307 ASN A HB2  1 
ATOM   1148 H  HB3  . ASN A 1 92  ? 58.858 58.393 -20.284 1.00 106.76 ? 307 ASN A HB3  1 
ATOM   1149 H  HD21 . ASN A 1 92  ? 61.875 58.730 -22.472 1.00 112.45 ? 307 ASN A HD21 1 
ATOM   1150 H  HD22 . ASN A 1 92  ? 60.443 58.819 -22.872 1.00 112.45 ? 307 ASN A HD22 1 
ATOM   1151 N  N    . TRP A 1 93  ? 60.081 54.961 -18.855 1.00 87.80  ? 308 TRP A N    1 
ATOM   1152 C  CA   . TRP A 1 93  ? 60.845 54.684 -17.637 1.00 92.39  ? 308 TRP A CA   1 
ATOM   1153 C  C    . TRP A 1 93  ? 62.172 53.987 -17.973 1.00 78.61  ? 308 TRP A C    1 
ATOM   1154 O  O    . TRP A 1 93  ? 62.841 54.326 -18.953 1.00 85.98  ? 308 TRP A O    1 
ATOM   1155 C  CB   . TRP A 1 93  ? 60.020 53.827 -16.659 1.00 69.62  ? 308 TRP A CB   1 
ATOM   1156 C  CG   . TRP A 1 93  ? 60.048 52.328 -16.940 1.00 63.67  ? 308 TRP A CG   1 
ATOM   1157 C  CD1  . TRP A 1 93  ? 60.908 51.402 -16.395 1.00 60.31  ? 308 TRP A CD1  1 
ATOM   1158 C  CD2  . TRP A 1 93  ? 59.176 51.593 -17.819 1.00 57.37  ? 308 TRP A CD2  1 
ATOM   1159 N  NE1  . TRP A 1 93  ? 60.621 50.143 -16.883 1.00 57.88  ? 308 TRP A NE1  1 
ATOM   1160 C  CE2  . TRP A 1 93  ? 59.564 50.233 -17.755 1.00 57.71  ? 308 TRP A CE2  1 
ATOM   1161 C  CE3  . TRP A 1 93  ? 58.108 51.953 -18.650 1.00 68.03  ? 308 TRP A CE3  1 
ATOM   1162 C  CZ2  . TRP A 1 93  ? 58.923 49.234 -18.501 1.00 61.19  ? 308 TRP A CZ2  1 
ATOM   1163 C  CZ3  . TRP A 1 93  ? 57.471 50.958 -19.388 1.00 72.68  ? 308 TRP A CZ3  1 
ATOM   1164 C  CH2  . TRP A 1 93  ? 57.879 49.614 -19.305 1.00 64.40  ? 308 TRP A CH2  1 
ATOM   1165 H  H    . TRP A 1 93  ? 60.062 54.302 -19.408 1.00 105.36 ? 308 TRP A H    1 
ATOM   1166 H  HA   . TRP A 1 93  ? 61.051 55.524 -17.197 1.00 110.87 ? 308 TRP A HA   1 
ATOM   1167 H  HB2  . TRP A 1 93  ? 60.364 53.964 -15.762 1.00 83.55  ? 308 TRP A HB2  1 
ATOM   1168 H  HB3  . TRP A 1 93  ? 59.095 54.116 -16.700 1.00 83.55  ? 308 TRP A HB3  1 
ATOM   1169 H  HD1  . TRP A 1 93  ? 61.582 51.596 -15.784 1.00 72.38  ? 308 TRP A HD1  1 
ATOM   1170 H  HE1  . TRP A 1 93  ? 61.037 49.420 -16.675 1.00 69.46  ? 308 TRP A HE1  1 
ATOM   1171 H  HE3  . TRP A 1 93  ? 57.831 52.839 -18.709 1.00 81.64  ? 308 TRP A HE3  1 
ATOM   1172 H  HZ2  . TRP A 1 93  ? 59.193 48.346 -18.447 1.00 73.43  ? 308 TRP A HZ2  1 
ATOM   1173 H  HZ3  . TRP A 1 93  ? 56.760 51.186 -19.942 1.00 87.22  ? 308 TRP A HZ3  1 
ATOM   1174 H  HH2  . TRP A 1 93  ? 57.436 48.970 -19.810 1.00 77.28  ? 308 TRP A HH2  1 
ATOM   1175 N  N    . GLY A 1 110 ? 62.891 43.262 -12.302 1.00 56.76  ? 325 GLY A N    1 
ATOM   1176 C  CA   . GLY A 1 110 ? 62.033 44.303 -11.740 1.00 76.15  ? 325 GLY A CA   1 
ATOM   1177 C  C    . GLY A 1 110 ? 60.647 43.831 -11.314 1.00 65.79  ? 325 GLY A C    1 
ATOM   1178 O  O    . GLY A 1 110 ? 60.164 42.815 -11.793 1.00 69.28  ? 325 GLY A O    1 
ATOM   1179 H  HA2  . GLY A 1 110 ? 62.470 44.685 -10.963 1.00 91.38  ? 325 GLY A HA2  1 
ATOM   1180 H  HA3  . GLY A 1 110 ? 61.920 45.007 -12.397 1.00 91.38  ? 325 GLY A HA3  1 
ATOM   1181 N  N    . PHE A 1 111 ? 59.992 44.563 -10.418 1.00 49.32  ? 326 PHE A N    1 
ATOM   1182 C  CA   . PHE A 1 111 ? 58.657 44.162 -9.991  1.00 41.96  ? 326 PHE A CA   1 
ATOM   1183 C  C    . PHE A 1 111 ? 57.506 45.041 -10.522 1.00 39.20  ? 326 PHE A C    1 
ATOM   1184 O  O    . PHE A 1 111 ? 57.424 46.248 -10.243 1.00 42.61  ? 326 PHE A O    1 
ATOM   1185 C  CB   . PHE A 1 111 ? 58.590 44.118 -8.480  1.00 43.86  ? 326 PHE A CB   1 
ATOM   1186 C  CG   . PHE A 1 111 ? 57.266 43.653 -7.958  1.00 55.97  ? 326 PHE A CG   1 
ATOM   1187 C  CD1  . PHE A 1 111 ? 56.920 42.310 -8.006  1.00 64.44  ? 326 PHE A CD1  1 
ATOM   1188 C  CD2  . PHE A 1 111 ? 56.360 44.555 -7.433  1.00 54.74  ? 326 PHE A CD2  1 
ATOM   1189 C  CE1  . PHE A 1 111 ? 55.688 41.878 -7.532  1.00 54.26  ? 326 PHE A CE1  1 
ATOM   1190 C  CE2  . PHE A 1 111 ? 55.133 44.125 -6.965  1.00 62.52  ? 326 PHE A CE2  1 
ATOM   1191 C  CZ   . PHE A 1 111 ? 54.798 42.785 -7.015  1.00 55.14  ? 326 PHE A CZ   1 
ATOM   1192 H  H    . PHE A 1 111 ? 60.291 45.280 -10.049 1.00 59.18  ? 326 PHE A H    1 
ATOM   1193 H  HA   . PHE A 1 111 ? 58.497 43.261 -10.312 1.00 50.36  ? 326 PHE A HA   1 
ATOM   1194 H  HB2  . PHE A 1 111 ? 59.270 43.508 -8.154  1.00 52.63  ? 326 PHE A HB2  1 
ATOM   1195 H  HB3  . PHE A 1 111 ? 58.751 45.009 -8.132  1.00 52.63  ? 326 PHE A HB3  1 
ATOM   1196 H  HD1  . PHE A 1 111 ? 57.519 41.693 -8.359  1.00 77.33  ? 326 PHE A HD1  1 
ATOM   1197 H  HD2  . PHE A 1 111 ? 56.576 45.458 -7.399  1.00 65.69  ? 326 PHE A HD2  1 
ATOM   1198 H  HE1  . PHE A 1 111 ? 55.466 40.976 -7.567  1.00 65.12  ? 326 PHE A HE1  1 
ATOM   1199 H  HE2  . PHE A 1 111 ? 54.531 44.740 -6.611  1.00 75.03  ? 326 PHE A HE2  1 
ATOM   1200 H  HZ   . PHE A 1 111 ? 53.974 42.498 -6.694  1.00 66.17  ? 326 PHE A HZ   1 
ATOM   1201 N  N    . TYR A 1 112 ? 56.600 44.389 -11.253 1.00 50.42  ? 327 TYR A N    1 
ATOM   1202 C  CA   . TYR A 1 112 ? 55.427 45.012 -11.872 1.00 44.78  ? 327 TYR A CA   1 
ATOM   1203 C  C    . TYR A 1 112 ? 54.202 44.678 -11.070 1.00 42.92  ? 327 TYR A C    1 
ATOM   1204 O  O    . TYR A 1 112 ? 53.900 43.511 -10.860 1.00 38.98  ? 327 TYR A O    1 
ATOM   1205 C  CB   . TYR A 1 112 ? 55.246 44.514 -13.296 1.00 42.58  ? 327 TYR A CB   1 
ATOM   1206 C  CG   . TYR A 1 112 ? 56.376 44.925 -14.210 1.00 43.24  ? 327 TYR A CG   1 
ATOM   1207 C  CD1  . TYR A 1 112 ? 57.624 44.313 -14.130 1.00 46.03  ? 327 TYR A CD1  1 
ATOM   1208 C  CD2  . TYR A 1 112 ? 56.196 45.942 -15.142 1.00 51.27  ? 327 TYR A CD2  1 
ATOM   1209 C  CE1  . TYR A 1 112 ? 58.656 44.699 -14.964 1.00 53.40  ? 327 TYR A CE1  1 
ATOM   1210 C  CE2  . TYR A 1 112 ? 57.222 46.338 -15.982 1.00 53.81  ? 327 TYR A CE2  1 
ATOM   1211 C  CZ   . TYR A 1 112 ? 58.438 45.714 -15.894 1.00 50.66  ? 327 TYR A CZ   1 
ATOM   1212 O  OH   . TYR A 1 112 ? 59.443 46.135 -16.733 1.00 65.89  ? 327 TYR A OH   1 
ATOM   1213 H  H    . TYR A 1 112 ? 56.647 43.545 -11.410 1.00 60.51  ? 327 TYR A H    1 
ATOM   1214 H  HA   . TYR A 1 112 ? 55.537 45.976 -11.888 1.00 53.73  ? 327 TYR A HA   1 
ATOM   1215 H  HB2  . TYR A 1 112 ? 55.204 43.545 -13.289 1.00 51.10  ? 327 TYR A HB2  1 
ATOM   1216 H  HB3  . TYR A 1 112 ? 54.423 44.879 -13.656 1.00 51.10  ? 327 TYR A HB3  1 
ATOM   1217 H  HD1  . TYR A 1 112 ? 57.763 43.633 -13.511 1.00 55.24  ? 327 TYR A HD1  1 
ATOM   1218 H  HD2  . TYR A 1 112 ? 55.368 46.362 -15.204 1.00 61.52  ? 327 TYR A HD2  1 
ATOM   1219 H  HE1  . TYR A 1 112 ? 59.486 44.283 -14.907 1.00 64.08  ? 327 TYR A HE1  1 
ATOM   1220 H  HE2  . TYR A 1 112 ? 57.086 47.017 -16.602 1.00 64.57  ? 327 TYR A HE2  1 
ATOM   1221 H  HH   . TYR A 1 112 ? 59.161 46.748 -17.233 1.00 79.06  ? 327 TYR A HH   1 
ATOM   1222 N  N    . GLY A 1 113 ? 53.486 45.700 -10.624 1.00 38.49  ? 328 GLY A N    1 
ATOM   1223 C  CA   . GLY A 1 113 ? 52.361 45.474 -9.736  1.00 37.33  ? 328 GLY A CA   1 
ATOM   1224 C  C    . GLY A 1 113 ? 51.157 46.332 -9.992  1.00 31.50  ? 328 GLY A C    1 
ATOM   1225 O  O    . GLY A 1 113 ? 51.175 47.289 -10.781 1.00 29.79  ? 328 GLY A O    1 
ATOM   1226 H  H    . GLY A 1 113 ? 53.629 46.525 -10.818 1.00 46.19  ? 328 GLY A H    1 
ATOM   1227 H  HA2  . GLY A 1 113 ? 52.085 44.547 -9.809  1.00 44.80  ? 328 GLY A HA2  1 
ATOM   1228 H  HA3  . GLY A 1 113 ? 52.647 45.630 -8.822  1.00 44.80  ? 328 GLY A HA3  1 
ATOM   1229 N  N    . VAL A 1 114 ? 50.083 45.941 -9.333  1.00 29.30  ? 329 VAL A N    1 
ATOM   1230 C  CA   . VAL A 1 114 ? 48.860 46.684 -9.410  1.00 27.83  ? 329 VAL A CA   1 
ATOM   1231 C  C    . VAL A 1 114 ? 48.354 46.797 -7.986  1.00 29.99  ? 329 VAL A C    1 
ATOM   1232 O  O    . VAL A 1 114 ? 48.447 45.853 -7.215  1.00 31.01  ? 329 VAL A O    1 
ATOM   1233 C  CB   . VAL A 1 114 ? 47.820 46.018 -10.327 1.00 28.39  ? 329 VAL A CB   1 
ATOM   1234 C  CG1  . VAL A 1 114 ? 46.488 46.728 -10.202 1.00 30.20  ? 329 VAL A CG1  1 
ATOM   1235 C  CG2  . VAL A 1 114 ? 48.292 46.016 -11.798 1.00 27.29  ? 329 VAL A CG2  1 
ATOM   1236 H  H    . VAL A 1 114 ? 50.043 45.242 -8.832  1.00 35.16  ? 329 VAL A H    1 
ATOM   1237 H  HA   . VAL A 1 114 ? 49.042 47.576 -9.746  1.00 33.40  ? 329 VAL A HA   1 
ATOM   1238 H  HB   . VAL A 1 114 ? 47.697 45.096 -10.049 1.00 34.07  ? 329 VAL A HB   1 
ATOM   1239 H  HG11 . VAL A 1 114 ? 45.845 46.296 -10.785 1.00 36.24  ? 329 VAL A HG11 1 
ATOM   1240 H  HG12 . VAL A 1 114 ? 46.188 46.675 -9.281  1.00 36.24  ? 329 VAL A HG12 1 
ATOM   1241 H  HG13 . VAL A 1 114 ? 46.600 47.656 -10.461 1.00 36.24  ? 329 VAL A HG13 1 
ATOM   1242 H  HG21 . VAL A 1 114 ? 47.615 45.590 -12.346 1.00 32.75  ? 329 VAL A HG21 1 
ATOM   1243 H  HG22 . VAL A 1 114 ? 48.425 46.932 -12.087 1.00 32.75  ? 329 VAL A HG22 1 
ATOM   1244 H  HG23 . VAL A 1 114 ? 49.127 45.525 -11.860 1.00 32.75  ? 329 VAL A HG23 1 
ATOM   1245 N  N    . SER A 1 115 ? 47.855 47.973 -7.645  1.00 38.42  ? 330 SER A N    1 
ATOM   1246 C  CA   . SER A 1 115 ? 47.316 48.208 -6.331  1.00 40.82  ? 330 SER A CA   1 
ATOM   1247 C  C    . SER A 1 115 ? 45.994 48.885 -6.520  1.00 35.96  ? 330 SER A C    1 
ATOM   1248 O  O    . SER A 1 115 ? 45.864 49.821 -7.296  1.00 37.37  ? 330 SER A O    1 
ATOM   1249 C  CB   . SER A 1 115 ? 48.269 49.041 -5.480  1.00 36.51  ? 330 SER A CB   1 
ATOM   1250 O  OG   . SER A 1 115 ? 49.353 48.231 -5.016  1.00 43.56  ? 330 SER A OG   1 
ATOM   1251 H  H    . SER A 1 115 ? 47.820 48.656 -8.166  1.00 46.10  ? 330 SER A H    1 
ATOM   1252 H  HA   . SER A 1 115 ? 47.167 47.360 -5.885  1.00 48.98  ? 330 SER A HA   1 
ATOM   1253 H  HB2  . SER A 1 115 ? 48.622 49.767 -6.017  1.00 43.81  ? 330 SER A HB2  1 
ATOM   1254 H  HB3  . SER A 1 115 ? 47.787 49.395 -4.716  1.00 43.81  ? 330 SER A HB3  1 
ATOM   1255 H  HG   . SER A 1 115 ? 49.876 48.692 -4.548  1.00 52.27  ? 330 SER A HG   1 
ATOM   1256 N  N    . SER A 1 116 ? 44.991 48.354 -5.853  1.00 35.21  ? 331 SER A N    1 
ATOM   1257 C  CA   . SER A 1 116 ? 43.685 48.967 -5.861  1.00 30.86  ? 331 SER A CA   1 
ATOM   1258 C  C    . SER A 1 116 ? 43.146 49.000 -4.422  1.00 31.21  ? 331 SER A C    1 
ATOM   1259 O  O    . SER A 1 116 ? 43.544 48.199 -3.548  1.00 32.72  ? 331 SER A O    1 
ATOM   1260 C  CB   . SER A 1 116 ? 42.764 48.219 -6.800  1.00 29.04  ? 331 SER A CB   1 
ATOM   1261 O  OG   . SER A 1 116 ? 42.693 46.899 -6.374  1.00 43.12  ? 331 SER A OG   1 
ATOM   1262 H  H    . SER A 1 116 ? 45.043 47.634 -5.385  1.00 42.26  ? 331 SER A H    1 
ATOM   1263 H  HA   . SER A 1 116 ? 43.763 49.881 -6.177  1.00 37.03  ? 331 SER A HA   1 
ATOM   1264 H  HB2  . SER A 1 116 ? 41.880 48.617 -6.772  1.00 34.84  ? 331 SER A HB2  1 
ATOM   1265 H  HB3  . SER A 1 116 ? 43.124 48.251 -7.700  1.00 34.84  ? 331 SER A HB3  1 
ATOM   1266 H  HG   . SER A 1 116 ? 42.186 46.461 -6.881  1.00 51.74  ? 331 SER A HG   1 
ATOM   1267 N  N    . GLN A 1 117 ? 42.298 49.986 -4.173  1.00 32.63  ? 332 GLN A N    1 
ATOM   1268 C  CA   . GLN A 1 117 ? 41.691 50.145 -2.886  1.00 37.12  ? 332 GLN A CA   1 
ATOM   1269 C  C    . GLN A 1 117 ? 40.274 50.730 -3.076  1.00 33.04  ? 332 GLN A C    1 
ATOM   1270 O  O    . GLN A 1 117 ? 40.062 51.704 -3.818  1.00 34.32  ? 332 GLN A O    1 
ATOM   1271 C  CB   . GLN A 1 117 ? 42.544 51.030 -1.984  1.00 57.04  ? 332 GLN A CB   1 
ATOM   1272 C  CG   . GLN A 1 117 ? 42.093 50.963 -0.529  1.00 74.89  ? 332 GLN A CG   1 
ATOM   1273 C  CD   . GLN A 1 117 ? 42.852 51.902 0.397   1.00 67.47  ? 332 GLN A CD   1 
ATOM   1274 O  OE1  . GLN A 1 117 ? 44.071 52.019 0.326   1.00 83.97  ? 332 GLN A OE1  1 
ATOM   1275 N  NE2  . GLN A 1 117 ? 42.125 52.571 1.275   1.00 56.13  ? 332 GLN A NE2  1 
ATOM   1276 H  H    . GLN A 1 117 ? 42.060 50.578 -4.749  1.00 39.15  ? 332 GLN A H    1 
ATOM   1277 H  HA   . GLN A 1 117 ? 41.605 49.276 -2.463  1.00 44.55  ? 332 GLN A HA   1 
ATOM   1278 H  HB2  . GLN A 1 117 ? 43.467 50.735 -2.030  1.00 68.45  ? 332 GLN A HB2  1 
ATOM   1279 H  HB3  . GLN A 1 117 ? 42.472 51.951 -2.281  1.00 68.45  ? 332 GLN A HB3  1 
ATOM   1280 H  HG2  . GLN A 1 117 ? 41.153 51.196 -0.482  1.00 89.87  ? 332 GLN A HG2  1 
ATOM   1281 H  HG3  . GLN A 1 117 ? 42.223 50.058 -0.203  1.00 89.87  ? 332 GLN A HG3  1 
ATOM   1282 H  HE21 . GLN A 1 117 ? 41.273 52.462 1.300   1.00 67.36  ? 332 GLN A HE21 1 
ATOM   1283 H  HE22 . GLN A 1 117 ? 42.505 53.115 1.822   1.00 67.36  ? 332 GLN A HE22 1 
ATOM   1284 N  N    . TYR A 1 118 ? 39.325 50.058 -2.443  1.00 32.13  ? 333 TYR A N    1 
ATOM   1285 C  CA   . TYR A 1 118 ? 37.917 50.400 -2.480  1.00 32.92  ? 333 TYR A CA   1 
ATOM   1286 C  C    . TYR A 1 118 ? 37.468 50.650 -1.078  1.00 33.11  ? 333 TYR A C    1 
ATOM   1287 O  O    . TYR A 1 118 ? 38.102 50.193 -0.139  1.00 37.15  ? 333 TYR A O    1 
ATOM   1288 C  CB   . TYR A 1 118 ? 37.065 49.267 -3.059  1.00 30.21  ? 333 TYR A CB   1 
ATOM   1289 C  CG   . TYR A 1 118 ? 37.419 48.794 -4.437  1.00 38.06  ? 333 TYR A CG   1 
ATOM   1290 C  CD1  . TYR A 1 118 ? 38.341 47.773 -4.623  1.00 38.84  ? 333 TYR A CD1  1 
ATOM   1291 C  CD2  . TYR A 1 118 ? 36.789 49.334 -5.560  1.00 44.53  ? 333 TYR A CD2  1 
ATOM   1292 C  CE1  . TYR A 1 118 ? 38.649 47.323 -5.884  1.00 36.55  ? 333 TYR A CE1  1 
ATOM   1293 C  CE2  . TYR A 1 118 ? 37.095 48.887 -6.838  1.00 43.53  ? 333 TYR A CE2  1 
ATOM   1294 C  CZ   . TYR A 1 118 ? 38.033 47.884 -6.987  1.00 40.82  ? 333 TYR A CZ   1 
ATOM   1295 O  OH   . TYR A 1 118 ? 38.337 47.407 -8.232  1.00 41.26  ? 333 TYR A OH   1 
ATOM   1296 H  H    . TYR A 1 118 ? 39.484 49.364 -1.962  1.00 38.56  ? 333 TYR A H    1 
ATOM   1297 H  HA   . TYR A 1 118 ? 37.781 51.203 -3.007  1.00 39.51  ? 333 TYR A HA   1 
ATOM   1298 H  HB2  . TYR A 1 118 ? 37.137 48.502 -2.466  1.00 36.25  ? 333 TYR A HB2  1 
ATOM   1299 H  HB3  . TYR A 1 118 ? 36.143 49.565 -3.086  1.00 36.25  ? 333 TYR A HB3  1 
ATOM   1300 H  HD1  . TYR A 1 118 ? 38.764 47.396 -3.885  1.00 46.60  ? 333 TYR A HD1  1 
ATOM   1301 H  HD2  . TYR A 1 118 ? 36.164 50.013 -5.451  1.00 53.43  ? 333 TYR A HD2  1 
ATOM   1302 H  HE1  . TYR A 1 118 ? 39.274 46.643 -5.996  1.00 43.86  ? 333 TYR A HE1  1 
ATOM   1303 H  HE2  . TYR A 1 118 ? 36.676 49.257 -7.581  1.00 52.24  ? 333 TYR A HE2  1 
ATOM   1304 H  HH   . TYR A 1 118 ? 37.902 47.826 -8.815  1.00 49.51  ? 333 TYR A HH   1 
ATOM   1305 N  N    . GLU A 1 119 ? 36.333 51.311 -0.926  1.00 36.28  ? 334 GLU A N    1 
ATOM   1306 C  CA   . GLU A 1 119 ? 35.755 51.443 0.398   1.00 37.43  ? 334 GLU A CA   1 
ATOM   1307 C  C    . GLU A 1 119 ? 34.237 51.360 0.343   1.00 37.17  ? 334 GLU A C    1 
ATOM   1308 O  O    . GLU A 1 119 ? 33.622 51.571 -0.700  1.00 38.94  ? 334 GLU A O    1 
ATOM   1309 C  CB   . GLU A 1 119 ? 36.202 52.754 1.038   1.00 43.34  ? 334 GLU A CB   1 
ATOM   1310 C  CG   . GLU A 1 119 ? 35.582 53.976 0.400   1.00 46.32  ? 334 GLU A CG   1 
ATOM   1311 C  CD   . GLU A 1 119 ? 36.188 55.297 0.876   1.00 57.70  ? 334 GLU A CD   1 
ATOM   1312 O  OE1  . GLU A 1 119 ? 36.779 55.335 1.973   1.00 52.40  ? 334 GLU A OE1  1 
ATOM   1313 O  OE2  . GLU A 1 119 ? 36.069 56.304 0.146   1.00 67.83  ? 334 GLU A OE2  1 
ATOM   1314 H  H    . GLU A 1 119 ? 35.885 51.684 -1.558  1.00 43.53  ? 334 GLU A H    1 
ATOM   1315 H  HA   . GLU A 1 119 ? 36.074 50.715 0.954   1.00 44.92  ? 334 GLU A HA   1 
ATOM   1316 H  HB2  . GLU A 1 119 ? 35.952 52.747 1.975   1.00 52.01  ? 334 GLU A HB2  1 
ATOM   1317 H  HB3  . GLU A 1 119 ? 37.165 52.831 0.954   1.00 52.01  ? 334 GLU A HB3  1 
ATOM   1318 H  HG2  . GLU A 1 119 ? 35.704 53.923 -0.561  1.00 55.59  ? 334 GLU A HG2  1 
ATOM   1319 H  HG3  . GLU A 1 119 ? 34.635 53.991 0.610   1.00 55.59  ? 334 GLU A HG3  1 
ATOM   1320 N  N    . SER A 1 120 ? 33.659 51.037 1.497   1.00 36.21  ? 335 SER A N    1 
ATOM   1321 C  CA   . SER A 1 120 ? 32.213 51.018 1.698   1.00 37.10  ? 335 SER A CA   1 
ATOM   1322 C  C    . SER A 1 120 ? 31.884 51.165 3.162   1.00 38.63  ? 335 SER A C    1 
ATOM   1323 O  O    . SER A 1 120 ? 32.724 51.020 4.024   1.00 38.73  ? 335 SER A O    1 
ATOM   1324 C  CB   . SER A 1 120 ? 31.562 49.721 1.169   1.00 35.64  ? 335 SER A CB   1 
ATOM   1325 O  OG   . SER A 1 120 ? 32.113 48.548 1.746   1.00 37.01  ? 335 SER A OG   1 
ATOM   1326 H  H    . SER A 1 120 ? 34.100 50.818 2.202   1.00 43.45  ? 335 SER A H    1 
ATOM   1327 H  HA   . SER A 1 120 ? 31.819 51.767 1.225   1.00 44.52  ? 335 SER A HA   1 
ATOM   1328 H  HB2  . SER A 1 120 ? 30.613 49.748 1.371   1.00 42.77  ? 335 SER A HB2  1 
ATOM   1329 H  HB3  . SER A 1 120 ? 31.689 49.682 0.208   1.00 42.77  ? 335 SER A HB3  1 
ATOM   1330 H  HG   . SER A 1 120 ? 32.007 48.561 2.579   1.00 44.41  ? 335 SER A HG   1 
ATOM   1331 N  N    . LEU A 1 121 ? 30.621 51.464 3.412   1.00 40.02  ? 336 LEU A N    1 
ATOM   1332 C  CA   . LEU A 1 121 ? 30.067 51.432 4.752   1.00 41.46  ? 336 LEU A CA   1 
ATOM   1333 C  C    . LEU A 1 121 ? 29.550 50.053 5.163   1.00 40.49  ? 336 LEU A C    1 
ATOM   1334 O  O    . LEU A 1 121 ? 29.237 49.837 6.331   1.00 41.46  ? 336 LEU A O    1 
ATOM   1335 C  CB   . LEU A 1 121 ? 28.957 52.456 4.857   1.00 43.80  ? 336 LEU A CB   1 
ATOM   1336 C  CG   . LEU A 1 121 ? 29.446 53.860 4.509   1.00 50.42  ? 336 LEU A CG   1 
ATOM   1337 C  CD1  . LEU A 1 121 ? 28.281 54.852 4.487   1.00 61.46  ? 336 LEU A CD1  1 
ATOM   1338 C  CD2  . LEU A 1 121 ? 30.485 54.322 5.525   1.00 46.08  ? 336 LEU A CD2  1 
ATOM   1339 H  H    . LEU A 1 121 ? 30.053 51.695 2.808   1.00 48.02  ? 336 LEU A H    1 
ATOM   1340 H  HA   . LEU A 1 121 ? 30.761 51.684 5.381   1.00 49.76  ? 336 LEU A HA   1 
ATOM   1341 H  HB2  . LEU A 1 121 ? 28.246 52.221 4.239   1.00 52.56  ? 336 LEU A HB2  1 
ATOM   1342 H  HB3  . LEU A 1 121 ? 28.619 52.470 5.766   1.00 52.56  ? 336 LEU A HB3  1 
ATOM   1343 H  HG   . LEU A 1 121 ? 29.858 53.851 3.630   1.00 60.50  ? 336 LEU A HG   1 
ATOM   1344 H  HD11 . LEU A 1 121 ? 28.620 55.732 4.264   1.00 73.76  ? 336 LEU A HD11 1 
ATOM   1345 H  HD12 . LEU A 1 121 ? 27.637 54.566 3.820   1.00 73.76  ? 336 LEU A HD12 1 
ATOM   1346 H  HD13 . LEU A 1 121 ? 27.865 54.869 5.363   1.00 73.76  ? 336 LEU A HD13 1 
ATOM   1347 H  HD21 . LEU A 1 121 ? 30.784 55.214 5.288   1.00 55.29  ? 336 LEU A HD21 1 
ATOM   1348 H  HD22 . LEU A 1 121 ? 30.082 54.331 6.407   1.00 55.29  ? 336 LEU A HD22 1 
ATOM   1349 H  HD23 . LEU A 1 121 ? 31.235 53.707 5.511   1.00 55.29  ? 336 LEU A HD23 1 
ATOM   1350 N  N    . GLU A 1 122 ? 29.438 49.110 4.243   1.00 38.81  ? 337 GLU A N    1 
ATOM   1351 C  CA   . GLU A 1 122 ? 28.954 47.802 4.666   1.00 38.24  ? 337 GLU A CA   1 
ATOM   1352 C  C    . GLU A 1 122 ? 30.013 46.755 4.509   1.00 36.46  ? 337 GLU A C    1 
ATOM   1353 O  O    . GLU A 1 122 ? 30.822 46.810 3.614   1.00 35.28  ? 337 GLU A O    1 
ATOM   1354 C  CB   . GLU A 1 122 ? 27.654 47.411 3.928   1.00 55.09  ? 337 GLU A CB   1 
ATOM   1355 C  CG   . GLU A 1 122 ? 27.739 47.170 2.450   1.00 55.72  ? 337 GLU A CG   1 
ATOM   1356 C  CD   . GLU A 1 122 ? 26.364 47.187 1.789   1.00 66.08  ? 337 GLU A CD   1 
ATOM   1357 O  OE1  . GLU A 1 122 ? 25.941 48.273 1.327   1.00 65.31  ? 337 GLU A OE1  1 
ATOM   1358 O  OE2  . GLU A 1 122 ? 25.715 46.114 1.735   1.00 69.90  ? 337 GLU A OE2  1 
ATOM   1359 H  H    . GLU A 1 122 ? 29.625 49.190 3.407   1.00 46.57  ? 337 GLU A H    1 
ATOM   1360 H  HA   . GLU A 1 122 ? 28.741 47.851 5.611   1.00 45.89  ? 337 GLU A HA   1 
ATOM   1361 H  HB2  . GLU A 1 122 ? 27.315 46.596 4.330   1.00 66.11  ? 337 GLU A HB2  1 
ATOM   1362 H  HB3  . GLU A 1 122 ? 27.009 48.123 4.062   1.00 66.11  ? 337 GLU A HB3  1 
ATOM   1363 H  HG2  . GLU A 1 122 ? 28.279 47.866 2.044   1.00 66.87  ? 337 GLU A HG2  1 
ATOM   1364 H  HG3  . GLU A 1 122 ? 28.140 46.301 2.292   1.00 66.87  ? 337 GLU A HG3  1 
ATOM   1365 N  N    . HIS A 1 123 ? 29.994 45.817 5.449   1.00 36.54  ? 338 HIS A N    1 
ATOM   1366 C  CA   . HIS A 1 123 ? 30.977 44.757 5.537   1.00 36.90  ? 338 HIS A CA   1 
ATOM   1367 C  C    . HIS A 1 123 ? 30.663 43.666 4.529   1.00 37.81  ? 338 HIS A C    1 
ATOM   1368 O  O    . HIS A 1 123 ? 29.633 42.990 4.616   1.00 39.24  ? 338 HIS A O    1 
ATOM   1369 C  CB   . HIS A 1 123 ? 31.002 44.176 6.962   1.00 43.86  ? 338 HIS A CB   1 
ATOM   1370 C  CG   . HIS A 1 123 ? 32.108 43.194 7.190   1.00 44.21  ? 338 HIS A CG   1 
ATOM   1371 N  ND1  . HIS A 1 123 ? 32.098 41.922 6.664   1.00 43.83  ? 338 HIS A ND1  1 
ATOM   1372 C  CD2  . HIS A 1 123 ? 33.275 43.309 7.877   1.00 37.31  ? 338 HIS A CD2  1 
ATOM   1373 C  CE1  . HIS A 1 123 ? 33.203 41.290 7.014   1.00 44.86  ? 338 HIS A CE1  1 
ATOM   1374 N  NE2  . HIS A 1 123 ? 33.932 42.108 7.756   1.00 39.92  ? 338 HIS A NE2  1 
ATOM   1375 H  H    . HIS A 1 123 ? 29.398 45.778 6.067   1.00 43.85  ? 338 HIS A H    1 
ATOM   1376 H  HA   . HIS A 1 123 ? 31.856 45.114 5.337   1.00 44.28  ? 338 HIS A HA   1 
ATOM   1377 H  HB2  . HIS A 1 123 ? 31.116 44.903 7.594   1.00 52.63  ? 338 HIS A HB2  1 
ATOM   1378 H  HB3  . HIS A 1 123 ? 30.162 43.722 7.129   1.00 52.63  ? 338 HIS A HB3  1 
ATOM   1379 H  HD2  . HIS A 1 123 ? 33.569 44.057 8.345   1.00 44.78  ? 338 HIS A HD2  1 
ATOM   1380 H  HE1  . HIS A 1 123 ? 33.426 40.416 6.786   1.00 53.83  ? 338 HIS A HE1  1 
ATOM   1381 H  HE2  . HIS A 1 123 ? 34.696 41.920 8.103   1.00 47.90  ? 338 HIS A HE2  1 
ATOM   1382 N  N    . MET A 1 124 ? 31.561 43.502 3.572   1.00 35.93  ? 339 MET A N    1 
ATOM   1383 C  CA   . MET A 1 124 ? 31.384 42.522 2.540   1.00 36.73  ? 339 MET A CA   1 
ATOM   1384 C  C    . MET A 1 124 ? 32.670 41.763 2.357   1.00 33.18  ? 339 MET A C    1 
ATOM   1385 O  O    . MET A 1 124 ? 33.701 42.114 2.900   1.00 32.91  ? 339 MET A O    1 
ATOM   1386 C  CB   . MET A 1 124 ? 30.984 43.172 1.220   1.00 31.76  ? 339 MET A CB   1 
ATOM   1387 C  CG   . MET A 1 124 ? 29.691 43.907 1.248   1.00 32.73  ? 339 MET A CG   1 
ATOM   1388 S  SD   . MET A 1 124 ? 29.367 44.775 -0.298  1.00 36.07  ? 339 MET A SD   1 
ATOM   1389 C  CE   . MET A 1 124 ? 30.644 46.074 -0.305  1.00 33.17  ? 339 MET A CE   1 
ATOM   1390 H  H    . MET A 1 124 ? 32.288 43.957 3.505   1.00 43.12  ? 339 MET A H    1 
ATOM   1391 H  HA   . MET A 1 124 ? 30.682 41.906 2.801   1.00 44.07  ? 339 MET A HA   1 
ATOM   1392 H  HB2  . MET A 1 124 ? 31.675 43.804 0.966   1.00 38.11  ? 339 MET A HB2  1 
ATOM   1393 H  HB3  . MET A 1 124 ? 30.913 42.479 0.544   1.00 38.11  ? 339 MET A HB3  1 
ATOM   1394 H  HG2  . MET A 1 124 ? 28.970 43.275 1.397   1.00 39.27  ? 339 MET A HG2  1 
ATOM   1395 H  HG3  . MET A 1 124 ? 29.714 44.562 1.963   1.00 39.27  ? 339 MET A HG3  1 
ATOM   1396 H  HE1  . MET A 1 124 ? 30.551 46.604 -1.113  1.00 39.80  ? 339 MET A HE1  1 
ATOM   1397 H  HE2  . MET A 1 124 ? 30.526 46.637 0.476   1.00 39.80  ? 339 MET A HE2  1 
ATOM   1398 H  HE3  . MET A 1 124 ? 31.519 45.657 -0.283  1.00 39.80  ? 339 MET A HE3  1 
ATOM   1399 N  N    . THR A 1 125 ? 32.563 40.691 1.598   1.00 33.41  ? 340 THR A N    1 
ATOM   1400 C  CA   . THR A 1 125 ? 33.685 40.077 0.921   1.00 33.31  ? 340 THR A CA   1 
ATOM   1401 C  C    . THR A 1 125 ? 33.566 40.315 -0.610  1.00 28.55  ? 340 THR A C    1 
ATOM   1402 O  O    . THR A 1 125 ? 32.528 40.061 -1.204  1.00 28.96  ? 340 THR A O    1 
ATOM   1403 C  CB   . THR A 1 125 ? 33.738 38.608 1.206   1.00 35.23  ? 340 THR A CB   1 
ATOM   1404 O  OG1  . THR A 1 125 ? 33.867 38.433 2.611   1.00 35.18  ? 340 THR A OG1  1 
ATOM   1405 C  CG2  . THR A 1 125 ? 34.920 37.962 0.463   1.00 30.82  ? 340 THR A CG2  1 
ATOM   1406 H  H    . THR A 1 125 ? 31.819 40.285 1.453   1.00 40.09  ? 340 THR A H    1 
ATOM   1407 H  HA   . THR A 1 125 ? 34.511 40.480 1.232   1.00 39.97  ? 340 THR A HA   1 
ATOM   1408 H  HB   . THR A 1 125 ? 32.917 38.189 0.902   1.00 42.28  ? 340 THR A HB   1 
ATOM   1409 H  HG1  . THR A 1 125 ? 33.899 37.615 2.798   1.00 42.22  ? 340 THR A HG1  1 
ATOM   1410 H  HG21 . THR A 1 125 ? 34.950 37.011 0.651   1.00 36.99  ? 340 THR A HG21 1 
ATOM   1411 H  HG22 . THR A 1 125 ? 34.821 38.092 -0.493  1.00 36.99  ? 340 THR A HG22 1 
ATOM   1412 H  HG23 . THR A 1 125 ? 35.753 38.367 0.751   1.00 36.99  ? 340 THR A HG23 1 
ATOM   1413 N  N    . LEU A 1 126 ? 34.602 40.877 -1.211  1.00 29.35  ? 341 LEU A N    1 
ATOM   1414 C  CA   . LEU A 1 126 ? 34.565 41.214 -2.629  1.00 32.16  ? 341 LEU A CA   1 
ATOM   1415 C  C    . LEU A 1 126 ? 35.251 40.159 -3.487  1.00 31.62  ? 341 LEU A C    1 
ATOM   1416 O  O    . LEU A 1 126 ? 36.264 39.584 -3.111  1.00 27.27  ? 341 LEU A O    1 
ATOM   1417 C  CB   . LEU A 1 126 ? 35.231 42.564 -2.878  1.00 30.41  ? 341 LEU A CB   1 
ATOM   1418 C  CG   . LEU A 1 126 ? 34.663 43.805 -2.202  1.00 34.71  ? 341 LEU A CG   1 
ATOM   1419 C  CD1  . LEU A 1 126 ? 35.435 44.978 -2.777  1.00 38.72  ? 341 LEU A CD1  1 
ATOM   1420 C  CD2  . LEU A 1 126 ? 33.188 43.965 -2.431  1.00 35.97  ? 341 LEU A CD2  1 
ATOM   1421 H  H    . LEU A 1 126 ? 35.342 41.076 -0.821  1.00 35.22  ? 341 LEU A H    1 
ATOM   1422 H  HA   . LEU A 1 126 ? 33.640 41.278 -2.915  1.00 38.59  ? 341 LEU A HA   1 
ATOM   1423 H  HB2  . LEU A 1 126 ? 36.156 42.492 -2.595  1.00 36.49  ? 341 LEU A HB2  1 
ATOM   1424 H  HB3  . LEU A 1 126 ? 35.208 42.732 -3.833  1.00 36.49  ? 341 LEU A HB3  1 
ATOM   1425 H  HG   . LEU A 1 126 ? 34.828 43.763 -1.248  1.00 41.65  ? 341 LEU A HG   1 
ATOM   1426 H  HD11 . LEU A 1 126 ? 35.108 45.798 -2.375  1.00 46.47  ? 341 LEU A HD11 1 
ATOM   1427 H  HD12 . LEU A 1 126 ? 36.378 44.863 -2.576  1.00 46.47  ? 341 LEU A HD12 1 
ATOM   1428 H  HD13 . LEU A 1 126 ? 35.302 45.003 -3.737  1.00 46.47  ? 341 LEU A HD13 1 
ATOM   1429 H  HD21 . LEU A 1 126 ? 32.884 44.769 -1.980  1.00 43.16  ? 341 LEU A HD21 1 
ATOM   1430 H  HD22 . LEU A 1 126 ? 33.022 44.038 -3.384  1.00 43.16  ? 341 LEU A HD22 1 
ATOM   1431 H  HD23 . LEU A 1 126 ? 32.727 43.190 -2.073  1.00 43.16  ? 341 LEU A HD23 1 
ATOM   1432 N  N    . THR A 1 127 ? 34.656 39.892 -4.633  1.00 29.33  ? 342 THR A N    1 
ATOM   1433 C  CA   . THR A 1 127 ? 35.299 39.114 -5.689  1.00 28.60  ? 342 THR A CA   1 
ATOM   1434 C  C    . THR A 1 127 ? 35.587 40.084 -6.810  1.00 26.67  ? 342 THR A C    1 
ATOM   1435 O  O    . THR A 1 127 ? 34.702 40.841 -7.202  1.00 28.76  ? 342 THR A O    1 
ATOM   1436 C  CB   . THR A 1 127 ? 34.422 37.981 -6.192  1.00 39.11  ? 342 THR A CB   1 
ATOM   1437 O  OG1  . THR A 1 127 ? 34.249 37.039 -5.138  1.00 38.78  ? 342 THR A OG1  1 
ATOM   1438 C  CG2  . THR A 1 127 ? 35.075 37.278 -7.355  1.00 37.78  ? 342 THR A CG2  1 
ATOM   1439 H  H    . THR A 1 127 ? 33.862 40.153 -4.834  1.00 35.19  ? 342 THR A H    1 
ATOM   1440 H  HA   . THR A 1 127 ? 36.137 38.746 -5.368  1.00 34.32  ? 342 THR A HA   1 
ATOM   1441 H  HB   . THR A 1 127 ? 33.561 38.327 -6.474  1.00 46.94  ? 342 THR A HB   1 
ATOM   1442 H  HG1  . THR A 1 127 ? 33.765 36.403 -5.398  1.00 46.54  ? 342 THR A HG1  1 
ATOM   1443 H  HG21 . THR A 1 127 ? 34.506 36.557 -7.667  1.00 45.33  ? 342 THR A HG21 1 
ATOM   1444 H  HG22 . THR A 1 127 ? 35.219 37.904 -8.082  1.00 45.33  ? 342 THR A HG22 1 
ATOM   1445 H  HG23 . THR A 1 127 ? 35.930 36.910 -7.081  1.00 45.33  ? 342 THR A HG23 1 
ATOM   1446 N  N    . CYS A 1 128 ? 36.835 40.117 -7.255  1.00 28.45  ? 343 CYS A N    1 
ATOM   1447 C  CA   . CYS A 1 128 ? 37.271 41.068 -8.271  1.00 25.94  ? 343 CYS A CA   1 
ATOM   1448 C  C    . CYS A 1 128 ? 37.717 40.228 -9.475  1.00 38.49  ? 343 CYS A C    1 
ATOM   1449 O  O    . CYS A 1 128 ? 38.701 39.513 -9.398  1.00 25.10  ? 343 CYS A O    1 
ATOM   1450 C  CB   . CYS A 1 128 ? 38.398 41.968 -7.757  1.00 42.48  ? 343 CYS A CB   1 
ATOM   1451 S  SG   . CYS A 1 128 ? 38.067 42.815 -6.090  1.00 52.64  ? 343 CYS A SG   1 
ATOM   1452 H  H    . CYS A 1 128 ? 37.458 39.591 -6.982  1.00 34.14  ? 343 CYS A H    1 
ATOM   1453 H  HA   . CYS A 1 128 ? 36.525 41.626 -8.540  1.00 31.13  ? 343 CYS A HA   1 
ATOM   1454 H  HB2  . CYS A 1 128 ? 39.199 41.431 -7.657  1.00 50.97  ? 343 CYS A HB2  1 
ATOM   1455 H  HB3  . CYS A 1 128 ? 38.556 42.666 -8.412  1.00 50.97  ? 343 CYS A HB3  1 
ATOM   1456 H  HG   . CYS A 1 128 ? 39.017 43.487 -5.799  1.00 63.17  ? 343 CYS A HG   1 
ATOM   1457 N  N    . SER A 1 129 ? 36.963 40.255 -10.566 1.00 25.96  ? 344 SER A N    1 
ATOM   1458 C  CA   . SER A 1 129 ? 37.429 39.565 -11.774 1.00 25.49  ? 344 SER A CA   1 
ATOM   1459 C  C    . SER A 1 129 ? 37.990 40.545 -12.805 1.00 25.71  ? 344 SER A C    1 
ATOM   1460 O  O    . SER A 1 129 ? 37.315 41.491 -13.162 1.00 27.12  ? 344 SER A O    1 
ATOM   1461 C  CB   . SER A 1 129 ? 36.294 38.767 -12.366 1.00 31.24  ? 344 SER A CB   1 
ATOM   1462 O  OG   . SER A 1 129 ? 36.648 38.358 -13.678 1.00 46.86  ? 344 SER A OG   1 
ATOM   1463 H  H    . SER A 1 129 ? 36.203 40.650 -10.639 1.00 31.15  ? 344 SER A H    1 
ATOM   1464 H  HA   . SER A 1 129 ? 38.136 38.946 -11.532 1.00 30.59  ? 344 SER A HA   1 
ATOM   1465 H  HB2  . SER A 1 129 ? 36.132 37.984 -11.817 1.00 37.49  ? 344 SER A HB2  1 
ATOM   1466 H  HB3  . SER A 1 129 ? 35.499 39.321 -12.405 1.00 37.49  ? 344 SER A HB3  1 
ATOM   1467 H  HG   . SER A 1 129 ? 36.022 37.912 -14.018 1.00 56.23  ? 344 SER A HG   1 
ATOM   1468 N  N    . SER A 1 130 ? 39.235 40.340 -13.231 1.00 21.69  ? 345 SER A N    1 
ATOM   1469 C  CA   . SER A 1 130 ? 39.886 41.199 -14.228 1.00 21.34  ? 345 SER A CA   1 
ATOM   1470 C  C    . SER A 1 130 ? 40.167 40.427 -15.494 1.00 20.96  ? 345 SER A C    1 
ATOM   1471 O  O    . SER A 1 130 ? 40.805 39.357 -15.421 1.00 21.19  ? 345 SER A O    1 
ATOM   1472 C  CB   . SER A 1 130 ? 41.197 41.779 -13.672 1.00 21.49  ? 345 SER A CB   1 
ATOM   1473 O  OG   . SER A 1 130 ? 40.941 42.405 -12.439 1.00 27.41  ? 345 SER A OG   1 
ATOM   1474 H  H    . SER A 1 130 ? 39.735 39.698 -12.954 1.00 26.03  ? 345 SER A H    1 
ATOM   1475 H  HA   . SER A 1 130 ? 39.296 41.937 -14.447 1.00 25.61  ? 345 SER A HA   1 
ATOM   1476 H  HB2  . SER A 1 130 ? 41.835 41.060 -13.541 1.00 25.79  ? 345 SER A HB2  1 
ATOM   1477 H  HB3  . SER A 1 130 ? 41.549 42.432 -14.297 1.00 25.79  ? 345 SER A HB3  1 
ATOM   1478 H  HG   . SER A 1 130 ? 40.630 41.848 -11.893 1.00 32.89  ? 345 SER A HG   1 
ATOM   1479 N  N    . LYS A 1 131 ? 39.726 40.964 -16.635 1.00 20.26  ? 346 LYS A N    1 
ATOM   1480 C  CA   . LYS A 1 131 ? 39.886 40.300 -17.904 1.00 20.20  ? 346 LYS A CA   1 
ATOM   1481 C  C    . LYS A 1 131 ? 40.625 41.196 -18.850 1.00 19.73  ? 346 LYS A C    1 
ATOM   1482 O  O    . LYS A 1 131 ? 40.352 42.359 -18.915 1.00 19.66  ? 346 LYS A O    1 
ATOM   1483 C  CB   . LYS A 1 131 ? 38.531 39.922 -18.531 1.00 23.86  ? 346 LYS A CB   1 
ATOM   1484 C  CG   . LYS A 1 131 ? 37.670 39.023 -17.642 1.00 29.32  ? 346 LYS A CG   1 
ATOM   1485 C  CD   . LYS A 1 131 ? 36.420 38.546 -18.410 1.00 46.34  ? 346 LYS A CD   1 
ATOM   1486 C  CE   . LYS A 1 131 ? 35.525 37.623 -17.559 1.00 60.89  ? 346 LYS A CE   1 
ATOM   1487 N  NZ   . LYS A 1 131 ? 34.705 38.411 -16.586 1.00 60.12  ? 346 LYS A NZ   1 
ATOM   1488 H  H    . LYS A 1 131 ? 39.326 41.723 -16.688 1.00 24.32  ? 346 LYS A H    1 
ATOM   1489 H  HA   . LYS A 1 131 ? 40.404 39.489 -17.781 1.00 24.24  ? 346 LYS A HA   1 
ATOM   1490 H  HB2  . LYS A 1 131 ? 38.030 40.734 -18.705 1.00 28.63  ? 346 LYS A HB2  1 
ATOM   1491 H  HB3  . LYS A 1 131 ? 38.692 39.449 -19.363 1.00 28.63  ? 346 LYS A HB3  1 
ATOM   1492 H  HG2  . LYS A 1 131 ? 38.183 38.244 -17.376 1.00 35.19  ? 346 LYS A HG2  1 
ATOM   1493 H  HG3  . LYS A 1 131 ? 37.381 39.521 -16.861 1.00 35.19  ? 346 LYS A HG3  1 
ATOM   1494 H  HD2  . LYS A 1 131 ? 35.894 39.318 -18.671 1.00 55.60  ? 346 LYS A HD2  1 
ATOM   1495 H  HD3  . LYS A 1 131 ? 36.700 38.052 -19.197 1.00 55.60  ? 346 LYS A HD3  1 
ATOM   1496 H  HE2  . LYS A 1 131 ? 34.922 37.135 -18.141 1.00 73.07  ? 346 LYS A HE2  1 
ATOM   1497 H  HE3  . LYS A 1 131 ? 36.083 37.007 -17.059 1.00 73.07  ? 346 LYS A HE3  1 
ATOM   1498 H  HZ1  . LYS A 1 131 ? 34.196 37.864 -16.104 1.00 72.14  ? 346 LYS A HZ1  1 
ATOM   1499 H  HZ2  . LYS A 1 131 ? 35.238 38.867 -16.039 1.00 72.14  ? 346 LYS A HZ2  1 
ATOM   1500 H  HZ3  . LYS A 1 131 ? 34.182 38.984 -17.023 1.00 72.14  ? 346 LYS A HZ3  1 
ATOM   1501 N  N    . VAL A 1 132 ? 41.565 40.634 -19.585 1.00 19.60  ? 347 VAL A N    1 
ATOM   1502 C  CA   . VAL A 1 132 ? 42.223 41.331 -20.681 1.00 19.27  ? 347 VAL A CA   1 
ATOM   1503 C  C    . VAL A 1 132 ? 41.665 40.797 -21.965 1.00 19.44  ? 347 VAL A C    1 
ATOM   1504 O  O    . VAL A 1 132 ? 41.551 39.558 -22.170 1.00 19.88  ? 347 VAL A O    1 
ATOM   1505 C  CB   . VAL A 1 132 ? 43.744 41.154 -20.662 1.00 19.23  ? 347 VAL A CB   1 
ATOM   1506 C  CG1  . VAL A 1 132 ? 44.386 41.955 -21.797 1.00 18.99  ? 347 VAL A CG1  1 
ATOM   1507 C  CG2  . VAL A 1 132 ? 44.313 41.552 -19.301 1.00 19.37  ? 347 VAL A CG2  1 
ATOM   1508 H  H    . VAL A 1 132 ? 41.849 39.831 -19.469 1.00 23.52  ? 347 VAL A H    1 
ATOM   1509 H  HA   . VAL A 1 132 ? 42.024 42.279 -20.629 1.00 23.13  ? 347 VAL A HA   1 
ATOM   1510 H  HB   . VAL A 1 132 ? 43.951 40.217 -20.807 1.00 23.07  ? 347 VAL A HB   1 
ATOM   1511 H  HG11 . VAL A 1 132 ? 45.347 41.829 -21.767 1.00 22.79  ? 347 VAL A HG11 1 
ATOM   1512 H  HG12 . VAL A 1 132 ? 44.036 41.637 -22.644 1.00 22.79  ? 347 VAL A HG12 1 
ATOM   1513 H  HG13 . VAL A 1 132 ? 44.171 42.893 -21.681 1.00 22.79  ? 347 VAL A HG13 1 
ATOM   1514 H  HG21 . VAL A 1 132 ? 45.276 41.431 -19.315 1.00 23.24  ? 347 VAL A HG21 1 
ATOM   1515 H  HG22 . VAL A 1 132 ? 44.099 42.482 -19.130 1.00 23.24  ? 347 VAL A HG22 1 
ATOM   1516 H  HG23 . VAL A 1 132 ? 43.918 40.989 -18.617 1.00 23.24  ? 347 VAL A HG23 1 
ATOM   1517 N  N    . CYS A 1 133 ? 41.282 41.709 -22.832 1.00 26.14  ? 348 CYS A N    1 
ATOM   1518 C  CA   . CYS A 1 133 ? 40.739 41.311 -24.107 1.00 28.68  ? 348 CYS A CA   1 
ATOM   1519 C  C    . CYS A 1 133 ? 41.665 41.862 -25.187 1.00 27.88  ? 348 CYS A C    1 
ATOM   1520 O  O    . CYS A 1 133 ? 42.030 43.054 -25.217 1.00 26.43  ? 348 CYS A O    1 
ATOM   1521 C  CB   . CYS A 1 133 ? 39.289 41.778 -24.255 1.00 42.92  ? 348 CYS A CB   1 
ATOM   1522 S  SG   . CYS A 1 133 ? 38.192 41.044 -22.954 1.00 41.09  ? 348 CYS A SG   1 
ATOM   1523 H  H    . CYS A 1 133 ? 41.325 42.559 -22.708 1.00 31.37  ? 348 CYS A H    1 
ATOM   1524 H  HA   . CYS A 1 133 ? 40.750 40.343 -24.167 1.00 34.42  ? 348 CYS A HA   1 
ATOM   1525 H  HB2  . CYS A 1 133 ? 39.254 42.743 -24.171 1.00 51.50  ? 348 CYS A HB2  1 
ATOM   1526 H  HB3  . CYS A 1 133 ? 38.953 41.505 -25.123 1.00 51.50  ? 348 CYS A HB3  1 
ATOM   1527 H  HG   . CYS A 1 133 ? 38.591 41.378 -21.873 1.00 49.31  ? 348 CYS A HG   1 
ATOM   1528 N  N    . SER A 1 134 ? 42.051 40.972 -26.081 1.00 27.81  ? 349 SER A N    1 
ATOM   1529 C  CA   . SER A 1 134 ? 42.913 41.332 -27.194 1.00 28.47  ? 349 SER A CA   1 
ATOM   1530 C  C    . SER A 1 134 ? 42.344 40.891 -28.531 1.00 35.12  ? 349 SER A C    1 
ATOM   1531 O  O    . SER A 1 134 ? 42.157 39.690 -28.758 1.00 28.84  ? 349 SER A O    1 
ATOM   1532 C  CB   . SER A 1 134 ? 44.281 40.700 -27.041 1.00 37.95  ? 349 SER A CB   1 
ATOM   1533 O  OG   . SER A 1 134 ? 45.008 40.962 -28.223 1.00 38.50  ? 349 SER A OG   1 
ATOM   1534 H  H    . SER A 1 134 ? 41.827 40.142 -26.067 1.00 33.38  ? 349 SER A H    1 
ATOM   1535 H  HA   . SER A 1 134 ? 43.024 42.296 -27.214 1.00 34.17  ? 349 SER A HA   1 
ATOM   1536 H  HB2  . SER A 1 134 ? 44.739 41.094 -26.282 1.00 45.54  ? 349 SER A HB2  1 
ATOM   1537 H  HB3  . SER A 1 134 ? 44.186 39.742 -26.922 1.00 45.54  ? 349 SER A HB3  1 
ATOM   1538 H  HG   . SER A 1 134 ? 45.774 40.623 -28.170 1.00 46.21  ? 349 SER A HG   1 
ATOM   1539 N  N    . PHE A 1 135 ? 42.104 41.854 -29.424 1.00 33.42  ? 350 PHE A N    1 
ATOM   1540 C  CA   . PHE A 1 135 ? 41.528 41.544 -30.730 1.00 43.03  ? 350 PHE A CA   1 
ATOM   1541 C  C    . PHE A 1 135 ? 40.207 40.777 -30.578 1.00 40.77  ? 350 PHE A C    1 
ATOM   1542 O  O    . PHE A 1 135 ? 40.003 39.757 -31.225 1.00 36.69  ? 350 PHE A O    1 
ATOM   1543 C  CB   . PHE A 1 135 ? 42.541 40.734 -31.558 1.00 32.56  ? 350 PHE A CB   1 
ATOM   1544 C  CG   . PHE A 1 135 ? 43.702 41.569 -32.056 1.00 39.40  ? 350 PHE A CG   1 
ATOM   1545 C  CD1  . PHE A 1 135 ? 43.588 42.301 -33.231 1.00 28.81  ? 350 PHE A CD1  1 
ATOM   1546 C  CD2  . PHE A 1 135 ? 44.871 41.663 -31.332 1.00 25.76  ? 350 PHE A CD2  1 
ATOM   1547 C  CE1  . PHE A 1 135 ? 44.630 43.106 -33.700 1.00 30.74  ? 350 PHE A CE1  1 
ATOM   1548 C  CE2  . PHE A 1 135 ? 45.925 42.475 -31.779 1.00 27.88  ? 350 PHE A CE2  1 
ATOM   1549 C  CZ   . PHE A 1 135 ? 45.807 43.191 -32.976 1.00 31.12  ? 350 PHE A CZ   1 
ATOM   1550 H  H    . PHE A 1 135 ? 42.264 42.689 -29.298 1.00 40.10  ? 350 PHE A H    1 
ATOM   1551 H  HA   . PHE A 1 135 ? 41.345 42.372 -31.201 1.00 51.64  ? 350 PHE A HA   1 
ATOM   1552 H  HB2  . PHE A 1 135 ? 42.900 40.021 -31.007 1.00 39.07  ? 350 PHE A HB2  1 
ATOM   1553 H  HB3  . PHE A 1 135 ? 42.088 40.360 -32.330 1.00 39.07  ? 350 PHE A HB3  1 
ATOM   1554 H  HD1  . PHE A 1 135 ? 42.800 42.250 -33.722 1.00 34.57  ? 350 PHE A HD1  1 
ATOM   1555 H  HD2  . PHE A 1 135 ? 44.959 41.192 -30.535 1.00 30.92  ? 350 PHE A HD2  1 
ATOM   1556 H  HE1  . PHE A 1 135 ? 44.534 43.578 -34.495 1.00 36.89  ? 350 PHE A HE1  1 
ATOM   1557 H  HE2  . PHE A 1 135 ? 46.714 42.519 -31.289 1.00 33.45  ? 350 PHE A HE2  1 
ATOM   1558 H  HZ   . PHE A 1 135 ? 46.509 43.720 -33.279 1.00 37.34  ? 350 PHE A HZ   1 
ATOM   1559 N  N    . GLY A 1 136 ? 39.342 41.243 -29.687 1.00 44.08  ? 351 GLY A N    1 
ATOM   1560 C  CA   . GLY A 1 136 ? 38.037 40.631 -29.486 1.00 47.92  ? 351 GLY A CA   1 
ATOM   1561 C  C    . GLY A 1 136 ? 38.013 39.333 -28.681 1.00 53.01  ? 351 GLY A C    1 
ATOM   1562 O  O    . GLY A 1 136 ? 36.955 38.778 -28.397 1.00 73.44  ? 351 GLY A O    1 
ATOM   1563 H  H    . GLY A 1 136 ? 39.490 41.921 -29.180 1.00 52.89  ? 351 GLY A H    1 
ATOM   1564 H  HA2  . GLY A 1 136 ? 37.463 41.268 -29.033 1.00 57.50  ? 351 GLY A HA2  1 
ATOM   1565 H  HA3  . GLY A 1 136 ? 37.646 40.445 -30.354 1.00 57.50  ? 351 GLY A HA3  1 
ATOM   1566 N  N    . LYS A 1 137 ? 39.182 38.854 -28.293 1.00 32.00  ? 352 LYS A N    1 
ATOM   1567 C  CA   . LYS A 1 137 ? 39.287 37.614 -27.526 1.00 39.06  ? 352 LYS A CA   1 
ATOM   1568 C  C    . LYS A 1 137 ? 39.840 37.825 -26.128 1.00 32.05  ? 352 LYS A C    1 
ATOM   1569 O  O    . LYS A 1 137 ? 40.758 38.619 -25.912 1.00 25.40  ? 352 LYS A O    1 
ATOM   1570 C  CB   . LYS A 1 137 ? 40.176 36.622 -28.283 1.00 45.46  ? 352 LYS A CB   1 
ATOM   1571 C  CG   . LYS A 1 137 ? 39.487 36.040 -29.532 1.00 50.16  ? 352 LYS A CG   1 
ATOM   1572 C  CD   . LYS A 1 137 ? 40.407 35.166 -30.379 1.00 62.91  ? 352 LYS A CD   1 
ATOM   1573 C  CE   . LYS A 1 137 ? 39.582 34.230 -31.321 1.00 64.61  ? 352 LYS A CE   1 
ATOM   1574 N  NZ   . LYS A 1 137 ? 39.785 34.496 -32.795 1.00 57.89  ? 352 LYS A NZ   1 
ATOM   1575 H  H    . LYS A 1 137 ? 39.939 39.228 -28.459 1.00 38.40  ? 352 LYS A H    1 
ATOM   1576 H  HA   . LYS A 1 137 ? 38.404 37.220 -27.442 1.00 46.87  ? 352 LYS A HA   1 
ATOM   1577 H  HB2  . LYS A 1 137 ? 40.983 37.077 -28.570 1.00 54.55  ? 352 LYS A HB2  1 
ATOM   1578 H  HB3  . LYS A 1 137 ? 40.401 35.886 -27.694 1.00 54.55  ? 352 LYS A HB3  1 
ATOM   1579 H  HG2  . LYS A 1 137 ? 38.735 35.495 -29.250 1.00 60.20  ? 352 LYS A HG2  1 
ATOM   1580 H  HG3  . LYS A 1 137 ? 39.176 36.771 -30.088 1.00 60.20  ? 352 LYS A HG3  1 
ATOM   1581 H  HD2  . LYS A 1 137 ? 40.972 35.731 -30.928 1.00 75.49  ? 352 LYS A HD2  1 
ATOM   1582 H  HD3  . LYS A 1 137 ? 40.949 34.611 -29.796 1.00 75.49  ? 352 LYS A HD3  1 
ATOM   1583 H  HE2  . LYS A 1 137 ? 39.839 33.311 -31.149 1.00 77.54  ? 352 LYS A HE2  1 
ATOM   1584 H  HE3  . LYS A 1 137 ? 38.639 34.348 -31.127 1.00 77.54  ? 352 LYS A HE3  1 
ATOM   1585 H  HZ1  . LYS A 1 137 ? 39.290 33.933 -33.276 1.00 69.46  ? 352 LYS A HZ1  1 
ATOM   1586 H  HZ2  . LYS A 1 137 ? 39.545 35.330 -32.990 1.00 69.46  ? 352 LYS A HZ2  1 
ATOM   1587 H  HZ3  . LYS A 1 137 ? 40.641 34.383 -33.010 1.00 69.46  ? 352 LYS A HZ3  1 
ATOM   1588 N  N    . GLN A 1 138 ? 39.322 37.048 -25.190 1.00 31.19  ? 353 GLN A N    1 
ATOM   1589 C  CA   . GLN A 1 138 ? 39.778 37.121 -23.833 1.00 35.10  ? 353 GLN A CA   1 
ATOM   1590 C  C    . GLN A 1 138 ? 41.060 36.309 -23.638 1.00 34.24  ? 353 GLN A C    1 
ATOM   1591 O  O    . GLN A 1 138 ? 41.031 35.110 -23.743 1.00 31.68  ? 353 GLN A O    1 
ATOM   1592 C  CB   . GLN A 1 138 ? 38.677 36.631 -22.924 1.00 37.14  ? 353 GLN A CB   1 
ATOM   1593 C  CG   . GLN A 1 138 ? 38.929 36.888 -21.480 1.00 45.64  ? 353 GLN A CG   1 
ATOM   1594 C  CD   . GLN A 1 138 ? 38.141 35.947 -20.640 1.00 49.96  ? 353 GLN A CD   1 
ATOM   1595 O  OE1  . GLN A 1 138 ? 36.938 36.123 -20.508 1.00 45.80  ? 353 GLN A OE1  1 
ATOM   1596 N  NE2  . GLN A 1 138 ? 38.796 34.895 -20.105 1.00 59.03  ? 353 GLN A NE2  1 
ATOM   1597 H  H    . GLN A 1 138 ? 38.702 36.468 -25.325 1.00 37.43  ? 353 GLN A H    1 
ATOM   1598 H  HA   . GLN A 1 138 ? 39.968 38.045 -23.608 1.00 42.12  ? 353 GLN A HA   1 
ATOM   1599 H  HB2  . GLN A 1 138 ? 37.851 37.079 -23.165 1.00 44.57  ? 353 GLN A HB2  1 
ATOM   1600 H  HB3  . GLN A 1 138 ? 38.579 35.673 -23.042 1.00 44.57  ? 353 GLN A HB3  1 
ATOM   1601 H  HG2  . GLN A 1 138 ? 39.871 36.757 -21.287 1.00 54.76  ? 353 GLN A HG2  1 
ATOM   1602 H  HG3  . GLN A 1 138 ? 38.661 37.794 -21.261 1.00 54.76  ? 353 GLN A HG3  1 
ATOM   1603 H  HE21 . GLN A 1 138 ? 39.636 34.789 -20.255 1.00 70.83  ? 353 GLN A HE21 1 
ATOM   1604 H  HE22 . GLN A 1 138 ? 38.372 34.330 -19.613 1.00 70.83  ? 353 GLN A HE22 1 
ATOM   1605 N  N    . VAL A 1 139 ? 42.191 36.952 -23.356 1.00 21.27  ? 354 VAL A N    1 
ATOM   1606 C  CA   . VAL A 1 139 ? 43.457 36.221 -23.211 1.00 21.69  ? 354 VAL A CA   1 
ATOM   1607 C  C    . VAL A 1 139 ? 43.932 36.137 -21.746 1.00 22.81  ? 354 VAL A C    1 
ATOM   1608 O  O    . VAL A 1 139 ? 44.861 35.383 -21.435 1.00 22.47  ? 354 VAL A O    1 
ATOM   1609 C  CB   . VAL A 1 139 ? 44.502 36.857 -24.109 1.00 21.25  ? 354 VAL A CB   1 
ATOM   1610 C  CG1  . VAL A 1 139 ? 44.033 36.822 -25.599 1.00 23.65  ? 354 VAL A CG1  1 
ATOM   1611 C  CG2  . VAL A 1 139 ? 44.687 38.313 -23.807 1.00 20.63  ? 354 VAL A CG2  1 
ATOM   1612 H  H    . VAL A 1 139 ? 42.256 37.802 -23.244 1.00 25.52  ? 354 VAL A H    1 
ATOM   1613 H  HA   . VAL A 1 139 ? 43.322 35.312 -23.522 1.00 26.03  ? 354 VAL A HA   1 
ATOM   1614 H  HB   . VAL A 1 139 ? 45.351 36.397 -24.026 1.00 25.50  ? 354 VAL A HB   1 
ATOM   1615 H  HG11 . VAL A 1 139 ? 44.715 37.232 -26.154 1.00 28.38  ? 354 VAL A HG11 1 
ATOM   1616 H  HG12 . VAL A 1 139 ? 43.900 35.899 -25.867 1.00 28.38  ? 354 VAL A HG12 1 
ATOM   1617 H  HG13 . VAL A 1 139 ? 43.200 37.313 -25.680 1.00 28.38  ? 354 VAL A HG13 1 
ATOM   1618 H  HG21 . VAL A 1 139 ? 45.361 38.675 -24.403 1.00 24.76  ? 354 VAL A HG21 1 
ATOM   1619 H  HG22 . VAL A 1 139 ? 43.844 38.773 -23.942 1.00 24.76  ? 354 VAL A HG22 1 
ATOM   1620 H  HG23 . VAL A 1 139 ? 44.974 38.409 -22.885 1.00 24.76  ? 354 VAL A HG23 1 
ATOM   1621 N  N    . VAL A 1 140 ? 43.336 36.937 -20.851 1.00 21.15  ? 355 VAL A N    1 
ATOM   1622 C  CA   . VAL A 1 140 ? 43.640 36.808 -19.439 1.00 21.35  ? 355 VAL A CA   1 
ATOM   1623 C  C    . VAL A 1 140 ? 42.381 36.873 -18.597 1.00 21.36  ? 355 VAL A C    1 
ATOM   1624 O  O    . VAL A 1 140 ? 41.506 37.692 -18.845 1.00 20.89  ? 355 VAL A O    1 
ATOM   1625 C  CB   . VAL A 1 140 ? 44.615 37.887 -18.960 1.00 20.83  ? 355 VAL A CB   1 
ATOM   1626 C  CG1  . VAL A 1 140 ? 44.955 37.679 -17.459 1.00 21.30  ? 355 VAL A CG1  1 
ATOM   1627 C  CG2  . VAL A 1 140 ? 45.861 37.866 -19.761 1.00 20.98  ? 355 VAL A CG2  1 
ATOM   1628 H  H    . VAL A 1 140 ? 42.763 37.550 -21.041 1.00 25.38  ? 355 VAL A H    1 
ATOM   1629 H  HA   . VAL A 1 140 ? 44.055 35.945 -19.287 1.00 25.62  ? 355 VAL A HA   1 
ATOM   1630 H  HB   . VAL A 1 140 ? 44.203 38.759 -19.060 1.00 25.00  ? 355 VAL A HB   1 
ATOM   1631 H  HG11 . VAL A 1 140 ? 45.572 38.372 -17.177 1.00 25.56  ? 355 VAL A HG11 1 
ATOM   1632 H  HG12 . VAL A 1 140 ? 44.137 37.733 -16.940 1.00 25.56  ? 355 VAL A HG12 1 
ATOM   1633 H  HG13 . VAL A 1 140 ? 45.362 36.806 -17.346 1.00 25.56  ? 355 VAL A HG13 1 
ATOM   1634 H  HG21 . VAL A 1 140 ? 46.458 38.558 -19.435 1.00 25.18  ? 355 VAL A HG21 1 
ATOM   1635 H  HG22 . VAL A 1 140 ? 46.281 36.996 -19.669 1.00 25.18  ? 355 VAL A HG22 1 
ATOM   1636 H  HG23 . VAL A 1 140 ? 45.641 38.030 -20.691 1.00 25.18  ? 355 VAL A HG23 1 
ATOM   1637 N  N    . GLU A 1 141 ? 42.306 36.041 -17.578 1.00 22.08  ? 356 GLU A N    1 
ATOM   1638 C  CA   . GLU A 1 141 ? 41.343 36.270 -16.542 1.00 22.09  ? 356 GLU A CA   1 
ATOM   1639 C  C    . GLU A 1 141 ? 41.995 36.012 -15.209 1.00 22.50  ? 356 GLU A C    1 
ATOM   1640 O  O    . GLU A 1 141 ? 42.573 34.954 -14.979 1.00 23.42  ? 356 GLU A O    1 
ATOM   1641 C  CB   . GLU A 1 141 ? 40.120 35.401 -16.703 1.00 22.88  ? 356 GLU A CB   1 
ATOM   1642 C  CG   . GLU A 1 141 ? 38.984 35.850 -15.740 1.00 39.03  ? 356 GLU A CG   1 
ATOM   1643 C  CD   . GLU A 1 141 ? 37.948 34.771 -15.476 1.00 54.41  ? 356 GLU A CD   1 
ATOM   1644 O  OE1  . GLU A 1 141 ? 38.208 33.575 -15.791 1.00 52.63  ? 356 GLU A OE1  1 
ATOM   1645 O  OE2  . GLU A 1 141 ? 36.875 35.128 -14.934 1.00 62.55  ? 356 GLU A OE2  1 
ATOM   1646 H  H    . GLU A 1 141 ? 42.798 35.345 -17.469 1.00 26.49  ? 356 GLU A H    1 
ATOM   1647 H  HA   . GLU A 1 141 ? 41.061 37.197 -16.567 1.00 26.51  ? 356 GLU A HA   1 
ATOM   1648 H  HB2  . GLU A 1 141 ? 39.793 35.471 -17.613 1.00 27.45  ? 356 GLU A HB2  1 
ATOM   1649 H  HB3  . GLU A 1 141 ? 40.349 34.481 -16.496 1.00 27.45  ? 356 GLU A HB3  1 
ATOM   1650 H  HG2  . GLU A 1 141 ? 39.375 36.100 -14.889 1.00 46.84  ? 356 GLU A HG2  1 
ATOM   1651 H  HG3  . GLU A 1 141 ? 38.526 36.611 -16.129 1.00 46.84  ? 356 GLU A HG3  1 
ATOM   1652 N  N    . LYS A 1 142 ? 41.903 37.014 -14.349 1.00 22.03  ? 357 LYS A N    1 
ATOM   1653 C  CA   . LYS A 1 142 ? 42.435 36.985 -13.019 1.00 22.46  ? 357 LYS A CA   1 
ATOM   1654 C  C    . LYS A 1 142 ? 41.299 37.156 -12.030 1.00 22.60  ? 357 LYS A C    1 
ATOM   1655 O  O    . LYS A 1 142 ? 40.567 38.180 -12.052 1.00 22.08  ? 357 LYS A O    1 
ATOM   1656 C  CB   . LYS A 1 142 ? 43.479 38.104 -12.849 1.00 22.07  ? 357 LYS A CB   1 
ATOM   1657 C  CG   . LYS A 1 142 ? 44.178 38.066 -11.468 1.00 27.20  ? 357 LYS A CG   1 
ATOM   1658 C  CD   . LYS A 1 142 ? 44.864 39.388 -11.036 1.00 37.74  ? 357 LYS A CD   1 
ATOM   1659 C  CE   . LYS A 1 142 ? 46.321 39.509 -11.454 1.00 55.20  ? 357 LYS A CE   1 
ATOM   1660 N  NZ   . LYS A 1 142 ? 47.083 40.531 -10.635 1.00 58.31  ? 357 LYS A NZ   1 
ATOM   1661 H  H    . LYS A 1 142 ? 41.513 37.758 -14.536 1.00 26.43  ? 357 LYS A H    1 
ATOM   1662 H  HA   . LYS A 1 142 ? 42.864 36.130 -12.856 1.00 26.95  ? 357 LYS A HA   1 
ATOM   1663 H  HB2  . LYS A 1 142 ? 44.160 38.007 -13.533 1.00 26.48  ? 357 LYS A HB2  1 
ATOM   1664 H  HB3  . LYS A 1 142 ? 43.038 38.963 -12.939 1.00 26.48  ? 357 LYS A HB3  1 
ATOM   1665 H  HG2  . LYS A 1 142 ? 43.516 37.847 -10.794 1.00 32.63  ? 357 LYS A HG2  1 
ATOM   1666 H  HG3  . LYS A 1 142 ? 44.860 37.376 -11.487 1.00 32.63  ? 357 LYS A HG3  1 
ATOM   1667 H  HD2  . LYS A 1 142 ? 44.382 40.131 -11.431 1.00 45.29  ? 357 LYS A HD2  1 
ATOM   1668 H  HD3  . LYS A 1 142 ? 44.830 39.454 -10.069 1.00 45.29  ? 357 LYS A HD3  1 
ATOM   1669 H  HE2  . LYS A 1 142 ? 46.755 38.649 -11.339 1.00 66.24  ? 357 LYS A HE2  1 
ATOM   1670 H  HE3  . LYS A 1 142 ? 46.361 39.780 -12.384 1.00 66.24  ? 357 LYS A HE3  1 
ATOM   1671 H  HZ1  . LYS A 1 142 ? 47.928 40.571 -10.910 1.00 69.97  ? 357 LYS A HZ1  1 
ATOM   1672 H  HZ2  . LYS A 1 142 ? 46.710 41.334 -10.727 1.00 69.97  ? 357 LYS A HZ2  1 
ATOM   1673 H  HZ3  . LYS A 1 142 ? 47.069 40.303 -9.775  1.00 69.97  ? 357 LYS A HZ3  1 
ATOM   1674 N  N    . VAL A 1 143 ? 41.159 36.212 -11.110 1.00 23.48  ? 358 VAL A N    1 
ATOM   1675 C  CA   . VAL A 1 143 ? 40.148 36.338 -10.050 1.00 28.90  ? 358 VAL A CA   1 
ATOM   1676 C  C    . VAL A 1 143 ? 40.806 36.421 -8.664  1.00 25.07  ? 358 VAL A C    1 
ATOM   1677 O  O    . VAL A 1 143 ? 41.602 35.543 -8.311  1.00 25.10  ? 358 VAL A O    1 
ATOM   1678 C  CB   . VAL A 1 143 ? 39.127 35.157 -10.081 1.00 24.64  ? 358 VAL A CB   1 
ATOM   1679 C  CG1  . VAL A 1 143 ? 38.111 35.345 -8.930  1.00 26.37  ? 358 VAL A CG1  1 
ATOM   1680 C  CG2  . VAL A 1 143 ? 38.419 35.149 -11.478 1.00 26.05  ? 358 VAL A CG2  1 
ATOM   1681 H  H    . VAL A 1 143 ? 41.629 35.493 -11.070 1.00 28.17  ? 358 VAL A H    1 
ATOM   1682 H  HA   . VAL A 1 143 ? 39.653 37.160 -10.190 1.00 34.68  ? 358 VAL A HA   1 
ATOM   1683 H  HB   . VAL A 1 143 ? 39.591 34.314 -9.958  1.00 29.57  ? 358 VAL A HB   1 
ATOM   1684 H  HG11 . VAL A 1 143 ? 37.475 34.612 -8.948  1.00 31.65  ? 358 VAL A HG11 1 
ATOM   1685 H  HG12 . VAL A 1 143 ? 38.588 35.348 -8.086  1.00 31.65  ? 358 VAL A HG12 1 
ATOM   1686 H  HG13 . VAL A 1 143 ? 37.648 36.188 -9.052  1.00 31.65  ? 358 VAL A HG13 1 
ATOM   1687 H  HG21 . VAL A 1 143 ? 37.783 34.417 -11.505 1.00 31.26  ? 358 VAL A HG21 1 
ATOM   1688 H  HG22 . VAL A 1 143 ? 37.959 35.993 -11.604 1.00 31.26  ? 358 VAL A HG22 1 
ATOM   1689 H  HG23 . VAL A 1 143 ? 39.089 35.030 -12.170 1.00 31.26  ? 358 VAL A HG23 1 
ATOM   1690 N  N    . GLU A 1 144 ? 40.444 37.461 -7.911  1.00 27.55  ? 359 GLU A N    1 
ATOM   1691 C  CA   . GLU A 1 144 ? 40.898 37.663 -6.538  1.00 29.59  ? 359 GLU A CA   1 
ATOM   1692 C  C    . GLU A 1 144 ? 39.738 38.009 -5.611  1.00 34.50  ? 359 GLU A C    1 
ATOM   1693 O  O    . GLU A 1 144 ? 38.653 38.440 -6.015  1.00 33.25  ? 359 GLU A O    1 
ATOM   1694 C  CB   . GLU A 1 144 ? 41.960 38.779 -6.428  1.00 37.46  ? 359 GLU A CB   1 
ATOM   1695 C  CG   . GLU A 1 144 ? 43.194 38.572 -7.293  1.00 61.76  ? 359 GLU A CG   1 
ATOM   1696 C  CD   . GLU A 1 144 ? 44.474 39.162 -6.687  1.00 72.61  ? 359 GLU A CD   1 
ATOM   1697 O  OE1  . GLU A 1 144 ? 45.200 38.436 -5.942  1.00 70.93  ? 359 GLU A OE1  1 
ATOM   1698 O  OE2  . GLU A 1 144 ? 44.756 40.350 -6.981  1.00 78.01  ? 359 GLU A OE2  1 
ATOM   1699 H  H    . GLU A 1 144 ? 39.917 38.083 -8.186  1.00 33.06  ? 359 GLU A H    1 
ATOM   1700 H  HA   . GLU A 1 144 ? 41.298 36.839 -6.218  1.00 35.50  ? 359 GLU A HA   1 
ATOM   1701 H  HB2  . GLU A 1 144 ? 41.554 39.620 -6.692  1.00 44.95  ? 359 GLU A HB2  1 
ATOM   1702 H  HB3  . GLU A 1 144 ? 42.255 38.836 -5.505  1.00 44.95  ? 359 GLU A HB3  1 
ATOM   1703 H  HG2  . GLU A 1 144 ? 43.335 37.620 -7.416  1.00 74.11  ? 359 GLU A HG2  1 
ATOM   1704 H  HG3  . GLU A 1 144 ? 43.049 38.998 -8.153  1.00 74.11  ? 359 GLU A HG3  1 
ATOM   1705 N  N    . THR A 1 145 ? 40.023 37.849 -4.337  1.00 27.74  ? 360 THR A N    1 
ATOM   1706 C  CA   . THR A 1 145 ? 39.042 37.890 -3.288  1.00 33.30  ? 360 THR A CA   1 
ATOM   1707 C  C    . THR A 1 145 ? 39.653 38.678 -2.142  1.00 38.45  ? 360 THR A C    1 
ATOM   1708 O  O    . THR A 1 145 ? 40.815 38.463 -1.775  1.00 30.33  ? 360 THR A O    1 
ATOM   1709 C  CB   . THR A 1 145 ? 38.661 36.482 -2.898  1.00 40.07  ? 360 THR A CB   1 
ATOM   1710 O  OG1  . THR A 1 145 ? 37.666 36.029 -3.814  1.00 44.74  ? 360 THR A OG1  1 
ATOM   1711 C  CG2  . THR A 1 145 ? 38.091 36.428 -1.521  1.00 28.91  ? 360 THR A CG2  1 
ATOM   1712 H  H    . THR A 1 145 ? 40.820 37.709 -4.045  1.00 33.29  ? 360 THR A H    1 
ATOM   1713 H  HA   . THR A 1 145 ? 38.249 38.354 -3.599  1.00 39.96  ? 360 THR A HA   1 
ATOM   1714 H  HB   . THR A 1 145 ? 39.439 35.904 -2.941  1.00 48.08  ? 360 THR A HB   1 
ATOM   1715 H  HG1  . THR A 1 145 ? 37.434 35.245 -3.621  1.00 53.69  ? 360 THR A HG1  1 
ATOM   1716 H  HG21 . THR A 1 145 ? 37.856 35.514 -1.296  1.00 34.69  ? 360 THR A HG21 1 
ATOM   1717 H  HG22 . THR A 1 145 ? 38.742 36.753 -0.880  1.00 34.69  ? 360 THR A HG22 1 
ATOM   1718 H  HG23 . THR A 1 145 ? 37.296 36.980 -1.470  1.00 34.69  ? 360 THR A HG23 1 
ATOM   1719 N  N    . GLU A 1 146 ? 38.886 39.624 -1.626  1.00 29.88  ? 361 GLU A N    1 
ATOM   1720 C  CA   . GLU A 1 146 ? 39.338 40.486 -0.540  1.00 38.54  ? 361 GLU A CA   1 
ATOM   1721 C  C    . GLU A 1 146 ? 38.228 40.742 0.491   1.00 37.05  ? 361 GLU A C    1 
ATOM   1722 O  O    . GLU A 1 146 ? 37.071 41.102 0.153   1.00 30.84  ? 361 GLU A O    1 
ATOM   1723 C  CB   . GLU A 1 146 ? 39.853 41.824 -1.108  1.00 44.30  ? 361 GLU A CB   1 
ATOM   1724 C  CG   . GLU A 1 146 ? 40.709 42.678 -0.141  1.00 47.93  ? 361 GLU A CG   1 
ATOM   1725 C  CD   . GLU A 1 146 ? 41.893 41.919 0.474   1.00 54.41  ? 361 GLU A CD   1 
ATOM   1726 O  OE1  . GLU A 1 146 ? 42.648 41.222 -0.244  1.00 66.27  ? 361 GLU A OE1  1 
ATOM   1727 O  OE2  . GLU A 1 146 ? 42.066 42.027 1.702   1.00 71.41  ? 361 GLU A OE2  1 
ATOM   1728 H  H    . GLU A 1 146 ? 38.085 39.792 -1.891  1.00 35.85  ? 361 GLU A H    1 
ATOM   1729 H  HA   . GLU A 1 146 ? 40.076 40.053 -0.081  1.00 46.25  ? 361 GLU A HA   1 
ATOM   1730 H  HB2  . GLU A 1 146 ? 40.397 41.636 -1.888  1.00 53.16  ? 361 GLU A HB2  1 
ATOM   1731 H  HB3  . GLU A 1 146 ? 39.088 42.361 -1.368  1.00 53.16  ? 361 GLU A HB3  1 
ATOM   1732 H  HG2  . GLU A 1 146 ? 41.065 43.438 -0.627  1.00 57.52  ? 361 GLU A HG2  1 
ATOM   1733 H  HG3  . GLU A 1 146 ? 40.146 42.987 0.585   1.00 57.52  ? 361 GLU A HG3  1 
ATOM   1734 N  N    . ARG A 1 147 ? 38.611 40.572 1.754   1.00 33.99  ? 362 ARG A N    1 
ATOM   1735 C  CA   . ARG A 1 147 ? 37.703 40.753 2.861   1.00 34.41  ? 362 ARG A CA   1 
ATOM   1736 C  C    . ARG A 1 147 ? 37.814 42.169 3.343   1.00 35.09  ? 362 ARG A C    1 
ATOM   1737 O  O    . ARG A 1 147 ? 38.876 42.763 3.272   1.00 39.51  ? 362 ARG A O    1 
ATOM   1738 C  CB   . ARG A 1 147 ? 38.014 39.786 4.012   1.00 37.28  ? 362 ARG A CB   1 
ATOM   1739 C  CG   . ARG A 1 147 ? 36.795 39.558 4.941   1.00 49.27  ? 362 ARG A CG   1 
ATOM   1740 C  CD   . ARG A 1 147 ? 37.186 39.140 6.368   1.00 56.02  ? 362 ARG A CD   1 
ATOM   1741 N  NE   . ARG A 1 147 ? 36.000 38.827 7.171   1.00 58.75  ? 362 ARG A NE   1 
ATOM   1742 C  CZ   . ARG A 1 147 ? 35.904 38.978 8.499   1.00 79.66  ? 362 ARG A CZ   1 
ATOM   1743 N  NH1  . ARG A 1 147 ? 36.920 39.467 9.214   1.00 85.35  ? 362 ARG A NH1  1 
ATOM   1744 N  NH2  . ARG A 1 147 ? 34.772 38.644 9.125   1.00 75.72  ? 362 ARG A NH2  1 
ATOM   1745 H  H    . ARG A 1 147 ? 39.406 40.348 1.990   1.00 40.79  ? 362 ARG A H    1 
ATOM   1746 H  HA   . ARG A 1 147 ? 36.792 40.598 2.564   1.00 41.29  ? 362 ARG A HA   1 
ATOM   1747 H  HB2  . ARG A 1 147 ? 38.275 38.928 3.643   1.00 44.74  ? 362 ARG A HB2  1 
ATOM   1748 H  HB3  . ARG A 1 147 ? 38.735 40.152 4.547   1.00 44.74  ? 362 ARG A HB3  1 
ATOM   1749 H  HG2  . ARG A 1 147 ? 36.287 40.382 5.001   1.00 59.12  ? 362 ARG A HG2  1 
ATOM   1750 H  HG3  . ARG A 1 147 ? 36.241 38.856 4.566   1.00 59.12  ? 362 ARG A HG3  1 
ATOM   1751 H  HD2  . ARG A 1 147 ? 37.745 38.348 6.329   1.00 67.23  ? 362 ARG A HD2  1 
ATOM   1752 H  HD3  . ARG A 1 147 ? 37.662 39.868 6.797   1.00 67.23  ? 362 ARG A HD3  1 
ATOM   1753 H  HE   . ARG A 1 147 ? 35.311 38.523 6.757   1.00 70.50  ? 362 ARG A HE   1 
ATOM   1754 H  HH11 . ARG A 1 147 ? 37.656 39.683 8.824   1.00 102.42 ? 362 ARG A HH11 1 
ATOM   1755 H  HH12 . ARG A 1 147 ? 36.841 39.560 10.065  1.00 102.42 ? 362 ARG A HH12 1 
ATOM   1756 H  HH21 . ARG A 1 147 ? 34.108 38.332 8.676   1.00 90.87  ? 362 ARG A HH21 1 
ATOM   1757 H  HH22 . ARG A 1 147 ? 34.705 38.747 9.977   1.00 90.87  ? 362 ARG A HH22 1 
ATOM   1758 N  N    . ALA A 1 148 ? 36.705 42.686 3.855   1.00 33.66  ? 363 ALA A N    1 
ATOM   1759 C  CA   . ALA A 1 148 ? 36.661 44.023 4.427   1.00 35.19  ? 363 ALA A CA   1 
ATOM   1760 C  C    . ALA A 1 148 ? 37.593 44.164 5.610   1.00 34.51  ? 363 ALA A C    1 
ATOM   1761 O  O    . ALA A 1 148 ? 37.731 43.244 6.420   1.00 34.25  ? 363 ALA A O    1 
ATOM   1762 C  CB   . ALA A 1 148 ? 35.309 44.335 4.851   1.00 34.02  ? 363 ALA A CB   1 
ATOM   1763 H  H    . ALA A 1 148 ? 35.951 42.273 3.884   1.00 40.39  ? 363 ALA A H    1 
ATOM   1764 H  HA   . ALA A 1 148 ? 36.926 44.669 3.753   1.00 42.22  ? 363 ALA A HA   1 
ATOM   1765 H  HB1  . ALA A 1 148 ? 35.295 45.228 5.230   1.00 40.82  ? 363 ALA A HB1  1 
ATOM   1766 H  HB2  . ALA A 1 148 ? 34.719 44.292 4.082   1.00 40.82  ? 363 ALA A HB2  1 
ATOM   1767 H  HB3  . ALA A 1 148 ? 35.031 43.689 5.519   1.00 40.82  ? 363 ALA A HB3  1 
ATOM   1768 N  N    . GLN A 1 149 ? 38.200 45.343 5.706   1.00 37.93  ? 364 GLN A N    1 
ATOM   1769 C  CA   . GLN A 1 149 ? 38.978 45.742 6.868   1.00 35.72  ? 364 GLN A CA   1 
ATOM   1770 C  C    . GLN A 1 149 ? 38.413 47.028 7.459   1.00 37.15  ? 364 GLN A C    1 
ATOM   1771 O  O    . GLN A 1 149 ? 38.254 48.020 6.749   1.00 37.18  ? 364 GLN A O    1 
ATOM   1772 C  CB   . GLN A 1 149 ? 40.440 45.940 6.475   1.00 37.25  ? 364 GLN A CB   1 
ATOM   1773 C  CG   . GLN A 1 149 ? 41.301 46.702 7.458   1.00 49.69  ? 364 GLN A CG   1 
ATOM   1774 C  CD   . GLN A 1 149 ? 41.577 45.899 8.713   1.00 66.42  ? 364 GLN A CD   1 
ATOM   1775 O  OE1  . GLN A 1 149 ? 41.966 44.730 8.638   1.00 82.96  ? 364 GLN A OE1  1 
ATOM   1776 N  NE2  . GLN A 1 149 ? 41.370 46.516 9.877   1.00 52.70  ? 364 GLN A NE2  1 
ATOM   1777 H  H    . GLN A 1 149 ? 38.173 45.944 5.091   1.00 45.51  ? 364 GLN A H    1 
ATOM   1778 H  HA   . GLN A 1 149 ? 38.932 45.047 7.543   1.00 42.86  ? 364 GLN A HA   1 
ATOM   1779 H  HB2  . GLN A 1 149 ? 40.844 45.066 6.356   1.00 44.70  ? 364 GLN A HB2  1 
ATOM   1780 H  HB3  . GLN A 1 149 ? 40.467 46.423 5.634   1.00 44.70  ? 364 GLN A HB3  1 
ATOM   1781 H  HG2  . GLN A 1 149 ? 42.150 46.913 7.041   1.00 59.63  ? 364 GLN A HG2  1 
ATOM   1782 H  HG3  . GLN A 1 149 ? 40.843 47.517 7.716   1.00 59.63  ? 364 GLN A HG3  1 
ATOM   1783 H  HE21 . GLN A 1 149 ? 41.093 47.330 9.890   1.00 63.23  ? 364 GLN A HE21 1 
ATOM   1784 H  HE22 . GLN A 1 149 ? 41.514 46.100 10.616  1.00 63.23  ? 364 GLN A HE22 1 
ATOM   1785 N  N    . LEU A 1 150 ? 38.154 47.013 8.762   1.00 38.55  ? 365 LEU A N    1 
ATOM   1786 C  CA   . LEU A 1 150 ? 37.617 48.180 9.450   1.00 40.26  ? 365 LEU A CA   1 
ATOM   1787 C  C    . LEU A 1 150 ? 38.697 49.235 9.634   1.00 41.69  ? 365 LEU A C    1 
ATOM   1788 O  O    . LEU A 1 150 ? 39.756 48.948 10.163  1.00 44.52  ? 365 LEU A O    1 
ATOM   1789 C  CB   . LEU A 1 150 ? 37.037 47.784 10.802  1.00 41.43  ? 365 LEU A CB   1 
ATOM   1790 C  CG   . LEU A 1 150 ? 36.622 48.958 11.688  1.00 43.60  ? 365 LEU A CG   1 
ATOM   1791 C  CD1  . LEU A 1 150 ? 35.486 49.710 11.032  1.00 43.62  ? 365 LEU A CD1  1 
ATOM   1792 C  CD2  . LEU A 1 150 ? 36.211 48.531 13.095  1.00 46.51  ? 365 LEU A CD2  1 
ATOM   1793 H  H    . LEU A 1 150 ? 38.282 46.333 9.274   1.00 46.26  ? 365 LEU A H    1 
ATOM   1794 H  HA   . LEU A 1 150 ? 36.905 48.565 8.916   1.00 48.31  ? 365 LEU A HA   1 
ATOM   1795 H  HB2  . LEU A 1 150 ? 36.250 47.236 10.653  1.00 49.71  ? 365 LEU A HB2  1 
ATOM   1796 H  HB3  . LEU A 1 150 ? 37.703 47.272 11.287  1.00 49.71  ? 365 LEU A HB3  1 
ATOM   1797 H  HG   . LEU A 1 150 ? 37.372 49.567 11.771  1.00 52.32  ? 365 LEU A HG   1 
ATOM   1798 H  HD11 . LEU A 1 150 ? 35.229 50.452 11.600  1.00 52.35  ? 365 LEU A HD11 1 
ATOM   1799 H  HD12 . LEU A 1 150 ? 35.784 50.041 10.170  1.00 52.35  ? 365 LEU A HD12 1 
ATOM   1800 H  HD13 . LEU A 1 150 ? 34.735 49.107 10.914  1.00 52.35  ? 365 LEU A HD13 1 
ATOM   1801 H  HD21 . LEU A 1 150 ? 35.960 49.318 13.603  1.00 55.82  ? 365 LEU A HD21 1 
ATOM   1802 H  HD22 . LEU A 1 150 ? 35.457 47.923 13.033  1.00 55.82  ? 365 LEU A HD22 1 
ATOM   1803 H  HD23 . LEU A 1 150 ? 36.961 48.086 13.522  1.00 55.82  ? 365 LEU A HD23 1 
ATOM   1804 N  N    . GLU A 1 151 ? 38.424 50.457 9.200   1.00 55.76  ? 366 GLU A N    1 
ATOM   1805 C  CA   . GLU A 1 151 ? 39.387 51.545 9.329   1.00 49.23  ? 366 GLU A CA   1 
ATOM   1806 C  C    . GLU A 1 151 ? 38.707 52.907 9.275   1.00 50.30  ? 366 GLU A C    1 
ATOM   1807 O  O    . GLU A 1 151 ? 38.138 53.276 8.255   1.00 54.46  ? 366 GLU A O    1 
ATOM   1808 C  CB   . GLU A 1 151 ? 40.447 51.464 8.228   1.00 48.60  ? 366 GLU A CB   1 
ATOM   1809 C  CG   . GLU A 1 151 ? 41.242 52.766 8.094   1.00 64.52  ? 366 GLU A CG   1 
ATOM   1810 C  CD   . GLU A 1 151 ? 42.335 52.723 7.053   1.00 73.74  ? 366 GLU A CD   1 
ATOM   1811 O  OE1  . GLU A 1 151 ? 42.950 51.653 6.881   1.00 64.43  ? 366 GLU A OE1  1 
ATOM   1812 O  OE2  . GLU A 1 151 ? 42.576 53.769 6.407   1.00 88.44  ? 366 GLU A OE2  1 
ATOM   1813 H  H    . GLU A 1 151 ? 37.684 50.685 8.826   1.00 66.92  ? 366 GLU A H    1 
ATOM   1814 H  HA   . GLU A 1 151 ? 39.838 51.468 10.185  1.00 59.07  ? 366 GLU A HA   1 
ATOM   1815 H  HB2  . GLU A 1 151 ? 41.069 50.750 8.437   1.00 58.32  ? 366 GLU A HB2  1 
ATOM   1816 H  HB3  . GLU A 1 151 ? 40.011 51.288 7.379   1.00 58.32  ? 366 GLU A HB3  1 
ATOM   1817 H  HG2  . GLU A 1 151 ? 40.632 53.480 7.850   1.00 77.43  ? 366 GLU A HG2  1 
ATOM   1818 H  HG3  . GLU A 1 151 ? 41.656 52.967 8.948   1.00 77.43  ? 366 GLU A HG3  1 
ATOM   1819 N  N    . ASP A 1 152 ? 38.781 53.656 10.369  1.00 52.70  ? 367 ASP A N    1 
ATOM   1820 C  CA   . ASP A 1 152 ? 38.253 55.021 10.409  1.00 61.33  ? 367 ASP A CA   1 
ATOM   1821 C  C    . ASP A 1 152 ? 36.773 55.103 10.074  1.00 53.81  ? 367 ASP A C    1 
ATOM   1822 O  O    . ASP A 1 152 ? 36.375 55.932 9.252   1.00 66.83  ? 367 ASP A O    1 
ATOM   1823 C  CB   . ASP A 1 152 ? 39.024 55.915 9.428   1.00 67.77  ? 367 ASP A CB   1 
ATOM   1824 C  CG   . ASP A 1 152 ? 40.495 56.030 9.777   1.00 73.37  ? 367 ASP A CG   1 
ATOM   1825 O  OD1  . ASP A 1 152 ? 41.322 56.069 8.836   1.00 79.23  ? 367 ASP A OD1  1 
ATOM   1826 O  OD2  . ASP A 1 152 ? 40.810 56.089 10.994  1.00 72.87  ? 367 ASP A OD2  1 
ATOM   1827 H  H    . ASP A 1 152 ? 39.136 53.398 11.109  1.00 63.23  ? 367 ASP A H    1 
ATOM   1828 H  HA   . ASP A 1 152 ? 38.377 55.379 11.301  1.00 73.60  ? 367 ASP A HA   1 
ATOM   1829 H  HB2  . ASP A 1 152 ? 38.955 55.540 8.536   1.00 81.32  ? 367 ASP A HB2  1 
ATOM   1830 H  HB3  . ASP A 1 152 ? 38.641 56.806 9.444   1.00 81.32  ? 367 ASP A HB3  1 
ATOM   1831 N  N    . GLY A 1 153 ? 35.961 54.252 10.696  1.00 55.42  ? 368 GLY A N    1 
ATOM   1832 C  CA   . GLY A 1 153 ? 34.515 54.293 10.499  1.00 55.12  ? 368 GLY A CA   1 
ATOM   1833 C  C    . GLY A 1 153 ? 33.968 53.862 9.135   1.00 53.73  ? 368 GLY A C    1 
ATOM   1834 O  O    . GLY A 1 153 ? 32.803 54.112 8.846   1.00 51.79  ? 368 GLY A O    1 
ATOM   1835 H  H    . GLY A 1 153 ? 36.223 53.639 11.239  1.00 66.50  ? 368 GLY A H    1 
ATOM   1836 H  HA2  . GLY A 1 153 ? 34.101 53.727 11.169  1.00 66.14  ? 368 GLY A HA2  1 
ATOM   1837 H  HA3  . GLY A 1 153 ? 34.213 55.201 10.658  1.00 66.14  ? 368 GLY A HA3  1 
ATOM   1838 N  N    . ARG A 1 154 ? 34.814 53.257 8.303   1.00 46.70  ? 369 ARG A N    1 
ATOM   1839 C  CA   . ARG A 1 154 ? 34.428 52.675 7.011   1.00 43.13  ? 369 ARG A CA   1 
ATOM   1840 C  C    . ARG A 1 154 ? 35.124 51.304 6.836   1.00 42.38  ? 369 ARG A C    1 
ATOM   1841 O  O    . ARG A 1 154 ? 36.011 50.945 7.595   1.00 42.05  ? 369 ARG A O    1 
ATOM   1842 C  CB   . ARG A 1 154 ? 34.830 53.595 5.855   1.00 45.03  ? 369 ARG A CB   1 
ATOM   1843 C  CG   . ARG A 1 154 ? 36.355 53.760 5.784   1.00 55.00  ? 369 ARG A CG   1 
ATOM   1844 C  CD   . ARG A 1 154 ? 36.828 54.550 4.604   1.00 73.06  ? 369 ARG A CD   1 
ATOM   1845 N  NE   . ARG A 1 154 ? 38.292 54.504 4.477   1.00 61.95  ? 369 ARG A NE   1 
ATOM   1846 C  CZ   . ARG A 1 154 ? 39.135 55.457 4.870   1.00 78.03  ? 369 ARG A CZ   1 
ATOM   1847 N  NH1  . ARG A 1 154 ? 40.443 55.280 4.696   1.00 80.73  ? 369 ARG A NH1  1 
ATOM   1848 N  NH2  . ARG A 1 154 ? 38.682 56.585 5.418   1.00 84.19  ? 369 ARG A NH2  1 
ATOM   1849 H  H    . ARG A 1 154 ? 35.652 53.166 8.471   1.00 56.04  ? 369 ARG A H    1 
ATOM   1850 H  HA   . ARG A 1 154 ? 33.468 52.543 6.985   1.00 51.75  ? 369 ARG A HA   1 
ATOM   1851 H  HB2  . ARG A 1 154 ? 34.525 53.212 5.018   1.00 54.04  ? 369 ARG A HB2  1 
ATOM   1852 H  HB3  . ARG A 1 154 ? 34.434 54.471 5.988   1.00 54.04  ? 369 ARG A HB3  1 
ATOM   1853 H  HG2  . ARG A 1 154 ? 36.657 54.216 6.585   1.00 66.01  ? 369 ARG A HG2  1 
ATOM   1854 H  HG3  . ARG A 1 154 ? 36.761 52.881 5.734   1.00 66.01  ? 369 ARG A HG3  1 
ATOM   1855 H  HD2  . ARG A 1 154 ? 36.440 54.180 3.795   1.00 87.68  ? 369 ARG A HD2  1 
ATOM   1856 H  HD3  . ARG A 1 154 ? 36.561 55.477 4.711   1.00 87.68  ? 369 ARG A HD3  1 
ATOM   1857 H  HE   . ARG A 1 154 ? 38.633 53.801 4.118   1.00 74.34  ? 369 ARG A HE   1 
ATOM   1858 H  HH11 . ARG A 1 154 ? 40.735 54.554 4.340   1.00 96.87  ? 369 ARG A HH11 1 
ATOM   1859 H  HH12 . ARG A 1 154 ? 40.996 55.891 4.942   1.00 96.87  ? 369 ARG A HH12 1 
ATOM   1860 H  HH21 . ARG A 1 154 ? 37.837 56.700 5.530   1.00 101.03 ? 369 ARG A HH21 1 
ATOM   1861 H  HH22 . ARG A 1 154 ? 39.236 57.195 5.665   1.00 101.03 ? 369 ARG A HH22 1 
ATOM   1862 N  N    . PHE A 1 155 ? 34.727 50.550 5.829   1.00 39.09  ? 370 PHE A N    1 
ATOM   1863 C  CA   . PHE A 1 155 ? 35.457 49.355 5.486   1.00 37.28  ? 370 PHE A CA   1 
ATOM   1864 C  C    . PHE A 1 155 ? 36.276 49.604 4.230   1.00 38.33  ? 370 PHE A C    1 
ATOM   1865 O  O    . PHE A 1 155 ? 35.800 50.234 3.268   1.00 36.07  ? 370 PHE A O    1 
ATOM   1866 C  CB   . PHE A 1 155 ? 34.519 48.155 5.297   1.00 36.88  ? 370 PHE A CB   1 
ATOM   1867 C  CG   . PHE A 1 155 ? 33.742 47.810 6.528   1.00 37.22  ? 370 PHE A CG   1 
ATOM   1868 C  CD1  . PHE A 1 155 ? 34.335 47.116 7.556   1.00 37.48  ? 370 PHE A CD1  1 
ATOM   1869 C  CD2  . PHE A 1 155 ? 32.427 48.200 6.663   1.00 38.19  ? 370 PHE A CD2  1 
ATOM   1870 C  CE1  . PHE A 1 155 ? 33.629 46.809 8.710   1.00 38.57  ? 370 PHE A CE1  1 
ATOM   1871 C  CE2  . PHE A 1 155 ? 31.688 47.888 7.834   1.00 39.33  ? 370 PHE A CE2  1 
ATOM   1872 C  CZ   . PHE A 1 155 ? 32.297 47.202 8.843   1.00 39.45  ? 370 PHE A CZ   1 
ATOM   1873 H  H    . PHE A 1 155 ? 34.043 50.709 5.332   1.00 46.91  ? 370 PHE A H    1 
ATOM   1874 H  HA   . PHE A 1 155 ? 36.071 49.143 6.207   1.00 44.73  ? 370 PHE A HA   1 
ATOM   1875 H  HB2  . PHE A 1 155 ? 33.885 48.359 4.592   1.00 44.26  ? 370 PHE A HB2  1 
ATOM   1876 H  HB3  . PHE A 1 155 ? 35.048 47.379 5.051   1.00 44.26  ? 370 PHE A HB3  1 
ATOM   1877 H  HD1  . PHE A 1 155 ? 35.224 46.854 7.480   1.00 44.98  ? 370 PHE A HD1  1 
ATOM   1878 H  HD2  . PHE A 1 155 ? 32.017 48.672 5.975   1.00 45.83  ? 370 PHE A HD2  1 
ATOM   1879 H  HE1  . PHE A 1 155 ? 34.044 46.336 9.395   1.00 46.28  ? 370 PHE A HE1  1 
ATOM   1880 H  HE2  . PHE A 1 155 ? 30.801 48.154 7.914   1.00 47.20  ? 370 PHE A HE2  1 
ATOM   1881 H  HZ   . PHE A 1 155 ? 31.822 46.989 9.614   1.00 47.34  ? 370 PHE A HZ   1 
ATOM   1882 N  N    . VAL A 1 156 ? 37.527 49.133 4.260   1.00 43.09  ? 371 VAL A N    1 
ATOM   1883 C  CA   . VAL A 1 156 ? 38.408 49.260 3.114   1.00 41.08  ? 371 VAL A CA   1 
ATOM   1884 C  C    . VAL A 1 156 ? 38.785 47.879 2.617   1.00 34.86  ? 371 VAL A C    1 
ATOM   1885 O  O    . VAL A 1 156 ? 38.856 46.883 3.378   1.00 36.05  ? 371 VAL A O    1 
ATOM   1886 C  CB   . VAL A 1 156 ? 39.671 50.092 3.425   1.00 43.20  ? 371 VAL A CB   1 
ATOM   1887 C  CG1  . VAL A 1 156 ? 39.290 51.446 3.876   1.00 46.70  ? 371 VAL A CG1  1 
ATOM   1888 C  CG2  . VAL A 1 156 ? 40.518 49.442 4.458   1.00 38.23  ? 371 VAL A CG2  1 
ATOM   1889 H  H    . VAL A 1 156 ? 37.883 48.737 4.935   1.00 51.70  ? 371 VAL A H    1 
ATOM   1890 H  HA   . VAL A 1 156 ? 37.927 49.709 2.401   1.00 49.30  ? 371 VAL A HA   1 
ATOM   1891 H  HB   . VAL A 1 156 ? 40.198 50.182 2.616   1.00 51.84  ? 371 VAL A HB   1 
ATOM   1892 H  HG11 . VAL A 1 156 ? 40.095 51.953 4.066   1.00 56.04  ? 371 VAL A HG11 1 
ATOM   1893 H  HG12 . VAL A 1 156 ? 38.782 51.882 3.173   1.00 56.04  ? 371 VAL A HG12 1 
ATOM   1894 H  HG13 . VAL A 1 156 ? 38.749 51.371 4.678   1.00 56.04  ? 371 VAL A HG13 1 
ATOM   1895 H  HG21 . VAL A 1 156 ? 41.297 49.997 4.622   1.00 45.87  ? 371 VAL A HG21 1 
ATOM   1896 H  HG22 . VAL A 1 156 ? 40.002 49.347 5.274   1.00 45.87  ? 371 VAL A HG22 1 
ATOM   1897 H  HG23 . VAL A 1 156 ? 40.794 48.570 4.137   1.00 45.87  ? 371 VAL A HG23 1 
ATOM   1898 N  N    . TYR A 1 157 ? 39.021 47.854 1.315   1.00 38.98  ? 372 TYR A N    1 
ATOM   1899 C  CA   . TYR A 1 157 ? 39.381 46.656 0.607   1.00 34.95  ? 372 TYR A CA   1 
ATOM   1900 C  C    . TYR A 1 157 ? 40.667 46.980 -0.130  1.00 35.45  ? 372 TYR A C    1 
ATOM   1901 O  O    . TYR A 1 157 ? 40.630 47.681 -1.149  1.00 31.47  ? 372 TYR A O    1 
ATOM   1902 C  CB   . TYR A 1 157 ? 38.258 46.254 -0.340  1.00 34.96  ? 372 TYR A CB   1 
ATOM   1903 C  CG   . TYR A 1 157 ? 36.931 46.136 0.365   1.00 37.01  ? 372 TYR A CG   1 
ATOM   1904 C  CD1  . TYR A 1 157 ? 36.151 47.274 0.653   1.00 37.86  ? 372 TYR A CD1  1 
ATOM   1905 C  CD2  . TYR A 1 157 ? 36.451 44.889 0.759   1.00 29.62  ? 372 TYR A CD2  1 
ATOM   1906 C  CE1  . TYR A 1 157 ? 34.888 47.153 1.323   1.00 31.82  ? 372 TYR A CE1  1 
ATOM   1907 C  CE2  . TYR A 1 157 ? 35.224 44.755 1.411   1.00 35.54  ? 372 TYR A CE2  1 
ATOM   1908 C  CZ   . TYR A 1 157 ? 34.446 45.879 1.680   1.00 31.38  ? 372 TYR A CZ   1 
ATOM   1909 O  OH   . TYR A 1 157 ? 33.265 45.689 2.321   1.00 32.22  ? 372 TYR A OH   1 
ATOM   1910 H  H    . TYR A 1 157 ? 38.976 48.548 0.809   1.00 46.77  ? 372 TYR A H    1 
ATOM   1911 H  HA   . TYR A 1 157 ? 39.545 45.933 1.233   1.00 41.95  ? 372 TYR A HA   1 
ATOM   1912 H  HB2  . TYR A 1 157 ? 38.172 46.925 -1.034  1.00 41.96  ? 372 TYR A HB2  1 
ATOM   1913 H  HB3  . TYR A 1 157 ? 38.468 45.392 -0.733  1.00 41.96  ? 372 TYR A HB3  1 
ATOM   1914 H  HD1  . TYR A 1 157 ? 36.456 48.114 0.398   1.00 45.43  ? 372 TYR A HD1  1 
ATOM   1915 H  HD2  . TYR A 1 157 ? 36.955 44.129 0.575   1.00 35.54  ? 372 TYR A HD2  1 
ATOM   1916 H  HE1  . TYR A 1 157 ? 34.372 47.905 1.506   1.00 38.19  ? 372 TYR A HE1  1 
ATOM   1917 H  HE2  . TYR A 1 157 ? 34.921 43.911 1.658   1.00 42.65  ? 372 TYR A HE2  1 
ATOM   1918 H  HH   . TYR A 1 157 ? 32.885 46.427 2.449   1.00 38.66  ? 372 TYR A HH   1 
ATOM   1919 N  N    . ARG A 1 158 ? 41.788 46.504 0.424   1.00 39.51  ? 373 ARG A N    1 
ATOM   1920 C  CA   . ARG A 1 158 ? 43.129 46.779 -0.088  1.00 37.76  ? 373 ARG A CA   1 
ATOM   1921 C  C    . ARG A 1 158 ? 43.709 45.575 -0.792  1.00 36.37  ? 373 ARG A C    1 
ATOM   1922 O  O    . ARG A 1 158 ? 43.998 44.560 -0.179  1.00 39.51  ? 373 ARG A O    1 
ATOM   1923 C  CB   . ARG A 1 158 ? 44.061 47.206 1.044   1.00 51.51  ? 373 ARG A CB   1 
ATOM   1924 C  CG   . ARG A 1 158 ? 43.852 48.654 1.470   1.00 67.97  ? 373 ARG A CG   1 
ATOM   1925 C  CD   . ARG A 1 158 ? 44.732 49.073 2.626   1.00 70.60  ? 373 ARG A CD   1 
ATOM   1926 N  NE   . ARG A 1 158 ? 44.527 50.497 2.906   1.00 55.00  ? 373 ARG A NE   1 
ATOM   1927 C  CZ   . ARG A 1 158 ? 44.143 51.000 4.075   1.00 49.79  ? 373 ARG A CZ   1 
ATOM   1928 N  NH1  . ARG A 1 158 ? 43.925 50.199 5.115   1.00 50.25  ? 373 ARG A NH1  1 
ATOM   1929 N  NH2  . ARG A 1 158 ? 43.975 52.314 4.200   1.00 58.50  ? 373 ARG A NH2  1 
ATOM   1930 H  H    . ARG A 1 158 ? 41.793 46.001 1.122   1.00 47.41  ? 373 ARG A H    1 
ATOM   1931 H  HA   . ARG A 1 158 ? 43.080 47.507 -0.728  1.00 45.31  ? 373 ARG A HA   1 
ATOM   1932 H  HB2  . ARG A 1 158 ? 43.899 46.640 1.816   1.00 61.82  ? 373 ARG A HB2  1 
ATOM   1933 H  HB3  . ARG A 1 158 ? 44.980 47.110 0.750   1.00 61.82  ? 373 ARG A HB3  1 
ATOM   1934 H  HG2  . ARG A 1 158 ? 44.052 49.234 0.719   1.00 81.57  ? 373 ARG A HG2  1 
ATOM   1935 H  HG3  . ARG A 1 158 ? 42.928 48.771 1.741   1.00 81.57  ? 373 ARG A HG3  1 
ATOM   1936 H  HD2  . ARG A 1 158 ? 44.495 48.564 3.417   1.00 84.72  ? 373 ARG A HD2  1 
ATOM   1937 H  HD3  . ARG A 1 158 ? 45.663 48.933 2.395   1.00 84.72  ? 373 ARG A HD3  1 
ATOM   1938 H  HE   . ARG A 1 158 ? 44.666 51.051 2.264   1.00 66.00  ? 373 ARG A HE   1 
ATOM   1939 H  HH11 . ARG A 1 158 ? 44.030 49.350 5.033   1.00 60.31  ? 373 ARG A HH11 1 
ATOM   1940 H  HH12 . ARG A 1 158 ? 43.679 50.531 5.870   1.00 60.31  ? 373 ARG A HH12 1 
ATOM   1941 H  HH21 . ARG A 1 158 ? 44.120 52.832 3.529   1.00 70.21  ? 373 ARG A HH21 1 
ATOM   1942 H  HH22 . ARG A 1 158 ? 43.734 52.647 4.956   1.00 70.21  ? 373 ARG A HH22 1 
ATOM   1943 N  N    . LEU A 1 159 ? 43.854 45.719 -2.102  1.00 35.39  ? 374 LEU A N    1 
ATOM   1944 C  CA   . LEU A 1 159 ? 44.452 44.723 -2.959  1.00 36.75  ? 374 LEU A CA   1 
ATOM   1945 C  C    . LEU A 1 159 ? 45.788 45.309 -3.406  1.00 40.55  ? 374 LEU A C    1 
ATOM   1946 O  O    . LEU A 1 159 ? 45.910 45.873 -4.503  1.00 38.60  ? 374 LEU A O    1 
ATOM   1947 C  CB   . LEU A 1 159 ? 43.522 44.391 -4.153  1.00 35.15  ? 374 LEU A CB   1 
ATOM   1948 C  CG   . LEU A 1 159 ? 42.082 43.931 -3.772  1.00 42.31  ? 374 LEU A CG   1 
ATOM   1949 C  CD1  . LEU A 1 159 ? 41.102 45.063 -3.475  1.00 41.78  ? 374 LEU A CD1  1 
ATOM   1950 C  CD2  . LEU A 1 159 ? 41.484 43.055 -4.862  1.00 46.93  ? 374 LEU A CD2  1 
ATOM   1951 H  H    . LEU A 1 159 ? 43.599 46.419 -2.530  1.00 42.47  ? 374 LEU A H    1 
ATOM   1952 H  HA   . LEU A 1 159 ? 44.619 43.911 -2.455  1.00 44.10  ? 374 LEU A HA   1 
ATOM   1953 H  HB2  . LEU A 1 159 ? 43.437 45.183 -4.706  1.00 42.18  ? 374 LEU A HB2  1 
ATOM   1954 H  HB3  . LEU A 1 159 ? 43.928 43.678 -4.670  1.00 42.18  ? 374 LEU A HB3  1 
ATOM   1955 H  HG   . LEU A 1 159 ? 42.142 43.388 -2.970  1.00 50.77  ? 374 LEU A HG   1 
ATOM   1956 H  HD11 . LEU A 1 159 ? 40.239 44.682 -3.250  1.00 50.13  ? 374 LEU A HD11 1 
ATOM   1957 H  HD12 . LEU A 1 159 ? 41.440 45.584 -2.730  1.00 50.13  ? 374 LEU A HD12 1 
ATOM   1958 H  HD13 . LEU A 1 159 ? 41.021 45.624 -4.262  1.00 50.13  ? 374 LEU A HD13 1 
ATOM   1959 H  HD21 . LEU A 1 159 ? 40.591 42.786 -4.595  1.00 56.31  ? 374 LEU A HD21 1 
ATOM   1960 H  HD22 . LEU A 1 159 ? 41.445 43.562 -5.688  1.00 56.31  ? 374 LEU A HD22 1 
ATOM   1961 H  HD23 . LEU A 1 159 ? 42.044 42.272 -4.980  1.00 56.31  ? 374 LEU A HD23 1 
ATOM   1962 N  N    . LEU A 1 160 ? 46.794 45.190 -2.549  1.00 33.63  ? 375 LEU A N    1 
ATOM   1963 C  CA   . LEU A 1 160 ? 48.053 45.910 -2.777  1.00 35.26  ? 375 LEU A CA   1 
ATOM   1964 C  C    . LEU A 1 160 ? 49.164 45.039 -3.361  1.00 36.94  ? 375 LEU A C    1 
ATOM   1965 O  O    . LEU A 1 160 ? 49.319 43.871 -3.002  1.00 39.99  ? 375 LEU A O    1 
ATOM   1966 C  CB   . LEU A 1 160 ? 48.549 46.547 -1.480  1.00 41.26  ? 375 LEU A CB   1 
ATOM   1967 C  CG   . LEU A 1 160 ? 47.495 47.336 -0.688  1.00 54.80  ? 375 LEU A CG   1 
ATOM   1968 C  CD1  . LEU A 1 160 ? 48.047 47.637 0.692   1.00 55.40  ? 375 LEU A CD1  1 
ATOM   1969 C  CD2  . LEU A 1 160 ? 47.059 48.633 -1.392  1.00 59.99  ? 375 LEU A CD2  1 
ATOM   1970 H  H    . LEU A 1 160 ? 46.780 44.708 -1.837  1.00 40.35  ? 375 LEU A H    1 
ATOM   1971 H  HA   . LEU A 1 160 ? 47.885 46.628 -3.407  1.00 42.31  ? 375 LEU A HA   1 
ATOM   1972 H  HB2  . LEU A 1 160 ? 48.882 45.843 -0.901  1.00 49.51  ? 375 LEU A HB2  1 
ATOM   1973 H  HB3  . LEU A 1 160 ? 49.270 47.158 -1.695  1.00 49.51  ? 375 LEU A HB3  1 
ATOM   1974 H  HG   . LEU A 1 160 ? 46.707 46.781 -0.577  1.00 65.76  ? 375 LEU A HG   1 
ATOM   1975 H  HD11 . LEU A 1 160 ? 47.384 48.136 1.195   1.00 66.48  ? 375 LEU A HD11 1 
ATOM   1976 H  HD12 . LEU A 1 160 ? 48.245 46.801 1.142   1.00 66.48  ? 375 LEU A HD12 1 
ATOM   1977 H  HD13 . LEU A 1 160 ? 48.857 48.163 0.600   1.00 66.48  ? 375 LEU A HD13 1 
ATOM   1978 H  HD21 . LEU A 1 160 ? 46.396 49.082 -0.845  1.00 71.98  ? 375 LEU A HD21 1 
ATOM   1979 H  HD22 . LEU A 1 160 ? 47.834 49.204 -1.509  1.00 71.98  ? 375 LEU A HD22 1 
ATOM   1980 H  HD23 . LEU A 1 160 ? 46.678 48.410 -2.256  1.00 71.98  ? 375 LEU A HD23 1 
ATOM   1981 N  N    . ARG A 1 161 ? 49.929 45.649 -4.268  1.00 42.67  ? 376 ARG A N    1 
ATOM   1982 C  CA   . ARG A 1 161 ? 51.076 45.016 -4.926  1.00 40.32  ? 376 ARG A CA   1 
ATOM   1983 C  C    . ARG A 1 161 ? 50.734 43.605 -5.430  1.00 39.04  ? 376 ARG A C    1 
ATOM   1984 O  O    . ARG A 1 161 ? 51.440 42.625 -5.188  1.00 42.00  ? 376 ARG A O    1 
ATOM   1985 C  CB   . ARG A 1 161 ? 52.272 45.003 -3.961  1.00 42.71  ? 376 ARG A CB   1 
ATOM   1986 C  CG   . ARG A 1 161 ? 52.790 46.423 -3.580  1.00 55.02  ? 376 ARG A CG   1 
ATOM   1987 C  CD   . ARG A 1 161 ? 54.025 46.407 -2.634  1.00 61.56  ? 376 ARG A CD   1 
ATOM   1988 N  NE   . ARG A 1 161 ? 54.955 45.322 -2.975  1.00 59.60  ? 376 ARG A NE   1 
ATOM   1989 C  CZ   . ARG A 1 161 ? 56.045 45.451 -3.728  1.00 64.29  ? 376 ARG A CZ   1 
ATOM   1990 N  NH1  . ARG A 1 161 ? 56.402 46.636 -4.221  1.00 63.63  ? 376 ARG A NH1  1 
ATOM   1991 N  NH2  . ARG A 1 161 ? 56.787 44.375 -3.993  1.00 61.56  ? 376 ARG A NH2  1 
ATOM   1992 H  H    . ARG A 1 161 ? 49.798 46.458 -4.528  1.00 51.21  ? 376 ARG A H    1 
ATOM   1993 H  HA   . ARG A 1 161 ? 51.325 45.551 -5.696  1.00 48.38  ? 376 ARG A HA   1 
ATOM   1994 H  HB2  . ARG A 1 161 ? 52.007 44.555 -3.142  1.00 51.25  ? 376 ARG A HB2  1 
ATOM   1995 H  HB3  . ARG A 1 161 ? 53.004 44.522 -4.378  1.00 51.25  ? 376 ARG A HB3  1 
ATOM   1996 H  HG2  . ARG A 1 161 ? 53.044 46.891 -4.391  1.00 66.03  ? 376 ARG A HG2  1 
ATOM   1997 H  HG3  . ARG A 1 161 ? 52.078 46.906 -3.131  1.00 66.03  ? 376 ARG A HG3  1 
ATOM   1998 H  HD2  . ARG A 1 161 ? 54.499 47.249 -2.714  1.00 73.87  ? 376 ARG A HD2  1 
ATOM   1999 H  HD3  . ARG A 1 161 ? 53.726 46.275 -1.721  1.00 73.87  ? 376 ARG A HD3  1 
ATOM   2000 H  HE   . ARG A 1 161 ? 54.781 44.540 -2.663  1.00 71.52  ? 376 ARG A HE   1 
ATOM   2001 H  HH11 . ARG A 1 161 ? 55.921 47.331 -4.061  1.00 76.35  ? 376 ARG A HH11 1 
ATOM   2002 H  HH12 . ARG A 1 161 ? 57.111 46.705 -4.702  1.00 76.35  ? 376 ARG A HH12 1 
ATOM   2003 H  HH21 . ARG A 1 161 ? 56.565 43.609 -3.671  1.00 73.87  ? 376 ARG A HH21 1 
ATOM   2004 H  HH22 . ARG A 1 161 ? 57.502 44.452 -4.466  1.00 73.87  ? 376 ARG A HH22 1 
ATOM   2005 N  N    . SER A 1 162 ? 49.625 43.496 -6.139  1.00 46.41  ? 377 SER A N    1 
ATOM   2006 C  CA   . SER A 1 162 ? 49.308 42.246 -6.806  1.00 51.75  ? 377 SER A CA   1 
ATOM   2007 C  C    . SER A 1 162 ? 50.214 42.151 -8.044  1.00 48.60  ? 377 SER A C    1 
ATOM   2008 O  O    . SER A 1 162 ? 50.278 43.088 -8.843  1.00 39.72  ? 377 SER A O    1 
ATOM   2009 C  CB   . SER A 1 162 ? 47.831 42.204 -7.160  1.00 37.58  ? 377 SER A CB   1 
ATOM   2010 O  OG   . SER A 1 162 ? 47.540 41.082 -7.958  1.00 37.20  ? 377 SER A OG   1 
ATOM   2011 H  H    . SER A 1 162 ? 49.045 44.121 -6.249  1.00 55.69  ? 377 SER A H    1 
ATOM   2012 H  HA   . SER A 1 162 ? 49.508 41.501 -6.217  1.00 62.10  ? 377 SER A HA   1 
ATOM   2013 H  HB2  . SER A 1 162 ? 47.312 42.154 -6.342  1.00 45.09  ? 377 SER A HB2  1 
ATOM   2014 H  HB3  . SER A 1 162 ? 47.601 43.009 -7.650  1.00 45.09  ? 377 SER A HB3  1 
ATOM   2015 H  HG   . SER A 1 162 ? 46.722 41.069 -8.148  1.00 44.64  ? 377 SER A HG   1 
ATOM   2016 N  N    . PRO A 1 163 ? 50.992 41.069 -8.163  1.00 35.44  ? 378 PRO A N    1 
ATOM   2017 C  CA   . PRO A 1 163 ? 51.884 41.075 -9.316  1.00 33.60  ? 378 PRO A CA   1 
ATOM   2018 C  C    . PRO A 1 163 ? 51.100 41.076 -10.602 1.00 30.19  ? 378 PRO A C    1 
ATOM   2019 O  O    . PRO A 1 163 ? 50.122 40.367 -10.800 1.00 30.27  ? 378 PRO A O    1 
ATOM   2020 C  CB   . PRO A 1 163 ? 52.710 39.795 -9.150  1.00 33.13  ? 378 PRO A CB   1 
ATOM   2021 C  CG   . PRO A 1 163 ? 52.197 39.124 -7.938  1.00 31.57  ? 378 PRO A CG   1 
ATOM   2022 C  CD   . PRO A 1 163 ? 51.363 40.048 -7.175  1.00 39.74  ? 378 PRO A CD   1 
ATOM   2023 H  HA   . PRO A 1 163 ? 52.470 41.847 -9.291  1.00 40.32  ? 378 PRO A HA   1 
ATOM   2024 H  HB2  . PRO A 1 163 ? 52.589 39.229 -9.929  1.00 39.75  ? 378 PRO A HB2  1 
ATOM   2025 H  HB3  . PRO A 1 163 ? 53.646 40.027 -9.040  1.00 39.75  ? 378 PRO A HB3  1 
ATOM   2026 H  HG2  . PRO A 1 163 ? 51.673 38.353 -8.205  1.00 37.88  ? 378 PRO A HG2  1 
ATOM   2027 H  HG3  . PRO A 1 163 ? 52.950 38.838 -7.397  1.00 37.88  ? 378 PRO A HG3  1 
ATOM   2028 H  HD2  . PRO A 1 163 ? 50.572 39.594 -6.844  1.00 47.69  ? 378 PRO A HD2  1 
ATOM   2029 H  HD3  . PRO A 1 163 ? 51.874 40.446 -6.453  1.00 47.69  ? 378 PRO A HD3  1 
ATOM   2030 N  N    . MET A 1 164 ? 51.530 41.933 -11.483 1.00 28.98  ? 379 MET A N    1 
ATOM   2031 C  CA   . MET A 1 164 ? 50.917 42.058 -12.769 1.00 29.09  ? 379 MET A CA   1 
ATOM   2032 C  C    . MET A 1 164 ? 51.138 40.724 -13.487 1.00 25.42  ? 379 MET A C    1 
ATOM   2033 O  O    . MET A 1 164 ? 52.193 40.122 -13.360 1.00 30.22  ? 379 MET A O    1 
ATOM   2034 C  CB   . MET A 1 164 ? 51.530 43.271 -13.473 1.00 29.93  ? 379 MET A CB   1 
ATOM   2035 C  CG   . MET A 1 164 ? 50.949 43.673 -14.782 1.00 36.82  ? 379 MET A CG   1 
ATOM   2036 S  SD   . MET A 1 164 ? 51.905 45.080 -15.463 1.00 36.92  ? 379 MET A SD   1 
ATOM   2037 C  CE   . MET A 1 164 ? 51.583 46.360 -14.241 1.00 38.25  ? 379 MET A CE   1 
ATOM   2038 H  H    . MET A 1 164 ? 52.192 42.468 -11.358 1.00 34.77  ? 379 MET A H    1 
ATOM   2039 H  HA   . MET A 1 164 ? 49.965 42.213 -12.661 1.00 34.91  ? 379 MET A HA   1 
ATOM   2040 H  HB2  . MET A 1 164 ? 51.448 44.034 -12.880 1.00 35.91  ? 379 MET A HB2  1 
ATOM   2041 H  HB3  . MET A 1 164 ? 52.470 43.086 -13.625 1.00 35.91  ? 379 MET A HB3  1 
ATOM   2042 H  HG2  . MET A 1 164 ? 51.001 42.932 -15.404 1.00 44.18  ? 379 MET A HG2  1 
ATOM   2043 H  HG3  . MET A 1 164 ? 50.029 43.954 -14.658 1.00 44.18  ? 379 MET A HG3  1 
ATOM   2044 H  HE1  . MET A 1 164 ? 52.049 47.170 -14.502 1.00 45.90  ? 379 MET A HE1  1 
ATOM   2045 H  HE2  . MET A 1 164 ? 50.628 46.526 -14.201 1.00 45.90  ? 379 MET A HE2  1 
ATOM   2046 H  HE3  . MET A 1 164 ? 51.903 46.059 -13.376 1.00 45.90  ? 379 MET A HE3  1 
ATOM   2047 N  N    . CYS A 1 165 ? 50.151 40.199 -14.192 1.00 31.30  ? 380 CYS A N    1 
ATOM   2048 C  CA   . CYS A 1 165 ? 50.360 38.868 -14.759 1.00 29.56  ? 380 CYS A CA   1 
ATOM   2049 C  C    . CYS A 1 165 ? 51.390 38.957 -15.879 1.00 31.93  ? 380 CYS A C    1 
ATOM   2050 O  O    . CYS A 1 165 ? 51.566 40.007 -16.523 1.00 29.85  ? 380 CYS A O    1 
ATOM   2051 C  CB   . CYS A 1 165 ? 49.056 38.267 -15.268 1.00 55.16  ? 380 CYS A CB   1 
ATOM   2052 S  SG   . CYS A 1 165 ? 48.690 38.778 -16.914 1.00 57.42  ? 380 CYS A SG   1 
ATOM   2053 H  H    . CYS A 1 165 ? 49.390 40.564 -14.354 1.00 37.56  ? 380 CYS A H    1 
ATOM   2054 H  HA   . CYS A 1 165 ? 50.713 38.282 -14.071 1.00 35.47  ? 380 CYS A HA   1 
ATOM   2055 H  HB2  . CYS A 1 165 ? 49.127 37.299 -15.260 1.00 66.20  ? 380 CYS A HB2  1 
ATOM   2056 H  HB3  . CYS A 1 165 ? 48.328 38.552 -14.694 1.00 66.20  ? 380 CYS A HB3  1 
ATOM   2057 H  HG   . CYS A 1 165 ? 47.656 38.274 -17.258 1.00 68.90  ? 380 CYS A HG   1 
ATOM   2058 N  N    . GLU A 1 166 ? 52.050 37.840 -16.112 1.00 37.45  ? 381 GLU A N    1 
ATOM   2059 C  CA   . GLU A 1 166 ? 53.218 37.784 -16.975 1.00 57.59  ? 381 GLU A CA   1 
ATOM   2060 C  C    . GLU A 1 166 ? 52.895 38.168 -18.423 1.00 47.11  ? 381 GLU A C    1 
ATOM   2061 O  O    . GLU A 1 166 ? 53.722 38.769 -19.090 1.00 40.72  ? 381 GLU A O    1 
ATOM   2062 C  CB   . GLU A 1 166 ? 53.835 36.380 -16.901 1.00 58.18  ? 381 GLU A CB   1 
ATOM   2063 C  CG   . GLU A 1 166 ? 54.240 35.968 -15.457 1.00 68.89  ? 381 GLU A CG   1 
ATOM   2064 C  CD   . GLU A 1 166 ? 53.159 35.170 -14.685 1.00 81.96  ? 381 GLU A CD   1 
ATOM   2065 O  OE1  . GLU A 1 166 ? 52.024 35.704 -14.421 1.00 54.28  ? 381 GLU A OE1  1 
ATOM   2066 O  OE2  . GLU A 1 166 ? 53.477 33.999 -14.329 1.00 79.04  ? 381 GLU A OE2  1 
ATOM   2067 H  H    . GLU A 1 166 ? 51.837 37.078 -15.773 1.00 44.94  ? 381 GLU A H    1 
ATOM   2068 H  HA   . GLU A 1 166 ? 53.878 38.413 -16.645 1.00 69.11  ? 381 GLU A HA   1 
ATOM   2069 H  HB2  . GLU A 1 166 ? 53.189 35.734 -17.227 1.00 69.81  ? 381 GLU A HB2  1 
ATOM   2070 H  HB3  . GLU A 1 166 ? 54.633 36.357 -17.453 1.00 69.81  ? 381 GLU A HB3  1 
ATOM   2071 H  HG2  . GLU A 1 166 ? 55.035 35.414 -15.504 1.00 82.67  ? 381 GLU A HG2  1 
ATOM   2072 H  HG3  . GLU A 1 166 ? 54.431 36.771 -14.948 1.00 82.67  ? 381 GLU A HG3  1 
ATOM   2073 N  N    . TYR A 1 167 ? 51.694 37.846 -18.894 1.00 37.34  ? 382 TYR A N    1 
ATOM   2074 C  CA   . TYR A 1 167 ? 51.284 38.224 -20.239 1.00 42.11  ? 382 TYR A CA   1 
ATOM   2075 C  C    . TYR A 1 167 ? 51.415 39.747 -20.402 1.00 37.67  ? 382 TYR A C    1 
ATOM   2076 O  O    . TYR A 1 167 ? 51.982 40.205 -21.369 1.00 31.03  ? 382 TYR A O    1 
ATOM   2077 C  CB   . TYR A 1 167 ? 49.847 37.754 -20.544 1.00 48.19  ? 382 TYR A CB   1 
ATOM   2078 C  CG   . TYR A 1 167 ? 49.360 38.176 -21.935 1.00 46.49  ? 382 TYR A CG   1 
ATOM   2079 C  CD1  . TYR A 1 167 ? 48.662 39.379 -22.123 1.00 38.68  ? 382 TYR A CD1  1 
ATOM   2080 C  CD2  . TYR A 1 167 ? 49.641 37.397 -23.070 1.00 54.71  ? 382 TYR A CD2  1 
ATOM   2081 C  CE1  . TYR A 1 167 ? 48.240 39.802 -23.408 1.00 54.76  ? 382 TYR A CE1  1 
ATOM   2082 C  CE2  . TYR A 1 167 ? 49.208 37.810 -24.366 1.00 64.51  ? 382 TYR A CE2  1 
ATOM   2083 C  CZ   . TYR A 1 167 ? 48.508 39.019 -24.515 1.00 51.56  ? 382 TYR A CZ   1 
ATOM   2084 O  OH   . TYR A 1 167 ? 48.077 39.467 -25.753 1.00 54.51  ? 382 TYR A OH   1 
ATOM   2085 H  H    . TYR A 1 167 ? 51.098 37.410 -18.454 1.00 44.80  ? 382 TYR A H    1 
ATOM   2086 H  HA   . TYR A 1 167 ? 51.879 37.803 -20.879 1.00 50.53  ? 382 TYR A HA   1 
ATOM   2087 H  HB2  . TYR A 1 167 ? 49.815 36.786 -20.497 1.00 57.83  ? 382 TYR A HB2  1 
ATOM   2088 H  HB3  . TYR A 1 167 ? 49.244 38.138 -19.888 1.00 57.83  ? 382 TYR A HB3  1 
ATOM   2089 H  HD1  . TYR A 1 167 ? 48.479 39.917 -21.387 1.00 46.41  ? 382 TYR A HD1  1 
ATOM   2090 H  HD2  . TYR A 1 167 ? 50.107 36.597 -22.975 1.00 65.65  ? 382 TYR A HD2  1 
ATOM   2091 H  HE1  . TYR A 1 167 ? 47.773 40.600 -23.505 1.00 65.72  ? 382 TYR A HE1  1 
ATOM   2092 H  HE2  . TYR A 1 167 ? 49.395 37.285 -25.110 1.00 77.41  ? 382 TYR A HE2  1 
ATOM   2093 H  HH   . TYR A 1 167 ? 48.292 38.916 -26.350 1.00 65.41  ? 382 TYR A HH   1 
ATOM   2094 N  N    . LEU A 1 168 ? 50.945 40.526 -19.428 1.00 22.28  ? 383 LEU A N    1 
ATOM   2095 C  CA   . LEU A 1 168 ? 51.041 41.983 -19.501 1.00 21.95  ? 383 LEU A CA   1 
ATOM   2096 C  C    . LEU A 1 168 ? 52.434 42.555 -19.391 1.00 26.24  ? 383 LEU A C    1 
ATOM   2097 O  O    . LEU A 1 168 ? 52.741 43.549 -20.055 1.00 27.63  ? 383 LEU A O    1 
ATOM   2098 C  CB   . LEU A 1 168 ? 50.205 42.643 -18.391 1.00 25.85  ? 383 LEU A CB   1 
ATOM   2099 C  CG   . LEU A 1 168 ? 48.695 42.528 -18.414 1.00 32.32  ? 383 LEU A CG   1 
ATOM   2100 C  CD1  . LEU A 1 168 ? 48.052 43.406 -17.311 1.00 36.57  ? 383 LEU A CD1  1 
ATOM   2101 C  CD2  . LEU A 1 168 ? 48.195 42.962 -19.735 1.00 39.05  ? 383 LEU A CD2  1 
ATOM   2102 H  H    . LEU A 1 168 ? 50.565 40.234 -18.714 1.00 26.73  ? 383 LEU A H    1 
ATOM   2103 H  HA   . LEU A 1 168 ? 50.675 42.271 -20.352 1.00 26.34  ? 383 LEU A HA   1 
ATOM   2104 H  HB2  . LEU A 1 168 ? 50.497 42.268 -17.545 1.00 31.02  ? 383 LEU A HB2  1 
ATOM   2105 H  HB3  . LEU A 1 168 ? 50.409 43.591 -18.398 1.00 31.02  ? 383 LEU A HB3  1 
ATOM   2106 H  HG   . LEU A 1 168 ? 48.434 41.605 -18.270 1.00 38.78  ? 383 LEU A HG   1 
ATOM   2107 H  HD11 . LEU A 1 168 ? 47.087 43.310 -17.354 1.00 43.88  ? 383 LEU A HD11 1 
ATOM   2108 H  HD12 . LEU A 1 168 ? 48.376 43.113 -16.446 1.00 43.88  ? 383 LEU A HD12 1 
ATOM   2109 H  HD13 . LEU A 1 168 ? 48.299 44.332 -17.462 1.00 43.88  ? 383 LEU A HD13 1 
ATOM   2110 H  HD21 . LEU A 1 168 ? 47.228 42.887 -19.747 1.00 46.87  ? 383 LEU A HD21 1 
ATOM   2111 H  HD22 . LEU A 1 168 ? 48.457 43.884 -19.884 1.00 46.87  ? 383 LEU A HD22 1 
ATOM   2112 H  HD23 . LEU A 1 168 ? 48.579 42.393 -20.421 1.00 46.87  ? 383 LEU A HD23 1 
ATOM   2113 N  N    . VAL A 1 169 ? 53.256 42.023 -18.486 1.00 24.14  ? 384 VAL A N    1 
ATOM   2114 C  CA   . VAL A 1 169 ? 54.630 42.517 -18.367 1.00 25.48  ? 384 VAL A CA   1 
ATOM   2115 C  C    . VAL A 1 169 ? 55.317 42.345 -19.748 1.00 25.64  ? 384 VAL A C    1 
ATOM   2116 O  O    . VAL A 1 169 ? 55.999 43.249 -20.249 1.00 26.07  ? 384 VAL A O    1 
ATOM   2117 C  CB   . VAL A 1 169 ? 55.371 41.786 -17.246 1.00 27.59  ? 384 VAL A CB   1 
ATOM   2118 C  CG1  . VAL A 1 169 ? 56.835 42.292 -17.103 1.00 28.75  ? 384 VAL A CG1  1 
ATOM   2119 C  CG2  . VAL A 1 169 ? 54.582 41.941 -15.896 1.00 26.76  ? 384 VAL A CG2  1 
ATOM   2120 H  H    . VAL A 1 169 ? 53.051 41.390 -17.941 1.00 28.97  ? 384 VAL A H    1 
ATOM   2121 H  HA   . VAL A 1 169 ? 54.612 43.463 -18.152 1.00 30.58  ? 384 VAL A HA   1 
ATOM   2122 H  HB   . VAL A 1 169 ? 55.406 40.840 -17.461 1.00 33.10  ? 384 VAL A HB   1 
ATOM   2123 H  HG11 . VAL A 1 169 ? 57.268 41.805 -16.385 1.00 34.50  ? 384 VAL A HG11 1 
ATOM   2124 H  HG12 . VAL A 1 169 ? 57.305 42.139 -17.938 1.00 34.50  ? 384 VAL A HG12 1 
ATOM   2125 H  HG13 . VAL A 1 169 ? 56.822 43.240 -16.899 1.00 34.50  ? 384 VAL A HG13 1 
ATOM   2126 H  HG21 . VAL A 1 169 ? 55.063 41.473 -15.194 1.00 32.11  ? 384 VAL A HG21 1 
ATOM   2127 H  HG22 . VAL A 1 169 ? 54.513 42.884 -15.678 1.00 32.11  ? 384 VAL A HG22 1 
ATOM   2128 H  HG23 . VAL A 1 169 ? 53.697 41.560 -16.002 1.00 32.11  ? 384 VAL A HG23 1 
ATOM   2129 N  N    . ASN A 1 170 ? 55.086 41.196 -20.375 1.00 28.47  ? 385 ASN A N    1 
ATOM   2130 C  CA   . ASN A 1 170 ? 55.730 40.877 -21.616 1.00 28.84  ? 385 ASN A CA   1 
ATOM   2131 C  C    . ASN A 1 170 ? 55.245 41.784 -22.731 1.00 31.25  ? 385 ASN A C    1 
ATOM   2132 O  O    . ASN A 1 170 ? 56.043 42.294 -23.500 1.00 33.78  ? 385 ASN A O    1 
ATOM   2133 C  CB   . ASN A 1 170 ? 55.482 39.423 -21.968 1.00 36.68  ? 385 ASN A CB   1 
ATOM   2134 C  CG   . ASN A 1 170 ? 56.465 38.495 -21.287 1.00 34.69  ? 385 ASN A CG   1 
ATOM   2135 O  OD1  . ASN A 1 170 ? 57.661 38.790 -21.184 1.00 45.70  ? 385 ASN A OD1  1 
ATOM   2136 N  ND2  . ASN A 1 170 ? 55.967 37.356 -20.820 1.00 41.22  ? 385 ASN A ND2  1 
ATOM   2137 H  H    . ASN A 1 170 ? 54.553 40.585 -20.089 1.00 34.16  ? 385 ASN A H    1 
ATOM   2138 H  HA   . ASN A 1 170 ? 56.687 41.004 -21.519 1.00 34.61  ? 385 ASN A HA   1 
ATOM   2139 H  HB2  . ASN A 1 170 ? 54.588 39.175 -21.685 1.00 44.02  ? 385 ASN A HB2  1 
ATOM   2140 H  HB3  . ASN A 1 170 ? 55.573 39.308 -22.926 1.00 44.02  ? 385 ASN A HB3  1 
ATOM   2141 H  HD21 . ASN A 1 170 ? 56.481 36.791 -20.424 1.00 49.47  ? 385 ASN A HD21 1 
ATOM   2142 H  HD22 . ASN A 1 170 ? 55.130 37.182 -20.914 1.00 49.47  ? 385 ASN A HD22 1 
ATOM   2143 N  N    . PHE A 1 171 ? 53.932 41.997 -22.777 1.00 24.78  ? 386 PHE A N    1 
ATOM   2144 C  CA   . PHE A 1 171 ? 53.307 42.908 -23.732 1.00 28.43  ? 386 PHE A CA   1 
ATOM   2145 C  C    . PHE A 1 171 ? 53.861 44.324 -23.533 1.00 35.63  ? 386 PHE A C    1 
ATOM   2146 O  O    . PHE A 1 171 ? 54.310 44.946 -24.500 1.00 27.42  ? 386 PHE A O    1 
ATOM   2147 C  CB   . PHE A 1 171 ? 51.782 42.886 -23.581 1.00 28.14  ? 386 PHE A CB   1 
ATOM   2148 C  CG   . PHE A 1 171 ? 51.071 43.873 -24.450 1.00 22.41  ? 386 PHE A CG   1 
ATOM   2149 C  CD1  . PHE A 1 171 ? 50.912 43.644 -25.806 1.00 28.14  ? 386 PHE A CD1  1 
ATOM   2150 C  CD2  . PHE A 1 171 ? 50.568 45.026 -23.922 1.00 27.33  ? 386 PHE A CD2  1 
ATOM   2151 C  CE1  . PHE A 1 171 ? 50.260 44.566 -26.591 1.00 30.01  ? 386 PHE A CE1  1 
ATOM   2152 C  CE2  . PHE A 1 171 ? 49.903 45.948 -24.717 1.00 31.32  ? 386 PHE A CE2  1 
ATOM   2153 C  CZ   . PHE A 1 171 ? 49.761 45.719 -26.040 1.00 27.44  ? 386 PHE A CZ   1 
ATOM   2154 H  H    . PHE A 1 171 ? 53.368 41.614 -22.252 1.00 29.73  ? 386 PHE A H    1 
ATOM   2155 H  HA   . PHE A 1 171 ? 53.525 42.623 -24.633 1.00 34.11  ? 386 PHE A HA   1 
ATOM   2156 H  HB2  . PHE A 1 171 ? 51.459 42.001 -23.813 1.00 33.77  ? 386 PHE A HB2  1 
ATOM   2157 H  HB3  . PHE A 1 171 ? 51.557 43.086 -22.660 1.00 33.77  ? 386 PHE A HB3  1 
ATOM   2158 H  HD1  . PHE A 1 171 ? 51.251 42.866 -26.188 1.00 33.77  ? 386 PHE A HD1  1 
ATOM   2159 H  HD2  . PHE A 1 171 ? 50.665 45.193 -23.013 1.00 32.80  ? 386 PHE A HD2  1 
ATOM   2160 H  HE1  . PHE A 1 171 ? 50.156 44.406 -27.501 1.00 36.01  ? 386 PHE A HE1  1 
ATOM   2161 H  HE2  . PHE A 1 171 ? 49.568 46.730 -24.342 1.00 37.58  ? 386 PHE A HE2  1 
ATOM   2162 H  HZ   . PHE A 1 171 ? 49.316 46.337 -26.574 1.00 32.93  ? 386 PHE A HZ   1 
ATOM   2163 N  N    . LEU A 1 172 ? 53.885 44.813 -22.288 1.00 28.14  ? 387 LEU A N    1 
ATOM   2164 C  CA   . LEU A 1 172 ? 54.494 46.121 -22.016 1.00 27.47  ? 387 LEU A CA   1 
ATOM   2165 C  C    . LEU A 1 172 ? 55.947 46.221 -22.492 1.00 29.58  ? 387 LEU A C    1 
ATOM   2166 O  O    . LEU A 1 172 ? 56.373 47.266 -22.990 1.00 33.72  ? 387 LEU A O    1 
ATOM   2167 C  CB   . LEU A 1 172 ? 54.469 46.447 -20.542 1.00 30.40  ? 387 LEU A CB   1 
ATOM   2168 C  CG   . LEU A 1 172 ? 53.188 46.882 -19.847 1.00 39.30  ? 387 LEU A CG   1 
ATOM   2169 C  CD1  . LEU A 1 172 ? 53.517 47.339 -18.426 1.00 38.22  ? 387 LEU A CD1  1 
ATOM   2170 C  CD2  . LEU A 1 172 ? 52.488 47.973 -20.613 1.00 48.46  ? 387 LEU A CD2  1 
ATOM   2171 H  H    . LEU A 1 172 ? 53.563 44.417 -21.596 1.00 33.77  ? 387 LEU A H    1 
ATOM   2172 H  HA   . LEU A 1 172 ? 53.984 46.804 -22.480 1.00 32.96  ? 387 LEU A HA   1 
ATOM   2173 H  HB2  . LEU A 1 172 ? 54.777 45.658 -20.070 1.00 36.49  ? 387 LEU A HB2  1 
ATOM   2174 H  HB3  . LEU A 1 172 ? 55.109 47.161 -20.397 1.00 36.49  ? 387 LEU A HB3  1 
ATOM   2175 H  HG   . LEU A 1 172 ? 52.587 46.123 -19.788 1.00 47.16  ? 387 LEU A HG   1 
ATOM   2176 H  HD11 . LEU A 1 172 ? 52.698 47.615 -17.986 1.00 45.86  ? 387 LEU A HD11 1 
ATOM   2177 H  HD12 . LEU A 1 172 ? 53.920 46.600 -17.943 1.00 45.86  ? 387 LEU A HD12 1 
ATOM   2178 H  HD13 . LEU A 1 172 ? 54.138 48.083 -18.470 1.00 45.86  ? 387 LEU A HD13 1 
ATOM   2179 H  HD21 . LEU A 1 172 ? 51.679 48.222 -20.140 1.00 58.15  ? 387 LEU A HD21 1 
ATOM   2180 H  HD22 . LEU A 1 172 ? 53.079 48.739 -20.683 1.00 58.15  ? 387 LEU A HD22 1 
ATOM   2181 H  HD23 . LEU A 1 172 ? 52.266 47.644 -21.499 1.00 58.15  ? 387 LEU A HD23 1 
ATOM   2182 N  N    . HIS A 1 173 ? 56.722 45.162 -22.325 1.00 34.38  ? 388 HIS A N    1 
ATOM   2183 C  CA   . HIS A 1 173 ? 58.088 45.231 -22.743 1.00 40.58  ? 388 HIS A CA   1 
ATOM   2184 C  C    . HIS A 1 173 ? 58.176 45.411 -24.246 1.00 40.07  ? 388 HIS A C    1 
ATOM   2185 O  O    . HIS A 1 173 ? 59.051 46.107 -24.744 1.00 44.79  ? 388 HIS A O    1 
ATOM   2186 C  CB   . HIS A 1 173 ? 58.843 43.987 -22.302 1.00 44.85  ? 388 HIS A CB   1 
ATOM   2187 C  CG   . HIS A 1 173 ? 59.394 44.100 -20.920 1.00 67.04  ? 388 HIS A CG   1 
ATOM   2188 N  ND1  . HIS A 1 173 ? 59.456 43.035 -20.049 1.00 72.17  ? 388 HIS A ND1  1 
ATOM   2189 C  CD2  . HIS A 1 173 ? 59.882 45.173 -20.247 1.00 66.31  ? 388 HIS A CD2  1 
ATOM   2190 C  CE1  . HIS A 1 173 ? 59.974 43.443 -18.900 1.00 66.40  ? 388 HIS A CE1  1 
ATOM   2191 N  NE2  . HIS A 1 173 ? 60.236 44.731 -18.996 1.00 67.95  ? 388 HIS A NE2  1 
ATOM   2192 H  H    . HIS A 1 173 ? 56.480 44.413 -21.979 1.00 41.26  ? 388 HIS A H    1 
ATOM   2193 H  HA   . HIS A 1 173 ? 58.508 46.000 -22.325 1.00 48.70  ? 388 HIS A HA   1 
ATOM   2194 H  HB2  . HIS A 1 173 ? 58.240 43.228 -22.322 1.00 53.82  ? 388 HIS A HB2  1 
ATOM   2195 H  HB3  . HIS A 1 173 ? 59.585 43.836 -22.908 1.00 53.82  ? 388 HIS A HB3  1 
ATOM   2196 H  HD1  . HIS A 1 173 ? 59.204 42.232 -20.226 1.00 86.60  ? 388 HIS A HD1  1 
ATOM   2197 H  HD2  . HIS A 1 173 ? 59.965 46.040 -20.572 1.00 79.57  ? 388 HIS A HD2  1 
ATOM   2198 H  HE1  . HIS A 1 173 ? 60.125 42.911 -18.152 1.00 79.68  ? 388 HIS A HE1  1 
ATOM   2199 N  N    . LYS A 1 174 ? 57.272 44.773 -24.974 1.00 34.67  ? 389 LYS A N    1 
ATOM   2200 C  CA   . LYS A 1 174 ? 57.301 44.889 -26.407 1.00 32.62  ? 389 LYS A CA   1 
ATOM   2201 C  C    . LYS A 1 174 ? 56.866 46.281 -26.823 1.00 34.78  ? 389 LYS A C    1 
ATOM   2202 O  O    . LYS A 1 174 ? 57.535 46.951 -27.598 1.00 37.04  ? 389 LYS A O    1 
ATOM   2203 C  CB   . LYS A 1 174 ? 56.415 43.858 -27.030 1.00 29.64  ? 389 LYS A CB   1 
ATOM   2204 C  CG   . LYS A 1 174 ? 56.976 42.471 -26.924 1.00 31.54  ? 389 LYS A CG   1 
ATOM   2205 C  CD   . LYS A 1 174 ? 55.845 41.514 -27.203 1.00 42.14  ? 389 LYS A CD   1 
ATOM   2206 C  CE   . LYS A 1 174 ? 56.273 40.085 -27.170 1.00 33.41  ? 389 LYS A CE   1 
ATOM   2207 N  NZ   . LYS A 1 174 ? 55.024 39.287 -27.486 1.00 41.37  ? 389 LYS A NZ   1 
ATOM   2208 H  H    . LYS A 1 174 ? 56.644 44.275 -24.662 1.00 41.60  ? 389 LYS A H    1 
ATOM   2209 H  HA   . LYS A 1 174 ? 58.207 44.745 -26.723 1.00 39.14  ? 389 LYS A HA   1 
ATOM   2210 H  HB2  . LYS A 1 174 ? 55.554 43.869 -26.583 1.00 35.56  ? 389 LYS A HB2  1 
ATOM   2211 H  HB3  . LYS A 1 174 ? 56.303 44.066 -27.971 1.00 35.56  ? 389 LYS A HB3  1 
ATOM   2212 H  HG2  . LYS A 1 174 ? 57.673 42.341 -27.586 1.00 37.84  ? 389 LYS A HG2  1 
ATOM   2213 H  HG3  . LYS A 1 174 ? 57.311 42.314 -26.027 1.00 37.84  ? 389 LYS A HG3  1 
ATOM   2214 H  HD2  . LYS A 1 174 ? 55.155 41.636 -26.533 1.00 50.57  ? 389 LYS A HD2  1 
ATOM   2215 H  HD3  . LYS A 1 174 ? 55.486 41.699 -28.086 1.00 50.57  ? 389 LYS A HD3  1 
ATOM   2216 H  HE2  . LYS A 1 174 ? 56.944 39.915 -27.849 1.00 40.09  ? 389 LYS A HE2  1 
ATOM   2217 H  HE3  . LYS A 1 174 ? 56.593 39.847 -26.286 1.00 40.09  ? 389 LYS A HE3  1 
ATOM   2218 H  HZ1  . LYS A 1 174 ? 55.210 38.417 -27.482 1.00 49.65  ? 389 LYS A HZ1  1 
ATOM   2219 H  HZ2  . LYS A 1 174 ? 54.396 39.451 -26.877 1.00 49.65  ? 389 LYS A HZ2  1 
ATOM   2220 H  HZ3  . LYS A 1 174 ? 54.714 39.513 -28.289 1.00 49.65  ? 389 LYS A HZ3  1 
ATOM   2221 N  N    . LEU A 1 175 ? 55.743 46.712 -26.277 1.00 30.07  ? 390 LEU A N    1 
ATOM   2222 C  CA   . LEU A 1 175 ? 55.203 48.023 -26.561 1.00 28.09  ? 390 LEU A CA   1 
ATOM   2223 C  C    . LEU A 1 175 ? 56.266 49.103 -26.347 1.00 35.33  ? 390 LEU A C    1 
ATOM   2224 O  O    . LEU A 1 175 ? 56.397 50.065 -27.123 1.00 34.66  ? 390 LEU A O    1 
ATOM   2225 C  CB   . LEU A 1 175 ? 53.982 48.265 -25.674 1.00 27.21  ? 390 LEU A CB   1 
ATOM   2226 C  CG   . LEU A 1 175 ? 52.986 49.307 -26.080 1.00 28.99  ? 390 LEU A CG   1 
ATOM   2227 C  CD1  . LEU A 1 175 ? 52.388 48.901 -27.420 1.00 30.60  ? 390 LEU A CD1  1 
ATOM   2228 C  CD2  . LEU A 1 175 ? 51.947 49.345 -25.027 1.00 35.25  ? 390 LEU A CD2  1 
ATOM   2229 H  H    . LEU A 1 175 ? 55.267 46.253 -25.727 1.00 36.09  ? 390 LEU A H    1 
ATOM   2230 H  HA   . LEU A 1 175 ? 54.917 48.057 -27.488 1.00 33.71  ? 390 LEU A HA   1 
ATOM   2231 H  HB2  . LEU A 1 175 ? 53.498 47.427 -25.605 1.00 32.65  ? 390 LEU A HB2  1 
ATOM   2232 H  HB3  . LEU A 1 175 ? 54.303 48.514 -24.793 1.00 32.65  ? 390 LEU A HB3  1 
ATOM   2233 H  HG   . LEU A 1 175 ? 53.409 50.176 -26.157 1.00 34.78  ? 390 LEU A HG   1 
ATOM   2234 H  HD11 . LEU A 1 175 ? 51.741 49.570 -27.692 1.00 36.72  ? 390 LEU A HD11 1 
ATOM   2235 H  HD12 . LEU A 1 175 ? 53.099 48.842 -28.078 1.00 36.72  ? 390 LEU A HD12 1 
ATOM   2236 H  HD13 . LEU A 1 175 ? 51.953 48.040 -27.324 1.00 36.72  ? 390 LEU A HD13 1 
ATOM   2237 H  HD21 . LEU A 1 175 ? 51.284 50.013 -25.262 1.00 42.30  ? 390 LEU A HD21 1 
ATOM   2238 H  HD22 . LEU A 1 175 ? 51.529 48.472 -24.964 1.00 42.30  ? 390 LEU A HD22 1 
ATOM   2239 H  HD23 . LEU A 1 175 ? 52.364 49.575 -24.181 1.00 42.30  ? 390 LEU A HD23 1 
ATOM   2240 N  N    . ARG A 1 176 ? 57.029 48.922 -25.290 1.00 41.80  ? 391 ARG A N    1 
ATOM   2241 C  CA   . ARG A 1 176 ? 58.049 49.862 -24.920 1.00 44.14  ? 391 ARG A CA   1 
ATOM   2242 C  C    . ARG A 1 176 ? 59.101 49.952 -26.042 1.00 42.95  ? 391 ARG A C    1 
ATOM   2243 O  O    . ARG A 1 176 ? 59.696 50.993 -26.227 1.00 47.56  ? 391 ARG A O    1 
ATOM   2244 C  CB   . ARG A 1 176 ? 58.672 49.438 -23.574 1.00 54.69  ? 391 ARG A CB   1 
ATOM   2245 C  CG   . ARG A 1 176 ? 59.652 50.407 -22.958 1.00 68.04  ? 391 ARG A CG   1 
ATOM   2246 C  CD   . ARG A 1 176 ? 58.974 51.694 -22.482 1.00 77.19  ? 391 ARG A CD   1 
ATOM   2247 N  NE   . ARG A 1 176 ? 59.930 52.771 -22.210 1.00 64.34  ? 391 ARG A NE   1 
ATOM   2248 C  CZ   . ARG A 1 176 ? 60.863 52.732 -21.259 1.00 80.71  ? 391 ARG A CZ   1 
ATOM   2249 N  NH1  . ARG A 1 176 ? 60.985 51.670 -20.471 1.00 76.15  ? 391 ARG A NH1  1 
ATOM   2250 N  NH2  . ARG A 1 176 ? 61.688 53.763 -21.097 1.00 92.19  ? 391 ARG A NH2  1 
ATOM   2251 H  H    . ARG A 1 176 ? 56.970 48.245 -24.763 1.00 50.16  ? 391 ARG A H    1 
ATOM   2252 H  HA   . ARG A 1 176 ? 57.650 50.739 -24.807 1.00 52.96  ? 391 ARG A HA   1 
ATOM   2253 H  HB2  . ARG A 1 176 ? 57.954 49.308 -22.934 1.00 65.63  ? 391 ARG A HB2  1 
ATOM   2254 H  HB3  . ARG A 1 176 ? 59.140 48.599 -23.707 1.00 65.63  ? 391 ARG A HB3  1 
ATOM   2255 H  HG2  . ARG A 1 176 ? 60.075 49.988 -22.192 1.00 81.65  ? 391 ARG A HG2  1 
ATOM   2256 H  HG3  . ARG A 1 176 ? 60.321 50.646 -23.619 1.00 81.65  ? 391 ARG A HG3  1 
ATOM   2257 H  HD2  . ARG A 1 176 ? 58.362 52.002 -23.169 1.00 92.63  ? 391 ARG A HD2  1 
ATOM   2258 H  HD3  . ARG A 1 176 ? 58.488 51.511 -21.663 1.00 92.63  ? 391 ARG A HD3  1 
ATOM   2259 H  HE   . ARG A 1 176 ? 59.885 53.478 -22.698 1.00 77.21  ? 391 ARG A HE   1 
ATOM   2260 H  HH11 . ARG A 1 176 ? 60.457 50.998 -20.570 1.00 91.38  ? 391 ARG A HH11 1 
ATOM   2261 H  HH12 . ARG A 1 176 ? 61.590 51.655 -19.860 1.00 91.38  ? 391 ARG A HH12 1 
ATOM   2262 H  HH21 . ARG A 1 176 ? 61.616 54.455 -21.603 1.00 110.63 ? 391 ARG A HH21 1 
ATOM   2263 H  HH22 . ARG A 1 176 ? 62.290 53.740 -20.483 1.00 110.63 ? 391 ARG A HH22 1 
ATOM   2264 N  N    . GLN A 1 177 ? 59.301 48.864 -26.790 1.00 41.46  ? 392 GLN A N    1 
ATOM   2265 C  CA   . GLN A 1 177 ? 60.263 48.824 -27.890 1.00 42.05  ? 392 GLN A CA   1 
ATOM   2266 C  C    . GLN A 1 177 ? 59.921 49.691 -29.105 1.00 44.46  ? 392 GLN A C    1 
ATOM   2267 O  O    . GLN A 1 177 ? 60.810 50.027 -29.857 1.00 45.12  ? 392 GLN A O    1 
ATOM   2268 C  CB   . GLN A 1 177 ? 60.418 47.394 -28.424 1.00 46.41  ? 392 GLN A CB   1 
ATOM   2269 C  CG   . GLN A 1 177 ? 61.342 46.464 -27.673 1.00 68.28  ? 392 GLN A CG   1 
ATOM   2270 C  CD   . GLN A 1 177 ? 61.453 45.116 -28.398 1.00 61.00  ? 392 GLN A CD   1 
ATOM   2271 O  OE1  . GLN A 1 177 ? 62.069 45.017 -29.469 1.00 60.30  ? 392 GLN A OE1  1 
ATOM   2272 N  NE2  . GLN A 1 177 ? 60.839 44.079 -27.826 1.00 44.68  ? 392 GLN A NE2  1 
ATOM   2273 H  H    . GLN A 1 177 ? 58.881 48.122 -26.676 1.00 49.76  ? 392 GLN A H    1 
ATOM   2274 H  HA   . GLN A 1 177 ? 61.128 49.111 -27.556 1.00 50.46  ? 392 GLN A HA   1 
ATOM   2275 H  HB2  . GLN A 1 177 ? 59.541 46.979 -28.429 1.00 55.69  ? 392 GLN A HB2  1 
ATOM   2276 H  HB3  . GLN A 1 177 ? 60.749 47.448 -29.334 1.00 55.69  ? 392 GLN A HB3  1 
ATOM   2277 H  HG2  . GLN A 1 177 ? 62.226 46.858 -27.621 1.00 81.94  ? 392 GLN A HG2  1 
ATOM   2278 H  HG3  . GLN A 1 177 ? 60.988 46.305 -26.783 1.00 81.94  ? 392 GLN A HG3  1 
ATOM   2279 H  HE21 . GLN A 1 177 ? 60.409 44.188 -27.089 1.00 53.62  ? 392 GLN A HE21 1 
ATOM   2280 H  HE22 . GLN A 1 177 ? 60.872 43.303 -28.195 1.00 53.62  ? 392 GLN A HE22 1 
ATOM   2281 N  N    . LEU A 1 178 ? 58.642 49.979 -29.338 1.00 31.70  ? 393 LEU A N    1 
ATOM   2282 C  CA   . LEU A 1 178 ? 58.202 50.603 -30.570 1.00 27.40  ? 393 LEU A CA   1 
ATOM   2283 C  C    . LEU A 1 178 ? 58.845 51.982 -30.726 1.00 29.01  ? 393 LEU A C    1 
ATOM   2284 O  O    . LEU A 1 178 ? 59.043 52.660 -29.766 1.00 30.00  ? 393 LEU A O    1 
ATOM   2285 C  CB   . LEU A 1 178 ? 56.679 50.698 -30.601 1.00 26.20  ? 393 LEU A CB   1 
ATOM   2286 C  CG   . LEU A 1 178 ? 56.000 49.450 -31.171 1.00 24.61  ? 393 LEU A CG   1 
ATOM   2287 C  CD1  . LEU A 1 178 ? 56.641 48.190 -30.631 1.00 27.06  ? 393 LEU A CD1  1 
ATOM   2288 C  CD2  . LEU A 1 178 ? 54.495 49.426 -30.966 1.00 24.49  ? 393 LEU A CD2  1 
ATOM   2289 H  H    . LEU A 1 178 ? 58.004 49.818 -28.784 1.00 38.04  ? 393 LEU A H    1 
ATOM   2290 H  HA   . LEU A 1 178 ? 58.484 50.055 -31.319 1.00 32.87  ? 393 LEU A HA   1 
ATOM   2291 H  HB2  . LEU A 1 178 ? 56.354 50.826 -29.695 1.00 31.44  ? 393 LEU A HB2  1 
ATOM   2292 H  HB3  . LEU A 1 178 ? 56.423 51.454 -31.152 1.00 31.44  ? 393 LEU A HB3  1 
ATOM   2293 H  HG   . LEU A 1 178 ? 56.148 49.447 -32.129 1.00 29.53  ? 393 LEU A HG   1 
ATOM   2294 H  HD11 . LEU A 1 178 ? 56.190 47.419 -31.009 1.00 32.48  ? 393 LEU A HD11 1 
ATOM   2295 H  HD12 . LEU A 1 178 ? 57.578 48.181 -30.880 1.00 32.48  ? 393 LEU A HD12 1 
ATOM   2296 H  HD13 . LEU A 1 178 ? 56.555 48.182 -29.664 1.00 32.48  ? 393 LEU A HD13 1 
ATOM   2297 H  HD21 . LEU A 1 178 ? 54.137 48.610 -31.351 1.00 29.38  ? 393 LEU A HD21 1 
ATOM   2298 H  HD22 . LEU A 1 178 ? 54.306 49.454 -30.015 1.00 29.38  ? 393 LEU A HD22 1 
ATOM   2299 H  HD23 . LEU A 1 178 ? 54.105 50.198 -31.404 1.00 29.38  ? 393 LEU A HD23 1 
ATOM   2300 N  N    . PRO A 1 179 ? 59.208 52.371 -31.955 1.00 31.72  ? 394 PRO A N    1 
ATOM   2301 C  CA   . PRO A 1 179 ? 59.873 53.644 -32.217 1.00 34.38  ? 394 PRO A CA   1 
ATOM   2302 C  C    . PRO A 1 179 ? 58.987 54.853 -32.123 1.00 35.18  ? 394 PRO A C    1 
ATOM   2303 O  O    . PRO A 1 179 ? 59.522 55.924 -31.913 1.00 36.35  ? 394 PRO A O    1 
ATOM   2304 C  CB   . PRO A 1 179 ? 60.345 53.503 -33.669 1.00 36.02  ? 394 PRO A CB   1 
ATOM   2305 C  CG   . PRO A 1 179 ? 60.207 52.049 -33.998 1.00 35.80  ? 394 PRO A CG   1 
ATOM   2306 C  CD   . PRO A 1 179 ? 59.087 51.571 -33.183 1.00 32.18  ? 394 PRO A CD   1 
ATOM   2307 H  HA   . PRO A 1 179 ? 60.641 53.756 -31.635 1.00 41.26  ? 394 PRO A HA   1 
ATOM   2308 H  HB2  . PRO A 1 179 ? 59.780 54.039 -34.248 1.00 43.23  ? 394 PRO A HB2  1 
ATOM   2309 H  HB3  . PRO A 1 179 ? 61.271 53.783 -33.740 1.00 43.23  ? 394 PRO A HB3  1 
ATOM   2310 H  HG2  . PRO A 1 179 ? 60.013 51.945 -34.942 1.00 42.95  ? 394 PRO A HG2  1 
ATOM   2311 H  HG3  . PRO A 1 179 ? 61.025 51.583 -33.762 1.00 42.95  ? 394 PRO A HG3  1 
ATOM   2312 H  HD2  . PRO A 1 179 ? 58.243 51.755 -33.626 1.00 38.61  ? 394 PRO A HD2  1 
ATOM   2313 H  HD3  . PRO A 1 179 ? 59.188 50.627 -32.986 1.00 38.61  ? 394 PRO A HD3  1 
ATOM   2314 N  N    . GLU A 1 180 ? 57.683 54.720 -32.339 1.00 37.39  ? 395 GLU A N    1 
ATOM   2315 C  CA   . GLU A 1 180 ? 56.825 55.898 -32.325 1.00 35.24  ? 395 GLU A CA   1 
ATOM   2316 C  C    . GLU A 1 180 ? 55.556 55.673 -31.523 1.00 34.41  ? 395 GLU A C    1 
ATOM   2317 O  O    . GLU A 1 180 ? 55.015 54.571 -31.428 1.00 34.24  ? 395 GLU A O    1 
ATOM   2318 C  CB   . GLU A 1 180 ? 56.465 56.330 -33.743 1.00 41.95  ? 395 GLU A CB   1 
ATOM   2319 C  CG   . GLU A 1 180 ? 57.665 56.581 -34.674 1.00 52.29  ? 395 GLU A CG   1 
ATOM   2320 C  CD   . GLU A 1 180 ? 58.281 57.968 -34.484 1.00 50.61  ? 395 GLU A CD   1 
ATOM   2321 O  OE1  . GLU A 1 180 ? 57.576 58.889 -33.997 1.00 48.45  ? 395 GLU A OE1  1 
ATOM   2322 O  OE2  . GLU A 1 180 ? 59.478 58.131 -34.823 1.00 48.99  ? 395 GLU A OE2  1 
ATOM   2323 H  H    . GLU A 1 180 ? 57.278 53.977 -32.492 1.00 44.87  ? 395 GLU A H    1 
ATOM   2324 H  HA   . GLU A 1 180 ? 57.309 56.629 -31.910 1.00 42.28  ? 395 GLU A HA   1 
ATOM   2325 H  HB2  . GLU A 1 180 ? 55.922 55.635 -34.148 1.00 50.34  ? 395 GLU A HB2  1 
ATOM   2326 H  HB3  . GLU A 1 180 ? 55.955 57.153 -33.694 1.00 50.34  ? 395 GLU A HB3  1 
ATOM   2327 H  HG2  . GLU A 1 180 ? 58.352 55.921 -34.490 1.00 62.74  ? 395 GLU A HG2  1 
ATOM   2328 H  HG3  . GLU A 1 180 ? 57.372 56.507 -35.596 1.00 62.74  ? 395 GLU A HG3  1 
ATOM   2329 N  N    . ARG A 1 181 ? 55.080 56.761 -30.965 1.00 34.76  ? 396 ARG A N    1 
ATOM   2330 C  CA   . ARG A 1 181 ? 53.939 56.740 -30.072 1.00 34.54  ? 396 ARG A CA   1 
ATOM   2331 C  C    . ARG A 1 181 ? 52.662 56.380 -30.837 1.00 32.80  ? 396 ARG A C    1 
ATOM   2332 O  O    . ARG A 1 181 ? 51.734 55.730 -30.282 1.00 31.12  ? 396 ARG A O    1 
ATOM   2333 C  CB   . ARG A 1 181 ? 53.825 58.109 -29.391 1.00 35.44  ? 396 ARG A CB   1 
ATOM   2334 C  CG   . ARG A 1 181 ? 52.769 58.244 -28.312 1.00 54.24  ? 396 ARG A CG   1 
ATOM   2335 C  CD   . ARG A 1 181 ? 52.808 59.637 -27.654 1.00 57.30  ? 396 ARG A CD   1 
ATOM   2336 N  NE   . ARG A 1 181 ? 52.454 60.715 -28.577 1.00 76.11  ? 396 ARG A NE   1 
ATOM   2337 C  CZ   . ARG A 1 181 ? 51.208 61.087 -28.865 1.00 73.72  ? 396 ARG A CZ   1 
ATOM   2338 N  NH1  . ARG A 1 181 ? 50.159 60.479 -28.310 1.00 63.83  ? 396 ARG A NH1  1 
ATOM   2339 N  NH2  . ARG A 1 181 ? 51.012 62.078 -29.720 1.00 81.60  ? 396 ARG A NH2  1 
ATOM   2340 H  H    . ARG A 1 181 ? 55.408 57.546 -31.088 1.00 41.71  ? 396 ARG A H    1 
ATOM   2341 H  HA   . ARG A 1 181 ? 54.081 56.070 -29.386 1.00 41.45  ? 396 ARG A HA   1 
ATOM   2342 H  HB2  . ARG A 1 181 ? 54.680 58.316 -28.983 1.00 42.53  ? 396 ARG A HB2  1 
ATOM   2343 H  HB3  . ARG A 1 181 ? 53.626 58.770 -30.072 1.00 42.53  ? 396 ARG A HB3  1 
ATOM   2344 H  HG2  . ARG A 1 181 ? 51.892 58.118 -28.705 1.00 65.08  ? 396 ARG A HG2  1 
ATOM   2345 H  HG3  . ARG A 1 181 ? 52.927 57.579 -27.624 1.00 65.08  ? 396 ARG A HG3  1 
ATOM   2346 H  HD2  . ARG A 1 181 ? 52.177 59.656 -26.917 1.00 68.77  ? 396 ARG A HD2  1 
ATOM   2347 H  HD3  . ARG A 1 181 ? 53.705 59.806 -27.326 1.00 68.77  ? 396 ARG A HD3  1 
ATOM   2348 H  HE   . ARG A 1 181 ? 53.097 61.139 -28.961 1.00 91.34  ? 396 ARG A HE   1 
ATOM   2349 H  HH11 . ARG A 1 181 ? 50.281 59.834 -27.754 1.00 76.60  ? 396 ARG A HH11 1 
ATOM   2350 H  HH12 . ARG A 1 181 ? 49.362 60.732 -28.507 1.00 76.60  ? 396 ARG A HH12 1 
ATOM   2351 H  HH21 . ARG A 1 181 ? 51.685 62.474 -30.081 1.00 97.92  ? 396 ARG A HH21 1 
ATOM   2352 H  HH22 . ARG A 1 181 ? 50.212 62.327 -29.913 1.00 97.92  ? 396 ARG A HH22 1 
ATOM   2353 N  N    . TYR A 1 182 ? 52.603 56.803 -32.102 1.00 29.22  ? 397 TYR A N    1 
ATOM   2354 C  CA   . TYR A 1 182 ? 51.416 56.535 -32.880 1.00 28.40  ? 397 TYR A CA   1 
ATOM   2355 C  C    . TYR A 1 182 ? 51.376 55.043 -33.152 1.00 26.55  ? 397 TYR A C    1 
ATOM   2356 O  O    . TYR A 1 182 ? 50.292 54.453 -33.281 1.00 25.61  ? 397 TYR A O    1 
ATOM   2357 C  CB   . TYR A 1 182 ? 51.349 57.349 -34.182 1.00 29.53  ? 397 TYR A CB   1 
ATOM   2358 C  CG   . TYR A 1 182 ? 52.335 56.961 -35.274 1.00 29.78  ? 397 TYR A CG   1 
ATOM   2359 C  CD1  . TYR A 1 182 ? 52.091 55.878 -36.087 1.00 28.00  ? 397 TYR A CD1  1 
ATOM   2360 C  CD2  . TYR A 1 182 ? 53.474 57.714 -35.507 1.00 30.86  ? 397 TYR A CD2  1 
ATOM   2361 C  CE1  . TYR A 1 182 ? 52.981 55.516 -37.087 1.00 29.65  ? 397 TYR A CE1  1 
ATOM   2362 C  CE2  . TYR A 1 182 ? 54.358 57.378 -36.500 1.00 30.87  ? 397 TYR A CE2  1 
ATOM   2363 C  CZ   . TYR A 1 182 ? 54.099 56.272 -37.289 1.00 29.68  ? 397 TYR A CZ   1 
ATOM   2364 O  OH   . TYR A 1 182 ? 54.973 55.898 -38.289 1.00 35.19  ? 397 TYR A OH   1 
ATOM   2365 H  H    . TYR A 1 182 ? 53.222 57.233 -32.514 1.00 35.06  ? 397 TYR A H    1 
ATOM   2366 H  HA   . TYR A 1 182 ? 50.636 56.761 -32.349 1.00 34.08  ? 397 TYR A HA   1 
ATOM   2367 H  HB2  . TYR A 1 182 ? 50.457 57.256 -34.553 1.00 35.44  ? 397 TYR A HB2  1 
ATOM   2368 H  HB3  . TYR A 1 182 ? 51.511 58.281 -33.966 1.00 35.44  ? 397 TYR A HB3  1 
ATOM   2369 H  HD1  . TYR A 1 182 ? 51.330 55.362 -35.945 1.00 33.60  ? 397 TYR A HD1  1 
ATOM   2370 H  HD2  . TYR A 1 182 ? 53.647 58.456 -34.973 1.00 37.04  ? 397 TYR A HD2  1 
ATOM   2371 H  HE1  . TYR A 1 182 ? 52.810 54.775 -37.623 1.00 35.58  ? 397 TYR A HE1  1 
ATOM   2372 H  HE2  . TYR A 1 182 ? 55.126 57.884 -36.638 1.00 37.04  ? 397 TYR A HE2  1 
ATOM   2373 H  HH   . TYR A 1 182 ? 54.691 55.207 -38.674 1.00 42.23  ? 397 TYR A HH   1 
ATOM   2374 N  N    . MET A 1 183 ? 52.548 54.422 -33.202 1.00 26.30  ? 398 MET A N    1 
ATOM   2375 C  CA   . MET A 1 183 ? 52.575 52.955 -33.360 1.00 24.88  ? 398 MET A CA   1 
ATOM   2376 C  C    . MET A 1 183 ? 52.059 52.233 -32.092 1.00 24.10  ? 398 MET A C    1 
ATOM   2377 O  O    . MET A 1 183 ? 51.246 51.306 -32.181 1.00 23.34  ? 398 MET A O    1 
ATOM   2378 C  CB   . MET A 1 183 ? 53.966 52.479 -33.708 1.00 26.25  ? 398 MET A CB   1 
ATOM   2379 C  CG   . MET A 1 183 ? 54.532 53.109 -35.029 1.00 27.08  ? 398 MET A CG   1 
ATOM   2380 S  SD   . MET A 1 183 ? 55.997 52.184 -35.577 1.00 32.89  ? 398 MET A SD   1 
ATOM   2381 C  CE   . MET A 1 183 ? 56.410 53.099 -37.076 1.00 36.50  ? 398 MET A CE   1 
ATOM   2382 H  H    . MET A 1 183 ? 53.319 54.801 -33.149 1.00 31.56  ? 398 MET A H    1 
ATOM   2383 H  HA   . MET A 1 183 ? 51.995 52.719 -34.101 1.00 29.86  ? 398 MET A HA   1 
ATOM   2384 H  HB2  . MET A 1 183 ? 54.568 52.714 -32.985 1.00 31.50  ? 398 MET A HB2  1 
ATOM   2385 H  HB3  . MET A 1 183 ? 53.949 51.516 -33.822 1.00 31.50  ? 398 MET A HB3  1 
ATOM   2386 H  HG2  . MET A 1 183 ? 53.859 53.063 -35.725 1.00 32.50  ? 398 MET A HG2  1 
ATOM   2387 H  HG3  . MET A 1 183 ? 54.791 54.029 -34.865 1.00 32.50  ? 398 MET A HG3  1 
ATOM   2388 H  HE1  . MET A 1 183 ? 57.195 52.701 -37.482 1.00 43.80  ? 398 MET A HE1  1 
ATOM   2389 H  HE2  . MET A 1 183 ? 55.660 53.053 -37.689 1.00 43.80  ? 398 MET A HE2  1 
ATOM   2390 H  HE3  . MET A 1 183 ? 56.590 54.023 -36.841 1.00 43.80  ? 398 MET A HE3  1 
ATOM   2391 N  N    . MET A 1 184 ? 52.530 52.662 -30.928 1.00 24.59  ? 399 MET A N    1 
ATOM   2392 C  CA   . MET A 1 184 ? 51.987 52.194 -29.631 1.00 23.99  ? 399 MET A CA   1 
ATOM   2393 C  C    . MET A 1 184 ? 50.459 52.316 -29.599 1.00 23.48  ? 399 MET A C    1 
ATOM   2394 O  O    . MET A 1 184 ? 49.769 51.371 -29.248 1.00 22.48  ? 399 MET A O    1 
ATOM   2395 C  CB   . MET A 1 184 ? 52.634 52.979 -28.476 1.00 25.17  ? 399 MET A CB   1 
ATOM   2396 C  CG   . MET A 1 184 ? 54.085 52.660 -28.310 1.00 25.80  ? 399 MET A CG   1 
ATOM   2397 S  SD   . MET A 1 184 ? 54.847 53.758 -27.154 1.00 30.02  ? 399 MET A SD   1 
ATOM   2398 C  CE   . MET A 1 184 ? 56.612 53.412 -27.267 1.00 28.84  ? 399 MET A CE   1 
ATOM   2399 H  H    . MET A 1 184 ? 53.171 53.231 -30.849 1.00 29.50  ? 399 MET A H    1 
ATOM   2400 H  HA   . MET A 1 184 ? 52.223 51.260 -29.517 1.00 28.79  ? 399 MET A HA   1 
ATOM   2401 H  HB2  . MET A 1 184 ? 52.553 53.929 -28.655 1.00 30.20  ? 399 MET A HB2  1 
ATOM   2402 H  HB3  . MET A 1 184 ? 52.180 52.757 -27.648 1.00 30.20  ? 399 MET A HB3  1 
ATOM   2403 H  HG2  . MET A 1 184 ? 54.179 51.754 -27.977 1.00 30.97  ? 399 MET A HG2  1 
ATOM   2404 H  HG3  . MET A 1 184 ? 54.535 52.755 -29.164 1.00 30.97  ? 399 MET A HG3  1 
ATOM   2405 H  HE1  . MET A 1 184 ? 57.087 53.990 -26.650 1.00 34.61  ? 399 MET A HE1  1 
ATOM   2406 H  HE2  . MET A 1 184 ? 56.767 52.483 -27.037 1.00 34.61  ? 399 MET A HE2  1 
ATOM   2407 H  HE3  . MET A 1 184 ? 56.909 53.582 -28.175 1.00 34.61  ? 399 MET A HE3  1 
ATOM   2408 N  N    . ASN A 1 185 ? 49.927 53.464 -30.011 1.00 24.39  ? 400 ASN A N    1 
ATOM   2409 C  CA   . ASN A 1 185 ? 48.489 53.681 -29.991 1.00 24.33  ? 400 ASN A CA   1 
ATOM   2410 C  C    . ASN A 1 185 ? 47.740 52.825 -31.028 1.00 23.44  ? 400 ASN A C    1 
ATOM   2411 O  O    . ASN A 1 185 ? 46.634 52.336 -30.726 1.00 23.51  ? 400 ASN A O    1 
ATOM   2412 C  CB   . ASN A 1 185 ? 48.173 55.192 -30.158 1.00 26.01  ? 400 ASN A CB   1 
ATOM   2413 C  CG   . ASN A 1 185 ? 48.591 55.997 -28.926 1.00 27.12  ? 400 ASN A CG   1 
ATOM   2414 O  OD1  . ASN A 1 185 ? 48.653 55.450 -27.836 1.00 26.51  ? 400 ASN A OD1  1 
ATOM   2415 N  ND2  . ASN A 1 185 ? 48.939 57.246 -29.106 1.00 28.90  ? 400 ASN A ND2  1 
ATOM   2416 H  H    . ASN A 1 185 ? 50.380 54.133 -30.306 1.00 29.27  ? 400 ASN A H    1 
ATOM   2417 H  HA   . ASN A 1 185 ? 48.160 53.418 -29.118 1.00 29.19  ? 400 ASN A HA   1 
ATOM   2418 H  HB2  . ASN A 1 185 ? 48.656 55.536 -30.925 1.00 31.21  ? 400 ASN A HB2  1 
ATOM   2419 H  HB3  . ASN A 1 185 ? 47.218 55.306 -30.285 1.00 31.21  ? 400 ASN A HB3  1 
ATOM   2420 H  HD21 . ASN A 1 185 ? 49.180 57.727 -28.435 1.00 34.68  ? 400 ASN A HD21 1 
ATOM   2421 H  HD22 . ASN A 1 185 ? 48.926 57.587 -29.896 1.00 34.68  ? 400 ASN A HD22 1 
ATOM   2422 N  N    . SER A 1 186 ? 48.325 52.580 -32.205 1.00 23.35  ? 401 SER A N    1 
ATOM   2423 C  CA   . SER A 1 186 ? 47.732 51.615 -33.116 1.00 22.62  ? 401 SER A CA   1 
ATOM   2424 C  C    . SER A 1 186 ? 47.566 50.257 -32.491 1.00 21.54  ? 401 SER A C    1 
ATOM   2425 O  O    . SER A 1 186 ? 46.515 49.657 -32.633 1.00 21.38  ? 401 SER A O    1 
ATOM   2426 C  CB   . SER A 1 186 ? 48.574 51.414 -34.370 1.00 22.72  ? 401 SER A CB   1 
ATOM   2427 O  OG   . SER A 1 186 ? 48.742 52.629 -35.016 1.00 25.99  ? 401 SER A OG   1 
ATOM   2428 H  H    . SER A 1 186 ? 49.047 52.952 -32.489 1.00 28.02  ? 401 SER A H    1 
ATOM   2429 H  HA   . SER A 1 186 ? 46.856 51.932 -33.388 1.00 27.15  ? 401 SER A HA   1 
ATOM   2430 H  HB2  . SER A 1 186 ? 49.443 51.063 -34.118 1.00 27.26  ? 401 SER A HB2  1 
ATOM   2431 H  HB3  . SER A 1 186 ? 48.121 50.796 -34.964 1.00 27.26  ? 401 SER A HB3  1 
ATOM   2432 H  HG   . SER A 1 186 ? 49.130 53.174 -34.507 1.00 31.19  ? 401 SER A HG   1 
ATOM   2433 N  N    . VAL A 1 187 ? 48.620 49.743 -31.862 1.00 21.22  ? 402 VAL A N    1 
ATOM   2434 C  CA   . VAL A 1 187 ? 48.557 48.459 -31.235 1.00 20.48  ? 402 VAL A CA   1 
ATOM   2435 C  C    . VAL A 1 187 ? 47.480 48.458 -30.112 1.00 20.25  ? 402 VAL A C    1 
ATOM   2436 O  O    . VAL A 1 187 ? 46.627 47.567 -30.059 1.00 19.82  ? 402 VAL A O    1 
ATOM   2437 C  CB   . VAL A 1 187 ? 49.919 48.071 -30.694 1.00 20.57  ? 402 VAL A CB   1 
ATOM   2438 C  CG1  . VAL A 1 187 ? 49.806 46.777 -29.885 1.00 20.07  ? 402 VAL A CG1  1 
ATOM   2439 C  CG2  . VAL A 1 187 ? 50.932 47.886 -31.838 1.00 22.10  ? 402 VAL A CG2  1 
ATOM   2440 H  H    . VAL A 1 187 ? 49.383 50.132 -31.792 1.00 25.47  ? 402 VAL A H    1 
ATOM   2441 H  HA   . VAL A 1 187 ? 48.299 47.797 -31.896 1.00 24.57  ? 402 VAL A HA   1 
ATOM   2442 H  HB   . VAL A 1 187 ? 50.244 48.772 -30.107 1.00 24.69  ? 402 VAL A HB   1 
ATOM   2443 H  HG11 . VAL A 1 187 ? 50.683 46.540 -29.545 1.00 24.08  ? 402 VAL A HG11 1 
ATOM   2444 H  HG12 . VAL A 1 187 ? 49.192 46.918 -29.148 1.00 24.08  ? 402 VAL A HG12 1 
ATOM   2445 H  HG13 . VAL A 1 187 ? 49.473 46.072 -30.463 1.00 24.08  ? 402 VAL A HG13 1 
ATOM   2446 H  HG21 . VAL A 1 187 ? 51.791 47.640 -31.460 1.00 26.52  ? 402 VAL A HG21 1 
ATOM   2447 H  HG22 . VAL A 1 187 ? 50.616 47.185 -32.428 1.00 26.52  ? 402 VAL A HG22 1 
ATOM   2448 H  HG23 . VAL A 1 187 ? 51.012 48.720 -32.326 1.00 26.52  ? 402 VAL A HG23 1 
ATOM   2449 N  N    . LEU A 1 188 ? 47.534 49.452 -29.220 1.00 20.72  ? 403 LEU A N    1 
ATOM   2450 C  CA   . LEU A 1 188 ? 46.628 49.552 -28.073 1.00 21.24  ? 403 LEU A CA   1 
ATOM   2451 C  C    . LEU A 1 188 ? 45.137 49.697 -28.407 1.00 21.19  ? 403 LEU A C    1 
ATOM   2452 O  O    . LEU A 1 188 ? 44.299 49.363 -27.572 1.00 20.68  ? 403 LEU A O    1 
ATOM   2453 C  CB   . LEU A 1 188 ? 47.039 50.742 -27.177 1.00 21.54  ? 403 LEU A CB   1 
ATOM   2454 C  CG   . LEU A 1 188 ? 48.332 50.423 -26.415 1.00 24.13  ? 403 LEU A CG   1 
ATOM   2455 C  CD1  . LEU A 1 188 ? 48.894 51.684 -25.782 1.00 22.97  ? 403 LEU A CD1  1 
ATOM   2456 C  CD2  . LEU A 1 188 ? 48.133 49.419 -25.337 1.00 21.28  ? 403 LEU A CD2  1 
ATOM   2457 H  H    . LEU A 1 188 ? 48.102 50.096 -29.260 1.00 24.86  ? 403 LEU A H    1 
ATOM   2458 H  HA   . LEU A 1 188 ? 46.725 48.745 -27.542 1.00 25.48  ? 403 LEU A HA   1 
ATOM   2459 H  HB2  . LEU A 1 188 ? 47.193 51.523 -27.730 1.00 25.85  ? 403 LEU A HB2  1 
ATOM   2460 H  HB3  . LEU A 1 188 ? 46.337 50.917 -26.531 1.00 25.85  ? 403 LEU A HB3  1 
ATOM   2461 H  HG   . LEU A 1 188 ? 48.991 50.075 -27.035 1.00 28.96  ? 403 LEU A HG   1 
ATOM   2462 H  HD11 . LEU A 1 188 ? 49.709 51.461 -25.306 1.00 27.57  ? 403 LEU A HD11 1 
ATOM   2463 H  HD12 . LEU A 1 188 ? 49.084 52.329 -26.481 1.00 27.57  ? 403 LEU A HD12 1 
ATOM   2464 H  HD13 . LEU A 1 188 ? 48.239 52.046 -25.166 1.00 27.57  ? 403 LEU A HD13 1 
ATOM   2465 H  HD21 . LEU A 1 188 ? 48.981 49.260 -24.894 1.00 25.53  ? 403 LEU A HD21 1 
ATOM   2466 H  HD22 . LEU A 1 188 ? 47.486 49.764 -24.701 1.00 25.53  ? 403 LEU A HD22 1 
ATOM   2467 H  HD23 . LEU A 1 188 ? 47.805 48.595 -25.730 1.00 25.53  ? 403 LEU A HD23 1 
ATOM   2468 N  N    . GLU A 1 189 ? 44.792 50.150 -29.600 1.00 24.35  ? 404 GLU A N    1 
ATOM   2469 C  CA   . GLU A 1 189 ? 43.368 50.261 -29.941 1.00 39.29  ? 404 GLU A CA   1 
ATOM   2470 C  C    . GLU A 1 189 ? 42.703 48.865 -29.975 1.00 24.63  ? 404 GLU A C    1 
ATOM   2471 O  O    . GLU A 1 189 ? 41.488 48.780 -29.866 1.00 26.35  ? 404 GLU A O    1 
ATOM   2472 C  CB   . GLU A 1 189 ? 43.169 51.044 -31.270 1.00 51.06  ? 404 GLU A CB   1 
ATOM   2473 C  CG   . GLU A 1 189 ? 43.149 50.250 -32.579 1.00 69.00  ? 404 GLU A CG   1 
ATOM   2474 C  CD   . GLU A 1 189 ? 43.276 51.136 -33.867 1.00 71.79  ? 404 GLU A CD   1 
ATOM   2475 O  OE1  . GLU A 1 189 ? 44.005 50.725 -34.820 1.00 63.99  ? 404 GLU A OE1  1 
ATOM   2476 O  OE2  . GLU A 1 189 ? 42.645 52.225 -33.936 1.00 69.16  ? 404 GLU A OE2  1 
ATOM   2477 H  H    . GLU A 1 189 ? 45.337 50.394 -30.219 1.00 29.22  ? 404 GLU A H    1 
ATOM   2478 H  HA   . GLU A 1 189 ? 42.929 50.770 -29.241 1.00 47.14  ? 404 GLU A HA   1 
ATOM   2479 H  HB2  . GLU A 1 189 ? 42.324 51.516 -31.214 1.00 61.27  ? 404 GLU A HB2  1 
ATOM   2480 H  HB3  . GLU A 1 189 ? 43.888 51.691 -31.344 1.00 61.27  ? 404 GLU A HB3  1 
ATOM   2481 H  HG2  . GLU A 1 189 ? 43.890 49.625 -32.576 1.00 82.80  ? 404 GLU A HG2  1 
ATOM   2482 H  HG3  . GLU A 1 189 ? 42.311 49.765 -32.636 1.00 82.80  ? 404 GLU A HG3  1 
ATOM   2483 N  N    . ASN A 1 190 ? 43.491 47.787 -30.065 1.00 23.15  ? 405 ASN A N    1 
ATOM   2484 C  CA   . ASN A 1 190 ? 42.949 46.419 -30.035 1.00 28.74  ? 405 ASN A CA   1 
ATOM   2485 C  C    . ASN A 1 190 ? 42.946 45.758 -28.648 1.00 23.44  ? 405 ASN A C    1 
ATOM   2486 O  O    . ASN A 1 190 ? 42.756 44.554 -28.538 1.00 23.29  ? 405 ASN A O    1 
ATOM   2487 C  CB   . ASN A 1 190 ? 43.740 45.541 -31.012 1.00 23.35  ? 405 ASN A CB   1 
ATOM   2488 C  CG   . ASN A 1 190 ? 43.772 46.169 -32.381 1.00 28.47  ? 405 ASN A CG   1 
ATOM   2489 O  OD1  . ASN A 1 190 ? 42.772 46.162 -33.087 1.00 28.76  ? 405 ASN A OD1  1 
ATOM   2490 N  ND2  . ASN A 1 190 ? 44.847 46.866 -32.687 1.00 25.21  ? 405 ASN A ND2  1 
ATOM   2491 H  H    . ASN A 1 190 ? 44.346 47.819 -30.144 1.00 27.78  ? 405 ASN A H    1 
ATOM   2492 H  HA   . ASN A 1 190 ? 42.030 46.447 -30.346 1.00 34.48  ? 405 ASN A HA   1 
ATOM   2493 H  HB2  . ASN A 1 190 ? 44.652 45.448 -30.695 1.00 28.02  ? 405 ASN A HB2  1 
ATOM   2494 H  HB3  . ASN A 1 190 ? 43.315 44.672 -31.082 1.00 28.02  ? 405 ASN A HB3  1 
ATOM   2495 H  HD21 . ASN A 1 190 ? 44.910 47.242 -33.458 1.00 30.26  ? 405 ASN A HD21 1 
ATOM   2496 H  HD22 . ASN A 1 190 ? 45.485 46.945 -32.117 1.00 30.26  ? 405 ASN A HD22 1 
ATOM   2497 N  N    . PHE A 1 191 ? 43.166 46.546 -27.598 1.00 25.36  ? 406 PHE A N    1 
ATOM   2498 C  CA   . PHE A 1 191 ? 43.284 45.988 -26.254 1.00 24.43  ? 406 PHE A CA   1 
ATOM   2499 C  C    . PHE A 1 191 ? 42.348 46.697 -25.272 1.00 26.19  ? 406 PHE A C    1 
ATOM   2500 O  O    . PHE A 1 191 ? 42.216 47.954 -25.261 1.00 26.18  ? 406 PHE A O    1 
ATOM   2501 C  CB   . PHE A 1 191 ? 44.739 46.086 -25.769 1.00 29.61  ? 406 PHE A CB   1 
ATOM   2502 C  CG   . PHE A 1 191 ? 45.659 45.123 -26.444 1.00 39.66  ? 406 PHE A CG   1 
ATOM   2503 C  CD1  . PHE A 1 191 ? 45.898 43.869 -25.898 1.00 51.82  ? 406 PHE A CD1  1 
ATOM   2504 C  CD2  . PHE A 1 191 ? 46.305 45.465 -27.627 1.00 29.76  ? 406 PHE A CD2  1 
ATOM   2505 C  CE1  . PHE A 1 191 ? 46.769 42.967 -26.535 1.00 52.08  ? 406 PHE A CE1  1 
ATOM   2506 C  CE2  . PHE A 1 191 ? 47.175 44.585 -28.254 1.00 38.46  ? 406 PHE A CE2  1 
ATOM   2507 C  CZ   . PHE A 1 191 ? 47.405 43.334 -27.713 1.00 42.87  ? 406 PHE A CZ   1 
ATOM   2508 H  H    . PHE A 1 191 ? 43.251 47.401 -27.636 1.00 30.43  ? 406 PHE A H    1 
ATOM   2509 H  HA   . PHE A 1 191 ? 43.038 45.050 -26.278 1.00 29.32  ? 406 PHE A HA   1 
ATOM   2510 H  HB2  . PHE A 1 191 ? 45.067 46.983 -25.943 1.00 35.53  ? 406 PHE A HB2  1 
ATOM   2511 H  HB3  . PHE A 1 191 ? 44.766 45.905 -24.817 1.00 35.53  ? 406 PHE A HB3  1 
ATOM   2512 H  HD1  . PHE A 1 191 ? 45.474 43.621 -25.108 1.00 62.18  ? 406 PHE A HD1  1 
ATOM   2513 H  HD2  . PHE A 1 191 ? 46.159 46.305 -28.000 1.00 35.72  ? 406 PHE A HD2  1 
ATOM   2514 H  HE1  . PHE A 1 191 ? 46.924 42.128 -26.165 1.00 62.50  ? 406 PHE A HE1  1 
ATOM   2515 H  HE2  . PHE A 1 191 ? 47.594 44.833 -29.046 1.00 46.16  ? 406 PHE A HE2  1 
ATOM   2516 H  HZ   . PHE A 1 191 ? 47.982 42.741 -28.137 1.00 51.44  ? 406 PHE A HZ   1 
ATOM   2517 N  N    . THR A 1 192 ? 41.713 45.904 -24.427 1.00 19.54  ? 407 THR A N    1 
ATOM   2518 C  CA   . THR A 1 192 ? 40.855 46.461 -23.418 1.00 20.34  ? 407 THR A CA   1 
ATOM   2519 C  C    . THR A 1 192 ? 40.883 45.555 -22.204 1.00 20.17  ? 407 THR A C    1 
ATOM   2520 O  O    . THR A 1 192 ? 41.167 44.355 -22.300 1.00 19.34  ? 407 THR A O    1 
ATOM   2521 C  CB   . THR A 1 192 ? 39.413 46.656 -23.932 1.00 24.37  ? 407 THR A CB   1 
ATOM   2522 O  OG1  . THR A 1 192 ? 38.824 45.380 -24.148 1.00 28.80  ? 407 THR A OG1  1 
ATOM   2523 C  CG2  . THR A 1 192 ? 39.385 47.397 -25.241 1.00 31.19  ? 407 THR A CG2  1 
ATOM   2524 H  H    . THR A 1 192 ? 41.765 45.046 -24.421 1.00 23.45  ? 407 THR A H    1 
ATOM   2525 H  HA   . THR A 1 192 ? 41.199 47.328 -23.153 1.00 24.41  ? 407 THR A HA   1 
ATOM   2526 H  HB   . THR A 1 192 ? 38.894 47.152 -23.279 1.00 29.24  ? 407 THR A HB   1 
ATOM   2527 H  HG1  . THR A 1 192 ? 38.037 45.471 -24.428 1.00 34.56  ? 407 THR A HG1  1 
ATOM   2528 H  HG21 . THR A 1 192 ? 38.469 47.506 -25.541 1.00 37.43  ? 407 THR A HG21 1 
ATOM   2529 H  HG22 . THR A 1 192 ? 39.788 48.273 -25.134 1.00 37.43  ? 407 THR A HG22 1 
ATOM   2530 H  HG23 . THR A 1 192 ? 39.880 46.902 -25.913 1.00 37.43  ? 407 THR A HG23 1 
ATOM   2531 N  N    . ILE A 1 193 ? 40.635 46.168 -21.055 1.00 20.00  ? 408 ILE A N    1 
ATOM   2532 C  CA   . ILE A 1 193 ? 40.518 45.477 -19.800 1.00 19.92  ? 408 ILE A CA   1 
ATOM   2533 C  C    . ILE A 1 193 ? 39.135 45.703 -19.220 1.00 20.53  ? 408 ILE A C    1 
ATOM   2534 O  O    . ILE A 1 193 ? 38.598 46.779 -19.327 1.00 21.18  ? 408 ILE A O    1 
ATOM   2535 C  CB   . ILE A 1 193 ? 41.603 45.949 -18.849 1.00 23.27  ? 408 ILE A CB   1 
ATOM   2536 C  CG1  . ILE A 1 193 ? 42.956 45.527 -19.405 1.00 22.75  ? 408 ILE A CG1  1 
ATOM   2537 C  CG2  . ILE A 1 193 ? 41.359 45.410 -17.493 1.00 22.59  ? 408 ILE A CG2  1 
ATOM   2538 C  CD1  . ILE A 1 193 ? 44.152 45.898 -18.549 1.00 30.48  ? 408 ILE A CD1  1 
ATOM   2539 H  H    . ILE A 1 193 ? 40.529 47.018 -20.985 1.00 24.00  ? 408 ILE A H    1 
ATOM   2540 H  HA   . ILE A 1 193 ? 40.635 44.526 -19.947 1.00 23.90  ? 408 ILE A HA   1 
ATOM   2541 H  HB   . ILE A 1 193 ? 41.576 46.918 -18.806 1.00 27.93  ? 408 ILE A HB   1 
ATOM   2542 H  HG12 . ILE A 1 193 ? 42.959 44.562 -19.508 1.00 27.30  ? 408 ILE A HG12 1 
ATOM   2543 H  HG13 . ILE A 1 193 ? 43.077 45.946 -20.272 1.00 27.30  ? 408 ILE A HG13 1 
ATOM   2544 H  HG21 . ILE A 1 193 ? 42.060 45.721 -16.900 1.00 27.11  ? 408 ILE A HG21 1 
ATOM   2545 H  HG22 . ILE A 1 193 ? 40.496 45.723 -17.180 1.00 27.11  ? 408 ILE A HG22 1 
ATOM   2546 H  HG23 . ILE A 1 193 ? 41.365 44.441 -17.534 1.00 27.11  ? 408 ILE A HG23 1 
ATOM   2547 H  HD11 . ILE A 1 193 ? 44.961 45.588 -18.985 1.00 36.58  ? 408 ILE A HD11 1 
ATOM   2548 H  HD12 . ILE A 1 193 ? 44.179 46.862 -18.446 1.00 36.58  ? 408 ILE A HD12 1 
ATOM   2549 H  HD13 . ILE A 1 193 ? 44.061 45.475 -17.680 1.00 36.58  ? 408 ILE A HD13 1 
ATOM   2550 N  N    . LEU A 1 194 ? 38.595 44.682 -18.587 1.00 20.52  ? 409 LEU A N    1 
ATOM   2551 C  CA   . LEU A 1 194 ? 37.309 44.725 -17.896 1.00 23.73  ? 409 LEU A CA   1 
ATOM   2552 C  C    . LEU A 1 194 ? 37.530 44.240 -16.515 1.00 21.34  ? 409 LEU A C    1 
ATOM   2553 O  O    . LEU A 1 194 ? 38.108 43.186 -16.332 1.00 20.82  ? 409 LEU A O    1 
ATOM   2554 C  CB   . LEU A 1 194 ? 36.279 43.844 -18.575 1.00 22.64  ? 409 LEU A CB   1 
ATOM   2555 C  CG   . LEU A 1 194 ? 34.833 43.955 -18.102 1.00 28.26  ? 409 LEU A CG   1 
ATOM   2556 C  CD1  . LEU A 1 194 ? 34.225 45.325 -18.372 1.00 42.06  ? 409 LEU A CD1  1 
ATOM   2557 C  CD2  . LEU A 1 194 ? 34.042 42.841 -18.810 1.00 48.33  ? 409 LEU A CD2  1 
ATOM   2558 H  H    . LEU A 1 194 ? 38.971 43.910 -18.538 1.00 24.63  ? 409 LEU A H    1 
ATOM   2559 H  HA   . LEU A 1 194 ? 36.977 45.636 -17.864 1.00 28.47  ? 409 LEU A HA   1 
ATOM   2560 H  HB2  . LEU A 1 194 ? 36.285 44.052 -19.523 1.00 27.17  ? 409 LEU A HB2  1 
ATOM   2561 H  HB3  . LEU A 1 194 ? 36.548 42.920 -18.452 1.00 27.17  ? 409 LEU A HB3  1 
ATOM   2562 H  HG   . LEU A 1 194 ? 34.797 43.792 -17.147 1.00 33.91  ? 409 LEU A HG   1 
ATOM   2563 H  HD11 . LEU A 1 194 ? 33.310 45.333 -18.050 1.00 50.47  ? 409 LEU A HD11 1 
ATOM   2564 H  HD12 . LEU A 1 194 ? 34.746 45.998 -17.907 1.00 50.47  ? 409 LEU A HD12 1 
ATOM   2565 H  HD13 . LEU A 1 194 ? 34.242 45.495 -19.327 1.00 50.47  ? 409 LEU A HD13 1 
ATOM   2566 H  HD21 . LEU A 1 194 ? 33.115 42.885 -18.529 1.00 57.99  ? 409 LEU A HD21 1 
ATOM   2567 H  HD22 . LEU A 1 194 ? 34.104 42.971 -19.769 1.00 57.99  ? 409 LEU A HD22 1 
ATOM   2568 H  HD23 . LEU A 1 194 ? 34.421 41.982 -18.567 1.00 57.99  ? 409 LEU A HD23 1 
ATOM   2569 N  N    . GLN A 1 195 ? 37.088 45.015 -15.546 1.00 22.47  ? 410 GLN A N    1 
ATOM   2570 C  CA   . GLN A 1 195 ? 37.126 44.629 -14.140 1.00 22.79  ? 410 GLN A CA   1 
ATOM   2571 C  C    . GLN A 1 195 ? 35.714 44.588 -13.573 1.00 22.73  ? 410 GLN A C    1 
ATOM   2572 O  O    . GLN A 1 195 ? 34.997 45.582 -13.645 1.00 23.51  ? 410 GLN A O    1 
ATOM   2573 C  CB   . GLN A 1 195 ? 37.930 45.622 -13.343 1.00 26.12  ? 410 GLN A CB   1 
ATOM   2574 C  CG   . GLN A 1 195 ? 39.400 45.407 -13.317 1.00 46.44  ? 410 GLN A CG   1 
ATOM   2575 C  CD   . GLN A 1 195 ? 39.964 46.047 -12.090 1.00 54.04  ? 410 GLN A CD   1 
ATOM   2576 O  OE1  . GLN A 1 195 ? 39.755 47.235 -11.857 1.00 36.04  ? 410 GLN A OE1  1 
ATOM   2577 N  NE2  . GLN A 1 195 ? 40.617 45.258 -11.256 1.00 60.00  ? 410 GLN A NE2  1 
ATOM   2578 H  H    . GLN A 1 195 ? 36.750 45.795 -15.677 1.00 26.97  ? 410 GLN A H    1 
ATOM   2579 H  HA   . GLN A 1 195 ? 37.529 43.751 -14.048 1.00 27.34  ? 410 GLN A HA   1 
ATOM   2580 H  HB2  . GLN A 1 195 ? 37.775 46.505 -13.712 1.00 31.35  ? 410 GLN A HB2  1 
ATOM   2581 H  HB3  . GLN A 1 195 ? 37.619 45.598 -12.424 1.00 31.35  ? 410 GLN A HB3  1 
ATOM   2582 H  HG2  . GLN A 1 195 ? 39.592 44.457 -13.289 1.00 55.73  ? 410 GLN A HG2  1 
ATOM   2583 H  HG3  . GLN A 1 195 ? 39.805 45.817 -14.097 1.00 55.73  ? 410 GLN A HG3  1 
ATOM   2584 H  HE21 . GLN A 1 195 ? 40.699 44.420 -11.433 1.00 72.00  ? 410 GLN A HE21 1 
ATOM   2585 H  HE22 . GLN A 1 195 ? 40.959 45.581 -10.537 1.00 72.00  ? 410 GLN A HE22 1 
ATOM   2586 N  N    . VAL A 1 196 ? 35.334 43.445 -13.028 1.00 22.79  ? 411 VAL A N    1 
ATOM   2587 C  CA   . VAL A 1 196 ? 34.017 43.231 -12.480 1.00 23.72  ? 411 VAL A CA   1 
ATOM   2588 C  C    . VAL A 1 196 ? 34.162 42.925 -10.985 1.00 23.91  ? 411 VAL A C    1 
ATOM   2589 O  O    . VAL A 1 196 ? 34.800 41.947 -10.615 1.00 23.53  ? 411 VAL A O    1 
ATOM   2590 C  CB   . VAL A 1 196 ? 33.284 42.079 -13.180 1.00 24.12  ? 411 VAL A CB   1 
ATOM   2591 C  CG1  . VAL A 1 196 ? 31.940 41.917 -12.570 1.00 25.21  ? 411 VAL A CG1  1 
ATOM   2592 C  CG2  . VAL A 1 196 ? 33.193 42.319 -14.682 1.00 25.54  ? 411 VAL A CG2  1 
ATOM   2593 H  H    . VAL A 1 196 ? 35.845 42.756 -12.964 1.00 27.35  ? 411 VAL A H    1 
ATOM   2594 H  HA   . VAL A 1 196 ? 33.489 44.039 -12.580 1.00 28.46  ? 411 VAL A HA   1 
ATOM   2595 H  HB   . VAL A 1 196 ? 33.779 41.257 -13.037 1.00 28.95  ? 411 VAL A HB   1 
ATOM   2596 H  HG11 . VAL A 1 196 ? 31.478 41.188 -13.014 1.00 30.25  ? 411 VAL A HG11 1 
ATOM   2597 H  HG12 . VAL A 1 196 ? 32.044 41.717 -11.626 1.00 30.25  ? 411 VAL A HG12 1 
ATOM   2598 H  HG13 . VAL A 1 196 ? 31.442 42.741 -12.681 1.00 30.25  ? 411 VAL A HG13 1 
ATOM   2599 H  HG21 . VAL A 1 196 ? 32.725 41.575 -15.093 1.00 30.65  ? 411 VAL A HG21 1 
ATOM   2600 H  HG22 . VAL A 1 196 ? 32.707 43.144 -14.841 1.00 30.65  ? 411 VAL A HG22 1 
ATOM   2601 H  HG23 . VAL A 1 196 ? 34.089 42.388 -15.045 1.00 30.65  ? 411 VAL A HG23 1 
ATOM   2602 N  N    . VAL A 1 197 ? 33.565 43.759 -10.151 1.00 24.71  ? 412 VAL A N    1 
ATOM   2603 C  CA   . VAL A 1 197 ? 33.602 43.571 -8.715  1.00 25.08  ? 412 VAL A CA   1 
ATOM   2604 C  C    . VAL A 1 197 ? 32.193 43.209 -8.227  1.00 26.15  ? 412 VAL A C    1 
ATOM   2605 O  O    . VAL A 1 197 ? 31.194 43.869 -8.565  1.00 27.03  ? 412 VAL A O    1 
ATOM   2606 C  CB   . VAL A 1 197 ? 34.146 44.803 -8.038  1.00 25.38  ? 412 VAL A CB   1 
ATOM   2607 C  CG1  . VAL A 1 197 ? 34.262 44.582 -6.551  1.00 26.03  ? 412 VAL A CG1  1 
ATOM   2608 C  CG2  . VAL A 1 197 ? 35.488 45.091 -8.586  1.00 24.70  ? 412 VAL A CG2  1 
ATOM   2609 H  H    . VAL A 1 197 ? 33.125 44.454 -10.398 1.00 29.65  ? 412 VAL A H    1 
ATOM   2610 H  HA   . VAL A 1 197 ? 34.192 42.829 -8.508  1.00 30.09  ? 412 VAL A HA   1 
ATOM   2611 H  HB   . VAL A 1 197 ? 33.565 45.561 -8.204  1.00 30.45  ? 412 VAL A HB   1 
ATOM   2612 H  HG11 . VAL A 1 197 ? 34.614 45.387 -6.139  1.00 31.24  ? 412 VAL A HG11 1 
ATOM   2613 H  HG12 . VAL A 1 197 ? 33.383 44.383 -6.192  1.00 31.24  ? 412 VAL A HG12 1 
ATOM   2614 H  HG13 . VAL A 1 197 ? 34.863 43.838 -6.388  1.00 31.24  ? 412 VAL A HG13 1 
ATOM   2615 H  HG21 . VAL A 1 197 ? 35.842 45.883 -8.153  1.00 29.64  ? 412 VAL A HG21 1 
ATOM   2616 H  HG22 . VAL A 1 197 ? 36.068 44.332 -8.414  1.00 29.64  ? 412 VAL A HG22 1 
ATOM   2617 H  HG23 . VAL A 1 197 ? 35.413 45.241 -9.541  1.00 29.64  ? 412 VAL A HG23 1 
ATOM   2618 N  N    . THR A 1 198 ? 32.138 42.113 -7.499  1.00 26.24  ? 413 THR A N    1 
ATOM   2619 C  CA   . THR A 1 198 ? 30.897 41.505 -7.045  1.00 30.86  ? 413 THR A CA   1 
ATOM   2620 C  C    . THR A 1 198 ? 31.010 41.174 -5.569  1.00 31.60  ? 413 THR A C    1 
ATOM   2621 O  O    . THR A 1 198 ? 32.072 40.777 -5.082  1.00 27.11  ? 413 THR A O    1 
ATOM   2622 C  CB   . THR A 1 198 ? 30.586 40.201 -7.753  1.00 27.41  ? 413 THR A CB   1 
ATOM   2623 O  OG1  . THR A 1 198 ? 31.674 39.328 -7.494  1.00 36.70  ? 413 THR A OG1  1 
ATOM   2624 C  CG2  . THR A 1 198 ? 30.470 40.397 -9.245  1.00 28.27  ? 413 THR A CG2  1 
ATOM   2625 H  H    . THR A 1 198 ? 32.836 41.682 -7.241  1.00 31.49  ? 413 THR A H    1 
ATOM   2626 H  HA   . THR A 1 198 ? 30.159 42.120 -7.176  1.00 37.04  ? 413 THR A HA   1 
ATOM   2627 H  HB   . THR A 1 198 ? 29.760 39.820 -7.413  1.00 32.89  ? 413 THR A HB   1 
ATOM   2628 H  HG1  . THR A 1 198 ? 31.545 38.587 -7.868  1.00 44.04  ? 413 THR A HG1  1 
ATOM   2629 H  HG21 . THR A 1 198 ? 30.271 39.551 -9.676  1.00 33.92  ? 413 THR A HG21 1 
ATOM   2630 H  HG22 . THR A 1 198 ? 29.759 41.027 -9.442  1.00 33.92  ? 413 THR A HG22 1 
ATOM   2631 H  HG23 . THR A 1 198 ? 31.304 40.743 -9.599  1.00 33.92  ? 413 THR A HG23 1 
ATOM   2632 N  N    . ASN A 1 199 ? 29.891 41.322 -4.880  1.00 37.61  ? 414 ASN A N    1 
ATOM   2633 C  CA   . ASN A 1 199 ? 29.741 40.843 -3.523  1.00 35.65  ? 414 ASN A CA   1 
ATOM   2634 C  C    . ASN A 1 199 ? 29.753 39.310 -3.552  1.00 30.85  ? 414 ASN A C    1 
ATOM   2635 O  O    . ASN A 1 199 ? 28.851 38.671 -4.063  1.00 39.05  ? 414 ASN A O    1 
ATOM   2636 C  CB   . ASN A 1 199 ? 28.445 41.389 -2.932  1.00 32.13  ? 414 ASN A CB   1 
ATOM   2637 C  CG   . ASN A 1 199 ? 28.198 40.926 -1.513  1.00 33.32  ? 414 ASN A CG   1 
ATOM   2638 O  OD1  . ASN A 1 199 ? 28.300 39.741 -1.193  1.00 38.59  ? 414 ASN A OD1  1 
ATOM   2639 N  ND2  . ASN A 1 199 ? 27.857 41.864 -0.656  1.00 36.91  ? 414 ASN A ND2  1 
ATOM   2640 H  H    . ASN A 1 199 ? 29.187 41.707 -5.188  1.00 45.13  ? 414 ASN A H    1 
ATOM   2641 H  HA   . ASN A 1 199 ? 30.485 41.151 -2.982  1.00 42.78  ? 414 ASN A HA   1 
ATOM   2642 H  HB2  . ASN A 1 199 ? 28.485 42.358 -2.928  1.00 38.56  ? 414 ASN A HB2  1 
ATOM   2643 H  HB3  . ASN A 1 199 ? 27.701 41.091 -3.478  1.00 38.56  ? 414 ASN A HB3  1 
ATOM   2644 H  HD21 . ASN A 1 199 ? 27.704 41.661 0.166   1.00 44.29  ? 414 ASN A HD21 1 
ATOM   2645 H  HD22 . ASN A 1 199 ? 27.788 42.680 -0.917  1.00 44.29  ? 414 ASN A HD22 1 
ATOM   2646 N  N    . ARG A 1 200 ? 30.773 38.711 -3.004  1.00 35.72  ? 415 ARG A N    1 
ATOM   2647 C  CA   . ARG A 1 200 ? 30.920 37.275 -3.171  1.00 42.65  ? 415 ARG A CA   1 
ATOM   2648 C  C    . ARG A 1 200 ? 29.806 36.475 -2.508  1.00 40.22  ? 415 ARG A C    1 
ATOM   2649 O  O    . ARG A 1 200 ? 29.388 35.457 -3.031  1.00 44.84  ? 415 ARG A O    1 
ATOM   2650 C  CB   . ARG A 1 200 ? 32.259 36.848 -2.630  1.00 44.68  ? 415 ARG A CB   1 
ATOM   2651 C  CG   . ARG A 1 200 ? 32.436 35.365 -2.471  1.00 54.37  ? 415 ARG A CG   1 
ATOM   2652 C  CD   . ARG A 1 200 ? 33.714 35.162 -1.730  1.00 53.72  ? 415 ARG A CD   1 
ATOM   2653 N  NE   . ARG A 1 200 ? 33.798 33.884 -1.028  1.00 59.74  ? 415 ARG A NE   1 
ATOM   2654 C  CZ   . ARG A 1 200 ? 33.530 33.696 0.262   1.00 67.83  ? 415 ARG A CZ   1 
ATOM   2655 N  NH1  . ARG A 1 200 ? 33.097 34.708 1.033   1.00 48.47  ? 415 ARG A NH1  1 
ATOM   2656 N  NH2  . ARG A 1 200 ? 33.671 32.465 0.769   1.00 77.20  ? 415 ARG A NH2  1 
ATOM   2657 H  H    . ARG A 1 200 ? 31.387 39.093 -2.538  1.00 42.86  ? 415 ARG A H    1 
ATOM   2658 H  HA   . ARG A 1 200 ? 30.906 37.070 -4.119  1.00 51.18  ? 415 ARG A HA   1 
ATOM   2659 H  HB2  . ARG A 1 200 ? 32.950 37.161 -3.234  1.00 53.62  ? 415 ARG A HB2  1 
ATOM   2660 H  HB3  . ARG A 1 200 ? 32.382 37.252 -1.757  1.00 53.62  ? 415 ARG A HB3  1 
ATOM   2661 H  HG2  . ARG A 1 200 ? 31.705 34.994 -1.952  1.00 65.25  ? 415 ARG A HG2  1 
ATOM   2662 H  HG3  . ARG A 1 200 ? 32.501 34.940 -3.340  1.00 65.25  ? 415 ARG A HG3  1 
ATOM   2663 H  HD2  . ARG A 1 200 ? 34.450 35.202 -2.361  1.00 64.46  ? 415 ARG A HD2  1 
ATOM   2664 H  HD3  . ARG A 1 200 ? 33.808 35.868 -1.071  1.00 64.46  ? 415 ARG A HD3  1 
ATOM   2665 H  HE   . ARG A 1 200 ? 34.040 33.197 -1.485  1.00 71.69  ? 415 ARG A HE   1 
ATOM   2666 H  HH11 . ARG A 1 200 ? 33.012 35.496 0.700   1.00 58.16  ? 415 ARG A HH11 1 
ATOM   2667 H  HH12 . ARG A 1 200 ? 32.920 34.571 1.863   1.00 58.16  ? 415 ARG A HH12 1 
ATOM   2668 H  HH21 . ARG A 1 200 ? 33.939 31.821 0.266   1.00 92.64  ? 415 ARG A HH21 1 
ATOM   2669 H  HH22 . ARG A 1 200 ? 33.489 32.318 1.597   1.00 92.64  ? 415 ARG A HH22 1 
ATOM   2670 N  N    . ASP A 1 201 ? 29.308 36.931 -1.370  1.00 38.65  ? 416 ASP A N    1 
ATOM   2671 C  CA   . ASP A 1 201 ? 28.313 36.153 -0.677  1.00 42.04  ? 416 ASP A CA   1 
ATOM   2672 C  C    . ASP A 1 201 ? 26.920 36.253 -1.319  1.00 49.29  ? 416 ASP A C    1 
ATOM   2673 O  O    . ASP A 1 201 ? 26.054 35.425 -1.070  1.00 53.68  ? 416 ASP A O    1 
ATOM   2674 C  CB   . ASP A 1 201 ? 28.273 36.581 0.792   1.00 44.68  ? 416 ASP A CB   1 
ATOM   2675 C  CG   . ASP A 1 201 ? 29.615 36.366 1.493   1.00 51.56  ? 416 ASP A CG   1 
ATOM   2676 O  OD1  . ASP A 1 201 ? 30.003 37.224 2.316   1.00 61.61  ? 416 ASP A OD1  1 
ATOM   2677 O  OD2  . ASP A 1 201 ? 30.301 35.347 1.205   1.00 43.41  ? 416 ASP A OD2  1 
ATOM   2678 H  H    . ASP A 1 201 ? 29.526 37.670 -0.989  1.00 46.38  ? 416 ASP A H    1 
ATOM   2679 H  HA   . ASP A 1 201 ? 28.579 35.220 -0.703  1.00 50.45  ? 416 ASP A HA   1 
ATOM   2680 H  HB2  . ASP A 1 201 ? 28.054 37.524 0.842   1.00 53.61  ? 416 ASP A HB2  1 
ATOM   2681 H  HB3  . ASP A 1 201 ? 27.602 36.057 1.257   1.00 53.61  ? 416 ASP A HB3  1 
ATOM   2682 N  N    . THR A 1 202 ? 26.697 37.245 -2.162  1.00 38.22  ? 417 THR A N    1 
ATOM   2683 C  CA   . THR A 1 202 ? 25.379 37.401 -2.754  1.00 36.63  ? 417 THR A CA   1 
ATOM   2684 C  C    . THR A 1 202 ? 25.427 37.352 -4.257  1.00 41.02  ? 417 THR A C    1 
ATOM   2685 O  O    . THR A 1 202 ? 24.397 37.168 -4.898  1.00 43.03  ? 417 THR A O    1 
ATOM   2686 C  CB   . THR A 1 202 ? 24.734 38.719 -2.362  1.00 44.81  ? 417 THR A CB   1 
ATOM   2687 O  OG1  . THR A 1 202 ? 25.588 39.815 -2.740  1.00 36.88  ? 417 THR A OG1  1 
ATOM   2688 C  CG2  . THR A 1 202 ? 24.476 38.734 -0.879  1.00 39.41  ? 417 THR A CG2  1 
ATOM   2689 H  H    . THR A 1 202 ? 27.277 37.831 -2.407  1.00 45.86  ? 417 THR A H    1 
ATOM   2690 H  HA   . THR A 1 202 ? 24.806 36.681 -2.446  1.00 43.95  ? 417 THR A HA   1 
ATOM   2691 H  HB   . THR A 1 202 ? 23.882 38.805 -2.819  1.00 53.77  ? 417 THR A HB   1 
ATOM   2692 H  HG1  . THR A 1 202 ? 25.232 40.545 -2.524  1.00 44.26  ? 417 THR A HG1  1 
ATOM   2693 H  HG21 . THR A 1 202 ? 24.063 39.574 -0.623  1.00 47.29  ? 417 THR A HG21 1 
ATOM   2694 H  HG22 . THR A 1 202 ? 23.882 38.005 -0.639  1.00 47.29  ? 417 THR A HG22 1 
ATOM   2695 H  HG23 . THR A 1 202 ? 25.311 38.633 -0.397  1.00 47.29  ? 417 THR A HG23 1 
ATOM   2696 N  N    . GLN A 1 203 ? 26.618 37.571 -4.802  1.00 40.79  ? 418 GLN A N    1 
ATOM   2697 C  CA   . GLN A 1 203 ? 26.859 37.530 -6.237  1.00 38.04  ? 418 GLN A CA   1 
ATOM   2698 C  C    . GLN A 1 203 ? 26.238 38.756 -6.934  1.00 39.41  ? 418 GLN A C    1 
ATOM   2699 O  O    . GLN A 1 203 ? 26.169 38.824 -8.158  1.00 43.76  ? 418 GLN A O    1 
ATOM   2700 C  CB   . GLN A 1 203 ? 26.351 36.199 -6.799  1.00 49.28  ? 418 GLN A CB   1 
ATOM   2701 C  CG   . GLN A 1 203 ? 26.997 34.967 -6.112  1.00 50.71  ? 418 GLN A CG   1 
ATOM   2702 C  CD   . GLN A 1 203 ? 27.231 33.797 -7.068  1.00 71.72  ? 418 GLN A CD   1 
ATOM   2703 O  OE1  . GLN A 1 203 ? 27.456 33.996 -8.268  1.00 78.23  ? 418 GLN A OE1  1 
ATOM   2704 N  NE2  . GLN A 1 203 ? 27.191 32.568 -6.535  1.00 72.42  ? 418 GLN A NE2  1 
ATOM   2705 H  H    . GLN A 1 203 ? 27.324 37.751 -4.345  1.00 48.95  ? 418 GLN A H    1 
ATOM   2706 H  HA   . GLN A 1 203 ? 27.817 37.563 -6.389  1.00 45.65  ? 418 GLN A HA   1 
ATOM   2707 H  HB2  . GLN A 1 203 ? 25.391 36.146 -6.666  1.00 59.14  ? 418 GLN A HB2  1 
ATOM   2708 H  HB3  . GLN A 1 203 ? 26.558 36.157 -7.745  1.00 59.14  ? 418 GLN A HB3  1 
ATOM   2709 H  HG2  . GLN A 1 203 ? 27.855 35.227 -5.743  1.00 60.86  ? 418 GLN A HG2  1 
ATOM   2710 H  HG3  . GLN A 1 203 ? 26.411 34.660 -5.402  1.00 60.86  ? 418 GLN A HG3  1 
ATOM   2711 H  HE21 . GLN A 1 203 ? 27.039 32.468 -5.694  1.00 86.91  ? 418 GLN A HE21 1 
ATOM   2712 H  HE22 . GLN A 1 203 ? 27.317 31.878 -7.034  1.00 86.91  ? 418 GLN A HE22 1 
ATOM   2713 N  N    . GLU A 1 204 ? 25.832 39.745 -6.137  1.00 40.59  ? 419 GLU A N    1 
ATOM   2714 C  CA   . GLU A 1 204 ? 25.512 41.070 -6.643  1.00 44.51  ? 419 GLU A CA   1 
ATOM   2715 C  C    . GLU A 1 204 ? 26.730 41.759 -7.226  1.00 34.52  ? 419 GLU A C    1 
ATOM   2716 O  O    . GLU A 1 204 ? 27.792 41.775 -6.615  1.00 36.12  ? 419 GLU A O    1 
ATOM   2717 C  CB   . GLU A 1 204 ? 24.958 41.965 -5.538  1.00 45.15  ? 419 GLU A CB   1 
ATOM   2718 C  CG   . GLU A 1 204 ? 23.514 41.749 -5.204  1.00 58.63  ? 419 GLU A CG   1 
ATOM   2719 C  CD   . GLU A 1 204 ? 23.187 42.249 -3.804  1.00 59.09  ? 419 GLU A CD   1 
ATOM   2720 O  OE1  . GLU A 1 204 ? 24.090 42.238 -2.934  1.00 57.26  ? 419 GLU A OE1  1 
ATOM   2721 O  OE2  . GLU A 1 204 ? 22.033 42.667 -3.581  1.00 83.50  ? 419 GLU A OE2  1 
ATOM   2722 H  H    . GLU A 1 204 ? 25.734 39.667 -5.286  1.00 48.71  ? 419 GLU A H    1 
ATOM   2723 H  HA   . GLU A 1 204 ? 24.841 40.994 -7.340  1.00 53.42  ? 419 GLU A HA   1 
ATOM   2724 H  HB2  . GLU A 1 204 ? 25.472 41.809 -4.730  1.00 54.18  ? 419 GLU A HB2  1 
ATOM   2725 H  HB3  . GLU A 1 204 ? 25.059 42.890 -5.813  1.00 54.18  ? 419 GLU A HB3  1 
ATOM   2726 H  HG2  . GLU A 1 204 ? 22.963 42.234 -5.838  1.00 70.35  ? 419 GLU A HG2  1 
ATOM   2727 H  HG3  . GLU A 1 204 ? 23.316 40.800 -5.243  1.00 70.35  ? 419 GLU A HG3  1 
ATOM   2728 N  N    . LEU A 1 205 ? 26.530 42.379 -8.373  1.00 31.73  ? 420 LEU A N    1 
ATOM   2729 C  CA   . LEU A 1 205 ? 27.565 43.124 -9.079  1.00 32.70  ? 420 LEU A CA   1 
ATOM   2730 C  C    . LEU A 1 205 ? 27.643 44.487 -8.463  1.00 30.94  ? 420 LEU A C    1 
ATOM   2731 O  O    . LEU A 1 205 ? 26.635 45.101 -8.317  1.00 38.20  ? 420 LEU A O    1 
ATOM   2732 C  CB   . LEU A 1 205 ? 27.228 43.247 -10.562 1.00 33.25  ? 420 LEU A CB   1 
ATOM   2733 C  CG   . LEU A 1 205 ? 28.164 44.132 -11.395 1.00 34.61  ? 420 LEU A CG   1 
ATOM   2734 C  CD1  . LEU A 1 205 ? 28.918 43.229 -12.299 1.00 46.64  ? 420 LEU A CD1  1 
ATOM   2735 C  CD2  . LEU A 1 205 ? 27.419 45.143 -12.194 1.00 40.38  ? 420 LEU A CD2  1 
ATOM   2736 H  H    . LEU A 1 205 ? 25.774 42.384 -8.782  1.00 38.08  ? 420 LEU A H    1 
ATOM   2737 H  HA   . LEU A 1 205 ? 28.422 42.681 -8.982  1.00 39.24  ? 420 LEU A HA   1 
ATOM   2738 H  HB2  . LEU A 1 205 ? 27.246 42.360 -10.954 1.00 39.90  ? 420 LEU A HB2  1 
ATOM   2739 H  HB3  . LEU A 1 205 ? 26.335 43.616 -10.642 1.00 39.90  ? 420 LEU A HB3  1 
ATOM   2740 H  HG   . LEU A 1 205 ? 28.791 44.590 -10.813 1.00 41.54  ? 420 LEU A HG   1 
ATOM   2741 H  HD11 . LEU A 1 205 ? 29.522 43.759 -12.842 1.00 55.97  ? 420 LEU A HD11 1 
ATOM   2742 H  HD12 . LEU A 1 205 ? 29.422 42.597 -11.764 1.00 55.97  ? 420 LEU A HD12 1 
ATOM   2743 H  HD13 . LEU A 1 205 ? 28.290 42.756 -12.867 1.00 55.97  ? 420 LEU A HD13 1 
ATOM   2744 H  HD21 . LEU A 1 205 ? 28.054 45.674 -12.700 1.00 48.45  ? 420 LEU A HD21 1 
ATOM   2745 H  HD22 . LEU A 1 205 ? 26.815 44.684 -12.798 1.00 48.45  ? 420 LEU A HD22 1 
ATOM   2746 H  HD23 . LEU A 1 205 ? 26.916 45.713 -11.592 1.00 48.45  ? 420 LEU A HD23 1 
ATOM   2747 N  N    . LEU A 1 206 ? 28.811 44.953 -8.063  1.00 30.74  ? 421 LEU A N    1 
ATOM   2748 C  CA   . LEU A 1 206 ? 28.905 46.258 -7.397  1.00 30.98  ? 421 LEU A CA   1 
ATOM   2749 C  C    . LEU A 1 206 ? 29.529 47.270 -8.303  1.00 32.48  ? 421 LEU A C    1 
ATOM   2750 O  O    . LEU A 1 206 ? 29.237 48.430 -8.198  1.00 32.39  ? 421 LEU A O    1 
ATOM   2751 C  CB   . LEU A 1 206 ? 29.738 46.152 -6.105  1.00 31.99  ? 421 LEU A CB   1 
ATOM   2752 C  CG   . LEU A 1 206 ? 29.278 45.069 -5.118  1.00 37.22  ? 421 LEU A CG   1 
ATOM   2753 C  CD1  . LEU A 1 206 ? 30.313 44.752 -4.030  1.00 30.88  ? 421 LEU A CD1  1 
ATOM   2754 C  CD2  . LEU A 1 206 ? 28.007 45.529 -4.510  1.00 38.19  ? 421 LEU A CD2  1 
ATOM   2755 H  H    . LEU A 1 206 ? 29.562 44.545 -8.159  1.00 36.89  ? 421 LEU A H    1 
ATOM   2756 H  HA   . LEU A 1 206 ? 28.015 46.565 -7.163  1.00 37.17  ? 421 LEU A HA   1 
ATOM   2757 H  HB2  . LEU A 1 206 ? 30.656 45.955 -6.347  1.00 38.39  ? 421 LEU A HB2  1 
ATOM   2758 H  HB3  . LEU A 1 206 ? 29.699 47.004 -5.643  1.00 38.39  ? 421 LEU A HB3  1 
ATOM   2759 H  HG   . LEU A 1 206 ? 29.097 44.251 -5.608  1.00 44.66  ? 421 LEU A HG   1 
ATOM   2760 H  HD11 . LEU A 1 206 ? 29.957 44.064 -3.447  1.00 37.06  ? 421 LEU A HD11 1 
ATOM   2761 H  HD12 . LEU A 1 206 ? 31.128 44.439 -4.452  1.00 37.06  ? 421 LEU A HD12 1 
ATOM   2762 H  HD13 . LEU A 1 206 ? 30.492 45.558 -3.521  1.00 37.06  ? 421 LEU A HD13 1 
ATOM   2763 H  HD21 . LEU A 1 206 ? 27.697 44.859 -3.881  1.00 45.83  ? 421 LEU A HD21 1 
ATOM   2764 H  HD22 . LEU A 1 206 ? 28.164 46.368 -4.049  1.00 45.83  ? 421 LEU A HD22 1 
ATOM   2765 H  HD23 . LEU A 1 206 ? 27.349 45.655 -5.211  1.00 45.83  ? 421 LEU A HD23 1 
ATOM   2766 N  N    . LEU A 1 207 ? 30.456 46.813 -9.146  1.00 28.95  ? 422 LEU A N    1 
ATOM   2767 C  CA   . LEU A 1 207 ? 31.196 47.672 -10.071 1.00 31.10  ? 422 LEU A CA   1 
ATOM   2768 C  C    . LEU A 1 207 ? 31.628 46.885 -11.301 1.00 27.32  ? 422 LEU A C    1 
ATOM   2769 O  O    . LEU A 1 207 ? 32.131 45.763 -11.188 1.00 26.29  ? 422 LEU A O    1 
ATOM   2770 C  CB   . LEU A 1 207 ? 32.439 48.250 -9.409  1.00 30.05  ? 422 LEU A CB   1 
ATOM   2771 C  CG   . LEU A 1 207 ? 32.374 49.578 -8.677  1.00 45.94  ? 422 LEU A CG   1 
ATOM   2772 C  CD1  . LEU A 1 207 ? 33.731 49.892 -8.097  1.00 53.54  ? 422 LEU A CD1  1 
ATOM   2773 C  CD2  . LEU A 1 207 ? 31.934 50.698 -9.606  1.00 59.95  ? 422 LEU A CD2  1 
ATOM   2774 H  H    . LEU A 1 207 ? 30.680 45.985 -9.201  1.00 34.74  ? 422 LEU A H    1 
ATOM   2775 H  HA   . LEU A 1 207 ? 30.630 48.406 -10.357 1.00 37.32  ? 422 LEU A HA   1 
ATOM   2776 H  HB2  . LEU A 1 207 ? 32.751 47.597 -8.763  1.00 36.06  ? 422 LEU A HB2  1 
ATOM   2777 H  HB3  . LEU A 1 207 ? 33.113 48.350 -10.099 1.00 36.06  ? 422 LEU A HB3  1 
ATOM   2778 H  HG   . LEU A 1 207 ? 31.736 49.515 -7.949  1.00 55.13  ? 422 LEU A HG   1 
ATOM   2779 H  HD11 . LEU A 1 207 ? 33.685 50.741 -7.631  1.00 64.25  ? 422 LEU A HD11 1 
ATOM   2780 H  HD12 . LEU A 1 207 ? 33.980 49.188 -7.479  1.00 64.25  ? 422 LEU A HD12 1 
ATOM   2781 H  HD13 . LEU A 1 207 ? 34.378 49.945 -8.818  1.00 64.25  ? 422 LEU A HD13 1 
ATOM   2782 H  HD21 . LEU A 1 207 ? 31.904 51.528 -9.107  1.00 71.94  ? 422 LEU A HD21 1 
ATOM   2783 H  HD22 . LEU A 1 207 ? 32.571 50.772 -10.335 1.00 71.94  ? 422 LEU A HD22 1 
ATOM   2784 H  HD23 . LEU A 1 207 ? 31.053 50.489 -9.956  1.00 71.94  ? 422 LEU A HD23 1 
ATOM   2785 N  N    . CYS A 1 208 ? 31.399 47.477 -12.473 1.00 27.67  ? 423 CYS A N    1 
ATOM   2786 C  CA   . CYS A 1 208 ? 31.919 46.947 -13.717 1.00 26.64  ? 423 CYS A CA   1 
ATOM   2787 C  C    . CYS A 1 208 ? 32.591 48.065 -14.485 1.00 26.63  ? 423 CYS A C    1 
ATOM   2788 O  O    . CYS A 1 208 ? 31.941 49.030 -14.860 1.00 30.73  ? 423 CYS A O    1 
ATOM   2789 C  CB   . CYS A 1 208 ? 30.824 46.342 -14.560 1.00 28.45  ? 423 CYS A CB   1 
ATOM   2790 S  SG   . CYS A 1 208 ? 31.520 45.670 -16.127 1.00 29.87  ? 423 CYS A SG   1 
ATOM   2791 H  H    . CYS A 1 208 ? 30.937 48.196 -12.568 1.00 33.21  ? 423 CYS A H    1 
ATOM   2792 H  HA   . CYS A 1 208 ? 32.579 46.261 -13.528 1.00 31.97  ? 423 CYS A HA   1 
ATOM   2793 H  HB2  . CYS A 1 208 ? 30.404 45.615 -14.073 1.00 34.14  ? 423 CYS A HB2  1 
ATOM   2794 H  HB3  . CYS A 1 208 ? 30.170 47.024 -14.781 1.00 34.14  ? 423 CYS A HB3  1 
ATOM   2795 H  HG   . CYS A 1 208 ? 30.631 45.195 -16.778 1.00 35.85  ? 423 CYS A HG   1 
ATOM   2796 N  N    . THR A 1 209 ? 33.883 47.958 -14.693 1.00 25.42  ? 424 THR A N    1 
ATOM   2797 C  CA   . THR A 1 209 ? 34.661 49.020 -15.290 1.00 25.49  ? 424 THR A CA   1 
ATOM   2798 C  C    . THR A 1 209 ? 35.436 48.539 -16.509 1.00 24.38  ? 424 THR A C    1 
ATOM   2799 O  O    . THR A 1 209 ? 36.200 47.587 -16.451 1.00 25.46  ? 424 THR A O    1 
ATOM   2800 C  CB   . THR A 1 209 ? 35.660 49.624 -14.265 1.00 25.60  ? 424 THR A CB   1 
ATOM   2801 O  OG1  . THR A 1 209 ? 34.948 50.169 -13.147 1.00 32.16  ? 424 THR A OG1  1 
ATOM   2802 C  CG2  . THR A 1 209 ? 36.460 50.756 -14.895 1.00 25.90  ? 424 THR A CG2  1 
ATOM   2803 H  H    . THR A 1 209 ? 34.346 47.262 -14.491 1.00 30.50  ? 424 THR A H    1 
ATOM   2804 H  HA   . THR A 1 209 ? 34.061 49.727 -15.576 1.00 30.59  ? 424 THR A HA   1 
ATOM   2805 H  HB   . THR A 1 209 ? 36.274 48.938 -13.960 1.00 30.73  ? 424 THR A HB   1 
ATOM   2806 H  HG1  . THR A 1 209 ? 34.502 49.566 -12.769 1.00 38.59  ? 424 THR A HG1  1 
ATOM   2807 H  HG21 . THR A 1 209 ? 37.080 51.125 -14.247 1.00 31.08  ? 424 THR A HG21 1 
ATOM   2808 H  HG22 . THR A 1 209 ? 36.961 50.424 -15.656 1.00 31.08  ? 424 THR A HG22 1 
ATOM   2809 H  HG23 . THR A 1 209 ? 35.861 51.458 -15.194 1.00 31.08  ? 424 THR A HG23 1 
ATOM   2810 N  N    . ALA A 1 210 ? 35.267 49.227 -17.616 1.00 24.89  ? 425 ALA A N    1 
ATOM   2811 C  CA   . ALA A 1 210 ? 36.063 48.964 -18.811 1.00 24.01  ? 425 ALA A CA   1 
ATOM   2812 C  C    . ALA A 1 210 ? 37.190 49.975 -18.924 1.00 24.05  ? 425 ALA A C    1 
ATOM   2813 O  O    . ALA A 1 210 ? 36.951 51.168 -18.758 1.00 25.30  ? 425 ALA A O    1 
ATOM   2814 C  CB   . ALA A 1 210 ? 35.200 49.017 -20.042 1.00 24.65  ? 425 ALA A CB   1 
ATOM   2815 H  H    . ALA A 1 210 ? 34.693 49.860 -17.710 1.00 29.86  ? 425 ALA A H    1 
ATOM   2816 H  HA   . ALA A 1 210 ? 36.452 48.078 -18.749 1.00 28.81  ? 425 ALA A HA   1 
ATOM   2817 H  HB1  . ALA A 1 210 ? 35.750 48.839 -20.821 1.00 29.58  ? 425 ALA A HB1  1 
ATOM   2818 H  HB2  . ALA A 1 210 ? 34.504 48.345 -19.969 1.00 29.58  ? 425 ALA A HB2  1 
ATOM   2819 H  HB3  . ALA A 1 210 ? 34.803 49.899 -20.111 1.00 29.58  ? 425 ALA A HB3  1 
ATOM   2820 N  N    . TYR A 1 211 ? 38.403 49.500 -19.172 1.00 23.80  ? 426 TYR A N    1 
ATOM   2821 C  CA   . TYR A 1 211 ? 39.543 50.380 -19.432 1.00 23.97  ? 426 TYR A CA   1 
ATOM   2822 C  C    . TYR A 1 211 ? 40.125 50.314 -20.850 1.00 23.99  ? 426 TYR A C    1 
ATOM   2823 O  O    . TYR A 1 211 ? 40.440 49.233 -21.377 1.00 23.39  ? 426 TYR A O    1 
ATOM   2824 C  CB   . TYR A 1 211 ? 40.678 50.075 -18.493 1.00 27.76  ? 426 TYR A CB   1 
ATOM   2825 C  CG   . TYR A 1 211 ? 40.377 50.078 -17.035 1.00 31.50  ? 426 TYR A CG   1 
ATOM   2826 C  CD1  . TYR A 1 211 ? 40.763 51.135 -16.260 1.00 34.44  ? 426 TYR A CD1  1 
ATOM   2827 C  CD2  . TYR A 1 211 ? 39.772 48.993 -16.413 1.00 31.11  ? 426 TYR A CD2  1 
ATOM   2828 C  CE1  . TYR A 1 211 ? 40.537 51.151 -14.922 1.00 34.25  ? 426 TYR A CE1  1 
ATOM   2829 C  CE2  . TYR A 1 211 ? 39.535 48.989 -15.058 1.00 31.25  ? 426 TYR A CE2  1 
ATOM   2830 C  CZ   . TYR A 1 211 ? 39.925 50.079 -14.311 1.00 35.40  ? 426 TYR A CZ   1 
ATOM   2831 O  OH   . TYR A 1 211 ? 39.734 50.145 -12.946 1.00 36.06  ? 426 TYR A OH   1 
ATOM   2832 H  H    . TYR A 1 211 ? 38.597 48.663 -19.196 1.00 28.56  ? 426 TYR A H    1 
ATOM   2833 H  HA   . TYR A 1 211 ? 39.267 51.296 -19.271 1.00 28.76  ? 426 TYR A HA   1 
ATOM   2834 H  HB2  . TYR A 1 211 ? 41.020 49.194 -18.712 1.00 33.31  ? 426 TYR A HB2  1 
ATOM   2835 H  HB3  . TYR A 1 211 ? 41.375 50.733 -18.641 1.00 33.31  ? 426 TYR A HB3  1 
ATOM   2836 H  HD1  . TYR A 1 211 ? 41.181 51.863 -16.659 1.00 41.33  ? 426 TYR A HD1  1 
ATOM   2837 H  HD2  . TYR A 1 211 ? 39.515 48.259 -16.924 1.00 37.33  ? 426 TYR A HD2  1 
ATOM   2838 H  HE1  . TYR A 1 211 ? 40.802 51.884 -14.415 1.00 41.10  ? 426 TYR A HE1  1 
ATOM   2839 H  HE2  . TYR A 1 211 ? 39.122 48.261 -14.652 1.00 37.50  ? 426 TYR A HE2  1 
ATOM   2840 H  HH   . TYR A 1 211 ? 39.355 49.446 -12.675 1.00 43.27  ? 426 TYR A HH   1 
ATOM   2841 N  N    . VAL A 1 212 ? 40.294 51.477 -21.461 1.00 23.58  ? 427 VAL A N    1 
ATOM   2842 C  CA   . VAL A 1 212 ? 40.986 51.567 -22.733 1.00 23.29  ? 427 VAL A CA   1 
ATOM   2843 C  C    . VAL A 1 212 ? 42.209 52.500 -22.581 1.00 23.86  ? 427 VAL A C    1 
ATOM   2844 O  O    . VAL A 1 212 ? 42.261 53.340 -21.665 1.00 24.89  ? 427 VAL A O    1 
ATOM   2845 C  CB   . VAL A 1 212 ? 40.058 52.044 -23.865 1.00 26.66  ? 427 VAL A CB   1 
ATOM   2846 C  CG1  . VAL A 1 212 ? 38.996 51.026 -24.157 1.00 26.23  ? 427 VAL A CG1  1 
ATOM   2847 C  CG2  . VAL A 1 212 ? 39.450 53.337 -23.549 1.00 27.12  ? 427 VAL A CG2  1 
ATOM   2848 H  H    . VAL A 1 212 ? 40.016 52.232 -21.157 1.00 28.29  ? 427 VAL A H    1 
ATOM   2849 H  HA   . VAL A 1 212 ? 41.314 50.686 -22.972 1.00 27.95  ? 427 VAL A HA   1 
ATOM   2850 H  HB   . VAL A 1 212 ? 40.585 52.158 -24.671 1.00 31.99  ? 427 VAL A HB   1 
ATOM   2851 H  HG11 . VAL A 1 212 ? 38.430 51.357 -24.872 1.00 31.47  ? 427 VAL A HG11 1 
ATOM   2852 H  HG12 . VAL A 1 212 ? 39.420 50.197 -24.428 1.00 31.47  ? 427 VAL A HG12 1 
ATOM   2853 H  HG13 . VAL A 1 212 ? 38.468 50.882 -23.357 1.00 31.47  ? 427 VAL A HG13 1 
ATOM   2854 H  HG21 . VAL A 1 212 ? 38.874 53.602 -24.283 1.00 32.55  ? 427 VAL A HG21 1 
ATOM   2855 H  HG22 . VAL A 1 212 ? 38.930 53.250 -22.735 1.00 32.55  ? 427 VAL A HG22 1 
ATOM   2856 H  HG23 . VAL A 1 212 ? 40.153 53.994 -23.425 1.00 32.55  ? 427 VAL A HG23 1 
ATOM   2857 N  N    . PHE A 1 213 ? 43.181 52.306 -23.495 1.00 23.35  ? 428 PHE A N    1 
ATOM   2858 C  CA   . PHE A 1 213 ? 44.518 52.852 -23.332 1.00 24.83  ? 428 PHE A CA   1 
ATOM   2859 C  C    . PHE A 1 213 ? 45.062 53.505 -24.547 1.00 24.29  ? 428 PHE A C    1 
ATOM   2860 O  O    . PHE A 1 213 ? 44.881 53.039 -25.670 1.00 23.69  ? 428 PHE A O    1 
ATOM   2861 C  CB   . PHE A 1 213 ? 45.502 51.774 -22.919 1.00 29.75  ? 428 PHE A CB   1 
ATOM   2862 C  CG   . PHE A 1 213 ? 45.110 51.064 -21.688 1.00 26.75  ? 428 PHE A CG   1 
ATOM   2863 C  CD1  . PHE A 1 213 ? 44.202 50.003 -21.739 1.00 26.83  ? 428 PHE A CD1  1 
ATOM   2864 C  CD2  . PHE A 1 213 ? 45.608 51.457 -20.479 1.00 28.32  ? 428 PHE A CD2  1 
ATOM   2865 C  CE1  . PHE A 1 213 ? 43.824 49.336 -20.581 1.00 21.63  ? 428 PHE A CE1  1 
ATOM   2866 C  CE2  . PHE A 1 213 ? 45.230 50.803 -19.317 1.00 26.31  ? 428 PHE A CE2  1 
ATOM   2867 C  CZ   . PHE A 1 213 ? 44.326 49.755 -19.370 1.00 24.22  ? 428 PHE A CZ   1 
ATOM   2868 H  H    . PHE A 1 213 ? 43.077 51.857 -24.221 1.00 28.02  ? 428 PHE A H    1 
ATOM   2869 H  HA   . PHE A 1 213 ? 44.496 53.517 -22.626 1.00 29.79  ? 428 PHE A HA   1 
ATOM   2870 H  HB2  . PHE A 1 213 ? 45.568 51.120 -23.632 1.00 35.70  ? 428 PHE A HB2  1 
ATOM   2871 H  HB3  . PHE A 1 213 ? 46.368 52.182 -22.764 1.00 35.70  ? 428 PHE A HB3  1 
ATOM   2872 H  HD1  . PHE A 1 213 ? 43.858 49.732 -22.559 1.00 32.19  ? 428 PHE A HD1  1 
ATOM   2873 H  HD2  . PHE A 1 213 ? 46.206 52.168 -20.434 1.00 33.99  ? 428 PHE A HD2  1 
ATOM   2874 H  HE1  . PHE A 1 213 ? 43.219 48.631 -20.621 1.00 25.96  ? 428 PHE A HE1  1 
ATOM   2875 H  HE2  . PHE A 1 213 ? 45.575 51.077 -18.498 1.00 31.57  ? 428 PHE A HE2  1 
ATOM   2876 H  HZ   . PHE A 1 213 ? 44.084 49.311 -18.589 1.00 29.06  ? 428 PHE A HZ   1 
ATOM   2877 N  N    . GLU A 1 214 ? 45.748 54.596 -24.288 1.00 25.59  ? 429 GLU A N    1 
ATOM   2878 C  CA   . GLU A 1 214 ? 46.641 55.209 -25.237 1.00 26.40  ? 429 GLU A CA   1 
ATOM   2879 C  C    . GLU A 1 214 ? 47.888 55.578 -24.472 1.00 27.04  ? 429 GLU A C    1 
ATOM   2880 O  O    . GLU A 1 214 ? 47.935 55.508 -23.244 1.00 28.06  ? 429 GLU A O    1 
ATOM   2881 C  CB   . GLU A 1 214 ? 46.032 56.463 -25.916 1.00 27.85  ? 429 GLU A CB   1 
ATOM   2882 C  CG   . GLU A 1 214 ? 45.015 56.203 -27.025 1.00 49.00  ? 429 GLU A CG   1 
ATOM   2883 C  CD   . GLU A 1 214 ? 44.513 57.504 -27.638 1.00 34.16  ? 429 GLU A CD   1 
ATOM   2884 O  OE1  . GLU A 1 214 ? 45.282 58.463 -27.658 1.00 31.21  ? 429 GLU A OE1  1 
ATOM   2885 O  OE2  . GLU A 1 214 ? 43.347 57.582 -28.078 1.00 52.73  ? 429 GLU A OE2  1 
ATOM   2886 H  H    . GLU A 1 214 ? 45.709 55.015 -23.537 1.00 30.71  ? 429 GLU A H    1 
ATOM   2887 H  HA   . GLU A 1 214 ? 46.877 54.568 -25.925 1.00 31.68  ? 429 GLU A HA   1 
ATOM   2888 H  HB2  . GLU A 1 214 ? 45.588 56.992 -25.235 1.00 33.42  ? 429 GLU A HB2  1 
ATOM   2889 H  HB3  . GLU A 1 214 ? 46.756 56.981 -26.303 1.00 33.42  ? 429 GLU A HB3  1 
ATOM   2890 H  HG2  . GLU A 1 214 ? 45.433 55.679 -27.726 1.00 58.80  ? 429 GLU A HG2  1 
ATOM   2891 H  HG3  . GLU A 1 214 ? 44.255 55.727 -26.657 1.00 58.80  ? 429 GLU A HG3  1 
ATOM   2892 N  N    . VAL A 1 215 ? 48.892 55.993 -25.213 1.00 27.68  ? 430 VAL A N    1 
ATOM   2893 C  CA   . VAL A 1 215 ? 50.150 56.428 -24.642 1.00 30.73  ? 430 VAL A CA   1 
ATOM   2894 C  C    . VAL A 1 215 ? 50.214 57.937 -24.775 1.00 31.60  ? 430 VAL A C    1 
ATOM   2895 O  O    . VAL A 1 215 ? 49.983 58.448 -25.875 1.00 32.01  ? 430 VAL A O    1 
ATOM   2896 C  CB   . VAL A 1 215 ? 51.344 55.771 -25.352 1.00 36.27  ? 430 VAL A CB   1 
ATOM   2897 C  CG1  . VAL A 1 215 ? 52.648 56.402 -24.924 1.00 35.10  ? 430 VAL A CG1  1 
ATOM   2898 C  CG2  . VAL A 1 215 ? 51.354 54.287 -25.099 1.00 33.21  ? 430 VAL A CG2  1 
ATOM   2899 H  H    . VAL A 1 215 ? 48.871 56.034 -26.071 1.00 33.21  ? 430 VAL A H    1 
ATOM   2900 H  HA   . VAL A 1 215 ? 50.181 56.196 -23.700 1.00 36.87  ? 430 VAL A HA   1 
ATOM   2901 H  HB   . VAL A 1 215 ? 51.250 55.907 -26.308 1.00 43.53  ? 430 VAL A HB   1 
ATOM   2902 H  HG11 . VAL A 1 215 ? 53.378 55.965 -25.390 1.00 42.12  ? 430 VAL A HG11 1 
ATOM   2903 H  HG12 . VAL A 1 215 ? 52.630 57.346 -25.147 1.00 42.12  ? 430 VAL A HG12 1 
ATOM   2904 H  HG13 . VAL A 1 215 ? 52.753 56.291 -23.966 1.00 42.12  ? 430 VAL A HG13 1 
ATOM   2905 H  HG21 . VAL A 1 215 ? 52.114 53.895 -25.556 1.00 39.85  ? 430 VAL A HG21 1 
ATOM   2906 H  HG22 . VAL A 1 215 ? 51.425 54.131 -24.145 1.00 39.85  ? 430 VAL A HG22 1 
ATOM   2907 H  HG23 . VAL A 1 215 ? 50.530 53.904 -25.438 1.00 39.85  ? 430 VAL A HG23 1 
ATOM   2908 N  N    . SER A 1 216 ? 50.550 58.644 -23.694 1.00 36.74  ? 431 SER A N    1 
ATOM   2909 C  CA   . SER A 1 216 ? 50.790 60.085 -23.777 1.00 40.77  ? 431 SER A CA   1 
ATOM   2910 C  C    . SER A 1 216 ? 52.234 60.405 -24.124 1.00 55.50  ? 431 SER A C    1 
ATOM   2911 O  O    . SER A 1 216 ? 53.096 59.532 -24.083 1.00 44.72  ? 431 SER A O    1 
ATOM   2912 C  CB   . SER A 1 216 ? 50.450 60.783 -22.449 1.00 45.72  ? 431 SER A CB   1 
ATOM   2913 O  OG   . SER A 1 216 ? 50.485 62.182 -22.635 1.00 49.99  ? 431 SER A OG   1 
ATOM   2914 H  H    . SER A 1 216 ? 50.645 58.314 -22.905 1.00 44.09  ? 431 SER A H    1 
ATOM   2915 H  HA   . SER A 1 216 ? 50.223 60.461 -24.469 1.00 48.92  ? 431 SER A HA   1 
ATOM   2916 H  HB2  . SER A 1 216 ? 49.561 60.519 -22.166 1.00 54.87  ? 431 SER A HB2  1 
ATOM   2917 H  HB3  . SER A 1 216 ? 51.105 60.532 -21.779 1.00 54.87  ? 431 SER A HB3  1 
ATOM   2918 H  HG   . SER A 1 216 ? 51.251 62.420 -22.886 1.00 59.99  ? 431 SER A HG   1 
ATOM   2919 N  N    . THR A 1 217 ? 52.500 61.673 -24.431 1.00 65.69  ? 432 THR A N    1 
ATOM   2920 C  CA   . THR A 1 217 ? 53.876 62.188 -24.536 1.00 61.83  ? 432 THR A CA   1 
ATOM   2921 C  C    . THR A 1 217 ? 54.373 62.675 -23.168 1.00 74.56  ? 432 THR A C    1 
ATOM   2922 O  O    . THR A 1 217 ? 53.611 63.291 -22.426 1.00 76.79  ? 432 THR A O    1 
ATOM   2923 C  CB   . THR A 1 217 ? 53.964 63.343 -25.545 1.00 60.40  ? 432 THR A CB   1 
ATOM   2924 O  OG1  . THR A 1 217 ? 52.921 63.209 -26.521 1.00 63.03  ? 432 THR A OG1  1 
ATOM   2925 C  CG2  . THR A 1 217 ? 55.327 63.332 -26.246 1.00 73.57  ? 432 THR A CG2  1 
ATOM   2926 H  H    . THR A 1 217 ? 51.898 62.266 -24.586 1.00 78.82  ? 432 THR A H    1 
ATOM   2927 H  HA   . THR A 1 217 ? 54.463 61.476 -24.836 1.00 74.19  ? 432 THR A HA   1 
ATOM   2928 H  HB   . THR A 1 217 ? 53.865 64.188 -25.079 1.00 72.48  ? 432 THR A HB   1 
ATOM   2929 H  HG1  . THR A 1 217 ? 52.965 63.838 -27.076 1.00 75.63  ? 432 THR A HG1  1 
ATOM   2930 H  HG21 . THR A 1 217 ? 55.378 64.062 -26.882 1.00 88.28  ? 432 THR A HG21 1 
ATOM   2931 H  HG22 . THR A 1 217 ? 56.036 63.432 -25.592 1.00 88.28  ? 432 THR A HG22 1 
ATOM   2932 H  HG23 . THR A 1 217 ? 55.449 62.493 -26.718 1.00 88.28  ? 432 THR A HG23 1 
ATOM   2933 N  N    . SER A 1 218 ? 55.652 62.442 -22.863 1.00 114.49 ? 433 SER A N    1 
ATOM   2934 C  CA   . SER A 1 218 ? 56.218 62.604 -21.502 1.00 108.77 ? 433 SER A CA   1 
ATOM   2935 C  C    . SER A 1 218 ? 55.975 63.972 -20.828 1.00 93.01  ? 433 SER A C    1 
ATOM   2936 O  O    . SER A 1 218 ? 55.795 64.055 -19.603 1.00 91.48  ? 433 SER A O    1 
ATOM   2937 C  CB   . SER A 1 218 ? 57.723 62.340 -21.559 1.00 100.98 ? 433 SER A CB   1 
ATOM   2938 O  OG   . SER A 1 218 ? 58.291 62.978 -22.689 1.00 106.79 ? 433 SER A OG   1 
ATOM   2939 H  H    . SER A 1 218 ? 56.235 62.180 -23.439 1.00 137.39 ? 433 SER A H    1 
ATOM   2940 H  HA   . SER A 1 218 ? 55.826 61.927 -20.929 1.00 130.52 ? 433 SER A HA   1 
ATOM   2941 H  HB2  . SER A 1 218 ? 58.137 62.691 -20.754 1.00 121.17 ? 433 SER A HB2  1 
ATOM   2942 H  HB3  . SER A 1 218 ? 57.875 61.385 -21.623 1.00 121.17 ? 433 SER A HB3  1 
ATOM   2943 H  HG   . SER A 1 218 ? 59.117 62.831 -22.716 1.00 128.14 ? 433 SER A HG   1 
ATOM   2944 N  N    . GLU A 1 219 ? 56.011 65.030 -21.632 1.00 77.06  ? 434 GLU A N    1 
ATOM   2945 C  CA   . GLU A 1 219 ? 55.613 66.388 -21.214 1.00 84.76  ? 434 GLU A CA   1 
ATOM   2946 C  C    . GLU A 1 219 ? 54.216 66.389 -20.582 1.00 84.19  ? 434 GLU A C    1 
ATOM   2947 O  O    . GLU A 1 219 ? 53.997 66.992 -19.516 1.00 76.23  ? 434 GLU A O    1 
ATOM   2948 C  CB   . GLU A 1 219 ? 55.641 67.333 -22.428 1.00 78.79  ? 434 GLU A CB   1 
ATOM   2949 C  CG   . GLU A 1 219 ? 54.820 66.804 -23.612 1.00 73.83  ? 434 GLU A CG   1 
ATOM   2950 C  CD   . GLU A 1 219 ? 55.467 67.037 -24.954 1.00 85.87  ? 434 GLU A CD   1 
ATOM   2951 O  OE1  . GLU A 1 219 ? 55.949 68.164 -25.208 1.00 87.22  ? 434 GLU A OE1  1 
ATOM   2952 O  OE2  . GLU A 1 219 ? 55.483 66.074 -25.756 1.00 75.17  ? 434 GLU A OE2  1 
ATOM   2953 H  H    . GLU A 1 219 ? 56.269 64.992 -22.451 1.00 92.47  ? 434 GLU A H    1 
ATOM   2954 H  HA   . GLU A 1 219 ? 56.245 66.718 -20.556 1.00 101.72 ? 434 GLU A HA   1 
ATOM   2955 H  HB2  . GLU A 1 219 ? 55.273 68.192 -22.168 1.00 94.55  ? 434 GLU A HB2  1 
ATOM   2956 H  HB3  . GLU A 1 219 ? 56.559 67.441 -22.724 1.00 94.55  ? 434 GLU A HB3  1 
ATOM   2957 H  HG2  . GLU A 1 219 ? 54.697 65.848 -23.504 1.00 88.60  ? 434 GLU A HG2  1 
ATOM   2958 H  HG3  . GLU A 1 219 ? 53.957 67.248 -23.617 1.00 88.60  ? 434 GLU A HG3  1 
ATOM   2959 N  N    . ARG A 1 220 ? 53.279 65.736 -21.282 1.00 56.57  ? 435 ARG A N    1 
ATOM   2960 C  CA   . ARG A 1 220 ? 51.944 65.439 -20.781 1.00 51.45  ? 435 ARG A CA   1 
ATOM   2961 C  C    . ARG A 1 220 ? 52.031 64.132 -19.996 1.00 59.80  ? 435 ARG A C    1 
ATOM   2962 O  O    . ARG A 1 220 ? 52.183 63.064 -20.583 1.00 71.13  ? 435 ARG A O    1 
ATOM   2963 C  CB   . ARG A 1 220 ? 50.940 65.280 -21.937 1.00 56.80  ? 435 ARG A CB   1 
ATOM   2964 C  CG   . ARG A 1 220 ? 50.701 66.485 -22.849 1.00 49.56  ? 435 ARG A CG   1 
ATOM   2965 C  CD   . ARG A 1 220 ? 49.304 66.380 -23.504 1.00 48.54  ? 435 ARG A CD   1 
ATOM   2966 N  NE   . ARG A 1 220 ? 48.219 66.503 -22.516 1.00 49.00  ? 435 ARG A NE   1 
ATOM   2967 C  CZ   . ARG A 1 220 ? 46.982 66.932 -22.790 1.00 49.84  ? 435 ARG A CZ   1 
ATOM   2968 N  NH1  . ARG A 1 220 ? 46.638 67.279 -24.031 1.00 50.32  ? 435 ARG A NH1  1 
ATOM   2969 N  NH2  . ARG A 1 220 ? 46.082 67.001 -21.821 1.00 50.36  ? 435 ARG A NH2  1 
ATOM   2970 H  H    . ARG A 1 220 ? 53.406 65.447 -22.082 1.00 67.88  ? 435 ARG A H    1 
ATOM   2971 H  HA   . ARG A 1 220 ? 51.642 66.147 -20.190 1.00 61.74  ? 435 ARG A HA   1 
ATOM   2972 H  HB2  . ARG A 1 220 ? 51.248 64.554 -22.502 1.00 68.17  ? 435 ARG A HB2  1 
ATOM   2973 H  HB3  . ARG A 1 220 ? 50.081 65.040 -21.555 1.00 68.17  ? 435 ARG A HB3  1 
ATOM   2974 H  HG2  . ARG A 1 220 ? 50.737 67.301 -22.326 1.00 59.47  ? 435 ARG A HG2  1 
ATOM   2975 H  HG3  . ARG A 1 220 ? 51.371 66.500 -23.550 1.00 59.47  ? 435 ARG A HG3  1 
ATOM   2976 H  HD2  . ARG A 1 220 ? 49.203 67.093 -24.154 1.00 58.25  ? 435 ARG A HD2  1 
ATOM   2977 H  HD3  . ARG A 1 220 ? 49.221 65.517 -23.939 1.00 58.25  ? 435 ARG A HD3  1 
ATOM   2978 H  HE   . ARG A 1 220 ? 48.393 66.282 -21.703 1.00 58.79  ? 435 ARG A HE   1 
ATOM   2979 H  HH11 . ARG A 1 220 ? 47.217 67.235 -24.665 1.00 60.39  ? 435 ARG A HH11 1 
ATOM   2980 H  HH12 . ARG A 1 220 ? 45.839 67.552 -24.195 1.00 60.39  ? 435 ARG A HH12 1 
ATOM   2981 H  HH21 . ARG A 1 220 ? 46.296 66.777 -21.019 1.00 60.43  ? 435 ARG A HH21 1 
ATOM   2982 H  HH22 . ARG A 1 220 ? 45.285 67.275 -21.993 1.00 60.43  ? 435 ARG A HH22 1 
ATOM   2983 N  N    . GLY A 1 221 ? 51.938 64.187 -18.683 1.00 49.96  ? 436 GLY A N    1 
ATOM   2984 C  CA   . GLY A 1 221 ? 52.031 62.969 -17.905 1.00 54.47  ? 436 GLY A CA   1 
ATOM   2985 C  C    . GLY A 1 221 ? 50.784 62.127 -18.116 1.00 51.16  ? 436 GLY A C    1 
ATOM   2986 O  O    . GLY A 1 221 ? 49.953 62.463 -18.961 1.00 44.82  ? 436 GLY A O    1 
ATOM   2987 H  H    . GLY A 1 221 ? 51.822 64.904 -18.222 1.00 59.96  ? 436 GLY A H    1 
ATOM   2988 H  HA2  . GLY A 1 221 ? 52.808 62.458 -18.180 1.00 65.36  ? 436 GLY A HA2  1 
ATOM   2989 H  HA3  . GLY A 1 221 ? 52.112 63.183 -16.962 1.00 65.36  ? 436 GLY A HA3  1 
ATOM   2990 N  N    . ALA A 1 222 ? 50.655 61.046 -17.357 1.00 44.33  ? 437 ALA A N    1 
ATOM   2991 C  CA   . ALA A 1 222 ? 49.452 60.218 -17.408 1.00 42.04  ? 437 ALA A CA   1 
ATOM   2992 C  C    . ALA A 1 222 ? 48.178 61.006 -17.076 1.00 40.96  ? 437 ALA A C    1 
ATOM   2993 O  O    . ALA A 1 222 ? 48.238 62.006 -16.409 1.00 45.78  ? 437 ALA A O    1 
ATOM   2994 C  CB   . ALA A 1 222 ? 49.592 59.014 -16.464 1.00 41.42  ? 437 ALA A CB   1 
ATOM   2995 H  H    . ALA A 1 222 ? 51.250 60.767 -16.802 1.00 53.19  ? 437 ALA A H    1 
ATOM   2996 H  HA   . ALA A 1 222 ? 49.355 59.872 -18.309 1.00 50.44  ? 437 ALA A HA   1 
ATOM   2997 H  HB1  . ALA A 1 222 ? 48.784 58.479 -16.514 1.00 49.71  ? 437 ALA A HB1  1 
ATOM   2998 H  HB2  . ALA A 1 222 ? 50.357 58.485 -16.739 1.00 49.71  ? 437 ALA A HB2  1 
ATOM   2999 H  HB3  . ALA A 1 222 ? 49.720 59.337 -15.559 1.00 49.71  ? 437 ALA A HB3  1 
ATOM   3000 N  N    . GLN A 1 223 ? 47.041 60.556 -17.588 1.00 37.47  ? 438 GLN A N    1 
ATOM   3001 C  CA   . GLN A 1 223 ? 45.802 61.260 -17.433 1.00 38.72  ? 438 GLN A CA   1 
ATOM   3002 C  C    . GLN A 1 223 ? 44.745 60.221 -17.618 1.00 36.48  ? 438 GLN A C    1 
ATOM   3003 O  O    . GLN A 1 223 ? 44.953 59.228 -18.318 1.00 34.32  ? 438 GLN A O    1 
ATOM   3004 C  CB   . GLN A 1 223 ? 45.628 62.425 -18.457 1.00 40.69  ? 438 GLN A CB   1 
ATOM   3005 C  CG   . GLN A 1 223 ? 44.467 63.398 -18.102 1.00 42.99  ? 438 GLN A CG   1 
ATOM   3006 C  CD   . GLN A 1 223 ? 44.323 64.602 -19.087 1.00 45.42  ? 438 GLN A CD   1 
ATOM   3007 O  OE1  . GLN A 1 223 ? 44.713 64.536 -20.255 1.00 44.76  ? 438 GLN A OE1  1 
ATOM   3008 N  NE2  . GLN A 1 223 ? 43.763 65.677 -18.603 1.00 48.35  ? 438 GLN A NE2  1 
ATOM   3009 H  H    . GLN A 1 223 ? 46.971 59.827 -18.039 1.00 44.96  ? 438 GLN A H    1 
ATOM   3010 H  HA   . GLN A 1 223 ? 45.736 61.619 -16.534 1.00 46.47  ? 438 GLN A HA   1 
ATOM   3011 H  HB2  . GLN A 1 223 ? 46.449 62.941 -18.488 1.00 48.83  ? 438 GLN A HB2  1 
ATOM   3012 H  HB3  . GLN A 1 223 ? 45.443 62.048 -19.332 1.00 48.83  ? 438 GLN A HB3  1 
ATOM   3013 H  HG2  . GLN A 1 223 ? 43.632 62.904 -18.114 1.00 51.59  ? 438 GLN A HG2  1 
ATOM   3014 H  HG3  . GLN A 1 223 ? 44.622 63.758 -17.215 1.00 51.59  ? 438 GLN A HG3  1 
ATOM   3015 H  HE21 . GLN A 1 223 ? 43.499 65.693 -17.785 1.00 58.02  ? 438 GLN A HE21 1 
ATOM   3016 H  HE22 . GLN A 1 223 ? 43.659 66.369 -19.102 1.00 58.02  ? 438 GLN A HE22 1 
ATOM   3017 N  N    . HIS A 1 224 ? 43.611 60.413 -16.979 1.00 37.14  ? 439 HIS A N    1 
ATOM   3018 C  CA   . HIS A 1 224 ? 42.510 59.507 -17.208 1.00 35.41  ? 439 HIS A CA   1 
ATOM   3019 C  C    . HIS A 1 224 ? 41.219 60.289 -17.347 1.00 37.15  ? 439 HIS A C    1 
ATOM   3020 O  O    . HIS A 1 224 ? 41.122 61.413 -16.873 1.00 39.66  ? 439 HIS A O    1 
ATOM   3021 C  CB   . HIS A 1 224 ? 42.425 58.481 -16.057 1.00 34.01  ? 439 HIS A CB   1 
ATOM   3022 C  CG   . HIS A 1 224 ? 42.291 59.122 -14.722 1.00 35.80  ? 439 HIS A CG   1 
ATOM   3023 N  ND1  . HIS A 1 224 ? 41.065 59.301 -14.098 1.00 36.63  ? 439 HIS A ND1  1 
ATOM   3024 C  CD2  . HIS A 1 224 ? 43.208 59.723 -13.930 1.00 37.28  ? 439 HIS A CD2  1 
ATOM   3025 C  CE1  . HIS A 1 224 ? 41.246 59.950 -12.974 1.00 38.42  ? 439 HIS A CE1  1 
ATOM   3026 N  NE2  . HIS A 1 224 ? 42.539 60.216 -12.841 1.00 41.65  ? 439 HIS A NE2  1 
ATOM   3027 H  H    . HIS A 1 224 ? 43.453 61.047 -16.420 1.00 44.57  ? 439 HIS A H    1 
ATOM   3028 H  HA   . HIS A 1 224 ? 42.662 59.022 -18.034 1.00 42.49  ? 439 HIS A HA   1 
ATOM   3029 H  HB2  . HIS A 1 224 ? 41.650 57.915 -16.196 1.00 40.81  ? 439 HIS A HB2  1 
ATOM   3030 H  HB3  . HIS A 1 224 ? 43.232 57.944 -16.052 1.00 40.81  ? 439 HIS A HB3  1 
ATOM   3031 H  HD2  . HIS A 1 224 ? 44.123 59.777 -14.088 1.00 44.74  ? 439 HIS A HD2  1 
ATOM   3032 H  HE1  . HIS A 1 224 ? 40.580 60.173 -12.363 1.00 46.10  ? 439 HIS A HE1  1 
ATOM   3033 H  HE2  . HIS A 1 224 ? 42.900 60.626 -12.176 1.00 49.98  ? 439 HIS A HE2  1 
ATOM   3034 N  N    . HIS A 1 225 ? 40.228 59.709 -18.000 1.00 36.13  ? 440 HIS A N    1 
ATOM   3035 C  CA   . HIS A 1 225 ? 38.881 60.255 -17.915 1.00 40.96  ? 440 HIS A CA   1 
ATOM   3036 C  C    . HIS A 1 225 ? 37.871 59.159 -17.696 1.00 37.81  ? 440 HIS A C    1 
ATOM   3037 O  O    . HIS A 1 225 ? 37.835 58.162 -18.429 1.00 37.52  ? 440 HIS A O    1 
ATOM   3038 C  CB   . HIS A 1 225 ? 38.540 61.079 -19.165 1.00 47.71  ? 440 HIS A CB   1 
ATOM   3039 C  CG   . HIS A 1 225 ? 39.241 62.396 -19.178 1.00 55.99  ? 440 HIS A CG   1 
ATOM   3040 N  ND1  . HIS A 1 225 ? 39.029 63.355 -18.213 1.00 60.12  ? 440 HIS A ND1  1 
ATOM   3041 C  CD2  . HIS A 1 225 ? 40.195 62.890 -20.003 1.00 47.55  ? 440 HIS A CD2  1 
ATOM   3042 C  CE1  . HIS A 1 225 ? 39.813 64.388 -18.445 1.00 54.64  ? 440 HIS A CE1  1 
ATOM   3043 N  NE2  . HIS A 1 225 ? 40.527 64.128 -19.524 1.00 49.97  ? 440 HIS A NE2  1 
ATOM   3044 H  H    . HIS A 1 225 ? 40.303 59.009 -18.494 1.00 43.35  ? 440 HIS A H    1 
ATOM   3045 H  HA   . HIS A 1 225 ? 38.837 60.851 -17.151 1.00 49.15  ? 440 HIS A HA   1 
ATOM   3046 H  HB2  . HIS A 1 225 ? 38.810 60.585 -19.955 1.00 57.25  ? 440 HIS A HB2  1 
ATOM   3047 H  HB3  . HIS A 1 225 ? 37.585 61.245 -19.185 1.00 57.25  ? 440 HIS A HB3  1 
ATOM   3048 H  HD2  . HIS A 1 225 ? 40.557 62.468 -20.748 1.00 57.06  ? 440 HIS A HD2  1 
ATOM   3049 H  HE1  . HIS A 1 225 ? 39.847 65.170 -17.943 1.00 65.57  ? 440 HIS A HE1  1 
ATOM   3050 H  HE2  . HIS A 1 225 ? 41.101 64.660 -19.879 1.00 59.97  ? 440 HIS A HE2  1 
ATOM   3051 N  N    . ILE A 1 226 ? 37.061 59.374 -16.670 1.00 37.50  ? 441 ILE A N    1 
ATOM   3052 C  CA   . ILE A 1 226 ? 36.069 58.416 -16.218 1.00 36.50  ? 441 ILE A CA   1 
ATOM   3053 C  C    . ILE A 1 226 ? 34.727 58.804 -16.784 1.00 38.13  ? 441 ILE A C    1 
ATOM   3054 O  O    . ILE A 1 226 ? 34.359 59.969 -16.795 1.00 40.70  ? 441 ILE A O    1 
ATOM   3055 C  CB   . ILE A 1 226 ? 36.005 58.341 -14.681 1.00 39.48  ? 441 ILE A CB   1 
ATOM   3056 C  CG1  . ILE A 1 226 ? 37.372 57.996 -14.116 1.00 42.40  ? 441 ILE A CG1  1 
ATOM   3057 C  CG2  . ILE A 1 226 ? 34.967 57.336 -14.236 1.00 51.22  ? 441 ILE A CG2  1 
ATOM   3058 C  CD1  . ILE A 1 226 ? 37.484 58.299 -12.650 1.00 44.68  ? 441 ILE A CD1  1 
ATOM   3059 H  H    . ILE A 1 226 ? 37.070 60.096 -16.203 1.00 45.00  ? 441 ILE A H    1 
ATOM   3060 H  HA   . ILE A 1 226 ? 36.297 57.536 -16.555 1.00 43.80  ? 441 ILE A HA   1 
ATOM   3061 H  HB   . ILE A 1 226 ? 35.747 59.214 -14.344 1.00 47.37  ? 441 ILE A HB   1 
ATOM   3062 H  HG12 . ILE A 1 226 ? 37.535 57.048 -14.240 1.00 50.88  ? 441 ILE A HG12 1 
ATOM   3063 H  HG13 . ILE A 1 226 ? 38.047 58.514 -14.582 1.00 50.88  ? 441 ILE A HG13 1 
ATOM   3064 H  HG21 . ILE A 1 226 ? 34.949 57.310 -13.266 1.00 61.46  ? 441 ILE A HG21 1 
ATOM   3065 H  HG22 . ILE A 1 226 ? 34.100 57.606 -14.577 1.00 61.46  ? 441 ILE A HG22 1 
ATOM   3066 H  HG23 . ILE A 1 226 ? 35.203 56.463 -14.586 1.00 61.46  ? 441 ILE A HG23 1 
ATOM   3067 H  HD11 . ILE A 1 226 ? 38.373 58.060 -12.346 1.00 53.62  ? 441 ILE A HD11 1 
ATOM   3068 H  HD12 . ILE A 1 226 ? 37.330 59.247 -12.512 1.00 53.62  ? 441 ILE A HD12 1 
ATOM   3069 H  HD13 . ILE A 1 226 ? 36.819 57.782 -12.170 1.00 53.62  ? 441 ILE A HD13 1 
ATOM   3070 N  N    . TYR A 1 227 ? 33.981 57.799 -17.204 1.00 41.17  ? 442 TYR A N    1 
ATOM   3071 C  CA   . TYR A 1 227 ? 32.742 57.995 -17.908 1.00 38.35  ? 442 TYR A CA   1 
ATOM   3072 C  C    . TYR A 1 227 ? 31.752 56.993 -17.407 1.00 46.48  ? 442 TYR A C    1 
ATOM   3073 O  O    . TYR A 1 227 ? 32.136 55.883 -17.046 1.00 40.53  ? 442 TYR A O    1 
ATOM   3074 C  CB   . TYR A 1 227 ? 32.932 57.827 -19.398 1.00 37.71  ? 442 TYR A CB   1 
ATOM   3075 C  CG   . TYR A 1 227 ? 33.936 58.784 -19.994 1.00 49.90  ? 442 TYR A CG   1 
ATOM   3076 C  CD1  . TYR A 1 227 ? 33.588 60.103 -20.250 1.00 56.49  ? 442 TYR A CD1  1 
ATOM   3077 C  CD2  . TYR A 1 227 ? 35.235 58.375 -20.288 1.00 41.48  ? 442 TYR A CD2  1 
ATOM   3078 C  CE1  . TYR A 1 227 ? 34.502 60.995 -20.775 1.00 55.88  ? 442 TYR A CE1  1 
ATOM   3079 C  CE2  . TYR A 1 227 ? 36.152 59.265 -20.822 1.00 61.70  ? 442 TYR A CE2  1 
ATOM   3080 C  CZ   . TYR A 1 227 ? 35.769 60.578 -21.066 1.00 62.68  ? 442 TYR A CZ   1 
ATOM   3081 O  OH   . TYR A 1 227 ? 36.653 61.485 -21.582 1.00 55.42  ? 442 TYR A OH   1 
ATOM   3082 H  H    . TYR A 1 227 ? 34.183 56.971 -17.086 1.00 49.40  ? 442 TYR A H    1 
ATOM   3083 H  HA   . TYR A 1 227 ? 32.402 58.887 -17.734 1.00 46.02  ? 442 TYR A HA   1 
ATOM   3084 H  HB2  . TYR A 1 227 ? 33.241 56.925 -19.574 1.00 45.26  ? 442 TYR A HB2  1 
ATOM   3085 H  HB3  . TYR A 1 227 ? 32.081 57.976 -19.840 1.00 45.26  ? 442 TYR A HB3  1 
ATOM   3086 H  HD1  . TYR A 1 227 ? 32.727 60.395 -20.053 1.00 67.79  ? 442 TYR A HD1  1 
ATOM   3087 H  HD2  . TYR A 1 227 ? 35.490 57.496 -20.123 1.00 49.78  ? 442 TYR A HD2  1 
ATOM   3088 H  HE1  . TYR A 1 227 ? 34.251 61.875 -20.942 1.00 67.06  ? 442 TYR A HE1  1 
ATOM   3089 H  HE2  . TYR A 1 227 ? 37.018 58.987 -21.016 1.00 74.05  ? 442 TYR A HE2  1 
ATOM   3090 H  HH   . TYR A 1 227 ? 37.395 61.116 -21.720 1.00 66.50  ? 442 TYR A HH   1 
ATOM   3091 N  N    . ARG A 1 228 ? 30.488 57.386 -17.366 1.00 54.53  ? 443 ARG A N    1 
ATOM   3092 C  CA   . ARG A 1 228 ? 29.401 56.447 -17.157 1.00 57.00  ? 443 ARG A CA   1 
ATOM   3093 C  C    . ARG A 1 228 ? 29.131 55.717 -18.463 1.00 62.98  ? 443 ARG A C    1 
ATOM   3094 O  O    . ARG A 1 228 ? 29.278 56.303 -19.529 1.00 55.13  ? 443 ARG A O    1 
ATOM   3095 C  CB   . ARG A 1 228 ? 28.138 57.178 -16.674 1.00 62.15  ? 443 ARG A CB   1 
ATOM   3096 C  CG   . ARG A 1 228 ? 27.866 57.042 -15.165 1.00 61.12  ? 443 ARG A CG   1 
ATOM   3097 C  CD   . ARG A 1 228 ? 26.668 57.892 -14.666 1.00 73.75  ? 443 ARG A CD   1 
ATOM   3098 N  NE   . ARG A 1 228 ? 26.932 59.326 -14.781 1.00 89.36  ? 443 ARG A NE   1 
ATOM   3099 C  CZ   . ARG A 1 228 ? 26.544 60.101 -15.796 1.00 90.38  ? 443 ARG A CZ   1 
ATOM   3100 N  NH1  . ARG A 1 228 ? 25.834 59.609 -16.811 1.00 103.23 ? 443 ARG A NH1  1 
ATOM   3101 N  NH2  . ARG A 1 228 ? 26.871 61.388 -15.794 1.00 75.03  ? 443 ARG A NH2  1 
ATOM   3102 H  H    . ARG A 1 228 ? 30.232 58.202 -17.457 1.00 65.43  ? 443 ARG A H    1 
ATOM   3103 H  HA   . ARG A 1 228 ? 29.658 55.796 -16.486 1.00 68.39  ? 443 ARG A HA   1 
ATOM   3104 H  HB2  . ARG A 1 228 ? 28.230 58.122 -16.873 1.00 74.59  ? 443 ARG A HB2  1 
ATOM   3105 H  HB3  . ARG A 1 228 ? 27.371 56.817 -17.146 1.00 74.59  ? 443 ARG A HB3  1 
ATOM   3106 H  HG2  . ARG A 1 228 ? 27.673 56.113 -14.965 1.00 73.35  ? 443 ARG A HG2  1 
ATOM   3107 H  HG3  . ARG A 1 228 ? 28.655 57.327 -14.679 1.00 73.35  ? 443 ARG A HG3  1 
ATOM   3108 H  HD2  . ARG A 1 228 ? 25.885 57.685 -15.201 1.00 88.50  ? 443 ARG A HD2  1 
ATOM   3109 H  HD3  . ARG A 1 228 ? 26.500 57.689 -13.733 1.00 88.50  ? 443 ARG A HD3  1 
ATOM   3110 H  HE   . ARG A 1 228 ? 27.373 59.699 -14.144 1.00 107.23 ? 443 ARG A HE   1 
ATOM   3111 H  HH11 . ARG A 1 228 ? 25.623 58.775 -16.824 1.00 123.88 ? 443 ARG A HH11 1 
ATOM   3112 H  HH12 . ARG A 1 228 ? 25.589 60.124 -17.454 1.00 123.88 ? 443 ARG A HH12 1 
ATOM   3113 H  HH21 . ARG A 1 228 ? 27.324 61.715 -15.140 1.00 90.03  ? 443 ARG A HH21 1 
ATOM   3114 H  HH22 . ARG A 1 228 ? 26.615 61.897 -16.438 1.00 90.03  ? 443 ARG A HH22 1 
ATOM   3115 N  N    . LEU A 1 229 ? 28.760 54.442 -18.385 1.00 59.55  ? 444 LEU A N    1 
ATOM   3116 C  CA   . LEU A 1 229 ? 28.247 53.708 -19.545 1.00 57.47  ? 444 LEU A CA   1 
ATOM   3117 C  C    . LEU A 1 229 ? 26.720 53.580 -19.536 1.00 72.95  ? 444 LEU A C    1 
ATOM   3118 O  O    . LEU A 1 229 ? 26.144 53.115 -18.548 1.00 76.55  ? 444 LEU A O    1 
ATOM   3119 C  CB   . LEU A 1 229 ? 28.835 52.311 -19.604 1.00 62.40  ? 444 LEU A CB   1 
ATOM   3120 C  CG   . LEU A 1 229 ? 30.297 52.132 -19.981 1.00 51.82  ? 444 LEU A CG   1 
ATOM   3121 C  CD1  . LEU A 1 229 ? 30.579 50.647 -20.112 1.00 47.89  ? 444 LEU A CD1  1 
ATOM   3122 C  CD2  . LEU A 1 229 ? 30.627 52.845 -21.281 1.00 65.63  ? 444 LEU A CD2  1 
ATOM   3123 H  H    . LEU A 1 229 ? 28.795 53.973 -17.665 1.00 71.46  ? 444 LEU A H    1 
ATOM   3124 H  HA   . LEU A 1 229 ? 28.505 54.177 -20.354 1.00 68.96  ? 444 LEU A HA   1 
ATOM   3125 H  HB2  . LEU A 1 229 ? 28.724 51.909 -18.728 1.00 74.88  ? 444 LEU A HB2  1 
ATOM   3126 H  HB3  . LEU A 1 229 ? 28.318 51.803 -20.248 1.00 74.88  ? 444 LEU A HB3  1 
ATOM   3127 H  HG   . LEU A 1 229 ? 30.860 52.493 -19.279 1.00 62.18  ? 444 LEU A HG   1 
ATOM   3128 H  HD11 . LEU A 1 229 ? 31.510 50.523 -20.353 1.00 57.47  ? 444 LEU A HD11 1 
ATOM   3129 H  HD12 . LEU A 1 229 ? 30.396 50.215 -19.263 1.00 57.47  ? 444 LEU A HD12 1 
ATOM   3130 H  HD13 . LEU A 1 229 ? 30.006 50.277 -20.802 1.00 57.47  ? 444 LEU A HD13 1 
ATOM   3131 H  HD21 . LEU A 1 229 ? 31.565 52.707 -21.486 1.00 78.75  ? 444 LEU A HD21 1 
ATOM   3132 H  HD22 . LEU A 1 229 ? 30.075 52.479 -21.990 1.00 78.75  ? 444 LEU A HD22 1 
ATOM   3133 H  HD23 . LEU A 1 229 ? 30.446 53.792 -21.176 1.00 78.75  ? 444 LEU A HD23 1 
ATOM   3134 N  N    . VAL A 1 230 ? 26.080 53.961 -20.647 1.00 74.70  ? 445 VAL A N    1 
ATOM   3135 C  CA   . VAL A 1 230 ? 24.616 53.920 -20.777 1.00 65.80  ? 445 VAL A CA   1 
ATOM   3136 C  C    . VAL A 1 230 ? 24.187 53.299 -22.113 1.00 71.20  ? 445 VAL A C    1 
ATOM   3137 O  O    . VAL A 1 230 ? 25.005 53.127 -23.014 1.00 67.88  ? 445 VAL A O    1 
ATOM   3138 C  CB   . VAL A 1 230 ? 24.017 55.330 -20.636 1.00 75.38  ? 445 VAL A CB   1 
ATOM   3139 C  CG1  . VAL A 1 230 ? 24.280 55.881 -19.240 1.00 72.62  ? 445 VAL A CG1  1 
ATOM   3140 C  CG2  . VAL A 1 230 ? 24.585 56.264 -21.715 1.00 65.12  ? 445 VAL A CG2  1 
ATOM   3141 H  H    . VAL A 1 230 ? 26.478 54.251 -21.352 1.00 89.64  ? 445 VAL A H    1 
ATOM   3142 H  HA   . VAL A 1 230 ? 24.255 53.371 -20.065 1.00 78.97  ? 445 VAL A HA   1 
ATOM   3143 H  HB   . VAL A 1 230 ? 23.056 55.278 -20.760 1.00 90.46  ? 445 VAL A HB   1 
ATOM   3144 H  HG11 . VAL A 1 230 ? 23.894 56.768 -19.173 1.00 87.14  ? 445 VAL A HG11 1 
ATOM   3145 H  HG12 . VAL A 1 230 ? 23.872 55.292 -18.586 1.00 87.14  ? 445 VAL A HG12 1 
ATOM   3146 H  HG13 . VAL A 1 230 ? 25.238 55.925 -19.094 1.00 87.14  ? 445 VAL A HG13 1 
ATOM   3147 H  HG21 . VAL A 1 230 ? 24.194 57.145 -21.607 1.00 78.15  ? 445 VAL A HG21 1 
ATOM   3148 H  HG22 . VAL A 1 230 ? 25.548 56.314 -21.613 1.00 78.15  ? 445 VAL A HG22 1 
ATOM   3149 H  HG23 . VAL A 1 230 ? 24.363 55.908 -22.590 1.00 78.15  ? 445 VAL A HG23 1 
ATOM   3150 N  N    . ARG A 1 231 ? 22.900 52.975 -22.242 1.00 95.03  ? 446 ARG A N    1 
ATOM   3151 C  CA   . ARG A 1 231 ? 22.374 52.397 -23.480 1.00 93.30  ? 446 ARG A CA   1 
ATOM   3152 C  C    . ARG A 1 231 ? 21.012 52.991 -23.774 1.00 78.74  ? 446 ARG A C    1 
ATOM   3153 O  O    . ARG A 1 231 ? 20.725 54.102 -23.345 1.00 89.62  ? 446 ARG A O    1 
ATOM   3154 C  CB   . ARG A 1 231 ? 22.281 50.871 -23.376 1.00 97.90  ? 446 ARG A CB   1 
ATOM   3155 C  CG   . ARG A 1 231 ? 22.211 50.148 -24.721 1.00 98.35  ? 446 ARG A CG   1 
ATOM   3156 C  CD   . ARG A 1 231 ? 22.643 48.683 -24.592 1.00 93.24  ? 446 ARG A CD   1 
ATOM   3157 N  NE   . ARG A 1 231 ? 21.826 47.939 -23.631 1.00 96.19  ? 446 ARG A NE   1 
ATOM   3158 C  CZ   . ARG A 1 231 ? 21.887 46.622 -23.454 1.00 93.70  ? 446 ARG A CZ   1 
ATOM   3159 N  NH1  . ARG A 1 231 ? 21.102 46.035 -22.558 1.00 87.97  ? 446 ARG A NH1  1 
ATOM   3160 N  NH2  . ARG A 1 231 ? 22.728 45.884 -24.173 1.00 98.26  ? 446 ARG A NH2  1 
ATOM   3161 H  H    . ARG A 1 231 ? 22.309 53.081 -21.626 1.00 114.04 ? 446 ARG A H    1 
ATOM   3162 H  HA   . ARG A 1 231 ? 22.968 52.617 -24.215 1.00 111.96 ? 446 ARG A HA   1 
ATOM   3163 H  HB2  . ARG A 1 231 ? 23.064 50.544 -22.906 1.00 117.48 ? 446 ARG A HB2  1 
ATOM   3164 H  HB3  . ARG A 1 231 ? 21.481 50.643 -22.877 1.00 117.48 ? 446 ARG A HB3  1 
ATOM   3165 H  HG2  . ARG A 1 231 ? 21.299 50.169 -25.049 1.00 118.02 ? 446 ARG A HG2  1 
ATOM   3166 H  HG3  . ARG A 1 231 ? 22.805 50.585 -25.351 1.00 118.02 ? 446 ARG A HG3  1 
ATOM   3167 H  HD2  . ARG A 1 231 ? 22.558 48.251 -25.457 1.00 111.89 ? 446 ARG A HD2  1 
ATOM   3168 H  HD3  . ARG A 1 231 ? 23.565 48.650 -24.293 1.00 111.89 ? 446 ARG A HD3  1 
ATOM   3169 H  HE   . ARG A 1 231 ? 21.269 48.383 -23.149 1.00 115.43 ? 446 ARG A HE   1 
ATOM   3170 H  HH11 . ARG A 1 231 ? 20.556 46.507 -22.090 1.00 105.56 ? 446 ARG A HH11 1 
ATOM   3171 H  HH12 . ARG A 1 231 ? 21.142 45.184 -22.443 1.00 105.56 ? 446 ARG A HH12 1 
ATOM   3172 H  HH21 . ARG A 1 231 ? 23.238 46.258 -24.755 1.00 117.91 ? 446 ARG A HH21 1 
ATOM   3173 H  HH22 . ARG A 1 231 ? 22.763 45.033 -24.054 1.00 117.91 ? 446 ARG A HH22 1 
ATOM   3174 N  N    . ALA B 1 5   ? 61.881 13.122 -5.562  1.00 63.61  ? 220 ALA B N    1 
ATOM   3175 C  CA   . ALA B 1 5   ? 60.412 13.185 -5.538  1.00 61.20  ? 220 ALA B CA   1 
ATOM   3176 C  C    . ALA B 1 5   ? 59.795 11.871 -6.020  1.00 58.92  ? 220 ALA B C    1 
ATOM   3177 O  O    . ALA B 1 5   ? 60.275 11.245 -6.983  1.00 54.90  ? 220 ALA B O    1 
ATOM   3178 C  CB   . ALA B 1 5   ? 59.884 14.353 -6.392  1.00 45.34  ? 220 ALA B CB   1 
ATOM   3179 H  HA   . ALA B 1 5   ? 60.121 13.331 -4.624  1.00 73.44  ? 220 ALA B HA   1 
ATOM   3180 H  HB1  . ALA B 1 5   ? 58.915 14.361 -6.351  1.00 54.41  ? 220 ALA B HB1  1 
ATOM   3181 H  HB2  . ALA B 1 5   ? 60.237 15.185 -6.041  1.00 54.41  ? 220 ALA B HB2  1 
ATOM   3182 H  HB3  . ALA B 1 5   ? 60.175 14.230 -7.309  1.00 54.41  ? 220 ALA B HB3  1 
ATOM   3183 N  N    . ARG B 1 6   ? 58.728 11.466 -5.329  1.00 49.96  ? 221 ARG B N    1 
ATOM   3184 C  CA   . ARG B 1 6   ? 58.005 10.230 -5.632  1.00 52.88  ? 221 ARG B CA   1 
ATOM   3185 C  C    . ARG B 1 6   ? 56.664 10.509 -6.291  1.00 53.08  ? 221 ARG B C    1 
ATOM   3186 O  O    . ARG B 1 6   ? 56.122 9.651  -6.963  1.00 58.49  ? 221 ARG B O    1 
ATOM   3187 C  CB   . ARG B 1 6   ? 57.781 9.423  -4.351  1.00 60.75  ? 221 ARG B CB   1 
ATOM   3188 C  CG   . ARG B 1 6   ? 59.020 8.685  -3.864  1.00 66.59  ? 221 ARG B CG   1 
ATOM   3189 C  CD   . ARG B 1 6   ? 59.371 9.053  -2.445  1.00 69.47  ? 221 ARG B CD   1 
ATOM   3190 N  NE   . ARG B 1 6   ? 60.695 8.548  -2.088  1.00 74.39  ? 221 ARG B NE   1 
ATOM   3191 C  CZ   . ARG B 1 6   ? 60.947 7.322  -1.638  1.00 96.24  ? 221 ARG B CZ   1 
ATOM   3192 N  NH1  . ARG B 1 6   ? 59.959 6.443  -1.470  1.00 94.39  ? 221 ARG B NH1  1 
ATOM   3193 N  NH2  . ARG B 1 6   ? 62.200 6.977  -1.351  1.00 101.70 ? 221 ARG B NH2  1 
ATOM   3194 H  H    . ARG B 1 6   ? 58.397 11.901 -4.666  1.00 59.95  ? 221 ARG B H    1 
ATOM   3195 H  HA   . ARG B 1 6   ? 58.535 9.692  -6.241  1.00 63.45  ? 221 ARG B HA   1 
ATOM   3196 H  HB2  . ARG B 1 6   ? 57.500 10.027 -3.646  1.00 72.91  ? 221 ARG B HB2  1 
ATOM   3197 H  HB3  . ARG B 1 6   ? 57.089 8.763  -4.514  1.00 72.91  ? 221 ARG B HB3  1 
ATOM   3198 H  HG2  . ARG B 1 6   ? 58.855 7.730  -3.898  1.00 79.91  ? 221 ARG B HG2  1 
ATOM   3199 H  HG3  . ARG B 1 6   ? 59.772 8.915  -4.432  1.00 79.91  ? 221 ARG B HG3  1 
ATOM   3200 H  HD2  . ARG B 1 6   ? 59.377 10.018 -2.355  1.00 83.36  ? 221 ARG B HD2  1 
ATOM   3201 H  HD3  . ARG B 1 6   ? 58.722 8.661  -1.841  1.00 83.36  ? 221 ARG B HD3  1 
ATOM   3202 H  HE   . ARG B 1 6   ? 61.362 9.084  -2.176  1.00 89.27  ? 221 ARG B HE   1 
ATOM   3203 H  HH11 . ARG B 1 6   ? 59.150 6.665  -1.656  1.00 113.27 ? 221 ARG B HH11 1 
ATOM   3204 H  HH12 . ARG B 1 6   ? 60.132 5.653  -1.177  1.00 113.27 ? 221 ARG B HH12 1 
ATOM   3205 H  HH21 . ARG B 1 6   ? 62.837 7.544  -1.457  1.00 122.04 ? 221 ARG B HH21 1 
ATOM   3206 H  HH22 . ARG B 1 6   ? 62.371 6.187  -1.056  1.00 122.04 ? 221 ARG B HH22 1 
ATOM   3207 N  N    . GLY B 1 7   ? 56.127 11.707 -6.076  1.00 38.08  ? 222 GLY B N    1 
ATOM   3208 C  CA   . GLY B 1 7   ? 54.819 12.059 -6.582  1.00 36.69  ? 222 GLY B CA   1 
ATOM   3209 C  C    . GLY B 1 7   ? 54.803 13.500 -7.038  1.00 31.95  ? 222 GLY B C    1 
ATOM   3210 O  O    . GLY B 1 7   ? 55.798 14.195 -6.895  1.00 31.24  ? 222 GLY B O    1 
ATOM   3211 H  H    . GLY B 1 7   ? 56.510 12.338 -5.634  1.00 45.69  ? 222 GLY B H    1 
ATOM   3212 H  HA2  . GLY B 1 7   ? 54.591 11.489 -7.333  1.00 44.03  ? 222 GLY B HA2  1 
ATOM   3213 H  HA3  . GLY B 1 7   ? 54.154 11.942 -5.886  1.00 44.03  ? 222 GLY B HA3  1 
ATOM   3214 N  N    . LEU B 1 8   ? 53.681 13.963 -7.560  1.00 29.87  ? 223 LEU B N    1 
ATOM   3215 C  CA   . LEU B 1 8   ? 53.616 15.341 -8.001  1.00 27.86  ? 223 LEU B CA   1 
ATOM   3216 C  C    . LEU B 1 8   ? 53.359 16.227 -6.797  1.00 26.82  ? 223 LEU B C    1 
ATOM   3217 O  O    . LEU B 1 8   ? 52.230 16.423 -6.376  1.00 24.12  ? 223 LEU B O    1 
ATOM   3218 C  CB   . LEU B 1 8   ? 52.534 15.543 -9.060  1.00 29.37  ? 223 LEU B CB   1 
ATOM   3219 C  CG   . LEU B 1 8   ? 52.828 16.707 -10.020 1.00 27.97  ? 223 LEU B CG   1 
ATOM   3220 C  CD1  . LEU B 1 8   ? 51.749 16.720 -11.084 1.00 33.05  ? 223 LEU B CD1  1 
ATOM   3221 C  CD2  . LEU B 1 8   ? 52.878 18.049 -9.266  1.00 24.68  ? 223 LEU B CD2  1 
ATOM   3222 H  H    . LEU B 1 8   ? 52.957 13.510 -7.668  1.00 35.85  ? 223 LEU B H    1 
ATOM   3223 H  HA   . LEU B 1 8   ? 54.470 15.593 -8.387  1.00 33.43  ? 223 LEU B HA   1 
ATOM   3224 H  HB2  . LEU B 1 8   ? 52.458 14.733 -9.588  1.00 35.24  ? 223 LEU B HB2  1 
ATOM   3225 H  HB3  . LEU B 1 8   ? 51.692 15.728 -8.616  1.00 35.24  ? 223 LEU B HB3  1 
ATOM   3226 H  HG   . LEU B 1 8   ? 53.684 16.563 -10.452 1.00 33.57  ? 223 LEU B HG   1 
ATOM   3227 H  HD11 . LEU B 1 8   ? 51.921 17.451 -11.698 1.00 39.66  ? 223 LEU B HD11 1 
ATOM   3228 H  HD12 . LEU B 1 8   ? 51.765 15.875 -11.560 1.00 39.66  ? 223 LEU B HD12 1 
ATOM   3229 H  HD13 . LEU B 1 8   ? 50.887 16.843 -10.656 1.00 39.66  ? 223 LEU B HD13 1 
ATOM   3230 H  HD21 . LEU B 1 8   ? 53.065 18.760 -9.899  1.00 29.62  ? 223 LEU B HD21 1 
ATOM   3231 H  HD22 . LEU B 1 8   ? 52.022 18.203 -8.838  1.00 29.62  ? 223 LEU B HD22 1 
ATOM   3232 H  HD23 . LEU B 1 8   ? 53.580 18.009 -8.597  1.00 29.62  ? 223 LEU B HD23 1 
ATOM   3233 N  N    . GLY B 1 9   ? 54.435 16.768 -6.257  1.00 23.46  ? 224 GLY B N    1 
ATOM   3234 C  CA   . GLY B 1 9   ? 54.330 17.546 -5.062  1.00 22.40  ? 224 GLY B CA   1 
ATOM   3235 C  C    . GLY B 1 9   ? 55.680 17.691 -4.433  1.00 23.39  ? 224 GLY B C    1 
ATOM   3236 O  O    . GLY B 1 9   ? 56.640 17.049 -4.830  1.00 25.10  ? 224 GLY B O    1 
ATOM   3237 H  H    . GLY B 1 9   ? 55.233 16.695 -6.569  1.00 28.16  ? 224 GLY B H    1 
ATOM   3238 H  HA2  . GLY B 1 9   ? 53.982 18.427 -5.269  1.00 26.88  ? 224 GLY B HA2  1 
ATOM   3239 H  HA3  . GLY B 1 9   ? 53.734 17.110 -4.433  1.00 26.88  ? 224 GLY B HA3  1 
ATOM   3240 N  N    . THR B 1 10  ? 55.725 18.581 -3.467  1.00 29.19  ? 225 THR B N    1 
ATOM   3241 C  CA   . THR B 1 10  ? 56.887 18.820 -2.658  1.00 27.27  ? 225 THR B CA   1 
ATOM   3242 C  C    . THR B 1 10  ? 56.455 18.701 -1.212  1.00 27.96  ? 225 THR B C    1 
ATOM   3243 O  O    . THR B 1 10  ? 55.270 18.510 -0.929  1.00 26.31  ? 225 THR B O    1 
ATOM   3244 C  CB   . THR B 1 10  ? 57.472 20.193 -2.903  1.00 30.08  ? 225 THR B CB   1 
ATOM   3245 O  OG1  . THR B 1 10  ? 56.630 21.183 -2.319  1.00 27.24  ? 225 THR B OG1  1 
ATOM   3246 C  CG2  . THR B 1 10  ? 57.590 20.485 -4.404  1.00 33.21  ? 225 THR B CG2  1 
ATOM   3247 H  H    . THR B 1 10  ? 55.058 19.081 -3.254  1.00 35.03  ? 225 THR B H    1 
ATOM   3248 H  HA   . THR B 1 10  ? 57.564 18.150 -2.843  1.00 32.72  ? 225 THR B HA   1 
ATOM   3249 H  HB   . THR B 1 10  ? 58.357 20.244 -2.508  1.00 36.09  ? 225 THR B HB   1 
ATOM   3250 H  HG1  . THR B 1 10  ? 56.950 21.948 -2.452  1.00 32.68  ? 225 THR B HG1  1 
ATOM   3251 H  HG21 . THR B 1 10  ? 57.966 21.368 -4.541  1.00 39.86  ? 225 THR B HG21 1 
ATOM   3252 H  HG22 . THR B 1 10  ? 58.166 19.828 -4.825  1.00 39.86  ? 225 THR B HG22 1 
ATOM   3253 H  HG23 . THR B 1 10  ? 56.714 20.447 -4.818  1.00 39.86  ? 225 THR B HG23 1 
ATOM   3254 N  N    . ALA B 1 11  ? 57.409 18.800 -0.300  1.00 30.80  ? 226 ALA B N    1 
ATOM   3255 C  CA   . ALA B 1 11  ? 57.080 18.770 1.125   1.00 33.29  ? 226 ALA B CA   1 
ATOM   3256 C  C    . ALA B 1 11  ? 56.161 19.927 1.508   1.00 28.76  ? 226 ALA B C    1 
ATOM   3257 O  O    . ALA B 1 11  ? 55.480 19.852 2.503   1.00 28.92  ? 226 ALA B O    1 
ATOM   3258 C  CB   . ALA B 1 11  ? 58.330 18.808 1.944   1.00 33.37  ? 226 ALA B CB   1 
ATOM   3259 H  H    . ALA B 1 11  ? 58.248 18.884 -0.472  1.00 36.96  ? 226 ALA B H    1 
ATOM   3260 H  HA   . ALA B 1 11  ? 56.617 17.941 1.324   1.00 39.95  ? 226 ALA B HA   1 
ATOM   3261 H  HB1  . ALA B 1 11  ? 58.092 18.787 2.884   1.00 40.04  ? 226 ALA B HB1  1 
ATOM   3262 H  HB2  . ALA B 1 11  ? 58.876 18.036 1.724   1.00 40.04  ? 226 ALA B HB2  1 
ATOM   3263 H  HB3  . ALA B 1 11  ? 58.814 19.624 1.743   1.00 40.04  ? 226 ALA B HB3  1 
ATOM   3264 N  N    . ARG B 1 12  ? 56.134 20.976 0.697   1.00 28.88  ? 227 ARG B N    1 
ATOM   3265 C  CA   . ARG B 1 12  ? 55.381 22.189 0.998   1.00 29.96  ? 227 ARG B CA   1 
ATOM   3266 C  C    . ARG B 1 12  ? 53.972 22.194 0.425   1.00 27.25  ? 227 ARG B C    1 
ATOM   3267 O  O    . ARG B 1 12  ? 53.086 22.841 0.962   1.00 24.16  ? 227 ARG B O    1 
ATOM   3268 C  CB   . ARG B 1 12  ? 56.096 23.412 0.442   1.00 31.69  ? 227 ARG B CB   1 
ATOM   3269 C  CG   . ARG B 1 12  ? 56.828 24.176 1.431   1.00 35.62  ? 227 ARG B CG   1 
ATOM   3270 C  CD   . ARG B 1 12  ? 57.276 25.497 0.892   1.00 25.52  ? 227 ARG B CD   1 
ATOM   3271 N  NE   . ARG B 1 12  ? 56.682 26.573 1.659   1.00 27.00  ? 227 ARG B NE   1 
ATOM   3272 C  CZ   . ARG B 1 12  ? 56.820 27.859 1.362   1.00 37.54  ? 227 ARG B CZ   1 
ATOM   3273 N  NH1  . ARG B 1 12  ? 57.541 28.231 0.292   1.00 29.64  ? 227 ARG B NH1  1 
ATOM   3274 N  NH2  . ARG B 1 12  ? 56.218 28.770 2.119   1.00 31.32  ? 227 ARG B NH2  1 
ATOM   3275 H  H    . ARG B 1 12  ? 56.554 21.011 -0.053  1.00 34.65  ? 227 ARG B H    1 
ATOM   3276 H  HA   . ARG B 1 12  ? 55.315 22.289 1.960   1.00 35.96  ? 227 ARG B HA   1 
ATOM   3277 H  HB2  . ARG B 1 12  ? 56.728 23.122 -0.234  1.00 38.03  ? 227 ARG B HB2  1 
ATOM   3278 H  HB3  . ARG B 1 12  ? 55.437 24.002 0.042   1.00 38.03  ? 227 ARG B HB3  1 
ATOM   3279 H  HG2  . ARG B 1 12  ? 56.254 24.339 2.197   1.00 42.75  ? 227 ARG B HG2  1 
ATOM   3280 H  HG3  . ARG B 1 12  ? 57.614 23.676 1.703   1.00 42.75  ? 227 ARG B HG3  1 
ATOM   3281 H  HD2  . ARG B 1 12  ? 58.241 25.565 0.961   1.00 30.62  ? 227 ARG B HD2  1 
ATOM   3282 H  HD3  . ARG B 1 12  ? 56.993 25.584 -0.032  1.00 30.62  ? 227 ARG B HD3  1 
ATOM   3283 H  HE   . ARG B 1 12  ? 56.278 26.370 2.391   1.00 32.40  ? 227 ARG B HE   1 
ATOM   3284 H  HH11 . ARG B 1 12  ? 57.922 27.636 -0.198  1.00 35.57  ? 227 ARG B HH11 1 
ATOM   3285 H  HH12 . ARG B 1 12  ? 57.628 29.065 0.101   1.00 35.57  ? 227 ARG B HH12 1 
ATOM   3286 H  HH21 . ARG B 1 12  ? 55.758 28.525 2.803   1.00 37.59  ? 227 ARG B HH21 1 
ATOM   3287 H  HH22 . ARG B 1 12  ? 56.305 29.606 1.936   1.00 37.59  ? 227 ARG B HH22 1 
ATOM   3288 N  N    . LEU B 1 13  ? 53.792 21.531 -0.713  1.00 21.25  ? 228 LEU B N    1 
ATOM   3289 C  CA   . LEU B 1 13  ? 52.509 21.534 -1.370  1.00 19.62  ? 228 LEU B CA   1 
ATOM   3290 C  C    . LEU B 1 13  ? 52.405 20.303 -2.248  1.00 21.80  ? 228 LEU B C    1 
ATOM   3291 O  O    . LEU B 1 13  ? 53.259 20.115 -3.146  1.00 21.28  ? 228 LEU B O    1 
ATOM   3292 C  CB   . LEU B 1 13  ? 52.321 22.815 -2.223  1.00 18.53  ? 228 LEU B CB   1 
ATOM   3293 C  CG   . LEU B 1 13  ? 50.927 22.948 -2.843  1.00 17.90  ? 228 LEU B CG   1 
ATOM   3294 C  CD1  . LEU B 1 13  ? 50.002 23.435 -1.824  1.00 18.57  ? 228 LEU B CD1  1 
ATOM   3295 C  CD2  . LEU B 1 13  ? 50.924 23.886 -4.030  1.00 17.16  ? 228 LEU B CD2  1 
ATOM   3296 H  H    . LEU B 1 13  ? 54.399 21.076 -1.118  1.00 25.50  ? 228 LEU B H    1 
ATOM   3297 H  HA   . LEU B 1 13  ? 51.804 21.500 -0.705  1.00 23.55  ? 228 LEU B HA   1 
ATOM   3298 H  HB2  . LEU B 1 13  ? 52.469 23.590 -1.659  1.00 22.24  ? 228 LEU B HB2  1 
ATOM   3299 H  HB3  . LEU B 1 13  ? 52.967 22.807 -2.946  1.00 22.24  ? 228 LEU B HB3  1 
ATOM   3300 H  HG   . LEU B 1 13  ? 50.623 22.076 -3.141  1.00 21.48  ? 228 LEU B HG   1 
ATOM   3301 H  HD11 . LEU B 1 13  ? 49.118 23.519 -2.215  1.00 22.28  ? 228 LEU B HD11 1 
ATOM   3302 H  HD12 . LEU B 1 13  ? 49.980 22.801 -1.089  1.00 22.28  ? 228 LEU B HD12 1 
ATOM   3303 H  HD13 . LEU B 1 13  ? 50.308 24.299 -1.507  1.00 22.28  ? 228 LEU B HD13 1 
ATOM   3304 H  HD21 . LEU B 1 13  ? 50.024 23.938 -4.388  1.00 20.59  ? 228 LEU B HD21 1 
ATOM   3305 H  HD22 . LEU B 1 13  ? 51.216 24.764 -3.739  1.00 20.59  ? 228 LEU B HD22 1 
ATOM   3306 H  HD23 . LEU B 1 13  ? 51.530 23.542 -4.705  1.00 20.59  ? 228 LEU B HD23 1 
ATOM   3307 N  N    . GLN B 1 14  ? 51.342 19.516 -2.043  1.00 20.30  ? 229 GLN B N    1 
ATOM   3308 C  CA   . GLN B 1 14  ? 51.057 18.340 -2.877  1.00 21.67  ? 229 GLN B CA   1 
ATOM   3309 C  C    . GLN B 1 14  ? 49.746 18.460 -3.629  1.00 22.84  ? 229 GLN B C    1 
ATOM   3310 O  O    . GLN B 1 14  ? 48.714 18.941 -3.099  1.00 19.87  ? 229 GLN B O    1 
ATOM   3311 C  CB   . GLN B 1 14  ? 50.985 17.046 -2.052  1.00 23.37  ? 229 GLN B CB   1 
ATOM   3312 C  CG   . GLN B 1 14  ? 52.207 16.788 -1.231  1.00 27.52  ? 229 GLN B CG   1 
ATOM   3313 C  CD   . GLN B 1 14  ? 52.127 17.416 0.136   1.00 50.06  ? 229 GLN B CD   1 
ATOM   3314 O  OE1  . GLN B 1 14  ? 51.068 17.396 0.779   1.00 43.72  ? 229 GLN B OE1  1 
ATOM   3315 N  NE2  . GLN B 1 14  ? 53.253 17.981 0.603   1.00 43.78  ? 229 GLN B NE2  1 
ATOM   3316 H  H    . GLN B 1 14  ? 50.765 19.643 -1.419  1.00 24.36  ? 229 GLN B H    1 
ATOM   3317 H  HA   . GLN B 1 14  ? 51.767 18.239 -3.530  1.00 26.00  ? 229 GLN B HA   1 
ATOM   3318 H  HB2  . GLN B 1 14  ? 50.228 17.102 -1.448  1.00 28.04  ? 229 GLN B HB2  1 
ATOM   3319 H  HB3  . GLN B 1 14  ? 50.869 16.296 -2.656  1.00 28.04  ? 229 GLN B HB3  1 
ATOM   3320 H  HG2  . GLN B 1 14  ? 52.315 15.831 -1.116  1.00 33.02  ? 229 GLN B HG2  1 
ATOM   3321 H  HG3  . GLN B 1 14  ? 52.979 17.157 -1.688  1.00 33.02  ? 229 GLN B HG3  1 
ATOM   3322 H  HE21 . GLN B 1 14  ? 53.969 17.971 0.127   1.00 52.54  ? 229 GLN B HE21 1 
ATOM   3323 H  HE22 . GLN B 1 14  ? 53.257 18.353 1.378   1.00 52.54  ? 229 GLN B HE22 1 
ATOM   3324 N  N    . LEU B 1 15  ? 49.796 17.985 -4.865  1.00 23.84  ? 230 LEU B N    1 
ATOM   3325 C  CA   . LEU B 1 15  ? 48.607 17.744 -5.630  1.00 26.10  ? 230 LEU B CA   1 
ATOM   3326 C  C    . LEU B 1 15  ? 47.869 16.555 -5.052  1.00 29.98  ? 230 LEU B C    1 
ATOM   3327 O  O    . LEU B 1 15  ? 48.420 15.496 -4.891  1.00 32.51  ? 230 LEU B O    1 
ATOM   3328 C  CB   . LEU B 1 15  ? 48.950 17.491 -7.095  1.00 26.94  ? 230 LEU B CB   1 
ATOM   3329 C  CG   . LEU B 1 15  ? 47.772 17.373 -8.062  1.00 29.31  ? 230 LEU B CG   1 
ATOM   3330 C  CD1  . LEU B 1 15  ? 47.048 18.683 -8.107  1.00 25.97  ? 230 LEU B CD1  1 
ATOM   3331 C  CD2  . LEU B 1 15  ? 48.229 17.012 -9.453  1.00 46.12  ? 230 LEU B CD2  1 
ATOM   3332 H  H    . LEU B 1 15  ? 50.524 17.795 -5.281  1.00 28.61  ? 230 LEU B H    1 
ATOM   3333 H  HA   . LEU B 1 15  ? 48.028 18.520 -5.580  1.00 31.31  ? 230 LEU B HA   1 
ATOM   3334 H  HB2  . LEU B 1 15  ? 49.505 18.223 -7.407  1.00 32.33  ? 230 LEU B HB2  1 
ATOM   3335 H  HB3  . LEU B 1 15  ? 49.451 16.663 -7.151  1.00 32.33  ? 230 LEU B HB3  1 
ATOM   3336 H  HG   . LEU B 1 15  ? 47.159 16.689 -7.749  1.00 35.17  ? 230 LEU B HG   1 
ATOM   3337 H  HD11 . LEU B 1 15  ? 46.300 18.609 -8.720  1.00 31.17  ? 230 LEU B HD11 1 
ATOM   3338 H  HD12 . LEU B 1 15  ? 46.726 18.896 -7.217  1.00 31.17  ? 230 LEU B HD12 1 
ATOM   3339 H  HD13 . LEU B 1 15  ? 47.660 19.371 -8.412  1.00 31.17  ? 230 LEU B HD13 1 
ATOM   3340 H  HD21 . LEU B 1 15  ? 47.454 16.947 -10.033 1.00 55.34  ? 230 LEU B HD21 1 
ATOM   3341 H  HD22 . LEU B 1 15  ? 48.828 17.703 -9.777  1.00 55.34  ? 230 LEU B HD22 1 
ATOM   3342 H  HD23 . LEU B 1 15  ? 48.692 16.161 -9.422  1.00 55.34  ? 230 LEU B HD23 1 
ATOM   3343 N  N    . VAL B 1 16  ? 46.611 16.724 -4.716  1.00 24.38  ? 231 VAL B N    1 
ATOM   3344 C  CA   . VAL B 1 16  ? 45.844 15.597 -4.252  1.00 24.69  ? 231 VAL B CA   1 
ATOM   3345 C  C    . VAL B 1 16  ? 45.135 15.035 -5.427  1.00 24.55  ? 231 VAL B C    1 
ATOM   3346 O  O    . VAL B 1 16  ? 45.075 13.826 -5.632  1.00 28.07  ? 231 VAL B O    1 
ATOM   3347 C  CB   . VAL B 1 16  ? 44.863 16.002 -3.155  1.00 24.05  ? 231 VAL B CB   1 
ATOM   3348 C  CG1  . VAL B 1 16  ? 43.777 14.977 -2.965  1.00 27.92  ? 231 VAL B CG1  1 
ATOM   3349 C  CG2  . VAL B 1 16  ? 45.602 16.168 -1.924  1.00 27.15  ? 231 VAL B CG2  1 
ATOM   3350 H  H    . VAL B 1 16  ? 46.183 17.469 -4.746  1.00 29.26  ? 231 VAL B H    1 
ATOM   3351 H  HA   . VAL B 1 16  ? 46.442 14.920 -3.898  1.00 29.63  ? 231 VAL B HA   1 
ATOM   3352 H  HB   . VAL B 1 16  ? 44.451 16.850 -3.384  1.00 28.86  ? 231 VAL B HB   1 
ATOM   3353 H  HG11 . VAL B 1 16  ? 43.180 15.276 -2.261  1.00 33.50  ? 231 VAL B HG11 1 
ATOM   3354 H  HG12 . VAL B 1 16  ? 43.286 14.879 -3.796  1.00 33.50  ? 231 VAL B HG12 1 
ATOM   3355 H  HG13 . VAL B 1 16  ? 44.182 14.130 -2.718  1.00 33.50  ? 231 VAL B HG13 1 
ATOM   3356 H  HG21 . VAL B 1 16  ? 44.987 16.425 -1.220  1.00 32.58  ? 231 VAL B HG21 1 
ATOM   3357 H  HG22 . VAL B 1 16  ? 46.031 15.328 -1.699  1.00 32.58  ? 231 VAL B HG22 1 
ATOM   3358 H  HG23 . VAL B 1 16  ? 46.271 16.859 -2.049  1.00 32.58  ? 231 VAL B HG23 1 
ATOM   3359 N  N    . GLU B 1 17  ? 44.537 15.934 -6.179  1.00 26.21  ? 232 GLU B N    1 
ATOM   3360 C  CA   . GLU B 1 17  ? 43.705 15.513 -7.241  1.00 24.13  ? 232 GLU B CA   1 
ATOM   3361 C  C    . GLU B 1 17  ? 43.561 16.574 -8.314  1.00 25.31  ? 232 GLU B C    1 
ATOM   3362 O  O    . GLU B 1 17  ? 43.528 17.772 -8.055  1.00 25.77  ? 232 GLU B O    1 
ATOM   3363 C  CB   . GLU B 1 17  ? 42.339 15.087 -6.714  1.00 28.20  ? 232 GLU B CB   1 
ATOM   3364 C  CG   . GLU B 1 17  ? 41.774 13.963 -7.586  1.00 54.85  ? 232 GLU B CG   1 
ATOM   3365 C  CD   . GLU B 1 17  ? 40.799 13.077 -6.865  1.00 66.83  ? 232 GLU B CD   1 
ATOM   3366 O  OE1  . GLU B 1 17  ? 41.102 12.640 -5.721  1.00 73.72  ? 232 GLU B OE1  1 
ATOM   3367 O  OE2  . GLU B 1 17  ? 39.735 12.819 -7.472  1.00 57.42  ? 232 GLU B OE2  1 
ATOM   3368 H  H    . GLU B 1 17  ? 44.605 16.786 -6.085  1.00 31.46  ? 232 GLU B H    1 
ATOM   3369 H  HA   . GLU B 1 17  ? 44.110 14.735 -7.657  1.00 28.95  ? 232 GLU B HA   1 
ATOM   3370 H  HB2  . GLU B 1 17  ? 42.429 14.758 -5.806  1.00 33.84  ? 232 GLU B HB2  1 
ATOM   3371 H  HB3  . GLU B 1 17  ? 41.728 15.840 -6.746  1.00 33.84  ? 232 GLU B HB3  1 
ATOM   3372 H  HG2  . GLU B 1 17  ? 41.314 14.356 -8.344  1.00 65.82  ? 232 GLU B HG2  1 
ATOM   3373 H  HG3  . GLU B 1 17  ? 42.507 13.409 -7.896  1.00 65.82  ? 232 GLU B HG3  1 
ATOM   3374 N  N    . PHE B 1 18  ? 43.496 16.104 -9.547  1.00 23.17  ? 233 PHE B N    1 
ATOM   3375 C  CA   . PHE B 1 18  ? 43.256 16.989 -10.667 1.00 21.25  ? 233 PHE B CA   1 
ATOM   3376 C  C    . PHE B 1 18  ? 42.413 16.286 -11.739 1.00 21.16  ? 233 PHE B C    1 
ATOM   3377 O  O    . PHE B 1 18  ? 42.658 15.128 -12.057 1.00 22.70  ? 233 PHE B O    1 
ATOM   3378 C  CB   . PHE B 1 18  ? 44.551 17.465 -11.282 1.00 19.35  ? 233 PHE B CB   1 
ATOM   3379 C  CG   . PHE B 1 18  ? 44.344 18.294 -12.459 1.00 19.96  ? 233 PHE B CG   1 
ATOM   3380 C  CD1  . PHE B 1 18  ? 43.983 19.624 -12.324 1.00 20.81  ? 233 PHE B CD1  1 
ATOM   3381 C  CD2  . PHE B 1 18  ? 44.450 17.761 -13.721 1.00 29.08  ? 233 PHE B CD2  1 
ATOM   3382 C  CE1  . PHE B 1 18  ? 43.799 20.425 -13.456 1.00 24.68  ? 233 PHE B CE1  1 
ATOM   3383 C  CE2  . PHE B 1 18  ? 44.260 18.558 -14.859 1.00 29.25  ? 233 PHE B CE2  1 
ATOM   3384 C  CZ   . PHE B 1 18  ? 43.926 19.893 -14.711 1.00 31.89  ? 233 PHE B CZ   1 
ATOM   3385 H  H    . PHE B 1 18  ? 43.588 15.277 -9.762  1.00 27.81  ? 233 PHE B H    1 
ATOM   3386 H  HA   . PHE B 1 18  ? 42.765 17.767 -10.358 1.00 25.50  ? 233 PHE B HA   1 
ATOM   3387 H  HB2  . PHE B 1 18  ? 45.038 17.990 -10.628 1.00 23.22  ? 233 PHE B HB2  1 
ATOM   3388 H  HB3  . PHE B 1 18  ? 45.077 16.694 -11.547 1.00 23.22  ? 233 PHE B HB3  1 
ATOM   3389 H  HD1  . PHE B 1 18  ? 43.908 19.999 -11.476 1.00 24.97  ? 233 PHE B HD1  1 
ATOM   3390 H  HD2  . PHE B 1 18  ? 44.687 16.867 -13.823 1.00 34.90  ? 233 PHE B HD2  1 
ATOM   3391 H  HE1  . PHE B 1 18  ? 43.568 21.320 -13.355 1.00 29.61  ? 233 PHE B HE1  1 
ATOM   3392 H  HE2  . PHE B 1 18  ? 44.347 18.189 -15.708 1.00 35.11  ? 233 PHE B HE2  1 
ATOM   3393 H  HZ   . PHE B 1 18  ? 43.787 20.425 -15.460 1.00 38.26  ? 233 PHE B HZ   1 
ATOM   3394 N  N    . SER B 1 19  ? 41.429 16.980 -12.287 1.00 22.74  ? 234 SER B N    1 
ATOM   3395 C  CA   . SER B 1 19  ? 40.672 16.394 -13.377 1.00 20.23  ? 234 SER B CA   1 
ATOM   3396 C  C    . SER B 1 19  ? 40.037 17.470 -14.215 1.00 18.30  ? 234 SER B C    1 
ATOM   3397 O  O    . SER B 1 19  ? 39.712 18.547 -13.735 1.00 16.87  ? 234 SER B O    1 
ATOM   3398 C  CB   . SER B 1 19  ? 39.603 15.461 -12.845 1.00 27.67  ? 234 SER B CB   1 
ATOM   3399 O  OG   . SER B 1 19  ? 38.717 16.234 -12.092 1.00 26.77  ? 234 SER B OG   1 
ATOM   3400 H  H    . SER B 1 19  ? 41.185 17.771 -12.054 1.00 27.28  ? 234 SER B H    1 
ATOM   3401 H  HA   . SER B 1 19  ? 41.270 15.881 -13.943 1.00 24.27  ? 234 SER B HA   1 
ATOM   3402 H  HB2  . SER B 1 19  ? 39.130 15.050 -13.586 1.00 33.21  ? 234 SER B HB2  1 
ATOM   3403 H  HB3  . SER B 1 19  ? 40.010 14.786 -12.280 1.00 33.21  ? 234 SER B HB3  1 
ATOM   3404 H  HG   . SER B 1 19  ? 38.107 15.748 -11.779 1.00 32.13  ? 234 SER B HG   1 
ATOM   3405 N  N    . ALA B 1 20  ? 39.861 17.143 -15.476 1.00 18.32  ? 235 ALA B N    1 
ATOM   3406 C  CA   . ALA B 1 20  ? 39.112 17.940 -16.401 1.00 15.73  ? 235 ALA B CA   1 
ATOM   3407 C  C    . ALA B 1 20  ? 37.994 17.025 -16.902 1.00 15.81  ? 235 ALA B C    1 
ATOM   3408 O  O    . ALA B 1 20  ? 38.236 15.892 -17.243 1.00 16.80  ? 235 ALA B O    1 
ATOM   3409 C  CB   . ALA B 1 20  ? 40.013 18.438 -17.563 1.00 15.14  ? 235 ALA B CB   1 
ATOM   3410 H  H    . ALA B 1 20  ? 40.185 16.429 -15.830 1.00 21.99  ? 235 ALA B H    1 
ATOM   3411 H  HA   . ALA B 1 20  ? 38.722 18.704 -15.947 1.00 18.87  ? 235 ALA B HA   1 
ATOM   3412 H  HB1  . ALA B 1 20  ? 39.478 18.973 -18.170 1.00 18.17  ? 235 ALA B HB1  1 
ATOM   3413 H  HB2  . ALA B 1 20  ? 40.734 18.974 -17.197 1.00 18.17  ? 235 ALA B HB2  1 
ATOM   3414 H  HB3  . ALA B 1 20  ? 40.377 17.670 -18.031 1.00 18.17  ? 235 ALA B HB3  1 
ATOM   3415 N  N    . PHE B 1 21  ? 36.780 17.529 -16.968 1.00 15.75  ? 236 PHE B N    1 
ATOM   3416 C  CA   . PHE B 1 21  ? 35.664 16.646 -17.190 1.00 16.91  ? 236 PHE B CA   1 
ATOM   3417 C  C    . PHE B 1 21  ? 34.521 17.316 -17.889 1.00 16.67  ? 236 PHE B C    1 
ATOM   3418 O  O    . PHE B 1 21  ? 34.467 18.546 -18.000 1.00 18.12  ? 236 PHE B O    1 
ATOM   3419 C  CB   . PHE B 1 21  ? 35.172 16.061 -15.838 1.00 18.42  ? 236 PHE B CB   1 
ATOM   3420 C  CG   . PHE B 1 21  ? 34.682 17.086 -14.872 1.00 18.46  ? 236 PHE B CG   1 
ATOM   3421 C  CD1  . PHE B 1 21  ? 33.364 17.475 -14.863 1.00 19.31  ? 236 PHE B CD1  1 
ATOM   3422 C  CD2  . PHE B 1 21  ? 35.548 17.671 -13.982 1.00 20.60  ? 236 PHE B CD2  1 
ATOM   3423 C  CE1  . PHE B 1 21  ? 32.903 18.427 -13.953 1.00 23.93  ? 236 PHE B CE1  1 
ATOM   3424 C  CE2  . PHE B 1 21  ? 35.102 18.616 -13.066 1.00 18.44  ? 236 PHE B CE2  1 
ATOM   3425 C  CZ   . PHE B 1 21  ? 33.754 18.982 -13.053 1.00 20.25  ? 236 PHE B CZ   1 
ATOM   3426 H  H    . PHE B 1 21  ? 36.580 18.361 -16.890 1.00 18.90  ? 236 PHE B H    1 
ATOM   3427 H  HA   . PHE B 1 21  ? 35.957 15.906 -17.744 1.00 20.29  ? 236 PHE B HA   1 
ATOM   3428 H  HB2  . PHE B 1 21  ? 34.442 15.447 -16.012 1.00 22.10  ? 236 PHE B HB2  1 
ATOM   3429 H  HB3  . PHE B 1 21  ? 35.907 15.587 -15.418 1.00 22.10  ? 236 PHE B HB3  1 
ATOM   3430 H  HD1  . PHE B 1 21  ? 32.768 17.087 -15.461 1.00 23.18  ? 236 PHE B HD1  1 
ATOM   3431 H  HD2  . PHE B 1 21  ? 36.442 17.414 -13.976 1.00 24.72  ? 236 PHE B HD2  1 
ATOM   3432 H  HE1  . PHE B 1 21  ? 32.006 18.671 -13.953 1.00 28.72  ? 236 PHE B HE1  1 
ATOM   3433 H  HE2  . PHE B 1 21  ? 35.697 18.999 -12.462 1.00 22.13  ? 236 PHE B HE2  1 
ATOM   3434 H  HZ   . PHE B 1 21  ? 33.449 19.627 -12.456 1.00 24.30  ? 236 PHE B HZ   1 
ATOM   3435 N  N    . VAL B 1 22  ? 33.602 16.479 -18.370 1.00 22.88  ? 237 VAL B N    1 
ATOM   3436 C  CA   . VAL B 1 22  ? 32.347 16.980 -18.870 1.00 21.53  ? 237 VAL B CA   1 
ATOM   3437 C  C    . VAL B 1 22  ? 31.164 16.181 -18.320 1.00 24.70  ? 237 VAL B C    1 
ATOM   3438 O  O    . VAL B 1 22  ? 31.171 14.970 -18.279 1.00 24.91  ? 237 VAL B O    1 
ATOM   3439 C  CB   . VAL B 1 22  ? 32.305 17.005 -20.413 1.00 21.21  ? 237 VAL B CB   1 
ATOM   3440 C  CG1  . VAL B 1 22  ? 32.514 15.662 -21.025 1.00 24.87  ? 237 VAL B CG1  1 
ATOM   3441 C  CG2  . VAL B 1 22  ? 30.962 17.583 -20.869 1.00 21.62  ? 237 VAL B CG2  1 
ATOM   3442 H  H    . VAL B 1 22  ? 33.689 15.624 -18.414 1.00 27.45  ? 237 VAL B H    1 
ATOM   3443 H  HA   . VAL B 1 22  ? 32.243 17.894 -18.565 1.00 25.84  ? 237 VAL B HA   1 
ATOM   3444 H  HB   . VAL B 1 22  ? 33.007 17.592 -20.736 1.00 25.45  ? 237 VAL B HB   1 
ATOM   3445 H  HG11 . VAL B 1 22  ? 32.477 15.746 -21.991 1.00 29.84  ? 237 VAL B HG11 1 
ATOM   3446 H  HG12 . VAL B 1 22  ? 33.382 15.324 -20.755 1.00 29.84  ? 237 VAL B HG12 1 
ATOM   3447 H  HG13 . VAL B 1 22  ? 31.815 15.064 -20.718 1.00 29.84  ? 237 VAL B HG13 1 
ATOM   3448 H  HG21 . VAL B 1 22  ? 30.938 17.598 -21.839 1.00 25.95  ? 237 VAL B HG21 1 
ATOM   3449 H  HG22 . VAL B 1 22  ? 30.247 17.023 -20.529 1.00 25.95  ? 237 VAL B HG22 1 
ATOM   3450 H  HG23 . VAL B 1 22  ? 30.872 18.484 -20.521 1.00 25.95  ? 237 VAL B HG23 1 
ATOM   3451 N  N    . GLU B 1 23  ? 30.143 16.907 -17.898 1.00 20.71  ? 238 GLU B N    1 
ATOM   3452 C  CA   . GLU B 1 23  ? 28.918 16.289 -17.458 1.00 24.19  ? 238 GLU B CA   1 
ATOM   3453 C  C    . GLU B 1 23  ? 27.860 16.495 -18.530 1.00 23.61  ? 238 GLU B C    1 
ATOM   3454 O  O    . GLU B 1 23  ? 27.643 17.622 -18.938 1.00 27.50  ? 238 GLU B O    1 
ATOM   3455 C  CB   . GLU B 1 23  ? 28.451 16.912 -16.141 1.00 27.90  ? 238 GLU B CB   1 
ATOM   3456 C  CG   . GLU B 1 23  ? 29.343 16.621 -14.985 1.00 29.19  ? 238 GLU B CG   1 
ATOM   3457 C  CD   . GLU B 1 23  ? 29.056 17.525 -13.802 1.00 27.98  ? 238 GLU B CD   1 
ATOM   3458 O  OE1  . GLU B 1 23  ? 28.251 18.473 -13.938 1.00 35.06  ? 238 GLU B OE1  1 
ATOM   3459 O  OE2  . GLU B 1 23  ? 29.622 17.281 -12.724 1.00 30.11  ? 238 GLU B OE2  1 
ATOM   3460 H  H    . GLU B 1 23  ? 30.139 17.766 -17.858 1.00 24.86  ? 238 GLU B H    1 
ATOM   3461 H  HA   . GLU B 1 23  ? 29.055 15.337 -17.327 1.00 29.03  ? 238 GLU B HA   1 
ATOM   3462 H  HB2  . GLU B 1 23  ? 28.410 17.875 -16.249 1.00 33.48  ? 238 GLU B HB2  1 
ATOM   3463 H  HB3  . GLU B 1 23  ? 27.570 16.567 -15.928 1.00 33.48  ? 238 GLU B HB3  1 
ATOM   3464 H  HG2  . GLU B 1 23  ? 29.210 15.703 -14.703 1.00 35.02  ? 238 GLU B HG2  1 
ATOM   3465 H  HG3  . GLU B 1 23  ? 30.266 16.758 -15.253 1.00 35.02  ? 238 GLU B HG3  1 
ATOM   3466 N  N    . PRO B 1 24  ? 27.187 15.438 -18.975 1.00 31.01  ? 239 PRO B N    1 
ATOM   3467 C  CA   . PRO B 1 24  ? 26.157 15.674 -19.993 1.00 33.15  ? 239 PRO B CA   1 
ATOM   3468 C  C    . PRO B 1 24  ? 24.974 16.463 -19.450 1.00 35.22  ? 239 PRO B C    1 
ATOM   3469 O  O    . PRO B 1 24  ? 24.795 16.529 -18.244 1.00 41.27  ? 239 PRO B O    1 
ATOM   3470 C  CB   . PRO B 1 24  ? 25.729 14.273 -20.376 1.00 35.07  ? 239 PRO B CB   1 
ATOM   3471 C  CG   . PRO B 1 24  ? 25.961 13.473 -19.091 1.00 39.14  ? 239 PRO B CG   1 
ATOM   3472 C  CD   . PRO B 1 24  ? 27.305 14.011 -18.638 1.00 35.84  ? 239 PRO B CD   1 
ATOM   3473 H  HA   . PRO B 1 24  ? 26.531 16.127 -20.765 1.00 39.78  ? 239 PRO B HA   1 
ATOM   3474 H  HB2  . PRO B 1 24  ? 24.792 14.268 -20.625 1.00 42.08  ? 239 PRO B HB2  1 
ATOM   3475 H  HB3  . PRO B 1 24  ? 26.285 13.941 -21.098 1.00 42.08  ? 239 PRO B HB3  1 
ATOM   3476 H  HG2  . PRO B 1 24  ? 25.266 13.667 -18.443 1.00 46.96  ? 239 PRO B HG2  1 
ATOM   3477 H  HG3  . PRO B 1 24  ? 26.009 12.525 -19.289 1.00 46.96  ? 239 PRO B HG3  1 
ATOM   3478 H  HD2  . PRO B 1 24  ? 27.416 13.893 -17.682 1.00 43.01  ? 239 PRO B HD2  1 
ATOM   3479 H  HD3  . PRO B 1 24  ? 28.026 13.599 -19.140 1.00 43.01  ? 239 PRO B HD3  1 
ATOM   3480 N  N    . PRO B 1 25  ? 24.165 17.054 -20.328 1.00 38.93  ? 240 PRO B N    1 
ATOM   3481 C  CA   . PRO B 1 25  ? 22.955 17.765 -19.898 1.00 39.74  ? 240 PRO B CA   1 
ATOM   3482 C  C    . PRO B 1 25  ? 22.002 16.920 -19.034 1.00 44.58  ? 240 PRO B C    1 
ATOM   3483 O  O    . PRO B 1 25  ? 21.422 17.448 -18.080 1.00 53.46  ? 240 PRO B O    1 
ATOM   3484 C  CB   . PRO B 1 25  ? 22.272 18.119 -21.211 1.00 40.98  ? 240 PRO B CB   1 
ATOM   3485 C  CG   . PRO B 1 25  ? 23.339 18.106 -22.234 1.00 44.80  ? 240 PRO B CG   1 
ATOM   3486 C  CD   . PRO B 1 25  ? 24.308 17.038 -21.793 1.00 45.06  ? 240 PRO B CD   1 
ATOM   3487 H  HA   . PRO B 1 25  ? 23.188 18.578 -19.424 1.00 47.68  ? 240 PRO B HA   1 
ATOM   3488 H  HB2  . PRO B 1 25  ? 21.595 17.455 -21.415 1.00 49.17  ? 240 PRO B HB2  1 
ATOM   3489 H  HB3  . PRO B 1 25  ? 21.875 19.002 -21.143 1.00 49.17  ? 240 PRO B HB3  1 
ATOM   3490 H  HG2  . PRO B 1 25  ? 22.959 17.886 -23.099 1.00 53.76  ? 240 PRO B HG2  1 
ATOM   3491 H  HG3  . PRO B 1 25  ? 23.775 18.972 -22.262 1.00 53.76  ? 240 PRO B HG3  1 
ATOM   3492 H  HD2  . PRO B 1 25  ? 24.048 16.174 -22.150 1.00 54.07  ? 240 PRO B HD2  1 
ATOM   3493 H  HD3  . PRO B 1 25  ? 25.213 17.273 -22.049 1.00 54.07  ? 240 PRO B HD3  1 
ATOM   3494 N  N    . ASP B 1 26  ? 21.843 15.635 -19.350 1.00 59.75  ? 241 ASP B N    1 
ATOM   3495 C  CA   . ASP B 1 26  ? 20.924 14.789 -18.586 1.00 74.31  ? 241 ASP B CA   1 
ATOM   3496 C  C    . ASP B 1 26  ? 21.544 14.233 -17.288 1.00 75.12  ? 241 ASP B C    1 
ATOM   3497 O  O    . ASP B 1 26  ? 21.024 13.284 -16.693 1.00 74.47  ? 241 ASP B O    1 
ATOM   3498 C  CB   . ASP B 1 26  ? 20.407 13.632 -19.465 1.00 73.78  ? 241 ASP B CB   1 
ATOM   3499 C  CG   . ASP B 1 26  ? 21.499 12.646 -19.866 1.00 79.96  ? 241 ASP B CG   1 
ATOM   3500 O  OD1  . ASP B 1 26  ? 21.216 11.773 -20.721 1.00 90.75  ? 241 ASP B OD1  1 
ATOM   3501 O  OD2  . ASP B 1 26  ? 22.627 12.733 -19.338 1.00 75.86  ? 241 ASP B OD2  1 
ATOM   3502 H  H    . ASP B 1 26  ? 22.248 15.233 -19.994 1.00 71.70  ? 241 ASP B H    1 
ATOM   3503 H  HA   . ASP B 1 26  ? 20.156 15.324 -18.333 1.00 89.18  ? 241 ASP B HA   1 
ATOM   3504 H  HB2  . ASP B 1 26  ? 19.729 13.143 -18.974 1.00 88.54  ? 241 ASP B HB2  1 
ATOM   3505 H  HB3  . ASP B 1 26  ? 20.026 14.001 -20.277 1.00 88.54  ? 241 ASP B HB3  1 
ATOM   3506 N  N    . ALA B 1 27  ? 22.645 14.832 -16.841 1.00 61.44  ? 242 ALA B N    1 
ATOM   3507 C  CA   . ALA B 1 27  ? 23.330 14.365 -15.637 1.00 50.24  ? 242 ALA B CA   1 
ATOM   3508 C  C    . ALA B 1 27  ? 22.460 14.592 -14.403 1.00 47.47  ? 242 ALA B C    1 
ATOM   3509 O  O    . ALA B 1 27  ? 22.698 13.993 -13.352 1.00 50.59  ? 242 ALA B O    1 
ATOM   3510 C  CB   . ALA B 1 27  ? 24.660 15.067 -15.474 1.00 40.33  ? 242 ALA B CB   1 
ATOM   3511 H  H    . ALA B 1 27  ? 23.016 15.512 -17.216 1.00 73.72  ? 242 ALA B H    1 
ATOM   3512 H  HA   . ALA B 1 27  ? 23.499 13.414 -15.716 1.00 60.29  ? 242 ALA B HA   1 
ATOM   3513 H  HB1  . ALA B 1 27  ? 25.093 14.741 -14.670 1.00 48.40  ? 242 ALA B HB1  1 
ATOM   3514 H  HB2  . ALA B 1 27  ? 25.213 14.878 -16.248 1.00 48.40  ? 242 ALA B HB2  1 
ATOM   3515 H  HB3  . ALA B 1 27  ? 24.506 16.022 -15.403 1.00 48.40  ? 242 ALA B HB3  1 
ATOM   3516 N  N    . VAL B 1 28  ? 21.472 15.475 -14.549 1.00 54.62  ? 243 VAL B N    1 
ATOM   3517 C  CA   . VAL B 1 28  ? 20.512 15.792 -13.501 1.00 54.77  ? 243 VAL B CA   1 
ATOM   3518 C  C    . VAL B 1 28  ? 19.520 14.647 -13.300 1.00 59.76  ? 243 VAL B C    1 
ATOM   3519 O  O    . VAL B 1 28  ? 18.907 14.538 -12.236 1.00 57.68  ? 243 VAL B O    1 
ATOM   3520 C  CB   . VAL B 1 28  ? 19.756 17.093 -13.815 1.00 55.37  ? 243 VAL B CB   1 
ATOM   3521 C  CG1  . VAL B 1 28  ? 20.700 18.274 -13.822 1.00 51.85  ? 243 VAL B CG1  1 
ATOM   3522 C  CG2  . VAL B 1 28  ? 19.049 16.970 -15.150 1.00 69.09  ? 243 VAL B CG2  1 
ATOM   3523 H  H    . VAL B 1 28  ? 21.337 15.918 -15.274 1.00 65.54  ? 243 VAL B H    1 
ATOM   3524 H  HA   . VAL B 1 28  ? 20.990 15.920 -12.667 1.00 65.72  ? 243 VAL B HA   1 
ATOM   3525 H  HB   . VAL B 1 28  ? 19.085 17.245 -13.131 1.00 66.44  ? 243 VAL B HB   1 
ATOM   3526 H  HG11 . VAL B 1 28  ? 20.196 19.079 -14.022 1.00 62.22  ? 243 VAL B HG11 1 
ATOM   3527 H  HG12 . VAL B 1 28  ? 21.114 18.352 -12.948 1.00 62.22  ? 243 VAL B HG12 1 
ATOM   3528 H  HG13 . VAL B 1 28  ? 21.379 18.131 -14.499 1.00 62.22  ? 243 VAL B HG13 1 
ATOM   3529 H  HG21 . VAL B 1 28  ? 18.577 17.798 -15.334 1.00 82.91  ? 243 VAL B HG21 1 
ATOM   3530 H  HG22 . VAL B 1 28  ? 19.708 16.804 -15.842 1.00 82.91  ? 243 VAL B HG22 1 
ATOM   3531 H  HG23 . VAL B 1 28  ? 18.420 16.233 -15.108 1.00 82.91  ? 243 VAL B HG23 1 
ATOM   3532 N  N    . ASP B 1 29  ? 19.362 13.795 -14.309 1.00 62.76  ? 244 ASP B N    1 
ATOM   3533 C  CA   . ASP B 1 29  ? 18.525 12.598 -14.167 1.00 79.62  ? 244 ASP B CA   1 
ATOM   3534 C  C    . ASP B 1 29  ? 19.334 11.460 -13.566 1.00 79.99  ? 244 ASP B C    1 
ATOM   3535 O  O    . ASP B 1 29  ? 19.057 10.984 -12.463 1.00 86.80  ? 244 ASP B O    1 
ATOM   3536 C  CB   . ASP B 1 29  ? 17.953 12.159 -15.516 1.00 80.45  ? 244 ASP B CB   1 
ATOM   3537 C  CG   . ASP B 1 29  ? 17.215 13.272 -16.229 1.00 78.58  ? 244 ASP B CG   1 
ATOM   3538 O  OD1  . ASP B 1 29  ? 16.607 14.129 -15.549 1.00 74.57  ? 244 ASP B OD1  1 
ATOM   3539 O  OD2  . ASP B 1 29  ? 17.241 13.284 -17.476 1.00 85.60  ? 244 ASP B OD2  1 
ATOM   3540 H  H    . ASP B 1 29  ? 19.724 13.883 -15.083 1.00 75.31  ? 244 ASP B H    1 
ATOM   3541 H  HA   . ASP B 1 29  ? 17.784 12.793 -13.571 1.00 95.54  ? 244 ASP B HA   1 
ATOM   3542 H  HB2  . ASP B 1 29  ? 18.680 11.867 -16.087 1.00 96.54  ? 244 ASP B HB2  1 
ATOM   3543 H  HB3  . ASP B 1 29  ? 17.330 11.429 -15.373 1.00 96.54  ? 244 ASP B HB3  1 
ATOM   3544 N  N    . SER B 1 30  ? 20.328 11.019 -14.320 1.00 58.80  ? 245 SER B N    1 
ATOM   3545 C  CA   . SER B 1 30  ? 21.298 10.068 -13.820 1.00 57.19  ? 245 SER B CA   1 
ATOM   3546 C  C    . SER B 1 30  ? 22.661 10.720 -13.979 1.00 58.72  ? 245 SER B C    1 
ATOM   3547 O  O    . SER B 1 30  ? 23.001 11.235 -15.040 1.00 60.41  ? 245 SER B O    1 
ATOM   3548 C  CB   . SER B 1 30  ? 21.213 8.739  -14.569 1.00 57.74  ? 245 SER B CB   1 
ATOM   3549 O  OG   . SER B 1 30  ? 21.763 7.692  -13.793 1.00 74.50  ? 245 SER B OG   1 
ATOM   3550 H  H    . SER B 1 30  ? 20.463 11.260 -15.134 1.00 70.56  ? 245 SER B H    1 
ATOM   3551 H  HA   . SER B 1 30  ? 21.139 9.904  -12.877 1.00 68.63  ? 245 SER B HA   1 
ATOM   3552 H  HB2  . SER B 1 30  ? 20.282 8.539  -14.754 1.00 69.29  ? 245 SER B HB2  1 
ATOM   3553 H  HB3  . SER B 1 30  ? 21.710 8.811  -15.399 1.00 69.29  ? 245 SER B HB3  1 
ATOM   3554 H  HG   . SER B 1 30  ? 21.712 6.966  -14.213 1.00 89.40  ? 245 SER B HG   1 
ATOM   3555 N  N    . TYR B 1 31  ? 23.431 10.741 -12.906 1.00 50.88  ? 246 TYR B N    1 
ATOM   3556 C  CA   . TYR B 1 31  ? 24.667 11.470 -12.933 1.00 45.18  ? 246 TYR B CA   1 
ATOM   3557 C  C    . TYR B 1 31  ? 25.788 10.684 -13.600 1.00 45.77  ? 246 TYR B C    1 
ATOM   3558 O  O    . TYR B 1 31  ? 26.036 9.521  -13.310 1.00 42.37  ? 246 TYR B O    1 
ATOM   3559 C  CB   . TYR B 1 31  ? 25.114 11.864 -11.530 1.00 45.80  ? 246 TYR B CB   1 
ATOM   3560 C  CG   . TYR B 1 31  ? 26.371 12.673 -11.600 1.00 37.07  ? 246 TYR B CG   1 
ATOM   3561 C  CD1  . TYR B 1 31  ? 26.326 14.019 -11.907 1.00 35.51  ? 246 TYR B CD1  1 
ATOM   3562 C  CD2  . TYR B 1 31  ? 27.598 12.078 -11.439 1.00 35.21  ? 246 TYR B CD2  1 
ATOM   3563 C  CE1  . TYR B 1 31  ? 27.490 14.766 -12.008 1.00 32.67  ? 246 TYR B CE1  1 
ATOM   3564 C  CE2  . TYR B 1 31  ? 28.764 12.815 -11.545 1.00 33.47  ? 246 TYR B CE2  1 
ATOM   3565 C  CZ   . TYR B 1 31  ? 28.696 14.150 -11.832 1.00 30.61  ? 246 TYR B CZ   1 
ATOM   3566 O  OH   . TYR B 1 31  ? 29.866 14.852 -11.939 1.00 29.24  ? 246 TYR B OH   1 
ATOM   3567 H  H    . TYR B 1 31  ? 23.259 10.345 -12.162 1.00 61.06  ? 246 TYR B H    1 
ATOM   3568 H  HA   . TYR B 1 31  ? 24.535 12.286 -13.441 1.00 54.21  ? 246 TYR B HA   1 
ATOM   3569 H  HB2  . TYR B 1 31  ? 24.425 12.400 -11.108 1.00 54.97  ? 246 TYR B HB2  1 
ATOM   3570 H  HB3  . TYR B 1 31  ? 25.290 11.065 -11.009 1.00 54.97  ? 246 TYR B HB3  1 
ATOM   3571 H  HD1  . TYR B 1 31  ? 25.502 14.433 -12.030 1.00 42.61  ? 246 TYR B HD1  1 
ATOM   3572 H  HD2  . TYR B 1 31  ? 27.646 11.169 -11.249 1.00 42.25  ? 246 TYR B HD2  1 
ATOM   3573 H  HE1  . TYR B 1 31  ? 27.450 15.674 -12.207 1.00 39.20  ? 246 TYR B HE1  1 
ATOM   3574 H  HE2  . TYR B 1 31  ? 29.590 12.404 -11.425 1.00 40.17  ? 246 TYR B HE2  1 
ATOM   3575 H  HH   . TYR B 1 31  ? 29.703 15.657 -12.116 1.00 35.09  ? 246 TYR B HH   1 
ATOM   3576 N  N    . GLN B 1 32  ? 26.506 11.353 -14.482 1.00 45.81  ? 247 GLN B N    1 
ATOM   3577 C  CA   . GLN B 1 32  ? 27.693 10.766 -15.025 1.00 37.78  ? 247 GLN B CA   1 
ATOM   3578 C  C    . GLN B 1 32  ? 28.620 11.904 -15.356 1.00 35.11  ? 247 GLN B C    1 
ATOM   3579 O  O    . GLN B 1 32  ? 28.188 13.043 -15.507 1.00 34.15  ? 247 GLN B O    1 
ATOM   3580 C  CB   . GLN B 1 32  ? 27.354 9.913  -16.242 1.00 40.24  ? 247 GLN B CB   1 
ATOM   3581 C  CG   . GLN B 1 32  ? 26.694 10.667 -17.365 1.00 43.69  ? 247 GLN B CG   1 
ATOM   3582 C  CD   . GLN B 1 32  ? 26.157 9.738  -18.449 1.00 59.43  ? 247 GLN B CD   1 
ATOM   3583 O  OE1  . GLN B 1 32  ? 26.882 8.893  -18.964 1.00 72.64  ? 247 GLN B OE1  1 
ATOM   3584 N  NE2  . GLN B 1 32  ? 24.876 9.888  -18.792 1.00 57.40  ? 247 GLN B NE2  1 
ATOM   3585 H  H    . GLN B 1 32  ? 26.323 12.140 -14.776 1.00 54.97  ? 247 GLN B H    1 
ATOM   3586 H  HA   . GLN B 1 32  ? 28.116 10.204 -14.358 1.00 45.34  ? 247 GLN B HA   1 
ATOM   3587 H  HB2  . GLN B 1 32  ? 28.173 9.526  -16.588 1.00 48.28  ? 247 GLN B HB2  1 
ATOM   3588 H  HB3  . GLN B 1 32  ? 26.750 9.206  -15.966 1.00 48.28  ? 247 GLN B HB3  1 
ATOM   3589 H  HG2  . GLN B 1 32  ? 25.950 11.178 -17.011 1.00 52.42  ? 247 GLN B HG2  1 
ATOM   3590 H  HG3  . GLN B 1 32  ? 27.343 11.262 -17.773 1.00 52.42  ? 247 GLN B HG3  1 
ATOM   3591 H  HE21 . GLN B 1 32  ? 24.395 10.487 -18.406 1.00 68.88  ? 247 GLN B HE21 1 
ATOM   3592 H  HE22 . GLN B 1 32  ? 24.532 9.385  -19.399 1.00 68.88  ? 247 GLN B HE22 1 
ATOM   3593 N  N    . ARG B 1 33  ? 29.902 11.614 -15.412 1.00 34.51  ? 248 ARG B N    1 
ATOM   3594 C  CA   . ARG B 1 33  ? 30.842 12.596 -15.872 1.00 38.09  ? 248 ARG B CA   1 
ATOM   3595 C  C    . ARG B 1 33  ? 31.872 11.810 -16.659 1.00 33.04  ? 248 ARG B C    1 
ATOM   3596 O  O    . ARG B 1 33  ? 32.187 10.683 -16.342 1.00 33.05  ? 248 ARG B O    1 
ATOM   3597 C  CB   . ARG B 1 33  ? 31.449 13.432 -14.719 1.00 33.68  ? 248 ARG B CB   1 
ATOM   3598 C  CG   . ARG B 1 33  ? 32.666 12.861 -13.994 1.00 39.61  ? 248 ARG B CG   1 
ATOM   3599 C  CD   . ARG B 1 33  ? 33.360 13.898 -13.052 1.00 34.16  ? 248 ARG B CD   1 
ATOM   3600 N  NE   . ARG B 1 33  ? 32.462 14.519 -12.061 1.00 42.96  ? 248 ARG B NE   1 
ATOM   3601 C  CZ   . ARG B 1 33  ? 32.845 15.344 -11.076 1.00 52.52  ? 248 ARG B CZ   1 
ATOM   3602 N  NH1  . ARG B 1 33  ? 34.124 15.681 -10.912 1.00 56.91  ? 248 ARG B NH1  1 
ATOM   3603 N  NH2  . ARG B 1 33  ? 31.931 15.847 -10.252 1.00 65.86  ? 248 ARG B NH2  1 
ATOM   3604 H  H    . ARG B 1 33  ? 30.248 10.859 -15.190 1.00 41.41  ? 248 ARG B H    1 
ATOM   3605 H  HA   . ARG B 1 33  ? 30.395 13.204 -16.482 1.00 45.70  ? 248 ARG B HA   1 
ATOM   3606 H  HB2  . ARG B 1 33  ? 31.713 14.293 -15.079 1.00 40.41  ? 248 ARG B HB2  1 
ATOM   3607 H  HB3  . ARG B 1 33  ? 30.759 13.566 -14.051 1.00 40.41  ? 248 ARG B HB3  1 
ATOM   3608 H  HG2  . ARG B 1 33  ? 32.385 12.107 -13.453 1.00 47.53  ? 248 ARG B HG2  1 
ATOM   3609 H  HG3  . ARG B 1 33  ? 33.317 12.572 -14.652 1.00 47.53  ? 248 ARG B HG3  1 
ATOM   3610 H  HD2  . ARG B 1 33  ? 34.069 13.449 -12.566 1.00 40.99  ? 248 ARG B HD2  1 
ATOM   3611 H  HD3  . ARG B 1 33  ? 33.735 14.609 -13.595 1.00 40.99  ? 248 ARG B HD3  1 
ATOM   3612 H  HE   . ARG B 1 33  ? 31.624 14.336 -12.119 1.00 51.55  ? 248 ARG B HE   1 
ATOM   3613 H  HH11 . ARG B 1 33  ? 34.724 15.365 -11.441 1.00 68.30  ? 248 ARG B HH11 1 
ATOM   3614 H  HH12 . ARG B 1 33  ? 34.351 16.212 -10.275 1.00 68.30  ? 248 ARG B HH12 1 
ATOM   3615 H  HH21 . ARG B 1 33  ? 31.103 15.637 -10.348 1.00 79.03  ? 248 ARG B HH21 1 
ATOM   3616 H  HH22 . ARG B 1 33  ? 32.169 16.376 -9.617  1.00 79.03  ? 248 ARG B HH22 1 
ATOM   3617 N  N    . HIS B 1 34  ? 32.304 12.388 -17.755 1.00 26.28  ? 249 HIS B N    1 
ATOM   3618 C  CA   . HIS B 1 34  ? 33.375 11.854 -18.549 1.00 28.60  ? 249 HIS B CA   1 
ATOM   3619 C  C    . HIS B 1 34  ? 34.660 12.586 -18.193 1.00 22.73  ? 249 HIS B C    1 
ATOM   3620 O  O    . HIS B 1 34  ? 34.660 13.817 -18.149 1.00 25.74  ? 249 HIS B O    1 
ATOM   3621 C  CB   . HIS B 1 34  ? 33.071 12.057 -20.007 1.00 25.67  ? 249 HIS B CB   1 
ATOM   3622 C  CG   . HIS B 1 34  ? 34.227 11.751 -20.895 1.00 29.35  ? 249 HIS B CG   1 
ATOM   3623 N  ND1  . HIS B 1 34  ? 34.489 10.483 -21.352 1.00 28.10  ? 249 HIS B ND1  1 
ATOM   3624 C  CD2  . HIS B 1 34  ? 35.229 12.539 -21.372 1.00 26.83  ? 249 HIS B CD2  1 
ATOM   3625 C  CE1  . HIS B 1 34  ? 35.575 10.503 -22.108 1.00 27.58  ? 249 HIS B CE1  1 
ATOM   3626 N  NE2  . HIS B 1 34  ? 36.045 11.741 -22.125 1.00 25.15  ? 249 HIS B NE2  1 
ATOM   3627 H  H    . HIS B 1 34  ? 31.978 13.120 -18.069 1.00 31.54  ? 249 HIS B H    1 
ATOM   3628 H  HA   . HIS B 1 34  ? 33.485 10.907 -18.373 1.00 34.33  ? 249 HIS B HA   1 
ATOM   3629 H  HB2  . HIS B 1 34  ? 32.338 11.474 -20.260 1.00 30.81  ? 249 HIS B HB2  1 
ATOM   3630 H  HB3  . HIS B 1 34  ? 32.821 12.984 -20.150 1.00 30.81  ? 249 HIS B HB3  1 
ATOM   3631 H  HD2  . HIS B 1 34  ? 35.330 13.452 -21.228 1.00 32.20  ? 249 HIS B HD2  1 
ATOM   3632 H  HE1  . HIS B 1 34  ? 35.954 9.770  -22.537 1.00 33.09  ? 249 HIS B HE1  1 
ATOM   3633 H  HE2  . HIS B 1 34  ? 36.748 12.002 -22.546 1.00 30.18  ? 249 HIS B HE2  1 
ATOM   3634 N  N    . LEU B 1 35  ? 35.742 11.857 -17.963 1.00 22.44  ? 250 LEU B N    1 
ATOM   3635 C  CA   . LEU B 1 35  ? 37.014 12.471 -17.612 1.00 20.64  ? 250 LEU B CA   1 
ATOM   3636 C  C    . LEU B 1 35  ? 37.964 12.554 -18.794 1.00 20.14  ? 250 LEU B C    1 
ATOM   3637 O  O    . LEU B 1 35  ? 38.397 11.543 -19.319 1.00 21.16  ? 250 LEU B O    1 
ATOM   3638 C  CB   . LEU B 1 35  ? 37.701 11.694 -16.510 1.00 23.12  ? 250 LEU B CB   1 
ATOM   3639 C  CG   . LEU B 1 35  ? 36.951 11.465 -15.207 1.00 30.30  ? 250 LEU B CG   1 
ATOM   3640 C  CD1  . LEU B 1 35  ? 37.581 10.300 -14.493 1.00 34.15  ? 250 LEU B CD1  1 
ATOM   3641 C  CD2  . LEU B 1 35  ? 37.023 12.694 -14.350 1.00 27.12  ? 250 LEU B CD2  1 
ATOM   3642 H  H    . LEU B 1 35  ? 35.767 10.999 -18.005 1.00 26.93  ? 250 LEU B H    1 
ATOM   3643 H  HA   . LEU B 1 35  ? 36.853 13.372 -17.290 1.00 24.77  ? 250 LEU B HA   1 
ATOM   3644 H  HB2  . LEU B 1 35  ? 37.926 10.819 -16.862 1.00 27.75  ? 250 LEU B HB2  1 
ATOM   3645 H  HB3  . LEU B 1 35  ? 38.519 12.163 -16.284 1.00 27.75  ? 250 LEU B HB3  1 
ATOM   3646 H  HG   . LEU B 1 35  ? 36.020 11.260 -15.390 1.00 36.36  ? 250 LEU B HG   1 
ATOM   3647 H  HD11 . LEU B 1 35  ? 37.108 10.148 -13.660 1.00 40.98  ? 250 LEU B HD11 1 
ATOM   3648 H  HD12 . LEU B 1 35  ? 37.521 9.514  -15.057 1.00 40.98  ? 250 LEU B HD12 1 
ATOM   3649 H  HD13 . LEU B 1 35  ? 38.512 10.507 -14.312 1.00 40.98  ? 250 LEU B HD13 1 
ATOM   3650 H  HD21 . LEU B 1 35  ? 36.540 12.531 -13.524 1.00 32.54  ? 250 LEU B HD21 1 
ATOM   3651 H  HD22 . LEU B 1 35  ? 37.953 12.890 -14.157 1.00 32.54  ? 250 LEU B HD22 1 
ATOM   3652 H  HD23 . LEU B 1 35  ? 36.620 13.436 -14.828 1.00 32.54  ? 250 LEU B HD23 1 
ATOM   3653 N  N    . PHE B 1 36  ? 38.300 13.768 -19.191 1.00 18.92  ? 251 PHE B N    1 
ATOM   3654 C  CA   . PHE B 1 36  ? 39.264 13.971 -20.270 1.00 18.67  ? 251 PHE B CA   1 
ATOM   3655 C  C    . PHE B 1 36  ? 40.667 13.540 -19.799 1.00 18.13  ? 251 PHE B C    1 
ATOM   3656 O  O    . PHE B 1 36  ? 41.357 12.768 -20.455 1.00 18.93  ? 251 PHE B O    1 
ATOM   3657 C  CB   . PHE B 1 36  ? 39.265 15.435 -20.715 1.00 18.99  ? 251 PHE B CB   1 
ATOM   3658 C  CG   . PHE B 1 36  ? 37.958 15.884 -21.306 1.00 18.85  ? 251 PHE B CG   1 
ATOM   3659 C  CD1  . PHE B 1 36  ? 37.500 15.348 -22.467 1.00 21.69  ? 251 PHE B CD1  1 
ATOM   3660 C  CD2  . PHE B 1 36  ? 37.197 16.838 -20.678 1.00 19.65  ? 251 PHE B CD2  1 
ATOM   3661 C  CE1  . PHE B 1 36  ? 36.307 15.738 -23.003 1.00 21.51  ? 251 PHE B CE1  1 
ATOM   3662 C  CE2  . PHE B 1 36  ? 35.994 17.231 -21.215 1.00 19.78  ? 251 PHE B CE2  1 
ATOM   3663 C  CZ   . PHE B 1 36  ? 35.558 16.680 -22.382 1.00 24.75  ? 251 PHE B CZ   1 
ATOM   3664 H  H    . PHE B 1 36  ? 37.988 14.495 -18.855 1.00 22.71  ? 251 PHE B H    1 
ATOM   3665 H  HA   . PHE B 1 36  ? 39.015 13.422 -21.030 1.00 22.40  ? 251 PHE B HA   1 
ATOM   3666 H  HB2  . PHE B 1 36  ? 39.452 15.996 -19.946 1.00 22.79  ? 251 PHE B HB2  1 
ATOM   3667 H  HB3  . PHE B 1 36  ? 39.953 15.558 -21.388 1.00 22.79  ? 251 PHE B HB3  1 
ATOM   3668 H  HD1  . PHE B 1 36  ? 38.005 14.698 -22.901 1.00 26.03  ? 251 PHE B HD1  1 
ATOM   3669 H  HD2  . PHE B 1 36  ? 37.492 17.213 -19.879 1.00 23.58  ? 251 PHE B HD2  1 
ATOM   3670 H  HE1  . PHE B 1 36  ? 36.011 15.361 -23.800 1.00 25.81  ? 251 PHE B HE1  1 
ATOM   3671 H  HE2  . PHE B 1 36  ? 35.483 17.879 -20.787 1.00 23.73  ? 251 PHE B HE2  1 
ATOM   3672 H  HZ   . PHE B 1 36  ? 34.747 16.948 -22.750 1.00 29.70  ? 251 PHE B HZ   1 
ATOM   3673 N  N    . VAL B 1 37  ? 41.057 14.083 -18.652 1.00 18.70  ? 252 VAL B N    1 
ATOM   3674 C  CA   . VAL B 1 37  ? 42.290 13.749 -17.962 1.00 19.63  ? 252 VAL B CA   1 
ATOM   3675 C  C    . VAL B 1 37  ? 42.007 13.714 -16.444 1.00 22.31  ? 252 VAL B C    1 
ATOM   3676 O  O    . VAL B 1 37  ? 41.029 14.333 -15.944 1.00 23.99  ? 252 VAL B O    1 
ATOM   3677 C  CB   . VAL B 1 37  ? 43.392 14.735 -18.248 1.00 19.61  ? 252 VAL B CB   1 
ATOM   3678 C  CG1  . VAL B 1 37  ? 43.782 14.729 -19.707 1.00 18.10  ? 252 VAL B CG1  1 
ATOM   3679 C  CG2  . VAL B 1 37  ? 42.975 16.109 -17.808 1.00 23.46  ? 252 VAL B CG2  1 
ATOM   3680 H  H    . VAL B 1 37  ? 40.596 14.679 -18.237 1.00 22.44  ? 252 VAL B H    1 
ATOM   3681 H  HA   . VAL B 1 37  ? 42.586 12.868 -18.240 1.00 23.56  ? 252 VAL B HA   1 
ATOM   3682 H  HB   . VAL B 1 37  ? 44.175 14.485 -17.733 1.00 23.54  ? 252 VAL B HB   1 
ATOM   3683 H  HG11 . VAL B 1 37  ? 44.492 15.375 -19.847 1.00 21.72  ? 252 VAL B HG11 1 
ATOM   3684 H  HG12 . VAL B 1 37  ? 44.090 13.841 -19.948 1.00 21.72  ? 252 VAL B HG12 1 
ATOM   3685 H  HG13 . VAL B 1 37  ? 43.008 14.967 -20.241 1.00 21.72  ? 252 VAL B HG13 1 
ATOM   3686 H  HG21 . VAL B 1 37  ? 43.693 16.733 -17.998 1.00 28.16  ? 252 VAL B HG21 1 
ATOM   3687 H  HG22 . VAL B 1 37  ? 42.175 16.366 -18.293 1.00 28.16  ? 252 VAL B HG22 1 
ATOM   3688 H  HG23 . VAL B 1 37  ? 42.793 16.093 -16.855 1.00 28.16  ? 252 VAL B HG23 1 
ATOM   3689 N  N    . HIS B 1 38  ? 42.910 13.065 -15.722 1.00 22.89  ? 253 HIS B N    1 
ATOM   3690 C  CA   . HIS B 1 38  ? 42.709 12.783 -14.305 1.00 27.96  ? 253 HIS B CA   1 
ATOM   3691 C  C    . HIS B 1 38  ? 44.018 12.343 -13.605 1.00 25.90  ? 253 HIS B C    1 
ATOM   3692 O  O    . HIS B 1 38  ? 44.721 11.465 -14.095 1.00 25.71  ? 253 HIS B O    1 
ATOM   3693 C  CB   . HIS B 1 38  ? 41.642 11.694 -14.174 1.00 34.97  ? 253 HIS B CB   1 
ATOM   3694 C  CG   . HIS B 1 38  ? 41.294 11.337 -12.777 1.00 39.96  ? 253 HIS B CG   1 
ATOM   3695 N  ND1  . HIS B 1 38  ? 40.779 12.246 -11.866 1.00 48.52  ? 253 HIS B ND1  1 
ATOM   3696 C  CD2  . HIS B 1 38  ? 41.351 10.164 -12.115 1.00 39.63  ? 253 HIS B CD2  1 
ATOM   3697 C  CE1  . HIS B 1 38  ? 40.550 11.651 -10.720 1.00 39.92  ? 253 HIS B CE1  1 
ATOM   3698 N  NE2  . HIS B 1 38  ? 40.892 10.371 -10.842 1.00 47.29  ? 253 HIS B NE2  1 
ATOM   3699 H  H    . HIS B 1 38  ? 43.658 12.774 -16.032 1.00 27.46  ? 253 HIS B H    1 
ATOM   3700 H  HA   . HIS B 1 38  ? 42.383 13.583 -13.864 1.00 33.55  ? 253 HIS B HA   1 
ATOM   3701 H  HB2  . HIS B 1 38  ? 40.831 12.001 -14.610 1.00 41.96  ? 253 HIS B HB2  1 
ATOM   3702 H  HB3  . HIS B 1 38  ? 41.963 10.891 -14.612 1.00 41.96  ? 253 HIS B HB3  1 
ATOM   3703 H  HD2  . HIS B 1 38  ? 41.654 9.356  -12.462 1.00 47.56  ? 253 HIS B HD2  1 
ATOM   3704 H  HE1  . HIS B 1 38  ? 40.210 12.054 -9.954  1.00 47.90  ? 253 HIS B HE1  1 
ATOM   3705 H  HE2  . HIS B 1 38  ? 40.836 9.775  -10.225 1.00 56.74  ? 253 HIS B HE2  1 
ATOM   3706 N  N    . ILE B 1 39  ? 44.337 13.005 -12.493 1.00 22.41  ? 254 ILE B N    1 
ATOM   3707 C  CA   . ILE B 1 39  ? 45.370 12.584 -11.546 1.00 25.05  ? 254 ILE B CA   1 
ATOM   3708 C  C    . ILE B 1 39  ? 44.749 12.491 -10.147 1.00 24.24  ? 254 ILE B C    1 
ATOM   3709 O  O    . ILE B 1 39  ? 44.222 13.466 -9.636  1.00 26.89  ? 254 ILE B O    1 
ATOM   3710 C  CB   . ILE B 1 39  ? 46.549 13.576 -11.521 1.00 21.98  ? 254 ILE B CB   1 
ATOM   3711 C  CG1  . ILE B 1 39  ? 47.070 13.828 -12.915 1.00 20.10  ? 254 ILE B CG1  1 
ATOM   3712 C  CG2  . ILE B 1 39  ? 47.690 13.043 -10.654 1.00 25.57  ? 254 ILE B CG2  1 
ATOM   3713 C  CD1  . ILE B 1 39  ? 48.056 15.013 -12.965 1.00 26.12  ? 254 ILE B CD1  1 
ATOM   3714 H  H    . ILE B 1 39  ? 43.950 13.735 -12.257 1.00 26.90  ? 254 ILE B H    1 
ATOM   3715 H  HA   . ILE B 1 39  ? 45.706 11.708 -11.796 1.00 30.06  ? 254 ILE B HA   1 
ATOM   3716 H  HB   . ILE B 1 39  ? 46.241 14.417 -11.147 1.00 26.38  ? 254 ILE B HB   1 
ATOM   3717 H  HG12 . ILE B 1 39  ? 47.533 13.036 -13.228 1.00 24.12  ? 254 ILE B HG12 1 
ATOM   3718 H  HG13 . ILE B 1 39  ? 46.324 14.032 -13.500 1.00 24.12  ? 254 ILE B HG13 1 
ATOM   3719 H  HG21 . ILE B 1 39  ? 48.415 13.687 -10.657 1.00 30.68  ? 254 ILE B HG21 1 
ATOM   3720 H  HG22 . ILE B 1 39  ? 47.365 12.914 -9.750  1.00 30.68  ? 254 ILE B HG22 1 
ATOM   3721 H  HG23 . ILE B 1 39  ? 47.995 12.198 -11.020 1.00 30.68  ? 254 ILE B HG23 1 
ATOM   3722 H  HD11 . ILE B 1 39  ? 48.360 15.132 -13.879 1.00 31.35  ? 254 ILE B HD11 1 
ATOM   3723 H  HD12 . ILE B 1 39  ? 47.603 15.814 -12.659 1.00 31.35  ? 254 ILE B HD12 1 
ATOM   3724 H  HD13 . ILE B 1 39  ? 48.812 14.819 -12.388 1.00 31.35  ? 254 ILE B HD13 1 
ATOM   3725 N  N    . SER B 1 40  ? 44.854 11.341 -9.519  1.00 27.13  ? 255 SER B N    1 
ATOM   3726 C  CA   . SER B 1 40  ? 44.624 11.213 -8.083  1.00 33.32  ? 255 SER B CA   1 
ATOM   3727 C  C    . SER B 1 40  ? 45.882 10.764 -7.336  1.00 33.82  ? 255 SER B C    1 
ATOM   3728 O  O    . SER B 1 40  ? 46.481 9.790  -7.716  1.00 34.10  ? 255 SER B O    1 
ATOM   3729 C  CB   . SER B 1 40  ? 43.515 10.210 -7.811  1.00 35.99  ? 255 SER B CB   1 
ATOM   3730 O  OG   . SER B 1 40  ? 43.386 9.994  -6.409  1.00 54.17  ? 255 SER B OG   1 
ATOM   3731 H  H    . SER B 1 40  ? 45.061 10.600 -9.903  1.00 32.55  ? 255 SER B H    1 
ATOM   3732 H  HA   . SER B 1 40  ? 44.350 12.072 -7.726  1.00 39.98  ? 255 SER B HA   1 
ATOM   3733 H  HB2  . SER B 1 40  ? 42.679 10.558 -8.158  1.00 43.19  ? 255 SER B HB2  1 
ATOM   3734 H  HB3  . SER B 1 40  ? 43.733 9.369  -8.243  1.00 43.19  ? 255 SER B HB3  1 
ATOM   3735 H  HG   . SER B 1 40  ? 42.773 9.440  -6.259  1.00 65.01  ? 255 SER B HG   1 
ATOM   3736 N  N    . GLN B 1 41  ? 46.256 11.418 -6.246  1.00 32.32  ? 256 GLN B N    1 
ATOM   3737 C  CA   . GLN B 1 41  ? 47.426 10.975 -5.483  1.00 35.83  ? 256 GLN B CA   1 
ATOM   3738 C  C    . GLN B 1 41  ? 47.133 10.801 -3.979  1.00 35.13  ? 256 GLN B C    1 
ATOM   3739 O  O    . GLN B 1 41  ? 46.078 11.211 -3.514  1.00 41.82  ? 256 GLN B O    1 
ATOM   3740 C  CB   . GLN B 1 41  ? 48.575 11.970 -5.653  1.00 32.78  ? 256 GLN B CB   1 
ATOM   3741 C  CG   . GLN B 1 41  ? 49.167 12.042 -7.076  1.00 34.98  ? 256 GLN B CG   1 
ATOM   3742 C  CD   . GLN B 1 41  ? 50.439 12.885 -7.140  1.00 31.45  ? 256 GLN B CD   1 
ATOM   3743 O  OE1  . GLN B 1 41  ? 51.405 12.491 -7.751  1.00 31.71  ? 256 GLN B OE1  1 
ATOM   3744 N  NE2  . GLN B 1 41  ? 50.440 14.034 -6.489  1.00 32.47  ? 256 GLN B NE2  1 
ATOM   3745 H  H    . GLN B 1 41  ? 45.861 12.112 -5.927  1.00 38.79  ? 256 GLN B H    1 
ATOM   3746 H  HA   . GLN B 1 41  ? 47.720 10.118 -5.830  1.00 42.99  ? 256 GLN B HA   1 
ATOM   3747 H  HB2  . GLN B 1 41  ? 48.253 12.856 -5.425  1.00 39.34  ? 256 GLN B HB2  1 
ATOM   3748 H  HB3  . GLN B 1 41  ? 49.292 11.719 -5.050  1.00 39.34  ? 256 GLN B HB3  1 
ATOM   3749 H  HG2  . GLN B 1 41  ? 49.386 11.145 -7.374  1.00 41.98  ? 256 GLN B HG2  1 
ATOM   3750 H  HG3  . GLN B 1 41  ? 48.513 12.439 -7.672  1.00 41.98  ? 256 GLN B HG3  1 
ATOM   3751 H  HE21 . GLN B 1 41  ? 49.742 14.281 -6.052  1.00 38.97  ? 256 GLN B HE21 1 
ATOM   3752 H  HE22 . GLN B 1 41  ? 51.139 14.535 -6.503  1.00 38.97  ? 256 GLN B HE22 1 
ATOM   3753 N  N    . ALA B 1 48  ? 56.497 4.316  -4.266  1.00 93.37  ? 263 ALA B N    1 
ATOM   3754 C  CA   . ALA B 1 48  ? 57.708 4.320  -3.461  1.00 99.12  ? 263 ALA B CA   1 
ATOM   3755 C  C    . ALA B 1 48  ? 58.950 4.698  -4.280  1.00 97.15  ? 263 ALA B C    1 
ATOM   3756 O  O    . ALA B 1 48  ? 59.889 5.271  -3.727  1.00 98.46  ? 263 ALA B O    1 
ATOM   3757 C  CB   . ALA B 1 48  ? 57.909 2.947  -2.779  1.00 87.88  ? 263 ALA B CB   1 
ATOM   3758 H  HA   . ALA B 1 48  ? 57.608 4.983  -2.759  1.00 118.95 ? 263 ALA B HA   1 
ATOM   3759 H  HB1  . ALA B 1 48  ? 58.721 2.975  -2.249  1.00 105.46 ? 263 ALA B HB1  1 
ATOM   3760 H  HB2  . ALA B 1 48  ? 57.147 2.764  -2.208  1.00 105.46 ? 263 ALA B HB2  1 
ATOM   3761 H  HB3  . ALA B 1 48  ? 57.983 2.264  -3.463  1.00 105.46 ? 263 ALA B HB3  1 
ATOM   3762 N  N    . PRO B 1 49  ? 58.976 4.391  -5.595  1.00 88.71  ? 264 PRO B N    1 
ATOM   3763 C  CA   . PRO B 1 49  ? 60.235 4.739  -6.268  1.00 77.77  ? 264 PRO B CA   1 
ATOM   3764 C  C    . PRO B 1 49  ? 60.284 6.206  -6.676  1.00 79.91  ? 264 PRO B C    1 
ATOM   3765 O  O    . PRO B 1 49  ? 59.270 6.900  -6.584  1.00 62.76  ? 264 PRO B O    1 
ATOM   3766 C  CB   . PRO B 1 49  ? 60.249 3.836  -7.515  1.00 70.00  ? 264 PRO B CB   1 
ATOM   3767 C  CG   . PRO B 1 49  ? 58.881 3.180  -7.573  1.00 86.61  ? 264 PRO B CG   1 
ATOM   3768 C  CD   . PRO B 1 49  ? 58.000 3.842  -6.551  1.00 89.64  ? 264 PRO B CD   1 
ATOM   3769 H  HA   . PRO B 1 49  ? 60.996 4.529  -5.704  1.00 93.33  ? 264 PRO B HA   1 
ATOM   3770 H  HB2  . PRO B 1 49  ? 60.401 4.377  -8.305  1.00 84.00  ? 264 PRO B HB2  1 
ATOM   3771 H  HB3  . PRO B 1 49  ? 60.945 3.166  -7.422  1.00 84.00  ? 264 PRO B HB3  1 
ATOM   3772 H  HG2  . PRO B 1 49  ? 58.510 3.298  -8.462  1.00 103.93 ? 264 PRO B HG2  1 
ATOM   3773 H  HG3  . PRO B 1 49  ? 58.973 2.235  -7.373  1.00 103.93 ? 264 PRO B HG3  1 
ATOM   3774 H  HD2  . PRO B 1 49  ? 57.483 4.555  -6.957  1.00 107.57 ? 264 PRO B HD2  1 
ATOM   3775 H  HD3  . PRO B 1 49  ? 57.430 3.188  -6.118  1.00 107.57 ? 264 PRO B HD3  1 
ATOM   3776 N  N    . PRO B 1 50  ? 61.457 6.676  -7.119  1.00 69.81  ? 265 PRO B N    1 
ATOM   3777 C  CA   . PRO B 1 50  ? 61.558 8.026  -7.669  1.00 65.04  ? 265 PRO B CA   1 
ATOM   3778 C  C    . PRO B 1 50  ? 60.906 8.134  -9.041  1.00 63.91  ? 265 PRO B C    1 
ATOM   3779 O  O    . PRO B 1 50  ? 60.815 7.152  -9.792  1.00 56.06  ? 265 PRO B O    1 
ATOM   3780 C  CB   . PRO B 1 50  ? 63.074 8.262  -7.773  1.00 60.73  ? 265 PRO B CB   1 
ATOM   3781 C  CG   . PRO B 1 50  ? 63.696 7.209  -6.953  1.00 63.04  ? 265 PRO B CG   1 
ATOM   3782 C  CD   . PRO B 1 50  ? 62.774 6.033  -7.042  1.00 67.21  ? 265 PRO B CD   1 
ATOM   3783 H  HA   . PRO B 1 50  ? 61.165 8.676  -7.065  1.00 78.05  ? 265 PRO B HA   1 
ATOM   3784 H  HB2  . PRO B 1 50  ? 63.353 8.183  -8.698  1.00 72.88  ? 265 PRO B HB2  1 
ATOM   3785 H  HB3  . PRO B 1 50  ? 63.292 9.140  -7.423  1.00 72.88  ? 265 PRO B HB3  1 
ATOM   3786 H  HG2  . PRO B 1 50  ? 64.568 6.988  -7.314  1.00 75.65  ? 265 PRO B HG2  1 
ATOM   3787 H  HG3  . PRO B 1 50  ? 63.773 7.514  -6.035  1.00 75.65  ? 265 PRO B HG3  1 
ATOM   3788 H  HD2  . PRO B 1 50  ? 62.952 5.520  -7.846  1.00 80.65  ? 265 PRO B HD2  1 
ATOM   3789 H  HD3  . PRO B 1 50  ? 62.841 5.486  -6.244  1.00 80.65  ? 265 PRO B HD3  1 
ATOM   3790 N  N    . LEU B 1 51  ? 60.446 9.329  -9.370  1.00 42.47  ? 266 LEU B N    1 
ATOM   3791 C  CA   . LEU B 1 51  ? 59.941 9.561  -10.707 1.00 35.19  ? 266 LEU B CA   1 
ATOM   3792 C  C    . LEU B 1 51  ? 61.119 9.577  -11.674 1.00 38.69  ? 266 LEU B C    1 
ATOM   3793 O  O    . LEU B 1 51  ? 62.235 9.950  -11.287 1.00 41.02  ? 266 LEU B O    1 
ATOM   3794 C  CB   . LEU B 1 51  ? 59.211 10.872 -10.757 1.00 32.20  ? 266 LEU B CB   1 
ATOM   3795 C  CG   . LEU B 1 51  ? 57.952 11.061 -9.918  1.00 30.94  ? 266 LEU B CG   1 
ATOM   3796 C  CD1  . LEU B 1 51  ? 57.473 12.469 -10.045 1.00 40.00  ? 266 LEU B CD1  1 
ATOM   3797 C  CD2  . LEU B 1 51  ? 56.896 10.111 -10.377 1.00 32.13  ? 266 LEU B CD2  1 
ATOM   3798 H  H    . LEU B 1 51  ? 60.416 10.011 -8.847  1.00 50.96  ? 266 LEU B H    1 
ATOM   3799 H  HA   . LEU B 1 51  ? 59.332 8.849  -10.960 1.00 42.22  ? 266 LEU B HA   1 
ATOM   3800 H  HB2  . LEU B 1 51  ? 59.833 11.564 -10.482 1.00 38.64  ? 266 LEU B HB2  1 
ATOM   3801 H  HB3  . LEU B 1 51  ? 58.955 11.030 -11.679 1.00 38.64  ? 266 LEU B HB3  1 
ATOM   3802 H  HG   . LEU B 1 51  ? 58.150 10.882 -8.986  1.00 37.13  ? 266 LEU B HG   1 
ATOM   3803 H  HD11 . LEU B 1 51  ? 56.673 12.580 -9.508  1.00 48.00  ? 266 LEU B HD11 1 
ATOM   3804 H  HD12 . LEU B 1 51  ? 58.168 13.068 -9.730  1.00 48.00  ? 266 LEU B HD12 1 
ATOM   3805 H  HD13 . LEU B 1 51  ? 57.275 12.652 -10.977 1.00 48.00  ? 266 LEU B HD13 1 
ATOM   3806 H  HD21 . LEU B 1 51  ? 56.100 10.240 -9.837  1.00 38.55  ? 266 LEU B HD21 1 
ATOM   3807 H  HD22 . LEU B 1 51  ? 56.696 10.289 -11.309 1.00 38.55  ? 266 LEU B HD22 1 
ATOM   3808 H  HD23 . LEU B 1 51  ? 57.222 9.204  -10.275 1.00 38.55  ? 266 LEU B HD23 1 
ATOM   3809 N  N    . GLU B 1 52  ? 60.884 9.216  -12.928 1.00 36.66  ? 267 GLU B N    1 
ATOM   3810 C  CA   . GLU B 1 52  ? 61.877 9.481  -13.957 1.00 36.52  ? 267 GLU B CA   1 
ATOM   3811 C  C    . GLU B 1 52  ? 62.021 10.984 -14.100 1.00 34.66  ? 267 GLU B C    1 
ATOM   3812 O  O    . GLU B 1 52  ? 61.119 11.737 -13.728 1.00 32.98  ? 267 GLU B O    1 
ATOM   3813 C  CB   . GLU B 1 52  ? 61.485 8.907  -15.312 1.00 37.52  ? 267 GLU B CB   1 
ATOM   3814 C  CG   . GLU B 1 52  ? 61.068 7.439  -15.336 1.00 66.54  ? 267 GLU B CG   1 
ATOM   3815 C  CD   . GLU B 1 52  ? 60.671 6.971  -16.740 1.00 69.31  ? 267 GLU B CD   1 
ATOM   3816 O  OE1  . GLU B 1 52  ? 61.346 7.361  -17.723 1.00 69.20  ? 267 GLU B OE1  1 
ATOM   3817 O  OE2  . GLU B 1 52  ? 59.673 6.225  -16.859 1.00 72.22  ? 267 GLU B OE2  1 
ATOM   3818 H  H    . GLU B 1 52  ? 60.171 8.824  -13.206 1.00 43.99  ? 267 GLU B H    1 
ATOM   3819 H  HA   . GLU B 1 52  ? 62.732 9.108  -13.694 1.00 43.82  ? 267 GLU B HA   1 
ATOM   3820 H  HB2  . GLU B 1 52  ? 60.738 9.423  -15.655 1.00 45.03  ? 267 GLU B HB2  1 
ATOM   3821 H  HB3  . GLU B 1 52  ? 62.241 9.001  -15.911 1.00 45.03  ? 267 GLU B HB3  1 
ATOM   3822 H  HG2  . GLU B 1 52  ? 61.812 6.893  -15.035 1.00 79.85  ? 267 GLU B HG2  1 
ATOM   3823 H  HG3  . GLU B 1 52  ? 60.305 7.315  -14.750 1.00 79.85  ? 267 GLU B HG3  1 
ATOM   3824 N  N    . SER B 1 53  ? 63.145 11.373 -14.694 1.00 36.70  ? 268 SER B N    1 
ATOM   3825 C  CA   . SER B 1 53  ? 63.498 12.749 -14.966 1.00 36.83  ? 268 SER B CA   1 
ATOM   3826 C  C    . SER B 1 53  ? 63.449 13.076 -16.478 1.00 38.10  ? 268 SER B C    1 
ATOM   3827 O  O    . SER B 1 53  ? 63.644 12.203 -17.328 1.00 41.07  ? 268 SER B O    1 
ATOM   3828 C  CB   . SER B 1 53  ? 64.902 13.039 -14.430 1.00 37.68  ? 268 SER B CB   1 
ATOM   3829 O  OG   . SER B 1 53  ? 65.900 12.585 -15.321 1.00 77.47  ? 268 SER B OG   1 
ATOM   3830 H  H    . SER B 1 53  ? 63.746 10.819 -14.961 1.00 44.04  ? 268 SER B H    1 
ATOM   3831 H  HA   . SER B 1 53  ? 62.873 13.334 -14.509 1.00 44.19  ? 268 SER B HA   1 
ATOM   3832 H  HB2  . SER B 1 53  ? 65.001 13.996 -14.310 1.00 45.22  ? 268 SER B HB2  1 
ATOM   3833 H  HB3  . SER B 1 53  ? 65.013 12.587 -13.579 1.00 45.22  ? 268 SER B HB3  1 
ATOM   3834 H  HG   . SER B 1 53  ? 66.662 12.754 -15.009 1.00 92.96  ? 268 SER B HG   1 
ATOM   3835 N  N    . VAL B 1 54  ? 63.190 14.349 -16.783 1.00 36.98  ? 269 VAL B N    1 
ATOM   3836 C  CA   . VAL B 1 54  ? 63.306 14.876 -18.138 1.00 39.14  ? 269 VAL B CA   1 
ATOM   3837 C  C    . VAL B 1 54  ? 64.076 16.196 -18.052 1.00 39.81  ? 269 VAL B C    1 
ATOM   3838 O  O    . VAL B 1 54  ? 63.752 17.002 -17.195 1.00 37.56  ? 269 VAL B O    1 
ATOM   3839 C  CB   . VAL B 1 54  ? 61.898 15.079 -18.794 1.00 37.65  ? 269 VAL B CB   1 
ATOM   3840 C  CG1  . VAL B 1 54  ? 62.005 15.851 -20.096 1.00 39.75  ? 269 VAL B CG1  1 
ATOM   3841 C  CG2  . VAL B 1 54  ? 61.232 13.746 -19.049 1.00 53.96  ? 269 VAL B CG2  1 
ATOM   3842 H  H    . VAL B 1 54  ? 62.940 14.937 -16.208 1.00 44.37  ? 269 VAL B H    1 
ATOM   3843 H  HA   . VAL B 1 54  ? 63.815 14.256 -18.685 1.00 46.97  ? 269 VAL B HA   1 
ATOM   3844 H  HB   . VAL B 1 54  ? 61.335 15.585 -18.188 1.00 45.18  ? 269 VAL B HB   1 
ATOM   3845 H  HG11 . VAL B 1 54  ? 61.118 15.958 -20.473 1.00 47.70  ? 269 VAL B HG11 1 
ATOM   3846 H  HG12 . VAL B 1 54  ? 62.395 16.721 -19.915 1.00 47.70  ? 269 VAL B HG12 1 
ATOM   3847 H  HG13 . VAL B 1 54  ? 62.569 15.356 -20.710 1.00 47.70  ? 269 VAL B HG13 1 
ATOM   3848 H  HG21 . VAL B 1 54  ? 60.364 13.899 -19.454 1.00 64.75  ? 269 VAL B HG21 1 
ATOM   3849 H  HG22 . VAL B 1 54  ? 61.790 13.224 -19.647 1.00 64.75  ? 269 VAL B HG22 1 
ATOM   3850 H  HG23 . VAL B 1 54  ? 61.126 13.280 -18.204 1.00 64.75  ? 269 VAL B HG23 1 
ATOM   3851 N  N    . ASP B 1 55  ? 65.047 16.441 -18.945 1.00 43.54  ? 270 ASP B N    1 
ATOM   3852 C  CA   . ASP B 1 55  ? 65.756 17.719 -18.967 1.00 45.11  ? 270 ASP B CA   1 
ATOM   3853 C  C    . ASP B 1 55  ? 64.901 18.859 -19.536 1.00 44.08  ? 270 ASP B C    1 
ATOM   3854 O  O    . ASP B 1 55  ? 64.386 18.765 -20.643 1.00 44.87  ? 270 ASP B O    1 
ATOM   3855 C  CB   . ASP B 1 55  ? 67.041 17.630 -19.775 1.00 50.18  ? 270 ASP B CB   1 
ATOM   3856 C  CG   . ASP B 1 55  ? 68.018 18.750 -19.426 1.00 59.33  ? 270 ASP B CG   1 
ATOM   3857 O  OD1  . ASP B 1 55  ? 69.062 18.476 -18.783 1.00 72.70  ? 270 ASP B OD1  1 
ATOM   3858 O  OD2  . ASP B 1 55  ? 67.727 19.914 -19.772 1.00 61.50  ? 270 ASP B OD2  1 
ATOM   3859 H  H    . ASP B 1 55  ? 65.308 15.883 -19.544 1.00 52.25  ? 270 ASP B H    1 
ATOM   3860 H  HA   . ASP B 1 55  ? 65.996 17.956 -18.057 1.00 54.14  ? 270 ASP B HA   1 
ATOM   3861 H  HB2  . ASP B 1 55  ? 67.474 16.782 -19.590 1.00 60.22  ? 270 ASP B HB2  1 
ATOM   3862 H  HB3  . ASP B 1 55  ? 66.828 17.698 -20.719 1.00 60.22  ? 270 ASP B HB3  1 
ATOM   3863 N  N    . VAL B 1 56  ? 64.781 19.950 -18.777 1.00 42.95  ? 271 VAL B N    1 
ATOM   3864 C  CA   . VAL B 1 56  ? 63.865 21.037 -19.109 1.00 41.96  ? 271 VAL B CA   1 
ATOM   3865 C  C    . VAL B 1 56  ? 64.302 21.772 -20.343 1.00 45.51  ? 271 VAL B C    1 
ATOM   3866 O  O    . VAL B 1 56  ? 63.473 22.352 -21.033 1.00 45.11  ? 271 VAL B O    1 
ATOM   3867 C  CB   . VAL B 1 56  ? 63.712 22.032 -17.941 1.00 41.02  ? 271 VAL B CB   1 
ATOM   3868 C  CG1  . VAL B 1 56  ? 64.952 22.915 -17.791 1.00 58.77  ? 271 VAL B CG1  1 
ATOM   3869 C  CG2  . VAL B 1 56  ? 62.461 22.876 -18.144 1.00 42.33  ? 271 VAL B CG2  1 
ATOM   3870 H  H    . VAL B 1 56  ? 65.228 20.084 -18.054 1.00 51.54  ? 271 VAL B H    1 
ATOM   3871 H  HA   . VAL B 1 56  ? 62.990 20.658 -19.288 1.00 50.35  ? 271 VAL B HA   1 
ATOM   3872 H  HB   . VAL B 1 56  ? 63.603 21.533 -17.117 1.00 49.23  ? 271 VAL B HB   1 
ATOM   3873 H  HG11 . VAL B 1 56  ? 64.816 23.525 -17.049 1.00 70.52  ? 271 VAL B HG11 1 
ATOM   3874 H  HG12 . VAL B 1 56  ? 65.722 22.351 -17.620 1.00 70.52  ? 271 VAL B HG12 1 
ATOM   3875 H  HG13 . VAL B 1 56  ? 65.084 23.415 -18.612 1.00 70.52  ? 271 VAL B HG13 1 
ATOM   3876 H  HG21 . VAL B 1 56  ? 62.377 23.497 -17.403 1.00 50.80  ? 271 VAL B HG21 1 
ATOM   3877 H  HG22 . VAL B 1 56  ? 62.541 23.364 -18.978 1.00 50.80  ? 271 VAL B HG22 1 
ATOM   3878 H  HG23 . VAL B 1 56  ? 61.688 22.290 -18.175 1.00 50.80  ? 271 VAL B HG23 1 
ATOM   3879 N  N    . ARG B 1 57  ? 65.606 21.752 -20.609 1.00 58.99  ? 272 ARG B N    1 
ATOM   3880 C  CA   . ARG B 1 57  ? 66.173 22.419 -21.775 1.00 70.00  ? 272 ARG B CA   1 
ATOM   3881 C  C    . ARG B 1 57  ? 65.482 21.890 -23.052 1.00 63.05  ? 272 ARG B C    1 
ATOM   3882 O  O    . ARG B 1 57  ? 65.279 22.632 -24.007 1.00 67.67  ? 272 ARG B O    1 
ATOM   3883 C  CB   . ARG B 1 57  ? 67.710 22.221 -21.816 1.00 70.14  ? 272 ARG B CB   1 
ATOM   3884 C  CG   . ARG B 1 57  ? 68.500 23.105 -20.801 1.00 76.58  ? 272 ARG B CG   1 
ATOM   3885 C  CD   . ARG B 1 57  ? 69.844 22.496 -20.290 1.00 78.43  ? 272 ARG B CD   1 
ATOM   3886 N  NE   . ARG B 1 57  ? 70.446 23.357 -19.261 1.00 83.73  ? 272 ARG B NE   1 
ATOM   3887 C  CZ   . ARG B 1 57  ? 71.713 23.313 -18.826 1.00 101.37 ? 272 ARG B CZ   1 
ATOM   3888 N  NH1  . ARG B 1 57  ? 72.595 22.447 -19.317 1.00 97.05  ? 272 ARG B NH1  1 
ATOM   3889 N  NH2  . ARG B 1 57  ? 72.112 24.166 -17.886 1.00 106.50 ? 272 ARG B NH2  1 
ATOM   3890 H  H    . ARG B 1 57  ? 66.191 21.352 -20.121 1.00 70.78  ? 272 ARG B H    1 
ATOM   3891 H  HA   . ARG B 1 57  ? 65.995 23.371 -21.711 1.00 83.99  ? 272 ARG B HA   1 
ATOM   3892 H  HB2  . ARG B 1 57  ? 67.910 21.293 -21.617 1.00 84.16  ? 272 ARG B HB2  1 
ATOM   3893 H  HB3  . ARG B 1 57  ? 68.028 22.440 -22.707 1.00 84.16  ? 272 ARG B HB3  1 
ATOM   3894 H  HG2  . ARG B 1 57  ? 68.707 23.952 -21.227 1.00 91.90  ? 272 ARG B HG2  1 
ATOM   3895 H  HG3  . ARG B 1 57  ? 67.938 23.261 -20.027 1.00 91.90  ? 272 ARG B HG3  1 
ATOM   3896 H  HD2  . ARG B 1 57  ? 69.676 21.624 -19.900 1.00 94.12  ? 272 ARG B HD2  1 
ATOM   3897 H  HD3  . ARG B 1 57  ? 70.467 22.421 -21.030 1.00 94.12  ? 272 ARG B HD3  1 
ATOM   3898 H  HE   . ARG B 1 57  ? 69.934 23.947 -18.902 1.00 100.47 ? 272 ARG B HE   1 
ATOM   3899 H  HH11 . ARG B 1 57  ? 72.356 21.889 -19.927 1.00 116.46 ? 272 ARG B HH11 1 
ATOM   3900 H  HH12 . ARG B 1 57  ? 73.403 22.441 -19.022 1.00 116.46 ? 272 ARG B HH12 1 
ATOM   3901 H  HH21 . ARG B 1 57  ? 71.557 24.734 -17.558 1.00 127.79 ? 272 ARG B HH21 1 
ATOM   3902 H  HH22 . ARG B 1 57  ? 72.924 24.145 -17.603 1.00 127.79 ? 272 ARG B HH22 1 
ATOM   3903 N  N    . GLN B 1 58  ? 65.077 20.623 -23.035 1.00 53.88  ? 273 GLN B N    1 
ATOM   3904 C  CA   . GLN B 1 58  ? 64.475 19.977 -24.201 1.00 59.47  ? 273 GLN B CA   1 
ATOM   3905 C  C    . GLN B 1 58  ? 63.063 20.482 -24.567 1.00 66.33  ? 273 GLN B C    1 
ATOM   3906 O  O    . GLN B 1 58  ? 62.612 20.301 -25.696 1.00 76.26  ? 273 GLN B O    1 
ATOM   3907 C  CB   . GLN B 1 58  ? 64.412 18.463 -23.969 1.00 58.26  ? 273 GLN B CB   1 
ATOM   3908 C  CG   . GLN B 1 58  ? 65.770 17.755 -23.980 1.00 64.62  ? 273 GLN B CG   1 
ATOM   3909 C  CD   . GLN B 1 58  ? 66.333 17.552 -25.391 1.00 80.82  ? 273 GLN B CD   1 
ATOM   3910 O  OE1  . GLN B 1 58  ? 66.565 18.512 -26.131 1.00 93.94  ? 273 GLN B OE1  1 
ATOM   3911 N  NE2  . GLN B 1 58  ? 66.551 16.295 -25.766 1.00 86.47  ? 273 GLN B NE2  1 
ATOM   3912 H  H    . GLN B 1 58  ? 65.141 20.107 -22.350 1.00 64.66  ? 273 GLN B H    1 
ATOM   3913 H  HA   . GLN B 1 58  ? 65.048 20.132 -24.968 1.00 71.36  ? 273 GLN B HA   1 
ATOM   3914 H  HB2  . GLN B 1 58  ? 64.003 18.300 -23.104 1.00 69.91  ? 273 GLN B HB2  1 
ATOM   3915 H  HB3  . GLN B 1 58  ? 63.868 18.066 -24.666 1.00 69.91  ? 273 GLN B HB3  1 
ATOM   3916 H  HG2  . GLN B 1 58  ? 66.407 18.287 -23.478 1.00 77.54  ? 273 GLN B HG2  1 
ATOM   3917 H  HG3  . GLN B 1 58  ? 65.672 16.881 -23.570 1.00 77.54  ? 273 GLN B HG3  1 
ATOM   3918 H  HE21 . GLN B 1 58  ? 66.376 15.649 -25.226 1.00 103.76 ? 273 GLN B HE21 1 
ATOM   3919 H  HE22 . GLN B 1 58  ? 66.867 16.128 -26.548 1.00 103.76 ? 273 GLN B HE22 1 
ATOM   3920 N  N    . ILE B 1 59  ? 62.363 21.102 -23.622 1.00 46.98  ? 274 ILE B N    1 
ATOM   3921 C  CA   . ILE B 1 59  ? 61.001 21.569 -23.877 1.00 44.50  ? 274 ILE B CA   1 
ATOM   3922 C  C    . ILE B 1 59  ? 60.872 23.092 -23.756 1.00 47.50  ? 274 ILE B C    1 
ATOM   3923 O  O    . ILE B 1 59  ? 59.762 23.615 -23.823 1.00 47.27  ? 274 ILE B O    1 
ATOM   3924 C  CB   . ILE B 1 59  ? 59.987 20.872 -22.926 1.00 40.53  ? 274 ILE B CB   1 
ATOM   3925 C  CG1  . ILE B 1 59  ? 60.133 21.387 -21.495 1.00 38.39  ? 274 ILE B CG1  1 
ATOM   3926 C  CG2  . ILE B 1 59  ? 60.187 19.351 -22.933 1.00 43.43  ? 274 ILE B CG2  1 
ATOM   3927 C  CD1  . ILE B 1 59  ? 59.077 20.801 -20.552 1.00 41.28  ? 274 ILE B CD1  1 
ATOM   3928 H  H    . ILE B 1 59  ? 62.650 21.265 -22.828 1.00 56.38  ? 274 ILE B H    1 
ATOM   3929 H  HA   . ILE B 1 59  ? 60.760 21.329 -24.786 1.00 53.40  ? 274 ILE B HA   1 
ATOM   3930 H  HB   . ILE B 1 59  ? 59.089 21.067 -23.235 1.00 48.64  ? 274 ILE B HB   1 
ATOM   3931 H  HG12 . ILE B 1 59  ? 61.008 21.141 -21.157 1.00 46.07  ? 274 ILE B HG12 1 
ATOM   3932 H  HG13 . ILE B 1 59  ? 60.035 22.352 -21.494 1.00 46.07  ? 274 ILE B HG13 1 
ATOM   3933 H  HG21 . ILE B 1 59  ? 59.542 18.946 -22.332 1.00 52.12  ? 274 ILE B HG21 1 
ATOM   3934 H  HG22 . ILE B 1 59  ? 60.053 19.020 -23.835 1.00 52.12  ? 274 ILE B HG22 1 
ATOM   3935 H  HG23 . ILE B 1 59  ? 61.088 19.150 -22.637 1.00 52.12  ? 274 ILE B HG23 1 
ATOM   3936 H  HD11 . ILE B 1 59  ? 59.215 21.160 -19.662 1.00 49.54  ? 274 ILE B HD11 1 
ATOM   3937 H  HD12 . ILE B 1 59  ? 58.195 21.046 -20.875 1.00 49.54  ? 274 ILE B HD12 1 
ATOM   3938 H  HD13 . ILE B 1 59  ? 59.168 19.835 -20.538 1.00 49.54  ? 274 ILE B HD13 1 
ATOM   3939 N  N    . TYR B 1 60  ? 61.989 23.796 -23.556 1.00 53.54  ? 275 TYR B N    1 
ATOM   3940 C  CA   . TYR B 1 60  ? 61.979 25.259 -23.457 1.00 57.63  ? 275 TYR B CA   1 
ATOM   3941 C  C    . TYR B 1 60  ? 61.130 25.884 -24.569 1.00 54.31  ? 275 TYR B C    1 
ATOM   3942 O  O    . TYR B 1 60  ? 60.367 26.823 -24.312 1.00 57.77  ? 275 TYR B O    1 
ATOM   3943 C  CB   . TYR B 1 60  ? 63.410 25.841 -23.529 1.00 64.74  ? 275 TYR B CB   1 
ATOM   3944 C  CG   . TYR B 1 60  ? 64.199 25.929 -22.222 1.00 65.71  ? 275 TYR B CG   1 
ATOM   3945 C  CD1  . TYR B 1 60  ? 63.583 25.794 -20.981 1.00 59.35  ? 275 TYR B CD1  1 
ATOM   3946 C  CD2  . TYR B 1 60  ? 65.578 26.167 -22.238 1.00 73.80  ? 275 TYR B CD2  1 
ATOM   3947 C  CE1  . TYR B 1 60  ? 64.315 25.881 -19.794 1.00 62.18  ? 275 TYR B CE1  1 
ATOM   3948 C  CE2  . TYR B 1 60  ? 66.314 26.254 -21.059 1.00 75.09  ? 275 TYR B CE2  1 
ATOM   3949 C  CZ   . TYR B 1 60  ? 65.675 26.110 -19.840 1.00 66.95  ? 275 TYR B CZ   1 
ATOM   3950 O  OH   . TYR B 1 60  ? 66.392 26.198 -18.670 1.00 68.24  ? 275 TYR B OH   1 
ATOM   3951 H  H    . TYR B 1 60  ? 62.771 23.448 -23.474 1.00 64.25  ? 275 TYR B H    1 
ATOM   3952 H  HA   . TYR B 1 60  ? 61.594 25.515 -22.605 1.00 69.15  ? 275 TYR B HA   1 
ATOM   3953 H  HB2  . TYR B 1 60  ? 63.928 25.291 -24.137 1.00 77.69  ? 275 TYR B HB2  1 
ATOM   3954 H  HB3  . TYR B 1 60  ? 63.351 26.741 -23.886 1.00 77.69  ? 275 TYR B HB3  1 
ATOM   3955 H  HD1  . TYR B 1 60  ? 62.667 25.637 -20.942 1.00 71.22  ? 275 TYR B HD1  1 
ATOM   3956 H  HD2  . TYR B 1 60  ? 66.013 26.263 -23.055 1.00 88.55  ? 275 TYR B HD2  1 
ATOM   3957 H  HE1  . TYR B 1 60  ? 63.886 25.785 -18.975 1.00 74.61  ? 275 TYR B HE1  1 
ATOM   3958 H  HE2  . TYR B 1 60  ? 67.230 26.410 -21.090 1.00 90.11  ? 275 TYR B HE2  1 
ATOM   3959 H  HH   . TYR B 1 60  ? 67.202 26.338 -18.839 1.00 81.89  ? 275 TYR B HH   1 
ATOM   3960 N  N    . ASP B 1 61  ? 61.244 25.345 -25.785 1.00 54.41  ? 276 ASP B N    1 
ATOM   3961 C  CA   . ASP B 1 61  ? 60.656 25.976 -26.978 1.00 59.97  ? 276 ASP B CA   1 
ATOM   3962 C  C    . ASP B 1 61  ? 59.135 25.767 -27.084 1.00 58.49  ? 276 ASP B C    1 
ATOM   3963 O  O    . ASP B 1 61  ? 58.459 26.457 -27.843 1.00 59.35  ? 276 ASP B O    1 
ATOM   3964 C  CB   . ASP B 1 61  ? 61.366 25.477 -28.267 1.00 64.98  ? 276 ASP B CB   1 
ATOM   3965 C  CG   . ASP B 1 61  ? 61.103 23.990 -28.586 1.00 69.74  ? 276 ASP B CG   1 
ATOM   3966 O  OD1  . ASP B 1 61  ? 61.132 23.640 -29.788 1.00 82.17  ? 276 ASP B OD1  1 
ATOM   3967 O  OD2  . ASP B 1 61  ? 60.884 23.169 -27.667 1.00 68.32  ? 276 ASP B OD2  1 
ATOM   3968 H  H    . ASP B 1 61  ? 61.658 24.609 -25.950 1.00 65.29  ? 276 ASP B H    1 
ATOM   3969 H  HA   . ASP B 1 61  ? 60.809 26.932 -26.919 1.00 71.97  ? 276 ASP B HA   1 
ATOM   3970 H  HB2  . ASP B 1 61  ? 61.052 26.002 -29.020 1.00 77.98  ? 276 ASP B HB2  1 
ATOM   3971 H  HB3  . ASP B 1 61  ? 62.323 25.593 -28.162 1.00 77.98  ? 276 ASP B HB3  1 
ATOM   3972 N  N    . LYS B 1 62  ? 58.586 24.842 -26.305 1.00 57.09  ? 277 LYS B N    1 
ATOM   3973 C  CA   . LYS B 1 62  ? 57.153 24.586 -26.361 1.00 47.13  ? 277 LYS B CA   1 
ATOM   3974 C  C    . LYS B 1 62  ? 56.397 25.460 -25.346 1.00 43.11  ? 277 LYS B C    1 
ATOM   3975 O  O    . LYS B 1 62  ? 55.171 25.393 -25.241 1.00 43.40  ? 277 LYS B O    1 
ATOM   3976 C  CB   . LYS B 1 62  ? 56.892 23.097 -26.126 1.00 48.70  ? 277 LYS B CB   1 
ATOM   3977 C  CG   . LYS B 1 62  ? 57.596 22.181 -27.149 1.00 59.52  ? 277 LYS B CG   1 
ATOM   3978 C  CD   . LYS B 1 62  ? 56.588 21.524 -28.120 1.00 68.70  ? 277 LYS B CD   1 
ATOM   3979 C  CE   . LYS B 1 62  ? 57.144 21.275 -29.535 1.00 66.76  ? 277 LYS B CE   1 
ATOM   3980 N  NZ   . LYS B 1 62  ? 57.362 19.839 -29.846 1.00 80.81  ? 277 LYS B NZ   1 
ATOM   3981 H  H    . LYS B 1 62  ? 59.015 24.353 -25.743 1.00 68.51  ? 277 LYS B H    1 
ATOM   3982 H  HA   . LYS B 1 62  ? 56.828 24.810 -27.247 1.00 56.56  ? 277 LYS B HA   1 
ATOM   3983 H  HB2  . LYS B 1 62  ? 57.212 22.858 -25.242 1.00 58.45  ? 277 LYS B HB2  1 
ATOM   3984 H  HB3  . LYS B 1 62  ? 55.938 22.932 -26.186 1.00 58.45  ? 277 LYS B HB3  1 
ATOM   3985 H  HG2  . LYS B 1 62  ? 58.221 22.707 -27.671 1.00 71.43  ? 277 LYS B HG2  1 
ATOM   3986 H  HG3  . LYS B 1 62  ? 58.065 21.476 -26.676 1.00 71.43  ? 277 LYS B HG3  1 
ATOM   3987 H  HD2  . LYS B 1 62  ? 56.317 20.668 -27.754 1.00 82.44  ? 277 LYS B HD2  1 
ATOM   3988 H  HD3  . LYS B 1 62  ? 55.815 22.104 -28.204 1.00 82.44  ? 277 LYS B HD3  1 
ATOM   3989 H  HE2  . LYS B 1 62  ? 56.515 21.627 -30.184 1.00 80.11  ? 277 LYS B HE2  1 
ATOM   3990 H  HE3  . LYS B 1 62  ? 57.996 21.731 -29.622 1.00 80.11  ? 277 LYS B HE3  1 
ATOM   3991 H  HZ1  . LYS B 1 62  ? 57.682 19.753 -30.672 1.00 96.98  ? 277 LYS B HZ1  1 
ATOM   3992 H  HZ2  . LYS B 1 62  ? 57.945 19.489 -29.272 1.00 96.98  ? 277 LYS B HZ2  1 
ATOM   3993 H  HZ3  . LYS B 1 62  ? 56.594 19.395 -29.786 1.00 96.98  ? 277 LYS B HZ3  1 
ATOM   3994 N  N    . PHE B 1 63  ? 57.115 26.306 -24.612 1.00 49.52  ? 278 PHE B N    1 
ATOM   3995 C  CA   . PHE B 1 63  ? 56.481 27.071 -23.537 1.00 56.66  ? 278 PHE B CA   1 
ATOM   3996 C  C    . PHE B 1 63  ? 56.759 28.556 -23.719 1.00 40.41  ? 278 PHE B C    1 
ATOM   3997 O  O    . PHE B 1 63  ? 57.510 28.939 -24.635 1.00 42.61  ? 278 PHE B O    1 
ATOM   3998 C  CB   . PHE B 1 63  ? 56.937 26.500 -22.186 1.00 53.38  ? 278 PHE B CB   1 
ATOM   3999 C  CG   . PHE B 1 63  ? 56.367 25.152 -21.948 1.00 45.57  ? 278 PHE B CG   1 
ATOM   4000 C  CD1  . PHE B 1 63  ? 55.092 25.025 -21.412 1.00 43.96  ? 278 PHE B CD1  1 
ATOM   4001 C  CD2  . PHE B 1 63  ? 57.027 24.013 -22.378 1.00 56.38  ? 278 PHE B CD2  1 
ATOM   4002 C  CE1  . PHE B 1 63  ? 54.511 23.785 -21.243 1.00 41.08  ? 278 PHE B CE1  1 
ATOM   4003 C  CE2  . PHE B 1 63  ? 56.460 22.755 -22.204 1.00 44.04  ? 278 PHE B CE2  1 
ATOM   4004 C  CZ   . PHE B 1 63  ? 55.183 22.648 -21.644 1.00 39.00  ? 278 PHE B CZ   1 
ATOM   4005 H  H    . PHE B 1 63  ? 57.956 26.454 -24.712 1.00 59.42  ? 278 PHE B H    1 
ATOM   4006 H  HA   . PHE B 1 63  ? 55.521 26.947 -23.595 1.00 67.99  ? 278 PHE B HA   1 
ATOM   4007 H  HB2  . PHE B 1 63  ? 57.904 26.427 -22.179 1.00 64.05  ? 278 PHE B HB2  1 
ATOM   4008 H  HB3  . PHE B 1 63  ? 56.639 27.087 -21.473 1.00 64.05  ? 278 PHE B HB3  1 
ATOM   4009 H  HD1  . PHE B 1 63  ? 54.629 25.787 -21.146 1.00 52.76  ? 278 PHE B HD1  1 
ATOM   4010 H  HD2  . PHE B 1 63  ? 57.873 24.087 -22.757 1.00 67.65  ? 278 PHE B HD2  1 
ATOM   4011 H  HE1  . PHE B 1 63  ? 53.667 23.716 -20.860 1.00 49.29  ? 278 PHE B HE1  1 
ATOM   4012 H  HE2  . PHE B 1 63  ? 56.918 21.992 -22.475 1.00 52.85  ? 278 PHE B HE2  1 
ATOM   4013 H  HZ   . PHE B 1 63  ? 54.798 21.811 -21.516 1.00 46.81  ? 278 PHE B HZ   1 
ATOM   4014 N  N    . PRO B 1 64  ? 56.111 29.411 -22.901 1.00 72.24  ? 279 PRO B N    1 
ATOM   4015 C  CA   . PRO B 1 64  ? 56.183 30.820 -23.311 1.00 69.09  ? 279 PRO B CA   1 
ATOM   4016 C  C    . PRO B 1 64  ? 57.562 31.431 -23.151 1.00 62.39  ? 279 PRO B C    1 
ATOM   4017 O  O    . PRO B 1 64  ? 58.478 30.849 -22.565 1.00 62.77  ? 279 PRO B O    1 
ATOM   4018 C  CB   . PRO B 1 64  ? 55.173 31.520 -22.386 1.00 69.21  ? 279 PRO B CB   1 
ATOM   4019 C  CG   . PRO B 1 64  ? 54.997 30.623 -21.209 1.00 68.72  ? 279 PRO B CG   1 
ATOM   4020 C  CD   . PRO B 1 64  ? 55.451 29.235 -21.589 1.00 73.17  ? 279 PRO B CD   1 
ATOM   4021 H  HA   . PRO B 1 64  ? 55.894 30.917 -24.231 1.00 82.91  ? 279 PRO B HA   1 
ATOM   4022 H  HB2  . PRO B 1 64  ? 55.530 32.379 -22.108 1.00 83.05  ? 279 PRO B HB2  1 
ATOM   4023 H  HB3  . PRO B 1 64  ? 54.332 31.637 -22.854 1.00 83.05  ? 279 PRO B HB3  1 
ATOM   4024 H  HG2  . PRO B 1 64  ? 55.532 30.958 -20.473 1.00 82.47  ? 279 PRO B HG2  1 
ATOM   4025 H  HG3  . PRO B 1 64  ? 54.060 30.610 -20.959 1.00 82.47  ? 279 PRO B HG3  1 
ATOM   4026 H  HD2  . PRO B 1 64  ? 56.085 28.899 -20.936 1.00 87.80  ? 279 PRO B HD2  1 
ATOM   4027 H  HD3  . PRO B 1 64  ? 54.686 28.644 -21.675 1.00 87.80  ? 279 PRO B HD3  1 
ATOM   4028 N  N    . GLU B 1 65  ? 57.690 32.619 -23.716 1.00 81.40  ? 280 GLU B N    1 
ATOM   4029 C  CA   . GLU B 1 65  ? 58.813 33.501 -23.456 1.00 87.73  ? 280 GLU B CA   1 
ATOM   4030 C  C    . GLU B 1 65  ? 58.185 34.844 -23.109 1.00 93.34  ? 280 GLU B C    1 
ATOM   4031 O  O    . GLU B 1 65  ? 57.090 35.138 -23.595 1.00 100.71 ? 280 GLU B O    1 
ATOM   4032 C  CB   . GLU B 1 65  ? 59.736 33.610 -24.674 1.00 94.01  ? 280 GLU B CB   1 
ATOM   4033 C  CG   . GLU B 1 65  ? 60.587 32.375 -24.942 1.00 92.93  ? 280 GLU B CG   1 
ATOM   4034 C  CD   . GLU B 1 65  ? 61.785 32.283 -24.013 1.00 98.02  ? 280 GLU B CD   1 
ATOM   4035 O  OE1  . GLU B 1 65  ? 62.044 33.266 -23.280 1.00 91.72  ? 280 GLU B OE1  1 
ATOM   4036 O  OE2  . GLU B 1 65  ? 62.468 31.233 -24.019 1.00 101.79 ? 280 GLU B OE2  1 
ATOM   4037 H  H    . GLU B 1 65  ? 57.122 32.946 -24.273 1.00 97.68  ? 280 GLU B H    1 
ATOM   4038 H  HA   . GLU B 1 65  ? 59.323 33.180 -22.695 1.00 105.28 ? 280 GLU B HA   1 
ATOM   4039 H  HB2  . GLU B 1 65  ? 59.191 33.767 -25.461 1.00 112.81 ? 280 GLU B HB2  1 
ATOM   4040 H  HB3  . GLU B 1 65  ? 60.338 34.359 -24.540 1.00 112.81 ? 280 GLU B HB3  1 
ATOM   4041 H  HG2  . GLU B 1 65  ? 60.045 31.582 -24.812 1.00 111.51 ? 280 GLU B HG2  1 
ATOM   4042 H  HG3  . GLU B 1 65  ? 60.916 32.409 -25.854 1.00 111.51 ? 280 GLU B HG3  1 
ATOM   4043 N  N    . LYS B 1 66  ? 58.813 35.670 -22.277 1.00 75.70  ? 281 LYS B N    1 
ATOM   4044 C  CA   . LYS B 1 66  ? 60.064 35.405 -21.573 1.00 61.64  ? 281 LYS B CA   1 
ATOM   4045 C  C    . LYS B 1 66  ? 59.662 35.291 -20.115 1.00 46.72  ? 281 LYS B C    1 
ATOM   4046 O  O    . LYS B 1 66  ? 59.751 34.231 -19.529 1.00 46.00  ? 281 LYS B O    1 
ATOM   4047 C  CB   . LYS B 1 66  ? 61.064 36.544 -21.806 1.00 61.50  ? 281 LYS B CB   1 
ATOM   4048 C  CG   . LYS B 1 66  ? 60.828 37.248 -23.129 1.00 56.44  ? 281 LYS B CG   1 
ATOM   4049 C  CD   . LYS B 1 66  ? 61.891 38.249 -23.451 1.00 71.51  ? 281 LYS B CD   1 
ATOM   4050 C  CE   . LYS B 1 66  ? 61.614 39.605 -22.813 1.00 73.04  ? 281 LYS B CE   1 
ATOM   4051 N  NZ   . LYS B 1 66  ? 62.064 40.707 -23.716 1.00 87.08  ? 281 LYS B NZ   1 
ATOM   4052 H  H    . LYS B 1 66  ? 58.505 36.451 -22.093 1.00 90.84  ? 281 LYS B H    1 
ATOM   4053 H  HA   . LYS B 1 66  ? 60.451 34.567 -21.869 1.00 73.97  ? 281 LYS B HA   1 
ATOM   4054 H  HB2  . LYS B 1 66  ? 60.974 37.198 -21.096 1.00 73.80  ? 281 LYS B HB2  1 
ATOM   4055 H  HB3  . LYS B 1 66  ? 61.964 36.181 -21.813 1.00 73.80  ? 281 LYS B HB3  1 
ATOM   4056 H  HG2  . LYS B 1 66  ? 60.813 36.588 -23.840 1.00 67.72  ? 281 LYS B HG2  1 
ATOM   4057 H  HG3  . LYS B 1 66  ? 59.979 37.715 -23.091 1.00 67.72  ? 281 LYS B HG3  1 
ATOM   4058 H  HD2  . LYS B 1 66  ? 62.743 37.927 -23.118 1.00 85.81  ? 281 LYS B HD2  1 
ATOM   4059 H  HD3  . LYS B 1 66  ? 61.933 38.371 -24.412 1.00 85.81  ? 281 LYS B HD3  1 
ATOM   4060 H  HE2  . LYS B 1 66  ? 60.661 39.702 -22.660 1.00 87.65  ? 281 LYS B HE2  1 
ATOM   4061 H  HE3  . LYS B 1 66  ? 62.100 39.674 -21.976 1.00 87.65  ? 281 LYS B HE3  1 
ATOM   4062 H  HZ1  . LYS B 1 66  ? 61.900 41.496 -23.338 1.00 104.50 ? 281 LYS B HZ1  1 
ATOM   4063 H  HZ2  . LYS B 1 66  ? 62.938 40.636 -23.869 1.00 104.50 ? 281 LYS B HZ2  1 
ATOM   4064 H  HZ3  . LYS B 1 66  ? 61.630 40.661 -24.491 1.00 104.50 ? 281 LYS B HZ3  1 
ATOM   4065 N  N    . LYS B 1 67  ? 59.131 36.383 -19.571 1.00 55.19  ? 282 LYS B N    1 
ATOM   4066 C  CA   . LYS B 1 67  ? 58.500 36.373 -18.254 1.00 52.54  ? 282 LYS B CA   1 
ATOM   4067 C  C    . LYS B 1 67  ? 57.419 35.292 -18.188 1.00 41.16  ? 282 LYS B C    1 
ATOM   4068 O  O    . LYS B 1 67  ? 56.495 35.244 -19.023 1.00 36.23  ? 282 LYS B O    1 
ATOM   4069 C  CB   . LYS B 1 67  ? 57.896 37.742 -17.923 1.00 60.13  ? 282 LYS B CB   1 
ATOM   4070 C  CG   . LYS B 1 67  ? 58.556 38.432 -16.731 1.00 62.07  ? 282 LYS B CG   1 
ATOM   4071 C  CD   . LYS B 1 67  ? 59.851 39.100 -17.163 1.00 67.35  ? 282 LYS B CD   1 
ATOM   4072 C  CE   . LYS B 1 67  ? 60.302 40.161 -16.195 1.00 65.43  ? 282 LYS B CE   1 
ATOM   4073 N  NZ   . LYS B 1 67  ? 61.127 41.101 -16.965 1.00 72.62  ? 282 LYS B NZ   1 
ATOM   4074 H  H    . LYS B 1 67  ? 59.123 37.154 -19.951 1.00 66.23  ? 282 LYS B H    1 
ATOM   4075 H  HA   . LYS B 1 67  ? 59.171 36.170 -17.584 1.00 63.05  ? 282 LYS B HA   1 
ATOM   4076 H  HB2  . LYS B 1 67  ? 57.995 38.322 -18.694 1.00 72.15  ? 282 LYS B HB2  1 
ATOM   4077 H  HB3  . LYS B 1 67  ? 56.956 37.627 -17.716 1.00 72.15  ? 282 LYS B HB3  1 
ATOM   4078 H  HG2  . LYS B 1 67  ? 57.960 39.113 -16.381 1.00 74.48  ? 282 LYS B HG2  1 
ATOM   4079 H  HG3  . LYS B 1 67  ? 58.761 37.774 -16.048 1.00 74.48  ? 282 LYS B HG3  1 
ATOM   4080 H  HD2  . LYS B 1 67  ? 60.549 38.429 -17.221 1.00 80.82  ? 282 LYS B HD2  1 
ATOM   4081 H  HD3  . LYS B 1 67  ? 59.719 39.518 -18.028 1.00 80.82  ? 282 LYS B HD3  1 
ATOM   4082 H  HE2  . LYS B 1 67  ? 59.536 40.632 -15.832 1.00 78.52  ? 282 LYS B HE2  1 
ATOM   4083 H  HE3  . LYS B 1 67  ? 60.840 39.767 -15.491 1.00 78.52  ? 282 LYS B HE3  1 
ATOM   4084 H  HZ1  . LYS B 1 67  ? 61.421 41.752 -16.435 1.00 87.15  ? 282 LYS B HZ1  1 
ATOM   4085 H  HZ2  . LYS B 1 67  ? 61.827 40.675 -17.315 1.00 87.15  ? 282 LYS B HZ2  1 
ATOM   4086 H  HZ3  . LYS B 1 67  ? 60.647 41.458 -17.624 1.00 87.15  ? 282 LYS B HZ3  1 
ATOM   4087 N  N    . GLY B 1 68  ? 57.574 34.404 -17.214 1.00 38.45  ? 283 GLY B N    1 
ATOM   4088 C  CA   . GLY B 1 68  ? 56.618 33.346 -16.980 1.00 40.99  ? 283 GLY B CA   1 
ATOM   4089 C  C    . GLY B 1 68  ? 56.815 32.146 -17.871 1.00 42.77  ? 283 GLY B C    1 
ATOM   4090 O  O    . GLY B 1 68  ? 55.995 31.224 -17.824 1.00 34.75  ? 283 GLY B O    1 
ATOM   4091 H  H    . GLY B 1 68  ? 58.238 34.399 -16.667 1.00 46.14  ? 283 GLY B H    1 
ATOM   4092 H  HA2  . GLY B 1 68  ? 56.686 33.052 -16.058 1.00 49.19  ? 283 GLY B HA2  1 
ATOM   4093 H  HA3  . GLY B 1 68  ? 55.722 33.687 -17.124 1.00 49.19  ? 283 GLY B HA3  1 
ATOM   4094 N  N    . GLY B 1 69  ? 57.859 32.171 -18.716 1.00 40.85  ? 284 GLY B N    1 
ATOM   4095 C  CA   . GLY B 1 69  ? 58.278 30.968 -19.431 1.00 36.63  ? 284 GLY B CA   1 
ATOM   4096 C  C    . GLY B 1 69  ? 59.182 30.067 -18.571 1.00 43.33  ? 284 GLY B C    1 
ATOM   4097 O  O    . GLY B 1 69  ? 59.687 30.492 -17.512 1.00 34.84  ? 284 GLY B O    1 
ATOM   4098 H  H    . GLY B 1 69  ? 58.333 32.868 -18.887 1.00 49.02  ? 284 GLY B H    1 
ATOM   4099 H  HA2  . GLY B 1 69  ? 57.495 30.459 -19.694 1.00 43.95  ? 284 GLY B HA2  1 
ATOM   4100 H  HA3  . GLY B 1 69  ? 58.765 31.220 -20.231 1.00 43.95  ? 284 GLY B HA3  1 
ATOM   4101 N  N    . LEU B 1 70  ? 59.387 28.823 -19.018 1.00 46.30  ? 285 LEU B N    1 
ATOM   4102 C  CA   . LEU B 1 70  ? 60.125 27.841 -18.221 1.00 53.36  ? 285 LEU B CA   1 
ATOM   4103 C  C    . LEU B 1 70  ? 61.516 28.322 -17.810 1.00 45.26  ? 285 LEU B C    1 
ATOM   4104 O  O    . LEU B 1 70  ? 61.895 28.153 -16.667 1.00 35.89  ? 285 LEU B O    1 
ATOM   4105 C  CB   . LEU B 1 70  ? 60.263 26.497 -18.961 1.00 48.17  ? 285 LEU B CB   1 
ATOM   4106 C  CG   . LEU B 1 70  ? 59.128 25.505 -18.731 1.00 36.75  ? 285 LEU B CG   1 
ATOM   4107 C  CD1  . LEU B 1 70  ? 59.264 24.316 -19.640 1.00 53.64  ? 285 LEU B CD1  1 
ATOM   4108 C  CD2  . LEU B 1 70  ? 59.097 25.080 -17.246 1.00 30.51  ? 285 LEU B CD2  1 
ATOM   4109 H  H    . LEU B 1 70  ? 59.111 28.526 -19.776 1.00 55.56  ? 285 LEU B H    1 
ATOM   4110 H  HA   . LEU B 1 70  ? 59.625 27.673 -17.407 1.00 64.03  ? 285 LEU B HA   1 
ATOM   4111 H  HB2  . LEU B 1 70  ? 60.306 26.674 -19.914 1.00 57.81  ? 285 LEU B HB2  1 
ATOM   4112 H  HB3  . LEU B 1 70  ? 61.085 26.071 -18.674 1.00 57.81  ? 285 LEU B HB3  1 
ATOM   4113 H  HG   . LEU B 1 70  ? 58.285 25.939 -18.934 1.00 44.10  ? 285 LEU B HG   1 
ATOM   4114 H  HD11 . LEU B 1 70  ? 58.530 23.704 -19.470 1.00 64.37  ? 285 LEU B HD11 1 
ATOM   4115 H  HD12 . LEU B 1 70  ? 59.237 24.618 -20.561 1.00 64.37  ? 285 LEU B HD12 1 
ATOM   4116 H  HD13 . LEU B 1 70  ? 60.110 23.876 -19.459 1.00 64.37  ? 285 LEU B HD13 1 
ATOM   4117 H  HD21 . LEU B 1 70  ? 58.371 24.450 -17.114 1.00 36.61  ? 285 LEU B HD21 1 
ATOM   4118 H  HD22 . LEU B 1 70  ? 59.943 24.664 -17.020 1.00 36.61  ? 285 LEU B HD22 1 
ATOM   4119 H  HD23 . LEU B 1 70  ? 58.957 25.867 -16.696 1.00 36.61  ? 285 LEU B HD23 1 
ATOM   4120 N  N    . ARG B 1 71  ? 62.283 28.925 -18.703 1.00 43.28  ? 286 ARG B N    1 
ATOM   4121 C  CA   . ARG B 1 71  ? 63.663 29.195 -18.324 1.00 43.30  ? 286 ARG B CA   1 
ATOM   4122 C  C    . ARG B 1 71  ? 63.730 30.180 -17.164 1.00 46.54  ? 286 ARG B C    1 
ATOM   4123 O  O    . ARG B 1 71  ? 64.477 29.936 -16.201 1.00 43.71  ? 286 ARG B O    1 
ATOM   4124 C  CB   . ARG B 1 71  ? 64.505 29.724 -19.486 1.00 46.45  ? 286 ARG B CB   1 
ATOM   4125 C  CG   . ARG B 1 71  ? 65.987 29.836 -19.105 1.00 51.09  ? 286 ARG B CG   1 
ATOM   4126 C  CD   . ARG B 1 71  ? 66.816 30.545 -20.147 1.00 69.61  ? 286 ARG B CD   1 
ATOM   4127 N  NE   . ARG B 1 71  ? 66.849 29.791 -21.397 1.00 79.86  ? 286 ARG B NE   1 
ATOM   4128 C  CZ   . ARG B 1 71  ? 67.561 30.131 -22.473 1.00 82.44  ? 286 ARG B CZ   1 
ATOM   4129 N  NH1  . ARG B 1 71  ? 68.320 31.234 -22.470 1.00 68.08  ? 286 ARG B NH1  1 
ATOM   4130 N  NH2  . ARG B 1 71  ? 67.511 29.360 -23.558 1.00 74.53  ? 286 ARG B NH2  1 
ATOM   4131 H  H    . ARG B 1 71  ? 62.050 29.177 -19.491 1.00 51.93  ? 286 ARG B H    1 
ATOM   4132 H  HA   . ARG B 1 71  ? 64.067 28.366 -18.026 1.00 51.96  ? 286 ARG B HA   1 
ATOM   4133 H  HB2  . ARG B 1 71  ? 64.430 29.115 -20.237 1.00 55.74  ? 286 ARG B HB2  1 
ATOM   4134 H  HB3  . ARG B 1 71  ? 64.188 30.606 -19.735 1.00 55.74  ? 286 ARG B HB3  1 
ATOM   4135 H  HG2  . ARG B 1 71  ? 66.061 30.334 -18.275 1.00 61.31  ? 286 ARG B HG2  1 
ATOM   4136 H  HG3  . ARG B 1 71  ? 66.351 28.945 -18.990 1.00 61.31  ? 286 ARG B HG3  1 
ATOM   4137 H  HD2  . ARG B 1 71  ? 66.430 31.417 -20.327 1.00 83.53  ? 286 ARG B HD2  1 
ATOM   4138 H  HD3  . ARG B 1 71  ? 67.726 30.640 -19.824 1.00 83.53  ? 286 ARG B HD3  1 
ATOM   4139 H  HE   . ARG B 1 71  ? 66.375 29.075 -21.443 1.00 95.83  ? 286 ARG B HE   1 
ATOM   4140 H  HH11 . ARG B 1 71  ? 68.353 31.732 -21.770 1.00 81.70  ? 286 ARG B HH11 1 
ATOM   4141 H  HH12 . ARG B 1 71  ? 68.775 31.445 -23.169 1.00 81.70  ? 286 ARG B HH12 1 
ATOM   4142 H  HH21 . ARG B 1 71  ? 67.024 28.652 -23.561 1.00 89.43  ? 286 ARG B HH21 1 
ATOM   4143 H  HH22 . ARG B 1 71  ? 67.966 29.572 -24.257 1.00 89.43  ? 286 ARG B HH22 1 
ATOM   4144 N  N    . GLU B 1 72  ? 62.975 31.280 -17.267 1.00 50.12  ? 287 GLU B N    1 
ATOM   4145 C  CA   . GLU B 1 72  ? 62.925 32.307 -16.230 1.00 50.76  ? 287 GLU B CA   1 
ATOM   4146 C  C    . GLU B 1 72  ? 62.336 31.736 -14.945 1.00 41.01  ? 287 GLU B C    1 
ATOM   4147 O  O    . GLU B 1 72  ? 62.777 32.055 -13.864 1.00 42.54  ? 287 GLU B O    1 
ATOM   4148 C  CB   . GLU B 1 72  ? 62.095 33.519 -16.700 1.00 52.23  ? 287 GLU B CB   1 
ATOM   4149 C  CG   . GLU B 1 72  ? 61.901 34.681 -15.661 1.00 68.80  ? 287 GLU B CG   1 
ATOM   4150 C  CD   . GLU B 1 72  ? 60.698 34.488 -14.684 1.00 77.45  ? 287 GLU B CD   1 
ATOM   4151 O  OE1  . GLU B 1 72  ? 60.939 34.327 -13.457 1.00 81.10  ? 287 GLU B OE1  1 
ATOM   4152 O  OE2  . GLU B 1 72  ? 59.518 34.524 -15.127 1.00 58.09  ? 287 GLU B OE2  1 
ATOM   4153 H  H    . GLU B 1 72  ? 62.475 31.454 -17.945 1.00 60.15  ? 287 GLU B H    1 
ATOM   4154 H  HA   . GLU B 1 72  ? 63.826 32.612 -16.040 1.00 60.92  ? 287 GLU B HA   1 
ATOM   4155 H  HB2  . GLU B 1 72  ? 62.530 33.900 -17.479 1.00 62.67  ? 287 GLU B HB2  1 
ATOM   4156 H  HB3  . GLU B 1 72  ? 61.212 33.204 -16.948 1.00 62.67  ? 287 GLU B HB3  1 
ATOM   4157 H  HG2  . GLU B 1 72  ? 62.706 34.754 -15.124 1.00 82.55  ? 287 GLU B HG2  1 
ATOM   4158 H  HG3  . GLU B 1 72  ? 61.756 35.509 -16.145 1.00 82.55  ? 287 GLU B HG3  1 
ATOM   4159 N  N    . LEU B 1 73  ? 61.322 30.899 -15.066 1.00 31.28  ? 288 LEU B N    1 
ATOM   4160 C  CA   . LEU B 1 73  ? 60.743 30.277 -13.878 1.00 28.28  ? 288 LEU B CA   1 
ATOM   4161 C  C    . LEU B 1 73  ? 61.738 29.356 -13.228 1.00 28.00  ? 288 LEU B C    1 
ATOM   4162 O  O    . LEU B 1 73  ? 61.894 29.382 -12.027 1.00 28.00  ? 288 LEU B O    1 
ATOM   4163 C  CB   . LEU B 1 73  ? 59.498 29.498 -14.206 1.00 26.22  ? 288 LEU B CB   1 
ATOM   4164 C  CG   . LEU B 1 73  ? 58.253 30.302 -14.432 1.00 30.23  ? 288 LEU B CG   1 
ATOM   4165 C  CD1  . LEU B 1 73  ? 57.179 29.367 -14.967 1.00 34.96  ? 288 LEU B CD1  1 
ATOM   4166 C  CD2  . LEU B 1 73  ? 57.826 30.956 -13.131 1.00 29.01  ? 288 LEU B CD2  1 
ATOM   4167 H  H    . LEU B 1 73  ? 60.952 30.673 -15.809 1.00 37.54  ? 288 LEU B H    1 
ATOM   4168 H  HA   . LEU B 1 73  ? 60.508 30.969 -13.239 1.00 33.94  ? 288 LEU B HA   1 
ATOM   4169 H  HB2  . LEU B 1 73  ? 59.662 28.989 -15.015 1.00 31.47  ? 288 LEU B HB2  1 
ATOM   4170 H  HB3  . LEU B 1 73  ? 59.318 28.888 -13.473 1.00 31.47  ? 288 LEU B HB3  1 
ATOM   4171 H  HG   . LEU B 1 73  ? 58.423 30.994 -15.090 1.00 36.28  ? 288 LEU B HG   1 
ATOM   4172 H  HD11 . LEU B 1 73  ? 56.366 29.874 -15.118 1.00 41.95  ? 288 LEU B HD11 1 
ATOM   4173 H  HD12 . LEU B 1 73  ? 57.487 28.978 -15.801 1.00 41.95  ? 288 LEU B HD12 1 
ATOM   4174 H  HD13 . LEU B 1 73  ? 57.017 28.667 -14.315 1.00 41.95  ? 288 LEU B HD13 1 
ATOM   4175 H  HD21 . LEU B 1 73  ? 57.021 31.473 -13.288 1.00 34.81  ? 288 LEU B HD21 1 
ATOM   4176 H  HD22 . LEU B 1 73  ? 57.653 30.265 -12.473 1.00 34.81  ? 288 LEU B HD22 1 
ATOM   4177 H  HD23 . LEU B 1 73  ? 58.538 31.537 -12.821 1.00 34.81  ? 288 LEU B HD23 1 
ATOM   4178 N  N    . TYR B 1 74  ? 62.414 28.553 -14.037 1.00 37.04  ? 289 TYR B N    1 
ATOM   4179 C  CA   . TYR B 1 74  ? 63.389 27.612 -13.516 1.00 40.62  ? 289 TYR B CA   1 
ATOM   4180 C  C    . TYR B 1 74  ? 64.543 28.327 -12.856 1.00 45.64  ? 289 TYR B C    1 
ATOM   4181 O  O    . TYR B 1 74  ? 65.052 27.849 -11.844 1.00 39.66  ? 289 TYR B O    1 
ATOM   4182 C  CB   . TYR B 1 74  ? 63.936 26.691 -14.602 1.00 38.81  ? 289 TYR B CB   1 
ATOM   4183 C  CG   . TYR B 1 74  ? 64.340 25.341 -14.052 1.00 40.92  ? 289 TYR B CG   1 
ATOM   4184 C  CD1  . TYR B 1 74  ? 63.462 24.271 -14.110 1.00 35.72  ? 289 TYR B CD1  1 
ATOM   4185 C  CD2  . TYR B 1 74  ? 65.589 25.143 -13.444 1.00 39.15  ? 289 TYR B CD2  1 
ATOM   4186 C  CE1  . TYR B 1 74  ? 63.804 23.044 -13.606 1.00 35.64  ? 289 TYR B CE1  1 
ATOM   4187 C  CE2  . TYR B 1 74  ? 65.952 23.906 -12.946 1.00 43.48  ? 289 TYR B CE2  1 
ATOM   4188 C  CZ   . TYR B 1 74  ? 65.044 22.853 -13.025 1.00 46.68  ? 289 TYR B CZ   1 
ATOM   4189 O  OH   . TYR B 1 74  ? 65.337 21.597 -12.525 1.00 39.64  ? 289 TYR B OH   1 
ATOM   4190 H  H    . TYR B 1 74  ? 62.325 28.534 -14.892 1.00 44.44  ? 289 TYR B H    1 
ATOM   4191 H  HA   . TYR B 1 74  ? 62.960 27.057 -12.845 1.00 48.74  ? 289 TYR B HA   1 
ATOM   4192 H  HB2  . TYR B 1 74  ? 63.251 26.551 -15.275 1.00 46.57  ? 289 TYR B HB2  1 
ATOM   4193 H  HB3  . TYR B 1 74  ? 64.718 27.101 -15.003 1.00 46.57  ? 289 TYR B HB3  1 
ATOM   4194 H  HD1  . TYR B 1 74  ? 62.626 24.388 -14.501 1.00 42.86  ? 289 TYR B HD1  1 
ATOM   4195 H  HD2  . TYR B 1 74  ? 66.192 25.849 -13.398 1.00 46.98  ? 289 TYR B HD2  1 
ATOM   4196 H  HE1  . TYR B 1 74  ? 63.202 22.336 -13.659 1.00 42.77  ? 289 TYR B HE1  1 
ATOM   4197 H  HE2  . TYR B 1 74  ? 66.782 23.784 -12.547 1.00 52.18  ? 289 TYR B HE2  1 
ATOM   4198 H  HH   . TYR B 1 74  ? 64.685 21.080 -12.646 1.00 47.57  ? 289 TYR B HH   1 
ATOM   4199 N  N    . ASP B 1 75  ? 64.966 29.458 -13.423 1.00 50.59  ? 290 ASP B N    1 
ATOM   4200 C  CA   . ASP B 1 75  ? 66.049 30.243 -12.825 1.00 51.76  ? 290 ASP B CA   1 
ATOM   4201 C  C    . ASP B 1 75  ? 65.613 30.817 -11.474 1.00 49.87  ? 290 ASP B C    1 
ATOM   4202 O  O    . ASP B 1 75  ? 66.401 30.920 -10.554 1.00 52.24  ? 290 ASP B O    1 
ATOM   4203 C  CB   . ASP B 1 75  ? 66.491 31.385 -13.749 1.00 55.22  ? 290 ASP B CB   1 
ATOM   4204 C  CG   . ASP B 1 75  ? 67.253 30.903 -14.980 1.00 65.40  ? 290 ASP B CG   1 
ATOM   4205 O  OD1  . ASP B 1 75  ? 67.658 29.718 -15.048 1.00 53.28  ? 290 ASP B OD1  1 
ATOM   4206 O  OD2  . ASP B 1 75  ? 67.462 31.738 -15.885 1.00 78.31  ? 290 ASP B OD2  1 
ATOM   4207 H  H    . ASP B 1 75  ? 64.645 29.791 -14.148 1.00 60.71  ? 290 ASP B H    1 
ATOM   4208 H  HA   . ASP B 1 75  ? 66.814 29.665 -12.675 1.00 62.11  ? 290 ASP B HA   1 
ATOM   4209 H  HB2  . ASP B 1 75  ? 65.705 31.864 -14.054 1.00 66.27  ? 290 ASP B HB2  1 
ATOM   4210 H  HB3  . ASP B 1 75  ? 67.071 31.983 -13.254 1.00 66.27  ? 290 ASP B HB3  1 
ATOM   4211 N  N    . ARG B 1 76  ? 64.354 31.202 -11.372 1.00 52.81  ? 291 ARG B N    1 
ATOM   4212 C  CA   . ARG B 1 76  ? 63.807 31.703 -10.124 1.00 47.53  ? 291 ARG B CA   1 
ATOM   4213 C  C    . ARG B 1 76  ? 63.833 30.606 -9.059  1.00 38.83  ? 291 ARG B C    1 
ATOM   4214 O  O    . ARG B 1 76  ? 64.030 30.889 -7.875  1.00 42.45  ? 291 ARG B O    1 
ATOM   4215 C  CB   . ARG B 1 76  ? 62.376 32.214 -10.340 1.00 43.49  ? 291 ARG B CB   1 
ATOM   4216 C  CG   . ARG B 1 76  ? 61.511 32.290 -9.077  1.00 48.27  ? 291 ARG B CG   1 
ATOM   4217 C  CD   . ARG B 1 76  ? 60.481 33.441 -9.150  1.00 56.68  ? 291 ARG B CD   1 
ATOM   4218 N  NE   . ARG B 1 76  ? 59.274 33.072 -9.898  1.00 46.95  ? 291 ARG B NE   1 
ATOM   4219 C  CZ   . ARG B 1 76  ? 58.020 33.267 -9.478  1.00 65.34  ? 291 ARG B CZ   1 
ATOM   4220 N  NH1  . ARG B 1 76  ? 57.770 33.855 -8.308  1.00 73.75  ? 291 ARG B NH1  1 
ATOM   4221 N  NH2  . ARG B 1 76  ? 56.995 32.877 -10.237 1.00 61.70  ? 291 ARG B NH2  1 
ATOM   4222 H  H    . ARG B 1 76  ? 63.788 31.183 -12.019 1.00 63.37  ? 291 ARG B H    1 
ATOM   4223 H  HA   . ARG B 1 76  ? 64.350 32.443 -9.810  1.00 57.03  ? 291 ARG B HA   1 
ATOM   4224 H  HB2  . ARG B 1 76  ? 62.421 33.107 -10.716 1.00 52.18  ? 291 ARG B HB2  1 
ATOM   4225 H  HB3  . ARG B 1 76  ? 61.929 31.621 -10.964 1.00 52.18  ? 291 ARG B HB3  1 
ATOM   4226 H  HG2  . ARG B 1 76  ? 61.026 31.456 -8.972  1.00 57.93  ? 291 ARG B HG2  1 
ATOM   4227 H  HG3  . ARG B 1 76  ? 62.082 32.443 -8.308  1.00 57.93  ? 291 ARG B HG3  1 
ATOM   4228 H  HD2  . ARG B 1 76  ? 60.213 33.684 -8.249  1.00 68.02  ? 291 ARG B HD2  1 
ATOM   4229 H  HD3  . ARG B 1 76  ? 60.888 34.203 -9.592  1.00 68.02  ? 291 ARG B HD3  1 
ATOM   4230 H  HE   . ARG B 1 76  ? 59.382 32.702 -10.667 1.00 56.34  ? 291 ARG B HE   1 
ATOM   4231 H  HH11 . ARG B 1 76  ? 58.421 34.108 -7.806  1.00 88.50  ? 291 ARG B HH11 1 
ATOM   4232 H  HH12 . ARG B 1 76  ? 56.958 33.976 -8.052  1.00 88.50  ? 291 ARG B HH12 1 
ATOM   4233 H  HH21 . ARG B 1 76  ? 57.142 32.501 -10.997 1.00 74.04  ? 291 ARG B HH21 1 
ATOM   4234 H  HH22 . ARG B 1 76  ? 56.188 33.009 -9.972  1.00 74.04  ? 291 ARG B HH22 1 
ATOM   4235 N  N    . GLY B 1 77  ? 63.620 29.361 -9.487  1.00 44.35  ? 292 GLY B N    1 
ATOM   4236 C  CA   . GLY B 1 77  ? 63.614 28.217 -8.591  1.00 29.99  ? 292 GLY B CA   1 
ATOM   4237 C  C    . GLY B 1 77  ? 62.415 28.205 -7.667  1.00 38.17  ? 292 GLY B C    1 
ATOM   4238 O  O    . GLY B 1 77  ? 61.546 29.100 -7.726  1.00 33.63  ? 292 GLY B O    1 
ATOM   4239 H  H    . GLY B 1 77  ? 63.474 29.155 -10.309 1.00 53.23  ? 292 GLY B H    1 
ATOM   4240 H  HA2  . GLY B 1 77  ? 63.606 27.399 -9.112  1.00 35.99  ? 292 GLY B HA2  1 
ATOM   4241 H  HA3  . GLY B 1 77  ? 64.418 28.228 -8.049  1.00 35.99  ? 292 GLY B HA3  1 
ATOM   4242 N  N    . PRO B 1 78  ? 62.360 27.200 -6.778  1.00 30.35  ? 293 PRO B N    1 
ATOM   4243 C  CA   . PRO B 1 78  ? 63.396 26.183 -6.554  1.00 28.79  ? 293 PRO B CA   1 
ATOM   4244 C  C    . PRO B 1 78  ? 63.286 25.013 -7.527  1.00 25.85  ? 293 PRO B C    1 
ATOM   4245 O  O    . PRO B 1 78  ? 62.174 24.687 -7.917  1.00 26.45  ? 293 PRO B O    1 
ATOM   4246 C  CB   . PRO B 1 78  ? 63.109 25.743 -5.125  1.00 32.83  ? 293 PRO B CB   1 
ATOM   4247 C  CG   . PRO B 1 78  ? 61.622 25.839 -5.031  1.00 35.70  ? 293 PRO B CG   1 
ATOM   4248 C  CD   . PRO B 1 78  ? 61.238 27.050 -5.833  1.00 30.95  ? 293 PRO B CD   1 
ATOM   4249 H  HA   . PRO B 1 78  ? 64.281 26.575 -6.607  1.00 34.55  ? 293 PRO B HA   1 
ATOM   4250 H  HB2  . PRO B 1 78  ? 63.409 24.830 -4.992  1.00 39.39  ? 293 PRO B HB2  1 
ATOM   4251 H  HB3  . PRO B 1 78  ? 63.538 26.347 -4.499  1.00 39.39  ? 293 PRO B HB3  1 
ATOM   4252 H  HG2  . PRO B 1 78  ? 61.220 25.040 -5.407  1.00 42.84  ? 293 PRO B HG2  1 
ATOM   4253 H  HG3  . PRO B 1 78  ? 61.361 25.948 -4.103  1.00 42.84  ? 293 PRO B HG3  1 
ATOM   4254 H  HD2  . PRO B 1 78  ? 60.410 26.890 -6.313  1.00 37.13  ? 293 PRO B HD2  1 
ATOM   4255 H  HD3  . PRO B 1 78  ? 61.172 27.829 -5.259  1.00 37.13  ? 293 PRO B HD3  1 
ATOM   4256 N  N    . PRO B 1 79  ? 64.410 24.405 -7.925  1.00 26.71  ? 294 PRO B N    1 
ATOM   4257 C  CA   . PRO B 1 79  ? 64.443 23.330 -8.937  1.00 26.69  ? 294 PRO B CA   1 
ATOM   4258 C  C    . PRO B 1 79  ? 63.563 22.125 -8.666  1.00 29.39  ? 294 PRO B C    1 
ATOM   4259 O  O    . PRO B 1 79  ? 63.056 21.524 -9.613  1.00 24.77  ? 294 PRO B O    1 
ATOM   4260 C  CB   . PRO B 1 79  ? 65.911 22.870 -8.929  1.00 36.86  ? 294 PRO B CB   1 
ATOM   4261 C  CG   . PRO B 1 79  ? 66.677 23.973 -8.399  1.00 31.02  ? 294 PRO B CG   1 
ATOM   4262 C  CD   . PRO B 1 79  ? 65.768 24.814 -7.525  1.00 28.89  ? 294 PRO B CD   1 
ATOM   4263 H  HA   . PRO B 1 79  ? 64.228 23.689 -9.812  1.00 32.03  ? 294 PRO B HA   1 
ATOM   4264 H  HB2  . PRO B 1 79  ? 66.003 22.089 -8.361  1.00 44.24  ? 294 PRO B HB2  1 
ATOM   4265 H  HB3  . PRO B 1 79  ? 66.192 22.666 -9.835  1.00 44.24  ? 294 PRO B HB3  1 
ATOM   4266 H  HG2  . PRO B 1 79  ? 67.414 23.624 -7.874  1.00 37.22  ? 294 PRO B HG2  1 
ATOM   4267 H  HG3  . PRO B 1 79  ? 67.017 24.505 -9.135  1.00 37.22  ? 294 PRO B HG3  1 
ATOM   4268 H  HD2  . PRO B 1 79  ? 65.918 24.610 -6.588  1.00 34.67  ? 294 PRO B HD2  1 
ATOM   4269 H  HD3  . PRO B 1 79  ? 65.903 25.757 -7.708  1.00 34.67  ? 294 PRO B HD3  1 
ATOM   4270 N  N    . HIS B 1 80  ? 63.397 21.742 -7.407  1.00 29.01  ? 295 HIS B N    1 
ATOM   4271 C  CA   . HIS B 1 80  ? 62.681 20.504 -7.145  1.00 25.17  ? 295 HIS B CA   1 
ATOM   4272 C  C    . HIS B 1 80  ? 61.194 20.660 -7.349  1.00 23.47  ? 295 HIS B C    1 
ATOM   4273 O  O    . HIS B 1 80  ? 60.442 19.693 -7.266  1.00 23.21  ? 295 HIS B O    1 
ATOM   4274 C  CB   . HIS B 1 80  ? 62.941 20.022 -5.715  1.00 25.90  ? 295 HIS B CB   1 
ATOM   4275 C  CG   . HIS B 1 80  ? 62.335 20.921 -4.683  1.00 26.04  ? 295 HIS B CG   1 
ATOM   4276 N  ND1  . HIS B 1 80  ? 62.854 22.151 -4.371  1.00 32.43  ? 295 HIS B ND1  1 
ATOM   4277 C  CD2  . HIS B 1 80  ? 61.234 20.770 -3.914  1.00 30.16  ? 295 HIS B CD2  1 
ATOM   4278 C  CE1  . HIS B 1 80  ? 62.083 22.744 -3.472  1.00 28.27  ? 295 HIS B CE1  1 
ATOM   4279 N  NE2  . HIS B 1 80  ? 61.108 21.918 -3.160  1.00 30.58  ? 295 HIS B NE2  1 
ATOM   4280 H  H    . HIS B 1 80  ? 63.677 22.162 -6.711  1.00 34.82  ? 295 HIS B H    1 
ATOM   4281 H  HA   . HIS B 1 80  ? 62.998 19.820 -7.756  1.00 30.21  ? 295 HIS B HA   1 
ATOM   4282 H  HB2  . HIS B 1 80  ? 62.558 19.137 -5.605  1.00 31.07  ? 295 HIS B HB2  1 
ATOM   4283 H  HB3  . HIS B 1 80  ? 63.898 19.990 -5.561  1.00 31.07  ? 295 HIS B HB3  1 
ATOM   4284 H  HD1  . HIS B 1 80  ? 63.550 22.502 -4.735  1.00 38.91  ? 295 HIS B HD1  1 
ATOM   4285 H  HD2  . HIS B 1 80  ? 60.665 20.034 -3.900  1.00 36.19  ? 295 HIS B HD2  1 
ATOM   4286 H  HE1  . HIS B 1 80  ? 62.235 23.578 -3.088  1.00 33.93  ? 295 HIS B HE1  1 
ATOM   4287 N  N    . ALA B 1 81  ? 60.753 21.895 -7.536  1.00 21.58  ? 296 ALA B N    1 
ATOM   4288 C  CA   . ALA B 1 81  ? 59.342 22.176 -7.656  1.00 20.43  ? 296 ALA B CA   1 
ATOM   4289 C  C    . ALA B 1 81  ? 58.766 21.906 -9.039  1.00 19.47  ? 296 ALA B C    1 
ATOM   4290 O  O    . ALA B 1 81  ? 57.586 22.172 -9.281  1.00 18.69  ? 296 ALA B O    1 
ATOM   4291 C  CB   . ALA B 1 81  ? 59.084 23.658 -7.288  1.00 21.06  ? 296 ALA B CB   1 
ATOM   4292 H  H    . ALA B 1 81  ? 61.257 22.589 -7.596  1.00 25.89  ? 296 ALA B H    1 
ATOM   4293 H  HA   . ALA B 1 81  ? 58.858 21.624 -7.022  1.00 24.51  ? 296 ALA B HA   1 
ATOM   4294 H  HB1  . ALA B 1 81  ? 58.136 23.843 -7.370  1.00 25.27  ? 296 ALA B HB1  1 
ATOM   4295 H  HB2  . ALA B 1 81  ? 59.374 23.811 -6.375  1.00 25.27  ? 296 ALA B HB2  1 
ATOM   4296 H  HB3  . ALA B 1 81  ? 59.586 24.225 -7.894  1.00 25.27  ? 296 ALA B HB3  1 
ATOM   4297 N  N    . PHE B 1 82  ? 59.595 21.425 -9.965  1.00 19.81  ? 297 PHE B N    1 
ATOM   4298 C  CA   . PHE B 1 82  ? 59.240 21.417 -11.379 1.00 19.40  ? 297 PHE B CA   1 
ATOM   4299 C  C    . PHE B 1 82  ? 58.921 20.013 -11.935 1.00 18.81  ? 297 PHE B C    1 
ATOM   4300 O  O    . PHE B 1 82  ? 59.729 19.126 -11.894 1.00 19.40  ? 297 PHE B O    1 
ATOM   4301 C  CB   . PHE B 1 82  ? 60.386 22.055 -12.191 1.00 20.69  ? 297 PHE B CB   1 
ATOM   4302 C  CG   . PHE B 1 82  ? 60.422 23.563 -12.077 1.00 21.42  ? 297 PHE B CG   1 
ATOM   4303 C  CD1  . PHE B 1 82  ? 59.858 24.358 -13.065 1.00 21.48  ? 297 PHE B CD1  1 
ATOM   4304 C  CD2  . PHE B 1 82  ? 60.960 24.173 -10.966 1.00 22.26  ? 297 PHE B CD2  1 
ATOM   4305 C  CE1  . PHE B 1 82  ? 59.831 25.741 -12.950 1.00 22.44  ? 297 PHE B CE1  1 
ATOM   4306 C  CE2  . PHE B 1 82  ? 60.954 25.536 -10.837 1.00 23.20  ? 297 PHE B CE2  1 
ATOM   4307 C  CZ   . PHE B 1 82  ? 60.388 26.335 -11.838 1.00 23.33  ? 297 PHE B CZ   1 
ATOM   4308 H  H    . PHE B 1 82  ? 60.372 21.097 -9.797  1.00 23.77  ? 297 PHE B H    1 
ATOM   4309 H  HA   . PHE B 1 82  ? 58.450 21.967 -11.503 1.00 23.28  ? 297 PHE B HA   1 
ATOM   4310 H  HB2  . PHE B 1 82  ? 61.232 21.710 -11.865 1.00 24.82  ? 297 PHE B HB2  1 
ATOM   4311 H  HB3  . PHE B 1 82  ? 60.274 21.829 -13.127 1.00 24.82  ? 297 PHE B HB3  1 
ATOM   4312 H  HD1  . PHE B 1 82  ? 59.475 23.955 -13.810 1.00 25.78  ? 297 PHE B HD1  1 
ATOM   4313 H  HD2  . PHE B 1 82  ? 61.331 23.651 -10.292 1.00 26.72  ? 297 PHE B HD2  1 
ATOM   4314 H  HE1  . PHE B 1 82  ? 59.460 26.261 -13.626 1.00 26.93  ? 297 PHE B HE1  1 
ATOM   4315 H  HE2  . PHE B 1 82  ? 61.331 25.932 -10.085 1.00 27.84  ? 297 PHE B HE2  1 
ATOM   4316 H  HZ   . PHE B 1 82  ? 60.393 27.261 -11.756 1.00 27.99  ? 297 PHE B HZ   1 
ATOM   4317 N  N    . PHE B 1 83  ? 57.725 19.851 -12.473 1.00 17.88  ? 298 PHE B N    1 
ATOM   4318 C  CA   . PHE B 1 83  ? 57.280 18.584 -13.018 1.00 17.52  ? 298 PHE B CA   1 
ATOM   4319 C  C    . PHE B 1 83  ? 56.743 18.706 -14.434 1.00 17.39  ? 298 PHE B C    1 
ATOM   4320 O  O    . PHE B 1 83  ? 56.284 19.787 -14.882 1.00 17.31  ? 298 PHE B O    1 
ATOM   4321 C  CB   . PHE B 1 83  ? 56.201 18.004 -12.129 1.00 16.80  ? 298 PHE B CB   1 
ATOM   4322 C  CG   . PHE B 1 83  ? 56.633 17.819 -10.716 1.00 17.15  ? 298 PHE B CG   1 
ATOM   4323 C  CD1  . PHE B 1 83  ? 57.150 16.600 -10.292 1.00 17.76  ? 298 PHE B CD1  1 
ATOM   4324 C  CD2  . PHE B 1 83  ? 56.547 18.854 -9.795  1.00 17.22  ? 298 PHE B CD2  1 
ATOM   4325 C  CE1  . PHE B 1 83  ? 57.551 16.429 -8.995  1.00 18.29  ? 298 PHE B CE1  1 
ATOM   4326 C  CE2  . PHE B 1 83  ? 56.975 18.660 -8.502  1.00 19.25  ? 298 PHE B CE2  1 
ATOM   4327 C  CZ   . PHE B 1 83  ? 57.478 17.441 -8.105  1.00 18.33  ? 298 PHE B CZ   1 
ATOM   4328 H  H    . PHE B 1 83  ? 57.138 20.477 -12.535 1.00 21.46  ? 298 PHE B H    1 
ATOM   4329 H  HA   . PHE B 1 83  ? 58.027 17.965 -13.031 1.00 21.02  ? 298 PHE B HA   1 
ATOM   4330 H  HB2  . PHE B 1 83  ? 55.438 18.603 -12.131 1.00 20.16  ? 298 PHE B HB2  1 
ATOM   4331 H  HB3  . PHE B 1 83  ? 55.941 17.137 -12.477 1.00 20.16  ? 298 PHE B HB3  1 
ATOM   4332 H  HD1  . PHE B 1 83  ? 57.214 15.893 -10.892 1.00 21.31  ? 298 PHE B HD1  1 
ATOM   4333 H  HD2  . PHE B 1 83  ? 56.215 19.682 -10.056 1.00 20.67  ? 298 PHE B HD2  1 
ATOM   4334 H  HE1  . PHE B 1 83  ? 57.896 15.608 -8.727  1.00 21.94  ? 298 PHE B HE1  1 
ATOM   4335 H  HE2  . PHE B 1 83  ? 56.913 19.355 -7.887  1.00 23.10  ? 298 PHE B HE2  1 
ATOM   4336 H  HZ   . PHE B 1 83  ? 57.754 17.313 -7.226  1.00 21.99  ? 298 PHE B HZ   1 
ATOM   4337 N  N    . LEU B 1 84  ? 56.804 17.576 -15.119 1.00 18.68  ? 299 LEU B N    1 
ATOM   4338 C  CA   . LEU B 1 84  ? 56.241 17.401 -16.460 1.00 18.72  ? 299 LEU B CA   1 
ATOM   4339 C  C    . LEU B 1 84  ? 55.220 16.275 -16.417 1.00 19.55  ? 299 LEU B C    1 
ATOM   4340 O  O    . LEU B 1 84  ? 55.535 15.196 -15.982 1.00 19.01  ? 299 LEU B O    1 
ATOM   4341 C  CB   . LEU B 1 84  ? 57.299 17.048 -17.462 1.00 20.48  ? 299 LEU B CB   1 
ATOM   4342 C  CG   . LEU B 1 84  ? 56.814 16.569 -18.817 1.00 31.61  ? 299 LEU B CG   1 
ATOM   4343 C  CD1  . LEU B 1 84  ? 56.245 17.741 -19.540 1.00 25.86  ? 299 LEU B CD1  1 
ATOM   4344 C  CD2  . LEU B 1 84  ? 57.930 15.996 -19.605 1.00 40.52  ? 299 LEU B CD2  1 
ATOM   4345 H  H    . LEU B 1 84  ? 57.182 16.864 -14.819 1.00 22.42  ? 299 LEU B H    1 
ATOM   4346 H  HA   . LEU B 1 84  ? 55.799 18.217 -16.742 1.00 22.46  ? 299 LEU B HA   1 
ATOM   4347 H  HB2  . LEU B 1 84  ? 57.847 17.834 -17.614 1.00 24.58  ? 299 LEU B HB2  1 
ATOM   4348 H  HB3  . LEU B 1 84  ? 57.848 16.342 -17.087 1.00 24.58  ? 299 LEU B HB3  1 
ATOM   4349 H  HG   . LEU B 1 84  ? 56.123 15.897 -18.708 1.00 37.93  ? 299 LEU B HG   1 
ATOM   4350 H  HD11 . LEU B 1 84  ? 55.930 17.452 -20.410 1.00 31.04  ? 299 LEU B HD11 1 
ATOM   4351 H  HD12 . LEU B 1 84  ? 55.508 18.103 -19.023 1.00 31.04  ? 299 LEU B HD12 1 
ATOM   4352 H  HD13 . LEU B 1 84  ? 56.937 18.413 -19.644 1.00 31.04  ? 299 LEU B HD13 1 
ATOM   4353 H  HD21 . LEU B 1 84  ? 57.591 15.699 -20.464 1.00 48.62  ? 299 LEU B HD21 1 
ATOM   4354 H  HD22 . LEU B 1 84  ? 58.608 16.678 -19.734 1.00 48.62  ? 299 LEU B HD22 1 
ATOM   4355 H  HD23 . LEU B 1 84  ? 58.305 15.244 -19.120 1.00 48.62  ? 299 LEU B HD23 1 
ATOM   4356 N  N    . VAL B 1 85  ? 54.011 16.541 -16.890 1.00 19.30  ? 300 VAL B N    1 
ATOM   4357 C  CA   . VAL B 1 85  ? 52.989 15.503 -16.967 1.00 17.25  ? 300 VAL B CA   1 
ATOM   4358 C  C    . VAL B 1 85  ? 52.612 15.237 -18.413 1.00 17.69  ? 300 VAL B C    1 
ATOM   4359 O  O    . VAL B 1 85  ? 52.171 16.134 -19.118 1.00 17.97  ? 300 VAL B O    1 
ATOM   4360 C  CB   . VAL B 1 85  ? 51.718 15.907 -16.171 1.00 19.66  ? 300 VAL B CB   1 
ATOM   4361 C  CG1  . VAL B 1 85  ? 50.584 14.831 -16.343 1.00 22.57  ? 300 VAL B CG1  1 
ATOM   4362 C  CG2  . VAL B 1 85  ? 52.039 16.099 -14.737 1.00 17.06  ? 300 VAL B CG2  1 
ATOM   4363 H  H    . VAL B 1 85  ? 53.755 17.312 -17.173 1.00 23.16  ? 300 VAL B H    1 
ATOM   4364 H  HA   . VAL B 1 85  ? 53.338 14.681 -16.588 1.00 20.70  ? 300 VAL B HA   1 
ATOM   4365 H  HB   . VAL B 1 85  ? 51.385 16.749 -16.517 1.00 23.60  ? 300 VAL B HB   1 
ATOM   4366 H  HG11 . VAL B 1 85  ? 49.806 15.110 -15.836 1.00 27.09  ? 300 VAL B HG11 1 
ATOM   4367 H  HG12 . VAL B 1 85  ? 50.359 14.759 -17.284 1.00 27.09  ? 300 VAL B HG12 1 
ATOM   4368 H  HG13 . VAL B 1 85  ? 50.907 13.978 -16.013 1.00 27.09  ? 300 VAL B HG13 1 
ATOM   4369 H  HG21 . VAL B 1 85  ? 51.230 16.349 -14.264 1.00 20.47  ? 300 VAL B HG21 1 
ATOM   4370 H  HG22 . VAL B 1 85  ? 52.389 15.268 -14.379 1.00 20.47  ? 300 VAL B HG22 1 
ATOM   4371 H  HG23 . VAL B 1 85  ? 52.703 16.801 -14.654 1.00 20.47  ? 300 VAL B HG23 1 
ATOM   4372 N  N    . LYS B 1 86  ? 52.791 14.010 -18.857 1.00 18.15  ? 301 LYS B N    1 
ATOM   4373 C  CA   . LYS B 1 86  ? 52.242 13.583 -20.138 1.00 18.96  ? 301 LYS B CA   1 
ATOM   4374 C  C    . LYS B 1 86  ? 50.866 12.991 -19.888 1.00 18.87  ? 301 LYS B C    1 
ATOM   4375 O  O    . LYS B 1 86  ? 50.723 12.029 -19.132 1.00 19.98  ? 301 LYS B O    1 
ATOM   4376 C  CB   . LYS B 1 86  ? 53.117 12.530 -20.863 1.00 23.90  ? 301 LYS B CB   1 
ATOM   4377 C  CG   . LYS B 1 86  ? 54.556 12.944 -21.140 1.00 40.23  ? 301 LYS B CG   1 
ATOM   4378 C  CD   . LYS B 1 86  ? 55.402 11.777 -21.673 1.00 53.34  ? 301 LYS B CD   1 
ATOM   4379 C  CE   . LYS B 1 86  ? 56.509 12.234 -22.632 1.00 46.07  ? 301 LYS B CE   1 
ATOM   4380 N  NZ   . LYS B 1 86  ? 57.894 12.231 -22.066 1.00 63.94  ? 301 LYS B NZ   1 
ATOM   4381 H  H    . LYS B 1 86  ? 53.227 13.399 -18.438 1.00 21.78  ? 301 LYS B H    1 
ATOM   4382 H  HA   . LYS B 1 86  ? 52.144 14.353 -20.720 1.00 22.75  ? 301 LYS B HA   1 
ATOM   4383 H  HB2  . LYS B 1 86  ? 53.146 11.729 -20.317 1.00 28.69  ? 301 LYS B HB2  1 
ATOM   4384 H  HB3  . LYS B 1 86  ? 52.705 12.325 -21.716 1.00 28.69  ? 301 LYS B HB3  1 
ATOM   4385 H  HG2  . LYS B 1 86  ? 54.562 13.649 -21.806 1.00 48.28  ? 301 LYS B HG2  1 
ATOM   4386 H  HG3  . LYS B 1 86  ? 54.961 13.258 -20.317 1.00 48.28  ? 301 LYS B HG3  1 
ATOM   4387 H  HD2  . LYS B 1 86  ? 55.821 11.323 -20.926 1.00 64.01  ? 301 LYS B HD2  1 
ATOM   4388 H  HD3  . LYS B 1 86  ? 54.825 11.162 -22.153 1.00 64.01  ? 301 LYS B HD3  1 
ATOM   4389 H  HE2  . LYS B 1 86  ? 56.508 11.647 -23.403 1.00 55.28  ? 301 LYS B HE2  1 
ATOM   4390 H  HE3  . LYS B 1 86  ? 56.313 13.141 -22.915 1.00 55.28  ? 301 LYS B HE3  1 
ATOM   4391 H  HZ1  . LYS B 1 86  ? 58.475 12.507 -22.682 1.00 76.73  ? 301 LYS B HZ1  1 
ATOM   4392 H  HZ2  . LYS B 1 86  ? 57.937 12.775 -21.363 1.00 76.73  ? 301 LYS B HZ2  1 
ATOM   4393 H  HZ3  . LYS B 1 86  ? 58.116 11.408 -21.809 1.00 76.73  ? 301 LYS B HZ3  1 
ATOM   4394 N  N    . PHE B 1 87  ? 49.864 13.547 -20.560 1.00 21.74  ? 302 PHE B N    1 
ATOM   4395 C  CA   . PHE B 1 87  ? 48.504 12.997 -20.547 1.00 19.42  ? 302 PHE B CA   1 
ATOM   4396 C  C    . PHE B 1 87  ? 48.204 12.289 -21.860 1.00 20.72  ? 302 PHE B C    1 
ATOM   4397 O  O    . PHE B 1 87  ? 48.522 12.794 -22.943 1.00 21.33  ? 302 PHE B O    1 
ATOM   4398 C  CB   . PHE B 1 87  ? 47.475 14.090 -20.379 1.00 18.91  ? 302 PHE B CB   1 
ATOM   4399 C  CG   . PHE B 1 87  ? 47.291 14.565 -18.978 1.00 17.92  ? 302 PHE B CG   1 
ATOM   4400 C  CD1  . PHE B 1 87  ? 46.966 13.695 -17.960 1.00 20.75  ? 302 PHE B CD1  1 
ATOM   4401 C  CD2  . PHE B 1 87  ? 47.360 15.889 -18.704 1.00 18.86  ? 302 PHE B CD2  1 
ATOM   4402 C  CE1  . PHE B 1 87  ? 46.723 14.143 -16.688 1.00 19.34  ? 302 PHE B CE1  1 
ATOM   4403 C  CE2  . PHE B 1 87  ? 47.127 16.356 -17.396 1.00 18.66  ? 302 PHE B CE2  1 
ATOM   4404 C  CZ   . PHE B 1 87  ? 46.815 15.456 -16.398 1.00 18.13  ? 302 PHE B CZ   1 
ATOM   4405 H  H    . PHE B 1 87  ? 49.944 14.256 -21.041 1.00 26.08  ? 302 PHE B H    1 
ATOM   4406 H  HA   . PHE B 1 87  ? 48.411 12.363 -19.819 1.00 23.30  ? 302 PHE B HA   1 
ATOM   4407 H  HB2  . PHE B 1 87  ? 47.745 14.853 -20.913 1.00 22.69  ? 302 PHE B HB2  1 
ATOM   4408 H  HB3  . PHE B 1 87  ? 46.619 13.760 -20.691 1.00 22.69  ? 302 PHE B HB3  1 
ATOM   4409 H  HD1  . PHE B 1 87  ? 46.891 12.787 -18.144 1.00 24.90  ? 302 PHE B HD1  1 
ATOM   4410 H  HD2  . PHE B 1 87  ? 47.564 16.492 -19.382 1.00 22.63  ? 302 PHE B HD2  1 
ATOM   4411 H  HE1  . PHE B 1 87  ? 46.523 13.534 -16.014 1.00 23.21  ? 302 PHE B HE1  1 
ATOM   4412 H  HE2  . PHE B 1 87  ? 47.190 17.264 -17.204 1.00 22.39  ? 302 PHE B HE2  1 
ATOM   4413 H  HZ   . PHE B 1 87  ? 46.669 15.754 -15.529 1.00 21.75  ? 302 PHE B HZ   1 
ATOM   4414 N  N    . TRP B 1 88  ? 47.550 11.143 -21.731 1.00 21.08  ? 303 TRP B N    1 
ATOM   4415 C  CA   . TRP B 1 88  ? 46.788 10.585 -22.822 1.00 22.47  ? 303 TRP B CA   1 
ATOM   4416 C  C    . TRP B 1 88  ? 45.344 10.909 -22.513 1.00 22.39  ? 303 TRP B C    1 
ATOM   4417 O  O    . TRP B 1 88  ? 44.749 10.342 -21.601 1.00 25.64  ? 303 TRP B O    1 
ATOM   4418 C  CB   . TRP B 1 88  ? 47.032 9.098  -22.956 1.00 23.88  ? 303 TRP B CB   1 
ATOM   4419 C  CG   . TRP B 1 88  ? 48.398 8.799  -23.454 1.00 24.55  ? 303 TRP B CG   1 
ATOM   4420 C  CD1  . TRP B 1 88  ? 48.783 8.606  -24.753 1.00 26.03  ? 303 TRP B CD1  1 
ATOM   4421 C  CD2  . TRP B 1 88  ? 49.564 8.659  -22.675 1.00 24.10  ? 303 TRP B CD2  1 
ATOM   4422 N  NE1  . TRP B 1 88  ? 50.125 8.335  -24.814 1.00 26.58  ? 303 TRP B NE1  1 
ATOM   4423 C  CE2  . TRP B 1 88  ? 50.623 8.391  -23.533 1.00 25.35  ? 303 TRP B CE2  1 
ATOM   4424 C  CE3  . TRP B 1 88  ? 49.804 8.754  -21.298 1.00 24.79  ? 303 TRP B CE3  1 
ATOM   4425 C  CZ2  . TRP B 1 88  ? 51.910 8.174  -23.087 1.00 25.55  ? 303 TRP B CZ2  1 
ATOM   4426 C  CZ3  . TRP B 1 88  ? 51.098 8.527  -20.855 1.00 23.11  ? 303 TRP B CZ3  1 
ATOM   4427 C  CH2  . TRP B 1 88  ? 52.132 8.265  -21.751 1.00 24.38  ? 303 TRP B CH2  1 
ATOM   4428 H  H    . TRP B 1 88  ? 47.535 10.670 -21.013 1.00 25.29  ? 303 TRP B H    1 
ATOM   4429 H  HA   . TRP B 1 88  ? 47.036 11.019 -23.653 1.00 26.96  ? 303 TRP B HA   1 
ATOM   4430 H  HB2  . TRP B 1 88  ? 46.928 8.679  -22.087 1.00 28.66  ? 303 TRP B HB2  1 
ATOM   4431 H  HB3  . TRP B 1 88  ? 46.393 8.727  -23.584 1.00 28.66  ? 303 TRP B HB3  1 
ATOM   4432 H  HD1  . TRP B 1 88  ? 48.213 8.641  -25.487 1.00 31.24  ? 303 TRP B HD1  1 
ATOM   4433 H  HE1  . TRP B 1 88  ? 50.581 8.191  -25.529 1.00 31.89  ? 303 TRP B HE1  1 
ATOM   4434 H  HE3  . TRP B 1 88  ? 49.114 8.930  -20.700 1.00 29.75  ? 303 TRP B HE3  1 
ATOM   4435 H  HZ2  . TRP B 1 88  ? 52.602 7.991  -23.680 1.00 30.66  ? 303 TRP B HZ2  1 
ATOM   4436 H  HZ3  . TRP B 1 88  ? 51.287 8.592  -19.947 1.00 27.73  ? 303 TRP B HZ3  1 
ATOM   4437 H  HH2  . TRP B 1 88  ? 52.992 8.131  -21.424 1.00 29.25  ? 303 TRP B HH2  1 
ATOM   4438 N  N    . ALA B 1 89  ? 44.808 11.851 -23.268 1.00 22.37  ? 304 ALA B N    1 
ATOM   4439 C  CA   . ALA B 1 89  ? 43.460 12.357 -23.069 1.00 22.43  ? 304 ALA B CA   1 
ATOM   4440 C  C    . ALA B 1 89  ? 42.394 11.485 -23.740 1.00 24.10  ? 304 ALA B C    1 
ATOM   4441 O  O    . ALA B 1 89  ? 42.504 11.115 -24.908 1.00 25.36  ? 304 ALA B O    1 
ATOM   4442 C  CB   . ALA B 1 89  ? 43.368 13.749 -23.587 1.00 22.17  ? 304 ALA B CB   1 
ATOM   4443 H  H    . ALA B 1 89  ? 45.219 12.226 -23.923 1.00 26.85  ? 304 ALA B H    1 
ATOM   4444 H  HA   . ALA B 1 89  ? 43.270 12.380 -22.118 1.00 26.91  ? 304 ALA B HA   1 
ATOM   4445 H  HB1  . ALA B 1 89  ? 42.466 14.078 -23.451 1.00 26.61  ? 304 ALA B HB1  1 
ATOM   4446 H  HB2  . ALA B 1 89  ? 44.000 14.307 -23.107 1.00 26.61  ? 304 ALA B HB2  1 
ATOM   4447 H  HB3  . ALA B 1 89  ? 43.581 13.748 -24.534 1.00 26.61  ? 304 ALA B HB3  1 
ATOM   4448 N  N    . ASP B 1 90  ? 41.333 11.220 -22.984 1.00 24.32  ? 305 ASP B N    1 
ATOM   4449 C  CA   . ASP B 1 90  ? 40.170 10.524 -23.480 1.00 26.07  ? 305 ASP B CA   1 
ATOM   4450 C  C    . ASP B 1 90  ? 39.171 11.472 -24.118 1.00 26.71  ? 305 ASP B C    1 
ATOM   4451 O  O    . ASP B 1 90  ? 38.449 12.191 -23.407 1.00 26.32  ? 305 ASP B O    1 
ATOM   4452 C  CB   . ASP B 1 90  ? 39.521 9.770  -22.321 1.00 26.38  ? 305 ASP B CB   1 
ATOM   4453 C  CG   . ASP B 1 90  ? 38.379 8.862  -22.772 1.00 28.55  ? 305 ASP B CG   1 
ATOM   4454 O  OD1  . ASP B 1 90  ? 37.985 8.932  -23.938 1.00 29.74  ? 305 ASP B OD1  1 
ATOM   4455 O  OD2  . ASP B 1 90  ? 37.831 8.123  -21.919 1.00 31.09  ? 305 ASP B OD2  1 
ATOM   4456 H  H    . ASP B 1 90  ? 41.270 11.445 -22.156 1.00 29.19  ? 305 ASP B H    1 
ATOM   4457 H  HA   . ASP B 1 90  ? 40.445 9.877  -24.149 1.00 31.29  ? 305 ASP B HA   1 
ATOM   4458 H  HB2  . ASP B 1 90  ? 40.191 9.217  -21.889 1.00 31.65  ? 305 ASP B HB2  1 
ATOM   4459 H  HB3  . ASP B 1 90  ? 39.162 10.412 -21.689 1.00 31.65  ? 305 ASP B HB3  1 
ATOM   4460 N  N    . LEU B 1 91  ? 39.130 11.503 -25.452 1.00 27.93  ? 306 LEU B N    1 
ATOM   4461 C  CA   . LEU B 1 91  ? 38.167 12.343 -26.170 1.00 36.54  ? 306 LEU B CA   1 
ATOM   4462 C  C    . LEU B 1 91  ? 37.033 11.544 -26.752 1.00 37.54  ? 306 LEU B C    1 
ATOM   4463 O  O    . LEU B 1 91  ? 36.451 11.927 -27.763 1.00 34.01  ? 306 LEU B O    1 
ATOM   4464 C  CB   . LEU B 1 91  ? 38.831 13.085 -27.316 1.00 32.09  ? 306 LEU B CB   1 
ATOM   4465 C  CG   . LEU B 1 91  ? 39.967 14.012 -26.933 1.00 34.80  ? 306 LEU B CG   1 
ATOM   4466 C  CD1  . LEU B 1 91  ? 40.313 14.861 -28.164 1.00 40.99  ? 306 LEU B CD1  1 
ATOM   4467 C  CD2  . LEU B 1 91  ? 39.564 14.878 -25.791 1.00 32.14  ? 306 LEU B CD2  1 
ATOM   4468 H  H    . LEU B 1 91  ? 39.649 11.048 -25.965 1.00 33.51  ? 306 LEU B H    1 
ATOM   4469 H  HA   . LEU B 1 91  ? 37.795 12.998 -25.558 1.00 43.85  ? 306 LEU B HA   1 
ATOM   4470 H  HB2  . LEU B 1 91  ? 39.187 12.431 -27.937 1.00 38.51  ? 306 LEU B HB2  1 
ATOM   4471 H  HB3  . LEU B 1 91  ? 38.158 13.622 -27.763 1.00 38.51  ? 306 LEU B HB3  1 
ATOM   4472 H  HG   . LEU B 1 91  ? 40.747 13.493 -26.677 1.00 41.77  ? 306 LEU B HG   1 
ATOM   4473 H  HD11 . LEU B 1 91  ? 41.041 15.462 -27.938 1.00 49.18  ? 306 LEU B HD11 1 
ATOM   4474 H  HD12 . LEU B 1 91  ? 40.581 14.274 -28.888 1.00 49.18  ? 306 LEU B HD12 1 
ATOM   4475 H  HD13 . LEU B 1 91  ? 39.531 15.372 -28.425 1.00 49.18  ? 306 LEU B HD13 1 
ATOM   4476 H  HD21 . LEU B 1 91  ? 40.304 15.462 -25.562 1.00 38.57  ? 306 LEU B HD21 1 
ATOM   4477 H  HD22 . LEU B 1 91  ? 38.794 15.406 -26.053 1.00 38.57  ? 306 LEU B HD22 1 
ATOM   4478 H  HD23 . LEU B 1 91  ? 39.338 14.317 -25.033 1.00 38.57  ? 306 LEU B HD23 1 
ATOM   4479 N  N    . ASN B 1 92  ? 36.723 10.422 -26.142 1.00 50.83  ? 307 ASN B N    1 
ATOM   4480 C  CA   . ASN B 1 92  ? 35.727 9.541  -26.695 1.00 58.61  ? 307 ASN B CA   1 
ATOM   4481 C  C    . ASN B 1 92  ? 34.526 9.507  -25.722 1.00 48.63  ? 307 ASN B C    1 
ATOM   4482 O  O    . ASN B 1 92  ? 34.436 8.657  -24.831 1.00 47.92  ? 307 ASN B O    1 
ATOM   4483 C  CB   . ASN B 1 92  ? 36.390 8.185  -26.956 1.00 62.21  ? 307 ASN B CB   1 
ATOM   4484 C  CG   . ASN B 1 92  ? 35.419 7.082  -27.062 1.00 63.18  ? 307 ASN B CG   1 
ATOM   4485 O  OD1  . ASN B 1 92  ? 34.327 7.248  -27.605 1.00 66.91  ? 307 ASN B OD1  1 
ATOM   4486 N  ND2  . ASN B 1 92  ? 35.802 5.921  -26.539 1.00 62.70  ? 307 ASN B ND2  1 
ATOM   4487 H  H    . ASN B 1 92  ? 37.074 10.149 -25.406 1.00 60.99  ? 307 ASN B H    1 
ATOM   4488 H  HA   . ASN B 1 92  ? 35.421 9.897  -27.544 1.00 70.34  ? 307 ASN B HA   1 
ATOM   4489 H  HB2  . ASN B 1 92  ? 36.884 8.230  -27.789 1.00 74.65  ? 307 ASN B HB2  1 
ATOM   4490 H  HB3  . ASN B 1 92  ? 36.993 7.983  -26.224 1.00 74.65  ? 307 ASN B HB3  1 
ATOM   4491 H  HD21 . ASN B 1 92  ? 35.276 5.241  -26.572 1.00 75.24  ? 307 ASN B HD21 1 
ATOM   4492 H  HD22 . ASN B 1 92  ? 36.574 5.849  -26.168 1.00 75.24  ? 307 ASN B HD22 1 
ATOM   4493 N  N    . TRP B 1 93  ? 33.619 10.466 -25.905 1.00 56.26  ? 308 TRP B N    1 
ATOM   4494 C  CA   . TRP B 1 93  ? 32.573 10.742 -24.912 1.00 66.51  ? 308 TRP B CA   1 
ATOM   4495 C  C    . TRP B 1 93  ? 31.173 11.080 -25.469 1.00 69.07  ? 308 TRP B C    1 
ATOM   4496 O  O    . TRP B 1 93  ? 30.949 11.152 -26.679 1.00 57.80  ? 308 TRP B O    1 
ATOM   4497 C  CB   . TRP B 1 93  ? 33.031 11.895 -24.008 1.00 43.56  ? 308 TRP B CB   1 
ATOM   4498 C  CG   . TRP B 1 93  ? 32.755 13.273 -24.488 1.00 40.72  ? 308 TRP B CG   1 
ATOM   4499 C  CD1  . TRP B 1 93  ? 31.608 13.983 -24.304 1.00 40.10  ? 308 TRP B CD1  1 
ATOM   4500 C  CD2  . TRP B 1 93  ? 33.653 14.141 -25.208 1.00 40.98  ? 308 TRP B CD2  1 
ATOM   4501 N  NE1  . TRP B 1 93  ? 31.733 15.231 -24.862 1.00 44.30  ? 308 TRP B NE1  1 
ATOM   4502 C  CE2  . TRP B 1 93  ? 32.981 15.357 -25.412 1.00 42.94  ? 308 TRP B CE2  1 
ATOM   4503 C  CE3  . TRP B 1 93  ? 34.959 14.004 -25.686 1.00 57.63  ? 308 TRP B CE3  1 
ATOM   4504 C  CZ2  . TRP B 1 93  ? 33.559 16.429 -26.096 1.00 46.11  ? 308 TRP B CZ2  1 
ATOM   4505 C  CZ3  . TRP B 1 93  ? 35.534 15.072 -26.358 1.00 66.46  ? 308 TRP B CZ3  1 
ATOM   4506 C  CH2  . TRP B 1 93  ? 34.836 16.271 -26.549 1.00 53.24  ? 308 TRP B CH2  1 
ATOM   4507 H  H    . TRP B 1 93  ? 33.585 10.975 -26.598 1.00 67.52  ? 308 TRP B H    1 
ATOM   4508 H  HA   . TRP B 1 93  ? 32.475 9.957  -24.350 1.00 79.81  ? 308 TRP B HA   1 
ATOM   4509 H  HB2  . TRP B 1 93  ? 32.593 11.798 -23.149 1.00 52.27  ? 308 TRP B HB2  1 
ATOM   4510 H  HB3  . TRP B 1 93  ? 33.991 11.821 -23.888 1.00 52.27  ? 308 TRP B HB3  1 
ATOM   4511 H  HD1  . TRP B 1 93  ? 30.854 13.671 -23.859 1.00 48.12  ? 308 TRP B HD1  1 
ATOM   4512 H  HE1  . TRP B 1 93  ? 31.126 15.841 -24.859 1.00 53.16  ? 308 TRP B HE1  1 
ATOM   4513 H  HE3  . TRP B 1 93  ? 35.434 13.215 -25.553 1.00 69.15  ? 308 TRP B HE3  1 
ATOM   4514 H  HZ2  . TRP B 1 93  ? 33.094 17.223 -26.230 1.00 55.33  ? 308 TRP B HZ2  1 
ATOM   4515 H  HZ3  . TRP B 1 93  ? 36.404 14.995 -26.679 1.00 79.75  ? 308 TRP B HZ3  1 
ATOM   4516 H  HH2  . TRP B 1 93  ? 35.245 16.967 -27.009 1.00 63.88  ? 308 TRP B HH2  1 
ATOM   4517 N  N    . GLY B 1 109 ? 25.007 20.387 -25.575 1.00 54.97  ? 324 GLY B N    1 
ATOM   4518 C  CA   . GLY B 1 109 ? 25.492 21.313 -24.563 1.00 57.07  ? 324 GLY B CA   1 
ATOM   4519 C  C    . GLY B 1 109 ? 26.265 20.581 -23.473 1.00 67.17  ? 324 GLY B C    1 
ATOM   4520 O  O    . GLY B 1 109 ? 27.068 19.685 -23.779 1.00 71.66  ? 324 GLY B O    1 
ATOM   4521 H  HA2  . GLY B 1 109 ? 26.077 21.969 -24.973 1.00 68.49  ? 324 GLY B HA2  1 
ATOM   4522 H  HA3  . GLY B 1 109 ? 24.743 21.775 -24.156 1.00 68.49  ? 324 GLY B HA3  1 
ATOM   4523 N  N    . GLY B 1 110 ? 26.044 20.938 -22.209 1.00 67.60  ? 325 GLY B N    1 
ATOM   4524 C  CA   . GLY B 1 110 ? 26.710 20.237 -21.109 1.00 66.64  ? 325 GLY B CA   1 
ATOM   4525 C  C    . GLY B 1 110 ? 27.694 21.067 -20.288 1.00 51.89  ? 325 GLY B C    1 
ATOM   4526 O  O    . GLY B 1 110 ? 27.969 22.206 -20.643 1.00 51.21  ? 325 GLY B O    1 
ATOM   4527 H  H    . GLY B 1 110 ? 25.520 21.574 -21.962 1.00 81.12  ? 325 GLY B H    1 
ATOM   4528 H  HA2  . GLY B 1 110 ? 26.034 19.895 -20.503 1.00 79.97  ? 325 GLY B HA2  1 
ATOM   4529 H  HA3  . GLY B 1 110 ? 27.195 19.479 -21.472 1.00 79.97  ? 325 GLY B HA3  1 
ATOM   4530 N  N    . PHE B 1 111 ? 28.205 20.526 -19.177 1.00 32.07  ? 326 PHE B N    1 
ATOM   4531 C  CA   . PHE B 1 111 ? 29.052 21.335 -18.322 1.00 38.83  ? 326 PHE B CA   1 
ATOM   4532 C  C    . PHE B 1 111 ? 30.482 20.825 -18.378 1.00 22.21  ? 326 PHE B C    1 
ATOM   4533 O  O    . PHE B 1 111 ? 30.754 19.668 -18.068 1.00 28.78  ? 326 PHE B O    1 
ATOM   4534 C  CB   . PHE B 1 111 ? 28.548 21.373 -16.860 1.00 32.71  ? 326 PHE B CB   1 
ATOM   4535 C  CG   . PHE B 1 111 ? 29.521 22.058 -15.931 1.00 25.54  ? 326 PHE B CG   1 
ATOM   4536 C  CD1  . PHE B 1 111 ? 29.605 23.442 -15.905 1.00 29.39  ? 326 PHE B CD1  1 
ATOM   4537 C  CD2  . PHE B 1 111 ? 30.403 21.314 -15.176 1.00 29.81  ? 326 PHE B CD2  1 
ATOM   4538 C  CE1  . PHE B 1 111 ? 30.531 24.077 -15.109 1.00 26.13  ? 326 PHE B CE1  1 
ATOM   4539 C  CE2  . PHE B 1 111 ? 31.341 21.912 -14.345 1.00 28.02  ? 326 PHE B CE2  1 
ATOM   4540 C  CZ   . PHE B 1 111 ? 31.416 23.309 -14.304 1.00 26.93  ? 326 PHE B CZ   1 
ATOM   4541 H  H    . PHE B 1 111 ? 28.077 19.718 -18.909 1.00 38.49  ? 326 PHE B H    1 
ATOM   4542 H  HA   . PHE B 1 111 ? 29.051 22.245 -18.657 1.00 46.59  ? 326 PHE B HA   1 
ATOM   4543 H  HB2  . PHE B 1 111 ? 27.709 21.857 -16.827 1.00 39.25  ? 326 PHE B HB2  1 
ATOM   4544 H  HB3  . PHE B 1 111 ? 28.421 20.464 -16.545 1.00 39.25  ? 326 PHE B HB3  1 
ATOM   4545 H  HD1  . PHE B 1 111 ? 29.029 23.948 -16.432 1.00 35.26  ? 326 PHE B HD1  1 
ATOM   4546 H  HD2  . PHE B 1 111 ? 30.353 20.386 -15.205 1.00 35.77  ? 326 PHE B HD2  1 
ATOM   4547 H  HE1  . PHE B 1 111 ? 30.565 25.006 -15.082 1.00 31.36  ? 326 PHE B HE1  1 
ATOM   4548 H  HE2  . PHE B 1 111 ? 31.915 21.393 -13.830 1.00 33.63  ? 326 PHE B HE2  1 
ATOM   4549 H  HZ   . PHE B 1 111 ? 32.035 23.730 -13.754 1.00 32.32  ? 326 PHE B HZ   1 
ATOM   4550 N  N    . TYR B 1 112 ? 31.394 21.703 -18.793 1.00 22.85  ? 327 TYR B N    1 
ATOM   4551 C  CA   . TYR B 1 112 ? 32.803 21.389 -18.902 1.00 20.26  ? 327 TYR B CA   1 
ATOM   4552 C  C    . TYR B 1 112 ? 33.518 22.013 -17.741 1.00 19.78  ? 327 TYR B C    1 
ATOM   4553 O  O    . TYR B 1 112 ? 33.417 23.212 -17.556 1.00 20.14  ? 327 TYR B O    1 
ATOM   4554 C  CB   . TYR B 1 112 ? 33.386 21.916 -20.210 1.00 21.13  ? 327 TYR B CB   1 
ATOM   4555 C  CG   . TYR B 1 112 ? 32.845 21.207 -21.396 1.00 22.22  ? 327 TYR B CG   1 
ATOM   4556 C  CD1  . TYR B 1 112 ? 31.556 21.476 -21.857 1.00 22.06  ? 327 TYR B CD1  1 
ATOM   4557 C  CD2  . TYR B 1 112 ? 33.598 20.247 -22.049 1.00 18.28  ? 327 TYR B CD2  1 
ATOM   4558 C  CE1  . TYR B 1 112 ? 31.038 20.824 -22.939 1.00 23.27  ? 327 TYR B CE1  1 
ATOM   4559 C  CE2  . TYR B 1 112 ? 33.090 19.577 -23.168 1.00 23.78  ? 327 TYR B CE2  1 
ATOM   4560 C  CZ   . TYR B 1 112 ? 31.808 19.873 -23.598 1.00 21.02  ? 327 TYR B CZ   1 
ATOM   4561 O  OH   . TYR B 1 112 ? 31.272 19.208 -24.699 1.00 34.04  ? 327 TYR B OH   1 
ATOM   4562 H  H    . TYR B 1 112 ? 31.206 22.510 -19.022 1.00 27.41  ? 327 TYR B H    1 
ATOM   4563 H  HA   . TYR B 1 112 ? 32.930 20.428 -18.868 1.00 24.32  ? 327 TYR B HA   1 
ATOM   4564 H  HB2  . TYR B 1 112 ? 33.169 22.857 -20.297 1.00 25.35  ? 327 TYR B HB2  1 
ATOM   4565 H  HB3  . TYR B 1 112 ? 34.348 21.795 -20.200 1.00 25.35  ? 327 TYR B HB3  1 
ATOM   4566 H  HD1  . TYR B 1 112 ? 31.039 22.114 -21.419 1.00 26.48  ? 327 TYR B HD1  1 
ATOM   4567 H  HD2  . TYR B 1 112 ? 34.460 20.058 -21.753 1.00 21.93  ? 327 TYR B HD2  1 
ATOM   4568 H  HE1  . TYR B 1 112 ? 30.179 21.019 -23.236 1.00 27.92  ? 327 TYR B HE1  1 
ATOM   4569 H  HE2  . TYR B 1 112 ? 33.599 18.934 -23.606 1.00 28.54  ? 327 TYR B HE2  1 
ATOM   4570 H  HH   . TYR B 1 112 ? 30.490 19.479 -24.845 1.00 40.85  ? 327 TYR B HH   1 
ATOM   4571 N  N    . GLY B 1 113 ? 34.254 21.214 -16.961 1.00 19.98  ? 328 GLY B N    1 
ATOM   4572 C  CA   . GLY B 1 113 ? 34.966 21.758 -15.826 1.00 19.01  ? 328 GLY B CA   1 
ATOM   4573 C  C    . GLY B 1 113 ? 36.326 21.201 -15.524 1.00 18.15  ? 328 GLY B C    1 
ATOM   4574 O  O    . GLY B 1 113 ? 36.777 20.181 -16.083 1.00 17.74  ? 328 GLY B O    1 
ATOM   4575 H  H    . GLY B 1 113 ? 34.350 20.367 -17.074 1.00 23.98  ? 328 GLY B H    1 
ATOM   4576 H  HA2  . GLY B 1 113 ? 35.068 22.713 -15.959 1.00 22.81  ? 328 GLY B HA2  1 
ATOM   4577 H  HA3  . GLY B 1 113 ? 34.420 21.630 -15.035 1.00 22.81  ? 328 GLY B HA3  1 
ATOM   4578 N  N    . VAL B 1 114 ? 36.984 21.918 -14.633 1.00 19.89  ? 329 VAL B N    1 
ATOM   4579 C  CA   . VAL B 1 114 ? 38.283 21.583 -14.117 1.00 20.25  ? 329 VAL B CA   1 
ATOM   4580 C  C    . VAL B 1 114 ? 38.244 21.676 -12.580 1.00 20.24  ? 329 VAL B C    1 
ATOM   4581 O  O    . VAL B 1 114 ? 37.636 22.603 -12.011 1.00 20.98  ? 329 VAL B O    1 
ATOM   4582 C  CB   . VAL B 1 114 ? 39.360 22.510 -14.702 1.00 18.64  ? 329 VAL B CB   1 
ATOM   4583 C  CG1  . VAL B 1 114 ? 40.734 22.059 -14.225 1.00 21.38  ? 329 VAL B CG1  1 
ATOM   4584 C  CG2  . VAL B 1 114 ? 39.368 22.474 -16.251 1.00 19.09  ? 329 VAL B CG2  1 
ATOM   4585 H  H    . VAL B 1 114 ? 36.672 22.646 -14.297 1.00 23.87  ? 329 VAL B H    1 
ATOM   4586 H  HA   . VAL B 1 114 ? 38.500 20.670 -14.363 1.00 24.30  ? 329 VAL B HA   1 
ATOM   4587 H  HB   . VAL B 1 114 ? 39.208 23.422 -14.409 1.00 22.36  ? 329 VAL B HB   1 
ATOM   4588 H  HG11 . VAL B 1 114 ? 41.407 22.649 -14.599 1.00 25.65  ? 329 VAL B HG11 1 
ATOM   4589 H  HG12 . VAL B 1 114 ? 40.761 22.099 -13.256 1.00 25.65  ? 329 VAL B HG12 1 
ATOM   4590 H  HG13 . VAL B 1 114 ? 40.889 21.149 -14.524 1.00 25.65  ? 329 VAL B HG13 1 
ATOM   4591 H  HG21 . VAL B 1 114 ? 40.060 23.070 -16.577 1.00 22.90  ? 329 VAL B HG21 1 
ATOM   4592 H  HG22 . VAL B 1 114 ? 39.547 21.567 -16.545 1.00 22.90  ? 329 VAL B HG22 1 
ATOM   4593 H  HG23 . VAL B 1 114 ? 38.501 22.762 -16.578 1.00 22.90  ? 329 VAL B HG23 1 
ATOM   4594 N  N    . SER B 1 115 ? 38.828 20.675 -11.918 1.00 19.65  ? 330 SER B N    1 
ATOM   4595 C  CA   . SER B 1 115 ? 38.872 20.598 -10.469 1.00 20.31  ? 330 SER B CA   1 
ATOM   4596 C  C    . SER B 1 115 ? 40.284 20.225 -9.980  1.00 19.89  ? 330 SER B C    1 
ATOM   4597 O  O    . SER B 1 115 ? 40.936 19.325 -10.537 1.00 20.65  ? 330 SER B O    1 
ATOM   4598 C  CB   . SER B 1 115 ? 37.876 19.581 -9.939  1.00 21.07  ? 330 SER B CB   1 
ATOM   4599 O  OG   . SER B 1 115 ? 36.558 20.052 -10.065 1.00 25.87  ? 330 SER B OG   1 
ATOM   4600 H  H    . SER B 1 115 ? 39.215 20.011 -12.305 1.00 23.58  ? 330 SER B H    1 
ATOM   4601 H  HA   . SER B 1 115 ? 38.644 21.465 -10.099 1.00 24.37  ? 330 SER B HA   1 
ATOM   4602 H  HB2  . SER B 1 115 ? 37.966 18.758 -10.444 1.00 25.29  ? 330 SER B HB2  1 
ATOM   4603 H  HB3  . SER B 1 115 ? 38.062 19.417 -9.001  1.00 25.29  ? 330 SER B HB3  1 
ATOM   4604 H  HG   . SER B 1 115 ? 36.019 19.481 -9.768  1.00 31.04  ? 330 SER B HG   1 
ATOM   4605 N  N    . SER B 1 116 ? 40.722 20.922 -8.942  1.00 21.28  ? 331 SER B N    1 
ATOM   4606 C  CA   . SER B 1 116 ? 42.094 20.834 -8.418  1.00 20.91  ? 331 SER B CA   1 
ATOM   4607 C  C    . SER B 1 116 ? 42.017 20.818 -6.935  1.00 21.76  ? 331 SER B C    1 
ATOM   4608 O  O    . SER B 1 116 ? 41.234 21.569 -6.387  1.00 24.76  ? 331 SER B O    1 
ATOM   4609 C  CB   . SER B 1 116 ? 42.937 22.041 -8.826  1.00 25.08  ? 331 SER B CB   1 
ATOM   4610 O  OG   . SER B 1 116 ? 43.585 21.791 -10.024 1.00 29.83  ? 331 SER B OG   1 
ATOM   4611 H  H    . SER B 1 116 ? 40.231 21.475 -8.503  1.00 25.54  ? 331 SER B H    1 
ATOM   4612 H  HA   . SER B 1 116 ? 42.523 20.021 -8.727  1.00 25.09  ? 331 SER B HA   1 
ATOM   4613 H  HB2  . SER B 1 116 ? 42.357 22.812 -8.934  1.00 30.09  ? 331 SER B HB2  1 
ATOM   4614 H  HB3  . SER B 1 116 ? 43.598 22.214 -8.138  1.00 30.09  ? 331 SER B HB3  1 
ATOM   4615 H  HG   . SER B 1 116 ? 44.047 22.457 -10.245 1.00 35.79  ? 331 SER B HG   1 
ATOM   4616 N  N    . GLN B 1 117 ? 42.821 19.988 -6.295  1.00 20.97  ? 332 GLN B N    1 
ATOM   4617 C  CA   . GLN B 1 117 ? 42.928 19.988 -4.868  1.00 21.74  ? 332 GLN B CA   1 
ATOM   4618 C  C    . GLN B 1 117 ? 44.397 19.752 -4.457  1.00 22.20  ? 332 GLN B C    1 
ATOM   4619 O  O    . GLN B 1 117 ? 45.098 18.860 -4.999  1.00 21.83  ? 332 GLN B O    1 
ATOM   4620 C  CB   . GLN B 1 117 ? 42.015 18.909 -4.268  1.00 24.03  ? 332 GLN B CB   1 
ATOM   4621 C  CG   . GLN B 1 117 ? 41.866 19.088 -2.753  1.00 43.12  ? 332 GLN B CG   1 
ATOM   4622 C  CD   . GLN B 1 117 ? 40.912 18.090 -2.115  1.00 45.11  ? 332 GLN B CD   1 
ATOM   4623 O  OE1  . GLN B 1 117 ? 40.036 17.519 -2.781  1.00 51.59  ? 332 GLN B OE1  1 
ATOM   4624 N  NE2  . GLN B 1 117 ? 41.087 17.869 -0.823  1.00 59.06  ? 332 GLN B NE2  1 
ATOM   4625 H  H    . GLN B 1 117 ? 43.323 19.407 -6.682  1.00 25.17  ? 332 GLN B H    1 
ATOM   4626 H  HA   . GLN B 1 117 ? 42.649 20.850 -4.524  1.00 26.09  ? 332 GLN B HA   1 
ATOM   4627 H  HB2  . GLN B 1 117 ? 41.135 18.973 -4.671  1.00 28.84  ? 332 GLN B HB2  1 
ATOM   4628 H  HB3  . GLN B 1 117 ? 42.399 18.034 -4.435  1.00 28.84  ? 332 GLN B HB3  1 
ATOM   4629 H  HG2  . GLN B 1 117 ? 42.735 18.977 -2.337  1.00 51.74  ? 332 GLN B HG2  1 
ATOM   4630 H  HG3  . GLN B 1 117 ? 41.526 19.980 -2.575  1.00 51.74  ? 332 GLN B HG3  1 
ATOM   4631 H  HE21 . GLN B 1 117 ? 41.711 18.279 -0.397  1.00 70.87  ? 332 GLN B HE21 1 
ATOM   4632 H  HE22 . GLN B 1 117 ? 40.577 17.314 -0.409  1.00 70.87  ? 332 GLN B HE22 1 
ATOM   4633 N  N    . TYR B 1 118 ? 44.852 20.585 -3.529  1.00 22.02  ? 333 TYR B N    1 
ATOM   4634 C  CA   . TYR B 1 118 ? 46.207 20.575 -3.045  1.00 22.09  ? 333 TYR B CA   1 
ATOM   4635 C  C    . TYR B 1 118 ? 46.194 20.471 -1.555  1.00 22.91  ? 333 TYR B C    1 
ATOM   4636 O  O    . TYR B 1 118 ? 45.218 20.838 -0.920  1.00 23.34  ? 333 TYR B O    1 
ATOM   4637 C  CB   . TYR B 1 118 ? 46.956 21.845 -3.420  1.00 21.62  ? 333 TYR B CB   1 
ATOM   4638 C  CG   . TYR B 1 118 ? 47.077 22.149 -4.896  1.00 20.84  ? 333 TYR B CG   1 
ATOM   4639 C  CD1  . TYR B 1 118 ? 48.136 21.640 -5.647  1.00 21.66  ? 333 TYR B CD1  1 
ATOM   4640 C  CD2  . TYR B 1 118 ? 46.127 22.954 -5.546  1.00 21.90  ? 333 TYR B CD2  1 
ATOM   4641 C  CE1  . TYR B 1 118 ? 48.256 21.939 -6.999  1.00 19.99  ? 333 TYR B CE1  1 
ATOM   4642 C  CE2  . TYR B 1 118 ? 46.248 23.261 -6.896  1.00 21.72  ? 333 TYR B CE2  1 
ATOM   4643 C  CZ   . TYR B 1 118 ? 47.285 22.739 -7.609  1.00 21.77  ? 333 TYR B CZ   1 
ATOM   4644 O  OH   . TYR B 1 118 ? 47.398 23.054 -8.937  1.00 24.40  ? 333 TYR B OH   1 
ATOM   4645 H  H    . TYR B 1 118 ? 44.366 21.188 -3.155  1.00 26.43  ? 333 TYR B H    1 
ATOM   4646 H  HA   . TYR B 1 118 ? 46.682 19.812 -3.409  1.00 26.51  ? 333 TYR B HA   1 
ATOM   4647 H  HB2  . TYR B 1 118 ? 46.502 22.597 -3.008  1.00 25.95  ? 333 TYR B HB2  1 
ATOM   4648 H  HB3  . TYR B 1 118 ? 47.857 21.781 -3.066  1.00 25.95  ? 333 TYR B HB3  1 
ATOM   4649 H  HD1  . TYR B 1 118 ? 48.777 21.106 -5.236  1.00 25.99  ? 333 TYR B HD1  1 
ATOM   4650 H  HD2  . TYR B 1 118 ? 45.418 23.308 -5.059  1.00 26.28  ? 333 TYR B HD2  1 
ATOM   4651 H  HE1  . TYR B 1 118 ? 48.965 21.597 -7.495  1.00 23.99  ? 333 TYR B HE1  1 
ATOM   4652 H  HE2  . TYR B 1 118 ? 45.612 23.795 -7.315  1.00 26.06  ? 333 TYR B HE2  1 
ATOM   4653 H  HH   . TYR B 1 118 ? 48.091 22.703 -9.258  1.00 29.28  ? 333 TYR B HH   1 
ATOM   4654 N  N    . GLU B 1 119 ? 47.304 20.021 -1.001  1.00 24.31  ? 334 GLU B N    1 
ATOM   4655 C  CA   . GLU B 1 119 ? 47.454 19.935 0.442   1.00 24.55  ? 334 GLU B CA   1 
ATOM   4656 C  C    . GLU B 1 119 ? 48.789 20.489 0.908   1.00 25.46  ? 334 GLU B C    1 
ATOM   4657 O  O    . GLU B 1 119 ? 49.805 20.370 0.202   1.00 24.17  ? 334 GLU B O    1 
ATOM   4658 C  CB   . GLU B 1 119 ? 47.330 18.472 0.898   1.00 27.61  ? 334 GLU B CB   1 
ATOM   4659 C  CG   . GLU B 1 119 ? 45.902 17.977 1.063   1.00 61.54  ? 334 GLU B CG   1 
ATOM   4660 C  CD   . GLU B 1 119 ? 45.807 16.473 1.381   1.00 70.03  ? 334 GLU B CD   1 
ATOM   4661 O  OE1  . GLU B 1 119 ? 46.775 15.911 1.961   1.00 51.26  ? 334 GLU B OE1  1 
ATOM   4662 O  OE2  . GLU B 1 119 ? 44.749 15.867 1.052   1.00 62.35  ? 334 GLU B OE2  1 
ATOM   4663 H  H    . GLU B 1 119 ? 47.993 19.755 -1.442  1.00 29.17  ? 334 GLU B H    1 
ATOM   4664 H  HA   . GLU B 1 119 ? 46.748 20.446 0.867   1.00 29.46  ? 334 GLU B HA   1 
ATOM   4665 H  HB2  . GLU B 1 119 ? 47.763 17.905 0.240   1.00 33.13  ? 334 GLU B HB2  1 
ATOM   4666 H  HB3  . GLU B 1 119 ? 47.775 18.376 1.754   1.00 33.13  ? 334 GLU B HB3  1 
ATOM   4667 H  HG2  . GLU B 1 119 ? 45.485 18.462 1.793   1.00 73.85  ? 334 GLU B HG2  1 
ATOM   4668 H  HG3  . GLU B 1 119 ? 45.417 18.139 0.239   1.00 73.85  ? 334 GLU B HG3  1 
ATOM   4669 N  N    . SER B 1 120 ? 48.788 21.046 2.122   1.00 26.68  ? 335 SER B N    1 
ATOM   4670 C  CA   . SER B 1 120 ? 49.995 21.553 2.738   1.00 26.94  ? 335 SER B CA   1 
ATOM   4671 C  C    . SER B 1 120 ? 49.917 21.396 4.236   1.00 29.29  ? 335 SER B C    1 
ATOM   4672 O  O    . SER B 1 120 ? 48.842 21.245 4.803   1.00 28.43  ? 335 SER B O    1 
ATOM   4673 C  CB   . SER B 1 120 ? 50.231 23.037 2.395   1.00 26.57  ? 335 SER B CB   1 
ATOM   4674 O  OG   . SER B 1 120 ? 51.511 23.439 2.889   1.00 46.05  ? 335 SER B OG   1 
ATOM   4675 H  H    . SER B 1 120 ? 48.086 21.138 2.610   1.00 32.02  ? 335 SER B H    1 
ATOM   4676 H  HA   . SER B 1 120 ? 50.755 21.042 2.418   1.00 32.33  ? 335 SER B HA   1 
ATOM   4677 H  HB2  . SER B 1 120 ? 50.208 23.152 1.432   1.00 31.88  ? 335 SER B HB2  1 
ATOM   4678 H  HB3  . SER B 1 120 ? 49.542 23.576 2.815   1.00 31.88  ? 335 SER B HB3  1 
ATOM   4679 H  HG   . SER B 1 120 ? 52.114 22.973 2.535   1.00 55.26  ? 335 SER B HG   1 
ATOM   4680 N  N    . LEU B 1 121 ? 51.080 21.468 4.873   1.00 28.11  ? 336 LEU B N    1 
ATOM   4681 C  CA   . LEU B 1 121 ? 51.152 21.567 6.313   1.00 29.59  ? 336 LEU B CA   1 
ATOM   4682 C  C    . LEU B 1 121 ? 51.060 23.008 6.764   1.00 29.21  ? 336 LEU B C    1 
ATOM   4683 O  O    . LEU B 1 121 ? 50.667 23.267 7.899   1.00 30.21  ? 336 LEU B O    1 
ATOM   4684 C  CB   . LEU B 1 121 ? 52.434 20.944 6.829   1.00 35.39  ? 336 LEU B CB   1 
ATOM   4685 C  CG   . LEU B 1 121 ? 52.439 19.419 6.852   1.00 38.31  ? 336 LEU B CG   1 
ATOM   4686 C  CD1  . LEU B 1 121 ? 53.868 18.918 6.946   1.00 57.74  ? 336 LEU B CD1  1 
ATOM   4687 C  CD2  . LEU B 1 121 ? 51.647 18.921 8.013   1.00 49.15  ? 336 LEU B CD2  1 
ATOM   4688 H  H    . LEU B 1 121 ? 51.847 21.461 4.484   1.00 33.73  ? 336 LEU B H    1 
ATOM   4689 H  HA   . LEU B 1 121 ? 50.407 21.083 6.701   1.00 35.51  ? 336 LEU B HA   1 
ATOM   4690 H  HB2  . LEU B 1 121 ? 53.167 21.231 6.262   1.00 42.47  ? 336 LEU B HB2  1 
ATOM   4691 H  HB3  . LEU B 1 121 ? 52.584 21.252 7.736   1.00 42.47  ? 336 LEU B HB3  1 
ATOM   4692 H  HG   . LEU B 1 121 ? 52.043 19.078 6.036   1.00 45.97  ? 336 LEU B HG   1 
ATOM   4693 H  HD11 . LEU B 1 121 ? 53.862 17.948 6.961   1.00 69.28  ? 336 LEU B HD11 1 
ATOM   4694 H  HD12 . LEU B 1 121 ? 54.365 19.234 6.175   1.00 69.28  ? 336 LEU B HD12 1 
ATOM   4695 H  HD13 . LEU B 1 121 ? 54.269 19.259 7.761   1.00 69.28  ? 336 LEU B HD13 1 
ATOM   4696 H  HD21 . LEU B 1 121 ? 51.662 17.951 8.011   1.00 58.98  ? 336 LEU B HD21 1 
ATOM   4697 H  HD22 . LEU B 1 121 ? 52.043 19.257 8.832   1.00 58.98  ? 336 LEU B HD22 1 
ATOM   4698 H  HD23 . LEU B 1 121 ? 50.734 19.238 7.931   1.00 58.98  ? 336 LEU B HD23 1 
ATOM   4699 N  N    . GLU B 1 122 ? 51.435 23.956 5.915   1.00 28.80  ? 337 GLU B N    1 
ATOM   4700 C  CA   . GLU B 1 122 ? 51.231 25.368 6.296   1.00 32.15  ? 337 GLU B CA   1 
ATOM   4701 C  C    . GLU B 1 122 ? 49.950 25.964 5.684   1.00 29.12  ? 337 GLU B C    1 
ATOM   4702 O  O    . GLU B 1 122 ? 49.498 25.581 4.610   1.00 29.23  ? 337 GLU B O    1 
ATOM   4703 C  CB   . GLU B 1 122 ? 52.433 26.275 5.916   1.00 29.93  ? 337 GLU B CB   1 
ATOM   4704 C  CG   . GLU B 1 122 ? 53.272 25.784 4.844   1.00 38.51  ? 337 GLU B CG   1 
ATOM   4705 C  CD   . GLU B 1 122 ? 54.466 26.713 4.531   1.00 49.31  ? 337 GLU B CD   1 
ATOM   4706 O  OE1  . GLU B 1 122 ? 54.498 27.882 4.975   1.00 43.31  ? 337 GLU B OE1  1 
ATOM   4707 O  OE2  . GLU B 1 122 ? 55.373 26.258 3.807   1.00 38.84  ? 337 GLU B OE2  1 
ATOM   4708 H  H    . GLU B 1 122 ? 51.794 23.829 5.144   1.00 34.56  ? 337 GLU B H    1 
ATOM   4709 H  HA   . GLU B 1 122 ? 51.134 25.409 7.260   1.00 38.58  ? 337 GLU B HA   1 
ATOM   4710 H  HB2  . GLU B 1 122 ? 52.090 27.140 5.644   1.00 35.91  ? 337 GLU B HB2  1 
ATOM   4711 H  HB3  . GLU B 1 122 ? 52.995 26.383 6.699   1.00 35.91  ? 337 GLU B HB3  1 
ATOM   4712 H  HG2  . GLU B 1 122 ? 53.627 24.916 5.094   1.00 46.22  ? 337 GLU B HG2  1 
ATOM   4713 H  HG3  . GLU B 1 122 ? 52.738 25.703 4.038   1.00 46.22  ? 337 GLU B HG3  1 
ATOM   4714 N  N    . HIS B 1 123 ? 49.429 26.932 6.416   1.00 28.06  ? 338 HIS B N    1 
ATOM   4715 C  CA   . HIS B 1 123 ? 48.338 27.809 6.043   1.00 27.16  ? 338 HIS B CA   1 
ATOM   4716 C  C    . HIS B 1 123 ? 48.888 28.851 5.114   1.00 26.37  ? 338 HIS B C    1 
ATOM   4717 O  O    . HIS B 1 123 ? 49.784 29.578 5.484   1.00 29.08  ? 338 HIS B O    1 
ATOM   4718 C  CB   . HIS B 1 123 ? 47.721 28.475 7.299   1.00 31.40  ? 338 HIS B CB   1 
ATOM   4719 C  CG   . HIS B 1 123 ? 46.461 29.221 7.002   1.00 37.01  ? 338 HIS B CG   1 
ATOM   4720 N  ND1  . HIS B 1 123 ? 46.452 30.465 6.425   1.00 50.00  ? 338 HIS B ND1  1 
ATOM   4721 C  CD2  . HIS B 1 123 ? 45.163 28.841 7.112   1.00 47.74  ? 338 HIS B CD2  1 
ATOM   4722 C  CE1  . HIS B 1 123 ? 45.202 30.847 6.222   1.00 58.80  ? 338 HIS B CE1  1 
ATOM   4723 N  NE2  . HIS B 1 123 ? 44.401 29.882 6.632   1.00 43.58  ? 338 HIS B NE2  1 
ATOM   4724 H  H    . HIS B 1 123 ? 49.721 27.112 7.205   1.00 33.67  ? 338 HIS B H    1 
ATOM   4725 H  HA   . HIS B 1 123 ? 47.649 27.306 5.582   1.00 32.59  ? 338 HIS B HA   1 
ATOM   4726 H  HB2  . HIS B 1 123 ? 47.515 27.788 7.951   1.00 37.68  ? 338 HIS B HB2  1 
ATOM   4727 H  HB3  . HIS B 1 123 ? 48.360 29.104 7.669   1.00 37.68  ? 338 HIS B HB3  1 
ATOM   4728 H  HD2  . HIS B 1 123 ? 44.847 28.039 7.460   1.00 57.29  ? 338 HIS B HD2  1 
ATOM   4729 H  HE1  . HIS B 1 123 ? 44.933 31.662 5.862   1.00 70.56  ? 338 HIS B HE1  1 
ATOM   4730 H  HE2  . HIS B 1 123 ? 43.541 29.903 6.610   1.00 52.29  ? 338 HIS B HE2  1 
ATOM   4731 N  N    . MET B 1 124 ? 48.392 28.900 3.879   1.00 28.94  ? 339 MET B N    1 
ATOM   4732 C  CA   . MET B 1 124 ? 48.864 29.890 2.923   1.00 27.01  ? 339 MET B CA   1 
ATOM   4733 C  C    . MET B 1 124 ? 47.692 30.365 2.117   1.00 26.89  ? 339 MET B C    1 
ATOM   4734 O  O    . MET B 1 124 ? 46.618 29.771 2.151   1.00 28.47  ? 339 MET B O    1 
ATOM   4735 C  CB   . MET B 1 124 ? 49.906 29.314 1.979   1.00 25.78  ? 339 MET B CB   1 
ATOM   4736 C  CG   . MET B 1 124 ? 51.089 28.643 2.668   1.00 27.99  ? 339 MET B CG   1 
ATOM   4737 S  SD   . MET B 1 124 ? 52.285 27.942 1.456   1.00 31.54  ? 339 MET B SD   1 
ATOM   4738 C  CE   . MET B 1 124 ? 51.667 26.247 1.190   1.00 26.69  ? 339 MET B CE   1 
ATOM   4739 H  H    . MET B 1 124 ? 47.785 28.373 3.574   1.00 34.73  ? 339 MET B H    1 
ATOM   4740 H  HA   . MET B 1 124 ? 49.257 30.639 3.398   1.00 32.41  ? 339 MET B HA   1 
ATOM   4741 H  HB2  . MET B 1 124 ? 49.479 28.650 1.415   1.00 30.93  ? 339 MET B HB2  1 
ATOM   4742 H  HB3  . MET B 1 124 ? 50.255 30.033 1.429   1.00 30.93  ? 339 MET B HB3  1 
ATOM   4743 H  HG2  . MET B 1 124 ? 51.556 29.299 3.210   1.00 33.58  ? 339 MET B HG2  1 
ATOM   4744 H  HG3  . MET B 1 124 ? 50.763 27.919 3.226   1.00 33.58  ? 339 MET B HG3  1 
ATOM   4745 H  HE1  . MET B 1 124 ? 52.245 25.796 0.556   1.00 32.03  ? 339 MET B HE1  1 
ATOM   4746 H  HE2  . MET B 1 124 ? 51.672 25.774 2.037   1.00 32.03  ? 339 MET B HE2  1 
ATOM   4747 H  HE3  . MET B 1 124 ? 50.763 26.292 0.841   1.00 32.03  ? 339 MET B HE3  1 
ATOM   4748 N  N    . THR B 1 125 ? 47.915 31.419 1.363   1.00 25.00  ? 340 THR B N    1 
ATOM   4749 C  CA   . THR B 1 125 ? 47.023 31.758 0.287   1.00 24.97  ? 340 THR B CA   1 
ATOM   4750 C  C    . THR B 1 125 ? 47.819 31.487 -0.991  1.00 23.94  ? 340 THR B C    1 
ATOM   4751 O  O    . THR B 1 125 ? 48.970 31.960 -1.127  1.00 24.17  ? 340 THR B O    1 
ATOM   4752 C  CB   . THR B 1 125 ? 46.520 33.195 0.335   1.00 30.27  ? 340 THR B CB   1 
ATOM   4753 O  OG1  . THR B 1 125 ? 45.805 33.404 1.547   1.00 32.77  ? 340 THR B OG1  1 
ATOM   4754 C  CG2  . THR B 1 125 ? 45.542 33.450 -0.831  1.00 29.96  ? 340 THR B CG2  1 
ATOM   4755 H  H    . THR B 1 125 ? 48.581 31.956 1.457   1.00 30.00  ? 340 THR B H    1 
ATOM   4756 H  HA   . THR B 1 125 ? 46.257 31.164 0.304   1.00 29.96  ? 340 THR B HA   1 
ATOM   4757 H  HB   . THR B 1 125 ? 47.263 33.815 0.272   1.00 36.33  ? 340 THR B HB   1 
ATOM   4758 H  HG1  . THR B 1 125 ? 45.523 34.195 1.582   1.00 39.32  ? 340 THR B HG1  1 
ATOM   4759 H  HG21 . THR B 1 125 ? 45.221 34.365 -0.801  1.00 35.95  ? 340 THR B HG21 1 
ATOM   4760 H  HG22 . THR B 1 125 ? 45.991 33.301 -1.678  1.00 35.95  ? 340 THR B HG22 1 
ATOM   4761 H  HG23 . THR B 1 125 ? 44.784 32.848 -0.765  1.00 35.95  ? 340 THR B HG23 1 
ATOM   4762 N  N    . LEU B 1 126 ? 47.196 30.679 -1.863  1.00 24.89  ? 341 LEU B N    1 
ATOM   4763 C  CA   . LEU B 1 126 ? 47.759 30.235 -3.131  1.00 25.15  ? 341 LEU B CA   1 
ATOM   4764 C  C    . LEU B 1 126 ? 47.291 31.078 -4.303  1.00 24.14  ? 341 LEU B C    1 
ATOM   4765 O  O    . LEU B 1 126 ? 46.119 31.434 -4.387  1.00 25.54  ? 341 LEU B O    1 
ATOM   4766 C  CB   . LEU B 1 126 ? 47.362 28.784 -3.448  1.00 30.46  ? 341 LEU B CB   1 
ATOM   4767 C  CG   . LEU B 1 126 ? 47.729 27.638 -2.509  1.00 27.60  ? 341 LEU B CG   1 
ATOM   4768 C  CD1  . LEU B 1 126 ? 47.333 26.315 -3.194  1.00 24.73  ? 341 LEU B CD1  1 
ATOM   4769 C  CD2  . LEU B 1 126 ? 49.194 27.701 -2.143  1.00 25.05  ? 341 LEU B CD2  1 
ATOM   4770 H  H    . LEU B 1 126 ? 46.408 30.365 -1.726  1.00 29.87  ? 341 LEU B H    1 
ATOM   4771 H  HA   . LEU B 1 126 ? 48.727 30.284 -3.087  1.00 30.18  ? 341 LEU B HA   1 
ATOM   4772 H  HB2  . LEU B 1 126 ? 46.396 28.764 -3.533  1.00 36.55  ? 341 LEU B HB2  1 
ATOM   4773 H  HB3  . LEU B 1 126 ? 47.750 28.563 -4.309  1.00 36.55  ? 341 LEU B HB3  1 
ATOM   4774 H  HG   . LEU B 1 126 ? 47.212 27.720 -1.692  1.00 33.11  ? 341 LEU B HG   1 
ATOM   4775 H  HD11 . LEU B 1 126 ? 47.561 25.576 -2.609  1.00 29.68  ? 341 LEU B HD11 1 
ATOM   4776 H  HD12 . LEU B 1 126 ? 46.378 26.322 -3.364  1.00 29.68  ? 341 LEU B HD12 1 
ATOM   4777 H  HD13 . LEU B 1 126 ? 47.817 26.236 -4.031  1.00 29.68  ? 341 LEU B HD13 1 
ATOM   4778 H  HD21 . LEU B 1 126 ? 49.403 26.965 -1.548  1.00 30.06  ? 341 LEU B HD21 1 
ATOM   4779 H  HD22 . LEU B 1 126 ? 49.725 27.633 -2.953  1.00 30.06  ? 341 LEU B HD22 1 
ATOM   4780 H  HD23 . LEU B 1 126 ? 49.372 28.546 -1.701  1.00 30.06  ? 341 LEU B HD23 1 
ATOM   4781 N  N    . THR B 1 127 ? 48.208 31.362 -5.216  1.00 22.52  ? 342 THR B N    1 
ATOM   4782 C  CA   . THR B 1 127 ? 47.864 31.878 -6.529  1.00 22.55  ? 342 THR B CA   1 
ATOM   4783 C  C    . THR B 1 127 ? 48.170 30.780 -7.559  1.00 21.21  ? 342 THR B C    1 
ATOM   4784 O  O    . THR B 1 127 ? 49.282 30.274 -7.593  1.00 21.24  ? 342 THR B O    1 
ATOM   4785 C  CB   . THR B 1 127 ? 48.654 33.142 -6.891  1.00 23.81  ? 342 THR B CB   1 
ATOM   4786 O  OG1  . THR B 1 127 ? 48.443 34.158 -5.904  1.00 28.21  ? 342 THR B OG1  1 
ATOM   4787 C  CG2  . THR B 1 127 ? 48.210 33.631 -8.219  1.00 23.99  ? 342 THR B CG2  1 
ATOM   4788 H  H    . THR B 1 127 ? 49.053 31.262 -5.095  1.00 27.02  ? 342 THR B H    1 
ATOM   4789 H  HA   . THR B 1 127 ? 46.917 32.082 -6.563  1.00 27.06  ? 342 THR B HA   1 
ATOM   4790 H  HB   . THR B 1 127 ? 49.599 32.930 -6.941  1.00 28.57  ? 342 THR B HB   1 
ATOM   4791 H  HG1  . THR B 1 127 ? 48.877 34.849 -6.106  1.00 33.85  ? 342 THR B HG1  1 
ATOM   4792 H  HG21 . THR B 1 127 ? 48.703 34.432 -8.459  1.00 28.78  ? 342 THR B HG21 1 
ATOM   4793 H  HG22 . THR B 1 127 ? 48.367 32.951 -8.892  1.00 28.78  ? 342 THR B HG22 1 
ATOM   4794 H  HG23 . THR B 1 127 ? 47.263 33.840 -8.196  1.00 28.78  ? 342 THR B HG23 1 
ATOM   4795 N  N    . CYS B 1 128 ? 47.178 30.416 -8.367  1.00 25.22  ? 343 CYS B N    1 
ATOM   4796 C  CA   . CYS B 1 128 ? 47.315 29.361 -9.326  1.00 24.07  ? 343 CYS B CA   1 
ATOM   4797 C  C    . CYS B 1 128 ? 47.137 29.980 -10.678 1.00 24.17  ? 343 CYS B C    1 
ATOM   4798 O  O    . CYS B 1 128 ? 46.087 30.495 -10.983 1.00 25.73  ? 343 CYS B O    1 
ATOM   4799 C  CB   . CYS B 1 128 ? 46.285 28.261 -9.103  1.00 26.88  ? 343 CYS B CB   1 
ATOM   4800 S  SG   . CYS B 1 128 ? 46.334 27.505 -7.411  1.00 41.10  ? 343 CYS B SG   1 
ATOM   4801 H  H    . CYS B 1 128 ? 46.400 30.783 -8.367  1.00 30.27  ? 343 CYS B H    1 
ATOM   4802 H  HA   . CYS B 1 128 ? 48.204 28.977 -9.270  1.00 28.88  ? 343 CYS B HA   1 
ATOM   4803 H  HB2  . CYS B 1 128 ? 45.399 28.633 -9.235  1.00 32.26  ? 343 CYS B HB2  1 
ATOM   4804 H  HB3  . CYS B 1 128 ? 46.442 27.553 -9.747  1.00 32.26  ? 343 CYS B HB3  1 
ATOM   4805 H  HG   . CYS B 1 128 ? 45.490 26.655 -7.338  1.00 49.31  ? 343 CYS B HG   1 
ATOM   4806 N  N    . SER B 1 129 ? 48.197 29.936 -11.463 1.00 19.61  ? 344 SER B N    1 
ATOM   4807 C  CA   . SER B 1 129 ? 48.215 30.461 -12.803 1.00 19.90  ? 344 SER B CA   1 
ATOM   4808 C  C    . SER B 1 129 ? 48.308 29.343 -13.809 1.00 18.86  ? 344 SER B C    1 
ATOM   4809 O  O    . SER B 1 129 ? 49.243 28.570 -13.764 1.00 22.16  ? 344 SER B O    1 
ATOM   4810 C  CB   . SER B 1 129 ? 49.379 31.405 -12.968 1.00 21.30  ? 344 SER B CB   1 
ATOM   4811 O  OG   . SER B 1 129 ? 49.629 31.597 -14.348 1.00 43.58  ? 344 SER B OG   1 
ATOM   4812 H  H    . SER B 1 129 ? 48.948 29.589 -11.227 1.00 23.53  ? 344 SER B H    1 
ATOM   4813 H  HA   . SER B 1 129 ? 47.395 30.954 -12.967 1.00 23.88  ? 344 SER B HA   1 
ATOM   4814 H  HB2  . SER B 1 129 ? 49.163 32.257 -12.559 1.00 25.56  ? 344 SER B HB2  1 
ATOM   4815 H  HB3  . SER B 1 129 ? 50.166 31.021 -12.550 1.00 25.56  ? 344 SER B HB3  1 
ATOM   4816 H  HG   . SER B 1 129 ? 48.950 31.924 -14.720 1.00 52.30  ? 344 SER B HG   1 
ATOM   4817 N  N    . SER B 1 130 ? 47.337 29.256 -14.710 1.00 24.35  ? 345 SER B N    1 
ATOM   4818 C  CA   . SER B 1 130 ? 47.368 28.318 -15.809 1.00 22.92  ? 345 SER B CA   1 
ATOM   4819 C  C    . SER B 1 130 ? 47.532 29.039 -17.142 1.00 24.14  ? 345 SER B C    1 
ATOM   4820 O  O    . SER B 1 130 ? 46.749 29.923 -17.475 1.00 27.59  ? 345 SER B O    1 
ATOM   4821 C  CB   . SER B 1 130 ? 46.093 27.493 -15.817 1.00 21.90  ? 345 SER B CB   1 
ATOM   4822 O  OG   . SER B 1 130 ? 45.981 26.733 -14.623 1.00 26.80  ? 345 SER B OG   1 
ATOM   4823 H  H    . SER B 1 130 ? 46.632 29.748 -14.700 1.00 29.22  ? 345 SER B H    1 
ATOM   4824 H  HA   . SER B 1 130 ? 48.119 27.716 -15.695 1.00 27.51  ? 345 SER B HA   1 
ATOM   4825 H  HB2  . SER B 1 130 ? 45.331 28.088 -15.886 1.00 26.28  ? 345 SER B HB2  1 
ATOM   4826 H  HB3  . SER B 1 130 ? 46.112 26.888 -16.576 1.00 26.28  ? 345 SER B HB3  1 
ATOM   4827 H  HG   . SER B 1 130 ? 45.965 27.246 -13.957 1.00 32.16  ? 345 SER B HG   1 
ATOM   4828 N  N    . LYS B 1 131 ? 48.553 28.652 -17.889 1.00 18.21  ? 346 LYS B N    1 
ATOM   4829 C  CA   . LYS B 1 131 ? 48.873 29.282 -19.164 1.00 19.25  ? 346 LYS B CA   1 
ATOM   4830 C  C    . LYS B 1 131 ? 48.848 28.266 -20.324 1.00 20.06  ? 346 LYS B C    1 
ATOM   4831 O  O    . LYS B 1 131 ? 49.516 27.242 -20.255 1.00 18.39  ? 346 LYS B O    1 
ATOM   4832 C  CB   . LYS B 1 131 ? 50.248 29.889 -19.142 1.00 20.83  ? 346 LYS B CB   1 
ATOM   4833 C  CG   . LYS B 1 131 ? 50.601 30.705 -17.917 1.00 44.05  ? 346 LYS B CG   1 
ATOM   4834 C  CD   . LYS B 1 131 ? 52.009 31.292 -18.121 1.00 57.50  ? 346 LYS B CD   1 
ATOM   4835 C  CE   . LYS B 1 131 ? 52.323 32.430 -17.161 1.00 66.86  ? 346 LYS B CE   1 
ATOM   4836 N  NZ   . LYS B 1 131 ? 52.717 31.843 -15.868 1.00 41.16  ? 346 LYS B NZ   1 
ATOM   4837 H  H    . LYS B 1 131 ? 49.089 28.014 -17.676 1.00 21.85  ? 346 LYS B H    1 
ATOM   4838 H  HA   . LYS B 1 131 ? 48.228 29.981 -19.351 1.00 23.09  ? 346 LYS B HA   1 
ATOM   4839 H  HB2  . LYS B 1 131 ? 50.898 29.173 -19.208 1.00 25.00  ? 346 LYS B HB2  1 
ATOM   4840 H  HB3  . LYS B 1 131 ? 50.335 30.474 -19.912 1.00 25.00  ? 346 LYS B HB3  1 
ATOM   4841 H  HG2  . LYS B 1 131 ? 49.969 31.433 -17.811 1.00 52.86  ? 346 LYS B HG2  1 
ATOM   4842 H  HG3  . LYS B 1 131 ? 50.609 30.136 -17.131 1.00 52.86  ? 346 LYS B HG3  1 
ATOM   4843 H  HD2  . LYS B 1 131 ? 52.665 30.592 -17.980 1.00 69.00  ? 346 LYS B HD2  1 
ATOM   4844 H  HD3  . LYS B 1 131 ? 52.079 31.635 -19.026 1.00 69.00  ? 346 LYS B HD3  1 
ATOM   4845 H  HE2  . LYS B 1 131 ? 53.060 32.958 -17.505 1.00 80.23  ? 346 LYS B HE2  1 
ATOM   4846 H  HE3  . LYS B 1 131 ? 51.534 32.979 -17.030 1.00 80.23  ? 346 LYS B HE3  1 
ATOM   4847 H  HZ1  . LYS B 1 131 ? 52.907 32.490 -15.286 1.00 49.40  ? 346 LYS B HZ1  1 
ATOM   4848 H  HZ2  . LYS B 1 131 ? 52.053 31.348 -15.543 1.00 49.40  ? 346 LYS B HZ2  1 
ATOM   4849 H  HZ3  . LYS B 1 131 ? 53.436 31.329 -15.974 1.00 49.40  ? 346 LYS B HZ3  1 
ATOM   4850 N  N    . VAL B 1 132 ? 48.086 28.580 -21.371 1.00 19.65  ? 347 VAL B N    1 
ATOM   4851 C  CA   . VAL B 1 132 ? 48.036 27.797 -22.583 1.00 18.14  ? 347 VAL B CA   1 
ATOM   4852 C  C    . VAL B 1 132 ? 49.026 28.372 -23.588 1.00 21.33  ? 347 VAL B C    1 
ATOM   4853 O  O    . VAL B 1 132 ? 49.010 29.553 -23.876 1.00 21.04  ? 347 VAL B O    1 
ATOM   4854 C  CB   . VAL B 1 132 ? 46.610 27.773 -23.184 1.00 18.97  ? 347 VAL B CB   1 
ATOM   4855 C  CG1  . VAL B 1 132 ? 46.585 26.871 -24.369 1.00 17.08  ? 347 VAL B CG1  1 
ATOM   4856 C  CG2  . VAL B 1 132 ? 45.624 27.255 -22.203 1.00 15.93  ? 347 VAL B CG2  1 
ATOM   4857 H  H    . VAL B 1 132 ? 47.574 29.270 -21.393 1.00 23.58  ? 347 VAL B H    1 
ATOM   4858 H  HA   . VAL B 1 132 ? 48.298 26.884 -22.386 1.00 21.77  ? 347 VAL B HA   1 
ATOM   4859 H  HB   . VAL B 1 132 ? 46.347 28.666 -23.458 1.00 22.77  ? 347 VAL B HB   1 
ATOM   4860 H  HG11 . VAL B 1 132 ? 45.688 26.862 -24.739 1.00 20.49  ? 347 VAL B HG11 1 
ATOM   4861 H  HG12 . VAL B 1 132 ? 47.213 27.201 -25.030 1.00 20.49  ? 347 VAL B HG12 1 
ATOM   4862 H  HG13 . VAL B 1 132 ? 46.837 25.977 -24.090 1.00 20.49  ? 347 VAL B HG13 1 
ATOM   4863 H  HG21 . VAL B 1 132 ? 44.744 27.254 -22.611 1.00 19.12  ? 347 VAL B HG21 1 
ATOM   4864 H  HG22 . VAL B 1 132 ? 45.874 26.352 -21.952 1.00 19.12  ? 347 VAL B HG22 1 
ATOM   4865 H  HG23 . VAL B 1 132 ? 45.626 27.829 -21.421 1.00 19.12  ? 347 VAL B HG23 1 
ATOM   4866 N  N    . CYS B 1 133 ? 49.919 27.530 -24.086 1.00 26.13  ? 348 CYS B N    1 
ATOM   4867 C  CA   . CYS B 1 133 ? 50.775 27.925 -25.187 1.00 29.60  ? 348 CYS B CA   1 
ATOM   4868 C  C    . CYS B 1 133 ? 50.454 27.176 -26.462 1.00 34.06  ? 348 CYS B C    1 
ATOM   4869 O  O    . CYS B 1 133 ? 50.164 25.992 -26.459 1.00 27.98  ? 348 CYS B O    1 
ATOM   4870 C  CB   . CYS B 1 133 ? 52.228 27.726 -24.828 1.00 46.09  ? 348 CYS B CB   1 
ATOM   4871 S  SG   . CYS B 1 133 ? 52.644 28.781 -23.466 1.00 41.65  ? 348 CYS B SG   1 
ATOM   4872 H  H    . CYS B 1 133 ? 50.047 26.727 -23.804 1.00 31.36  ? 348 CYS B H    1 
ATOM   4873 H  HA   . CYS B 1 133 ? 50.641 28.870 -25.360 1.00 35.52  ? 348 CYS B HA   1 
ATOM   4874 H  HB2  . CYS B 1 133 ? 52.377 26.804 -24.564 1.00 55.31  ? 348 CYS B HB2  1 
ATOM   4875 H  HB3  . CYS B 1 133 ? 52.787 27.960 -25.586 1.00 55.31  ? 348 CYS B HB3  1 
ATOM   4876 H  HG   . CYS B 1 133 ? 51.952 28.499 -22.528 1.00 49.97  ? 348 CYS B HG   1 
ATOM   4877 N  N    . SER B 1 134 ? 50.519 27.922 -27.553 1.00 41.29  ? 349 SER B N    1 
ATOM   4878 C  CA   . SER B 1 134 ? 50.257 27.441 -28.900 1.00 45.14  ? 349 SER B CA   1 
ATOM   4879 C  C    . SER B 1 134 ? 51.445 27.787 -29.733 1.00 43.53  ? 349 SER B C    1 
ATOM   4880 O  O    . SER B 1 134 ? 51.786 28.958 -29.889 1.00 40.82  ? 349 SER B O    1 
ATOM   4881 C  CB   . SER B 1 134 ? 49.004 28.083 -29.482 1.00 52.75  ? 349 SER B CB   1 
ATOM   4882 O  OG   . SER B 1 134 ? 48.783 27.640 -30.806 1.00 42.32  ? 349 SER B OG   1 
ATOM   4883 H  H    . SER B 1 134 ? 50.725 28.757 -27.536 1.00 49.55  ? 349 SER B H    1 
ATOM   4884 H  HA   . SER B 1 134 ? 50.145 26.478 -28.893 1.00 54.17  ? 349 SER B HA   1 
ATOM   4885 H  HB2  . SER B 1 134 ? 48.241 27.840 -28.935 1.00 63.30  ? 349 SER B HB2  1 
ATOM   4886 H  HB3  . SER B 1 134 ? 49.116 29.047 -29.485 1.00 63.30  ? 349 SER B HB3  1 
ATOM   4887 H  HG   . SER B 1 134 ? 48.685 26.806 -30.817 1.00 50.78  ? 349 SER B HG   1 
ATOM   4888 N  N    . PHE B 1 135 ? 52.098 26.773 -30.264 1.00 43.05  ? 350 PHE B N    1 
ATOM   4889 C  CA   . PHE B 1 135 ? 53.303 26.996 -31.036 1.00 43.05  ? 350 PHE B CA   1 
ATOM   4890 C  C    . PHE B 1 135 ? 54.323 27.796 -30.240 1.00 52.92  ? 350 PHE B C    1 
ATOM   4891 O  O    . PHE B 1 135 ? 55.073 28.586 -30.813 1.00 41.59  ? 350 PHE B O    1 
ATOM   4892 C  CB   . PHE B 1 135 ? 52.954 27.703 -32.333 1.00 39.38  ? 350 PHE B CB   1 
ATOM   4893 C  CG   . PHE B 1 135 ? 52.106 26.869 -33.213 1.00 37.08  ? 350 PHE B CG   1 
ATOM   4894 C  CD1  . PHE B 1 135 ? 52.685 25.889 -34.008 1.00 51.51  ? 350 PHE B CD1  1 
ATOM   4895 C  CD2  . PHE B 1 135 ? 50.724 26.992 -33.190 1.00 38.19  ? 350 PHE B CD2  1 
ATOM   4896 C  CE1  . PHE B 1 135 ? 51.909 25.075 -34.807 1.00 42.31  ? 350 PHE B CE1  1 
ATOM   4897 C  CE2  . PHE B 1 135 ? 49.929 26.171 -33.977 1.00 39.21  ? 350 PHE B CE2  1 
ATOM   4898 C  CZ   . PHE B 1 135 ? 50.531 25.210 -34.791 1.00 43.61  ? 350 PHE B CZ   1 
ATOM   4899 H  H    . PHE B 1 135 ? 51.867 25.948 -30.193 1.00 51.66  ? 350 PHE B H    1 
ATOM   4900 H  HA   . PHE B 1 135 ? 53.699 26.139 -31.258 1.00 51.66  ? 350 PHE B HA   1 
ATOM   4901 H  HB2  . PHE B 1 135 ? 52.469 28.518 -32.130 1.00 47.26  ? 350 PHE B HB2  1 
ATOM   4902 H  HB3  . PHE B 1 135 ? 53.772 27.911 -32.811 1.00 47.26  ? 350 PHE B HB3  1 
ATOM   4903 H  HD1  . PHE B 1 135 ? 53.610 25.795 -34.018 1.00 61.82  ? 350 PHE B HD1  1 
ATOM   4904 H  HD2  . PHE B 1 135 ? 50.327 27.632 -32.644 1.00 45.83  ? 350 PHE B HD2  1 
ATOM   4905 H  HE1  . PHE B 1 135 ? 52.309 24.432 -35.347 1.00 50.77  ? 350 PHE B HE1  1 
ATOM   4906 H  HE2  . PHE B 1 135 ? 49.004 26.269 -33.972 1.00 47.06  ? 350 PHE B HE2  1 
ATOM   4907 H  HZ   . PHE B 1 135 ? 50.005 24.664 -35.331 1.00 52.33  ? 350 PHE B HZ   1 
ATOM   4908 N  N    . GLY B 1 136 ? 54.350 27.580 -28.926 1.00 53.41  ? 351 GLY B N    1 
ATOM   4909 C  CA   . GLY B 1 136 ? 55.330 28.229 -28.071 1.00 68.27  ? 351 GLY B CA   1 
ATOM   4910 C  C    . GLY B 1 136 ? 54.929 29.589 -27.522 1.00 66.80  ? 351 GLY B C    1 
ATOM   4911 O  O    . GLY B 1 136 ? 55.511 30.058 -26.543 1.00 70.95  ? 351 GLY B O    1 
ATOM   4912 H  H    . GLY B 1 136 ? 53.808 27.060 -28.507 1.00 64.10  ? 351 GLY B H    1 
ATOM   4913 H  HA2  . GLY B 1 136 ? 55.518 27.649 -27.316 1.00 81.93  ? 351 GLY B HA2  1 
ATOM   4914 H  HA3  . GLY B 1 136 ? 56.153 28.343 -28.571 1.00 81.93  ? 351 GLY B HA3  1 
ATOM   4915 N  N    . LYS B 1 137 ? 53.945 30.221 -28.155 1.00 40.84  ? 352 LYS B N    1 
ATOM   4916 C  CA   . LYS B 1 137 ? 53.414 31.509 -27.696 1.00 39.20  ? 352 LYS B CA   1 
ATOM   4917 C  C    . LYS B 1 137 ? 52.222 31.361 -26.762 1.00 38.28  ? 352 LYS B C    1 
ATOM   4918 O  O    . LYS B 1 137 ? 51.283 30.595 -27.008 1.00 33.56  ? 352 LYS B O    1 
ATOM   4919 C  CB   . LYS B 1 137 ? 52.992 32.365 -28.875 1.00 39.36  ? 352 LYS B CB   1 
ATOM   4920 C  CG   . LYS B 1 137 ? 53.960 32.351 -30.059 1.00 56.91  ? 352 LYS B CG   1 
ATOM   4921 C  CD   . LYS B 1 137 ? 55.409 32.729 -29.690 1.00 65.52  ? 352 LYS B CD   1 
ATOM   4922 C  CE   . LYS B 1 137 ? 56.200 33.269 -30.913 1.00 73.41  ? 352 LYS B CE   1 
ATOM   4923 N  NZ   . LYS B 1 137 ? 57.370 32.409 -31.315 1.00 81.84  ? 352 LYS B NZ   1 
ATOM   4924 H  H    . LYS B 1 137 ? 53.561 29.922 -28.865 1.00 49.01  ? 352 LYS B H    1 
ATOM   4925 H  HA   . LYS B 1 137 ? 54.111 31.983 -27.217 1.00 47.04  ? 352 LYS B HA   1 
ATOM   4926 H  HB2  . LYS B 1 137 ? 52.133 32.048 -29.195 1.00 47.23  ? 352 LYS B HB2  1 
ATOM   4927 H  HB3  . LYS B 1 137 ? 52.909 33.284 -28.575 1.00 47.23  ? 352 LYS B HB3  1 
ATOM   4928 H  HG2  . LYS B 1 137 ? 53.975 31.459 -30.440 1.00 68.29  ? 352 LYS B HG2  1 
ATOM   4929 H  HG3  . LYS B 1 137 ? 53.650 32.986 -30.723 1.00 68.29  ? 352 LYS B HG3  1 
ATOM   4930 H  HD2  . LYS B 1 137 ? 55.394 33.421 -29.010 1.00 78.62  ? 352 LYS B HD2  1 
ATOM   4931 H  HD3  . LYS B 1 137 ? 55.868 31.942 -29.356 1.00 78.62  ? 352 LYS B HD3  1 
ATOM   4932 H  HE2  . LYS B 1 137 ? 55.599 33.325 -31.672 1.00 88.09  ? 352 LYS B HE2  1 
ATOM   4933 H  HE3  . LYS B 1 137 ? 56.541 34.151 -30.698 1.00 88.09  ? 352 LYS B HE3  1 
ATOM   4934 H  HZ1  . LYS B 1 137 ? 57.783 32.767 -32.018 1.00 98.21  ? 352 LYS B HZ1  1 
ATOM   4935 H  HZ2  . LYS B 1 137 ? 57.948 32.347 -30.641 1.00 98.21  ? 352 LYS B HZ2  1 
ATOM   4936 H  HZ3  . LYS B 1 137 ? 57.088 31.593 -31.531 1.00 98.21  ? 352 LYS B HZ3  1 
ATOM   4937 N  N    . GLN B 1 138 ? 52.250 32.138 -25.696 1.00 39.61  ? 353 GLN B N    1 
ATOM   4938 C  CA   . GLN B 1 138 ? 51.170 32.114 -24.747 1.00 43.77  ? 353 GLN B CA   1 
ATOM   4939 C  C    . GLN B 1 138 ? 49.923 32.710 -25.405 1.00 33.86  ? 353 GLN B C    1 
ATOM   4940 O  O    . GLN B 1 138 ? 50.009 33.721 -26.076 1.00 38.10  ? 353 GLN B O    1 
ATOM   4941 C  CB   . GLN B 1 138 ? 51.581 32.867 -23.507 1.00 36.87  ? 353 GLN B CB   1 
ATOM   4942 C  CG   . GLN B 1 138 ? 50.439 33.114 -22.570 1.00 31.94  ? 353 GLN B CG   1 
ATOM   4943 C  CD   . GLN B 1 138 ? 50.908 33.630 -21.244 1.00 34.48  ? 353 GLN B CD   1 
ATOM   4944 O  OE1  . GLN B 1 138 ? 52.107 33.648 -20.954 1.00 45.12  ? 353 GLN B OE1  1 
ATOM   4945 N  NE2  . GLN B 1 138 ? 49.969 34.070 -20.424 1.00 47.15  ? 353 GLN B NE2  1 
ATOM   4946 H  H    . GLN B 1 138 ? 52.884 32.687 -25.503 1.00 47.54  ? 353 GLN B H    1 
ATOM   4947 H  HA   . GLN B 1 138 ? 50.977 31.197 -24.500 1.00 52.53  ? 353 GLN B HA   1 
ATOM   4948 H  HB2  . GLN B 1 138 ? 52.252 32.351 -23.033 1.00 44.24  ? 353 GLN B HB2  1 
ATOM   4949 H  HB3  . GLN B 1 138 ? 51.947 33.727 -23.767 1.00 44.24  ? 353 GLN B HB3  1 
ATOM   4950 H  HG2  . GLN B 1 138 ? 49.844 33.775 -22.959 1.00 38.33  ? 353 GLN B HG2  1 
ATOM   4951 H  HG3  . GLN B 1 138 ? 49.963 32.282 -22.420 1.00 38.33  ? 353 GLN B HG3  1 
ATOM   4952 H  HE21 . GLN B 1 138 ? 49.144 34.050 -20.665 1.00 56.58  ? 353 GLN B HE21 1 
ATOM   4953 H  HE22 . GLN B 1 138 ? 50.184 34.377 -19.650 1.00 56.58  ? 353 GLN B HE22 1 
ATOM   4954 N  N    . VAL B 1 139 ? 48.772 32.053 -25.266 1.00 28.51  ? 354 VAL B N    1 
ATOM   4955 C  CA   . VAL B 1 139 ? 47.533 32.556 -25.885 1.00 29.92  ? 354 VAL B CA   1 
ATOM   4956 C  C    . VAL B 1 139 ? 46.419 32.773 -24.865 1.00 32.70  ? 354 VAL B C    1 
ATOM   4957 O  O    . VAL B 1 139 ? 45.471 33.524 -25.118 1.00 30.36  ? 354 VAL B O    1 
ATOM   4958 C  CB   . VAL B 1 139 ? 47.056 31.608 -27.037 1.00 50.73  ? 354 VAL B CB   1 
ATOM   4959 C  CG1  . VAL B 1 139 ? 48.186 31.406 -28.021 1.00 58.36  ? 354 VAL B CG1  1 
ATOM   4960 C  CG2  . VAL B 1 139 ? 46.597 30.249 -26.534 1.00 30.71  ? 354 VAL B CG2  1 
ATOM   4961 H  H    . VAL B 1 139 ? 48.677 31.322 -24.825 1.00 34.22  ? 354 VAL B H    1 
ATOM   4962 H  HA   . VAL B 1 139 ? 47.724 33.418 -26.285 1.00 35.90  ? 354 VAL B HA   1 
ATOM   4963 H  HB   . VAL B 1 139 ? 46.315 32.024 -27.506 1.00 60.87  ? 354 VAL B HB   1 
ATOM   4964 H  HG11 . VAL B 1 139 ? 47.884 30.819 -28.732 1.00 70.03  ? 354 VAL B HG11 1 
ATOM   4965 H  HG12 . VAL B 1 139 ? 48.441 32.267 -28.389 1.00 70.03  ? 354 VAL B HG12 1 
ATOM   4966 H  HG13 . VAL B 1 139 ? 48.939 31.007 -27.559 1.00 70.03  ? 354 VAL B HG13 1 
ATOM   4967 H  HG21 . VAL B 1 139 ? 46.316 29.712 -27.291 1.00 36.85  ? 354 VAL B HG21 1 
ATOM   4968 H  HG22 . VAL B 1 139 ? 47.335 29.817 -26.077 1.00 36.85  ? 354 VAL B HG22 1 
ATOM   4969 H  HG23 . VAL B 1 139 ? 45.855 30.373 -25.921 1.00 36.85  ? 354 VAL B HG23 1 
ATOM   4970 N  N    . VAL B 1 140 ? 46.525 32.127 -23.705 1.00 27.85  ? 355 VAL B N    1 
ATOM   4971 C  CA   . VAL B 1 140 ? 45.556 32.367 -22.633 1.00 27.32  ? 355 VAL B CA   1 
ATOM   4972 C  C    . VAL B 1 140 ? 46.250 32.198 -21.305 1.00 25.88  ? 355 VAL B C    1 
ATOM   4973 O  O    . VAL B 1 140 ? 47.157 31.384 -21.193 1.00 25.33  ? 355 VAL B O    1 
ATOM   4974 C  CB   . VAL B 1 140 ? 44.340 31.420 -22.719 1.00 27.86  ? 355 VAL B CB   1 
ATOM   4975 C  CG1  . VAL B 1 140 ? 43.545 31.427 -21.404 1.00 45.46  ? 355 VAL B CG1  1 
ATOM   4976 C  CG2  . VAL B 1 140 ? 43.454 31.841 -23.839 1.00 29.60  ? 355 VAL B CG2  1 
ATOM   4977 H  H    . VAL B 1 140 ? 47.138 31.555 -23.514 1.00 33.42  ? 355 VAL B H    1 
ATOM   4978 H  HA   . VAL B 1 140 ? 45.234 33.280 -22.693 1.00 32.79  ? 355 VAL B HA   1 
ATOM   4979 H  HB   . VAL B 1 140 ? 44.645 30.515 -22.890 1.00 33.44  ? 355 VAL B HB   1 
ATOM   4980 H  HG11 . VAL B 1 140 ? 42.790 30.824 -21.490 1.00 54.55  ? 355 VAL B HG11 1 
ATOM   4981 H  HG12 . VAL B 1 140 ? 44.123 31.133 -20.684 1.00 54.55  ? 355 VAL B HG12 1 
ATOM   4982 H  HG13 . VAL B 1 140 ? 43.231 32.328 -21.231 1.00 54.55  ? 355 VAL B HG13 1 
ATOM   4983 H  HG21 . VAL B 1 140 ? 42.694 31.239 -23.883 1.00 35.52  ? 355 VAL B HG21 1 
ATOM   4984 H  HG22 . VAL B 1 140 ? 43.150 32.747 -23.677 1.00 35.52  ? 355 VAL B HG22 1 
ATOM   4985 H  HG23 . VAL B 1 140 ? 43.955 31.803 -24.669 1.00 35.52  ? 355 VAL B HG23 1 
ATOM   4986 N  N    . GLU B 1 141 ? 45.804 32.964 -20.311 1.00 25.53  ? 356 GLU B N    1 
ATOM   4987 C  CA   . GLU B 1 141 ? 46.189 32.778 -18.933 1.00 24.56  ? 356 GLU B CA   1 
ATOM   4988 C  C    . GLU B 1 141 ? 44.972 32.916 -18.021 1.00 24.57  ? 356 GLU B C    1 
ATOM   4989 O  O    . GLU B 1 141 ? 44.170 33.864 -18.146 1.00 25.13  ? 356 GLU B O    1 
ATOM   4990 C  CB   . GLU B 1 141 ? 47.265 33.782 -18.507 1.00 24.33  ? 356 GLU B CB   1 
ATOM   4991 C  CG   . GLU B 1 141 ? 47.909 33.448 -17.168 1.00 43.49  ? 356 GLU B CG   1 
ATOM   4992 C  CD   . GLU B 1 141 ? 49.119 34.322 -16.824 1.00 46.33  ? 356 GLU B CD   1 
ATOM   4993 O  OE1  . GLU B 1 141 ? 49.643 35.033 -17.725 1.00 42.27  ? 356 GLU B OE1  1 
ATOM   4994 O  OE2  . GLU B 1 141 ? 49.563 34.286 -15.643 1.00 48.54  ? 356 GLU B OE2  1 
ATOM   4995 H  H    . GLU B 1 141 ? 45.258 33.619 -20.424 1.00 30.63  ? 356 GLU B H    1 
ATOM   4996 H  HA   . GLU B 1 141 ? 46.550 31.884 -18.822 1.00 29.47  ? 356 GLU B HA   1 
ATOM   4997 H  HB2  . GLU B 1 141 ? 47.965 33.795 -19.179 1.00 29.19  ? 356 GLU B HB2  1 
ATOM   4998 H  HB3  . GLU B 1 141 ? 46.862 34.661 -18.433 1.00 29.19  ? 356 GLU B HB3  1 
ATOM   4999 H  HG2  . GLU B 1 141 ? 47.250 33.567 -16.466 1.00 52.19  ? 356 GLU B HG2  1 
ATOM   5000 H  HG3  . GLU B 1 141 ? 48.207 32.525 -17.186 1.00 52.19  ? 356 GLU B HG3  1 
ATOM   5001 N  N    . LYS B 1 142 ? 44.879 32.002 -17.069 1.00 24.12  ? 357 LYS B N    1 
ATOM   5002 C  CA   . LYS B 1 142 ? 43.859 32.080 -16.030 1.00 24.20  ? 357 LYS B CA   1 
ATOM   5003 C  C    . LYS B 1 142 ? 44.511 32.082 -14.654 1.00 23.79  ? 357 LYS B C    1 
ATOM   5004 O  O    . LYS B 1 142 ? 45.317 31.194 -14.311 1.00 23.57  ? 357 LYS B O    1 
ATOM   5005 C  CB   . LYS B 1 142 ? 42.879 30.934 -16.113 1.00 36.63  ? 357 LYS B CB   1 
ATOM   5006 C  CG   . LYS B 1 142 ? 41.541 31.245 -15.419 1.00 41.18  ? 357 LYS B CG   1 
ATOM   5007 C  CD   . LYS B 1 142 ? 41.188 30.181 -14.417 1.00 52.24  ? 357 LYS B CD   1 
ATOM   5008 C  CE   . LYS B 1 142 ? 39.651 29.972 -14.266 1.00 69.13  ? 357 LYS B CE   1 
ATOM   5009 N  NZ   . LYS B 1 142 ? 39.040 29.075 -15.338 1.00 71.28  ? 357 LYS B NZ   1 
ATOM   5010 H  H    . LYS B 1 142 ? 45.398 31.320 -17.000 1.00 28.94  ? 357 LYS B H    1 
ATOM   5011 H  HA   . LYS B 1 142 ? 43.365 32.908 -16.131 1.00 29.04  ? 357 LYS B HA   1 
ATOM   5012 H  HB2  . LYS B 1 142 ? 42.695 30.742 -17.046 1.00 43.96  ? 357 LYS B HB2  1 
ATOM   5013 H  HB3  . LYS B 1 142 ? 43.266 30.155 -15.683 1.00 43.96  ? 357 LYS B HB3  1 
ATOM   5014 H  HG2  . LYS B 1 142 ? 41.611 32.092 -14.952 1.00 49.42  ? 357 LYS B HG2  1 
ATOM   5015 H  HG3  . LYS B 1 142 ? 40.836 31.283 -16.084 1.00 49.42  ? 357 LYS B HG3  1 
ATOM   5016 H  HD2  . LYS B 1 142 ? 41.578 29.340 -14.700 1.00 62.68  ? 357 LYS B HD2  1 
ATOM   5017 H  HD3  . LYS B 1 142 ? 41.541 30.436 -13.550 1.00 62.68  ? 357 LYS B HD3  1 
ATOM   5018 H  HE2  . LYS B 1 142 ? 39.474 29.565 -13.404 1.00 82.95  ? 357 LYS B HE2  1 
ATOM   5019 H  HE3  . LYS B 1 142 ? 39.212 30.835 -14.318 1.00 82.95  ? 357 LYS B HE3  1 
ATOM   5020 H  HZ1  . LYS B 1 142 ? 39.175 29.428 -16.143 1.00 85.54  ? 357 LYS B HZ1  1 
ATOM   5021 H  HZ2  . LYS B 1 142 ? 39.415 28.268 -15.309 1.00 85.54  ? 357 LYS B HZ2  1 
ATOM   5022 H  HZ3  . LYS B 1 142 ? 38.164 28.992 -15.201 1.00 85.54  ? 357 LYS B HZ3  1 
ATOM   5023 N  N    . VAL B 1 143 ? 44.140 33.071 -13.852 1.00 23.95  ? 358 VAL B N    1 
ATOM   5024 C  CA   . VAL B 1 143 ? 44.752 33.250 -12.569 1.00 23.94  ? 358 VAL B CA   1 
ATOM   5025 C  C    . VAL B 1 143 ? 43.701 33.254 -11.468 1.00 24.37  ? 358 VAL B C    1 
ATOM   5026 O  O    . VAL B 1 143 ? 42.803 34.063 -11.496 1.00 24.66  ? 358 VAL B O    1 
ATOM   5027 C  CB   . VAL B 1 143 ? 45.569 34.525 -12.535 1.00 24.06  ? 358 VAL B CB   1 
ATOM   5028 C  CG1  . VAL B 1 143 ? 46.303 34.603 -11.237 1.00 24.34  ? 358 VAL B CG1  1 
ATOM   5029 C  CG2  . VAL B 1 143 ? 46.614 34.558 -13.646 1.00 23.81  ? 358 VAL B CG2  1 
ATOM   5030 H  H    . VAL B 1 143 ? 43.532 33.650 -14.039 1.00 28.74  ? 358 VAL B H    1 
ATOM   5031 H  HA   . VAL B 1 143 ? 45.353 32.507 -12.403 1.00 28.73  ? 358 VAL B HA   1 
ATOM   5032 H  HB   . VAL B 1 143 ? 44.989 35.298 -12.619 1.00 28.87  ? 358 VAL B HB   1 
ATOM   5033 H  HG11 . VAL B 1 143 ? 46.825 35.420 -11.219 1.00 29.21  ? 358 VAL B HG11 1 
ATOM   5034 H  HG12 . VAL B 1 143 ? 45.660 34.604 -10.511 1.00 29.21  ? 358 VAL B HG12 1 
ATOM   5035 H  HG13 . VAL B 1 143 ? 46.889 33.834 -11.159 1.00 29.21  ? 358 VAL B HG13 1 
ATOM   5036 H  HG21 . VAL B 1 143 ? 47.111 35.388 -13.586 1.00 28.58  ? 358 VAL B HG21 1 
ATOM   5037 H  HG22 . VAL B 1 143 ? 47.213 33.803 -13.537 1.00 28.58  ? 358 VAL B HG22 1 
ATOM   5038 H  HG23 . VAL B 1 143 ? 46.164 34.502 -14.503 1.00 28.58  ? 358 VAL B HG23 1 
ATOM   5039 N  N    . GLU B 1 144 ? 43.839 32.354 -10.500 1.00 24.61  ? 359 GLU B N    1 
ATOM   5040 C  CA   . GLU B 1 144 ? 42.894 32.175 -9.394  1.00 25.27  ? 359 GLU B CA   1 
ATOM   5041 C  C    . GLU B 1 144 ? 43.651 32.196 -8.052  1.00 25.90  ? 359 GLU B C    1 
ATOM   5042 O  O    . GLU B 1 144 ? 44.799 31.790 -7.985  1.00 25.88  ? 359 GLU B O    1 
ATOM   5043 C  CB   . GLU B 1 144 ? 42.151 30.822 -9.499  1.00 41.85  ? 359 GLU B CB   1 
ATOM   5044 C  CG   . GLU B 1 144 ? 41.303 30.557 -10.744 1.00 57.24  ? 359 GLU B CG   1 
ATOM   5045 C  CD   . GLU B 1 144 ? 41.168 29.037 -11.053 1.00 63.72  ? 359 GLU B CD   1 
ATOM   5046 O  OE1  . GLU B 1 144 ? 40.093 28.451 -10.790 1.00 74.23  ? 359 GLU B OE1  1 
ATOM   5047 O  OE2  . GLU B 1 144 ? 42.143 28.423 -11.555 1.00 71.77  ? 359 GLU B OE2  1 
ATOM   5048 H  H    . GLU B 1 144 ? 44.503 31.809 -10.459 1.00 29.54  ? 359 GLU B H    1 
ATOM   5049 H  HA   . GLU B 1 144 ? 42.241 32.893 -9.397  1.00 30.32  ? 359 GLU B HA   1 
ATOM   5050 H  HB2  . GLU B 1 144 ? 42.813 30.115 -9.454  1.00 50.22  ? 359 GLU B HB2  1 
ATOM   5051 H  HB3  . GLU B 1 144 ? 41.558 30.749 -8.734  1.00 50.22  ? 359 GLU B HB3  1 
ATOM   5052 H  HG2  . GLU B 1 144 ? 40.413 30.917 -10.605 1.00 68.68  ? 359 GLU B HG2  1 
ATOM   5053 H  HG3  . GLU B 1 144 ? 41.719 30.984 -11.509 1.00 68.68  ? 359 GLU B HG3  1 
ATOM   5054 N  N    . THR B 1 145 ? 42.994 32.637 -6.980  1.00 27.21  ? 360 THR B N    1 
ATOM   5055 C  CA   . THR B 1 145 ? 43.560 32.498 -5.645  1.00 27.75  ? 360 THR B CA   1 
ATOM   5056 C  C    . THR B 1 145 ? 42.686 31.621 -4.801  1.00 28.72  ? 360 THR B C    1 
ATOM   5057 O  O    . THR B 1 145 ? 41.496 31.575 -4.986  1.00 30.75  ? 360 THR B O    1 
ATOM   5058 C  CB   . THR B 1 145 ? 43.725 33.824 -4.965  1.00 30.08  ? 360 THR B CB   1 
ATOM   5059 O  OG1  . THR B 1 145 ? 42.440 34.415 -4.792  1.00 48.98  ? 360 THR B OG1  1 
ATOM   5060 C  CG2  . THR B 1 145 ? 44.638 34.714 -5.804  1.00 31.73  ? 360 THR B CG2  1 
ATOM   5061 H  H    . THR B 1 145 ? 42.223 33.018 -7.002  1.00 32.66  ? 360 THR B H    1 
ATOM   5062 H  HA   . THR B 1 145 ? 44.433 32.081 -5.711  1.00 33.30  ? 360 THR B HA   1 
ATOM   5063 H  HB   . THR B 1 145 ? 44.139 33.692 -4.098  1.00 36.10  ? 360 THR B HB   1 
ATOM   5064 H  HG1  . THR B 1 145 ? 42.516 35.161 -4.411  1.00 58.78  ? 360 THR B HG1  1 
ATOM   5065 H  HG21 . THR B 1 145 ? 44.750 35.575 -5.371  1.00 38.07  ? 360 THR B HG21 1 
ATOM   5066 H  HG22 . THR B 1 145 ? 45.507 34.296 -5.904  1.00 38.07  ? 360 THR B HG22 1 
ATOM   5067 H  HG23 . THR B 1 145 ? 44.251 34.851 -6.683  1.00 38.07  ? 360 THR B HG23 1 
ATOM   5068 N  N    . GLU B 1 146 ? 43.295 30.895 -3.890  1.00 29.82  ? 361 GLU B N    1 
ATOM   5069 C  CA   . GLU B 1 146 ? 42.576 30.007 -3.000  1.00 31.17  ? 361 GLU B CA   1 
ATOM   5070 C  C    . GLU B 1 146 ? 43.221 30.035 -1.632  1.00 32.93  ? 361 GLU B C    1 
ATOM   5071 O  O    . GLU B 1 146 ? 44.432 29.796 -1.466  1.00 33.34  ? 361 GLU B O    1 
ATOM   5072 C  CB   . GLU B 1 146 ? 42.560 28.567 -3.562  1.00 31.13  ? 361 GLU B CB   1 
ATOM   5073 C  CG   . GLU B 1 146 ? 41.765 27.556 -2.748  1.00 36.09  ? 361 GLU B CG   1 
ATOM   5074 C  CD   . GLU B 1 146 ? 40.274 27.905 -2.616  1.00 39.86  ? 361 GLU B CD   1 
ATOM   5075 O  OE1  . GLU B 1 146 ? 39.695 28.584 -3.523  1.00 45.21  ? 361 GLU B OE1  1 
ATOM   5076 O  OE2  . GLU B 1 146 ? 39.679 27.469 -1.603  1.00 49.51  ? 361 GLU B OE2  1 
ATOM   5077 H  H    . GLU B 1 146 ? 44.146 30.898 -3.763  1.00 35.79  ? 361 GLU B H    1 
ATOM   5078 H  HA   . GLU B 1 146 ? 41.659 30.312 -2.912  1.00 37.40  ? 361 GLU B HA   1 
ATOM   5079 H  HB2  . GLU B 1 146 ? 42.177 28.589 -4.453  1.00 37.36  ? 361 GLU B HB2  1 
ATOM   5080 H  HB3  . GLU B 1 146 ? 43.474 28.246 -3.611  1.00 37.36  ? 361 GLU B HB3  1 
ATOM   5081 H  HG2  . GLU B 1 146 ? 41.829 26.688 -3.177  1.00 43.31  ? 361 GLU B HG2  1 
ATOM   5082 H  HG3  . GLU B 1 146 ? 42.139 27.510 -1.855  1.00 43.31  ? 361 GLU B HG3  1 
ATOM   5083 N  N    . ARG B 1 147 ? 42.383 30.302 -0.654  1.00 35.19  ? 362 ARG B N    1 
ATOM   5084 C  CA   . ARG B 1 147 ? 42.796 30.397 0.729   1.00 37.31  ? 362 ARG B CA   1 
ATOM   5085 C  C    . ARG B 1 147 ? 42.638 29.005 1.299   1.00 38.91  ? 362 ARG B C    1 
ATOM   5086 O  O    . ARG B 1 147 ? 41.735 28.288 0.909   1.00 42.75  ? 362 ARG B O    1 
ATOM   5087 C  CB   . ARG B 1 147 ? 41.954 31.427 1.493   1.00 40.02  ? 362 ARG B CB   1 
ATOM   5088 C  CG   . ARG B 1 147 ? 42.493 31.783 2.895   1.00 61.31  ? 362 ARG B CG   1 
ATOM   5089 C  CD   . ARG B 1 147 ? 41.519 32.735 3.637   1.00 65.50  ? 362 ARG B CD   1 
ATOM   5090 N  NE   . ARG B 1 147 ? 41.603 32.625 5.095   1.00 73.79  ? 362 ARG B NE   1 
ATOM   5091 C  CZ   . ARG B 1 147 ? 42.500 33.256 5.848   1.00 71.62  ? 362 ARG B CZ   1 
ATOM   5092 N  NH1  . ARG B 1 147 ? 43.396 34.052 5.273   1.00 62.20  ? 362 ARG B NH1  1 
ATOM   5093 N  NH2  . ARG B 1 147 ? 42.505 33.091 7.174   1.00 63.75  ? 362 ARG B NH2  1 
ATOM   5094 H  H    . ARG B 1 147 ? 41.541 30.437 -0.769  1.00 42.23  ? 362 ARG B H    1 
ATOM   5095 H  HA   . ARG B 1 147 ? 43.730 30.654 0.779   1.00 44.78  ? 362 ARG B HA   1 
ATOM   5096 H  HB2  . ARG B 1 147 ? 41.920 32.246 0.974   1.00 48.03  ? 362 ARG B HB2  1 
ATOM   5097 H  HB3  . ARG B 1 147 ? 41.057 31.074 1.603   1.00 48.03  ? 362 ARG B HB3  1 
ATOM   5098 H  HG2  . ARG B 1 147 ? 42.587 30.972 3.419   1.00 73.57  ? 362 ARG B HG2  1 
ATOM   5099 H  HG3  . ARG B 1 147 ? 43.349 32.230 2.807   1.00 73.57  ? 362 ARG B HG3  1 
ATOM   5100 H  HD2  . ARG B 1 147 ? 41.728 33.651 3.395   1.00 78.60  ? 362 ARG B HD2  1 
ATOM   5101 H  HD3  . ARG B 1 147 ? 40.610 32.523 3.374   1.00 78.60  ? 362 ARG B HD3  1 
ATOM   5102 H  HE   . ARG B 1 147 ? 41.033 32.117 5.492   1.00 88.54  ? 362 ARG B HE   1 
ATOM   5103 H  HH11 . ARG B 1 147 ? 43.393 34.157 4.420   1.00 74.64  ? 362 ARG B HH11 1 
ATOM   5104 H  HH12 . ARG B 1 147 ? 43.978 34.463 5.755   1.00 74.64  ? 362 ARG B HH12 1 
ATOM   5105 H  HH21 . ARG B 1 147 ? 41.925 32.577 7.545   1.00 76.50  ? 362 ARG B HH21 1 
ATOM   5106 H  HH22 . ARG B 1 147 ? 43.086 33.503 7.656   1.00 76.50  ? 362 ARG B HH22 1 
ATOM   5107 N  N    . ALA B 1 148 ? 43.585 28.617 2.144   1.00 32.31  ? 363 ALA B N    1 
ATOM   5108 C  CA   . ALA B 1 148 ? 43.571 27.371 2.891   1.00 34.68  ? 363 ALA B CA   1 
ATOM   5109 C  C    . ALA B 1 148 ? 42.321 27.110 3.716   1.00 35.45  ? 363 ALA B C    1 
ATOM   5110 O  O    . ALA B 1 148 ? 41.757 28.010 4.354   1.00 37.79  ? 363 ALA B O    1 
ATOM   5111 C  CB   . ALA B 1 148 ? 44.753 27.360 3.813   1.00 31.97  ? 363 ALA B CB   1 
ATOM   5112 H  H    . ALA B 1 148 ? 44.286 29.089 2.307   1.00 38.78  ? 363 ALA B H    1 
ATOM   5113 H  HA   . ALA B 1 148 ? 43.673 26.635 2.268   1.00 41.62  ? 363 ALA B HA   1 
ATOM   5114 H  HB1  . ALA B 1 148 ? 44.752 26.531 4.316   1.00 38.36  ? 363 ALA B HB1  1 
ATOM   5115 H  HB2  . ALA B 1 148 ? 45.565 27.426 3.285   1.00 38.36  ? 363 ALA B HB2  1 
ATOM   5116 H  HB3  . ALA B 1 148 ? 44.689 28.116 4.417   1.00 38.36  ? 363 ALA B HB3  1 
ATOM   5117 N  N    . GLN B 1 149 ? 41.942 25.838 3.757   1.00 30.68  ? 364 GLN B N    1 
ATOM   5118 C  CA   . GLN B 1 149 ? 40.911 25.365 4.672   1.00 30.11  ? 364 GLN B CA   1 
ATOM   5119 C  C    . GLN B 1 149 ? 41.474 24.212 5.502   1.00 38.82  ? 364 GLN B C    1 
ATOM   5120 O  O    . GLN B 1 149 ? 42.242 23.384 5.010   1.00 28.81  ? 364 GLN B O    1 
ATOM   5121 C  CB   . GLN B 1 149 ? 39.691 24.946 3.880   1.00 47.69  ? 364 GLN B CB   1 
ATOM   5122 C  CG   . GLN B 1 149 ? 38.682 26.089 3.726   1.00 52.98  ? 364 GLN B CG   1 
ATOM   5123 C  CD   . GLN B 1 149 ? 37.815 25.978 2.497   1.00 53.94  ? 364 GLN B CD   1 
ATOM   5124 O  OE1  . GLN B 1 149 ? 38.237 25.460 1.440   1.00 43.64  ? 364 GLN B OE1  1 
ATOM   5125 N  NE2  . GLN B 1 149 ? 36.578 26.469 2.614   1.00 53.18  ? 364 GLN B NE2  1 
ATOM   5126 H  H    . GLN B 1 149 ? 42.272 25.221 3.257   1.00 36.82  ? 364 GLN B H    1 
ATOM   5127 H  HA   . GLN B 1 149 ? 40.657 26.083 5.273   1.00 36.13  ? 364 GLN B HA   1 
ATOM   5128 H  HB2  . GLN B 1 149 ? 39.968 24.667 2.993   1.00 57.22  ? 364 GLN B HB2  1 
ATOM   5129 H  HB3  . GLN B 1 149 ? 39.251 24.214 4.338   1.00 57.22  ? 364 GLN B HB3  1 
ATOM   5130 H  HG2  . GLN B 1 149 ? 38.098 26.096 4.501   1.00 63.58  ? 364 GLN B HG2  1 
ATOM   5131 H  HG3  . GLN B 1 149 ? 39.167 26.928 3.673   1.00 63.58  ? 364 GLN B HG3  1 
ATOM   5132 H  HE21 . GLN B 1 149 ? 36.323 26.819 3.357   1.00 63.81  ? 364 GLN B HE21 1 
ATOM   5133 H  HE22 . GLN B 1 149 ? 36.036 26.435 1.947   1.00 63.81  ? 364 GLN B HE22 1 
ATOM   5134 N  N    . LEU B 1 150 ? 41.143 24.188 6.782   1.00 43.19  ? 365 LEU B N    1 
ATOM   5135 C  CA   . LEU B 1 150 ? 41.727 23.243 7.727   1.00 43.44  ? 365 LEU B CA   1 
ATOM   5136 C  C    . LEU B 1 150 ? 40.984 21.933 7.660   1.00 65.07  ? 365 LEU B C    1 
ATOM   5137 O  O    . LEU B 1 150 ? 39.767 21.898 7.757   1.00 79.35  ? 365 LEU B O    1 
ATOM   5138 C  CB   . LEU B 1 150 ? 41.667 23.818 9.133   1.00 52.78  ? 365 LEU B CB   1 
ATOM   5139 C  CG   . LEU B 1 150 ? 42.056 22.957 10.343  1.00 54.36  ? 365 LEU B CG   1 
ATOM   5140 C  CD1  . LEU B 1 150 ? 43.480 22.431 10.273  1.00 45.02  ? 365 LEU B CD1  1 
ATOM   5141 C  CD2  . LEU B 1 150 ? 41.866 23.786 11.595  1.00 72.35  ? 365 LEU B CD2  1 
ATOM   5142 H  H    . LEU B 1 150 ? 40.569 24.721 7.138   1.00 51.83  ? 365 LEU B H    1 
ATOM   5143 H  HA   . LEU B 1 150 ? 42.656 23.085 7.497   1.00 52.13  ? 365 LEU B HA   1 
ATOM   5144 H  HB2  . LEU B 1 150 ? 42.247 24.595 9.153   1.00 63.34  ? 365 LEU B HB2  1 
ATOM   5145 H  HB3  . LEU B 1 150 ? 40.754 24.109 9.287   1.00 63.34  ? 365 LEU B HB3  1 
ATOM   5146 H  HG   . LEU B 1 150 ? 41.458 22.195 10.394  1.00 65.23  ? 365 LEU B HG   1 
ATOM   5147 H  HD11 . LEU B 1 150 ? 43.659 21.898 11.063  1.00 54.03  ? 365 LEU B HD11 1 
ATOM   5148 H  HD12 . LEU B 1 150 ? 43.576 21.885 9.477   1.00 54.03  ? 365 LEU B HD12 1 
ATOM   5149 H  HD13 . LEU B 1 150 ? 44.092 23.183 10.235  1.00 54.03  ? 365 LEU B HD13 1 
ATOM   5150 H  HD21 . LEU B 1 150 ? 42.110 23.252 12.367  1.00 86.82  ? 365 LEU B HD21 1 
ATOM   5151 H  HD22 . LEU B 1 150 ? 42.434 24.571 11.543  1.00 86.82  ? 365 LEU B HD22 1 
ATOM   5152 H  HD23 . LEU B 1 150 ? 40.936 24.054 11.658  1.00 86.82  ? 365 LEU B HD23 1 
ATOM   5153 N  N    . GLU B 1 151 ? 41.721 20.848 7.505   1.00 66.28  ? 366 GLU B N    1 
ATOM   5154 C  CA   . GLU B 1 151 ? 41.107 19.544 7.347   1.00 50.55  ? 366 GLU B CA   1 
ATOM   5155 C  C    . GLU B 1 151 ? 41.712 18.668 8.404   1.00 54.75  ? 366 GLU B C    1 
ATOM   5156 O  O    . GLU B 1 151 ? 42.259 19.185 9.376   1.00 68.82  ? 366 GLU B O    1 
ATOM   5157 C  CB   . GLU B 1 151 ? 41.351 18.996 5.948   1.00 70.30  ? 366 GLU B CB   1 
ATOM   5158 C  CG   . GLU B 1 151 ? 40.390 17.913 5.528   1.00 73.26  ? 366 GLU B CG   1 
ATOM   5159 C  CD   . GLU B 1 151 ? 39.317 18.426 4.607   1.00 71.69  ? 366 GLU B CD   1 
ATOM   5160 O  OE1  . GLU B 1 151 ? 38.821 19.558 4.822   1.00 76.01  ? 366 GLU B OE1  1 
ATOM   5161 O  OE2  . GLU B 1 151 ? 38.973 17.694 3.663   1.00 70.71  ? 366 GLU B OE2  1 
ATOM   5162 H  H    . GLU B 1 151 ? 42.580 20.840 7.488   1.00 79.53  ? 366 GLU B H    1 
ATOM   5163 H  HA   . GLU B 1 151 ? 40.151 19.607 7.498   1.00 60.66  ? 366 GLU B HA   1 
ATOM   5164 H  HB2  . GLU B 1 151 ? 41.272 19.723 5.311   1.00 84.36  ? 366 GLU B HB2  1 
ATOM   5165 H  HB3  . GLU B 1 151 ? 42.247 18.626 5.912   1.00 84.36  ? 366 GLU B HB3  1 
ATOM   5166 H  HG2  . GLU B 1 151 ? 40.880 17.217 5.062   1.00 87.91  ? 366 GLU B HG2  1 
ATOM   5167 H  HG3  . GLU B 1 151 ? 39.961 17.546 6.317   1.00 87.91  ? 366 GLU B HG3  1 
ATOM   5168 N  N    . ASP B 1 152 ? 41.643 17.354 8.217   1.00 71.13  ? 367 ASP B N    1 
ATOM   5169 C  CA   . ASP B 1 152 ? 42.137 16.412 9.213   1.00 63.87  ? 367 ASP B CA   1 
ATOM   5170 C  C    . ASP B 1 152 ? 43.663 16.371 9.240   1.00 62.73  ? 367 ASP B C    1 
ATOM   5171 O  O    . ASP B 1 152 ? 44.269 15.588 8.510   1.00 80.82  ? 367 ASP B O    1 
ATOM   5172 C  CB   . ASP B 1 152 ? 41.585 15.007 8.936   1.00 72.38  ? 367 ASP B CB   1 
ATOM   5173 C  CG   . ASP B 1 152 ? 41.890 14.013 10.073  1.00 89.47  ? 367 ASP B CG   1 
ATOM   5174 O  OD1  . ASP B 1 152 ? 40.931 13.452 10.663  1.00 95.27  ? 367 ASP B OD1  1 
ATOM   5175 O  OD2  . ASP B 1 152 ? 43.090 13.790 10.376  1.00 86.14  ? 367 ASP B OD2  1 
ATOM   5176 H  H    . ASP B 1 152 ? 41.312 16.980 7.516   1.00 85.35  ? 367 ASP B H    1 
ATOM   5177 H  HA   . ASP B 1 152 ? 41.828 16.689 10.090  1.00 76.64  ? 367 ASP B HA   1 
ATOM   5178 H  HB2  . ASP B 1 152 ? 40.622 15.060 8.834   1.00 86.85  ? 367 ASP B HB2  1 
ATOM   5179 H  HB3  . ASP B 1 152 ? 41.987 14.665 8.122   1.00 86.85  ? 367 ASP B HB3  1 
ATOM   5180 N  N    . GLY B 1 153 ? 44.278 17.207 10.084  1.00 41.46  ? 368 GLY B N    1 
ATOM   5181 C  CA   . GLY B 1 153 ? 45.725 17.201 10.258  1.00 40.77  ? 368 GLY B CA   1 
ATOM   5182 C  C    . GLY B 1 153 ? 46.537 17.881 9.136   1.00 52.28  ? 368 GLY B C    1 
ATOM   5183 O  O    . GLY B 1 153 ? 47.710 17.578 8.960   1.00 58.00  ? 368 GLY B O    1 
ATOM   5184 H  H    . GLY B 1 153 ? 43.872 17.790 10.568  1.00 49.75  ? 368 GLY B H    1 
ATOM   5185 H  HA2  . GLY B 1 153 ? 45.940 17.648 11.092  1.00 48.93  ? 368 GLY B HA2  1 
ATOM   5186 H  HA3  . GLY B 1 153 ? 46.026 16.282 10.327  1.00 48.93  ? 368 GLY B HA3  1 
ATOM   5187 N  N    . ARG B 1 154 ? 45.924 18.788 8.379   1.00 54.79  ? 369 ARG B N    1 
ATOM   5188 C  CA   . ARG B 1 154 ? 46.607 19.509 7.300   1.00 45.99  ? 369 ARG B CA   1 
ATOM   5189 C  C    . ARG B 1 154 ? 45.673 20.548 6.707   1.00 38.56  ? 369 ARG B C    1 
ATOM   5190 O  O    . ARG B 1 154 ? 44.501 20.573 7.041   1.00 39.31  ? 369 ARG B O    1 
ATOM   5191 C  CB   . ARG B 1 154 ? 47.057 18.551 6.216   1.00 49.51  ? 369 ARG B CB   1 
ATOM   5192 C  CG   . ARG B 1 154 ? 45.988 17.554 5.875   1.00 47.81  ? 369 ARG B CG   1 
ATOM   5193 C  CD   . ARG B 1 154 ? 46.051 17.096 4.467   1.00 56.55  ? 369 ARG B CD   1 
ATOM   5194 N  NE   . ARG B 1 154 ? 45.342 15.822 4.281   1.00 72.24  ? 369 ARG B NE   1 
ATOM   5195 C  CZ   . ARG B 1 154 ? 44.042 15.707 3.998   1.00 71.96  ? 369 ARG B CZ   1 
ATOM   5196 N  NH1  . ARG B 1 154 ? 43.285 16.792 3.876   1.00 76.84  ? 369 ARG B NH1  1 
ATOM   5197 N  NH2  . ARG B 1 154 ? 43.494 14.503 3.839   1.00 68.41  ? 369 ARG B NH2  1 
ATOM   5198 H  H    . ARG B 1 154 ? 45.098 19.008 8.470   1.00 65.74  ? 369 ARG B H    1 
ATOM   5199 H  HA   . ARG B 1 154 ? 47.388 19.962 7.656   1.00 55.19  ? 369 ARG B HA   1 
ATOM   5200 H  HB2  . ARG B 1 154 ? 47.269 19.054 5.414   1.00 59.41  ? 369 ARG B HB2  1 
ATOM   5201 H  HB3  . ARG B 1 154 ? 47.838 18.065 6.523   1.00 59.41  ? 369 ARG B HB3  1 
ATOM   5202 H  HG2  . ARG B 1 154 ? 46.088 16.777 6.447   1.00 57.38  ? 369 ARG B HG2  1 
ATOM   5203 H  HG3  . ARG B 1 154 ? 45.120 17.962 6.018   1.00 57.38  ? 369 ARG B HG3  1 
ATOM   5204 H  HD2  . ARG B 1 154 ? 45.636 17.761 3.896   1.00 67.86  ? 369 ARG B HD2  1 
ATOM   5205 H  HD3  . ARG B 1 154 ? 46.979 16.968 4.214   1.00 67.86  ? 369 ARG B HD3  1 
ATOM   5206 H  HE   . ARG B 1 154 ? 45.797 15.097 4.360   1.00 86.69  ? 369 ARG B HE   1 
ATOM   5207 H  HH11 . ARG B 1 154 ? 43.632 17.573 3.975   1.00 92.21  ? 369 ARG B HH11 1 
ATOM   5208 H  HH12 . ARG B 1 154 ? 42.448 16.714 3.695   1.00 92.21  ? 369 ARG B HH12 1 
ATOM   5209 H  HH21 . ARG B 1 154 ? 43.977 13.797 3.919   1.00 82.09  ? 369 ARG B HH21 1 
ATOM   5210 H  HH22 . ARG B 1 154 ? 42.655 14.433 3.661   1.00 82.09  ? 369 ARG B HH22 1 
ATOM   5211 N  N    . PHE B 1 155 ? 46.198 21.413 5.841   1.00 31.49  ? 370 PHE B N    1 
ATOM   5212 C  CA   . PHE B 1 155 ? 45.373 22.377 5.125   1.00 33.34  ? 370 PHE B CA   1 
ATOM   5213 C  C    . PHE B 1 155 ? 45.063 21.875 3.723   1.00 33.86  ? 370 PHE B C    1 
ATOM   5214 O  O    . PHE B 1 155 ? 45.908 21.201 3.092   1.00 31.43  ? 370 PHE B O    1 
ATOM   5215 C  CB   . PHE B 1 155 ? 46.073 23.742 5.076   1.00 28.84  ? 370 PHE B CB   1 
ATOM   5216 C  CG   . PHE B 1 155 ? 46.247 24.345 6.431   1.00 43.52  ? 370 PHE B CG   1 
ATOM   5217 C  CD1  . PHE B 1 155 ? 45.157 24.937 7.069   1.00 33.87  ? 370 PHE B CD1  1 
ATOM   5218 C  CD2  . PHE B 1 155 ? 47.460 24.256 7.108   1.00 29.43  ? 370 PHE B CD2  1 
ATOM   5219 C  CE1  . PHE B 1 155 ? 45.296 25.491 8.350   1.00 36.05  ? 370 PHE B CE1  1 
ATOM   5220 C  CE2  . PHE B 1 155 ? 47.591 24.803 8.391   1.00 30.08  ? 370 PHE B CE2  1 
ATOM   5221 C  CZ   . PHE B 1 155 ? 46.510 25.419 9.004   1.00 30.90  ? 370 PHE B CZ   1 
ATOM   5222 H  H    . PHE B 1 155 ? 47.035 21.460 5.651   1.00 37.79  ? 370 PHE B H    1 
ATOM   5223 H  HA   . PHE B 1 155 ? 44.533 22.487 5.597   1.00 40.00  ? 370 PHE B HA   1 
ATOM   5224 H  HB2  . PHE B 1 155 ? 46.952 23.633 4.680   1.00 34.61  ? 370 PHE B HB2  1 
ATOM   5225 H  HB3  . PHE B 1 155 ? 45.541 24.352 4.541   1.00 34.61  ? 370 PHE B HB3  1 
ATOM   5226 H  HD1  . PHE B 1 155 ? 44.340 24.993 6.628   1.00 40.64  ? 370 PHE B HD1  1 
ATOM   5227 H  HD2  . PHE B 1 155 ? 48.191 23.851 6.700   1.00 35.32  ? 370 PHE B HD2  1 
ATOM   5228 H  HE1  . PHE B 1 155 ? 44.568 25.898 8.762   1.00 43.26  ? 370 PHE B HE1  1 
ATOM   5229 H  HE2  . PHE B 1 155 ? 48.409 24.758 8.832   1.00 36.10  ? 370 PHE B HE2  1 
ATOM   5230 H  HZ   . PHE B 1 155 ? 46.602 25.780 9.856   1.00 37.07  ? 370 PHE B HZ   1 
ATOM   5231 N  N    . VAL B 1 156 ? 43.867 22.190 3.233   1.00 26.30  ? 371 VAL B N    1 
ATOM   5232 C  CA   . VAL B 1 156 ? 43.509 21.775 1.885   1.00 33.19  ? 371 VAL B CA   1 
ATOM   5233 C  C    . VAL B 1 156 ? 43.114 22.999 1.118   1.00 23.82  ? 371 VAL B C    1 
ATOM   5234 O  O    . VAL B 1 156 ? 42.651 23.960 1.691   1.00 27.22  ? 371 VAL B O    1 
ATOM   5235 C  CB   . VAL B 1 156 ? 42.408 20.745 1.875   1.00 30.39  ? 371 VAL B CB   1 
ATOM   5236 C  CG1  . VAL B 1 156 ? 42.798 19.600 2.780   1.00 38.25  ? 371 VAL B CG1  1 
ATOM   5237 C  CG2  . VAL B 1 156 ? 41.121 21.366 2.341   1.00 38.38  ? 371 VAL B CG2  1 
ATOM   5238 H  H    . VAL B 1 156 ? 43.260 22.633 3.651   1.00 31.55  ? 371 VAL B H    1 
ATOM   5239 H  HA   . VAL B 1 156 ? 44.287 21.387 1.455   1.00 39.83  ? 371 VAL B HA   1 
ATOM   5240 H  HB   . VAL B 1 156 ? 42.284 20.405 0.976   1.00 36.47  ? 371 VAL B HB   1 
ATOM   5241 H  HG11 . VAL B 1 156 ? 42.089 18.938 2.774   1.00 45.90  ? 371 VAL B HG11 1 
ATOM   5242 H  HG12 . VAL B 1 156 ? 43.622 19.207 2.453   1.00 45.90  ? 371 VAL B HG12 1 
ATOM   5243 H  HG13 . VAL B 1 156 ? 42.927 19.939 3.680   1.00 45.90  ? 371 VAL B HG13 1 
ATOM   5244 H  HG21 . VAL B 1 156 ? 40.424 20.692 2.329   1.00 46.06  ? 371 VAL B HG21 1 
ATOM   5245 H  HG22 . VAL B 1 156 ? 41.242 21.703 3.243   1.00 46.06  ? 371 VAL B HG22 1 
ATOM   5246 H  HG23 . VAL B 1 156 ? 40.889 22.095 1.744   1.00 46.06  ? 371 VAL B HG23 1 
ATOM   5247 N  N    . TYR B 1 157 ? 43.376 22.959 -0.170  1.00 24.27  ? 372 TYR B N    1 
ATOM   5248 C  CA   . TYR B 1 157 ? 43.114 24.048 -1.085  1.00 23.24  ? 372 TYR B CA   1 
ATOM   5249 C  C    . TYR B 1 157 ? 42.289 23.469 -2.203  1.00 23.44  ? 372 TYR B C    1 
ATOM   5250 O  O    . TYR B 1 157 ? 42.774 22.624 -2.974  1.00 25.07  ? 372 TYR B O    1 
ATOM   5251 C  CB   . TYR B 1 157 ? 44.424 24.621 -1.641  1.00 22.62  ? 372 TYR B CB   1 
ATOM   5252 C  CG   . TYR B 1 157 ? 45.337 25.162 -0.588  1.00 24.80  ? 372 TYR B CG   1 
ATOM   5253 C  CD1  . TYR B 1 157 ? 45.298 26.493 -0.239  1.00 24.23  ? 372 TYR B CD1  1 
ATOM   5254 C  CD2  . TYR B 1 157 ? 46.232 24.317 0.077   1.00 23.28  ? 372 TYR B CD2  1 
ATOM   5255 C  CE1  . TYR B 1 157 ? 46.147 26.993 0.756   1.00 25.99  ? 372 TYR B CE1  1 
ATOM   5256 C  CE2  . TYR B 1 157 ? 47.079 24.782 1.025   1.00 23.78  ? 372 TYR B CE2  1 
ATOM   5257 C  CZ   . TYR B 1 157 ? 47.053 26.112 1.380   1.00 25.93  ? 372 TYR B CZ   1 
ATOM   5258 O  OH   . TYR B 1 157 ? 47.902 26.523 2.391   1.00 28.13  ? 372 TYR B OH   1 
ATOM   5259 H  H    . TYR B 1 157 ? 43.725 22.275 -0.558  1.00 29.13  ? 372 TYR B H    1 
ATOM   5260 H  HA   . TYR B 1 157 ? 42.614 24.752 -0.642  1.00 27.89  ? 372 TYR B HA   1 
ATOM   5261 H  HB2  . TYR B 1 157 ? 44.898 23.917 -2.111  1.00 27.15  ? 372 TYR B HB2  1 
ATOM   5262 H  HB3  . TYR B 1 157 ? 44.215 25.344 -2.253  1.00 27.15  ? 372 TYR B HB3  1 
ATOM   5263 H  HD1  . TYR B 1 157 ? 44.702 27.065 -0.666  1.00 29.07  ? 372 TYR B HD1  1 
ATOM   5264 H  HD2  . TYR B 1 157 ? 46.267 23.419 -0.160  1.00 27.93  ? 372 TYR B HD2  1 
ATOM   5265 H  HE1  . TYR B 1 157 ? 46.123 27.892 0.991   1.00 31.19  ? 372 TYR B HE1  1 
ATOM   5266 H  HE2  . TYR B 1 157 ? 47.662 24.198 1.454   1.00 28.54  ? 372 TYR B HE2  1 
ATOM   5267 H  HH   . TYR B 1 157 ? 48.373 25.878 2.651   1.00 33.75  ? 372 TYR B HH   1 
ATOM   5268 N  N    . ARG B 1 158 ? 41.060 23.917 -2.304  1.00 26.61  ? 373 ARG B N    1 
ATOM   5269 C  CA   . ARG B 1 158 ? 40.118 23.334 -3.257  1.00 39.97  ? 373 ARG B CA   1 
ATOM   5270 C  C    . ARG B 1 158 ? 39.691 24.343 -4.258  1.00 32.40  ? 373 ARG B C    1 
ATOM   5271 O  O    . ARG B 1 158 ? 39.129 25.370 -3.902  1.00 25.92  ? 373 ARG B O    1 
ATOM   5272 C  CB   . ARG B 1 158 ? 38.890 22.792 -2.551  1.00 39.12  ? 373 ARG B CB   1 
ATOM   5273 C  CG   . ARG B 1 158 ? 39.246 21.600 -1.696  1.00 51.95  ? 373 ARG B CG   1 
ATOM   5274 C  CD   . ARG B 1 158 ? 38.507 21.693 -0.400  1.00 64.96  ? 373 ARG B CD   1 
ATOM   5275 N  NE   . ARG B 1 158 ? 37.108 21.391 -0.629  1.00 65.30  ? 373 ARG B NE   1 
ATOM   5276 C  CZ   . ARG B 1 158 ? 36.664 20.157 -0.832  1.00 65.53  ? 373 ARG B CZ   1 
ATOM   5277 N  NH1  . ARG B 1 158 ? 37.521 19.130 -0.794  1.00 44.85  ? 373 ARG B NH1  1 
ATOM   5278 N  NH2  . ARG B 1 158 ? 35.358 19.952 -1.062  1.00 59.66  ? 373 ARG B NH2  1 
ATOM   5279 H  H    . ARG B 1 158 ? 40.736 24.560 -1.835  1.00 31.93  ? 373 ARG B H    1 
ATOM   5280 H  HA   . ARG B 1 158 ? 40.548 22.602 -3.727  1.00 47.97  ? 373 ARG B HA   1 
ATOM   5281 H  HB2  . ARG B 1 158 ? 38.518 23.480 -1.977  1.00 46.94  ? 373 ARG B HB2  1 
ATOM   5282 H  HB3  . ARG B 1 158 ? 38.236 22.511 -3.210  1.00 46.94  ? 373 ARG B HB3  1 
ATOM   5283 H  HG2  . ARG B 1 158 ? 38.983 20.783 -2.147  1.00 62.34  ? 373 ARG B HG2  1 
ATOM   5284 H  HG3  . ARG B 1 158 ? 40.198 21.601 -1.513  1.00 62.34  ? 373 ARG B HG3  1 
ATOM   5285 H  HD2  . ARG B 1 158 ? 38.867 21.048 0.229   1.00 77.95  ? 373 ARG B HD2  1 
ATOM   5286 H  HD3  . ARG B 1 158 ? 38.578 22.594 -0.047  1.00 77.95  ? 373 ARG B HD3  1 
ATOM   5287 H  HE   . ARG B 1 158 ? 36.530 22.002 -0.451  1.00 78.36  ? 373 ARG B HE   1 
ATOM   5288 H  HH11 . ARG B 1 158 ? 38.357 19.272 -0.652  1.00 53.82  ? 373 ARG B HH11 1 
ATOM   5289 H  HH12 . ARG B 1 158 ? 37.236 18.328 -0.920  1.00 53.82  ? 373 ARG B HH12 1 
ATOM   5290 H  HH21 . ARG B 1 158 ? 34.814 20.618 -1.077  1.00 71.60  ? 373 ARG B HH21 1 
ATOM   5291 H  HH22 . ARG B 1 158 ? 35.063 19.153 -1.181  1.00 71.60  ? 373 ARG B HH22 1 
ATOM   5292 N  N    . LEU B 1 159 ? 39.949 24.013 -5.512  1.00 28.57  ? 374 LEU B N    1 
ATOM   5293 C  CA   . LEU B 1 159 ? 39.472 24.771 -6.642  1.00 29.37  ? 374 LEU B CA   1 
ATOM   5294 C  C    . LEU B 1 159 ? 38.592 23.851 -7.459  1.00 26.78  ? 374 LEU B C    1 
ATOM   5295 O  O    . LEU B 1 159 ? 39.009 23.334 -8.472  1.00 26.68  ? 374 LEU B O    1 
ATOM   5296 C  CB   . LEU B 1 159 ? 40.627 25.285 -7.461  1.00 26.65  ? 374 LEU B CB   1 
ATOM   5297 C  CG   . LEU B 1 159 ? 41.636 26.111 -6.657  1.00 44.54  ? 374 LEU B CG   1 
ATOM   5298 C  CD1  . LEU B 1 159 ? 42.689 25.241 -5.878  1.00 34.66  ? 374 LEU B CD1  1 
ATOM   5299 C  CD2  . LEU B 1 159 ? 42.336 27.091 -7.571  1.00 35.84  ? 374 LEU B CD2  1 
ATOM   5300 H  H    . LEU B 1 159 ? 40.417 23.327 -5.736  1.00 34.28  ? 374 LEU B H    1 
ATOM   5301 H  HA   . LEU B 1 159 ? 38.943 25.524 -6.336  1.00 35.25  ? 374 LEU B HA   1 
ATOM   5302 H  HB2  . LEU B 1 159 ? 41.100 24.530 -7.844  1.00 31.97  ? 374 LEU B HB2  1 
ATOM   5303 H  HB3  . LEU B 1 159 ? 40.280 25.849 -8.170  1.00 31.97  ? 374 LEU B HB3  1 
ATOM   5304 H  HG   . LEU B 1 159 ? 41.148 26.630 -5.998  1.00 53.44  ? 374 LEU B HG   1 
ATOM   5305 H  HD11 . LEU B 1 159 ? 43.290 25.830 -5.395  1.00 41.60  ? 374 LEU B HD11 1 
ATOM   5306 H  HD12 . LEU B 1 159 ? 42.221 24.663 -5.255  1.00 41.60  ? 374 LEU B HD12 1 
ATOM   5307 H  HD13 . LEU B 1 159 ? 43.189 24.706 -6.514  1.00 41.60  ? 374 LEU B HD13 1 
ATOM   5308 H  HD21 . LEU B 1 159 ? 42.972 27.608 -7.052  1.00 43.00  ? 374 LEU B HD21 1 
ATOM   5309 H  HD22 . LEU B 1 159 ? 42.800 26.598 -8.266  1.00 43.00  ? 374 LEU B HD22 1 
ATOM   5310 H  HD23 . LEU B 1 159 ? 41.675 27.681 -7.967  1.00 43.00  ? 374 LEU B HD23 1 
ATOM   5311 N  N    . LEU B 1 160 ? 37.376 23.610 -6.990  1.00 23.30  ? 375 LEU B N    1 
ATOM   5312 C  CA   . LEU B 1 160 ? 36.566 22.585 -7.601  1.00 25.62  ? 375 LEU B CA   1 
ATOM   5313 C  C    . LEU B 1 160 ? 35.574 23.143 -8.622  1.00 23.54  ? 375 LEU B C    1 
ATOM   5314 O  O    . LEU B 1 160 ? 34.988 24.179 -8.390  1.00 27.45  ? 375 LEU B O    1 
ATOM   5315 C  CB   . LEU B 1 160 ? 35.813 21.829 -6.519  1.00 25.50  ? 375 LEU B CB   1 
ATOM   5316 C  CG   . LEU B 1 160 ? 36.680 21.151 -5.462  1.00 26.36  ? 375 LEU B CG   1 
ATOM   5317 C  CD1  . LEU B 1 160 ? 35.785 20.574 -4.412  1.00 31.18  ? 375 LEU B CD1  1 
ATOM   5318 C  CD2  . LEU B 1 160 ? 37.538 20.072 -6.042  1.00 26.94  ? 375 LEU B CD2  1 
ATOM   5319 H  H    . LEU B 1 160 ? 37.008 24.021 -6.331  1.00 27.96  ? 375 LEU B H    1 
ATOM   5320 H  HA   . LEU B 1 160 ? 37.145 21.956 -8.059  1.00 30.74  ? 375 LEU B HA   1 
ATOM   5321 H  HB2  . LEU B 1 160 ? 35.230 22.453 -6.059  1.00 30.59  ? 375 LEU B HB2  1 
ATOM   5322 H  HB3  . LEU B 1 160 ? 35.279 21.139 -6.942  1.00 30.59  ? 375 LEU B HB3  1 
ATOM   5323 H  HG   . LEU B 1 160 ? 37.257 21.811 -5.045  1.00 31.63  ? 375 LEU B HG   1 
ATOM   5324 H  HD11 . LEU B 1 160 ? 36.330 20.141 -3.737  1.00 37.42  ? 375 LEU B HD11 1 
ATOM   5325 H  HD12 . LEU B 1 160 ? 35.267 21.289 -4.011  1.00 37.42  ? 375 LEU B HD12 1 
ATOM   5326 H  HD13 . LEU B 1 160 ? 35.192 19.927 -4.825  1.00 37.42  ? 375 LEU B HD13 1 
ATOM   5327 H  HD21 . LEU B 1 160 ? 38.067 19.675 -5.333  1.00 32.33  ? 375 LEU B HD21 1 
ATOM   5328 H  HD22 . LEU B 1 160 ? 36.968 19.400 -6.447  1.00 32.33  ? 375 LEU B HD22 1 
ATOM   5329 H  HD23 . LEU B 1 160 ? 38.121 20.460 -6.713  1.00 32.33  ? 375 LEU B HD23 1 
ATOM   5330 N  N    . ARG B 1 161 ? 35.331 22.403 -9.707  1.00 25.60  ? 376 ARG B N    1 
ATOM   5331 C  CA   . ARG B 1 161 ? 34.283 22.752 -10.683 1.00 25.64  ? 376 ARG B CA   1 
ATOM   5332 C  C    . ARG B 1 161 ? 34.428 24.167 -11.283 1.00 22.30  ? 376 ARG B C    1 
ATOM   5333 O  O    . ARG B 1 161 ? 33.437 24.863 -11.450 1.00 23.74  ? 376 ARG B O    1 
ATOM   5334 C  CB   . ARG B 1 161 ? 32.890 22.613 -10.036 1.00 24.62  ? 376 ARG B CB   1 
ATOM   5335 C  CG   . ARG B 1 161 ? 32.604 21.205 -9.534  1.00 27.79  ? 376 ARG B CG   1 
ATOM   5336 C  CD   . ARG B 1 161 ? 31.136 21.050 -9.039  1.00 29.37  ? 376 ARG B CD   1 
ATOM   5337 N  NE   . ARG B 1 161 ? 30.183 21.265 -10.145 1.00 29.65  ? 376 ARG B NE   1 
ATOM   5338 C  CZ   . ARG B 1 161 ? 29.796 20.331 -11.009 1.00 32.15  ? 376 ARG B CZ   1 
ATOM   5339 N  NH1  . ARG B 1 161 ? 30.272 19.096 -10.928 1.00 29.94  ? 376 ARG B NH1  1 
ATOM   5340 N  NH2  . ARG B 1 161 ? 28.929 20.651 -11.956 1.00 30.42  ? 376 ARG B NH2  1 
ATOM   5341 H  H    . ARG B 1 161 ? 35.762 21.685 -9.906  1.00 30.72  ? 376 ARG B H    1 
ATOM   5342 H  HA   . ARG B 1 161 ? 34.327 22.120 -11.418 1.00 30.77  ? 376 ARG B HA   1 
ATOM   5343 H  HB2  . ARG B 1 161 ? 32.832 23.218 -9.280  1.00 29.54  ? 376 ARG B HB2  1 
ATOM   5344 H  HB3  . ARG B 1 161 ? 32.213 22.839 -10.693 1.00 29.54  ? 376 ARG B HB3  1 
ATOM   5345 H  HG2  . ARG B 1 161 ? 32.748 20.574 -10.257 1.00 33.34  ? 376 ARG B HG2  1 
ATOM   5346 H  HG3  . ARG B 1 161 ? 33.197 21.005 -8.792  1.00 33.34  ? 376 ARG B HG3  1 
ATOM   5347 H  HD2  . ARG B 1 161 ? 31.006 20.153 -8.692  1.00 35.25  ? 376 ARG B HD2  1 
ATOM   5348 H  HD3  . ARG B 1 161 ? 30.957 21.708 -8.349  1.00 35.25  ? 376 ARG B HD3  1 
ATOM   5349 H  HE   . ARG B 1 161 ? 29.853 22.054 -10.238 1.00 35.58  ? 376 ARG B HE   1 
ATOM   5350 H  HH11 . ARG B 1 161 ? 30.834 18.892 -10.311 1.00 35.93  ? 376 ARG B HH11 1 
ATOM   5351 H  HH12 . ARG B 1 161 ? 30.016 18.500 -11.492 1.00 35.93  ? 376 ARG B HH12 1 
ATOM   5352 H  HH21 . ARG B 1 161 ? 28.624 21.454 -12.006 1.00 36.50  ? 376 ARG B HH21 1 
ATOM   5353 H  HH22 . ARG B 1 161 ? 28.673 20.058 -12.523 1.00 36.50  ? 376 ARG B HH22 1 
ATOM   5354 N  N    . SER B 1 162 ? 35.644 24.575 -11.608 1.00 22.95  ? 377 SER B N    1 
ATOM   5355 C  CA   . SER B 1 162 ? 35.868 25.788 -12.390 1.00 26.64  ? 377 SER B CA   1 
ATOM   5356 C  C    . SER B 1 162 ? 35.398 25.562 -13.796 1.00 23.91  ? 377 SER B C    1 
ATOM   5357 O  O    . SER B 1 162 ? 35.781 24.554 -14.417 1.00 25.58  ? 377 SER B O    1 
ATOM   5358 C  CB   . SER B 1 162 ? 37.346 26.174 -12.482 1.00 32.63  ? 377 SER B CB   1 
ATOM   5359 O  OG   . SER B 1 162 ? 37.915 26.471 -11.226 1.00 54.21  ? 377 SER B OG   1 
ATOM   5360 H  H    . SER B 1 162 ? 36.366 24.165 -11.386 1.00 27.54  ? 377 SER B H    1 
ATOM   5361 H  HA   . SER B 1 162 ? 35.372 26.527 -12.005 1.00 31.97  ? 377 SER B HA   1 
ATOM   5362 H  HB2  . SER B 1 162 ? 37.835 25.435 -12.876 1.00 39.15  ? 377 SER B HB2  1 
ATOM   5363 H  HB3  . SER B 1 162 ? 37.426 26.957 -13.050 1.00 39.15  ? 377 SER B HB3  1 
ATOM   5364 H  HG   . SER B 1 162 ? 38.724 26.677 -11.319 1.00 65.05  ? 377 SER B HG   1 
ATOM   5365 N  N    . PRO B 1 163 ? 34.623 26.501 -14.341 1.00 24.84  ? 378 PRO B N    1 
ATOM   5366 C  CA   . PRO B 1 163 ? 34.208 26.314 -15.731 1.00 23.92  ? 378 PRO B CA   1 
ATOM   5367 C  C    . PRO B 1 163 ? 35.421 26.309 -16.672 1.00 24.01  ? 378 PRO B C    1 
ATOM   5368 O  O    . PRO B 1 163 ? 36.340 27.120 -16.540 1.00 26.81  ? 378 PRO B O    1 
ATOM   5369 C  CB   . PRO B 1 163 ? 33.292 27.497 -15.971 1.00 35.58  ? 378 PRO B CB   1 
ATOM   5370 C  CG   . PRO B 1 163 ? 32.788 27.831 -14.590 1.00 34.84  ? 378 PRO B CG   1 
ATOM   5371 C  CD   . PRO B 1 163 ? 33.953 27.650 -13.714 1.00 25.51  ? 378 PRO B CD   1 
ATOM   5372 H  HA   . PRO B 1 163 ? 33.709 25.488 -15.832 1.00 28.70  ? 378 PRO B HA   1 
ATOM   5373 H  HB2  . PRO B 1 163 ? 33.796 28.236 -16.346 1.00 42.69  ? 378 PRO B HB2  1 
ATOM   5374 H  HB3  . PRO B 1 163 ? 32.562 27.239 -16.556 1.00 42.69  ? 378 PRO B HB3  1 
ATOM   5375 H  HG2  . PRO B 1 163 ? 32.479 28.750 -14.566 1.00 41.80  ? 378 PRO B HG2  1 
ATOM   5376 H  HG3  . PRO B 1 163 ? 32.075 27.221 -14.345 1.00 41.80  ? 378 PRO B HG3  1 
ATOM   5377 H  HD2  . PRO B 1 163 ? 34.524 28.433 -13.736 1.00 30.61  ? 378 PRO B HD2  1 
ATOM   5378 H  HD3  . PRO B 1 163 ? 33.673 27.432 -12.811 1.00 30.61  ? 378 PRO B HD3  1 
ATOM   5379 N  N    . MET B 1 164 ? 35.469 25.329 -17.545 1.00 25.17  ? 379 MET B N    1 
ATOM   5380 C  CA   . MET B 1 164 ? 36.502 25.271 -18.561 1.00 24.68  ? 379 MET B CA   1 
ATOM   5381 C  C    . MET B 1 164 ? 36.346 26.482 -19.467 1.00 26.37  ? 379 MET B C    1 
ATOM   5382 O  O    . MET B 1 164 ? 35.240 26.782 -19.967 1.00 27.23  ? 379 MET B O    1 
ATOM   5383 C  CB   . MET B 1 164 ? 36.399 23.971 -19.357 1.00 25.80  ? 379 MET B CB   1 
ATOM   5384 C  CG   . MET B 1 164 ? 37.609 23.582 -20.068 1.00 33.49  ? 379 MET B CG   1 
ATOM   5385 S  SD   . MET B 1 164 ? 37.391 21.997 -20.928 1.00 26.36  ? 379 MET B SD   1 
ATOM   5386 C  CE   . MET B 1 164 ? 37.590 20.764 -19.639 1.00 22.98  ? 379 MET B CE   1 
ATOM   5387 H  H    . MET B 1 164 ? 34.911 24.675 -17.574 1.00 30.21  ? 379 MET B H    1 
ATOM   5388 H  HA   . MET B 1 164 ? 37.373 25.300 -18.135 1.00 29.62  ? 379 MET B HA   1 
ATOM   5389 H  HB2  . MET B 1 164 ? 36.177 23.252 -18.745 1.00 30.95  ? 379 MET B HB2  1 
ATOM   5390 H  HB3  . MET B 1 164 ? 35.693 24.067 -20.015 1.00 30.95  ? 379 MET B HB3  1 
ATOM   5391 H  HG2  . MET B 1 164 ? 37.825 24.259 -20.728 1.00 40.19  ? 379 MET B HG2  1 
ATOM   5392 H  HG3  . MET B 1 164 ? 38.337 23.486 -19.434 1.00 40.19  ? 379 MET B HG3  1 
ATOM   5393 H  HE1  . MET B 1 164 ? 37.486 19.881 -20.028 1.00 27.58  ? 379 MET B HE1  1 
ATOM   5394 H  HE2  . MET B 1 164 ? 38.475 20.852 -19.252 1.00 27.58  ? 379 MET B HE2  1 
ATOM   5395 H  HE3  . MET B 1 164 ? 36.915 20.908 -18.958 1.00 27.58  ? 379 MET B HE3  1 
ATOM   5396 N  N    . CYS B 1 165 ? 37.449 27.193 -19.622 1.00 27.33  ? 380 CYS B N    1 
ATOM   5397 C  CA   . CYS B 1 165 ? 37.558 28.233 -20.630 1.00 29.39  ? 380 CYS B CA   1 
ATOM   5398 C  C    . CYS B 1 165 ? 36.936 27.782 -21.961 1.00 30.11  ? 380 CYS B C    1 
ATOM   5399 O  O    . CYS B 1 165 ? 37.156 26.662 -22.450 1.00 28.38  ? 380 CYS B O    1 
ATOM   5400 C  CB   . CYS B 1 165 ? 39.032 28.611 -20.807 1.00 37.93  ? 380 CYS B CB   1 
ATOM   5401 S  SG   . CYS B 1 165 ? 39.325 29.685 -22.142 1.00 43.52  ? 380 CYS B SG   1 
ATOM   5402 H  H    . CYS B 1 165 ? 38.160 27.091 -19.150 1.00 32.79  ? 380 CYS B H    1 
ATOM   5403 H  HA   . CYS B 1 165 ? 37.080 29.021 -20.326 1.00 35.27  ? 380 CYS B HA   1 
ATOM   5404 H  HB2  . CYS B 1 165 ? 39.341 29.050 -19.999 1.00 45.52  ? 380 CYS B HB2  1 
ATOM   5405 H  HB3  . CYS B 1 165 ? 39.545 27.802 -20.958 1.00 45.52  ? 380 CYS B HB3  1 
ATOM   5406 H  HG   . CYS B 1 165 ? 40.500 29.922 -22.202 1.00 52.22  ? 380 CYS B HG   1 
ATOM   5407 N  N    . GLU B 1 166 ? 36.147 28.667 -22.556 1.00 33.72  ? 381 GLU B N    1 
ATOM   5408 C  CA   . GLU B 1 166 ? 35.344 28.316 -23.712 1.00 35.50  ? 381 GLU B CA   1 
ATOM   5409 C  C    . GLU B 1 166 ? 36.244 28.034 -24.947 1.00 35.39  ? 381 GLU B C    1 
ATOM   5410 O  O    . GLU B 1 166 ? 35.853 27.286 -25.854 1.00 35.47  ? 381 GLU B O    1 
ATOM   5411 C  CB   . GLU B 1 166 ? 34.334 29.428 -23.985 1.00 36.88  ? 381 GLU B CB   1 
ATOM   5412 C  CG   . GLU B 1 166 ? 33.448 29.214 -25.205 1.00 63.84  ? 381 GLU B CG   1 
ATOM   5413 C  CD   . GLU B 1 166 ? 33.054 30.521 -25.878 1.00 77.03  ? 381 GLU B CD   1 
ATOM   5414 O  OE1  . GLU B 1 166 ? 33.707 30.888 -26.886 1.00 71.64  ? 381 GLU B OE1  1 
ATOM   5415 O  OE2  . GLU B 1 166 ? 32.096 31.180 -25.407 1.00 75.21  ? 381 GLU B OE2  1 
ATOM   5416 H  H    . GLU B 1 166 ? 36.060 29.485 -22.304 1.00 40.46  ? 381 GLU B H    1 
ATOM   5417 H  HA   . GLU B 1 166 ? 34.848 27.506 -23.515 1.00 42.61  ? 381 GLU B HA   1 
ATOM   5418 H  HB2  . GLU B 1 166 ? 33.753 29.513 -23.213 1.00 44.26  ? 381 GLU B HB2  1 
ATOM   5419 H  HB3  . GLU B 1 166 ? 34.819 30.258 -24.119 1.00 44.26  ? 381 GLU B HB3  1 
ATOM   5420 H  HG2  . GLU B 1 166 ? 33.927 28.674 -25.853 1.00 76.61  ? 381 GLU B HG2  1 
ATOM   5421 H  HG3  . GLU B 1 166 ? 32.635 28.760 -24.930 1.00 76.61  ? 381 GLU B HG3  1 
ATOM   5422 N  N    . TYR B 1 167 ? 37.453 28.606 -24.942 1.00 24.04  ? 382 TYR B N    1 
ATOM   5423 C  CA   . TYR B 1 167 ? 38.468 28.316 -25.960 1.00 24.83  ? 382 TYR B CA   1 
ATOM   5424 C  C    . TYR B 1 167 ? 38.814 26.833 -25.944 1.00 24.42  ? 382 TYR B C    1 
ATOM   5425 O  O    . TYR B 1 167 ? 39.094 26.226 -26.978 1.00 27.50  ? 382 TYR B O    1 
ATOM   5426 C  CB   . TYR B 1 167 ? 39.778 29.132 -25.749 1.00 29.31  ? 382 TYR B CB   1 
ATOM   5427 C  CG   . TYR B 1 167 ? 40.983 28.483 -26.488 1.00 55.75  ? 382 TYR B CG   1 
ATOM   5428 C  CD1  . TYR B 1 167 ? 41.318 28.853 -27.803 1.00 73.12  ? 382 TYR B CD1  1 
ATOM   5429 C  CD2  . TYR B 1 167 ? 41.745 27.436 -25.900 1.00 53.07  ? 382 TYR B CD2  1 
ATOM   5430 C  CE1  . TYR B 1 167 ? 42.381 28.221 -28.500 1.00 55.58  ? 382 TYR B CE1  1 
ATOM   5431 C  CE2  . TYR B 1 167 ? 42.802 26.800 -26.609 1.00 35.97  ? 382 TYR B CE2  1 
ATOM   5432 C  CZ   . TYR B 1 167 ? 43.097 27.208 -27.893 1.00 47.19  ? 382 TYR B CZ   1 
ATOM   5433 O  OH   . TYR B 1 167 ? 44.116 26.618 -28.585 1.00 67.76  ? 382 TYR B OH   1 
ATOM   5434 H  H    . TYR B 1 167 ? 37.712 29.173 -24.350 1.00 28.85  ? 382 TYR B H    1 
ATOM   5435 H  HA   . TYR B 1 167 ? 38.113 28.536 -26.835 1.00 29.80  ? 382 TYR B HA   1 
ATOM   5436 H  HB2  . TYR B 1 167 ? 39.655 30.029 -26.097 1.00 35.18  ? 382 TYR B HB2  1 
ATOM   5437 H  HB3  . TYR B 1 167 ? 39.985 29.165 -24.802 1.00 35.18  ? 382 TYR B HB3  1 
ATOM   5438 H  HD1  . TYR B 1 167 ? 40.832 29.524 -28.226 1.00 87.74  ? 382 TYR B HD1  1 
ATOM   5439 H  HD2  . TYR B 1 167 ? 41.537 27.150 -25.040 1.00 63.69  ? 382 TYR B HD2  1 
ATOM   5440 H  HE1  . TYR B 1 167 ? 42.592 28.484 -29.367 1.00 66.70  ? 382 TYR B HE1  1 
ATOM   5441 H  HE2  . TYR B 1 167 ? 43.297 26.123 -26.207 1.00 43.17  ? 382 TYR B HE2  1 
ATOM   5442 H  HH   . TYR B 1 167 ? 44.474 26.021 -28.115 1.00 81.31  ? 382 TYR B HH   1 
ATOM   5443 N  N    . LEU B 1 168 ? 38.861 26.268 -24.748 1.00 23.69  ? 383 LEU B N    1 
ATOM   5444 C  CA   . LEU B 1 168 ? 39.321 24.930 -24.600 1.00 22.98  ? 383 LEU B CA   1 
ATOM   5445 C  C    . LEU B 1 168 ? 38.160 24.018 -24.997 1.00 21.86  ? 383 LEU B C    1 
ATOM   5446 O  O    . LEU B 1 168 ? 38.346 23.057 -25.701 1.00 24.96  ? 383 LEU B O    1 
ATOM   5447 C  CB   . LEU B 1 168 ? 39.822 24.685 -23.166 1.00 24.35  ? 383 LEU B CB   1 
ATOM   5448 C  CG   . LEU B 1 168 ? 41.358 24.634 -23.082 1.00 43.01  ? 383 LEU B CG   1 
ATOM   5449 C  CD1  . LEU B 1 168 ? 41.892 24.800 -21.684 1.00 48.69  ? 383 LEU B CD1  1 
ATOM   5450 C  CD2  . LEU B 1 168 ? 41.812 23.299 -23.646 1.00 47.90  ? 383 LEU B CD2  1 
ATOM   5451 H  H    . LEU B 1 168 ? 38.629 26.651 -24.014 1.00 28.42  ? 383 LEU B H    1 
ATOM   5452 H  HA   . LEU B 1 168 ? 40.057 24.772 -25.212 1.00 27.58  ? 383 LEU B HA   1 
ATOM   5453 H  HB2  . LEU B 1 168 ? 39.513 25.405 -22.594 1.00 29.22  ? 383 LEU B HB2  1 
ATOM   5454 H  HB3  . LEU B 1 168 ? 39.475 23.836 -22.849 1.00 29.22  ? 383 LEU B HB3  1 
ATOM   5455 H  HG   . LEU B 1 168 ? 41.731 25.339 -23.634 1.00 51.61  ? 383 LEU B HG   1 
ATOM   5456 H  HD11 . LEU B 1 168 ? 42.860 24.757 -21.710 1.00 58.43  ? 383 LEU B HD11 1 
ATOM   5457 H  HD12 . LEU B 1 168 ? 41.607 25.660 -21.338 1.00 58.43  ? 383 LEU B HD12 1 
ATOM   5458 H  HD13 . LEU B 1 168 ? 41.543 24.086 -21.127 1.00 58.43  ? 383 LEU B HD13 1 
ATOM   5459 H  HD21 . LEU B 1 168 ? 42.779 23.250 -23.601 1.00 57.48  ? 383 LEU B HD21 1 
ATOM   5460 H  HD22 . LEU B 1 168 ? 41.419 22.585 -23.121 1.00 57.48  ? 383 LEU B HD22 1 
ATOM   5461 H  HD23 . LEU B 1 168 ? 41.519 23.231 -24.569 1.00 57.48  ? 383 LEU B HD23 1 
ATOM   5462 N  N    . VAL B 1 169 ? 36.959 24.376 -24.590 1.00 21.86  ? 384 VAL B N    1 
ATOM   5463 C  CA   . VAL B 1 169 ? 35.788 23.621 -24.981 1.00 20.52  ? 384 VAL B CA   1 
ATOM   5464 C  C    . VAL B 1 169 ? 35.700 23.541 -26.499 1.00 22.20  ? 384 VAL B C    1 
ATOM   5465 O  O    . VAL B 1 169 ? 35.504 22.448 -27.043 1.00 22.15  ? 384 VAL B O    1 
ATOM   5466 C  CB   . VAL B 1 169 ? 34.526 24.209 -24.388 1.00 20.32  ? 384 VAL B CB   1 
ATOM   5467 C  CG1  . VAL B 1 169 ? 33.304 23.409 -24.817 1.00 21.80  ? 384 VAL B CG1  1 
ATOM   5468 C  CG2  . VAL B 1 169 ? 34.665 24.221 -22.842 1.00 18.14  ? 384 VAL B CG2  1 
ATOM   5469 H  H    . VAL B 1 169 ? 36.793 25.054 -24.087 1.00 26.23  ? 384 VAL B H    1 
ATOM   5470 H  HA   . VAL B 1 169 ? 35.876 22.716 -24.643 1.00 24.62  ? 384 VAL B HA   1 
ATOM   5471 H  HB   . VAL B 1 169 ? 34.419 25.123 -24.695 1.00 24.39  ? 384 VAL B HB   1 
ATOM   5472 H  HG11 . VAL B 1 169 ? 32.512 23.808 -24.423 1.00 26.16  ? 384 VAL B HG11 1 
ATOM   5473 H  HG12 . VAL B 1 169 ? 33.238 23.428 -25.784 1.00 26.16  ? 384 VAL B HG12 1 
ATOM   5474 H  HG13 . VAL B 1 169 ? 33.402 22.494 -24.509 1.00 26.16  ? 384 VAL B HG13 1 
ATOM   5475 H  HG21 . VAL B 1 169 ? 33.859 24.597 -22.456 1.00 21.77  ? 384 VAL B HG21 1 
ATOM   5476 H  HG22 . VAL B 1 169 ? 34.789 23.311 -22.529 1.00 21.77  ? 384 VAL B HG22 1 
ATOM   5477 H  HG23 . VAL B 1 169 ? 35.432 24.762 -22.598 1.00 21.77  ? 384 VAL B HG23 1 
ATOM   5478 N  N    . ASN B 1 170 ? 35.895 24.666 -27.173 1.00 29.83  ? 385 ASN B N    1 
ATOM   5479 C  CA   . ASN B 1 170 ? 35.797 24.712 -28.628 1.00 27.28  ? 385 ASN B CA   1 
ATOM   5480 C  C    . ASN B 1 170 ? 36.895 23.880 -29.268 1.00 27.44  ? 385 ASN B C    1 
ATOM   5481 O  O    . ASN B 1 170 ? 36.670 23.195 -30.240 1.00 27.26  ? 385 ASN B O    1 
ATOM   5482 C  CB   . ASN B 1 170 ? 35.856 26.162 -29.153 1.00 31.09  ? 385 ASN B CB   1 
ATOM   5483 C  CG   . ASN B 1 170 ? 34.635 26.974 -28.754 1.00 34.87  ? 385 ASN B CG   1 
ATOM   5484 O  OD1  . ASN B 1 170 ? 33.590 26.410 -28.378 1.00 33.03  ? 385 ASN B OD1  1 
ATOM   5485 N  ND2  . ASN B 1 170 ? 34.759 28.301 -28.811 1.00 39.33  ? 385 ASN B ND2  1 
ATOM   5486 H  H    . ASN B 1 170 ? 36.085 25.423 -26.811 1.00 35.80  ? 385 ASN B H    1 
ATOM   5487 H  HA   . ASN B 1 170 ? 34.945 24.334 -28.896 1.00 32.73  ? 385 ASN B HA   1 
ATOM   5488 H  HB2  . ASN B 1 170 ? 36.641 26.599 -28.788 1.00 37.31  ? 385 ASN B HB2  1 
ATOM   5489 H  HB3  . ASN B 1 170 ? 35.904 26.146 -30.122 1.00 37.31  ? 385 ASN B HB3  1 
ATOM   5490 H  HD21 . ASN B 1 170 ? 34.096 28.804 -28.596 1.00 47.20  ? 385 ASN B HD21 1 
ATOM   5491 H  HD22 . ASN B 1 170 ? 35.502 28.653 -29.064 1.00 47.20  ? 385 ASN B HD22 1 
ATOM   5492 N  N    . PHE B 1 171 ? 38.085 23.937 -28.705 1.00 24.38  ? 386 PHE B N    1 
ATOM   5493 C  CA   . PHE B 1 171 ? 39.186 23.190 -29.240 1.00 22.69  ? 386 PHE B CA   1 
ATOM   5494 C  C    . PHE B 1 171 ? 38.923 21.681 -29.125 1.00 20.47  ? 386 PHE B C    1 
ATOM   5495 O  O    . PHE B 1 171 ? 39.181 20.943 -30.045 1.00 20.60  ? 386 PHE B O    1 
ATOM   5496 C  CB   . PHE B 1 171 ? 40.442 23.620 -28.512 1.00 18.89  ? 386 PHE B CB   1 
ATOM   5497 C  CG   . PHE B 1 171 ? 41.645 22.862 -28.870 1.00 17.77  ? 386 PHE B CG   1 
ATOM   5498 C  CD1  . PHE B 1 171 ? 42.280 23.059 -30.093 1.00 21.66  ? 386 PHE B CD1  1 
ATOM   5499 C  CD2  . PHE B 1 171 ? 42.195 21.974 -27.977 1.00 16.91  ? 386 PHE B CD2  1 
ATOM   5500 C  CE1  . PHE B 1 171 ? 43.426 22.379 -30.383 1.00 25.78  ? 386 PHE B CE1  1 
ATOM   5501 C  CE2  . PHE B 1 171 ? 43.329 21.304 -28.269 1.00 16.77  ? 386 PHE B CE2  1 
ATOM   5502 C  CZ   . PHE B 1 171 ? 43.944 21.508 -29.460 1.00 17.35  ? 386 PHE B CZ   1 
ATOM   5503 H  H    . PHE B 1 171 ? 38.276 24.404 -28.008 1.00 29.26  ? 386 PHE B H    1 
ATOM   5504 H  HA   . PHE B 1 171 ? 39.292 23.407 -30.179 1.00 27.23  ? 386 PHE B HA   1 
ATOM   5505 H  HB2  . PHE B 1 171 ? 40.612 24.554 -28.712 1.00 22.66  ? 386 PHE B HB2  1 
ATOM   5506 H  HB3  . PHE B 1 171 ? 40.299 23.511 -27.558 1.00 22.66  ? 386 PHE B HB3  1 
ATOM   5507 H  HD1  . PHE B 1 171 ? 41.932 23.666 -30.706 1.00 26.00  ? 386 PHE B HD1  1 
ATOM   5508 H  HD2  . PHE B 1 171 ? 41.787 21.844 -27.151 1.00 20.29  ? 386 PHE B HD2  1 
ATOM   5509 H  HE1  . PHE B 1 171 ? 43.852 22.503 -31.201 1.00 30.94  ? 386 PHE B HE1  1 
ATOM   5510 H  HE2  . PHE B 1 171 ? 43.686 20.703 -27.656 1.00 20.12  ? 386 PHE B HE2  1 
ATOM   5511 H  HZ   . PHE B 1 171 ? 44.714 21.028 -29.665 1.00 20.82  ? 386 PHE B HZ   1 
ATOM   5512 N  N    . LEU B 1 172 ? 38.366 21.253 -27.991 1.00 22.17  ? 387 LEU B N    1 
ATOM   5513 C  CA   . LEU B 1 172 ? 38.038 19.855 -27.801 1.00 22.12  ? 387 LEU B CA   1 
ATOM   5514 C  C    . LEU B 1 172 ? 37.031 19.404 -28.838 1.00 20.62  ? 387 LEU B C    1 
ATOM   5515 O  O    . LEU B 1 172 ? 37.120 18.295 -29.348 1.00 22.65  ? 387 LEU B O    1 
ATOM   5516 C  CB   . LEU B 1 172 ? 37.477 19.599 -26.376 1.00 21.28  ? 387 LEU B CB   1 
ATOM   5517 C  CG   . LEU B 1 172 ? 38.552 19.672 -25.278 1.00 23.26  ? 387 LEU B CG   1 
ATOM   5518 C  CD1  . LEU B 1 172 ? 37.922 19.345 -23.954 1.00 27.58  ? 387 LEU B CD1  1 
ATOM   5519 C  CD2  . LEU B 1 172 ? 39.680 18.727 -25.520 1.00 18.55  ? 387 LEU B CD2  1 
ATOM   5520 H  H    . LEU B 1 172 ? 38.171 21.757 -27.322 1.00 26.60  ? 387 LEU B H    1 
ATOM   5521 H  HA   . LEU B 1 172 ? 38.842 19.323 -27.909 1.00 26.54  ? 387 LEU B HA   1 
ATOM   5522 H  HB2  . LEU B 1 172 ? 36.803 20.269 -26.178 1.00 25.54  ? 387 LEU B HB2  1 
ATOM   5523 H  HB3  . LEU B 1 172 ? 37.081 18.714 -26.348 1.00 25.54  ? 387 LEU B HB3  1 
ATOM   5524 H  HG   . LEU B 1 172 ? 38.909 20.573 -25.234 1.00 27.92  ? 387 LEU B HG   1 
ATOM   5525 H  HD11 . LEU B 1 172 ? 38.601 19.391 -23.262 1.00 33.10  ? 387 LEU B HD11 1 
ATOM   5526 H  HD12 . LEU B 1 172 ? 37.219 19.988 -23.771 1.00 33.10  ? 387 LEU B HD12 1 
ATOM   5527 H  HD13 . LEU B 1 172 ? 37.550 18.450 -23.994 1.00 33.10  ? 387 LEU B HD13 1 
ATOM   5528 H  HD21 . LEU B 1 172 ? 40.324 18.815 -24.800 1.00 22.26  ? 387 LEU B HD21 1 
ATOM   5529 H  HD22 . LEU B 1 172 ? 39.333 17.822 -25.545 1.00 22.26  ? 387 LEU B HD22 1 
ATOM   5530 H  HD23 . LEU B 1 172 ? 40.097 18.946 -26.368 1.00 22.26  ? 387 LEU B HD23 1 
ATOM   5531 N  N    . HIS B 1 173 ? 36.036 20.237 -29.120 1.00 23.85  ? 388 HIS B N    1 
ATOM   5532 C  CA   . HIS B 1 173 ? 35.028 19.792 -30.064 1.00 27.52  ? 388 HIS B CA   1 
ATOM   5533 C  C    . HIS B 1 173 ? 35.606 19.648 -31.471 1.00 28.29  ? 388 HIS B C    1 
ATOM   5534 O  O    . HIS B 1 173 ? 35.248 18.707 -32.179 1.00 30.84  ? 388 HIS B O    1 
ATOM   5535 C  CB   . HIS B 1 173 ? 33.819 20.717 -30.039 1.00 30.15  ? 388 HIS B CB   1 
ATOM   5536 C  CG   . HIS B 1 173 ? 32.937 20.442 -28.871 1.00 46.81  ? 388 HIS B CG   1 
ATOM   5537 N  ND1  . HIS B 1 173 ? 32.310 19.231 -28.681 1.00 55.80  ? 388 HIS B ND1  1 
ATOM   5538 C  CD2  . HIS B 1 173 ? 32.640 21.188 -27.770 1.00 45.80  ? 388 HIS B CD2  1 
ATOM   5539 C  CE1  . HIS B 1 173 ? 31.638 19.243 -27.548 1.00 41.07  ? 388 HIS B CE1  1 
ATOM   5540 N  NE2  . HIS B 1 173 ? 31.826 20.426 -26.972 1.00 42.73  ? 388 HIS B NE2  1 
ATOM   5541 H  H    . HIS B 1 173 ? 35.926 21.026 -28.796 1.00 28.62  ? 388 HIS B H    1 
ATOM   5542 H  HA   . HIS B 1 173 ? 34.722 18.914 -29.788 1.00 33.02  ? 388 HIS B HA   1 
ATOM   5543 H  HB2  . HIS B 1 173 ? 34.122 21.636 -29.981 1.00 36.18  ? 388 HIS B HB2  1 
ATOM   5544 H  HB3  . HIS B 1 173 ? 33.300 20.585 -30.848 1.00 36.18  ? 388 HIS B HB3  1 
ATOM   5545 H  HD1  . HIS B 1 173 ? 32.342 18.568 -29.228 1.00 66.96  ? 388 HIS B HD1  1 
ATOM   5546 H  HD2  . HIS B 1 173 ? 32.925 22.056 -27.598 1.00 54.97  ? 388 HIS B HD2  1 
ATOM   5547 H  HE1  . HIS B 1 173 ? 31.120 18.548 -27.211 1.00 49.28  ? 388 HIS B HE1  1 
ATOM   5548 N  N    . LYS B 1 174 ? 36.527 20.538 -31.841 1.00 25.04  ? 389 LYS B N    1 
ATOM   5549 C  CA   . LYS B 1 174 ? 37.188 20.462 -33.129 1.00 27.86  ? 389 LYS B CA   1 
ATOM   5550 C  C    . LYS B 1 174 ? 38.145 19.282 -33.221 1.00 24.03  ? 389 LYS B C    1 
ATOM   5551 O  O    . LYS B 1 174 ? 38.174 18.572 -34.215 1.00 27.84  ? 389 LYS B O    1 
ATOM   5552 C  CB   . LYS B 1 174 ? 37.950 21.751 -33.375 1.00 27.73  ? 389 LYS B CB   1 
ATOM   5553 C  CG   . LYS B 1 174 ? 37.079 23.002 -33.485 1.00 30.37  ? 389 LYS B CG   1 
ATOM   5554 C  CD   . LYS B 1 174 ? 37.988 24.258 -33.435 1.00 31.87  ? 389 LYS B CD   1 
ATOM   5555 C  CE   . LYS B 1 174 ? 37.262 25.562 -33.644 1.00 34.91  ? 389 LYS B CE   1 
ATOM   5556 N  NZ   . LYS B 1 174 ? 38.214 26.692 -33.341 1.00 45.29  ? 389 LYS B NZ   1 
ATOM   5557 H  H    . LYS B 1 174 ? 36.785 21.199 -31.354 1.00 30.05  ? 389 LYS B H    1 
ATOM   5558 H  HA   . LYS B 1 174 ? 36.520 20.366 -33.826 1.00 33.44  ? 389 LYS B HA   1 
ATOM   5559 H  HB2  . LYS B 1 174 ? 38.569 21.889 -32.640 1.00 33.27  ? 389 LYS B HB2  1 
ATOM   5560 H  HB3  . LYS B 1 174 ? 38.444 21.664 -34.205 1.00 33.27  ? 389 LYS B HB3  1 
ATOM   5561 H  HG2  . LYS B 1 174 ? 36.602 22.996 -34.330 1.00 36.45  ? 389 LYS B HG2  1 
ATOM   5562 H  HG3  . LYS B 1 174 ? 36.458 23.036 -32.740 1.00 36.45  ? 389 LYS B HG3  1 
ATOM   5563 H  HD2  . LYS B 1 174 ? 38.417 24.296 -32.566 1.00 38.25  ? 389 LYS B HD2  1 
ATOM   5564 H  HD3  . LYS B 1 174 ? 38.662 24.181 -34.129 1.00 38.25  ? 389 LYS B HD3  1 
ATOM   5565 H  HE2  . LYS B 1 174 ? 36.973 25.635 -34.567 1.00 41.89  ? 389 LYS B HE2  1 
ATOM   5566 H  HE3  . LYS B 1 174 ? 36.506 25.619 -33.039 1.00 41.89  ? 389 LYS B HE3  1 
ATOM   5567 H  HZ1  . LYS B 1 174 ? 37.806 27.474 -33.458 1.00 54.35  ? 389 LYS B HZ1  1 
ATOM   5568 H  HZ2  . LYS B 1 174 ? 38.495 26.635 -32.499 1.00 54.35  ? 389 LYS B HZ2  1 
ATOM   5569 H  HZ3  . LYS B 1 174 ? 38.918 26.649 -33.884 1.00 54.35  ? 389 LYS B HZ3  1 
ATOM   5570 N  N    . LEU B 1 175 ? 38.929 19.066 -32.175 1.00 25.31  ? 390 LEU B N    1 
ATOM   5571 C  CA   . LEU B 1 175 ? 39.860 17.959 -32.160 1.00 21.84  ? 390 LEU B CA   1 
ATOM   5572 C  C    . LEU B 1 175 ? 39.144 16.639 -32.337 1.00 23.57  ? 390 LEU B C    1 
ATOM   5573 O  O    . LEU B 1 175 ? 39.580 15.749 -33.075 1.00 24.85  ? 390 LEU B O    1 
ATOM   5574 C  CB   . LEU B 1 175 ? 40.614 17.965 -30.850 1.00 19.73  ? 390 LEU B CB   1 
ATOM   5575 C  CG   . LEU B 1 175 ? 41.954 17.279 -30.772 1.00 35.36  ? 390 LEU B CG   1 
ATOM   5576 C  CD1  . LEU B 1 175 ? 42.873 17.887 -31.816 1.00 30.18  ? 390 LEU B CD1  1 
ATOM   5577 C  CD2  . LEU B 1 175 ? 42.490 17.533 -29.404 1.00 35.23  ? 390 LEU B CD2  1 
ATOM   5578 H  H    . LEU B 1 175 ? 38.938 19.547 -31.462 1.00 30.37  ? 390 LEU B H    1 
ATOM   5579 H  HA   . LEU B 1 175 ? 40.498 18.062 -32.883 1.00 26.20  ? 390 LEU B HA   1 
ATOM   5580 H  HB2  . LEU B 1 175 ? 40.760 18.890 -30.599 1.00 23.68  ? 390 LEU B HB2  1 
ATOM   5581 H  HB3  . LEU B 1 175 ? 40.048 17.545 -30.183 1.00 23.68  ? 390 LEU B HB3  1 
ATOM   5582 H  HG   . LEU B 1 175 ? 41.865 16.325 -30.922 1.00 42.43  ? 390 LEU B HG   1 
ATOM   5583 H  HD11 . LEU B 1 175 ? 43.737 17.448 -31.770 1.00 36.22  ? 390 LEU B HD11 1 
ATOM   5584 H  HD12 . LEU B 1 175 ? 42.482 17.756 -32.695 1.00 36.22  ? 390 LEU B HD12 1 
ATOM   5585 H  HD13 . LEU B 1 175 ? 42.972 18.835 -31.636 1.00 36.22  ? 390 LEU B HD13 1 
ATOM   5586 H  HD21 . LEU B 1 175 ? 43.356 17.103 -29.320 1.00 42.28  ? 390 LEU B HD21 1 
ATOM   5587 H  HD22 . LEU B 1 175 ? 42.581 18.490 -29.273 1.00 42.28  ? 390 LEU B HD22 1 
ATOM   5588 H  HD23 . LEU B 1 175 ? 41.874 17.166 -28.751 1.00 42.28  ? 390 LEU B HD23 1 
ATOM   5589 N  N    . ARG B 1 176 ? 38.021 16.542 -31.652 1.00 27.55  ? 391 ARG B N    1 
ATOM   5590 C  CA   . ARG B 1 176 ? 37.173 15.357 -31.638 1.00 31.88  ? 391 ARG B CA   1 
ATOM   5591 C  C    . ARG B 1 176 ? 36.798 14.920 -33.039 1.00 31.90  ? 391 ARG B C    1 
ATOM   5592 O  O    . ARG B 1 176 ? 36.562 13.741 -33.265 1.00 40.24  ? 391 ARG B O    1 
ATOM   5593 C  CB   . ARG B 1 176 ? 35.895 15.658 -30.862 1.00 30.83  ? 391 ARG B CB   1 
ATOM   5594 C  CG   . ARG B 1 176 ? 35.320 14.554 -30.059 1.00 44.00  ? 391 ARG B CG   1 
ATOM   5595 C  CD   . ARG B 1 176 ? 33.905 14.986 -29.598 1.00 46.75  ? 391 ARG B CD   1 
ATOM   5596 N  NE   . ARG B 1 176 ? 33.093 13.880 -29.119 1.00 56.52  ? 391 ARG B NE   1 
ATOM   5597 C  CZ   . ARG B 1 176 ? 31.932 14.049 -28.489 1.00 66.28  ? 391 ARG B CZ   1 
ATOM   5598 N  NH1  . ARG B 1 176 ? 31.465 15.281 -28.267 1.00 58.34  ? 391 ARG B NH1  1 
ATOM   5599 N  NH2  . ARG B 1 176 ? 31.240 12.993 -28.071 1.00 77.43  ? 391 ARG B NH2  1 
ATOM   5600 H  H    . ARG B 1 176 ? 37.713 17.179 -31.163 1.00 33.05  ? 391 ARG B H    1 
ATOM   5601 H  HA   . ARG B 1 176 ? 37.639 14.628 -31.200 1.00 38.25  ? 391 ARG B HA   1 
ATOM   5602 H  HB2  . ARG B 1 176 ? 36.079 16.389 -30.251 1.00 36.99  ? 391 ARG B HB2  1 
ATOM   5603 H  HB3  . ARG B 1 176 ? 35.215 15.934 -31.496 1.00 36.99  ? 391 ARG B HB3  1 
ATOM   5604 H  HG2  . ARG B 1 176 ? 35.243 13.754 -30.602 1.00 52.80  ? 391 ARG B HG2  1 
ATOM   5605 H  HG3  . ARG B 1 176 ? 35.870 14.391 -29.276 1.00 52.80  ? 391 ARG B HG3  1 
ATOM   5606 H  HD2  . ARG B 1 176 ? 33.993 15.626 -28.874 1.00 56.10  ? 391 ARG B HD2  1 
ATOM   5607 H  HD3  . ARG B 1 176 ? 33.442 15.394 -30.346 1.00 56.10  ? 391 ARG B HD3  1 
ATOM   5608 H  HE   . ARG B 1 176 ? 33.296 13.088 -29.384 1.00 67.82  ? 391 ARG B HE   1 
ATOM   5609 H  HH11 . ARG B 1 176 ? 31.912 15.965 -28.534 1.00 70.00  ? 391 ARG B HH11 1 
ATOM   5610 H  HH12 . ARG B 1 176 ? 30.715 15.390 -27.859 1.00 70.00  ? 391 ARG B HH12 1 
ATOM   5611 H  HH21 . ARG B 1 176 ? 31.540 12.199 -28.213 1.00 92.92  ? 391 ARG B HH21 1 
ATOM   5612 H  HH22 . ARG B 1 176 ? 30.490 13.103 -27.665 1.00 92.92  ? 391 ARG B HH22 1 
ATOM   5613 N  N    . GLN B 1 177 ? 36.721 15.870 -33.972 1.00 32.78  ? 392 GLN B N    1 
ATOM   5614 C  CA   . GLN B 1 177 ? 36.136 15.549 -35.259 1.00 34.62  ? 392 GLN B CA   1 
ATOM   5615 C  C    . GLN B 1 177 ? 37.186 15.270 -36.348 1.00 28.98  ? 392 GLN B C    1 
ATOM   5616 O  O    . GLN B 1 177 ? 36.839 14.833 -37.437 1.00 32.99  ? 392 GLN B O    1 
ATOM   5617 C  CB   . GLN B 1 177 ? 35.126 16.655 -35.685 1.00 48.13  ? 392 GLN B CB   1 
ATOM   5618 C  CG   . GLN B 1 177 ? 35.669 18.038 -36.112 1.00 43.29  ? 392 GLN B CG   1 
ATOM   5619 C  CD   . GLN B 1 177 ? 34.579 19.127 -36.086 1.00 53.18  ? 392 GLN B CD   1 
ATOM   5620 O  OE1  . GLN B 1 177 ? 33.727 19.155 -35.192 1.00 59.23  ? 392 GLN B OE1  1 
ATOM   5621 N  NE2  . GLN B 1 177 ? 34.601 20.018 -37.071 1.00 64.59  ? 392 GLN B NE2  1 
ATOM   5622 H  H    . GLN B 1 177 ? 36.992 16.682 -33.884 1.00 39.34  ? 392 GLN B H    1 
ATOM   5623 H  HA   . GLN B 1 177 ? 35.624 14.732 -35.153 1.00 41.54  ? 392 GLN B HA   1 
ATOM   5624 H  HB2  . GLN B 1 177 ? 34.614 16.313 -36.434 1.00 57.75  ? 392 GLN B HB2  1 
ATOM   5625 H  HB3  . GLN B 1 177 ? 34.526 16.809 -34.939 1.00 57.75  ? 392 GLN B HB3  1 
ATOM   5626 H  HG2  . GLN B 1 177 ? 36.376 18.304 -35.503 1.00 51.95  ? 392 GLN B HG2  1 
ATOM   5627 H  HG3  . GLN B 1 177 ? 36.014 17.978 -37.017 1.00 51.95  ? 392 GLN B HG3  1 
ATOM   5628 H  HE21 . GLN B 1 177 ? 35.205 19.968 -37.682 1.00 77.50  ? 392 GLN B HE21 1 
ATOM   5629 H  HE22 . GLN B 1 177 ? 34.013 20.644 -37.098 1.00 77.50  ? 392 GLN B HE22 1 
ATOM   5630 N  N    . LEU B 1 178 ? 38.460 15.395 -36.022 1.00 28.43  ? 393 LEU B N    1 
ATOM   5631 C  CA   . LEU B 1 178 ? 39.523 14.952 -36.907 1.00 26.43  ? 393 LEU B CA   1 
ATOM   5632 C  C    . LEU B 1 178 ? 39.377 13.463 -37.232 1.00 27.62  ? 393 LEU B C    1 
ATOM   5633 O  O    . LEU B 1 178 ? 39.039 12.664 -36.386 1.00 30.04  ? 393 LEU B O    1 
ATOM   5634 C  CB   . LEU B 1 178 ? 40.889 15.213 -36.268 1.00 23.73  ? 393 LEU B CB   1 
ATOM   5635 C  CG   . LEU B 1 178 ? 41.512 16.596 -36.477 1.00 25.29  ? 393 LEU B CG   1 
ATOM   5636 C  CD1  . LEU B 1 178 ? 40.442 17.753 -36.441 1.00 24.51  ? 393 LEU B CD1  1 
ATOM   5637 C  CD2  . LEU B 1 178 ? 42.619 16.883 -35.488 1.00 21.08  ? 393 LEU B CD2  1 
ATOM   5638 H  H    . LEU B 1 178 ? 38.740 15.738 -35.285 1.00 34.12  ? 393 LEU B H    1 
ATOM   5639 H  HA   . LEU B 1 178 ? 39.475 15.451 -37.738 1.00 31.71  ? 393 LEU B HA   1 
ATOM   5640 H  HB2  . LEU B 1 178 ? 40.803 15.082 -35.311 1.00 28.48  ? 393 LEU B HB2  1 
ATOM   5641 H  HB3  . LEU B 1 178 ? 41.515 14.563 -36.623 1.00 28.48  ? 393 LEU B HB3  1 
ATOM   5642 H  HG   . LEU B 1 178 ? 41.913 16.611 -37.360 1.00 30.34  ? 393 LEU B HG   1 
ATOM   5643 H  HD11 . LEU B 1 178 ? 40.891 18.602 -36.578 1.00 29.41  ? 393 LEU B HD11 1 
ATOM   5644 H  HD12 . LEU B 1 178 ? 39.793 17.604 -37.146 1.00 29.41  ? 393 LEU B HD12 1 
ATOM   5645 H  HD13 . LEU B 1 178 ? 40.001 17.747 -35.577 1.00 29.41  ? 393 LEU B HD13 1 
ATOM   5646 H  HD21 . LEU B 1 178 ? 42.977 17.767 -35.664 1.00 25.30  ? 393 LEU B HD21 1 
ATOM   5647 H  HD22 . LEU B 1 178 ? 42.256 16.845 -34.589 1.00 25.30  ? 393 LEU B HD22 1 
ATOM   5648 H  HD23 . LEU B 1 178 ? 43.316 16.216 -35.592 1.00 25.30  ? 393 LEU B HD23 1 
ATOM   5649 N  N    . PRO B 1 179 ? 39.651 13.083 -38.462 1.00 29.27  ? 394 PRO B N    1 
ATOM   5650 C  CA   . PRO B 1 179 ? 39.419 11.700 -38.923 1.00 31.62  ? 394 PRO B CA   1 
ATOM   5651 C  C    . PRO B 1 179 ? 40.433 10.666 -38.465 1.00 29.30  ? 394 PRO B C    1 
ATOM   5652 O  O    . PRO B 1 179 ? 40.192 9.498  -38.709 1.00 30.95  ? 394 PRO B O    1 
ATOM   5653 C  CB   . PRO B 1 179 ? 39.497 11.815 -40.429 1.00 33.54  ? 394 PRO B CB   1 
ATOM   5654 C  CG   . PRO B 1 179 ? 39.867 13.212 -40.730 1.00 32.95  ? 394 PRO B CG   1 
ATOM   5655 C  CD   . PRO B 1 179 ? 40.266 13.907 -39.508 1.00 29.85  ? 394 PRO B CD   1 
ATOM   5656 H  HA   . PRO B 1 179 ? 38.529 11.408 -38.671 1.00 37.94  ? 394 PRO B HA   1 
ATOM   5657 H  HB2  . PRO B 1 179 ? 40.173 11.206 -40.764 1.00 40.25  ? 394 PRO B HB2  1 
ATOM   5658 H  HB3  . PRO B 1 179 ? 38.631 11.604 -40.812 1.00 40.25  ? 394 PRO B HB3  1 
ATOM   5659 H  HG2  . PRO B 1 179 ? 40.604 13.208 -41.360 1.00 39.54  ? 394 PRO B HG2  1 
ATOM   5660 H  HG3  . PRO B 1 179 ? 39.101 13.658 -41.125 1.00 39.54  ? 394 PRO B HG3  1 
ATOM   5661 H  HD2  . PRO B 1 179 ? 41.231 13.909 -39.417 1.00 35.82  ? 394 PRO B HD2  1 
ATOM   5662 H  HD3  . PRO B 1 179 ? 39.901 14.806 -39.493 1.00 35.82  ? 394 PRO B HD3  1 
ATOM   5663 N  N    . GLU B 1 180 ? 41.546 11.089 -37.874 1.00 31.78  ? 395 GLU B N    1 
ATOM   5664 C  CA   . GLU B 1 180 ? 42.640 10.189 -37.544 1.00 28.78  ? 395 GLU B CA   1 
ATOM   5665 C  C    . GLU B 1 180 ? 43.306 10.683 -36.282 1.00 29.52  ? 395 GLU B C    1 
ATOM   5666 O  O    . GLU B 1 180 ? 43.514 11.893 -36.110 1.00 25.31  ? 395 GLU B O    1 
ATOM   5667 C  CB   . GLU B 1 180 ? 43.699 10.096 -38.654 1.00 29.31  ? 395 GLU B CB   1 
ATOM   5668 C  CG   . GLU B 1 180 ? 43.190 9.689  -40.016 1.00 41.82  ? 395 GLU B CG   1 
ATOM   5669 C  CD   . GLU B 1 180 ? 43.101 8.183  -40.151 1.00 46.20  ? 395 GLU B CD   1 
ATOM   5670 O  OE1  . GLU B 1 180 ? 43.400 7.482  -39.158 1.00 39.31  ? 395 GLU B OE1  1 
ATOM   5671 O  OE2  . GLU B 1 180 ? 42.728 7.704  -41.241 1.00 61.21  ? 395 GLU B OE2  1 
ATOM   5672 H  H    . GLU B 1 180 ? 41.691 11.907 -37.652 1.00 38.14  ? 395 GLU B H    1 
ATOM   5673 H  HA   . GLU B 1 180 ? 42.289 9.300  -37.379 1.00 34.53  ? 395 GLU B HA   1 
ATOM   5674 H  HB2  . GLU B 1 180 ? 44.119 10.965 -38.749 1.00 35.18  ? 395 GLU B HB2  1 
ATOM   5675 H  HB3  . GLU B 1 180 ? 44.365 9.443  -38.386 1.00 35.18  ? 395 GLU B HB3  1 
ATOM   5676 H  HG2  . GLU B 1 180 ? 42.304 10.059 -40.150 1.00 50.19  ? 395 GLU B HG2  1 
ATOM   5677 H  HG3  . GLU B 1 180 ? 43.798 10.020 -40.696 1.00 50.19  ? 395 GLU B HG3  1 
ATOM   5678 N  N    . ARG B 1 181 ? 43.648 9.713  -35.444 1.00 30.02  ? 396 ARG B N    1 
ATOM   5679 C  CA   . ARG B 1 181 ? 44.312 9.913  -34.160 1.00 29.87  ? 396 ARG B CA   1 
ATOM   5680 C  C    . ARG B 1 181 ? 45.671 10.554 -34.378 1.00 29.60  ? 396 ARG B C    1 
ATOM   5681 O  O    . ARG B 1 181 ? 46.034 11.478 -33.690 1.00 26.29  ? 396 ARG B O    1 
ATOM   5682 C  CB   . ARG B 1 181 ? 44.485 8.554  -33.408 1.00 26.43  ? 396 ARG B CB   1 
ATOM   5683 C  CG   . ARG B 1 181 ? 44.625 8.703  -31.910 1.00 34.11  ? 396 ARG B CG   1 
ATOM   5684 C  CD   . ARG B 1 181 ? 44.602 7.359  -31.116 1.00 44.77  ? 396 ARG B CD   1 
ATOM   5685 N  NE   . ARG B 1 181 ? 45.823 6.571  -31.328 1.00 53.99  ? 396 ARG B NE   1 
ATOM   5686 C  CZ   . ARG B 1 181 ? 46.955 6.708  -30.629 1.00 60.12  ? 396 ARG B CZ   1 
ATOM   5687 N  NH1  . ARG B 1 181 ? 47.057 7.603  -29.637 1.00 41.55  ? 396 ARG B NH1  1 
ATOM   5688 N  NH2  . ARG B 1 181 ? 47.999 5.938  -30.932 1.00 64.97  ? 396 ARG B NH2  1 
ATOM   5689 H  H    . ARG B 1 181 ? 43.495 8.882  -35.608 1.00 36.02  ? 396 ARG B H    1 
ATOM   5690 H  HA   . ARG B 1 181 ? 43.778 10.504 -33.608 1.00 35.84  ? 396 ARG B HA   1 
ATOM   5691 H  HB2  . ARG B 1 181 ? 43.708 8.000  -33.580 1.00 31.72  ? 396 ARG B HB2  1 
ATOM   5692 H  HB3  . ARG B 1 181 ? 45.283 8.113  -33.739 1.00 31.72  ? 396 ARG B HB3  1 
ATOM   5693 H  HG2  . ARG B 1 181 ? 45.468 9.143  -31.720 1.00 40.93  ? 396 ARG B HG2  1 
ATOM   5694 H  HG3  . ARG B 1 181 ? 43.892 9.249  -31.584 1.00 40.93  ? 396 ARG B HG3  1 
ATOM   5695 H  HD2  . ARG B 1 181 ? 44.527 7.551  -30.168 1.00 53.72  ? 396 ARG B HD2  1 
ATOM   5696 H  HD3  . ARG B 1 181 ? 43.846 6.828  -31.410 1.00 53.72  ? 396 ARG B HD3  1 
ATOM   5697 H  HE   . ARG B 1 181 ? 45.810 5.977  -31.949 1.00 64.79  ? 396 ARG B HE   1 
ATOM   5698 H  HH11 . ARG B 1 181 ? 46.386 8.105  -29.441 1.00 49.86  ? 396 ARG B HH11 1 
ATOM   5699 H  HH12 . ARG B 1 181 ? 47.792 7.676  -29.198 1.00 49.86  ? 396 ARG B HH12 1 
ATOM   5700 H  HH21 . ARG B 1 181 ? 47.938 5.360  -31.566 1.00 77.96  ? 396 ARG B HH21 1 
ATOM   5701 H  HH22 . ARG B 1 181 ? 48.731 6.012  -30.487 1.00 77.96  ? 396 ARG B HH22 1 
ATOM   5702 N  N    . TYR B 1 182 ? 46.415 10.057 -35.361 1.00 22.26  ? 397 TYR B N    1 
ATOM   5703 C  CA   . TYR B 1 182 ? 47.712 10.646 -35.679 1.00 23.52  ? 397 TYR B CA   1 
ATOM   5704 C  C    . TYR B 1 182 ? 47.588 12.157 -35.983 1.00 22.17  ? 397 TYR B C    1 
ATOM   5705 O  O    . TYR B 1 182 ? 48.519 12.937 -35.650 1.00 23.18  ? 397 TYR B O    1 
ATOM   5706 C  CB   . TYR B 1 182 ? 48.395 9.898  -36.833 1.00 24.14  ? 397 TYR B CB   1 
ATOM   5707 C  CG   . TYR B 1 182 ? 48.030 10.252 -38.252 1.00 31.89  ? 397 TYR B CG   1 
ATOM   5708 C  CD1  . TYR B 1 182 ? 48.547 11.402 -38.857 1.00 31.75  ? 397 TYR B CD1  1 
ATOM   5709 C  CD2  . TYR B 1 182 ? 47.229 9.416  -39.023 1.00 36.46  ? 397 TYR B CD2  1 
ATOM   5710 C  CE1  . TYR B 1 182 ? 48.244 11.722 -40.185 1.00 34.05  ? 397 TYR B CE1  1 
ATOM   5711 C  CE2  . TYR B 1 182 ? 46.926 9.729  -40.366 1.00 43.12  ? 397 TYR B CE2  1 
ATOM   5712 C  CZ   . TYR B 1 182 ? 47.436 10.888 -40.921 1.00 46.80  ? 397 TYR B CZ   1 
ATOM   5713 O  OH   . TYR B 1 182 ? 47.155 11.234 -42.224 1.00 44.26  ? 397 TYR B OH   1 
ATOM   5714 H  H    . TYR B 1 182 ? 46.196 9.387  -35.854 1.00 26.71  ? 397 TYR B H    1 
ATOM   5715 H  HA   . TYR B 1 182 ? 48.284 10.556 -34.901 1.00 28.23  ? 397 TYR B HA   1 
ATOM   5716 H  HB2  . TYR B 1 182 ? 49.351 10.037 -36.749 1.00 28.96  ? 397 TYR B HB2  1 
ATOM   5717 H  HB3  . TYR B 1 182 ? 48.204 8.953  -36.725 1.00 28.96  ? 397 TYR B HB3  1 
ATOM   5718 H  HD1  . TYR B 1 182 ? 49.093 11.971 -38.364 1.00 38.10  ? 397 TYR B HD1  1 
ATOM   5719 H  HD2  . TYR B 1 182 ? 46.887 8.637  -38.647 1.00 43.75  ? 397 TYR B HD2  1 
ATOM   5720 H  HE1  . TYR B 1 182 ? 48.585 12.498 -40.567 1.00 40.86  ? 397 TYR B HE1  1 
ATOM   5721 H  HE2  . TYR B 1 182 ? 46.376 9.170  -40.866 1.00 51.75  ? 397 TYR B HE2  1 
ATOM   5722 H  HH   . TYR B 1 182 ? 46.656 10.655 -42.573 1.00 53.11  ? 397 TYR B HH   1 
ATOM   5723 N  N    . MET B 1 183 ? 46.456 12.586 -36.561 1.00 23.72  ? 398 MET B N    1 
ATOM   5724 C  CA   . MET B 1 183 ? 46.262 14.025 -36.868 1.00 22.98  ? 398 MET B CA   1 
ATOM   5725 C  C    . MET B 1 183 ? 46.009 14.820 -35.587 1.00 25.58  ? 398 MET B C    1 
ATOM   5726 O  O    . MET B 1 183 ? 46.562 15.900 -35.437 1.00 23.18  ? 398 MET B O    1 
ATOM   5727 C  CB   . MET B 1 183 ? 45.123 14.262 -37.843 1.00 27.76  ? 398 MET B CB   1 
ATOM   5728 C  CG   . MET B 1 183 ? 45.415 13.685 -39.255 1.00 34.05  ? 398 MET B CG   1 
ATOM   5729 S  SD   . MET B 1 183 ? 44.135 14.101 -40.431 1.00 33.35  ? 398 MET B SD   1 
ATOM   5730 C  CE   . MET B 1 183 ? 44.753 13.348 -41.946 1.00 44.21  ? 398 MET B CE   1 
ATOM   5731 H  H    . MET B 1 183 ? 45.796 12.082 -36.784 1.00 28.46  ? 398 MET B H    1 
ATOM   5732 H  HA   . MET B 1 183 ? 47.073 14.361 -37.282 1.00 27.58  ? 398 MET B HA   1 
ATOM   5733 H  HB2  . MET B 1 183 ? 44.322 13.833 -37.503 1.00 33.31  ? 398 MET B HB2  1 
ATOM   5734 H  HB3  . MET B 1 183 ? 44.976 15.216 -37.932 1.00 33.31  ? 398 MET B HB3  1 
ATOM   5735 H  HG2  . MET B 1 183 ? 46.253 14.050 -39.579 1.00 40.86  ? 398 MET B HG2  1 
ATOM   5736 H  HG3  . MET B 1 183 ? 45.471 12.719 -39.198 1.00 40.86  ? 398 MET B HG3  1 
ATOM   5737 H  HE1  . MET B 1 183 ? 44.122 13.517 -42.663 1.00 53.05  ? 398 MET B HE1  1 
ATOM   5738 H  HE2  . MET B 1 183 ? 45.614 13.739 -42.164 1.00 53.05  ? 398 MET B HE2  1 
ATOM   5739 H  HE3  . MET B 1 183 ? 44.849 12.393 -41.807 1.00 53.05  ? 398 MET B HE3  1 
ATOM   5740 N  N    . MET B 1 184 ? 45.161 14.283 -34.704 1.00 20.15  ? 399 MET B N    1 
ATOM   5741 C  CA   . MET B 1 184 ? 44.949 14.838 -33.376 1.00 19.70  ? 399 MET B CA   1 
ATOM   5742 C  C    . MET B 1 184 ? 46.258 14.965 -32.622 1.00 18.65  ? 399 MET B C    1 
ATOM   5743 O  O    . MET B 1 184 ? 46.517 15.983 -31.995 1.00 19.24  ? 399 MET B O    1 
ATOM   5744 C  CB   . MET B 1 184 ? 44.018 13.946 -32.538 1.00 21.11  ? 399 MET B CB   1 
ATOM   5745 C  CG   . MET B 1 184 ? 42.631 13.809 -33.101 1.00 23.86  ? 399 MET B CG   1 
ATOM   5746 S  SD   . MET B 1 184 ? 41.733 12.598 -32.136 1.00 28.91  ? 399 MET B SD   1 
ATOM   5747 C  CE   . MET B 1 184 ? 40.203 12.523 -33.060 1.00 21.34  ? 399 MET B CE   1 
ATOM   5748 H  H    . MET B 1 184 ? 44.689 13.581 -34.861 1.00 24.18  ? 399 MET B H    1 
ATOM   5749 H  HA   . MET B 1 184 ? 44.539 15.713 -33.457 1.00 23.64  ? 399 MET B HA   1 
ATOM   5750 H  HB2  . MET B 1 184 ? 44.404 13.058 -32.484 1.00 25.33  ? 399 MET B HB2  1 
ATOM   5751 H  HB3  . MET B 1 184 ? 43.941 14.325 -31.649 1.00 25.33  ? 399 MET B HB3  1 
ATOM   5752 H  HG2  . MET B 1 184 ? 42.167 14.659 -33.044 1.00 28.63  ? 399 MET B HG2  1 
ATOM   5753 H  HG3  . MET B 1 184 ? 42.677 13.503 -34.020 1.00 28.63  ? 399 MET B HG3  1 
ATOM   5754 H  HE1  . MET B 1 184 ? 39.608 11.886 -32.634 1.00 25.61  ? 399 MET B HE1  1 
ATOM   5755 H  HE2  . MET B 1 184 ? 39.795 13.403 -33.067 1.00 25.61  ? 399 MET B HE2  1 
ATOM   5756 H  HE3  . MET B 1 184 ? 40.397 12.240 -33.968 1.00 25.61  ? 399 MET B HE3  1 
ATOM   5757 N  N    . ASN B 1 185 ? 47.069 13.917 -32.659 1.00 18.21  ? 400 ASN B N    1 
ATOM   5758 C  CA   . ASN B 1 185 ? 48.367 14.016 -32.014 1.00 18.00  ? 400 ASN B CA   1 
ATOM   5759 C  C    . ASN B 1 185 ? 49.310 15.057 -32.641 1.00 19.98  ? 400 ASN B C    1 
ATOM   5760 O  O    . ASN B 1 185 ? 49.997 15.753 -31.893 1.00 21.18  ? 400 ASN B O    1 
ATOM   5761 C  CB   . ASN B 1 185 ? 49.035 12.661 -31.980 1.00 18.57  ? 400 ASN B CB   1 
ATOM   5762 C  CG   . ASN B 1 185 ? 48.351 11.723 -30.989 1.00 18.19  ? 400 ASN B CG   1 
ATOM   5763 O  OD1  . ASN B 1 185 ? 47.550 12.161 -30.131 1.00 17.60  ? 400 ASN B OD1  1 
ATOM   5764 N  ND2  . ASN B 1 185 ? 48.646 10.417 -31.115 1.00 19.02  ? 400 ASN B ND2  1 
ATOM   5765 H  H    . ASN B 1 185 ? 46.900 13.163 -33.036 1.00 21.85  ? 400 ASN B H    1 
ATOM   5766 H  HA   . ASN B 1 185 ? 48.223 14.284 -31.094 1.00 21.60  ? 400 ASN B HA   1 
ATOM   5767 H  HB2  . ASN B 1 185 ? 48.987 12.259 -32.862 1.00 22.28  ? 400 ASN B HB2  1 
ATOM   5768 H  HB3  . ASN B 1 185 ? 49.960 12.768 -31.709 1.00 22.28  ? 400 ASN B HB3  1 
ATOM   5769 H  HD21 . ASN B 1 185 ? 48.290 9.842  -30.584 1.00 22.83  ? 400 ASN B HD21 1 
ATOM   5770 H  HD22 . ASN B 1 185 ? 49.191 10.156 -31.728 1.00 22.83  ? 400 ASN B HD22 1 
ATOM   5771 N  N    . SER B 1 186 ? 49.341 15.178 -33.978 1.00 20.36  ? 401 SER B N    1 
ATOM   5772 C  CA   . SER B 1 186 ? 50.112 16.249 -34.604 1.00 21.59  ? 401 SER B CA   1 
ATOM   5773 C  C    . SER B 1 186 ? 49.658 17.611 -34.160 1.00 21.01  ? 401 SER B C    1 
ATOM   5774 O  O    . SER B 1 186 ? 50.494 18.457 -33.908 1.00 21.28  ? 401 SER B O    1 
ATOM   5775 C  CB   . SER B 1 186 ? 50.025 16.264 -36.133 1.00 23.64  ? 401 SER B CB   1 
ATOM   5776 O  OG   . SER B 1 186 ? 50.284 15.004 -36.609 1.00 30.13  ? 401 SER B OG   1 
ATOM   5777 H  H    . SER B 1 186 ? 48.932 14.660 -34.529 1.00 24.44  ? 401 SER B H    1 
ATOM   5778 H  HA   . SER B 1 186 ? 51.045 16.150 -34.359 1.00 25.91  ? 401 SER B HA   1 
ATOM   5779 H  HB2  . SER B 1 186 ? 49.132 16.532 -36.402 1.00 28.36  ? 401 SER B HB2  1 
ATOM   5780 H  HB3  . SER B 1 186 ? 50.683 16.883 -36.487 1.00 28.36  ? 401 SER B HB3  1 
ATOM   5781 H  HG   . SER B 1 186 ? 49.722 14.460 -36.303 1.00 36.15  ? 401 SER B HG   1 
ATOM   5782 N  N    . VAL B 1 187 ? 48.351 17.844 -34.114 1.00 20.52  ? 402 VAL B N    1 
ATOM   5783 C  CA   . VAL B 1 187 ? 47.839 19.138 -33.620 1.00 20.21  ? 402 VAL B CA   1 
ATOM   5784 C  C    . VAL B 1 187 ? 48.293 19.388 -32.179 1.00 18.98  ? 402 VAL B C    1 
ATOM   5785 O  O    . VAL B 1 187 ? 48.715 20.499 -31.810 1.00 18.74  ? 402 VAL B O    1 
ATOM   5786 C  CB   . VAL B 1 187 ? 46.307 19.214 -33.705 1.00 20.19  ? 402 VAL B CB   1 
ATOM   5787 C  CG1  . VAL B 1 187 ? 45.755 20.525 -32.936 1.00 19.93  ? 402 VAL B CG1  1 
ATOM   5788 C  CG2  . VAL B 1 187 ? 45.874 19.181 -35.157 1.00 22.10  ? 402 VAL B CG2  1 
ATOM   5789 H  H    . VAL B 1 187 ? 47.743 17.287 -34.357 1.00 24.63  ? 402 VAL B H    1 
ATOM   5790 H  HA   . VAL B 1 187 ? 48.202 19.848 -34.172 1.00 24.25  ? 402 VAL B HA   1 
ATOM   5791 H  HB   . VAL B 1 187 ? 45.931 18.434 -33.266 1.00 24.23  ? 402 VAL B HB   1 
ATOM   5792 H  HG11 . VAL B 1 187 ? 44.787 20.547 -33.006 1.00 23.91  ? 402 VAL B HG11 1 
ATOM   5793 H  HG12 . VAL B 1 187 ? 46.019 20.479 -32.004 1.00 23.91  ? 402 VAL B HG12 1 
ATOM   5794 H  HG13 . VAL B 1 187 ? 46.135 21.316 -33.349 1.00 23.91  ? 402 VAL B HG13 1 
ATOM   5795 H  HG21 . VAL B 1 187 ? 44.906 19.229 -35.199 1.00 26.52  ? 402 VAL B HG21 1 
ATOM   5796 H  HG22 . VAL B 1 187 ? 46.264 19.939 -35.620 1.00 26.52  ? 402 VAL B HG22 1 
ATOM   5797 H  HG23 . VAL B 1 187 ? 46.182 18.353 -35.559 1.00 26.52  ? 402 VAL B HG23 1 
ATOM   5798 N  N    . LEU B 1 188 ? 48.164 18.369 -31.348 1.00 19.43  ? 403 LEU B N    1 
ATOM   5799 C  CA   . LEU B 1 188 ? 48.495 18.527 -29.927 1.00 17.76  ? 403 LEU B CA   1 
ATOM   5800 C  C    . LEU B 1 188 ? 49.988 18.716 -29.653 1.00 22.16  ? 403 LEU B C    1 
ATOM   5801 O  O    . LEU B 1 188 ? 50.370 19.175 -28.578 1.00 23.45  ? 403 LEU B O    1 
ATOM   5802 C  CB   . LEU B 1 188 ? 47.997 17.336 -29.134 1.00 16.28  ? 403 LEU B CB   1 
ATOM   5803 C  CG   . LEU B 1 188 ? 46.499 17.404 -28.869 1.00 18.73  ? 403 LEU B CG   1 
ATOM   5804 C  CD1  . LEU B 1 188 ? 46.078 15.979 -28.381 1.00 17.86  ? 403 LEU B CD1  1 
ATOM   5805 C  CD2  . LEU B 1 188 ? 46.131 18.535 -27.830 1.00 15.82  ? 403 LEU B CD2  1 
ATOM   5806 H  H    . LEU B 1 188 ? 47.893 17.583 -31.569 1.00 23.31  ? 403 LEU B H    1 
ATOM   5807 H  HA   . LEU B 1 188 ? 48.036 19.313 -29.592 1.00 21.31  ? 403 LEU B HA   1 
ATOM   5808 H  HB2  . LEU B 1 188 ? 48.178 16.524 -29.633 1.00 19.54  ? 403 LEU B HB2  1 
ATOM   5809 H  HB3  . LEU B 1 188 ? 48.454 17.310 -28.279 1.00 19.54  ? 403 LEU B HB3  1 
ATOM   5810 H  HG   . LEU B 1 188 ? 46.035 17.590 -29.700 1.00 22.48  ? 403 LEU B HG   1 
ATOM   5811 H  HD11 . LEU B 1 188 ? 45.125 15.977 -28.199 1.00 21.43  ? 403 LEU B HD11 1 
ATOM   5812 H  HD12 . LEU B 1 188 ? 46.284 15.334 -29.076 1.00 21.43  ? 403 LEU B HD12 1 
ATOM   5813 H  HD13 . LEU B 1 188 ? 46.570 15.764 -27.573 1.00 21.43  ? 403 LEU B HD13 1 
ATOM   5814 H  HD21 . LEU B 1 188 ? 45.170 18.538 -27.695 1.00 18.99  ? 403 LEU B HD21 1 
ATOM   5815 H  HD22 . LEU B 1 188 ? 46.583 18.353 -26.992 1.00 18.99  ? 403 LEU B HD22 1 
ATOM   5816 H  HD23 . LEU B 1 188 ? 46.418 19.392 -28.182 1.00 18.99  ? 403 LEU B HD23 1 
ATOM   5817 N  N    . GLU B 1 189 ? 50.831 18.391 -30.611 1.00 26.49  ? 404 GLU B N    1 
ATOM   5818 C  CA   . GLU B 1 189 ? 52.253 18.600 -30.407 1.00 25.93  ? 404 GLU B CA   1 
ATOM   5819 C  C    . GLU B 1 189 ? 52.553 20.071 -30.213 1.00 21.97  ? 404 GLU B C    1 
ATOM   5820 O  O    . GLU B 1 189 ? 53.605 20.439 -29.686 1.00 25.67  ? 404 GLU B O    1 
ATOM   5821 C  CB   . GLU B 1 189 ? 53.100 18.081 -31.589 1.00 29.78  ? 404 GLU B CB   1 
ATOM   5822 C  CG   . GLU B 1 189 ? 53.412 16.615 -31.530 1.00 46.22  ? 404 GLU B CG   1 
ATOM   5823 C  CD   . GLU B 1 189 ? 54.110 16.164 -32.795 1.00 62.66  ? 404 GLU B CD   1 
ATOM   5824 O  OE1  . GLU B 1 189 ? 54.968 16.950 -33.261 1.00 62.34  ? 404 GLU B OE1  1 
ATOM   5825 O  OE2  . GLU B 1 189 ? 53.790 15.068 -33.333 1.00 71.54  ? 404 GLU B OE2  1 
ATOM   5826 H  H    . GLU B 1 189 ? 50.615 18.054 -31.372 1.00 31.79  ? 404 GLU B H    1 
ATOM   5827 H  HA   . GLU B 1 189 ? 52.531 18.128 -29.607 1.00 31.12  ? 404 GLU B HA   1 
ATOM   5828 H  HB2  . GLU B 1 189 ? 52.617 18.246 -32.413 1.00 35.73  ? 404 GLU B HB2  1 
ATOM   5829 H  HB3  . GLU B 1 189 ? 53.943 18.561 -31.601 1.00 35.73  ? 404 GLU B HB3  1 
ATOM   5830 H  HG2  . GLU B 1 189 ? 53.998 16.440 -30.778 1.00 55.47  ? 404 GLU B HG2  1 
ATOM   5831 H  HG3  . GLU B 1 189 ? 52.587 16.113 -31.440 1.00 55.47  ? 404 GLU B HG3  1 
ATOM   5832 N  N    . ASN B 1 190 ? 51.669 20.923 -30.707 1.00 27.15  ? 405 ASN B N    1 
ATOM   5833 C  CA   . ASN B 1 190 ? 51.931 22.337 -30.622 1.00 27.02  ? 405 ASN B CA   1 
ATOM   5834 C  C    . ASN B 1 190 ? 51.170 23.037 -29.483 1.00 26.45  ? 405 ASN B C    1 
ATOM   5835 O  O    . ASN B 1 190 ? 51.173 24.267 -29.409 1.00 26.19  ? 405 ASN B O    1 
ATOM   5836 C  CB   . ASN B 1 190 ? 51.626 22.942 -31.975 1.00 35.95  ? 405 ASN B CB   1 
ATOM   5837 C  CG   . ASN B 1 190 ? 52.473 22.289 -33.079 1.00 38.79  ? 405 ASN B CG   1 
ATOM   5838 O  OD1  . ASN B 1 190 ? 53.688 22.295 -32.993 1.00 32.71  ? 405 ASN B OD1  1 
ATOM   5839 N  ND2  . ASN B 1 190 ? 51.834 21.670 -34.057 1.00 37.31  ? 405 ASN B ND2  1 
ATOM   5840 H  H    . ASN B 1 190 ? 50.927 20.710 -31.088 1.00 32.58  ? 405 ASN B H    1 
ATOM   5841 H  HA   . ASN B 1 190 ? 52.879 22.462 -30.455 1.00 32.43  ? 405 ASN B HA   1 
ATOM   5842 H  HB2  . ASN B 1 190 ? 50.690 22.803 -32.186 1.00 43.14  ? 405 ASN B HB2  1 
ATOM   5843 H  HB3  . ASN B 1 190 ? 51.830 23.891 -31.956 1.00 43.14  ? 405 ASN B HB3  1 
ATOM   5844 H  HD21 . ASN B 1 190 ? 52.278 21.294 -34.690 1.00 44.77  ? 405 ASN B HD21 1 
ATOM   5845 H  HD22 . ASN B 1 190 ? 50.974 21.643 -34.059 1.00 44.77  ? 405 ASN B HD22 1 
ATOM   5846 N  N    . PHE B 1 191 ? 50.578 22.268 -28.561 1.00 21.21  ? 406 PHE B N    1 
ATOM   5847 C  CA   . PHE B 1 191 ? 49.865 22.879 -27.419 1.00 21.58  ? 406 PHE B CA   1 
ATOM   5848 C  C    . PHE B 1 191 ? 50.355 22.369 -26.155 1.00 16.72  ? 406 PHE B C    1 
ATOM   5849 O  O    . PHE B 1 191 ? 50.549 21.163 -26.000 1.00 23.69  ? 406 PHE B O    1 
ATOM   5850 C  CB   . PHE B 1 191 ? 48.370 22.631 -27.479 1.00 27.28  ? 406 PHE B CB   1 
ATOM   5851 C  CG   . PHE B 1 191 ? 47.701 23.445 -28.549 1.00 43.11  ? 406 PHE B CG   1 
ATOM   5852 C  CD1  . PHE B 1 191 ? 47.345 24.767 -28.296 1.00 49.62  ? 406 PHE B CD1  1 
ATOM   5853 C  CD2  . PHE B 1 191 ? 47.492 22.927 -29.825 1.00 39.35  ? 406 PHE B CD2  1 
ATOM   5854 C  CE1  . PHE B 1 191 ? 46.745 25.564 -29.275 1.00 38.62  ? 406 PHE B CE1  1 
ATOM   5855 C  CE2  . PHE B 1 191 ? 46.901 23.720 -30.833 1.00 44.24  ? 406 PHE B CE2  1 
ATOM   5856 C  CZ   . PHE B 1 191 ? 46.516 25.048 -30.545 1.00 41.32  ? 406 PHE B CZ   1 
ATOM   5857 H  H    . PHE B 1 191 ? 50.571 21.408 -28.569 1.00 25.45  ? 406 PHE B H    1 
ATOM   5858 H  HA   . PHE B 1 191 ? 50.011 23.838 -27.432 1.00 25.90  ? 406 PHE B HA   1 
ATOM   5859 H  HB2  . PHE B 1 191 ? 48.211 21.693 -27.670 1.00 32.74  ? 406 PHE B HB2  1 
ATOM   5860 H  HB3  . PHE B 1 191 ? 47.974 22.869 -26.626 1.00 32.74  ? 406 PHE B HB3  1 
ATOM   5861 H  HD1  . PHE B 1 191 ? 47.489 25.121 -27.448 1.00 59.55  ? 406 PHE B HD1  1 
ATOM   5862 H  HD2  . PHE B 1 191 ? 47.742 22.051 -30.014 1.00 47.22  ? 406 PHE B HD2  1 
ATOM   5863 H  HE1  . PHE B 1 191 ? 46.502 26.439 -29.078 1.00 46.35  ? 406 PHE B HE1  1 
ATOM   5864 H  HE2  . PHE B 1 191 ? 46.747 23.363 -31.678 1.00 53.09  ? 406 PHE B HE2  1 
ATOM   5865 H  HZ   . PHE B 1 191 ? 46.121 25.576 -31.201 1.00 49.59  ? 406 PHE B HZ   1 
ATOM   5866 N  N    . THR B 1 192 ? 50.596 23.276 -25.235 1.00 19.97  ? 407 THR B N    1 
ATOM   5867 C  CA   . THR B 1 192 ? 51.033 22.898 -23.916 1.00 17.17  ? 407 THR B CA   1 
ATOM   5868 C  C    . THR B 1 192 ? 50.370 23.794 -22.857 1.00 17.91  ? 407 THR B C    1 
ATOM   5869 O  O    . THR B 1 192 ? 49.898 24.895 -23.165 1.00 21.90  ? 407 THR B O    1 
ATOM   5870 C  CB   . THR B 1 192 ? 52.521 23.016 -23.821 1.00 19.87  ? 407 THR B CB   1 
ATOM   5871 O  OG1  . THR B 1 192 ? 52.859 24.401 -24.009 1.00 27.97  ? 407 THR B OG1  1 
ATOM   5872 C  CG2  . THR B 1 192 ? 53.169 22.136 -24.896 1.00 26.19  ? 407 THR B CG2  1 
ATOM   5873 H  H    . THR B 1 192 ? 50.514 24.124 -25.352 1.00 23.97  ? 407 THR B H    1 
ATOM   5874 H  HA   . THR B 1 192 ? 50.783 21.977 -23.742 1.00 20.61  ? 407 THR B HA   1 
ATOM   5875 H  HB   . THR B 1 192 ? 52.820 22.718 -22.947 1.00 23.84  ? 407 THR B HB   1 
ATOM   5876 H  HG1  . THR B 1 192 ? 53.692 24.502 -23.961 1.00 33.56  ? 407 THR B HG1  1 
ATOM   5877 H  HG21 . THR B 1 192 ? 54.135 22.205 -24.842 1.00 31.43  ? 407 THR B HG21 1 
ATOM   5878 H  HG22 . THR B 1 192 ? 52.912 21.210 -24.765 1.00 31.43  ? 407 THR B HG22 1 
ATOM   5879 H  HG23 . THR B 1 192 ? 52.881 22.422 -25.776 1.00 31.43  ? 407 THR B HG23 1 
ATOM   5880 N  N    . ILE B 1 193 ? 50.286 23.270 -21.637 1.00 16.77  ? 408 ILE B N    1 
ATOM   5881 C  CA   . ILE B 1 193 ? 49.714 24.003 -20.524 1.00 13.64  ? 408 ILE B CA   1 
ATOM   5882 C  C    . ILE B 1 193 ? 50.791 24.013 -19.431 1.00 15.03  ? 408 ILE B C    1 
ATOM   5883 O  O    . ILE B 1 193 ? 51.470 23.015 -19.173 1.00 16.45  ? 408 ILE B O    1 
ATOM   5884 C  CB   . ILE B 1 193 ? 48.407 23.387 -20.076 1.00 13.53  ? 408 ILE B CB   1 
ATOM   5885 C  CG1  . ILE B 1 193 ? 47.364 23.618 -21.191 1.00 18.61  ? 408 ILE B CG1  1 
ATOM   5886 C  CG2  . ILE B 1 193 ? 47.975 24.034 -18.748 1.00 14.97  ? 408 ILE B CG2  1 
ATOM   5887 C  CD1  . ILE B 1 193 ? 46.056 22.976 -20.939 1.00 16.82  ? 408 ILE B CD1  1 
ATOM   5888 H  H    . ILE B 1 193 ? 50.558 22.481 -21.430 1.00 20.12  ? 408 ILE B H    1 
ATOM   5889 H  HA   . ILE B 1 193 ? 49.544 24.919 -20.795 1.00 16.37  ? 408 ILE B HA   1 
ATOM   5890 H  HB   . ILE B 1 193 ? 48.530 22.434 -19.944 1.00 16.24  ? 408 ILE B HB   1 
ATOM   5891 H  HG12 . ILE B 1 193 ? 47.212 24.572 -21.283 1.00 22.33  ? 408 ILE B HG12 1 
ATOM   5892 H  HG13 . ILE B 1 193 ? 47.713 23.261 -22.023 1.00 22.33  ? 408 ILE B HG13 1 
ATOM   5893 H  HG21 . ILE B 1 193 ? 47.137 23.638 -18.462 1.00 17.96  ? 408 ILE B HG21 1 
ATOM   5894 H  HG22 . ILE B 1 193 ? 48.662 23.874 -18.081 1.00 17.96  ? 408 ILE B HG22 1 
ATOM   5895 H  HG23 . ILE B 1 193 ? 47.861 24.988 -18.884 1.00 17.96  ? 408 ILE B HG23 1 
ATOM   5896 H  HD11 . ILE B 1 193 ? 45.462 23.169 -21.682 1.00 20.19  ? 408 ILE B HD11 1 
ATOM   5897 H  HD12 . ILE B 1 193 ? 46.186 22.018 -20.858 1.00 20.19  ? 408 ILE B HD12 1 
ATOM   5898 H  HD13 . ILE B 1 193 ? 45.684 23.331 -20.117 1.00 20.19  ? 408 ILE B HD13 1 
ATOM   5899 N  N    . LEU B 1 194 ? 50.990 25.198 -18.880 1.00 14.05  ? 409 LEU B N    1 
ATOM   5900 C  CA   . LEU B 1 194 ? 51.893 25.401 -17.777 1.00 17.14  ? 409 LEU B CA   1 
ATOM   5901 C  C    . LEU B 1 194 ? 51.092 25.913 -16.566 1.00 17.10  ? 409 LEU B C    1 
ATOM   5902 O  O    . LEU B 1 194 ? 50.448 26.949 -16.646 1.00 21.25  ? 409 LEU B O    1 
ATOM   5903 C  CB   . LEU B 1 194 ? 52.987 26.387 -18.197 1.00 18.31  ? 409 LEU B CB   1 
ATOM   5904 C  CG   . LEU B 1 194 ? 54.091 26.613 -17.191 1.00 25.82  ? 409 LEU B CG   1 
ATOM   5905 C  CD1  . LEU B 1 194 ? 55.007 25.379 -17.180 1.00 23.29  ? 409 LEU B CD1  1 
ATOM   5906 C  CD2  . LEU B 1 194 ? 54.863 27.890 -17.540 1.00 46.58  ? 409 LEU B CD2  1 
ATOM   5907 H  H    . LEU B 1 194 ? 50.599 25.918 -19.140 1.00 16.86  ? 409 LEU B H    1 
ATOM   5908 H  HA   . LEU B 1 194 ? 52.311 24.558 -17.539 1.00 20.57  ? 409 LEU B HA   1 
ATOM   5909 H  HB2  . LEU B 1 194 ? 53.399 26.058 -19.010 1.00 21.97  ? 409 LEU B HB2  1 
ATOM   5910 H  HB3  . LEU B 1 194 ? 52.572 27.247 -18.370 1.00 21.97  ? 409 LEU B HB3  1 
ATOM   5911 H  HG   . LEU B 1 194 ? 53.706 26.719 -16.307 1.00 30.99  ? 409 LEU B HG   1 
ATOM   5912 H  HD11 . LEU B 1 194 ? 55.718 25.520 -16.535 1.00 27.95  ? 409 LEU B HD11 1 
ATOM   5913 H  HD12 . LEU B 1 194 ? 54.485 24.601 -16.931 1.00 27.95  ? 409 LEU B HD12 1 
ATOM   5914 H  HD13 . LEU B 1 194 ? 55.383 25.258 -18.065 1.00 27.95  ? 409 LEU B HD13 1 
ATOM   5915 H  HD21 . LEU B 1 194 ? 55.567 28.022 -16.887 1.00 55.90  ? 409 LEU B HD21 1 
ATOM   5916 H  HD22 . LEU B 1 194 ? 55.246 27.795 -18.426 1.00 55.90  ? 409 LEU B HD22 1 
ATOM   5917 H  HD23 . LEU B 1 194 ? 54.251 28.643 -17.524 1.00 55.90  ? 409 LEU B HD23 1 
ATOM   5918 N  N    . GLN B 1 195 ? 51.050 25.148 -15.489 1.00 18.52  ? 410 GLN B N    1 
ATOM   5919 C  CA   . GLN B 1 195 ? 50.531 25.615 -14.196 1.00 18.23  ? 410 GLN B CA   1 
ATOM   5920 C  C    . GLN B 1 195 ? 51.600 26.018 -13.196 1.00 19.77  ? 410 GLN B C    1 
ATOM   5921 O  O    . GLN B 1 195 ? 52.517 25.259 -12.896 1.00 24.21  ? 410 GLN B O    1 
ATOM   5922 C  CB   . GLN B 1 195 ? 49.684 24.532 -13.560 1.00 20.93  ? 410 GLN B CB   1 
ATOM   5923 C  CG   . GLN B 1 195 ? 48.370 24.416 -14.237 1.00 47.25  ? 410 GLN B CG   1 
ATOM   5924 C  CD   . GLN B 1 195 ? 47.436 23.523 -13.497 1.00 42.83  ? 410 GLN B CD   1 
ATOM   5925 O  OE1  . GLN B 1 195 ? 47.852 22.529 -12.875 1.00 29.46  ? 410 GLN B OE1  1 
ATOM   5926 N  NE2  . GLN B 1 195 ? 46.160 23.851 -13.560 1.00 39.69  ? 410 GLN B NE2  1 
ATOM   5927 H  H    . GLN B 1 195 ? 51.322 24.332 -15.474 1.00 22.23  ? 410 GLN B H    1 
ATOM   5928 H  HA   . GLN B 1 195 ? 49.962 26.386 -14.348 1.00 21.87  ? 410 GLN B HA   1 
ATOM   5929 H  HB2  . GLN B 1 195 ? 50.142 23.680 -13.635 1.00 25.12  ? 410 GLN B HB2  1 
ATOM   5930 H  HB3  . GLN B 1 195 ? 49.529 24.750 -12.628 1.00 25.12  ? 410 GLN B HB3  1 
ATOM   5931 H  HG2  . GLN B 1 195 ? 47.964 25.295 -14.296 1.00 56.71  ? 410 GLN B HG2  1 
ATOM   5932 H  HG3  . GLN B 1 195 ? 48.500 24.047 -15.125 1.00 56.71  ? 410 GLN B HG3  1 
ATOM   5933 H  HE21 . GLN B 1 195 ? 45.916 24.543 -14.009 1.00 47.63  ? 410 GLN B HE21 1 
ATOM   5934 H  HE22 . GLN B 1 195 ? 45.572 23.373 -13.153 1.00 47.63  ? 410 GLN B HE22 1 
ATOM   5935 N  N    . VAL B 1 196 ? 51.462 27.226 -12.686 1.00 16.85  ? 411 VAL B N    1 
ATOM   5936 C  CA   . VAL B 1 196 ? 52.373 27.765 -11.713 1.00 16.24  ? 411 VAL B CA   1 
ATOM   5937 C  C    . VAL B 1 196 ? 51.601 28.132 -10.461 1.00 20.09  ? 411 VAL B C    1 
ATOM   5938 O  O    . VAL B 1 196 ? 50.722 29.002 -10.480 1.00 19.52  ? 411 VAL B O    1 
ATOM   5939 C  CB   . VAL B 1 196 ? 53.114 28.981 -12.258 1.00 19.78  ? 411 VAL B CB   1 
ATOM   5940 C  CG1  . VAL B 1 196 ? 54.154 29.421 -11.256 1.00 22.01  ? 411 VAL B CG1  1 
ATOM   5941 C  CG2  . VAL B 1 196 ? 53.779 28.628 -13.587 1.00 17.34  ? 411 VAL B CG2  1 
ATOM   5942 H  H    . VAL B 1 196 ? 50.827 27.766 -12.898 1.00 20.23  ? 411 VAL B H    1 
ATOM   5943 H  HA   . VAL B 1 196 ? 53.028 27.089 -11.480 1.00 19.49  ? 411 VAL B HA   1 
ATOM   5944 H  HB   . VAL B 1 196 ? 52.490 29.710 -12.403 1.00 23.74  ? 411 VAL B HB   1 
ATOM   5945 H  HG11 . VAL B 1 196 ? 54.622 30.195 -11.607 1.00 26.41  ? 411 VAL B HG11 1 
ATOM   5946 H  HG12 . VAL B 1 196 ? 53.712 29.651 -10.423 1.00 26.41  ? 411 VAL B HG12 1 
ATOM   5947 H  HG13 . VAL B 1 196 ? 54.779 28.694 -11.110 1.00 26.41  ? 411 VAL B HG13 1 
ATOM   5948 H  HG21 . VAL B 1 196 ? 54.246 29.408 -13.923 1.00 20.80  ? 411 VAL B HG21 1 
ATOM   5949 H  HG22 . VAL B 1 196 ? 54.406 27.902 -13.442 1.00 20.80  ? 411 VAL B HG22 1 
ATOM   5950 H  HG23 . VAL B 1 196 ? 53.095 28.354 -14.218 1.00 20.80  ? 411 VAL B HG23 1 
ATOM   5951 N  N    . VAL B 1 197 ? 51.998 27.498 -9.351  1.00 17.04  ? 412 VAL B N    1 
ATOM   5952 C  CA   . VAL B 1 197 ? 51.396 27.725 -8.072  1.00 18.25  ? 412 VAL B CA   1 
ATOM   5953 C  C    . VAL B 1 197 ? 52.401 28.397 -7.179  1.00 19.05  ? 412 VAL B C    1 
ATOM   5954 O  O    . VAL B 1 197 ? 53.515 27.901 -6.968  1.00 19.31  ? 412 VAL B O    1 
ATOM   5955 C  CB   . VAL B 1 197 ? 50.893 26.432 -7.472  1.00 19.01  ? 412 VAL B CB   1 
ATOM   5956 C  CG1  . VAL B 1 197 ? 50.140 26.731 -6.158  1.00 22.32  ? 412 VAL B CG1  1 
ATOM   5957 C  CG2  . VAL B 1 197 ? 49.970 25.752 -8.441  1.00 18.77  ? 412 VAL B CG2  1 
ATOM   5958 H  H    . VAL B 1 197 ? 52.634 26.918 -9.332  1.00 20.45  ? 412 VAL B H    1 
ATOM   5959 H  HA   . VAL B 1 197 ? 50.639 28.322 -8.178  1.00 21.90  ? 412 VAL B HA   1 
ATOM   5960 H  HB   . VAL B 1 197 ? 51.640 25.843 -7.281  1.00 22.81  ? 412 VAL B HB   1 
ATOM   5961 H  HG11 . VAL B 1 197 ? 49.821 25.896 -5.781  1.00 26.78  ? 412 VAL B HG11 1 
ATOM   5962 H  HG12 . VAL B 1 197 ? 50.747 27.164 -5.538  1.00 26.78  ? 412 VAL B HG12 1 
ATOM   5963 H  HG13 . VAL B 1 197 ? 49.390 27.315 -6.351  1.00 26.78  ? 412 VAL B HG13 1 
ATOM   5964 H  HG21 . VAL B 1 197 ? 49.654 24.924 -8.047  1.00 22.52  ? 412 VAL B HG21 1 
ATOM   5965 H  HG22 . VAL B 1 197 ? 49.220 26.338 -8.627  1.00 22.52  ? 412 VAL B HG22 1 
ATOM   5966 H  HG23 . VAL B 1 197 ? 50.455 25.565 -9.260  1.00 22.52  ? 412 VAL B HG23 1 
ATOM   5967 N  N    . THR B 1 198 ? 52.003 29.544 -6.644  1.00 20.98  ? 413 THR B N    1 
ATOM   5968 C  CA   . THR B 1 198 ? 52.874 30.310 -5.786  1.00 20.58  ? 413 THR B CA   1 
ATOM   5969 C  C    . THR B 1 198 ? 52.159 30.735 -4.517  1.00 22.19  ? 413 THR B C    1 
ATOM   5970 O  O    . THR B 1 198 ? 50.936 30.708 -4.410  1.00 23.74  ? 413 THR B O    1 
ATOM   5971 C  CB   . THR B 1 198 ? 53.399 31.559 -6.499  1.00 21.58  ? 413 THR B CB   1 
ATOM   5972 O  OG1  . THR B 1 198 ? 52.286 32.316 -6.933  1.00 27.47  ? 413 THR B OG1  1 
ATOM   5973 C  CG2  . THR B 1 198 ? 54.113 31.188 -7.768  1.00 22.72  ? 413 THR B CG2  1 
ATOM   5974 H  H    . THR B 1 198 ? 51.228 29.898 -6.767  1.00 25.17  ? 413 THR B H    1 
ATOM   5975 H  HA   . THR B 1 198 ? 53.635 29.763 -5.536  1.00 24.69  ? 413 THR B HA   1 
ATOM   5976 H  HB   . THR B 1 198 ? 53.979 32.081 -5.923  1.00 25.89  ? 413 THR B HB   1 
ATOM   5977 H  HG1  . THR B 1 198 ? 51.817 31.861 -7.461  1.00 32.96  ? 413 THR B HG1  1 
ATOM   5978 H  HG21 . THR B 1 198 ? 54.440 31.988 -8.210  1.00 27.26  ? 413 THR B HG21 1 
ATOM   5979 H  HG22 . THR B 1 198 ? 54.864 30.608 -7.569  1.00 27.26  ? 413 THR B HG22 1 
ATOM   5980 H  HG23 . THR B 1 198 ? 53.506 30.724 -8.366  1.00 27.26  ? 413 THR B HG23 1 
ATOM   5981 N  N    . ASN B 1 199 ? 52.964 31.103 -3.543  1.00 23.28  ? 414 ASN B N    1 
ATOM   5982 C  CA   . ASN B 1 199 ? 52.468 31.644 -2.307  1.00 25.49  ? 414 ASN B CA   1 
ATOM   5983 C  C    . ASN B 1 199 ? 52.112 33.099 -2.584  1.00 27.59  ? 414 ASN B C    1 
ATOM   5984 O  O    . ASN B 1 199 ? 52.975 33.873 -2.932  1.00 24.57  ? 414 ASN B O    1 
ATOM   5985 C  CB   . ASN B 1 199 ? 53.541 31.515 -1.236  1.00 26.40  ? 414 ASN B CB   1 
ATOM   5986 C  CG   . ASN B 1 199 ? 53.097 32.052 0.093   1.00 29.60  ? 414 ASN B CG   1 
ATOM   5987 O  OD1  . ASN B 1 199 ? 52.440 33.088 0.181   1.00 32.08  ? 414 ASN B OD1  1 
ATOM   5988 N  ND2  . ASN B 1 199 ? 53.437 31.338 1.138   1.00 32.37  ? 414 ASN B ND2  1 
ATOM   5989 H  H    . ASN B 1 199 ? 53.822 31.047 -3.578  1.00 27.93  ? 414 ASN B H    1 
ATOM   5990 H  HA   . ASN B 1 199 ? 51.672 31.166 -2.025  1.00 30.59  ? 414 ASN B HA   1 
ATOM   5991 H  HB2  . ASN B 1 199 ? 53.763 30.578 -1.122  1.00 31.69  ? 414 ASN B HB2  1 
ATOM   5992 H  HB3  . ASN B 1 199 ? 54.326 32.012 -1.514  1.00 31.69  ? 414 ASN B HB3  1 
ATOM   5993 H  HD21 . ASN B 1 199 ? 53.211 31.596 1.926   1.00 38.84  ? 414 ASN B HD21 1 
ATOM   5994 H  HD22 . ASN B 1 199 ? 53.887 30.613 1.034   1.00 38.84  ? 414 ASN B HD22 1 
ATOM   5995 N  N    . ARG B 1 200 ? 50.836 33.454 -2.496  1.00 30.60  ? 415 ARG B N    1 
ATOM   5996 C  CA   . ARG B 1 200 ? 50.407 34.815 -2.869  1.00 32.45  ? 415 ARG B CA   1 
ATOM   5997 C  C    . ARG B 1 200 ? 51.054 35.915 -2.022  1.00 35.42  ? 415 ARG B C    1 
ATOM   5998 O  O    . ARG B 1 200 ? 51.292 37.015 -2.512  1.00 35.26  ? 415 ARG B O    1 
ATOM   5999 C  CB   . ARG B 1 200 ? 48.888 34.963 -2.779  1.00 30.53  ? 415 ARG B CB   1 
ATOM   6000 C  CG   . ARG B 1 200 ? 48.417 36.367 -3.250  1.00 35.98  ? 415 ARG B CG   1 
ATOM   6001 C  CD   . ARG B 1 200 ? 46.982 36.650 -2.898  1.00 48.10  ? 415 ARG B CD   1 
ATOM   6002 N  NE   . ARG B 1 200 ? 46.890 37.053 -1.497  1.00 73.61  ? 415 ARG B NE   1 
ATOM   6003 C  CZ   . ARG B 1 200 ? 45.788 37.523 -0.926  1.00 73.24  ? 415 ARG B CZ   1 
ATOM   6004 N  NH1  . ARG B 1 200 ? 44.673 37.629 -1.645  1.00 55.32  ? 415 ARG B NH1  1 
ATOM   6005 N  NH2  . ARG B 1 200 ? 45.806 37.870 0.356   1.00 73.74  ? 415 ARG B NH2  1 
ATOM   6006 H  H    . ARG B 1 200 ? 50.200 32.941 -2.228  1.00 36.73  ? 415 ARG B H    1 
ATOM   6007 H  HA   . ARG B 1 200 ? 50.660 34.972 -3.792  1.00 38.93  ? 415 ARG B HA   1 
ATOM   6008 H  HB2  . ARG B 1 200 ? 48.468 34.297 -3.346  1.00 36.64  ? 415 ARG B HB2  1 
ATOM   6009 H  HB3  . ARG B 1 200 ? 48.609 34.843 -1.858  1.00 36.64  ? 415 ARG B HB3  1 
ATOM   6010 H  HG2  . ARG B 1 200 ? 48.969 37.043 -2.827  1.00 43.18  ? 415 ARG B HG2  1 
ATOM   6011 H  HG3  . ARG B 1 200 ? 48.506 36.423 -4.214  1.00 43.18  ? 415 ARG B HG3  1 
ATOM   6012 H  HD2  . ARG B 1 200 ? 46.647 37.374 -3.451  1.00 57.72  ? 415 ARG B HD2  1 
ATOM   6013 H  HD3  . ARG B 1 200 ? 46.451 35.849 -3.025  1.00 57.72  ? 415 ARG B HD3  1 
ATOM   6014 H  HE   . ARG B 1 200 ? 47.595 36.980 -1.011  1.00 88.33  ? 415 ARG B HE   1 
ATOM   6015 H  HH11 . ARG B 1 200 ? 44.673 37.403 -2.474  1.00 66.38  ? 415 ARG B HH11 1 
ATOM   6016 H  HH12 . ARG B 1 200 ? 43.954 37.930 -1.281  1.00 66.38  ? 415 ARG B HH12 1 
ATOM   6017 H  HH21 . ARG B 1 200 ? 46.531 37.794 0.812   1.00 88.49  ? 415 ARG B HH21 1 
ATOM   6018 H  HH22 . ARG B 1 200 ? 45.092 38.170 0.731   1.00 88.49  ? 415 ARG B HH22 1 
ATOM   6019 N  N    . ASP B 1 201 ? 51.330 35.639 -0.758  1.00 33.40  ? 416 ASP B N    1 
ATOM   6020 C  CA   . ASP B 1 201 ? 51.872 36.681 0.117   1.00 43.01  ? 416 ASP B CA   1 
ATOM   6021 C  C    . ASP B 1 201 ? 53.389 36.884 -0.062  1.00 47.69  ? 416 ASP B C    1 
ATOM   6022 O  O    . ASP B 1 201 ? 53.889 38.010 0.001   1.00 46.64  ? 416 ASP B O    1 
ATOM   6023 C  CB   . ASP B 1 201 ? 51.539 36.354 1.583   1.00 43.49  ? 416 ASP B CB   1 
ATOM   6024 C  CG   . ASP B 1 201 ? 50.043 36.390 1.858   1.00 60.05  ? 416 ASP B CG   1 
ATOM   6025 O  OD1  . ASP B 1 201 ? 49.351 37.255 1.283   1.00 61.40  ? 416 ASP B OD1  1 
ATOM   6026 O  OD2  . ASP B 1 201 ? 49.550 35.542 2.627   1.00 80.46  ? 416 ASP B OD2  1 
ATOM   6027 H  H    . ASP B 1 201 ? 51.217 34.874 -0.382  1.00 40.08  ? 416 ASP B H    1 
ATOM   6028 H  HA   . ASP B 1 201 ? 51.438 37.521 -0.101  1.00 51.62  ? 416 ASP B HA   1 
ATOM   6029 H  HB2  . ASP B 1 201 ? 51.863 35.464 1.791   1.00 52.19  ? 416 ASP B HB2  1 
ATOM   6030 H  HB3  . ASP B 1 201 ? 51.967 37.007 2.158   1.00 52.19  ? 416 ASP B HB3  1 
ATOM   6031 N  N    . THR B 1 202 ? 54.115 35.807 -0.314  1.00 40.49  ? 417 THR B N    1 
ATOM   6032 C  CA   . THR B 1 202 ? 55.572 35.881 -0.340  1.00 36.16  ? 417 THR B CA   1 
ATOM   6033 C  C    . THR B 1 202 ? 56.133 35.779 -1.738  1.00 35.94  ? 417 THR B C    1 
ATOM   6034 O  O    . THR B 1 202 ? 57.328 35.939 -1.932  1.00 34.61  ? 417 THR B O    1 
ATOM   6035 C  CB   . THR B 1 202 ? 56.215 34.749 0.484   1.00 34.81  ? 417 THR B CB   1 
ATOM   6036 O  OG1  . THR B 1 202 ? 56.099 33.518 -0.236  1.00 37.53  ? 417 THR B OG1  1 
ATOM   6037 C  CG2  . THR B 1 202 ? 55.576 34.587 1.846   1.00 34.77  ? 417 THR B CG2  1 
ATOM   6038 H  H    . THR B 1 202 ? 53.795 35.025 -0.474  1.00 48.59  ? 417 THR B H    1 
ATOM   6039 H  HA   . THR B 1 202 ? 55.855 36.728 0.039   1.00 43.39  ? 417 THR B HA   1 
ATOM   6040 H  HB   . THR B 1 202 ? 57.155 34.949 0.616   1.00 41.77  ? 417 THR B HB   1 
ATOM   6041 H  HG1  . THR B 1 202 ? 56.447 32.894 0.205   1.00 45.04  ? 417 THR B HG1  1 
ATOM   6042 H  HG21 . THR B 1 202 ? 56.008 33.866 2.331   1.00 41.72  ? 417 THR B HG21 1 
ATOM   6043 H  HG22 . THR B 1 202 ? 55.666 35.408 2.355   1.00 41.72  ? 417 THR B HG22 1 
ATOM   6044 H  HG23 . THR B 1 202 ? 54.633 34.380 1.747   1.00 41.72  ? 417 THR B HG23 1 
ATOM   6045 N  N    . GLN B 1 203 ? 55.274 35.433 -2.687  1.00 30.07  ? 418 GLN B N    1 
ATOM   6046 C  CA   . GLN B 1 203 ? 55.661 35.257 -4.071  1.00 25.92  ? 418 GLN B CA   1 
ATOM   6047 C  C    . GLN B 1 203 ? 56.556 34.031 -4.343  1.00 25.66  ? 418 GLN B C    1 
ATOM   6048 O  O    . GLN B 1 203 ? 57.094 33.882 -5.443  1.00 28.08  ? 418 GLN B O    1 
ATOM   6049 C  CB   . GLN B 1 203 ? 56.376 36.525 -4.537  1.00 43.67  ? 418 GLN B CB   1 
ATOM   6050 C  CG   . GLN B 1 203 ? 55.550 37.783 -4.304  1.00 62.41  ? 418 GLN B CG   1 
ATOM   6051 C  CD   . GLN B 1 203 ? 54.321 37.728 -5.172  1.00 64.70  ? 418 GLN B CD   1 
ATOM   6052 O  OE1  . GLN B 1 203 ? 54.435 37.568 -6.388  1.00 53.13  ? 418 GLN B OE1  1 
ATOM   6053 N  NE2  . GLN B 1 203 ? 53.144 37.768 -4.563  1.00 55.98  ? 418 GLN B NE2  1 
ATOM   6054 H  H    . GLN B 1 203 ? 54.438 35.292 -2.546  1.00 36.09  ? 418 GLN B H    1 
ATOM   6055 H  HA   . GLN B 1 203 ? 54.858 35.158 -4.606  1.00 31.11  ? 418 GLN B HA   1 
ATOM   6056 H  HB2  . GLN B 1 203 ? 57.209 36.617 -4.047  1.00 52.41  ? 418 GLN B HB2  1 
ATOM   6057 H  HB3  . GLN B 1 203 ? 56.556 36.455 -5.487  1.00 52.41  ? 418 GLN B HB3  1 
ATOM   6058 H  HG2  . GLN B 1 203 ? 55.274 37.826 -3.375  1.00 74.89  ? 418 GLN B HG2  1 
ATOM   6059 H  HG3  . GLN B 1 203 ? 56.069 38.566 -4.546  1.00 74.89  ? 418 GLN B HG3  1 
ATOM   6060 H  HE21 . GLN B 1 203 ? 53.105 37.824 -3.705  1.00 67.17  ? 418 GLN B HE21 1 
ATOM   6061 H  HE22 . GLN B 1 203 ? 52.419 37.739 -5.025  1.00 67.17  ? 418 GLN B HE22 1 
ATOM   6062 N  N    . GLU B 1 204 ? 56.750 33.138 -3.393  1.00 23.86  ? 419 GLU B N    1 
ATOM   6063 C  CA   . GLU B 1 204 ? 57.633 32.043 -3.722  1.00 23.65  ? 419 GLU B CA   1 
ATOM   6064 C  C    . GLU B 1 204 ? 56.878 30.997 -4.475  1.00 22.53  ? 419 GLU B C    1 
ATOM   6065 O  O    . GLU B 1 204 ? 55.705 30.755 -4.226  1.00 22.51  ? 419 GLU B O    1 
ATOM   6066 C  CB   . GLU B 1 204 ? 58.294 31.439 -2.483  1.00 34.95  ? 419 GLU B CB   1 
ATOM   6067 C  CG   . GLU B 1 204 ? 57.354 31.015 -1.412  1.00 62.43  ? 419 GLU B CG   1 
ATOM   6068 C  CD   . GLU B 1 204 ? 57.905 31.274 -0.002  1.00 60.09  ? 419 GLU B CD   1 
ATOM   6069 O  OE1  . GLU B 1 204 ? 57.088 31.242 0.956   1.00 38.83  ? 419 GLU B OE1  1 
ATOM   6070 O  OE2  . GLU B 1 204 ? 59.138 31.488 0.152   1.00 54.38  ? 419 GLU B OE2  1 
ATOM   6071 H  H    . GLU B 1 204 ? 56.409 33.138 -2.603  1.00 28.63  ? 419 GLU B H    1 
ATOM   6072 H  HA   . GLU B 1 204 ? 58.337 32.374 -4.301  1.00 28.38  ? 419 GLU B HA   1 
ATOM   6073 H  HB2  . GLU B 1 204 ? 58.801 30.658 -2.754  1.00 41.94  ? 419 GLU B HB2  1 
ATOM   6074 H  HB3  . GLU B 1 204 ? 58.894 32.099 -2.101  1.00 41.94  ? 419 GLU B HB3  1 
ATOM   6075 H  HG2  . GLU B 1 204 ? 56.525 31.510 -1.506  1.00 74.92  ? 419 GLU B HG2  1 
ATOM   6076 H  HG3  . GLU B 1 204 ? 57.185 30.064 -1.498  1.00 74.92  ? 419 GLU B HG3  1 
ATOM   6077 N  N    . LEU B 1 205 ? 57.589 30.355 -5.397  1.00 24.25  ? 420 LEU B N    1 
ATOM   6078 C  CA   . LEU B 1 205 ? 57.038 29.287 -6.195  1.00 20.87  ? 420 LEU B CA   1 
ATOM   6079 C  C    . LEU B 1 205 ? 56.899 28.004 -5.382  1.00 22.00  ? 420 LEU B C    1 
ATOM   6080 O  O    . LEU B 1 205 ? 57.819 27.601 -4.698  1.00 23.28  ? 420 LEU B O    1 
ATOM   6081 C  CB   . LEU B 1 205 ? 57.916 29.040 -7.423  1.00 20.18  ? 420 LEU B CB   1 
ATOM   6082 C  CG   . LEU B 1 205 ? 57.504 27.819 -8.261  1.00 25.77  ? 420 LEU B CG   1 
ATOM   6083 C  CD1  . LEU B 1 205 ? 56.550 28.312 -9.290  1.00 44.02  ? 420 LEU B CD1  1 
ATOM   6084 C  CD2  . LEU B 1 205 ? 58.670 27.168 -8.897  1.00 31.43  ? 420 LEU B CD2  1 
ATOM   6085 H  H    . LEU B 1 205 ? 58.412 30.531 -5.577  1.00 29.10  ? 420 LEU B H    1 
ATOM   6086 H  HA   . LEU B 1 205 ? 56.155 29.544 -6.503  1.00 25.05  ? 420 LEU B HA   1 
ATOM   6087 H  HB2  . LEU B 1 205 ? 57.872 29.820 -7.998  1.00 24.21  ? 420 LEU B HB2  1 
ATOM   6088 H  HB3  . LEU B 1 205 ? 58.830 28.901 -7.129  1.00 24.21  ? 420 LEU B HB3  1 
ATOM   6089 H  HG   . LEU B 1 205 ? 57.051 27.171 -7.699  1.00 30.93  ? 420 LEU B HG   1 
ATOM   6090 H  HD11 . LEU B 1 205 ? 56.267 27.565 -9.841  1.00 52.82  ? 420 LEU B HD11 1 
ATOM   6091 H  HD12 . LEU B 1 205 ? 55.782 28.705 -8.846  1.00 52.82  ? 420 LEU B HD12 1 
ATOM   6092 H  HD13 . LEU B 1 205 ? 56.993 28.978 -9.838  1.00 52.82  ? 420 LEU B HD13 1 
ATOM   6093 H  HD21 . LEU B 1 205 ? 58.363 26.406 -9.413  1.00 37.72  ? 420 LEU B HD21 1 
ATOM   6094 H  HD22 . LEU B 1 205 ? 59.110 27.807 -9.479  1.00 37.72  ? 420 LEU B HD22 1 
ATOM   6095 H  HD23 . LEU B 1 205 ? 59.283 26.874 -8.205  1.00 37.72  ? 420 LEU B HD23 1 
ATOM   6096 N  N    . LEU B 1 206 ? 55.765 27.329 -5.510  1.00 21.49  ? 421 LEU B N    1 
ATOM   6097 C  CA   . LEU B 1 206 ? 55.538 26.129 -4.727  1.00 22.79  ? 421 LEU B CA   1 
ATOM   6098 C  C    . LEU B 1 206 ? 55.517 24.929 -5.638  1.00 22.13  ? 421 LEU B C    1 
ATOM   6099 O  O    . LEU B 1 206 ? 55.972 23.866 -5.284  1.00 23.35  ? 421 LEU B O    1 
ATOM   6100 C  CB   . LEU B 1 206 ? 54.218 26.232 -3.957  1.00 23.47  ? 421 LEU B CB   1 
ATOM   6101 C  CG   . LEU B 1 206 ? 54.136 27.354 -2.935  1.00 24.54  ? 421 LEU B CG   1 
ATOM   6102 C  CD1  . LEU B 1 206 ? 52.709 27.577 -2.468  1.00 25.16  ? 421 LEU B CD1  1 
ATOM   6103 C  CD2  . LEU B 1 206 ? 54.987 26.997 -1.758  1.00 26.60  ? 421 LEU B CD2  1 
ATOM   6104 H  H    . LEU B 1 206 ? 55.119 27.543 -6.036  1.00 25.79  ? 421 LEU B H    1 
ATOM   6105 H  HA   . LEU B 1 206 ? 56.260 26.018 -4.089  1.00 27.35  ? 421 LEU B HA   1 
ATOM   6106 H  HB2  . LEU B 1 206 ? 53.501 26.368 -4.596  1.00 28.17  ? 421 LEU B HB2  1 
ATOM   6107 H  HB3  . LEU B 1 206 ? 54.074 25.397 -3.484  1.00 28.17  ? 421 LEU B HB3  1 
ATOM   6108 H  HG   . LEU B 1 206 ? 54.469 28.178 -3.324  1.00 29.45  ? 421 LEU B HG   1 
ATOM   6109 H  HD11 . LEU B 1 206 ? 52.699 28.298 -1.820  1.00 30.19  ? 421 LEU B HD11 1 
ATOM   6110 H  HD12 . LEU B 1 206 ? 52.160 27.811 -3.233  1.00 30.19  ? 421 LEU B HD12 1 
ATOM   6111 H  HD13 . LEU B 1 206 ? 52.380 26.760 -2.061  1.00 30.19  ? 421 LEU B HD13 1 
ATOM   6112 H  HD21 . LEU B 1 206 ? 54.937 27.712 -1.104  1.00 31.92  ? 421 LEU B HD21 1 
ATOM   6113 H  HD22 . LEU B 1 206 ? 54.660 26.171 -1.370  1.00 31.92  ? 421 LEU B HD22 1 
ATOM   6114 H  HD23 . LEU B 1 206 ? 55.904 26.884 -2.054  1.00 31.92  ? 421 LEU B HD23 1 
ATOM   6115 N  N    . LEU B 1 207 ? 54.966 25.104 -6.814  1.00 20.44  ? 422 LEU B N    1 
ATOM   6116 C  CA   . LEU B 1 207 ? 54.821 23.994 -7.737  1.00 19.82  ? 422 LEU B CA   1 
ATOM   6117 C  C    . LEU B 1 207 ? 54.734 24.529 -9.141  1.00 18.15  ? 422 LEU B C    1 
ATOM   6118 O  O    . LEU B 1 207 ? 54.043 25.467 -9.383  1.00 17.45  ? 422 LEU B O    1 
ATOM   6119 C  CB   . LEU B 1 207 ? 53.578 23.179 -7.447  1.00 21.68  ? 422 LEU B CB   1 
ATOM   6120 C  CG   . LEU B 1 207 ? 53.582 21.709 -7.712  1.00 28.33  ? 422 LEU B CG   1 
ATOM   6121 C  CD1  . LEU B 1 207 ? 54.594 20.979 -6.813  1.00 28.88  ? 422 LEU B CD1  1 
ATOM   6122 C  CD2  . LEU B 1 207 ? 52.173 21.290 -7.406  1.00 36.50  ? 422 LEU B CD2  1 
ATOM   6123 H  H    . LEU B 1 207 ? 54.664 25.853 -7.108  1.00 24.53  ? 422 LEU B H    1 
ATOM   6124 H  HA   . LEU B 1 207 ? 55.596 23.413 -7.673  1.00 23.79  ? 422 LEU B HA   1 
ATOM   6125 H  HB2  . LEU B 1 207 ? 53.369 23.290 -6.506  1.00 26.01  ? 422 LEU B HB2  1 
ATOM   6126 H  HB3  . LEU B 1 207 ? 52.854 23.553 -7.973  1.00 26.01  ? 422 LEU B HB3  1 
ATOM   6127 H  HG   . LEU B 1 207 ? 53.781 21.530 -8.644  1.00 34.00  ? 422 LEU B HG   1 
ATOM   6128 H  HD11 . LEU B 1 207 ? 54.567 20.031 -7.014  1.00 34.66  ? 422 LEU B HD11 1 
ATOM   6129 H  HD12 . LEU B 1 207 ? 55.481 21.330 -6.988  1.00 34.66  ? 422 LEU B HD12 1 
ATOM   6130 H  HD13 . LEU B 1 207 ? 54.356 21.128 -5.885  1.00 34.66  ? 422 LEU B HD13 1 
ATOM   6131 H  HD21 . LEU B 1 207 ? 52.089 20.336 -7.555  1.00 43.80  ? 422 LEU B HD21 1 
ATOM   6132 H  HD22 . LEU B 1 207 ? 51.976 21.500 -6.480  1.00 43.80  ? 422 LEU B HD22 1 
ATOM   6133 H  HD23 . LEU B 1 207 ? 51.567 21.771 -7.992  1.00 43.80  ? 422 LEU B HD23 1 
ATOM   6134 N  N    . CYS B 1 208 ? 55.449 23.934 -10.066 1.00 17.87  ? 423 CYS B N    1 
ATOM   6135 C  CA   . CYS B 1 208 ? 55.295 24.311 -11.461 1.00 16.60  ? 423 CYS B CA   1 
ATOM   6136 C  C    . CYS B 1 208 ? 55.204 23.056 -12.325 1.00 16.37  ? 423 CYS B C    1 
ATOM   6137 O  O    . CYS B 1 208 ? 56.027 22.173 -12.236 1.00 17.27  ? 423 CYS B O    1 
ATOM   6138 C  CB   . CYS B 1 208 ? 56.463 25.212 -11.910 1.00 18.72  ? 423 CYS B CB   1 
ATOM   6139 S  SG   . CYS B 1 208 ? 56.402 25.599 -13.712 1.00 22.35  ? 423 CYS B SG   1 
ATOM   6140 H  H    . CYS B 1 208 ? 56.027 23.314 -9.922  1.00 21.44  ? 423 CYS B H    1 
ATOM   6141 H  HA   . CYS B 1 208 ? 54.471 24.811 -11.567 1.00 19.92  ? 423 CYS B HA   1 
ATOM   6142 H  HB2  . CYS B 1 208 ? 56.425 26.048 -11.421 1.00 22.47  ? 423 CYS B HB2  1 
ATOM   6143 H  HB3  . CYS B 1 208 ? 57.301 24.758 -11.729 1.00 22.47  ? 423 CYS B HB3  1 
ATOM   6144 H  HG   . CYS B 1 208 ? 57.335 26.300 -13.993 1.00 26.83  ? 423 CYS B HG   1 
ATOM   6145 N  N    . THR B 1 209 ? 54.157 22.963 -13.111 1.00 16.83  ? 424 THR B N    1 
ATOM   6146 C  CA   . THR B 1 209 ? 53.856 21.742 -13.826 1.00 16.39  ? 424 THR B CA   1 
ATOM   6147 C  C    . THR B 1 209 ? 53.603 22.085 -15.291 1.00 14.51  ? 424 THR B C    1 
ATOM   6148 O  O    . THR B 1 209 ? 52.749 22.899 -15.614 1.00 16.45  ? 424 THR B O    1 
ATOM   6149 C  CB   . THR B 1 209 ? 52.628 21.021 -13.208 1.00 16.83  ? 424 THR B CB   1 
ATOM   6150 O  OG1  . THR B 1 209 ? 52.837 20.808 -11.797 1.00 24.05  ? 424 THR B OG1  1 
ATOM   6151 C  CG2  . THR B 1 209 ? 52.423 19.683 -13.878 1.00 17.43  ? 424 THR B CG2  1 
ATOM   6152 H  H    . THR B 1 209 ? 53.596 23.600 -13.251 1.00 20.20  ? 424 THR B H    1 
ATOM   6153 H  HA   . THR B 1 209 ? 54.618 21.145 -13.779 1.00 19.67  ? 424 THR B HA   1 
ATOM   6154 H  HB   . THR B 1 209 ? 51.833 21.559 -13.342 1.00 20.19  ? 424 THR B HB   1 
ATOM   6155 H  HG1  . THR B 1 209 ? 52.172 20.418 -11.464 1.00 28.86  ? 424 THR B HG1  1 
ATOM   6156 H  HG21 . THR B 1 209 ? 51.656 19.233 -13.491 1.00 20.92  ? 424 THR B HG21 1 
ATOM   6157 H  HG22 . THR B 1 209 ? 52.270 19.808 -14.828 1.00 20.92  ? 424 THR B HG22 1 
ATOM   6158 H  HG23 . THR B 1 209 ? 53.209 19.127 -13.756 1.00 20.92  ? 424 THR B HG23 1 
ATOM   6159 N  N    . ALA B 1 210 ? 54.372 21.448 -16.162 1.00 15.49  ? 425 ALA B N    1 
ATOM   6160 C  CA   . ALA B 1 210 ? 54.195 21.510 -17.617 1.00 14.13  ? 425 ALA B CA   1 
ATOM   6161 C  C    . ALA B 1 210 ? 53.388 20.285 -18.049 1.00 15.63  ? 425 ALA B C    1 
ATOM   6162 O  O    . ALA B 1 210 ? 53.687 19.158 -17.665 1.00 15.51  ? 425 ALA B O    1 
ATOM   6163 C  CB   . ALA B 1 210 ? 55.545 21.528 -18.348 1.00 16.29  ? 425 ALA B CB   1 
ATOM   6164 H  H    . ALA B 1 210 ? 55.034 20.951 -15.928 1.00 18.59  ? 425 ALA B H    1 
ATOM   6165 H  HA   . ALA B 1 210 ? 53.700 22.310 -17.854 1.00 16.96  ? 425 ALA B HA   1 
ATOM   6166 H  HB1  . ALA B 1 210 ? 55.384 21.569 -19.304 1.00 19.55  ? 425 ALA B HB1  1 
ATOM   6167 H  HB2  . ALA B 1 210 ? 56.047 22.307 -18.063 1.00 19.55  ? 425 ALA B HB2  1 
ATOM   6168 H  HB3  . ALA B 1 210 ? 56.033 20.719 -18.129 1.00 19.55  ? 425 ALA B HB3  1 
ATOM   6169 N  N    . TYR B 1 211 ? 52.359 20.513 -18.835 1.00 18.85  ? 426 TYR B N    1 
ATOM   6170 C  CA   . TYR B 1 211 ? 51.499 19.455 -19.304 1.00 20.09  ? 426 TYR B CA   1 
ATOM   6171 C  C    . TYR B 1 211 ? 51.591 19.348 -20.812 1.00 18.92  ? 426 TYR B C    1 
ATOM   6172 O  O    . TYR B 1 211 ? 51.453 20.368 -21.516 1.00 18.59  ? 426 TYR B O    1 
ATOM   6173 C  CB   . TYR B 1 211 ? 50.065 19.729 -18.949 1.00 19.66  ? 426 TYR B CB   1 
ATOM   6174 C  CG   . TYR B 1 211 ? 49.737 19.762 -17.486 1.00 22.48  ? 426 TYR B CG   1 
ATOM   6175 C  CD1  . TYR B 1 211 ? 49.365 18.615 -16.833 1.00 20.09  ? 426 TYR B CD1  1 
ATOM   6176 C  CD2  . TYR B 1 211 ? 49.786 20.951 -16.748 1.00 21.51  ? 426 TYR B CD2  1 
ATOM   6177 C  CE1  . TYR B 1 211 ? 49.012 18.621 -15.527 1.00 25.28  ? 426 TYR B CE1  1 
ATOM   6178 C  CE2  . TYR B 1 211 ? 49.426 20.958 -15.401 1.00 20.15  ? 426 TYR B CE2  1 
ATOM   6179 C  CZ   . TYR B 1 211 ? 49.029 19.783 -14.799 1.00 22.96  ? 426 TYR B CZ   1 
ATOM   6180 O  OH   . TYR B 1 211 ? 48.676 19.731 -13.461 1.00 27.26  ? 426 TYR B OH   1 
ATOM   6181 H  H    . TYR B 1 211 ? 52.133 21.293 -19.117 1.00 22.62  ? 426 TYR B H    1 
ATOM   6182 H  HA   . TYR B 1 211 ? 51.766 18.610 -18.911 1.00 24.11  ? 426 TYR B HA   1 
ATOM   6183 H  HB2  . TYR B 1 211 ? 49.820 20.592 -19.319 1.00 23.59  ? 426 TYR B HB2  1 
ATOM   6184 H  HB3  . TYR B 1 211 ? 49.515 19.039 -19.352 1.00 23.59  ? 426 TYR B HB3  1 
ATOM   6185 H  HD1  . TYR B 1 211 ? 49.315 17.819 -17.311 1.00 24.11  ? 426 TYR B HD1  1 
ATOM   6186 H  HD2  . TYR B 1 211 ? 50.026 21.746 -17.167 1.00 25.81  ? 426 TYR B HD2  1 
ATOM   6187 H  HE1  . TYR B 1 211 ? 48.754 17.827 -15.118 1.00 30.34  ? 426 TYR B HE1  1 
ATOM   6188 H  HE2  . TYR B 1 211 ? 49.449 21.750 -14.914 1.00 24.18  ? 426 TYR B HE2  1 
ATOM   6189 H  HH   . TYR B 1 211 ? 48.724 20.497 -13.121 1.00 32.71  ? 426 TYR B HH   1 
ATOM   6190 N  N    . VAL B 1 212 ? 51.848 18.129 -21.298 1.00 17.35  ? 427 VAL B N    1 
ATOM   6191 C  CA   . VAL B 1 212 ? 51.807 17.837 -22.703 1.00 16.67  ? 427 VAL B CA   1 
ATOM   6192 C  C    . VAL B 1 212 ? 50.820 16.700 -22.965 1.00 18.56  ? 427 VAL B C    1 
ATOM   6193 O  O    . VAL B 1 212 ? 50.595 15.850 -22.092 1.00 17.67  ? 427 VAL B O    1 
ATOM   6194 C  CB   . VAL B 1 212 ? 53.182 17.507 -23.242 1.00 20.97  ? 427 VAL B CB   1 
ATOM   6195 C  CG1  . VAL B 1 212 ? 54.062 18.706 -23.081 1.00 19.83  ? 427 VAL B CG1  1 
ATOM   6196 C  CG2  . VAL B 1 212 ? 53.800 16.264 -22.589 1.00 18.50  ? 427 VAL B CG2  1 
ATOM   6197 H  H    . VAL B 1 212 ? 52.052 17.451 -20.810 1.00 20.82  ? 427 VAL B H    1 
ATOM   6198 H  HA   . VAL B 1 212 ? 51.486 18.622 -23.174 1.00 20.00  ? 427 VAL B HA   1 
ATOM   6199 H  HB   . VAL B 1 212 ? 53.104 17.328 -24.192 1.00 25.16  ? 427 VAL B HB   1 
ATOM   6200 H  HG11 . VAL B 1 212 ? 54.945 18.497 -23.426 1.00 23.79  ? 427 VAL B HG11 1 
ATOM   6201 H  HG12 . VAL B 1 212 ? 53.680 19.447 -23.577 1.00 23.79  ? 427 VAL B HG12 1 
ATOM   6202 H  HG13 . VAL B 1 212 ? 54.120 18.931 -22.140 1.00 23.79  ? 427 VAL B HG13 1 
ATOM   6203 H  HG21 . VAL B 1 212 ? 54.676 16.107 -22.976 1.00 22.20  ? 427 VAL B HG21 1 
ATOM   6204 H  HG22 . VAL B 1 212 ? 53.883 16.417 -21.635 1.00 22.20  ? 427 VAL B HG22 1 
ATOM   6205 H  HG23 . VAL B 1 212 ? 53.224 15.502 -22.754 1.00 22.20  ? 427 VAL B HG23 1 
ATOM   6206 N  N    . PHE B 1 213 ? 50.264 16.690 -24.179 1.00 16.08  ? 428 PHE B N    1 
ATOM   6207 C  CA   . PHE B 1 213 ? 49.115 15.845 -24.522 1.00 16.35  ? 428 PHE B CA   1 
ATOM   6208 C  C    . PHE B 1 213 ? 49.225 15.005 -25.819 1.00 16.39  ? 428 PHE B C    1 
ATOM   6209 O  O    . PHE B 1 213 ? 49.769 15.430 -26.860 1.00 19.02  ? 428 PHE B O    1 
ATOM   6210 C  CB   . PHE B 1 213 ? 47.858 16.693 -24.691 1.00 18.37  ? 428 PHE B CB   1 
ATOM   6211 C  CG   . PHE B 1 213 ? 47.535 17.561 -23.524 1.00 15.04  ? 428 PHE B CG   1 
ATOM   6212 C  CD1  . PHE B 1 213 ? 48.158 18.786 -23.355 1.00 18.01  ? 428 PHE B CD1  1 
ATOM   6213 C  CD2  . PHE B 1 213 ? 46.626 17.135 -22.589 1.00 18.46  ? 428 PHE B CD2  1 
ATOM   6214 C  CE1  . PHE B 1 213 ? 47.874 19.581 -22.267 1.00 16.46  ? 428 PHE B CE1  1 
ATOM   6215 C  CE2  . PHE B 1 213 ? 46.306 17.925 -21.478 1.00 17.39  ? 428 PHE B CE2  1 
ATOM   6216 C  CZ   . PHE B 1 213 ? 46.940 19.141 -21.312 1.00 17.05  ? 428 PHE B CZ   1 
ATOM   6217 H  H    . PHE B 1 213 ? 50.541 17.173 -24.835 1.00 19.29  ? 428 PHE B H    1 
ATOM   6218 H  HA   . PHE B 1 213 ? 48.957 15.230 -23.788 1.00 19.62  ? 428 PHE B HA   1 
ATOM   6219 H  HB2  . PHE B 1 213 ? 47.975 17.270 -25.462 1.00 22.04  ? 428 PHE B HB2  1 
ATOM   6220 H  HB3  . PHE B 1 213 ? 47.103 16.103 -24.836 1.00 22.04  ? 428 PHE B HB3  1 
ATOM   6221 H  HD1  . PHE B 1 213 ? 48.781 19.074 -23.982 1.00 21.61  ? 428 PHE B HD1  1 
ATOM   6222 H  HD2  . PHE B 1 213 ? 46.207 16.313 -22.701 1.00 22.15  ? 428 PHE B HD2  1 
ATOM   6223 H  HE1  . PHE B 1 213 ? 48.296 20.403 -22.165 1.00 19.75  ? 428 PHE B HE1  1 
ATOM   6224 H  HE2  . PHE B 1 213 ? 45.688 17.626 -20.850 1.00 20.87  ? 428 PHE B HE2  1 
ATOM   6225 H  HZ   . PHE B 1 213 ? 46.736 19.677 -20.580 1.00 20.46  ? 428 PHE B HZ   1 
ATOM   6226 N  N    . GLU B 1 214 ? 48.641 13.832 -25.705 1.00 19.60  ? 429 GLU B N    1 
ATOM   6227 C  CA   . GLU B 1 214 ? 48.294 12.968 -26.815 1.00 22.70  ? 429 GLU B CA   1 
ATOM   6228 C  C    . GLU B 1 214 ? 46.879 12.519 -26.607 1.00 20.59  ? 429 GLU B C    1 
ATOM   6229 O  O    . GLU B 1 214 ? 46.359 12.657 -25.500 1.00 24.11  ? 429 GLU B O    1 
ATOM   6230 C  CB   . GLU B 1 214 ? 49.177 11.750 -26.873 1.00 23.33  ? 429 GLU B CB   1 
ATOM   6231 C  CG   . GLU B 1 214 ? 50.556 12.063 -27.361 1.00 36.49  ? 429 GLU B CG   1 
ATOM   6232 C  CD   . GLU B 1 214 ? 51.254 10.837 -27.871 1.00 48.94  ? 429 GLU B CD   1 
ATOM   6233 O  OE1  . GLU B 1 214 ? 50.682 9.715  -27.757 1.00 36.02  ? 429 GLU B OE1  1 
ATOM   6234 O  OE2  . GLU B 1 214 ? 52.364 11.002 -28.424 1.00 39.96  ? 429 GLU B OE2  1 
ATOM   6235 H  H    . GLU B 1 214 ? 48.422 13.494 -24.945 1.00 23.52  ? 429 GLU B H    1 
ATOM   6236 H  HA   . GLU B 1 214 ? 48.357 13.453 -27.653 1.00 27.24  ? 429 GLU B HA   1 
ATOM   6237 H  HB2  . GLU B 1 214 ? 49.251 11.371 -25.984 1.00 27.99  ? 429 GLU B HB2  1 
ATOM   6238 H  HB3  . GLU B 1 214 ? 48.783 11.103 -27.479 1.00 27.99  ? 429 GLU B HB3  1 
ATOM   6239 H  HG2  . GLU B 1 214 ? 50.501 12.704 -28.086 1.00 43.79  ? 429 GLU B HG2  1 
ATOM   6240 H  HG3  . GLU B 1 214 ? 51.079 12.427 -26.630 1.00 43.79  ? 429 GLU B HG3  1 
ATOM   6241 N  N    . VAL B 1 215 ? 46.259 11.943 -27.639 1.00 25.09  ? 430 VAL B N    1 
ATOM   6242 C  CA   . VAL B 1 215 ? 44.897 11.486 -27.459 1.00 20.62  ? 430 VAL B CA   1 
ATOM   6243 C  C    . VAL B 1 215 ? 45.030 10.008 -27.225 1.00 18.48  ? 430 VAL B C    1 
ATOM   6244 O  O    . VAL B 1 215 ? 45.836 9.325  -27.887 1.00 27.05  ? 430 VAL B O    1 
ATOM   6245 C  CB   . VAL B 1 215 ? 43.920 11.798 -28.621 1.00 21.76  ? 430 VAL B CB   1 
ATOM   6246 C  CG1  . VAL B 1 215 ? 43.790 13.312 -28.829 1.00 28.44  ? 430 VAL B CG1  1 
ATOM   6247 C  CG2  . VAL B 1 215 ? 44.371 11.100 -29.877 1.00 47.34  ? 430 VAL B CG2  1 
ATOM   6248 H  H    . VAL B 1 215 ? 46.594 11.813 -28.420 1.00 30.11  ? 430 VAL B H    1 
ATOM   6249 H  HA   . VAL B 1 215 ? 44.535 11.886 -26.653 1.00 24.74  ? 430 VAL B HA   1 
ATOM   6250 H  HB   . VAL B 1 215 ? 43.043 11.455 -28.391 1.00 26.11  ? 430 VAL B HB   1 
ATOM   6251 H  HG11 . VAL B 1 215 ? 43.175 13.479 -29.560 1.00 34.13  ? 430 VAL B HG11 1 
ATOM   6252 H  HG12 . VAL B 1 215 ? 43.452 13.715 -28.014 1.00 34.13  ? 430 VAL B HG12 1 
ATOM   6253 H  HG13 . VAL B 1 215 ? 44.664 13.678 -29.041 1.00 34.13  ? 430 VAL B HG13 1 
ATOM   6254 H  HG21 . VAL B 1 215 ? 43.750 11.306 -30.592 1.00 56.81  ? 430 VAL B HG21 1 
ATOM   6255 H  HG22 . VAL B 1 215 ? 45.260 11.412 -30.109 1.00 56.81  ? 430 VAL B HG22 1 
ATOM   6256 H  HG23 . VAL B 1 215 ? 44.387 10.144 -29.717 1.00 56.81  ? 430 VAL B HG23 1 
ATOM   6257 N  N    . SER B 1 216 ? 44.267 9.512  -26.269 1.00 26.62  ? 431 SER B N    1 
ATOM   6258 C  CA   . SER B 1 216 ? 44.204 8.097  -26.028 1.00 28.44  ? 431 SER B CA   1 
ATOM   6259 C  C    . SER B 1 216 ? 43.400 7.401  -27.152 1.00 30.89  ? 431 SER B C    1 
ATOM   6260 O  O    . SER B 1 216 ? 42.462 7.964  -27.738 1.00 31.16  ? 431 SER B O    1 
ATOM   6261 C  CB   . SER B 1 216 ? 43.563 7.825  -24.677 1.00 28.14  ? 431 SER B CB   1 
ATOM   6262 O  OG   . SER B 1 216 ? 43.658 6.453  -24.333 1.00 30.14  ? 431 SER B OG   1 
ATOM   6263 H  H    . SER B 1 216 ? 43.774 9.983  -25.745 1.00 31.95  ? 431 SER B H    1 
ATOM   6264 H  HA   . SER B 1 216 ? 45.102 7.730  -26.021 1.00 34.13  ? 431 SER B HA   1 
ATOM   6265 H  HB2  . SER B 1 216 ? 44.018 8.352  -24.001 1.00 33.77  ? 431 SER B HB2  1 
ATOM   6266 H  HB3  . SER B 1 216 ? 42.627 8.076  -24.716 1.00 33.77  ? 431 SER B HB3  1 
ATOM   6267 H  HG   . SER B 1 216 ? 43.300 6.319  -23.585 1.00 36.17  ? 431 SER B HG   1 
ATOM   6268 N  N    . THR B 1 217 ? 43.770 6.176  -27.450 1.00 38.20  ? 432 THR B N    1 
ATOM   6269 C  CA   . THR B 1 217 ? 42.918 5.321  -28.281 1.00 48.97  ? 432 THR B CA   1 
ATOM   6270 C  C    . THR B 1 217 ? 41.496 5.181  -27.699 1.00 46.42  ? 432 THR B C    1 
ATOM   6271 O  O    . THR B 1 217 ? 41.271 5.405  -26.512 1.00 51.56  ? 432 THR B O    1 
ATOM   6272 C  CB   . THR B 1 217 ? 43.533 3.919  -28.435 1.00 41.88  ? 432 THR B CB   1 
ATOM   6273 O  OG1  . THR B 1 217 ? 43.784 3.373  -27.130 1.00 44.01  ? 432 THR B OG1  1 
ATOM   6274 C  CG2  . THR B 1 217 ? 44.841 4.004  -29.201 1.00 41.90  ? 432 THR B CG2  1 
ATOM   6275 H  H    . THR B 1 217 ? 44.503 5.807  -27.191 1.00 45.84  ? 432 THR B H    1 
ATOM   6276 H  HA   . THR B 1 217 ? 42.842 5.714  -29.164 1.00 58.76  ? 432 THR B HA   1 
ATOM   6277 H  HB   . THR B 1 217 ? 42.922 3.343  -28.921 1.00 50.25  ? 432 THR B HB   1 
ATOM   6278 H  HG1  . THR B 1 217 ? 44.120 2.607  -27.199 1.00 52.81  ? 432 THR B HG1  1 
ATOM   6279 H  HG21 . THR B 1 217 ? 45.227 3.120  -29.297 1.00 50.28  ? 432 THR B HG21 1 
ATOM   6280 H  HG22 . THR B 1 217 ? 44.685 4.378  -30.082 1.00 50.28  ? 432 THR B HG22 1 
ATOM   6281 H  HG23 . THR B 1 217 ? 45.467 4.572  -28.724 1.00 50.28  ? 432 THR B HG23 1 
ATOM   6282 N  N    . SER B 1 218 ? 40.550 4.794  -28.547 1.00 71.17  ? 433 SER B N    1 
ATOM   6283 C  CA   . SER B 1 218 ? 39.127 4.765  -28.189 1.00 74.85  ? 433 SER B CA   1 
ATOM   6284 C  C    . SER B 1 218 ? 38.789 3.834  -26.995 1.00 69.12  ? 433 SER B C    1 
ATOM   6285 O  O    . SER B 1 218 ? 37.997 4.210  -26.125 1.00 67.16  ? 433 SER B O    1 
ATOM   6286 C  CB   . SER B 1 218 ? 38.298 4.362  -29.431 1.00 59.89  ? 433 SER B CB   1 
ATOM   6287 O  OG   . SER B 1 218 ? 38.845 3.224  -30.079 1.00 65.60  ? 433 SER B OG   1 
ATOM   6288 H  H    . SER B 1 218 ? 40.706 4.539  -29.353 1.00 85.41  ? 433 SER B H    1 
ATOM   6289 H  HA   . SER B 1 218 ? 38.858 5.663  -27.940 1.00 89.81  ? 433 SER B HA   1 
ATOM   6290 H  HB2  . SER B 1 218 ? 37.393 4.157  -29.150 1.00 71.87  ? 433 SER B HB2  1 
ATOM   6291 H  HB3  . SER B 1 218 ? 38.289 5.104  -30.056 1.00 71.87  ? 433 SER B HB3  1 
ATOM   6292 H  HG   . SER B 1 218 ? 38.380 3.023  -30.749 1.00 78.72  ? 433 SER B HG   1 
ATOM   6293 N  N    . GLU B 1 219 ? 39.394 2.644  -26.952 1.00 48.08  ? 434 GLU B N    1 
ATOM   6294 C  CA   . GLU B 1 219 ? 39.128 1.651  -25.883 1.00 60.16  ? 434 GLU B CA   1 
ATOM   6295 C  C    . GLU B 1 219 ? 39.748 2.022  -24.507 1.00 50.09  ? 434 GLU B C    1 
ATOM   6296 O  O    . GLU B 1 219 ? 39.227 1.619  -23.463 1.00 47.39  ? 434 GLU B O    1 
ATOM   6297 C  CB   . GLU B 1 219 ? 39.642 0.257  -26.318 1.00 55.36  ? 434 GLU B CB   1 
ATOM   6298 C  CG   . GLU B 1 219 ? 39.229 -0.180 -27.729 1.00 68.66  ? 434 GLU B CG   1 
ATOM   6299 C  CD   . GLU B 1 219 ? 39.921 -1.471 -28.194 1.00 78.13  ? 434 GLU B CD   1 
ATOM   6300 O  OE1  . GLU B 1 219 ? 39.969 -2.440 -27.409 1.00 76.90  ? 434 GLU B OE1  1 
ATOM   6301 O  OE2  . GLU B 1 219 ? 40.415 -1.519 -29.349 1.00 81.66  ? 434 GLU B OE2  1 
ATOM   6302 H  H    . GLU B 1 219 ? 39.969 2.378  -27.533 1.00 57.70  ? 434 GLU B H    1 
ATOM   6303 H  HA   . GLU B 1 219 ? 38.169 1.583  -25.760 1.00 72.20  ? 434 GLU B HA   1 
ATOM   6304 H  HB2  . GLU B 1 219 ? 40.611 0.263  -26.286 1.00 66.44  ? 434 GLU B HB2  1 
ATOM   6305 H  HB3  . GLU B 1 219 ? 39.300 -0.404 -25.696 1.00 66.44  ? 434 GLU B HB3  1 
ATOM   6306 H  HG2  . GLU B 1 219 ? 38.271 -0.334 -27.743 1.00 82.40  ? 434 GLU B HG2  1 
ATOM   6307 H  HG3  . GLU B 1 219 ? 39.459 0.524  -28.356 1.00 82.40  ? 434 GLU B HG3  1 
ATOM   6308 N  N    . ARG B 1 220 ? 40.852 2.779  -24.514 1.00 39.02  ? 435 ARG B N    1 
ATOM   6309 C  CA   . ARG B 1 220 ? 41.546 3.183  -23.291 1.00 37.15  ? 435 ARG B CA   1 
ATOM   6310 C  C    . ARG B 1 220 ? 41.112 4.569  -22.787 1.00 44.94  ? 435 ARG B C    1 
ATOM   6311 O  O    . ARG B 1 220 ? 40.971 5.555  -23.538 1.00 33.88  ? 435 ARG B O    1 
ATOM   6312 C  CB   . ARG B 1 220 ? 43.063 3.195  -23.501 1.00 36.35  ? 435 ARG B CB   1 
ATOM   6313 C  CG   . ARG B 1 220 ? 43.664 1.842  -23.751 1.00 39.25  ? 435 ARG B CG   1 
ATOM   6314 C  CD   . ARG B 1 220 ? 45.165 1.900  -23.906 1.00 38.83  ? 435 ARG B CD   1 
ATOM   6315 N  NE   . ARG B 1 220 ? 45.885 2.057  -22.631 1.00 37.93  ? 435 ARG B NE   1 
ATOM   6316 C  CZ   . ARG B 1 220 ? 47.163 1.720  -22.455 1.00 38.77  ? 435 ARG B CZ   1 
ATOM   6317 N  NH1  . ARG B 1 220 ? 47.881 1.207  -23.447 1.00 40.53  ? 435 ARG B NH1  1 
ATOM   6318 N  NH2  . ARG B 1 220 ? 47.734 1.893  -21.288 1.00 38.21  ? 435 ARG B NH2  1 
ATOM   6319 H  H    . ARG B 1 220 ? 41.223 3.076  -25.231 1.00 46.83  ? 435 ARG B H    1 
ATOM   6320 H  HA   . ARG B 1 220 ? 41.348 2.539  -22.593 1.00 44.58  ? 435 ARG B HA   1 
ATOM   6321 H  HB2  . ARG B 1 220 ? 43.266 3.753  -24.268 1.00 43.62  ? 435 ARG B HB2  1 
ATOM   6322 H  HB3  . ARG B 1 220 ? 43.484 3.563  -22.709 1.00 43.62  ? 435 ARG B HB3  1 
ATOM   6323 H  HG2  . ARG B 1 220 ? 43.461 1.261  -23.001 1.00 47.10  ? 435 ARG B HG2  1 
ATOM   6324 H  HG3  . ARG B 1 220 ? 43.291 1.474  -24.567 1.00 47.10  ? 435 ARG B HG3  1 
ATOM   6325 H  HD2  . ARG B 1 220 ? 45.470 1.077  -24.319 1.00 46.60  ? 435 ARG B HD2  1 
ATOM   6326 H  HD3  . ARG B 1 220 ? 45.393 2.655  -24.470 1.00 46.60  ? 435 ARG B HD3  1 
ATOM   6327 H  HE   . ARG B 1 220 ? 45.431 2.291  -21.939 1.00 45.51  ? 435 ARG B HE   1 
ATOM   6328 H  HH11 . ARG B 1 220 ? 47.522 1.088  -24.219 1.00 48.64  ? 435 ARG B HH11 1 
ATOM   6329 H  HH12 . ARG B 1 220 ? 48.704 0.995  -23.317 1.00 48.64  ? 435 ARG B HH12 1 
ATOM   6330 H  HH21 . ARG B 1 220 ? 47.284 2.223  -20.634 1.00 45.85  ? 435 ARG B HH21 1 
ATOM   6331 H  HH22 . ARG B 1 220 ? 48.558 1.674  -21.176 1.00 45.85  ? 435 ARG B HH22 1 
ATOM   6332 N  N    . GLY B 1 221 ? 40.904 4.629  -21.495 1.00 34.28  ? 436 GLY B N    1 
ATOM   6333 C  CA   . GLY B 1 221 ? 40.485 5.849  -20.868 1.00 33.31  ? 436 GLY B CA   1 
ATOM   6334 C  C    . GLY B 1 221 ? 41.703 6.738  -20.689 1.00 29.72  ? 436 GLY B C    1 
ATOM   6335 O  O    . GLY B 1 221 ? 42.774 6.439  -21.263 1.00 29.55  ? 436 GLY B O    1 
ATOM   6336 H  H    . GLY B 1 221 ? 41.001 3.968  -20.953 1.00 41.13  ? 436 GLY B H    1 
ATOM   6337 H  HA2  . GLY B 1 221 ? 39.834 6.306  -21.423 1.00 39.97  ? 436 GLY B HA2  1 
ATOM   6338 H  HA3  . GLY B 1 221 ? 40.093 5.664  -20.000 1.00 39.97  ? 436 GLY B HA3  1 
ATOM   6339 N  N    . ALA B 1 222 ? 41.549 7.810  -19.916 1.00 33.05  ? 437 ALA B N    1 
ATOM   6340 C  CA   . ALA B 1 222 ? 42.629 8.774  -19.666 1.00 27.94  ? 437 ALA B CA   1 
ATOM   6341 C  C    . ALA B 1 222 ? 43.767 8.154  -18.868 1.00 27.28  ? 437 ALA B C    1 
ATOM   6342 O  O    . ALA B 1 222 ? 43.553 7.324  -18.029 1.00 27.80  ? 437 ALA B O    1 
ATOM   6343 C  CB   . ALA B 1 222 ? 42.080 10.005 -18.943 1.00 28.23  ? 437 ALA B CB   1 
ATOM   6344 H  H    . ALA B 1 222 ? 40.815 8.009  -19.516 1.00 39.66  ? 437 ALA B H    1 
ATOM   6345 H  HA   . ALA B 1 222 ? 42.990 9.066  -20.518 1.00 33.53  ? 437 ALA B HA   1 
ATOM   6346 H  HB1  . ALA B 1 222 ? 42.806 10.629 -18.786 1.00 33.87  ? 437 ALA B HB1  1 
ATOM   6347 H  HB2  . ALA B 1 222 ? 41.400 10.419 -19.497 1.00 33.87  ? 437 ALA B HB2  1 
ATOM   6348 H  HB3  . ALA B 1 222 ? 41.693 9.727  -18.097 1.00 33.87  ? 437 ALA B HB3  1 
ATOM   6349 N  N    . GLN B 1 223 ? 44.984 8.574  -19.151 1.00 25.35  ? 438 GLN B N    1 
ATOM   6350 C  CA   . GLN B 1 223 ? 46.157 8.082  -18.440 1.00 27.80  ? 438 GLN B CA   1 
ATOM   6351 C  C    . GLN B 1 223 ? 47.206 9.192  -18.426 1.00 23.94  ? 438 GLN B C    1 
ATOM   6352 O  O    . GLN B 1 223 ? 47.153 10.089 -19.244 1.00 22.51  ? 438 GLN B O    1 
ATOM   6353 C  CB   . GLN B 1 223 ? 46.690 6.821  -19.119 1.00 33.40  ? 438 GLN B CB   1 
ATOM   6354 C  CG   . GLN B 1 223 ? 47.550 5.925  -18.241 1.00 49.40  ? 438 GLN B CG   1 
ATOM   6355 C  CD   . GLN B 1 223 ? 47.503 4.429  -18.636 1.00 49.28  ? 438 GLN B CD   1 
ATOM   6356 O  OE1  . GLN B 1 223 ? 47.261 4.064  -19.796 1.00 41.60  ? 438 GLN B OE1  1 
ATOM   6357 N  NE2  . GLN B 1 223 ? 47.733 3.562  -17.653 1.00 42.99  ? 438 GLN B NE2  1 
ATOM   6358 H  H    . GLN B 1 223 ? 45.165 9.153  -19.761 1.00 30.43  ? 438 GLN B H    1 
ATOM   6359 H  HA   . GLN B 1 223 ? 45.919 7.867  -17.525 1.00 33.36  ? 438 GLN B HA   1 
ATOM   6360 H  HB2  . GLN B 1 223 ? 45.935 6.293  -19.423 1.00 40.08  ? 438 GLN B HB2  1 
ATOM   6361 H  HB3  . GLN B 1 223 ? 47.229 7.086  -19.881 1.00 40.08  ? 438 GLN B HB3  1 
ATOM   6362 H  HG2  . GLN B 1 223 ? 48.472 6.219  -18.303 1.00 59.28  ? 438 GLN B HG2  1 
ATOM   6363 H  HG3  . GLN B 1 223 ? 47.243 5.999  -17.324 1.00 59.28  ? 438 GLN B HG3  1 
ATOM   6364 H  HE21 . GLN B 1 223 ? 47.896 3.847  -16.858 1.00 51.59  ? 438 GLN B HE21 1 
ATOM   6365 H  HE22 . GLN B 1 223 ? 47.720 2.718  -17.813 1.00 51.59  ? 438 GLN B HE22 1 
ATOM   6366 N  N    . HIS B 1 224 ? 48.155 9.116  -17.499 1.00 24.14  ? 439 HIS B N    1 
ATOM   6367 C  CA   . HIS B 1 224 ? 49.210 10.112 -17.370 1.00 22.29  ? 439 HIS B CA   1 
ATOM   6368 C  C    . HIS B 1 224 ? 50.522 9.481  -16.960 1.00 23.74  ? 439 HIS B C    1 
ATOM   6369 O  O    . HIS B 1 224 ? 50.561 8.405  -16.476 1.00 25.79  ? 439 HIS B O    1 
ATOM   6370 C  CB   . HIS B 1 224 ? 48.827 11.173 -16.341 1.00 24.02  ? 439 HIS B CB   1 
ATOM   6371 C  CG   . HIS B 1 224 ? 48.583 10.612 -14.990 1.00 26.48  ? 439 HIS B CG   1 
ATOM   6372 N  ND1  . HIS B 1 224 ? 49.584 10.539 -14.043 1.00 29.28  ? 439 HIS B ND1  1 
ATOM   6373 C  CD2  . HIS B 1 224 ? 47.483 10.068 -14.437 1.00 30.80  ? 439 HIS B CD2  1 
ATOM   6374 C  CE1  . HIS B 1 224 ? 49.100 9.974  -12.957 1.00 31.43  ? 439 HIS B CE1  1 
ATOM   6375 N  NE2  . HIS B 1 224 ? 47.827 9.688  -13.155 1.00 31.32  ? 439 HIS B NE2  1 
ATOM   6376 H  H    . HIS B 1 224 ? 48.209 8.482  -16.921 1.00 28.97  ? 439 HIS B H    1 
ATOM   6377 H  HA   . HIS B 1 224 ? 49.340 10.551 -18.225 1.00 26.75  ? 439 HIS B HA   1 
ATOM   6378 H  HB2  . HIS B 1 224 ? 49.548 11.818 -16.271 1.00 28.82  ? 439 HIS B HB2  1 
ATOM   6379 H  HB3  . HIS B 1 224 ? 48.015 11.615 -16.633 1.00 28.82  ? 439 HIS B HB3  1 
ATOM   6380 H  HD1  . HIS B 1 224 ? 50.393 10.811 -14.147 1.00 35.14  ? 439 HIS B HD1  1 
ATOM   6381 H  HD2  . HIS B 1 224 ? 46.648 9.977  -14.837 1.00 36.96  ? 439 HIS B HD2  1 
ATOM   6382 H  HE1  . HIS B 1 224 ? 49.572 9.822  -12.170 1.00 37.72  ? 439 HIS B HE1  1 
ATOM   6383 N  N    . HIS B 1 225 ? 51.607 10.178 -17.210 1.00 23.66  ? 440 HIS B N    1 
ATOM   6384 C  CA   . HIS B 1 225 ? 52.908 9.803  -16.712 1.00 24.64  ? 440 HIS B CA   1 
ATOM   6385 C  C    . HIS B 1 225 ? 53.590 11.073 -16.211 1.00 23.24  ? 440 HIS B C    1 
ATOM   6386 O  O    . HIS B 1 225 ? 53.620 12.098 -16.898 1.00 24.61  ? 440 HIS B O    1 
ATOM   6387 C  CB   . HIS B 1 225 ? 53.747 9.102  -17.815 1.00 28.75  ? 440 HIS B CB   1 
ATOM   6388 C  CG   . HIS B 1 225 ? 54.944 8.375  -17.291 1.00 40.42  ? 440 HIS B CG   1 
ATOM   6389 N  ND1  . HIS B 1 225 ? 56.020 9.025  -16.723 1.00 49.99  ? 440 HIS B ND1  1 
ATOM   6390 C  CD2  . HIS B 1 225 ? 55.232 7.055  -17.228 1.00 60.79  ? 440 HIS B CD2  1 
ATOM   6391 C  CE1  . HIS B 1 225 ? 56.920 8.139  -16.344 1.00 51.68  ? 440 HIS B CE1  1 
ATOM   6392 N  NE2  . HIS B 1 225 ? 56.468 6.932  -16.639 1.00 50.35  ? 440 HIS B NE2  1 
ATOM   6393 H  H    . HIS B 1 225 ? 51.615 10.897 -17.682 1.00 28.39  ? 440 HIS B H    1 
ATOM   6394 H  HA   . HIS B 1 225 ? 52.807 9.192  -15.965 1.00 29.56  ? 440 HIS B HA   1 
ATOM   6395 H  HB2  . HIS B 1 225 ? 53.185 8.457  -18.272 1.00 34.51  ? 440 HIS B HB2  1 
ATOM   6396 H  HB3  . HIS B 1 225 ? 54.058 9.771  -18.444 1.00 34.51  ? 440 HIS B HB3  1 
ATOM   6397 H  HD2  . HIS B 1 225 ? 54.696 6.359  -17.533 1.00 72.95  ? 440 HIS B HD2  1 
ATOM   6398 H  HE1  . HIS B 1 225 ? 57.734 8.330  -15.937 1.00 62.01  ? 440 HIS B HE1  1 
ATOM   6399 H  HE2  . HIS B 1 225 ? 56.879 6.192  -16.487 1.00 60.41  ? 440 HIS B HE2  1 
ATOM   6400 N  N    . ILE B 1 226 ? 54.125 11.011 -15.001 1.00 24.15  ? 441 ILE B N    1 
ATOM   6401 C  CA   . ILE B 1 226 ? 54.629 12.180 -14.296 1.00 23.43  ? 441 ILE B CA   1 
ATOM   6402 C  C    . ILE B 1 226 ? 56.162 12.066 -14.266 1.00 24.79  ? 441 ILE B C    1 
ATOM   6403 O  O    . ILE B 1 226 ? 56.671 11.012 -13.924 1.00 27.24  ? 441 ILE B O    1 
ATOM   6404 C  CB   . ILE B 1 226 ? 54.060 12.280 -12.860 1.00 23.62  ? 441 ILE B CB   1 
ATOM   6405 C  CG1  . ILE B 1 226 ? 52.530 12.314 -12.832 1.00 22.66  ? 441 ILE B CG1  1 
ATOM   6406 C  CG2  . ILE B 1 226 ? 54.518 13.578 -12.182 1.00 22.73  ? 441 ILE B CG2  1 
ATOM   6407 C  CD1  . ILE B 1 226 ? 51.960 12.050 -11.419 1.00 24.22  ? 441 ILE B CD1  1 
ATOM   6408 H  H    . ILE B 1 226 ? 54.209 10.281 -14.554 1.00 28.98  ? 441 ILE B H    1 
ATOM   6409 H  HA   . ILE B 1 226 ? 54.387 12.983 -14.783 1.00 28.12  ? 441 ILE B HA   1 
ATOM   6410 H  HB   . ILE B 1 226 ? 54.371 11.523 -12.340 1.00 28.34  ? 441 ILE B HB   1 
ATOM   6411 H  HG12 . ILE B 1 226 ? 52.227 13.189 -13.120 1.00 27.19  ? 441 ILE B HG12 1 
ATOM   6412 H  HG13 . ILE B 1 226 ? 52.187 11.630 -13.428 1.00 27.19  ? 441 ILE B HG13 1 
ATOM   6413 H  HG21 . ILE B 1 226 ? 54.147 13.614 -11.286 1.00 27.28  ? 441 ILE B HG21 1 
ATOM   6414 H  HG22 . ILE B 1 226 ? 55.487 13.587 -12.140 1.00 27.28  ? 441 ILE B HG22 1 
ATOM   6415 H  HG23 . ILE B 1 226 ? 54.202 14.334 -12.702 1.00 27.28  ? 441 ILE B HG23 1 
ATOM   6416 H  HD11 . ILE B 1 226 ? 50.992 12.082 -11.459 1.00 29.07  ? 441 ILE B HD11 1 
ATOM   6417 H  HD12 . ILE B 1 226 ? 52.250 11.173 -11.121 1.00 29.07  ? 441 ILE B HD12 1 
ATOM   6418 H  HD13 . ILE B 1 226 ? 52.290 12.732 -10.813 1.00 29.07  ? 441 ILE B HD13 1 
ATOM   6419 N  N    . TYR B 1 227 ? 56.869 13.144 -14.634 1.00 23.78  ? 442 TYR B N    1 
ATOM   6420 C  CA   . TYR B 1 227 ? 58.347 13.187 -14.583 1.00 25.54  ? 442 TYR B CA   1 
ATOM   6421 C  C    . TYR B 1 227 ? 58.764 14.345 -13.727 1.00 24.99  ? 442 TYR B C    1 
ATOM   6422 O  O    . TYR B 1 227 ? 58.079 15.353 -13.695 1.00 22.91  ? 442 TYR B O    1 
ATOM   6423 C  CB   . TYR B 1 227 ? 59.000 13.361 -15.968 1.00 25.80  ? 442 TYR B CB   1 
ATOM   6424 C  CG   . TYR B 1 227 ? 58.683 12.293 -16.955 1.00 26.47  ? 442 TYR B CG   1 
ATOM   6425 C  CD1  . TYR B 1 227 ? 59.505 11.177 -17.111 1.00 36.23  ? 442 TYR B CD1  1 
ATOM   6426 C  CD2  . TYR B 1 227 ? 57.555 12.377 -17.724 1.00 28.10  ? 442 TYR B CD2  1 
ATOM   6427 C  CE1  . TYR B 1 227 ? 59.192 10.173 -18.008 1.00 35.61  ? 442 TYR B CE1  1 
ATOM   6428 C  CE2  . TYR B 1 227 ? 57.236 11.392 -18.613 1.00 36.46  ? 442 TYR B CE2  1 
ATOM   6429 C  CZ   . TYR B 1 227 ? 58.049 10.302 -18.760 1.00 46.87  ? 442 TYR B CZ   1 
ATOM   6430 O  OH   . TYR B 1 227 ? 57.663 9.341  -19.652 1.00 37.80  ? 442 TYR B OH   1 
ATOM   6431 H  H    . TYR B 1 227 ? 56.515 13.873 -14.921 1.00 28.54  ? 442 TYR B H    1 
ATOM   6432 H  HA   . TYR B 1 227 ? 58.682 12.369 -14.183 1.00 30.65  ? 442 TYR B HA   1 
ATOM   6433 H  HB2  . TYR B 1 227 ? 58.703 14.204 -16.345 1.00 30.96  ? 442 TYR B HB2  1 
ATOM   6434 H  HB3  . TYR B 1 227 ? 59.963 13.377 -15.855 1.00 30.96  ? 442 TYR B HB3  1 
ATOM   6435 H  HD1  . TYR B 1 227 ? 60.273 11.101 -16.592 1.00 43.47  ? 442 TYR B HD1  1 
ATOM   6436 H  HD2  . TYR B 1 227 ? 56.991 13.110 -17.631 1.00 33.72  ? 442 TYR B HD2  1 
ATOM   6437 H  HE1  . TYR B 1 227 ? 59.743 9.430  -18.103 1.00 42.73  ? 442 TYR B HE1  1 
ATOM   6438 H  HE2  . TYR B 1 227 ? 56.463 11.464 -19.124 1.00 43.75  ? 442 TYR B HE2  1 
ATOM   6439 H  HH   . TYR B 1 227 ? 56.948 9.570  -20.029 1.00 45.36  ? 442 TYR B HH   1 
ATOM   6440 N  N    . ARG B 1 228 ? 59.916 14.235 -13.072 1.00 29.69  ? 443 ARG B N    1 
ATOM   6441 C  CA   . ARG B 1 228 ? 60.600 15.439 -12.557 1.00 30.48  ? 443 ARG B CA   1 
ATOM   6442 C  C    . ARG B 1 228 ? 61.257 16.192 -13.707 1.00 30.84  ? 443 ARG B C    1 
ATOM   6443 O  O    . ARG B 1 228 ? 61.847 15.579 -14.570 1.00 31.22  ? 443 ARG B O    1 
ATOM   6444 C  CB   . ARG B 1 228 ? 61.655 15.055 -11.522 1.00 33.67  ? 443 ARG B CB   1 
ATOM   6445 C  CG   . ARG B 1 228 ? 61.101 14.611 -10.182 1.00 41.62  ? 443 ARG B CG   1 
ATOM   6446 C  CD   . ARG B 1 228 ? 62.201 14.089 -9.269  1.00 54.70  ? 443 ARG B CD   1 
ATOM   6447 N  NE   . ARG B 1 228 ? 62.662 12.777 -9.717  1.00 62.79  ? 443 ARG B NE   1 
ATOM   6448 C  CZ   . ARG B 1 228 ? 63.903 12.487 -10.089 1.00 56.00  ? 443 ARG B CZ   1 
ATOM   6449 N  NH1  . ARG B 1 228 ? 64.865 13.407 -10.047 1.00 63.81  ? 443 ARG B NH1  1 
ATOM   6450 N  NH2  . ARG B 1 228 ? 64.183 11.257 -10.509 1.00 58.28  ? 443 ARG B NH2  1 
ATOM   6451 H  H    . ARG B 1 228 ? 60.322 13.494 -12.910 1.00 35.62  ? 443 ARG B H    1 
ATOM   6452 H  HA   . ARG B 1 228 ? 59.952 16.024 -12.134 1.00 36.57  ? 443 ARG B HA   1 
ATOM   6453 H  HB2  . ARG B 1 228 ? 62.184 14.324 -11.877 1.00 40.40  ? 443 ARG B HB2  1 
ATOM   6454 H  HB3  . ARG B 1 228 ? 62.225 15.824 -11.363 1.00 40.40  ? 443 ARG B HB3  1 
ATOM   6455 H  HG2  . ARG B 1 228 ? 60.677 15.366 -9.746  1.00 49.94  ? 443 ARG B HG2  1 
ATOM   6456 H  HG3  . ARG B 1 228 ? 60.458 13.899 -10.322 1.00 49.94  ? 443 ARG B HG3  1 
ATOM   6457 H  HD2  . ARG B 1 228 ? 62.954 14.701 -9.286  1.00 65.64  ? 443 ARG B HD2  1 
ATOM   6458 H  HD3  . ARG B 1 228 ? 61.857 14.001 -8.366  1.00 65.64  ? 443 ARG B HD3  1 
ATOM   6459 H  HE   . ARG B 1 228 ? 62.083 12.141 -9.743  1.00 75.35  ? 443 ARG B HE   1 
ATOM   6460 H  HH11 . ARG B 1 228 ? 64.685 14.206 -9.784  1.00 76.57  ? 443 ARG B HH11 1 
ATOM   6461 H  HH12 . ARG B 1 228 ? 65.665 13.203 -10.287 1.00 76.57  ? 443 ARG B HH12 1 
ATOM   6462 H  HH21 . ARG B 1 228 ? 63.565 10.660 -10.530 1.00 69.93  ? 443 ARG B HH21 1 
ATOM   6463 H  HH22 . ARG B 1 228 ? 64.986 11.054 -10.739 1.00 69.93  ? 443 ARG B HH22 1 
ATOM   6464 N  N    . LEU B 1 229 ? 61.159 17.512 -13.736 1.00 29.69  ? 444 LEU B N    1 
ATOM   6465 C  CA   . LEU B 1 229 ? 61.976 18.283 -14.682 1.00 30.33  ? 444 LEU B CA   1 
ATOM   6466 C  C    . LEU B 1 229 ? 63.284 18.720 -14.049 1.00 31.04  ? 444 LEU B C    1 
ATOM   6467 O  O    . LEU B 1 229 ? 63.297 19.332 -13.013 1.00 30.51  ? 444 LEU B O    1 
ATOM   6468 C  CB   . LEU B 1 229 ? 61.242 19.523 -15.184 1.00 24.88  ? 444 LEU B CB   1 
ATOM   6469 C  CG   . LEU B 1 229 ? 60.232 19.333 -16.298 1.00 30.67  ? 444 LEU B CG   1 
ATOM   6470 C  CD1  . LEU B 1 229 ? 59.359 20.562 -16.289 1.00 25.11  ? 444 LEU B CD1  1 
ATOM   6471 C  CD2  . LEU B 1 229 ? 60.863 19.201 -17.662 1.00 31.67  ? 444 LEU B CD2  1 
ATOM   6472 H  H    . LEU B 1 229 ? 60.642 17.982 -13.235 1.00 35.63  ? 444 LEU B H    1 
ATOM   6473 H  HA   . LEU B 1 229 ? 62.183 17.726 -15.448 1.00 36.40  ? 444 LEU B HA   1 
ATOM   6474 H  HB2  . LEU B 1 229 ? 60.767 19.915 -14.435 1.00 29.86  ? 444 LEU B HB2  1 
ATOM   6475 H  HB3  . LEU B 1 229 ? 61.904 20.154 -15.506 1.00 29.86  ? 444 LEU B HB3  1 
ATOM   6476 H  HG   . LEU B 1 229 ? 59.684 18.552 -16.124 1.00 36.80  ? 444 LEU B HG   1 
ATOM   6477 H  HD11 . LEU B 1 229 ? 58.695 20.482 -16.991 1.00 30.13  ? 444 LEU B HD11 1 
ATOM   6478 H  HD12 . LEU B 1 229 ? 58.923 20.632 -15.426 1.00 30.13  ? 444 LEU B HD12 1 
ATOM   6479 H  HD13 . LEU B 1 229 ? 59.913 21.343 -16.444 1.00 30.13  ? 444 LEU B HD13 1 
ATOM   6480 H  HD21 . LEU B 1 229 ? 60.164 19.083 -18.323 1.00 38.01  ? 444 LEU B HD21 1 
ATOM   6481 H  HD22 . LEU B 1 229 ? 61.368 20.006 -17.855 1.00 38.01  ? 444 LEU B HD22 1 
ATOM   6482 H  HD23 . LEU B 1 229 ? 61.454 18.431 -17.663 1.00 38.01  ? 444 LEU B HD23 1 
ATOM   6483 N  N    . VAL B 1 230 ? 64.392 18.418 -14.712 1.00 34.48  ? 445 VAL B N    1 
ATOM   6484 C  CA   . VAL B 1 230 ? 65.706 18.639 -14.128 1.00 35.16  ? 445 VAL B CA   1 
ATOM   6485 C  C    . VAL B 1 230 ? 66.555 19.442 -15.087 1.00 41.18  ? 445 VAL B C    1 
ATOM   6486 O  O    . VAL B 1 230 ? 66.278 19.499 -16.289 1.00 34.71  ? 445 VAL B O    1 
ATOM   6487 C  CB   . VAL B 1 230 ? 66.404 17.299 -13.762 1.00 37.22  ? 445 VAL B CB   1 
ATOM   6488 C  CG1  . VAL B 1 230 ? 65.479 16.423 -12.903 1.00 37.92  ? 445 VAL B CG1  1 
ATOM   6489 C  CG2  . VAL B 1 230 ? 66.882 16.546 -15.008 1.00 36.90  ? 445 VAL B CG2  1 
ATOM   6490 H  H    . VAL B 1 230 ? 64.411 18.083 -15.503 1.00 41.37  ? 445 VAL B H    1 
ATOM   6491 H  HA   . VAL B 1 230 ? 65.605 19.156 -13.313 1.00 42.19  ? 445 VAL B HA   1 
ATOM   6492 H  HB   . VAL B 1 230 ? 67.188 17.500 -13.228 1.00 44.67  ? 445 VAL B HB   1 
ATOM   6493 H  HG11 . VAL B 1 230 ? 65.938 15.595 -12.690 1.00 45.50  ? 445 VAL B HG11 1 
ATOM   6494 H  HG12 . VAL B 1 230 ? 65.260 16.900 -12.088 1.00 45.50  ? 445 VAL B HG12 1 
ATOM   6495 H  HG13 . VAL B 1 230 ? 64.670 16.233 -13.404 1.00 45.50  ? 445 VAL B HG13 1 
ATOM   6496 H  HG21 . VAL B 1 230 ? 67.309 15.720 -14.732 1.00 44.28  ? 445 VAL B HG21 1 
ATOM   6497 H  HG22 . VAL B 1 230 ? 66.117 16.351 -15.571 1.00 44.28  ? 445 VAL B HG22 1 
ATOM   6498 H  HG23 . VAL B 1 230 ? 67.514 17.102 -15.489 1.00 44.28  ? 445 VAL B HG23 1 
ATOM   6499 N  N    . ARG B 1 231 ? 67.602 20.057 -14.561 1.00 42.22  ? 446 ARG B N    1 
ATOM   6500 C  CA   . ARG B 1 231 ? 68.541 20.748 -15.404 1.00 51.37  ? 446 ARG B CA   1 
ATOM   6501 C  C    . ARG B 1 231 ? 69.969 20.597 -14.924 1.00 49.68  ? 446 ARG B C    1 
ATOM   6502 O  O    . ARG B 1 231 ? 70.275 20.904 -13.770 1.00 61.63  ? 446 ARG B O    1 
ATOM   6503 C  CB   . ARG B 1 231 ? 68.188 22.226 -15.477 1.00 51.15  ? 446 ARG B CB   1 
ATOM   6504 C  CG   . ARG B 1 231 ? 68.769 22.891 -16.721 1.00 65.39  ? 446 ARG B CG   1 
ATOM   6505 C  CD   . ARG B 1 231 ? 68.408 24.361 -16.816 1.00 57.15  ? 446 ARG B CD   1 
ATOM   6506 N  NE   . ARG B 1 231 ? 68.738 25.051 -15.584 1.00 50.98  ? 446 ARG B NE   1 
ATOM   6507 C  CZ   . ARG B 1 231 ? 68.274 26.251 -15.245 1.00 55.23  ? 446 ARG B CZ   1 
ATOM   6508 N  NH1  . ARG B 1 231 ? 67.445 26.895 -16.059 1.00 57.65  ? 446 ARG B NH1  1 
ATOM   6509 N  NH2  . ARG B 1 231 ? 68.633 26.802 -14.082 1.00 63.66  ? 446 ARG B NH2  1 
ATOM   6510 H  H    . ARG B 1 231 ? 67.786 20.085 -13.721 1.00 50.67  ? 446 ARG B H    1 
ATOM   6511 H  HA   . ARG B 1 231 ? 68.486 20.383 -16.301 1.00 61.64  ? 446 ARG B HA   1 
ATOM   6512 H  HB2  . ARG B 1 231 ? 67.223 22.322 -15.505 1.00 61.38  ? 446 ARG B HB2  1 
ATOM   6513 H  HB3  . ARG B 1 231 ? 68.547 22.678 -14.697 1.00 61.38  ? 446 ARG B HB3  1 
ATOM   6514 H  HG2  . ARG B 1 231 ? 69.736 22.819 -16.697 1.00 78.46  ? 446 ARG B HG2  1 
ATOM   6515 H  HG3  . ARG B 1 231 ? 68.422 22.445 -17.510 1.00 78.46  ? 446 ARG B HG3  1 
ATOM   6516 H  HD2  . ARG B 1 231 ? 68.907 24.770 -17.540 1.00 68.58  ? 446 ARG B HD2  1 
ATOM   6517 H  HD3  . ARG B 1 231 ? 67.454 24.449 -16.970 1.00 68.58  ? 446 ARG B HD3  1 
ATOM   6518 H  HE   . ARG B 1 231 ? 69.271 24.658 -15.034 1.00 61.17  ? 446 ARG B HE   1 
ATOM   6519 H  HH11 . ARG B 1 231 ? 67.213 26.539 -16.806 1.00 69.18  ? 446 ARG B HH11 1 
ATOM   6520 H  HH12 . ARG B 1 231 ? 67.144 27.670 -15.840 1.00 69.18  ? 446 ARG B HH12 1 
ATOM   6521 H  HH21 . ARG B 1 231 ? 69.169 26.384 -13.556 1.00 76.40  ? 446 ARG B HH21 1 
ATOM   6522 H  HH22 . ARG B 1 231 ? 68.333 27.578 -13.864 1.00 76.40  ? 446 ARG B HH22 1 
ATOM   6523 N  N    . ASP B 1 232 ? 70.849 20.175 -15.823 1.00 62.86  ? 447 ASP B N    1 
ATOM   6524 C  CA   . ASP B 1 232 ? 72.284 20.203 -15.547 1.00 73.36  ? 447 ASP B CA   1 
ATOM   6525 C  C    . ASP B 1 232 ? 72.742 21.447 -14.775 1.00 77.12  ? 447 ASP B C    1 
ATOM   6526 O  O    . ASP B 1 232 ? 72.330 22.565 -15.087 1.00 79.70  ? 447 ASP B O    1 
ATOM   6527 C  CB   . ASP B 1 232 ? 73.066 20.126 -16.847 1.00 81.55  ? 447 ASP B CB   1 
ATOM   6528 C  CG   . ASP B 1 232 ? 73.623 18.754 -17.092 1.00 88.50  ? 447 ASP B CG   1 
ATOM   6529 O  OD1  . ASP B 1 232 ? 72.892 17.783 -16.793 1.00 70.81  ? 447 ASP B OD1  1 
ATOM   6530 O  OD2  . ASP B 1 232 ? 74.782 18.651 -17.562 1.00 96.47  ? 447 ASP B OD2  1 
ATOM   6531 H  H    . ASP B 1 232 ? 70.644 19.868 -16.599 1.00 75.44  ? 447 ASP B H    1 
ATOM   6532 H  HA   . ASP B 1 232 ? 72.515 19.425 -15.016 1.00 88.03  ? 447 ASP B HA   1 
ATOM   6533 H  HB2  . ASP B 1 232 ? 72.478 20.349 -17.586 1.00 97.85  ? 447 ASP B HB2  1 
ATOM   6534 H  HB3  . ASP B 1 232 ? 73.808 20.750 -16.810 1.00 97.85  ? 447 ASP B HB3  1 
ATOM   6535 N  N    . VAL B 1 233 ? 73.594 21.228 -13.772 1.00 74.12  ? 448 VAL B N    1 
ATOM   6536 C  CA   . VAL B 1 233 ? 74.243 22.299 -13.002 1.00 70.92  ? 448 VAL B CA   1 
ATOM   6537 C  C    . VAL B 1 233 ? 73.295 22.894 -11.977 1.00 66.37  ? 448 VAL B C    1 
ATOM   6538 O  O    . VAL B 1 233 ? 72.523 22.171 -11.344 1.00 77.32  ? 448 VAL B O    1 
ATOM   6539 C  CB   . VAL B 1 233 ? 74.758 23.422 -13.921 1.00 20.00  ? 448 VAL B CB   1 
ATOM   6540 C  CG1  . VAL B 1 233 ? 75.315 24.572 -13.097 1.00 20.00  ? 448 VAL B CG1  1 
ATOM   6541 C  CG2  . VAL B 1 233 ? 75.810 22.885 -14.880 1.00 20.00  ? 448 VAL B CG2  1 
ATOM   6542 H  H    . VAL B 1 233 ? 73.821 20.441 -13.510 1.00 88.94  ? 448 VAL B H    1 
ATOM   6543 H  HA   . VAL B 1 233 ? 74.999 21.923 -12.522 1.00 85.10  ? 448 VAL B HA   1 
HETATM 6544 O  OAD  . 5E4 C 2 .   ? 47.594 42.987 -13.130 1.00 47.49  ? 501 5E4 A OAD  1 
HETATM 6545 C  CAP  . 5E4 C 2 .   ? 47.161 41.988 -13.752 1.00 46.13  ? 501 5E4 A CAP  1 
HETATM 6546 O  OAQ  . 5E4 C 2 .   ? 47.802 40.910 -13.700 1.00 48.39  ? 501 5E4 A OAQ  1 
HETATM 6547 C  CAI  . 5E4 C 2 .   ? 45.864 42.110 -14.550 1.00 58.21  ? 501 5E4 A CAI  1 
HETATM 6548 C  CAH  . 5E4 C 2 .   ? 45.203 41.046 -14.976 1.00 34.25  ? 501 5E4 A CAH  1 
HETATM 6549 C  CAA  . 5E4 C 2 .   ? 43.901 41.220 -15.761 1.00 41.31  ? 501 5E4 A CAA  1 
HETATM 6550 C  CAB  . 5E4 C 2 .   ? 43.459 42.434 -16.026 1.00 66.84  ? 501 5E4 A CAB  1 
HETATM 6551 C  CAC  . 5E4 C 2 .   ? 44.237 43.663 -15.540 1.00 71.13  ? 501 5E4 A CAC  1 
HETATM 6552 C  CAJ  . 5E4 C 2 .   ? 45.354 43.512 -14.858 1.00 49.59  ? 501 5E4 A CAJ  1 
HETATM 6553 N  NAK  . 5E4 C 2 .   ? 46.148 44.623 -14.371 1.00 49.63  ? 501 5E4 A NAK  1 
HETATM 6554 C  CAL  . 5E4 C 2 .   ? 46.129 45.970 -14.928 1.00 40.06  ? 501 5E4 A CAL  1 
HETATM 6555 C  CAM  . 5E4 C 2 .   ? 44.962 46.647 -14.874 1.00 38.57  ? 501 5E4 A CAM  1 
HETATM 6556 C  CAN  . 5E4 C 2 .   ? 44.886 47.924 -15.366 1.00 83.12  ? 501 5E4 A CAN  1 
HETATM 6557 BR BR   . 5E4 C 2 .   ? 43.133 48.728 -15.273 1.00 117.55 ? 501 5E4 A BR   1 
HETATM 6558 C  CAG  . 5E4 C 2 .   ? 45.994 48.582 -15.876 1.00 36.03  ? 501 5E4 A CAG  1 
HETATM 6559 C  CAF  . 5E4 C 2 .   ? 47.198 47.911 -15.924 1.00 41.60  ? 501 5E4 A CAF  1 
HETATM 6560 C  CAE  . 5E4 C 2 .   ? 47.265 46.609 -15.432 1.00 72.75  ? 501 5E4 A CAE  1 
HETATM 6561 H  HAH  . 5E4 C 2 .   ? 45.516 40.193 -14.778 1.00 41.10  ? 501 5E4 A HAH  1 
HETATM 6562 H  HAA  . 5E4 C 2 .   ? 43.429 40.476 -16.057 1.00 49.57  ? 501 5E4 A HAA  1 
HETATM 6563 H  HAB  . 5E4 C 2 .   ? 42.673 42.546 -16.509 1.00 80.21  ? 501 5E4 A HAB  1 
HETATM 6564 H  HAC  . 5E4 C 2 .   ? 43.922 44.517 -15.731 1.00 85.36  ? 501 5E4 A HAC  1 
HETATM 6565 H  HAK  . 5E4 C 2 .   ? 46.723 44.458 -13.752 1.00 59.56  ? 501 5E4 A HAK  1 
HETATM 6566 H  HAM  . 5E4 C 2 .   ? 44.199 46.231 -14.542 1.00 46.29  ? 501 5E4 A HAM  1 
HETATM 6567 H  HAG  . 5E4 C 2 .   ? 45.919 49.446 -16.212 1.00 43.24  ? 501 5E4 A HAG  1 
HETATM 6568 H  HAF  . 5E4 C 2 .   ? 47.957 48.326 -16.265 1.00 49.92  ? 501 5E4 A HAF  1 
HETATM 6569 H  HAE  . 5E4 C 2 .   ? 48.077 46.156 -15.446 1.00 87.30  ? 501 5E4 A HAE  1 
HETATM 6570 O  OAD  . 5E4 D 2 .   ? 40.202 28.015 -17.598 1.00 67.97  ? 501 5E4 B OAD  1 
HETATM 6571 C  CAP  . 5E4 D 2 .   ? 40.648 26.961 -18.114 1.00 53.96  ? 501 5E4 B CAP  1 
HETATM 6572 O  OAQ  . 5E4 D 2 .   ? 39.857 26.045 -18.428 1.00 36.74  ? 501 5E4 B OAQ  1 
HETATM 6573 C  CAI  . 5E4 D 2 .   ? 42.142 26.861 -18.385 1.00 59.46  ? 501 5E4 B CAI  1 
HETATM 6574 C  CAH  . 5E4 D 2 .   ? 42.706 27.980 -18.779 1.00 40.18  ? 501 5E4 B CAH  1 
HETATM 6575 C  CAA  . 5E4 D 2 .   ? 44.189 28.035 -19.078 1.00 56.82  ? 501 5E4 B CAA  1 
HETATM 6576 C  CAB  . 5E4 D 2 .   ? 44.897 26.935 -18.959 1.00 56.75  ? 501 5E4 B CAB  1 
HETATM 6577 C  CAC  . 5E4 D 2 .   ? 44.246 25.625 -18.516 1.00 71.06  ? 501 5E4 B CAC  1 
HETATM 6578 C  CAJ  . 5E4 D 2 .   ? 42.964 25.568 -18.245 1.00 52.46  ? 501 5E4 B CAJ  1 
HETATM 6579 N  NAK  . 5E4 D 2 .   ? 42.342 24.318 -17.815 1.00 46.08  ? 501 5E4 B NAK  1 
HETATM 6580 C  CAL  . 5E4 D 2 .   ? 42.853 22.970 -18.125 1.00 37.00  ? 501 5E4 B CAL  1 
HETATM 6581 C  CAM  . 5E4 D 2 .   ? 44.056 22.569 -17.635 1.00 41.48  ? 501 5E4 B CAM  1 
HETATM 6582 C  CAN  . 5E4 D 2 .   ? 44.543 21.308 -17.913 1.00 63.98  ? 501 5E4 B CAN  1 
HETATM 6583 BR BR   . 5E4 D 2 .   ? 46.285 20.866 -17.195 1.00 106.45 ? 501 5E4 B BR   1 
HETATM 6584 C  CAG  . 5E4 D 2 .   ? 43.827 20.386 -18.661 1.00 29.14  ? 501 5E4 B CAG  1 
HETATM 6585 C  CAF  . 5E4 D 2 .   ? 42.612 20.782 -19.167 1.00 28.62  ? 501 5E4 B CAF  1 
HETATM 6586 C  CAE  . 5E4 D 2 .   ? 42.132 22.060 -18.886 1.00 43.23  ? 501 5E4 B CAE  1 
HETATM 6587 H  HAH  . 5E4 D 2 .   ? 42.192 28.752 -18.855 1.00 48.22  ? 501 5E4 B HAH  1 
HETATM 6588 H  HAA  . 5E4 D 2 .   ? 44.589 28.828 -19.354 1.00 68.19  ? 501 5E4 B HAA  1 
HETATM 6589 H  HAB  . 5E4 D 2 .   ? 45.808 26.953 -19.147 1.00 68.10  ? 501 5E4 B HAB  1 
HETATM 6590 H  HAC  . 5E4 D 2 .   ? 44.767 24.859 -18.434 1.00 85.27  ? 501 5E4 B HAC  1 
HETATM 6591 H  HAK  . 5E4 D 2 .   ? 41.578 24.370 -17.424 1.00 55.30  ? 501 5E4 B HAK  1 
HETATM 6592 H  HAM  . 5E4 D 2 .   ? 44.567 23.159 -17.129 1.00 49.78  ? 501 5E4 B HAM  1 
HETATM 6593 H  HAG  . 5E4 D 2 .   ? 44.176 19.545 -18.849 1.00 34.97  ? 501 5E4 B HAG  1 
HETATM 6594 H  HAF  . 5E4 D 2 .   ? 42.103 20.193 -19.674 1.00 34.35  ? 501 5E4 B HAF  1 
HETATM 6595 H  HAE  . 5E4 D 2 .   ? 41.298 22.310 -19.214 1.00 51.88  ? 501 5E4 B HAE  1 
HETATM 6596 O  OAD  . 5E4 E 2 .   ? 52.945 12.891 -24.422 1.00 102.02 ? 502 5E4 B OAD  1 
HETATM 6597 C  CAP  . 5E4 E 2 .   ? 53.263 11.836 -25.033 1.00 82.76  ? 502 5E4 B CAP  1 
HETATM 6598 O  OAQ  . 5E4 E 2 .   ? 52.463 10.872 -24.977 1.00 80.19  ? 502 5E4 B OAQ  1 
HETATM 6599 C  CAI  . 5E4 E 2 .   ? 54.565 11.770 -25.860 1.00 84.25  ? 502 5E4 B CAI  1 
HETATM 6600 C  CAH  . 5E4 E 2 .   ? 55.112 10.641 -26.284 1.00 89.21  ? 502 5E4 B CAH  1 
HETATM 6601 C  CAA  . 5E4 E 2 .   ? 56.401 10.681 -27.118 1.00 90.07  ? 502 5E4 B CAA  1 
HETATM 6602 C  CAB  . 5E4 E 2 .   ? 56.971 11.833 -27.412 1.00 83.78  ? 502 5E4 B CAB  1 
HETATM 6603 C  CAC  . 5E4 E 2 .   ? 56.343 13.139 -26.917 1.00 87.94  ? 502 5E4 B CAC  1 
HETATM 6604 C  CAJ  . 5E4 E 2 .   ? 55.224 13.098 -26.219 1.00 75.87  ? 502 5E4 B CAJ  1 
HETATM 6605 N  NAK  . 5E4 E 2 .   ? 54.544 14.250 -25.670 1.00 55.86  ? 502 5E4 B NAK  1 
HETATM 6606 C  CAL  . 5E4 E 2 .   ? 54.528 15.620 -26.132 1.00 67.45  ? 502 5E4 B CAL  1 
HETATM 6607 C  CAM  . 5E4 E 2 .   ? 55.559 16.465 -25.762 1.00 85.93  ? 502 5E4 B CAM  1 
HETATM 6608 C  CAN  . 5E4 E 2 .   ? 55.519 17.798 -26.153 1.00 124.65 ? 502 5E4 B CAN  1 
HETATM 6609 BR BR   . 5E4 E 2 .   ? 56.957 19.015 -25.691 1.00 123.98 ? 502 5E4 B BR   1 
HETATM 6610 C  CAG  . 5E4 E 2 .   ? 54.448 18.289 -26.878 1.00 77.57  ? 502 5E4 B CAG  1 
HETATM 6611 C  CAF  . 5E4 E 2 .   ? 53.410 17.445 -27.216 1.00 57.66  ? 502 5E4 B CAF  1 
HETATM 6612 C  CAE  . 5E4 E 2 .   ? 53.436 16.110 -26.849 1.00 37.07  ? 502 5E4 B CAE  1 
HETATM 6613 H  HAH  . 5E4 E 2 .   ? 54.709 9.826  -26.089 1.00 107.05 ? 502 5E4 B HAH  1 
HETATM 6614 H  HAA  . 5E4 E 2 .   ? 56.782 9.888  -27.418 1.00 108.09 ? 502 5E4 B HAA  1 
HETATM 6615 H  HAB  . 5E4 E 2 .   ? 57.755 11.852 -27.912 1.00 100.54 ? 502 5E4 B HAB  1 
HETATM 6616 H  HAC  . 5E4 E 2 .   ? 56.741 13.956 -27.118 1.00 105.53 ? 502 5E4 B HAC  1 
HETATM 6617 H  HAK  . 5E4 E 2 .   ? 54.205 14.130 -24.889 1.00 67.03  ? 502 5E4 B HAK  1 
HETATM 6618 H  HAM  . 5E4 E 2 .   ? 56.277 16.142 -25.267 1.00 103.12 ? 502 5E4 B HAM  1 
HETATM 6619 H  HAG  . 5E4 E 2 .   ? 54.432 19.180 -27.145 1.00 93.09  ? 502 5E4 B HAG  1 
HETATM 6620 H  HAF  . 5E4 E 2 .   ? 52.697 17.770 -27.716 1.00 69.19  ? 502 5E4 B HAF  1 
HETATM 6621 H  HAE  . 5E4 E 2 .   ? 52.731 15.547 -27.074 1.00 44.49  ? 502 5E4 B HAE  1 
HETATM 6622 O  O    . HOH F 3 .   ? 38.917 54.922 2.003   1.00 50.16  ? 601 HOH A O    1 
HETATM 6623 O  O    . HOH F 3 .   ? 43.244 49.870 -25.068 1.00 25.78  ? 602 HOH A O    1 
HETATM 6624 O  O    . HOH F 3 .   ? 59.303 40.028 -20.412 1.00 60.49  ? 603 HOH A O    1 
HETATM 6625 O  O    . HOH F 3 .   ? 27.679 49.234 -5.994  1.00 41.56  ? 604 HOH A O    1 
HETATM 6626 O  O    . HOH F 3 .   ? 47.147 59.817 -27.482 1.00 35.75  ? 605 HOH A O    1 
HETATM 6627 O  O    . HOH F 3 .   ? 24.972 37.976 -9.969  1.00 64.23  ? 606 HOH A O    1 
HETATM 6628 O  O    . HOH F 3 .   ? 39.638 44.084 -27.529 1.00 43.80  ? 607 HOH A O    1 
HETATM 6629 O  O    . HOH F 3 .   ? 48.817 38.841 -27.978 1.00 61.54  ? 608 HOH A O    1 
HETATM 6630 O  O    . HOH F 3 .   ? 23.552 33.089 -20.879 1.00 62.58  ? 609 HOH A O    1 
HETATM 6631 O  O    . HOH F 3 .   ? 44.961 48.444 -35.306 1.00 37.48  ? 610 HOH A O    1 
HETATM 6632 O  O    . HOH F 3 .   ? 30.087 39.815 1.611   1.00 40.88  ? 611 HOH A O    1 
HETATM 6633 O  O    . HOH F 3 .   ? 52.297 67.461 -17.552 1.00 44.74  ? 612 HOH A O    1 
HETATM 6634 O  O    . HOH F 3 .   ? 57.224 57.083 -39.045 1.00 39.76  ? 613 HOH A O    1 
HETATM 6635 O  O    . HOH F 3 .   ? 35.934 63.382 -19.770 1.00 67.75  ? 614 HOH A O    1 
HETATM 6636 O  O    . HOH F 3 .   ? 52.469 40.221 -27.320 1.00 51.68  ? 615 HOH A O    1 
HETATM 6637 O  O    . HOH F 3 .   ? 50.356 35.521 -12.265 1.00 46.24  ? 616 HOH A O    1 
HETATM 6638 O  O    . HOH F 3 .   ? 41.201 40.662 -10.337 1.00 21.29  ? 617 HOH A O    1 
HETATM 6639 O  O    . HOH F 3 .   ? 44.811 53.517 -29.044 1.00 30.18  ? 618 HOH A O    1 
HETATM 6640 O  O    . HOH F 3 .   ? 37.311 48.440 -10.567 1.00 45.07  ? 619 HOH A O    1 
HETATM 6641 O  O    . HOH F 3 .   ? 54.545 62.363 -29.348 1.00 46.08  ? 620 HOH A O    1 
HETATM 6642 O  O    . HOH F 3 .   ? 40.874 44.538 -31.876 1.00 48.05  ? 621 HOH A O    1 
HETATM 6643 O  O    . HOH F 3 .   ? 35.515 39.959 -21.580 1.00 57.10  ? 622 HOH A O    1 
HETATM 6644 O  O    . HOH F 3 .   ? 33.802 39.489 -9.642  1.00 40.74  ? 623 HOH A O    1 
HETATM 6645 O  O    . HOH F 3 .   ? 33.575 62.764 -17.076 1.00 36.55  ? 624 HOH A O    1 
HETATM 6646 O  O    . HOH F 3 .   ? 40.193 54.760 -27.101 1.00 54.18  ? 625 HOH A O    1 
HETATM 6647 O  O    . HOH F 3 .   ? 56.870 59.156 -31.224 1.00 43.52  ? 626 HOH A O    1 
HETATM 6648 O  O    . HOH F 3 .   ? 38.458 44.653 10.429  1.00 35.56  ? 627 HOH A O    1 
HETATM 6649 O  O    . HOH F 3 .   ? 47.771 66.910 -26.682 1.00 50.43  ? 628 HOH A O    1 
HETATM 6650 O  O    . HOH F 3 .   ? 41.388 45.043 2.933   1.00 46.89  ? 629 HOH A O    1 
HETATM 6651 O  O    . HOH F 3 .   ? 27.776 45.816 7.387   1.00 34.52  ? 630 HOH A O    1 
HETATM 6652 O  O    . HOH F 3 .   ? 35.297 47.787 -11.391 1.00 30.00  ? 631 HOH A O    1 
HETATM 6653 O  O    . HOH F 3 .   ? 47.422 53.029 -5.621  1.00 46.16  ? 632 HOH A O    1 
HETATM 6654 O  O    . HOH F 3 .   ? 37.332 62.060 -15.223 1.00 42.08  ? 633 HOH A O    1 
HETATM 6655 O  O    . HOH F 3 .   ? 53.930 59.479 -32.811 1.00 47.31  ? 634 HOH A O    1 
HETATM 6656 O  O    . HOH F 3 .   ? 52.540 38.767 -24.048 1.00 40.53  ? 635 HOH A O    1 
HETATM 6657 O  O    . HOH F 3 .   ? 63.701 46.885 -31.323 1.00 62.43  ? 636 HOH A O    1 
HETATM 6658 O  O    . HOH F 3 .   ? 44.933 44.956 -7.301  1.00 44.03  ? 637 HOH A O    1 
HETATM 6659 O  O    . HOH F 3 .   ? 49.565 37.250 -10.097 1.00 57.39  ? 638 HOH A O    1 
HETATM 6660 O  O    . HOH F 3 .   ? 43.693 62.859 -14.813 1.00 41.01  ? 639 HOH A O    1 
HETATM 6661 O  O    . HOH F 3 .   ? 37.755 31.949 -26.959 1.00 62.10  ? 640 HOH A O    1 
HETATM 6662 O  O    . HOH F 3 .   ? 42.118 64.470 -15.100 1.00 55.60  ? 641 HOH A O    1 
HETATM 6663 O  O    . HOH F 3 .   ? 39.540 31.812 -25.541 1.00 53.88  ? 642 HOH A O    1 
HETATM 6664 O  O    . HOH F 3 .   ? 43.765 32.527 -30.172 1.00 52.18  ? 643 HOH A O    1 
HETATM 6665 O  O    . HOH G 3 .   ? 35.970 14.959 -11.340 1.00 55.29  ? 601 HOH B O    1 
HETATM 6666 O  O    . HOH G 3 .   ? 44.242 10.664 -2.759  1.00 61.77  ? 602 HOH B O    1 
HETATM 6667 O  O    . HOH G 3 .   ? 25.288 18.199 -25.451 1.00 49.91  ? 603 HOH B O    1 
HETATM 6668 O  O    . HOH G 3 .   ? 48.861 8.211  -28.482 1.00 39.80  ? 604 HOH B O    1 
HETATM 6669 O  O    . HOH G 3 .   ? 38.514 18.845 1.182   1.00 43.85  ? 605 HOH B O    1 
HETATM 6670 O  O    . HOH G 3 .   ? 50.788 18.903 -26.021 1.00 25.04  ? 606 HOH B O    1 
HETATM 6671 O  O    . HOH G 3 .   ? 40.123 25.654 -0.287  1.00 31.57  ? 607 HOH B O    1 
HETATM 6672 O  O    . HOH G 3 .   ? 49.111 22.430 -10.329 1.00 28.18  ? 608 HOH B O    1 
HETATM 6673 O  O    . HOH G 3 .   ? 43.024 37.291 -3.379  1.00 42.14  ? 609 HOH B O    1 
HETATM 6674 O  O    . HOH G 3 .   ? 42.152 11.731 -3.694  1.00 56.20  ? 610 HOH B O    1 
HETATM 6675 O  O    . HOH G 3 .   ? 59.743 28.794 -21.932 1.00 37.67  ? 611 HOH B O    1 
HETATM 6676 O  O    . HOH G 3 .   ? 39.601 6.807  -25.224 1.00 47.44  ? 612 HOH B O    1 
HETATM 6677 O  O    . HOH G 3 .   ? 44.411 28.722 -12.704 1.00 33.39  ? 613 HOH B O    1 
HETATM 6678 O  O    . HOH G 3 .   ? 32.330 17.983 -8.877  1.00 26.39  ? 614 HOH B O    1 
HETATM 6679 O  O    . HOH G 3 .   ? 53.893 21.274 3.980   1.00 50.36  ? 615 HOH B O    1 
HETATM 6680 O  O    . HOH G 3 .   ? 37.751 20.701 1.811   1.00 56.12  ? 616 HOH B O    1 
HETATM 6681 O  O    . HOH G 3 .   ? 50.750 15.154 -29.323 1.00 22.42  ? 617 HOH B O    1 
HETATM 6682 O  O    . HOH G 3 .   ? 57.679 23.613 -2.641  1.00 32.19  ? 618 HOH B O    1 
HETATM 6683 O  O    . HOH G 3 .   ? 52.819 13.211 -29.912 1.00 37.02  ? 619 HOH B O    1 
HETATM 6684 O  O    . HOH G 3 .   ? 39.138 29.083 0.960   1.00 45.30  ? 620 HOH B O    1 
HETATM 6685 O  O    . HOH G 3 .   ? 51.029 31.558 -9.604  1.00 30.12  ? 621 HOH B O    1 
HETATM 6686 O  O    . HOH G 3 .   ? 36.495 27.064 -8.967  1.00 47.06  ? 622 HOH B O    1 
HETATM 6687 O  O    . HOH G 3 .   ? 50.501 17.371 3.456   1.00 51.86  ? 623 HOH B O    1 
HETATM 6688 O  O    . HOH G 3 .   ? 40.212 9.350  -27.013 1.00 34.02  ? 624 HOH B O    1 
HETATM 6689 O  O    . HOH G 3 .   ? 30.771 25.642 -11.140 1.00 41.35  ? 625 HOH B O    1 
HETATM 6690 O  O    . HOH G 3 .   ? 60.182 18.835 -0.856  1.00 50.99  ? 626 HOH B O    1 
HETATM 6691 O  O    . HOH G 3 .   ? 32.440 26.305 -19.863 1.00 42.67  ? 627 HOH B O    1 
HETATM 6692 O  O    . HOH G 3 .   ? 60.577 30.929 -5.761  1.00 36.81  ? 628 HOH B O    1 
HETATM 6693 O  O    . HOH G 3 .   ? 64.377 29.519 -5.395  1.00 44.99  ? 629 HOH B O    1 
HETATM 6694 O  O    . HOH G 3 .   ? 51.825 23.186 -10.581 1.00 23.49  ? 630 HOH B O    1 
HETATM 6695 O  O    . HOH G 3 .   ? 41.011 6.202  -17.311 1.00 41.71  ? 631 HOH B O    1 
HETATM 6696 O  O    . HOH G 3 .   ? 36.026 25.046 -4.876  1.00 25.55  ? 632 HOH B O    1 
HETATM 6697 O  O    . HOH G 3 .   ? 44.868 8.959  -15.540 1.00 46.29  ? 633 HOH B O    1 
HETATM 6698 O  O    . HOH G 3 .   ? 37.257 28.965 -30.152 1.00 57.74  ? 634 HOH B O    1 
HETATM 6699 O  O    . HOH G 3 .   ? 39.266 16.041 -9.234  1.00 46.07  ? 635 HOH B O    1 
HETATM 6700 O  O    . HOH G 3 .   ? 53.168 25.318 -27.504 1.00 33.46  ? 636 HOH B O    1 
HETATM 6701 O  O    . HOH G 3 .   ? 38.743 8.352  -19.151 1.00 37.28  ? 637 HOH B O    1 
HETATM 6702 O  O    . HOH G 3 .   ? 40.625 23.823 -10.873 1.00 35.43  ? 638 HOH B O    1 
HETATM 6703 O  O    . HOH G 3 .   ? 26.243 20.509 -14.604 1.00 39.90  ? 639 HOH B O    1 
HETATM 6704 O  O    . HOH G 3 .   ? 47.184 0.824  -26.301 1.00 42.23  ? 640 HOH B O    1 
HETATM 6705 O  O    . HOH G 3 .   ? 50.099 19.880 -10.849 1.00 36.95  ? 641 HOH B O    1 
HETATM 6706 O  O    . HOH G 3 .   ? 44.736 11.143 -17.112 1.00 23.14  ? 642 HOH B O    1 
HETATM 6707 O  O    . HOH G 3 .   ? 50.390 9.580  -33.417 1.00 42.09  ? 643 HOH B O    1 
HETATM 6708 O  O    . HOH G 3 .   ? 44.124 4.655  -32.937 1.00 47.00  ? 644 HOH B O    1 
HETATM 6709 O  O    . HOH G 3 .   ? 65.578 23.445 -4.911  1.00 40.36  ? 645 HOH B O    1 
HETATM 6710 O  O    . HOH G 3 .   ? 32.785 8.047  -20.567 1.00 55.80  ? 646 HOH B O    1 
HETATM 6711 O  O    . HOH G 3 .   ? 29.151 23.713 -11.724 1.00 48.38  ? 647 HOH B O    1 
HETATM 6712 O  O    . HOH G 3 .   ? 35.410 8.792  -17.813 1.00 35.43  ? 648 HOH B O    1 
HETATM 6713 O  O    . HOH G 3 .   ? 43.131 6.667  -36.176 1.00 46.30  ? 649 HOH B O    1 
HETATM 6714 O  O    . HOH G 3 .   ? 30.957 24.753 -19.288 1.00 38.94  ? 650 HOH B O    1 
HETATM 6715 O  O    . HOH G 3 .   ? 51.962 23.251 10.756  1.00 55.29  ? 651 HOH B O    1 
HETATM 6716 O  O    . HOH G 3 .   ? 38.814 27.657 -29.847 1.00 43.11  ? 652 HOH B O    1 
HETATM 6717 O  O    . HOH G 3 .   ? 55.387 12.290 -33.922 1.00 53.45  ? 653 HOH B O    1 
HETATM 6718 O  O    . HOH G 3 .   ? 35.376 17.453 -8.472  1.00 45.55  ? 654 HOH B O    1 
HETATM 6719 O  O    . HOH G 3 .   ? 39.995 8.417  -29.972 1.00 58.83  ? 655 HOH B O    1 
HETATM 6720 O  O    . HOH G 3 .   ? 51.640 12.060 -34.761 1.00 45.00  ? 656 HOH B O    1 
HETATM 6721 O  O    . HOH G 3 .   ? 68.834 25.397 -11.030 1.00 58.73  ? 657 HOH B O    1 
HETATM 6722 O  O    . HOH G 3 .   ? 33.225 14.852 -38.599 1.00 68.63  ? 658 HOH B O    1 
HETATM 6723 O  O    . HOH G 3 .   ? 42.517 32.882 -27.458 1.00 57.22  ? 659 HOH B O    1 
HETATM 6724 O  O    . HOH G 3 .   ? 28.870 13.228 -23.181 1.00 48.94  ? 660 HOH B O    1 
HETATM 6725 O  O    . HOH G 3 .   ? 29.127 12.483 -21.169 1.00 62.91  ? 661 HOH B O    1 
HETATM 6726 O  O    . HOH G 3 .   ? 56.934 12.410 -32.422 1.00 54.48  ? 662 HOH B O    1 
HETATM 6727 O  O    . HOH G 3 .   ? 58.673 2.663  0.043   1.00 48.70  ? 663 HOH B O    1 
HETATM 6728 O  O    . HOH G 3 .   ? 26.902 12.906 -23.919 1.00 54.97  ? 664 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 7   ? 1.0733 0.6930 1.0351 0.2269  0.1987  0.1652  222 GLY A N   
2    C CA  . GLY A 7   ? 1.1214 0.7614 1.0807 0.2148  0.2027  0.1387  222 GLY A CA  
3    C C   . GLY A 7   ? 0.9796 0.6837 0.9743 0.2154  0.1883  0.1452  222 GLY A C   
4    O O   . GLY A 7   ? 0.9249 0.6729 0.9596 0.2298  0.1771  0.1654  222 GLY A O   
7    N N   . LEU A 8   ? 0.7480 0.4689 0.7299 0.1933  0.1842  0.1235  223 LEU A N   
8    C CA  . LEU A 8   ? 0.6756 0.4647 0.6912 0.1856  0.1688  0.1196  223 LEU A CA  
9    C C   . LEU A 8   ? 0.6096 0.4157 0.6545 0.2013  0.1825  0.1109  223 LEU A C   
10   O O   . LEU A 8   ? 0.5881 0.3903 0.6147 0.1896  0.1884  0.0888  223 LEU A O   
11   C CB  . LEU A 8   ? 0.6920 0.4988 0.6831 0.1527  0.1571  0.0990  223 LEU A CB  
12   C CG  . LEU A 8   ? 0.6925 0.5596 0.7071 0.1407  0.1358  0.1015  223 LEU A CG  
13   C CD1 . LEU A 8   ? 0.7018 0.5796 0.6876 0.1108  0.1285  0.0819  223 LEU A CD1 
14   C CD2 . LEU A 8   ? 0.7192 0.6260 0.7792 0.1509  0.1357  0.0971  223 LEU A CD2 
26   N N   . GLY A 9   ? 0.5746 0.4153 0.6599 0.2133  0.1792  0.1250  224 GLY A N   
27   C CA  . GLY A 9   ? 0.6181 0.4827 0.7217 0.2113  0.1860  0.1157  224 GLY A CA  
28   C C   . GLY A 9   ? 0.6211 0.5150 0.7673 0.2255  0.1869  0.1326  224 GLY A C   
29   O O   . GLY A 9   ? 0.6641 0.5701 0.8327 0.2381  0.1782  0.1519  224 GLY A O   
33   N N   . THR A 10  ? 0.5934 0.4993 0.7502 0.2241  0.1973  0.1271  225 THR A N   
34   C CA  . THR A 10  ? 0.7677 0.7021 0.9666 0.2368  0.2025  0.1415  225 THR A CA  
35   C C   . THR A 10  ? 0.7378 0.6488 0.9148 0.2407  0.2241  0.1347  225 THR A C   
36   O O   . THR A 10  ? 0.5833 0.4576 0.7126 0.2344  0.2312  0.1197  225 THR A O   
37   C CB  . THR A 10  ? 0.4954 0.4850 0.7475 0.2291  0.1913  0.1466  225 THR A CB  
38   O OG1 . THR A 10  ? 0.4766 0.4653 0.7196 0.2150  0.1989  0.1339  225 THR A OG1 
39   C CG2 . THR A 10  ? 0.4993 0.5114 0.7649 0.2230  0.1698  0.1488  225 THR A CG2 
47   N N   . ALA A 11  ? 0.6995 0.6331 0.9114 0.2521  0.2346  0.1463  226 ALA A N   
48   C CA  . ALA A 11  ? 0.7236 0.6362 0.9148 0.2587  0.2573  0.1425  226 ALA A CA  
49   C C   . ALA A 11  ? 0.5885 0.4985 0.7575 0.2427  0.2595  0.1317  226 ALA A C   
50   O O   . ALA A 11  ? 0.6805 0.5578 0.8049 0.2434  0.2715  0.1217  226 ALA A O   
51   C CB  . ALA A 11  ? 0.7619 0.7044 1.0003 0.2736  0.2691  0.1584  226 ALA A CB  
57   N N   . ARG A 12  ? 0.5220 0.4655 0.7221 0.2293  0.2469  0.1336  227 ARG A N   
58   C CA  . ARG A 12  ? 0.5043 0.4487 0.6935 0.2162  0.2491  0.1277  227 ARG A CA  
59   C C   . ARG A 12  ? 0.4904 0.4118 0.6347 0.2041  0.2386  0.1110  227 ARG A C   
60   O O   . ARG A 12  ? 0.4958 0.4043 0.6135 0.2002  0.2450  0.1063  227 ARG A O   
61   C CB  . ARG A 12  ? 0.4715 0.4577 0.7160 0.2069  0.2412  0.1352  227 ARG A CB  
62   C CG  . ARG A 12  ? 0.5211 0.5360 0.8160 0.2168  0.2534  0.1519  227 ARG A CG  
63   C CD  . ARG A 12  ? 0.5131 0.5661 0.8628 0.2043  0.2479  0.1571  227 ARG A CD  
64   N NE  . ARG A 12  ? 0.4604 0.4980 0.7960 0.1954  0.2606  0.1564  227 ARG A NE  
65   C CZ  . ARG A 12  ? 0.5078 0.5679 0.8887 0.1845  0.2633  0.1622  227 ARG A CZ  
66   N NH1 . ARG A 12  ? 0.6338 0.7383 1.0791 0.1790  0.2521  0.1662  227 ARG A NH1 
67   N NH2 . ARG A 12  ? 0.5282 0.5675 0.8926 0.1795  0.2773  0.1649  227 ARG A NH2 
81   N N   . LEU A 13  ? 0.4739 0.3935 0.6133 0.1991  0.2228  0.1041  228 LEU A N   
82   C CA  . LEU A 13  ? 0.4595 0.3633 0.5638 0.1873  0.2128  0.0882  228 LEU A CA  
83   C C   . LEU A 13  ? 0.4697 0.3523 0.5536 0.1890  0.2066  0.0833  228 LEU A C   
84   O O   . LEU A 13  ? 0.4639 0.3604 0.5742 0.1937  0.1998  0.0929  228 LEU A O   
85   C CB  . LEU A 13  ? 0.4198 0.3525 0.5513 0.1744  0.2007  0.0850  228 LEU A CB  
86   C CG  . LEU A 13  ? 0.4053 0.3283 0.5068 0.1635  0.1920  0.0688  228 LEU A CG  
87   C CD1 . LEU A 13  ? 0.4206 0.3283 0.4922 0.1641  0.2001  0.0658  228 LEU A CD1 
88   C CD2 . LEU A 13  ? 0.3713 0.3217 0.5040 0.1532  0.1803  0.0640  228 LEU A CD2 
100  N N   . GLN A 14  ? 0.4911 0.3388 0.5284 0.1863  0.2097  0.0700  229 GLN A N   
101  C CA  . GLN A 14  ? 0.5085 0.3275 0.5231 0.1857  0.2072  0.0652  229 GLN A CA  
102  C C   . GLN A 14  ? 0.5155 0.3302 0.5067 0.1715  0.1992  0.0486  229 GLN A C   
103  O O   . GLN A 14  ? 0.4941 0.3105 0.4668 0.1655  0.1987  0.0370  229 GLN A O   
104  C CB  . GLN A 14  ? 0.5653 0.3381 0.5446 0.1938  0.2205  0.0609  229 GLN A CB  
105  C CG  . GLN A 14  ? 0.7404 0.5111 0.7388 0.2109  0.2316  0.0752  229 GLN A CG  
106  C CD  . GLN A 14  ? 1.1275 0.9002 1.1196 0.2172  0.2452  0.0734  229 GLN A CD  
107  O OE1 . GLN A 14  ? 1.2480 0.9860 1.1990 0.2186  0.2549  0.0603  229 GLN A OE1 
108  N NE2 . GLN A 14  ? 1.1631 0.9742 1.1947 0.2210  0.2469  0.0866  229 GLN A NE2 
117  N N   . LEU A 15  ? 0.5621 0.3714 0.5534 0.1680  0.1942  0.0488  230 LEU A N   
118  C CA  . LEU A 15  ? 0.5407 0.3409 0.5060 0.1546  0.1918  0.0308  230 LEU A CA  
119  C C   . LEU A 15  ? 0.5438 0.2935 0.4626 0.1500  0.2004  0.0177  230 LEU A C   
120  O O   . LEU A 15  ? 0.6081 0.3188 0.5153 0.1561  0.2076  0.0258  230 LEU A O   
121  C CB  . LEU A 15  ? 0.6763 0.4958 0.6501 0.1394  0.1767  0.0358  230 LEU A CB  
122  C CG  . LEU A 15  ? 0.6350 0.4606 0.5821 0.1118  0.1667  0.0173  230 LEU A CG  
123  C CD1 . LEU A 15  ? 0.4788 0.3415 0.4393 0.1070  0.1618  0.0029  230 LEU A CD1 
124  C CD2 . LEU A 15  ? 0.6548 0.4942 0.5995 0.0940  0.1539  0.0249  230 LEU A CD2 
136  N N   . VAL A 16  ? 0.6027 0.3528 0.4958 0.1382  0.1983  -0.0027 231 VAL A N   
137  C CA  . VAL A 16  ? 0.6979 0.4018 0.5461 0.1306  0.2048  -0.0197 231 VAL A CA  
138  C C   . VAL A 16  ? 0.7314 0.4391 0.5633 0.1004  0.1926  -0.0340 231 VAL A C   
139  O O   . VAL A 16  ? 0.7485 0.4152 0.5556 0.0859  0.1952  -0.0395 231 VAL A O   
140  C CB  . VAL A 16  ? 0.7498 0.4628 0.5819 0.1341  0.2031  -0.0293 231 VAL A CB  
141  C CG1 . VAL A 16  ? 0.8061 0.4894 0.5915 0.1186  0.2028  -0.0559 231 VAL A CG1 
142  C CG2 . VAL A 16  ? 0.9119 0.6135 0.7507 0.1514  0.2126  -0.0150 231 VAL A CG2 
152  N N   . GLU A 17  ? 0.6381 0.3972 0.4881 0.0890  0.1792  -0.0388 232 GLU A N   
153  C CA  . GLU A 17  ? 0.6388 0.4156 0.4833 0.0593  0.1674  -0.0497 232 GLU A CA  
154  C C   . GLU A 17  ? 0.5881 0.4210 0.4634 0.0537  0.1565  -0.0475 232 GLU A C   
155  O O   . GLU A 17  ? 0.5807 0.4426 0.4751 0.0673  0.1546  -0.0482 232 GLU A O   
156  C CB  . GLU A 17  ? 0.6919 0.4672 0.5101 0.0447  0.1634  -0.0735 232 GLU A CB  
157  C CG  . GLU A 17  ? 0.9657 0.7336 0.7718 0.0109  0.1585  -0.0836 232 GLU A CG  
158  C CD  . GLU A 17  ? 1.0858 0.8512 0.8675 -0.0074 0.1528  -0.1091 232 GLU A CD  
159  O OE1 . GLU A 17  ? 1.0832 0.8614 0.8552 0.0075  0.1494  -0.1187 232 GLU A OE1 
160  O OE2 . GLU A 17  ? 1.0663 0.8174 0.8378 -0.0379 0.1514  -0.1187 232 GLU A OE2 
167  N N   . PHE A 18  ? 0.5113 0.3559 0.3883 0.0327  0.1513  -0.0454 233 PHE A N   
168  C CA  . PHE A 18  ? 0.4764 0.3719 0.3762 0.0249  0.1430  -0.0483 233 PHE A CA  
169  C C   . PHE A 18  ? 0.5156 0.4263 0.4051 -0.0044 0.1405  -0.0589 233 PHE A C   
170  O O   . PHE A 18  ? 0.5790 0.4579 0.4477 -0.0210 0.1449  -0.0537 233 PHE A O   
171  C CB  . PHE A 18  ? 0.4683 0.3726 0.3846 0.0326  0.1406  -0.0309 233 PHE A CB  
172  C CG  . PHE A 18  ? 0.4471 0.3985 0.3812 0.0242  0.1334  -0.0383 233 PHE A CG  
173  C CD1 . PHE A 18  ? 0.4370 0.4144 0.3973 0.0374  0.1312  -0.0450 233 PHE A CD1 
174  C CD2 . PHE A 18  ? 0.4631 0.4296 0.3854 0.0026  0.1316  -0.0392 233 PHE A CD2 
175  C CE1 . PHE A 18  ? 0.5063 0.5217 0.4819 0.0302  0.1265  -0.0556 233 PHE A CE1 
176  C CE2 . PHE A 18  ? 0.4712 0.4807 0.4059 -0.0043 0.1277  -0.0496 233 PHE A CE2 
177  C CZ  . PHE A 18  ? 0.4177 0.4501 0.3791 0.0098  0.1250  -0.0594 233 PHE A CZ  
187  N N   . SER A 19  ? 0.4811 0.4400 0.3881 -0.0102 0.1354  -0.0729 234 SER A N   
188  C CA  . SER A 19  ? 0.5398 0.5258 0.4458 -0.0375 0.1351  -0.0834 234 SER A CA  
189  C C   . SER A 19  ? 0.4676 0.5103 0.4006 -0.0351 0.1323  -0.0937 234 SER A C   
190  O O   . SER A 19  ? 0.4079 0.4684 0.3597 -0.0148 0.1287  -0.0991 234 SER A O   
191  C CB  . SER A 19  ? 0.5221 0.5013 0.4167 -0.0519 0.1332  -0.0983 234 SER A CB  
192  O OG  . SER A 19  ? 0.5489 0.5648 0.4603 -0.0386 0.1256  -0.1112 234 SER A OG  
198  N N   . ALA A 20  ? 0.3997 0.4679 0.3332 -0.0552 0.1364  -0.0958 235 ALA A N   
199  C CA  . ALA A 20  ? 0.3751 0.4973 0.3325 -0.0550 0.1377  -0.1094 235 ALA A CA  
200  C C   . ALA A 20  ? 0.3896 0.5415 0.3505 -0.0817 0.1424  -0.1193 235 ALA A C   
201  O O   . ALA A 20  ? 0.4543 0.5858 0.3944 -0.1057 0.1484  -0.1109 235 ALA A O   
202  C CB  . ALA A 20  ? 0.3723 0.5035 0.3259 -0.0540 0.1407  -0.1044 235 ALA A CB  
208  N N   . PHE A 21  ? 0.4303 0.6304 0.4200 -0.0773 0.1401  -0.1355 236 PHE A N   
209  C CA  . PHE A 21  ? 0.4353 0.6722 0.4383 -0.1017 0.1416  -0.1464 236 PHE A CA  
210  C C   . PHE A 21  ? 0.3968 0.7036 0.4395 -0.0949 0.1439  -0.1618 236 PHE A C   
211  O O   . PHE A 21  ? 0.3633 0.6842 0.4232 -0.0673 0.1429  -0.1657 236 PHE A O   
212  C CB  . PHE A 21  ? 0.4662 0.6836 0.4621 -0.1043 0.1299  -0.1503 236 PHE A CB  
213  C CG  . PHE A 21  ? 0.5366 0.7582 0.5423 -0.0717 0.1187  -0.1529 236 PHE A CG  
214  C CD1 . PHE A 21  ? 0.4622 0.7414 0.5008 -0.0600 0.1115  -0.1640 236 PHE A CD1 
215  C CD2 . PHE A 21  ? 0.6014 0.7719 0.5856 -0.0512 0.1170  -0.1417 236 PHE A CD2 
216  C CE1 . PHE A 21  ? 0.3925 0.6721 0.4369 -0.0283 0.1021  -0.1617 236 PHE A CE1 
217  C CE2 . PHE A 21  ? 0.4660 0.6389 0.4571 -0.0223 0.1099  -0.1408 236 PHE A CE2 
218  C CZ  . PHE A 21  ? 0.4056 0.6306 0.4246 -0.0108 0.1023  -0.1498 236 PHE A CZ  
228  N N   . VAL A 22  ? 0.3971 0.7474 0.4580 -0.1203 0.1480  -0.1704 237 VAL A N   
229  C CA  . VAL A 22  ? 0.4075 0.8315 0.5142 -0.1118 0.1485  -0.1851 237 VAL A CA  
230  C C   . VAL A 22  ? 0.4360 0.8926 0.5621 -0.1292 0.1357  -0.1934 237 VAL A C   
231  O O   . VAL A 22  ? 0.4065 0.8368 0.5129 -0.1608 0.1344  -0.1917 237 VAL A O   
232  C CB  . VAL A 22  ? 0.3953 0.8574 0.5147 -0.1236 0.1669  -0.1889 237 VAL A CB  
233  C CG1 . VAL A 22  ? 0.4341 0.8875 0.5330 -0.1656 0.1806  -0.1820 237 VAL A CG1 
234  C CG2 . VAL A 22  ? 0.3508 0.8745 0.5168 -0.1099 0.1619  -0.1990 237 VAL A CG2 
244  N N   . GLU A 23  ? 0.5050 1.0166 0.6694 -0.1073 0.1251  -0.2023 238 GLU A N   
245  C CA  . GLU A 23  ? 0.4380 0.9942 0.6254 -0.1191 0.1077  -0.2115 238 GLU A CA  
246  C C   . GLU A 23  ? 0.5740 1.2229 0.8204 -0.1188 0.1125  -0.2219 238 GLU A C   
247  O O   . GLU A 23  ? 0.4680 1.1310 0.7314 -0.0925 0.1233  -0.2204 238 GLU A O   
248  C CB  . GLU A 23  ? 0.4423 0.9824 0.6186 -0.0885 0.0859  -0.2087 238 GLU A CB  
249  C CG  . GLU A 23  ? 0.5387 0.9999 0.6615 -0.0963 0.0802  -0.2027 238 GLU A CG  
250  C CD  . GLU A 23  ? 0.6114 1.0468 0.7149 -0.0607 0.0658  -0.1958 238 GLU A CD  
251  O OE1 . GLU A 23  ? 0.5318 1.0022 0.6621 -0.0277 0.0614  -0.1921 238 GLU A OE1 
252  O OE2 . GLU A 23  ? 0.5358 0.9135 0.5965 -0.0652 0.0610  -0.1934 238 GLU A OE2 
259  N N   . PRO A 24  ? 0.6604 1.3629 0.9346 -0.1473 0.1023  -0.2316 239 PRO A N   
260  C CA  . PRO A 24  ? 0.5821 1.3610 0.9079 -0.1442 0.1046  -0.2365 239 PRO A CA  
261  C C   . PRO A 24  ? 0.5592 1.3706 0.9131 -0.0950 0.0904  -0.2337 239 PRO A C   
262  O O   . PRO A 24  ? 0.7769 1.6123 1.1567 -0.0779 0.0990  -0.2305 239 PRO A O   
263  C CB  . PRO A 24  ? 0.6612 1.4795 1.0052 -0.1865 0.0918  -0.2463 239 PRO A CB  
264  C CG  . PRO A 24  ? 0.5791 1.3311 0.8774 -0.2223 0.0935  -0.2473 239 PRO A CG  
265  C CD  . PRO A 24  ? 0.5021 1.1794 0.7529 -0.1838 0.0877  -0.2366 239 PRO A CD  
273  N N   . GLN A 32  ? 0.8951 1.4458 1.0509 -0.2935 0.0476  -0.2673 247 GLN A N   
274  C CA  . GLN A 32  ? 0.9438 1.3882 1.0397 -0.2835 0.0598  -0.2550 247 GLN A CA  
275  C C   . GLN A 32  ? 1.0070 1.4357 1.1005 -0.2485 0.0785  -0.2341 247 GLN A C   
276  O O   . GLN A 32  ? 1.0236 1.5159 1.1556 -0.2258 0.0803  -0.2316 247 GLN A O   
277  C CB  . GLN A 32  ? 0.9483 1.3333 1.0223 -0.3312 0.0746  -0.2568 247 GLN A CB  
278  C CG  . GLN A 32  ? 1.0849 1.4793 1.1618 -0.3733 0.0577  -0.2815 247 GLN A CG  
279  C CD  . GLN A 32  ? 1.0180 1.5118 1.1595 -0.4082 0.0553  -0.2926 247 GLN A CD  
280  O OE1 . GLN A 32  ? 0.8938 1.4543 1.0785 -0.3948 0.0666  -0.2822 247 GLN A OE1 
281  N NE2 . GLN A 32  ? 1.0048 1.5028 1.1509 -0.4472 0.0423  -0.3111 247 GLN A NE2 
289  N N   . ARG A 33  ? 0.8564 1.2003 0.9058 -0.2445 0.0919  -0.2202 248 ARG A N   
290  C CA  . ARG A 33  ? 0.7763 1.1002 0.8184 -0.2165 0.1070  -0.2019 248 ARG A CA  
291  C C   . ARG A 33  ? 0.7057 1.0012 0.7362 -0.2434 0.1289  -0.1894 248 ARG A C   
292  O O   . ARG A 33  ? 0.8772 1.1276 0.8869 -0.2761 0.1339  -0.1888 248 ARG A O   
293  C CB  . ARG A 33  ? 0.7804 1.0357 0.7831 -0.1840 0.1031  -0.1918 248 ARG A CB  
294  C CG  . ARG A 33  ? 0.7733 1.0514 0.7818 -0.1495 0.0861  -0.1965 248 ARG A CG  
295  C CD  . ARG A 33  ? 0.7558 0.9687 0.7299 -0.1190 0.0889  -0.1831 248 ARG A CD  
296  N NE  . ARG A 33  ? 0.9170 1.1504 0.8974 -0.0827 0.0776  -0.1816 248 ARG A NE  
297  C CZ  . ARG A 33  ? 0.9081 1.0966 0.8656 -0.0538 0.0800  -0.1699 248 ARG A CZ  
298  N NH1 . ARG A 33  ? 0.8953 1.0205 0.8257 -0.0549 0.0918  -0.1598 248 ARG A NH1 
299  N NH2 . ARG A 33  ? 0.8532 1.0619 0.8170 -0.0230 0.0715  -0.1661 248 ARG A NH2 
313  N N   . HIS A 34  ? 0.6155 0.9333 0.6557 -0.2297 0.1425  -0.1794 249 HIS A N   
314  C CA  . HIS A 34  ? 0.6185 0.8954 0.6316 -0.2450 0.1615  -0.1615 249 HIS A CA  
315  C C   . HIS A 34  ? 0.6687 0.8951 0.6516 -0.2113 0.1606  -0.1463 249 HIS A C   
316  O O   . HIS A 34  ? 0.6029 0.8561 0.5993 -0.1812 0.1577  -0.1487 249 HIS A O   
317  C CB  . HIS A 34  ? 0.5983 0.9347 0.6348 -0.2599 0.1799  -0.1607 249 HIS A CB  
318  C CG  . HIS A 34  ? 0.6728 0.9689 0.6730 -0.2682 0.1973  -0.1394 249 HIS A CG  
319  N ND1 . HIS A 34  ? 0.8877 1.1412 0.8637 -0.3033 0.2096  -0.1246 249 HIS A ND1 
320  C CD2 . HIS A 34  ? 0.6962 0.9839 0.6764 -0.2452 0.2026  -0.1290 249 HIS A CD2 
321  C CE1 . HIS A 34  ? 0.8745 1.0994 0.8167 -0.2995 0.2215  -0.1033 249 HIS A CE1 
322  N NE2 . HIS A 34  ? 0.7348 0.9823 0.6783 -0.2651 0.2162  -0.1070 249 HIS A NE2 
330  N N   . LEU A 35  ? 0.6139 0.7676 0.5594 -0.2176 0.1639  -0.1307 250 LEU A N   
331  C CA  . LEU A 35  ? 0.6824 0.7889 0.6031 -0.1882 0.1618  -0.1146 250 LEU A CA  
332  C C   . LEU A 35  ? 0.6476 0.7489 0.5509 -0.1920 0.1737  -0.0956 250 LEU A C   
333  O O   . LEU A 35  ? 0.7314 0.8046 0.6142 -0.2176 0.1848  -0.0813 250 LEU A O   
334  C CB  . LEU A 35  ? 0.7095 0.7405 0.6011 -0.1871 0.1587  -0.1073 250 LEU A CB  
335  C CG  . LEU A 35  ? 0.7439 0.7663 0.6374 -0.1823 0.1468  -0.1258 250 LEU A CG  
336  C CD1 . LEU A 35  ? 0.7569 0.6957 0.6155 -0.1823 0.1503  -0.1177 250 LEU A CD1 
337  C CD2 . LEU A 35  ? 0.6488 0.7008 0.5577 -0.1461 0.1360  -0.1314 250 LEU A CD2 
349  N N   . PHE A 36  ? 0.6233 0.7487 0.5321 -0.1672 0.1711  -0.0950 251 PHE A N   
350  C CA  . PHE A 36  ? 0.6399 0.7628 0.5259 -0.1685 0.1786  -0.0786 251 PHE A CA  
351  C C   . PHE A 36  ? 0.6816 0.7406 0.5376 -0.1579 0.1737  -0.0543 251 PHE A C   
352  O O   . PHE A 36  ? 0.6912 0.7255 0.5184 -0.1705 0.1807  -0.0324 251 PHE A O   
353  C CB  . PHE A 36  ? 0.5540 0.7195 0.4546 -0.1467 0.1757  -0.0904 251 PHE A CB  
354  C CG  . PHE A 36  ? 0.5294 0.7582 0.4628 -0.1507 0.1825  -0.1133 251 PHE A CG  
355  C CD1 . PHE A 36  ? 0.5376 0.8023 0.4711 -0.1773 0.1991  -0.1153 251 PHE A CD1 
356  C CD2 . PHE A 36  ? 0.5367 0.7899 0.5026 -0.1264 0.1741  -0.1305 251 PHE A CD2 
357  C CE1 . PHE A 36  ? 0.5355 0.8585 0.5060 -0.1759 0.2028  -0.1343 251 PHE A CE1 
358  C CE2 . PHE A 36  ? 0.4722 0.7850 0.4724 -0.1255 0.1804  -0.1496 251 PHE A CE2 
359  C CZ  . PHE A 36  ? 0.6505 0.9953 0.6549 -0.1481 0.1912  -0.1505 251 PHE A CZ  
369  N N   . VAL A 37  ? 0.5885 0.6232 0.4528 -0.1327 0.1626  -0.0568 252 VAL A N   
370  C CA  . VAL A 37  ? 0.6680 0.6479 0.5140 -0.1162 0.1582  -0.0359 252 VAL A CA  
371  C C   . VAL A 37  ? 0.6404 0.5905 0.4949 -0.1019 0.1537  -0.0454 252 VAL A C   
372  O O   . VAL A 37  ? 0.5857 0.5660 0.4610 -0.0954 0.1490  -0.0654 252 VAL A O   
373  C CB  . VAL A 37  ? 0.6416 0.6369 0.4890 -0.0940 0.1499  -0.0263 252 VAL A CB  
374  C CG1 . VAL A 37  ? 0.6756 0.7015 0.5041 -0.1098 0.1542  -0.0192 252 VAL A CG1 
375  C CG2 . VAL A 37  ? 0.6391 0.6669 0.5172 -0.0733 0.1424  -0.0457 252 VAL A CG2 
385  N N   . HIS A 38  ? 0.6143 0.5042 0.4499 -0.0961 0.1563  -0.0303 253 HIS A N   
386  C CA  . HIS A 38  ? 0.6596 0.5145 0.4936 -0.0845 0.1556  -0.0402 253 HIS A CA  
387  C C   . HIS A 38  ? 0.6904 0.4868 0.5101 -0.0636 0.1594  -0.0186 253 HIS A C   
388  O O   . HIS A 38  ? 0.7509 0.5136 0.5534 -0.0706 0.1649  0.0024  253 HIS A O   
389  C CB  . HIS A 38  ? 0.6700 0.5109 0.4945 -0.1138 0.1597  -0.0572 253 HIS A CB  
390  C CG  . HIS A 38  ? 0.7464 0.5553 0.5622 -0.1043 0.1576  -0.0729 253 HIS A CG  
391  N ND1 . HIS A 38  ? 1.1073 0.8713 0.9028 -0.1266 0.1623  -0.0842 253 HIS A ND1 
392  C CD2 . HIS A 38  ? 0.7177 0.5329 0.5391 -0.0760 0.1524  -0.0799 253 HIS A CD2 
393  C CE1 . HIS A 38  ? 0.9660 0.7104 0.7508 -0.1115 0.1591  -0.0996 253 HIS A CE1 
394  N NE2 . HIS A 38  ? 0.8098 0.5852 0.6093 -0.0801 0.1540  -0.0952 253 HIS A NE2 
402  N N   . ILE A 39  ? 0.5896 0.3793 0.4193 -0.0355 0.1573  -0.0213 254 ILE A N   
403  C CA  . ILE A 39  ? 0.6410 0.3807 0.4644 -0.0109 0.1633  -0.0046 254 ILE A CA  
404  C C   . ILE A 39  ? 0.6283 0.3418 0.4430 -0.0013 0.1687  -0.0231 254 ILE A C   
405  O O   . ILE A 39  ? 0.5997 0.3494 0.4274 0.0072  0.1637  -0.0371 254 ILE A O   
406  C CB  . ILE A 39  ? 0.6300 0.3965 0.4785 0.0165  0.1574  0.0121  254 ILE A CB  
407  C CG1 . ILE A 39  ? 0.6129 0.4132 0.4653 0.0071  0.1487  0.0269  254 ILE A CG1 
408  C CG2 . ILE A 39  ? 0.6323 0.3522 0.4807 0.0438  0.1655  0.0307  254 ILE A CG2 
409  C CD1 . ILE A 39  ? 0.5690 0.4068 0.4501 0.0285  0.1386  0.0366  254 ILE A CD1 
421  N N   . SER A 40  ? 0.8246 0.4735 0.6149 -0.0015 0.1796  -0.0232 255 SER A N   
422  C CA  . SER A 40  ? 0.9191 0.5370 0.6931 0.0105  0.1866  -0.0419 255 SER A CA  
423  C C   . SER A 40  ? 0.8982 0.4561 0.6640 0.0377  0.2016  -0.0270 255 SER A C   
424  O O   . SER A 40  ? 1.0067 0.5214 0.7647 0.0342  0.2078  -0.0104 255 SER A O   
425  C CB  . SER A 40  ? 1.0351 0.6315 0.7829 -0.0214 0.1860  -0.0683 255 SER A CB  
426  O OG  . SER A 40  ? 0.9529 0.5362 0.6816 -0.0109 0.1881  -0.0904 255 SER A OG  
432  N N   . GLN A 41  ? 1.0509 0.6058 0.8194 0.0665  0.2093  -0.0306 256 GLN A N   
433  C CA  . GLN A 41  ? 1.1241 0.6280 0.8912 0.0970  0.2266  -0.0161 256 GLN A CA  
434  C C   . GLN A 41  ? 0.9712 0.4461 0.7135 0.1082  0.2382  -0.0361 256 GLN A C   
435  O O   . GLN A 41  ? 1.0547 0.5725 0.8075 0.1206  0.2348  -0.0390 256 GLN A O   
436  C CB  . GLN A 41  ? 1.0495 0.5970 0.8594 0.1249  0.2242  0.0106  256 GLN A CB  
437  C CG  . GLN A 41  ? 0.9388 0.5380 0.7718 0.1086  0.2052  0.0259  256 GLN A CG  
438  C CD  . GLN A 41  ? 1.1072 0.7327 0.9769 0.1317  0.2008  0.0561  256 GLN A CD  
439  O OE1 . GLN A 41  ? 1.0378 0.7001 0.9392 0.1514  0.2009  0.0605  256 GLN A OE1 
440  N NE2 . GLN A 41  ? 1.2385 0.8477 1.1043 0.1279  0.1960  0.0779  256 GLN A NE2 
449  N N   . LEU A 51  ? 1.2981 0.9172 1.2926 0.2962  0.1395  0.3256  266 LEU A N   
450  C CA  . LEU A 51  ? 1.0281 0.6973 1.0199 0.2781  0.1248  0.3231  266 LEU A CA  
451  C C   . LEU A 51  ? 1.0389 0.7690 1.0439 0.2867  0.0941  0.3579  266 LEU A C   
452  O O   . LEU A 51  ? 1.0287 0.8203 1.0837 0.3059  0.0803  0.3650  266 LEU A O   
453  C CB  . LEU A 51  ? 0.9372 0.6475 0.9649 0.2795  0.1315  0.2948  266 LEU A CB  
454  C CG  . LEU A 51  ? 0.8833 0.6057 0.8926 0.2549  0.1313  0.2763  266 LEU A CG  
455  C CD1 . LEU A 51  ? 0.8938 0.5516 0.8627 0.2351  0.1547  0.2464  266 LEU A CD1 
456  C CD2 . LEU A 51  ? 0.8673 0.6562 0.9260 0.2611  0.1257  0.2636  266 LEU A CD2 
467  N N   . GLU A 52  ? 0.9652 0.6812 0.9237 0.2700  0.0834  0.3788  267 GLU A N   
468  C CA  . GLU A 52  ? 0.9968 0.7735 0.9531 0.2734  0.0517  0.4107  267 GLU A CA  
469  C C   . GLU A 52  ? 0.9578 0.8237 0.9548 0.2742  0.0317  0.4023  267 GLU A C   
470  O O   . GLU A 52  ? 0.9243 0.7979 0.9411 0.2636  0.0441  0.3678  267 GLU A O   
471  C CB  . GLU A 52  ? 1.0952 0.8473 0.9835 0.2451  0.0485  0.4260  267 GLU A CB  
472  C CG  . GLU A 52  ? 1.1922 0.8763 1.0449 0.2462  0.0554  0.4500  267 GLU A CG  
473  C CD  . GLU A 52  ? 1.3289 0.9992 1.1158 0.2151  0.0524  0.4668  267 GLU A CD  
474  O OE1 . GLU A 52  ? 1.2647 0.9985 1.0326 0.2080  0.0285  0.4817  267 GLU A OE1 
475  O OE2 . GLU A 52  ? 1.4898 1.0884 1.2435 0.1954  0.0743  0.4634  267 GLU A OE2 
482  N N   . SER A 53  ? 0.9333 0.8697 0.9424 0.2803  -0.0017 0.4255  268 SER A N   
483  C CA  . SER A 53  ? 0.8867 0.9125 0.9341 0.2677  -0.0253 0.4037  268 SER A CA  
484  C C   . SER A 53  ? 0.9233 1.0012 0.9295 0.2408  -0.0564 0.4049  268 SER A C   
485  O O   . SER A 53  ? 1.0280 1.0836 0.9819 0.2405  -0.0632 0.4350  268 SER A O   
486  C CB  . SER A 53  ? 0.8756 0.9563 0.9973 0.3008  -0.0388 0.4204  268 SER A CB  
487  O OG  . SER A 53  ? 0.8876 1.0608 1.0296 0.2903  -0.0773 0.4222  268 SER A OG  
493  N N   . VAL A 54  ? 0.7752 0.9204 0.8038 0.2186  -0.0740 0.3725  269 VAL A N   
494  C CA  . VAL A 54  ? 0.7851 0.9814 0.7733 0.1904  -0.1018 0.3633  269 VAL A CA  
495  C C   . VAL A 54  ? 0.8373 1.1212 0.8789 0.1858  -0.1319 0.3470  269 VAL A C   
496  O O   . VAL A 54  ? 0.8998 1.1965 0.9964 0.1835  -0.1216 0.3199  269 VAL A O   
497  C CB  . VAL A 54  ? 0.7632 0.9321 0.7023 0.1529  -0.0836 0.3244  269 VAL A CB  
498  C CG1 . VAL A 54  ? 0.7831 1.0038 0.6765 0.1263  -0.1093 0.3138  269 VAL A CG1 
499  C CG2 . VAL A 54  ? 0.8062 0.8899 0.6983 0.1514  -0.0522 0.3364  269 VAL A CG2 
509  N N   . ASP A 55  ? 1.0010 1.3455 1.0253 0.1817  -0.1692 0.3621  270 ASP A N   
510  C CA  . ASP A 55  ? 1.0557 1.4863 1.1343 0.1743  -0.2010 0.3453  270 ASP A CA  
511  C C   . ASP A 55  ? 0.9905 1.4376 1.0496 0.1330  -0.2015 0.2918  270 ASP A C   
512  O O   . ASP A 55  ? 0.9961 1.4367 0.9846 0.1106  -0.2056 0.2805  270 ASP A O   
513  C CB  . ASP A 55  ? 1.1572 1.6540 1.2275 0.1861  -0.2454 0.3805  270 ASP A CB  
514  C CG  . ASP A 55  ? 1.1106 1.7010 1.2579 0.1839  -0.2792 0.3689  270 ASP A CG  
515  O OD1 . ASP A 55  ? 1.1243 1.7508 1.2745 0.1488  -0.2907 0.3241  270 ASP A OD1 
516  O OD2 . ASP A 55  ? 1.0522 1.6797 1.2597 0.2166  -0.2934 0.4038  270 ASP A OD2 
521  N N   . VAL A 56  ? 1.2717 1.7382 1.3948 0.1248  -0.1946 0.2605  271 VAL A N   
522  C CA  . VAL A 56  ? 1.3298 1.8074 1.4472 0.0892  -0.1926 0.2091  271 VAL A CA  
523  C C   . VAL A 56  ? 1.4081 1.9275 1.4685 0.0642  -0.2235 0.1952  271 VAL A C   
524  O O   . VAL A 56  ? 1.4316 1.9294 1.4399 0.0396  -0.2123 0.1634  271 VAL A O   
525  C CB  . VAL A 56  ? 1.2897 1.8080 1.4931 0.0838  -0.1963 0.1871  271 VAL A CB  
526  C CG1 . VAL A 56  ? 1.1614 1.6724 1.3560 0.0501  -0.1876 0.1358  271 VAL A CG1 
527  C CG2 . VAL A 56  ? 1.3304 1.8159 1.5905 0.1112  -0.1659 0.2036  271 VAL A CG2 
537  N N   . ARG A 57  ? 1.2807 1.8631 1.3513 0.0720  -0.2625 0.2191  272 ARG A N   
538  C CA  . ARG A 57  ? 1.2768 1.9104 1.2945 0.0486  -0.2979 0.2054  272 ARG A CA  
539  C C   . ARG A 57  ? 1.2978 1.8903 1.2139 0.0404  -0.2859 0.2111  272 ARG A C   
540  O O   . ARG A 57  ? 1.3010 1.9226 1.1592 0.0161  -0.3041 0.1886  272 ARG A O   
541  C CB  . ARG A 57  ? 1.2872 1.9962 1.3339 0.0655  -0.3432 0.2408  272 ARG A CB  
542  C CG  . ARG A 57  ? 1.2453 2.0108 1.3986 0.0672  -0.3576 0.2310  272 ARG A CG  
543  C CD  . ARG A 57  ? 1.2241 2.0712 1.4175 0.0881  -0.4022 0.2701  272 ARG A CD  
544  N NE  . ARG A 57  ? 1.2792 2.1908 1.5327 0.0623  -0.4291 0.2338  272 ARG A NE  
545  C CZ  . ARG A 57  ? 1.3113 2.2753 1.5914 0.0669  -0.4637 0.2421  272 ARG A CZ  
546  N NH1 . ARG A 57  ? 1.3626 2.3244 1.6152 0.0985  -0.4762 0.2867  272 ARG A NH1 
547  N NH2 . ARG A 57  ? 1.2576 2.2745 1.5934 0.0394  -0.4857 0.2054  272 ARG A NH2 
561  N N   . GLN A 58  ? 1.3762 1.9006 1.2711 0.0585  -0.2532 0.2385  273 GLN A N   
562  C CA  . GLN A 58  ? 1.3978 1.8788 1.2044 0.0492  -0.2355 0.2468  273 GLN A CA  
563  C C   . GLN A 58  ? 1.3374 1.7956 1.1122 0.0181  -0.2103 0.1955  273 GLN A C   
564  O O   . GLN A 58  ? 1.3481 1.7967 1.0487 0.0022  -0.2030 0.1915  273 GLN A O   
565  C CB  . GLN A 58  ? 1.3793 1.7901 1.1819 0.0744  -0.2062 0.2878  273 GLN A CB  
566  C CG  . GLN A 58  ? 1.4732 1.8939 1.2905 0.1095  -0.2261 0.3454  273 GLN A CG  
567  C CD  . GLN A 58  ? 1.4866 1.8308 1.2647 0.1266  -0.1990 0.3867  273 GLN A CD  
568  O OE1 . GLN A 58  ? 1.5083 1.8194 1.2150 0.1082  -0.1836 0.3881  273 GLN A OE1 
569  N NE2 . GLN A 58  ? 1.3789 1.6932 1.2050 0.1615  -0.1909 0.4198  273 GLN A NE2 
578  N N   . ILE A 59  ? 1.3727 1.8225 1.2046 0.0112  -0.1952 0.1586  274 ILE A N   
579  C CA  . ILE A 59  ? 1.3142 1.7364 1.1267 -0.0113 -0.1677 0.1142  274 ILE A CA  
580  C C   . ILE A 59  ? 1.3422 1.8009 1.1886 -0.0314 -0.1801 0.0649  274 ILE A C   
581  O O   . ILE A 59  ? 1.3055 1.7427 1.1489 -0.0464 -0.1579 0.0260  274 ILE A O   
582  C CB  . ILE A 59  ? 1.2860 1.6463 1.1269 0.0003  -0.1302 0.1175  274 ILE A CB  
583  C CG1 . ILE A 59  ? 1.2859 1.6483 1.2094 0.0176  -0.1303 0.1199  274 ILE A CG1 
584  C CG2 . ILE A 59  ? 1.2421 1.5590 1.0444 0.0148  -0.1163 0.1612  274 ILE A CG2 
585  C CD1 . ILE A 59  ? 1.1537 1.4630 1.1045 0.0238  -0.0948 0.1088  274 ILE A CD1 
597  N N   . TYR A 60  ? 1.1567 1.6707 1.0372 -0.0317 -0.2157 0.0673  275 TYR A N   
598  C CA  . TYR A 60  ? 1.1249 1.6724 1.0494 -0.0524 -0.2295 0.0228  275 TYR A CA  
599  C C   . TYR A 60  ? 1.1181 1.6571 0.9922 -0.0799 -0.2195 -0.0278 275 TYR A C   
600  O O   . TYR A 60  ? 1.0496 1.5740 0.9592 -0.0927 -0.2056 -0.0676 275 TYR A O   
601  C CB  . TYR A 60  ? 1.1880 1.8086 1.1361 -0.0553 -0.2765 0.0327  275 TYR A CB  
602  C CG  . TYR A 60  ? 1.0971 1.7464 1.1454 -0.0472 -0.2865 0.0388  275 TYR A CG  
603  C CD1 . TYR A 60  ? 1.1108 1.7199 1.2150 -0.0257 -0.2556 0.0565  275 TYR A CD1 
604  C CD2 . TYR A 60  ? 1.0323 1.7525 1.1189 -0.0629 -0.3264 0.0258  275 TYR A CD2 
605  C CE1 . TYR A 60  ? 1.0935 1.7315 1.2885 -0.0183 -0.2604 0.0631  275 TYR A CE1 
606  C CE2 . TYR A 60  ? 1.0175 1.7699 1.2015 -0.0578 -0.3333 0.0323  275 TYR A CE2 
607  C CZ  . TYR A 60  ? 1.0613 1.7719 1.2991 -0.0346 -0.2983 0.0521  275 TYR A CZ  
608  O OH  . TYR A 60  ? 0.9512 1.6948 1.2854 -0.0289 -0.3001 0.0601  275 TYR A OH  
618  N N   . ASP A 61  ? 1.3577 1.9035 1.1485 -0.0872 -0.2242 -0.0243 276 ASP A N   
619  C CA  . ASP A 61  ? 1.3517 1.8973 1.0866 -0.1116 -0.2159 -0.0717 276 ASP A CA  
620  C C   . ASP A 61  ? 1.3996 1.8909 1.1274 -0.1114 -0.1703 -0.0908 276 ASP A C   
621  O O   . ASP A 61  ? 1.3447 1.8305 1.0510 -0.1281 -0.1570 -0.1369 276 ASP A O   
622  C CB  . ASP A 61  ? 1.3297 1.9044 0.9742 -0.1177 -0.2340 -0.0569 276 ASP A CB  
623  C CG  . ASP A 61  ? 1.3301 1.8702 0.9297 -0.1021 -0.2107 -0.0116 276 ASP A CG  
624  O OD1 . ASP A 61  ? 1.4255 1.9662 0.9453 -0.1123 -0.2015 -0.0138 276 ASP A OD1 
625  O OD2 . ASP A 61  ? 1.3052 1.8157 0.9487 -0.0807 -0.1998 0.0250  276 ASP A OD2 
630  N N   . LYS A 62  ? 1.2848 1.7374 1.0314 -0.0921 -0.1473 -0.0564 277 LYS A N   
631  C CA  . LYS A 62  ? 1.2037 1.6107 0.9490 -0.0907 -0.1074 -0.0692 277 LYS A CA  
632  C C   . LYS A 62  ? 1.1386 1.5280 0.9461 -0.0923 -0.0931 -0.1056 277 LYS A C   
633  O O   . LYS A 62  ? 1.0484 1.4131 0.8515 -0.0951 -0.0651 -0.1300 277 LYS A O   
634  C CB  . LYS A 62  ? 1.1405 1.5113 0.8904 -0.0718 -0.0909 -0.0234 277 LYS A CB  
635  C CG  . LYS A 62  ? 1.2051 1.5567 0.8902 -0.0776 -0.0687 -0.0101 277 LYS A CG  
636  C CD  . LYS A 62  ? 1.1603 1.4767 0.8430 -0.0617 -0.0601 0.0399  277 LYS A CD  
637  C CE  . LYS A 62  ? 1.1590 1.4560 0.7803 -0.0723 -0.0371 0.0540  277 LYS A CE  
638  N NZ  . LYS A 62  ? 1.3240 1.6566 0.8749 -0.0862 -0.0495 0.0541  277 LYS A NZ  
652  N N   . PHE A 63  ? 1.0856 1.4899 0.9530 -0.0896 -0.1117 -0.1064 278 PHE A N   
653  C CA  . PHE A 63  ? 1.0130 1.4025 0.9388 -0.0937 -0.1011 -0.1388 278 PHE A CA  
654  C C   . PHE A 63  ? 1.0875 1.5093 1.0210 -0.1158 -0.1249 -0.1767 278 PHE A C   
655  O O   . PHE A 63  ? 1.0493 1.5138 0.9565 -0.1254 -0.1564 -0.1721 278 PHE A O   
656  C CB  . PHE A 63  ? 1.0000 1.3774 0.9950 -0.0760 -0.0981 -0.1116 278 PHE A CB  
657  C CG  . PHE A 63  ? 0.9707 1.3074 0.9646 -0.0565 -0.0711 -0.0858 278 PHE A CG  
658  C CD1 . PHE A 63  ? 0.9510 1.2524 0.9614 -0.0531 -0.0432 -0.1040 278 PHE A CD1 
659  C CD2 . PHE A 63  ? 0.9247 1.2571 0.9005 -0.0414 -0.0743 -0.0437 278 PHE A CD2 
660  C CE1 . PHE A 63  ? 0.9293 1.1971 0.9364 -0.0379 -0.0214 -0.0836 278 PHE A CE1 
661  C CE2 . PHE A 63  ? 0.9164 1.2074 0.8891 -0.0270 -0.0497 -0.0248 278 PHE A CE2 
662  C CZ  . PHE A 63  ? 0.9395 1.2006 0.9274 -0.0265 -0.0242 -0.0461 278 PHE A CZ  
672  N N   . PRO A 64  ? 1.6494 2.0498 1.6189 -0.1244 -0.1109 -0.2145 279 PRO A N   
673  C CA  . PRO A 64  ? 1.6242 2.0490 1.6052 -0.1488 -0.1332 -0.2539 279 PRO A CA  
674  C C   . PRO A 64  ? 1.5780 2.0376 1.6219 -0.1532 -0.1616 -0.2373 279 PRO A C   
675  O O   . PRO A 64  ? 1.5358 2.0027 1.6129 -0.1341 -0.1636 -0.1936 279 PRO A O   
676  C CB  . PRO A 64  ? 1.6105 1.9912 1.6182 -0.1529 -0.1050 -0.2932 279 PRO A CB  
677  C CG  . PRO A 64  ? 1.5545 1.8982 1.5926 -0.1280 -0.0758 -0.2640 279 PRO A CG  
678  C CD  . PRO A 64  ? 1.5964 1.9495 1.5923 -0.1133 -0.0758 -0.2242 279 PRO A CD  
686  N N   . GLU A 65  ? 1.1894 1.6721 1.2506 -0.1793 -0.1829 -0.2744 280 GLU A N   
687  C CA  . GLU A 65  ? 1.1182 1.6295 1.2579 -0.1887 -0.2026 -0.2687 280 GLU A CA  
688  C C   . GLU A 65  ? 1.1532 1.6310 1.3334 -0.2096 -0.1883 -0.3148 280 GLU A C   
689  O O   . GLU A 65  ? 1.2077 1.7107 1.4045 -0.2393 -0.2123 -0.3493 280 GLU A O   
690  C CB  . GLU A 65  ? 1.1278 1.7098 1.2573 -0.2041 -0.2499 -0.2651 280 GLU A CB  
691  C CG  . GLU A 65  ? 1.1071 1.7202 1.2143 -0.1788 -0.2643 -0.2099 280 GLU A CG  
692  C CD  . GLU A 65  ? 1.1941 1.8831 1.2969 -0.1907 -0.3141 -0.2022 280 GLU A CD  
693  O OE1 . GLU A 65  ? 1.2870 2.0026 1.3718 -0.2218 -0.3381 -0.2465 280 GLU A OE1 
694  O OE2 . GLU A 65  ? 1.1591 1.8811 1.2767 -0.1683 -0.3298 -0.1527 280 GLU A OE2 
701  N N   . LYS A 66  ? 1.3556 1.7751 1.5511 -0.1937 -0.1493 -0.3143 281 LYS A N   
702  C CA  . LYS A 66  ? 1.3636 1.7391 1.6002 -0.2067 -0.1293 -0.3498 281 LYS A CA  
703  C C   . LYS A 66  ? 1.3318 1.7214 1.6558 -0.2237 -0.1392 -0.3473 281 LYS A C   
704  O O   . LYS A 66  ? 1.3079 1.6743 1.6563 -0.2482 -0.1364 -0.3875 281 LYS A O   
705  C CB  . LYS A 66  ? 1.3309 1.6475 1.5685 -0.1803 -0.0875 -0.3389 281 LYS A CB  
706  C CG  . LYS A 66  ? 1.3419 1.6323 1.5126 -0.1731 -0.0692 -0.3638 281 LYS A CG  
707  C CD  . LYS A 66  ? 1.3071 1.5679 1.4741 -0.1930 -0.0620 -0.4203 281 LYS A CD  
708  C CE  . LYS A 66  ? 1.1983 1.4284 1.3143 -0.1787 -0.0345 -0.4421 281 LYS A CE  
709  N NZ  . LYS A 66  ? 1.1261 1.3205 1.2672 -0.1492 -0.0035 -0.4146 281 LYS A NZ  
723  N N   . LYS A 67  ? 1.5400 1.9652 1.9144 -0.2131 -0.1487 -0.3038 282 LYS A N   
724  C CA  . LYS A 67  ? 1.5388 1.9887 1.8949 -0.1839 -0.1524 -0.2542 282 LYS A CA  
725  C C   . LYS A 67  ? 1.5695 1.9715 1.9380 -0.1529 -0.1145 -0.2234 282 LYS A C   
726  O O   . LYS A 67  ? 1.5569 1.9643 1.9822 -0.1404 -0.1056 -0.1923 282 LYS A O   
727  C CB  . LYS A 67  ? 1.4121 1.9288 1.8221 -0.1879 -0.1830 -0.2272 282 LYS A CB  
728  C CG  . LYS A 67  ? 1.4049 1.9813 1.8058 -0.2189 -0.2272 -0.2543 282 LYS A CG  
729  C CD  . LYS A 67  ? 1.3748 2.0232 1.8437 -0.2196 -0.2563 -0.2236 282 LYS A CD  
730  C CE  . LYS A 67  ? 1.4035 2.1196 1.8725 -0.2531 -0.3045 -0.2515 282 LYS A CE  
731  N NZ  . LYS A 67  ? 1.3601 2.1474 1.9194 -0.2575 -0.3288 -0.2259 282 LYS A NZ  
745  N N   . GLY A 68  ? 1.4943 1.8543 1.8071 -0.1409 -0.0930 -0.2331 283 GLY A N   
746  C CA  . GLY A 68  ? 1.3841 1.6979 1.6980 -0.1146 -0.0590 -0.2125 283 GLY A CA  
747  C C   . GLY A 68  ? 1.3888 1.7069 1.6466 -0.0950 -0.0586 -0.1863 283 GLY A C   
748  O O   . GLY A 68  ? 1.2528 1.5395 1.5003 -0.0735 -0.0352 -0.1669 283 GLY A O   
752  N N   . GLY A 69  ? 1.7224 2.0792 1.9405 -0.1047 -0.0855 -0.1875 284 GLY A N   
753  C CA  . GLY A 69  ? 1.6737 2.0443 1.8525 -0.0883 -0.0924 -0.1523 284 GLY A CA  
754  C C   . GLY A 69  ? 1.7419 2.1477 1.9676 -0.0786 -0.1103 -0.1165 284 GLY A C   
755  O O   . GLY A 69  ? 1.7930 2.2264 2.0768 -0.0904 -0.1235 -0.1232 284 GLY A O   
759  N N   . LEU A 70  ? 1.1133 1.5186 1.3151 -0.0574 -0.1102 -0.0788 285 LEU A N   
760  C CA  . LEU A 70  ? 1.0152 1.4375 1.2637 -0.0368 -0.1142 -0.0394 285 LEU A CA  
761  C C   . LEU A 70  ? 0.9151 1.4004 1.2170 -0.0451 -0.1462 -0.0332 285 LEU A C   
762  O O   . LEU A 70  ? 0.8704 1.3714 1.2328 -0.0294 -0.1429 -0.0074 285 LEU A O   
763  C CB  . LEU A 70  ? 1.0472 1.4570 1.2480 -0.0157 -0.1132 -0.0040 285 LEU A CB  
764  C CG  . LEU A 70  ? 1.0640 1.4804 1.3042 0.0123  -0.1124 0.0388  285 LEU A CG  
765  C CD1 . LEU A 70  ? 0.9039 1.2895 1.1945 0.0257  -0.0822 0.0416  285 LEU A CD1 
766  C CD2 . LEU A 70  ? 1.1122 1.5016 1.2972 0.0301  -0.1079 0.0691  285 LEU A CD2 
778  N N   . ARG A 71  ? 0.9881 1.5134 1.2698 -0.0695 -0.1768 -0.0571 286 ARG A N   
779  C CA  . ARG A 71  ? 1.0065 1.6023 1.3339 -0.0769 -0.2138 -0.0474 286 ARG A CA  
780  C C   . ARG A 71  ? 0.8929 1.5055 1.3164 -0.0816 -0.2068 -0.0486 286 ARG A C   
781  O O   . ARG A 71  ? 0.8007 1.4578 1.2814 -0.0674 -0.2185 -0.0175 286 ARG A O   
782  C CB  . ARG A 71  ? 1.0056 1.6401 1.2938 -0.1082 -0.2479 -0.0827 286 ARG A CB  
783  C CG  . ARG A 71  ? 1.0035 1.7184 1.3125 -0.1103 -0.2940 -0.0629 286 ARG A CG  
784  C CD  . ARG A 71  ? 0.9910 1.7570 1.3603 -0.1437 -0.3203 -0.0965 286 ARG A CD  
785  N NE  . ARG A 71  ? 1.0123 1.8633 1.4270 -0.1404 -0.3622 -0.0698 286 ARG A NE  
786  C CZ  . ARG A 71  ? 1.0202 1.9339 1.4963 -0.1694 -0.3930 -0.0919 286 ARG A CZ  
787  N NH1 . ARG A 71  ? 1.0590 1.9514 1.5558 -0.2051 -0.3847 -0.1420 286 ARG A NH1 
788  N NH2 . ARG A 71  ? 0.9881 1.9646 1.5017 -0.1594 -0.4270 -0.0631 286 ARG A NH2 
802  N N   . GLU A 72  ? 1.0488 1.6258 1.4919 -0.0998 -0.1855 -0.0821 287 GLU A N   
803  C CA  . GLU A 72  ? 1.0298 1.6188 1.5618 -0.1086 -0.1757 -0.0835 287 GLU A CA  
804  C C   . GLU A 72  ? 1.0138 1.5687 1.5777 -0.0777 -0.1389 -0.0498 287 GLU A C   
805  O O   . GLU A 72  ? 0.9909 1.5706 1.6308 -0.0751 -0.1316 -0.0341 287 GLU A O   
806  C CB  . GLU A 72  ? 1.0950 1.6518 1.6344 -0.1398 -0.1655 -0.1305 287 GLU A CB  
807  C CG  . GLU A 72  ? 1.1427 1.6928 1.7680 -0.1501 -0.1455 -0.1314 287 GLU A CG  
808  C CD  . GLU A 72  ? 1.1654 1.6735 1.7931 -0.1803 -0.1347 -0.1774 287 GLU A CD  
809  O OE1 . GLU A 72  ? 1.0286 1.4771 1.6008 -0.1724 -0.1132 -0.1936 287 GLU A OE1 
810  O OE2 . GLU A 72  ? 1.1001 1.6349 1.7879 -0.2119 -0.1475 -0.1975 287 GLU A OE2 
817  N N   . LEU A 73  ? 0.7314 1.2317 1.2369 -0.0556 -0.1152 -0.0399 288 LEU A N   
818  C CA  . LEU A 73  ? 0.6335 1.0922 1.1572 -0.0297 -0.0784 -0.0167 288 LEU A CA  
819  C C   . LEU A 73  ? 0.6060 1.0855 1.1497 0.0013  -0.0776 0.0261  288 LEU A C   
820  O O   . LEU A 73  ? 0.5610 1.0321 1.1500 0.0183  -0.0529 0.0450  288 LEU A O   
821  C CB  . LEU A 73  ? 0.6205 1.0143 1.0768 -0.0208 -0.0543 -0.0267 288 LEU A CB  
822  C CG  . LEU A 73  ? 0.6293 0.9780 1.0945 0.0034  -0.0180 -0.0079 288 LEU A CG  
823  C CD1 . LEU A 73  ? 0.6303 0.9779 1.1616 -0.0044 -0.0007 -0.0119 288 LEU A CD1 
824  C CD2 . LEU A 73  ? 0.6743 0.9695 1.0772 0.0088  0.0003  -0.0202 288 LEU A CD2 
836  N N   . TYR A 74  ? 0.9678 1.4712 1.4752 0.0104  -0.1023 0.0420  289 TYR A N   
837  C CA  . TYR A 74  ? 0.9952 1.5124 1.5177 0.0434  -0.1018 0.0838  289 TYR A CA  
838  C C   . TYR A 74  ? 1.0400 1.6212 1.6549 0.0467  -0.1113 0.0996  289 TYR A C   
839  O O   . TYR A 74  ? 0.9384 1.5199 1.5930 0.0754  -0.0916 0.1284  289 TYR A O   
840  C CB  . TYR A 74  ? 1.0715 1.6021 1.5359 0.0503  -0.1290 0.0993  289 TYR A CB  
841  C CG  . TYR A 74  ? 1.0968 1.6243 1.5659 0.0880  -0.1246 0.1435  289 TYR A CG  
842  C CD1 . TYR A 74  ? 1.0895 1.5533 1.4981 0.1067  -0.1036 0.1574  289 TYR A CD1 
843  C CD2 . TYR A 74  ? 1.0305 1.6188 1.5677 0.1049  -0.1411 0.1706  289 TYR A CD2 
844  C CE1 . TYR A 74  ? 1.1109 1.5624 1.5228 0.1414  -0.0976 0.1960  289 TYR A CE1 
845  C CE2 . TYR A 74  ? 1.0364 1.6182 1.5801 0.1433  -0.1350 0.2111  289 TYR A CE2 
846  C CZ  . TYR A 74  ? 1.0610 1.5698 1.5399 0.1616  -0.1126 0.2231  289 TYR A CZ  
847  O OH  . TYR A 74  ? 1.0215 1.5150 1.5064 0.2000  -0.1046 0.2616  289 TYR A OH  
857  N N   . ASP A 75  ? 1.5001 2.1367 2.1497 0.0161  -0.1408 0.0785  290 ASP A N   
858  C CA  . ASP A 75  ? 1.4814 2.1901 2.2263 0.0112  -0.1540 0.0889  290 ASP A CA  
859  C C   . ASP A 75  ? 1.4082 2.0955 2.2139 0.0209  -0.1123 0.0974  290 ASP A C   
860  O O   . ASP A 75  ? 1.3811 2.1012 2.2461 0.0458  -0.1021 0.1283  290 ASP A O   
861  C CB  . ASP A 75  ? 1.5246 2.2810 2.2919 -0.0329 -0.1872 0.0530  290 ASP A CB  
862  C CG  . ASP A 75  ? 1.6185 2.3867 2.3095 -0.0463 -0.2240 0.0372  290 ASP A CG  
863  O OD1 . ASP A 75  ? 1.6390 2.3629 2.2527 -0.0266 -0.2165 0.0487  290 ASP A OD1 
864  O OD2 . ASP A 75  ? 1.6535 2.4751 2.3603 -0.0783 -0.2595 0.0121  290 ASP A OD2 
869  N N   . ARG A 76  ? 0.8082 1.4402 1.5965 0.0032  -0.0870 0.0710  291 ARG A N   
870  C CA  . ARG A 76  ? 0.7319 1.3416 1.5712 0.0072  -0.0476 0.0770  291 ARG A CA  
871  C C   . ARG A 76  ? 0.6934 1.2785 1.5271 0.0502  -0.0173 0.1116  291 ARG A C   
872  O O   . ARG A 76  ? 0.6929 1.2703 1.5529 0.0604  0.0094  0.1235  291 ARG A O   
873  C CB  . ARG A 76  ? 0.6547 1.1978 1.4563 -0.0118 -0.0266 0.0471  291 ARG A CB  
874  C CG  . ARG A 76  ? 0.7698 1.3279 1.5720 -0.0533 -0.0538 0.0082  291 ARG A CG  
875  C CD  . ARG A 76  ? 0.7591 1.2456 1.5059 -0.0639 -0.0360 -0.0209 291 ARG A CD  
876  N NE  . ARG A 76  ? 0.8845 1.3643 1.6775 -0.0972 -0.0311 -0.0474 291 ARG A NE  
877  C CZ  . ARG A 76  ? 0.9936 1.4099 1.7712 -0.1018 -0.0036 -0.0626 291 ARG A CZ  
878  N NH1 . ARG A 76  ? 0.9115 1.2729 1.6298 -0.0756 0.0194  -0.0548 291 ARG A NH1 
879  N NH2 . ARG A 76  ? 1.0513 1.4591 1.8749 -0.1328 0.0004  -0.0850 291 ARG A NH2 
893  N N   . GLY A 77  ? 0.5822 1.1321 1.3431 0.0717  -0.0209 0.1200  292 GLY A N   
894  C CA  . GLY A 77  ? 0.5164 1.0438 1.2671 0.1122  0.0013  0.1509  292 GLY A CA  
895  C C   . GLY A 77  ? 0.3828 0.8341 1.0930 0.1238  0.0439  0.1466  292 GLY A C   
896  O O   . GLY A 77  ? 0.3593 0.7868 1.0672 0.1051  0.0568  0.1268  292 GLY A O   
900  N N   . PRO A 78  ? 0.3418 0.7508 1.0135 0.1529  0.0643  0.1633  293 PRO A N   
901  C CA  . PRO A 78  ? 0.3700 0.8004 1.0479 0.1765  0.0525  0.1868  293 PRO A CA  
902  C C   . PRO A 78  ? 0.4258 0.8440 1.0591 0.1889  0.0342  0.1968  293 PRO A C   
903  O O   . PRO A 78  ? 0.4435 0.8168 1.0285 0.1856  0.0437  0.1857  293 PRO A O   
904  C CB  . PRO A 78  ? 0.3753 0.7539 1.0276 0.1969  0.0878  0.1942  293 PRO A CB  
905  C CG  . PRO A 78  ? 0.4218 0.7326 1.0125 0.1914  0.1097  0.1779  293 PRO A CG  
906  C CD  . PRO A 78  ? 0.4229 0.7563 1.0365 0.1631  0.0986  0.1585  293 PRO A CD  
914  N N   . PRO A 79  ? 0.8331 1.1170 1.0065 0.2207  0.1066  0.2741  294 PRO A N   
915  C CA  . PRO A 79  ? 0.7162 0.9571 0.8781 0.2269  0.1112  0.2654  294 PRO A CA  
916  C C   . PRO A 79  ? 0.5901 0.7601 0.7302 0.2374  0.1244  0.2440  294 PRO A C   
917  O O   . PRO A 79  ? 0.6787 0.8067 0.8095 0.2308  0.1216  0.2300  294 PRO A O   
918  C CB  . PRO A 79  ? 0.8112 1.0936 0.9756 0.2445  0.1213  0.2877  294 PRO A CB  
919  C CG  . PRO A 79  ? 0.8600 1.2181 1.0416 0.2364  0.1136  0.3080  294 PRO A CG  
920  C CD  . PRO A 79  ? 0.8428 1.1960 1.0263 0.2287  0.1105  0.2994  294 PRO A CD  
928  N N   . HIS A 80  ? 0.6120 0.7719 0.7434 0.2510  0.1380  0.2417  295 HIS A N   
929  C CA  . HIS A 80  ? 0.5885 0.6856 0.6965 0.2601  0.1528  0.2234  295 HIS A CA  
930  C C   . HIS A 80  ? 0.7711 0.8267 0.8726 0.2418  0.1442  0.1992  295 HIS A C   
931  O O   . HIS A 80  ? 0.5982 0.6032 0.6796 0.2433  0.1543  0.1820  295 HIS A O   
932  C CB  . HIS A 80  ? 0.7959 0.8980 0.8957 0.2796  0.1699  0.2293  295 HIS A CB  
933  C CG  . HIS A 80  ? 0.9029 1.0386 1.0154 0.2729  0.1631  0.2311  295 HIS A CG  
934  N ND1 . HIS A 80  ? 0.9243 1.0292 1.0288 0.2664  0.1642  0.2127  295 HIS A ND1 
935  C CD2 . HIS A 80  ? 0.8662 1.0668 0.9985 0.2702  0.1550  0.2498  295 HIS A CD2 
936  C CE1 . HIS A 80  ? 0.8778 1.0251 0.9971 0.2616  0.1574  0.2204  295 HIS A CE1 
937  N NE2 . HIS A 80  ? 1.0113 1.2166 1.1473 0.2626  0.1515  0.2427  295 HIS A NE2 
945  N N   . ALA A 81  ? 0.5332 0.6110 0.6495 0.2241  0.1262  0.1988  296 ALA A N   
946  C CA  . ALA A 81  ? 0.5271 0.5706 0.6364 0.2093  0.1182  0.1789  296 ALA A CA  
947  C C   . ALA A 81  ? 0.5005 0.5166 0.6050 0.1957  0.1076  0.1680  296 ALA A C   
948  O O   . ALA A 81  ? 0.4311 0.4190 0.5276 0.1840  0.1013  0.1514  296 ALA A O   
949  C CB  . ALA A 81  ? 0.4786 0.5541 0.6020 0.1991  0.1060  0.1848  296 ALA A CB  
955  N N   . PHE A 82  ? 0.3835 0.4098 0.4916 0.1983  0.1066  0.1777  297 PHE A N   
956  C CA  . PHE A 82  ? 0.3725 0.3809 0.4782 0.1855  0.0957  0.1700  297 PHE A CA  
957  C C   . PHE A 82  ? 0.4262 0.3914 0.5139 0.1899  0.1062  0.1588  297 PHE A C   
958  O O   . PHE A 82  ? 0.4239 0.3884 0.5069 0.2045  0.1192  0.1683  297 PHE A O   
959  C CB  . PHE A 82  ? 0.3587 0.4109 0.4810 0.1822  0.0856  0.1890  297 PHE A CB  
960  C CG  . PHE A 82  ? 0.4151 0.5049 0.5522 0.1702  0.0719  0.1989  297 PHE A CG  
961  C CD1 . PHE A 82  ? 0.3354 0.4642 0.4828 0.1771  0.0764  0.2131  297 PHE A CD1 
962  C CD2 . PHE A 82  ? 0.3375 0.4224 0.4756 0.1513  0.0549  0.1950  297 PHE A CD2 
963  C CE1 . PHE A 82  ? 0.3238 0.4890 0.4834 0.1632  0.0635  0.2242  297 PHE A CE1 
964  C CE2 . PHE A 82  ? 0.4362 0.5502 0.5832 0.1381  0.0428  0.2060  297 PHE A CE2 
965  C CZ  . PHE A 82  ? 0.3859 0.5414 0.5439 0.1430  0.0465  0.2212  297 PHE A CZ  
975  N N   . PHE A 83  ? 0.3924 0.3232 0.4690 0.1770  0.1012  0.1399  298 PHE A N   
976  C CA  . PHE A 83  ? 0.4167 0.3069 0.4751 0.1769  0.1108  0.1286  298 PHE A CA  
977  C C   . PHE A 83  ? 0.4009 0.2820 0.4589 0.1627  0.0979  0.1215  298 PHE A C   
978  O O   . PHE A 83  ? 0.3729 0.2670 0.4392 0.1508  0.0821  0.1185  298 PHE A O   
979  C CB  . PHE A 83  ? 0.4345 0.2902 0.4754 0.1750  0.1217  0.1114  298 PHE A CB  
980  C CG  . PHE A 83  ? 0.5135 0.3702 0.5496 0.1902  0.1376  0.1167  298 PHE A CG  
981  C CD1 . PHE A 83  ? 0.5326 0.3644 0.5517 0.2037  0.1573  0.1200  298 PHE A CD1 
982  C CD2 . PHE A 83  ? 0.4804 0.3621 0.5272 0.1918  0.1337  0.1196  298 PHE A CD2 
983  C CE1 . PHE A 83  ? 0.5284 0.3594 0.5406 0.2194  0.1732  0.1254  298 PHE A CE1 
984  C CE2 . PHE A 83  ? 0.4786 0.3629 0.5205 0.2069  0.1491  0.1250  298 PHE A CE2 
985  C CZ  . PHE A 83  ? 0.5420 0.4003 0.5661 0.2209  0.1688  0.1276  298 PHE A CZ  
995  N N   . LEU A 84  ? 0.4243 0.2805 0.4703 0.1645  0.1059  0.1194  299 LEU A N   
996  C CA  . LEU A 84  ? 0.4496 0.2930 0.4921 0.1514  0.0964  0.1112  299 LEU A CA  
997  C C   . LEU A 84  ? 0.4427 0.2422 0.4629 0.1462  0.1089  0.0950  299 LEU A C   
998  O O   . LEU A 84  ? 0.4792 0.2540 0.4839 0.1555  0.1273  0.0960  299 LEU A O   
999  C CB  . LEU A 84  ? 0.4155 0.2738 0.4646 0.1562  0.0938  0.1257  299 LEU A CB  
1000 C CG  . LEU A 84  ? 0.5404 0.3819 0.5829 0.1467  0.0888  0.1206  299 LEU A CG  
1001 C CD1 . LEU A 84  ? 0.4334 0.2934 0.4866 0.1330  0.0691  0.1180  299 LEU A CD1 
1002 C CD2 . LEU A 84  ? 0.6839 0.5316 0.7268 0.1592  0.0965  0.1368  299 LEU A CD2 
1014 N N   . VAL A 85  ? 0.4257 0.2150 0.4421 0.1314  0.1007  0.0806  300 VAL A N   
1015 C CA  . VAL A 85  ? 0.4515 0.2025 0.4460 0.1222  0.1124  0.0646  300 VAL A CA  
1016 C C   . VAL A 85  ? 0.4461 0.1900 0.4382 0.1115  0.1054  0.0615  300 VAL A C   
1017 O O   . VAL A 85  ? 0.4141 0.1788 0.4190 0.1052  0.0889  0.0615  300 VAL A O   
1018 C CB  . VAL A 85  ? 0.4455 0.1905 0.4343 0.1139  0.1128  0.0489  300 VAL A CB  
1019 C CG1 . VAL A 85  ? 0.4769 0.1832 0.4398 0.1001  0.1266  0.0306  300 VAL A CG1 
1020 C CG2 . VAL A 85  ? 0.4511 0.2028 0.4416 0.1240  0.1199  0.0513  300 VAL A CG2 
1030 N N   . LYS A 86  ? 0.4812 0.1934 0.4543 0.1091  0.1192  0.0587  301 LYS A N   
1031 C CA  . LYS A 86  ? 0.4800 0.1818 0.4476 0.0966  0.1149  0.0536  301 LYS A CA  
1032 C C   . LYS A 86  ? 0.5054 0.1733 0.4482 0.0788  0.1268  0.0327  301 LYS A C   
1033 O O   . LYS A 86  ? 0.5457 0.1823 0.4657 0.0760  0.1450  0.0252  301 LYS A O   
1034 C CB  . LYS A 86  ? 0.5009 0.1941 0.4644 0.1033  0.1201  0.0662  301 LYS A CB  
1035 C CG  . LYS A 86  ? 0.8312 0.5139 0.7884 0.0886  0.1153  0.0605  301 LYS A CG  
1036 C CD  . LYS A 86  ? 0.7766 0.4684 0.7404 0.0957  0.1111  0.0766  301 LYS A CD  
1037 C CE  . LYS A 86  ? 0.8836 0.5687 0.8429 0.0804  0.1049  0.0710  301 LYS A CE  
1038 N NZ  . LYS A 86  ? 0.7372 0.4277 0.6998 0.0872  0.1028  0.0869  301 LYS A NZ  
1052 N N   . PHE A 87  ? 0.4843 0.1596 0.4298 0.0655  0.1173  0.0223  302 PHE A N   
1053 C CA  . PHE A 87  ? 0.5469 0.1966 0.4680 0.0437  0.1280  0.0001  302 PHE A CA  
1054 C C   . PHE A 87  ? 0.5224 0.1567 0.4304 0.0274  0.1300  -0.0048 302 PHE A C   
1055 O O   . PHE A 87  ? 0.4952 0.1483 0.4195 0.0309  0.1165  0.0041  302 PHE A O   
1056 C CB  . PHE A 87  ? 0.5629 0.2452 0.4941 0.0364  0.1150  -0.0118 302 PHE A CB  
1057 C CG  . PHE A 87  ? 0.4728 0.1655 0.4075 0.0438  0.1164  -0.0145 302 PHE A CG  
1058 C CD1 . PHE A 87  ? 0.5167 0.1803 0.4274 0.0357  0.1351  -0.0274 302 PHE A CD1 
1059 C CD2 . PHE A 87  ? 0.5838 0.3147 0.5431 0.0564  0.0993  -0.0053 302 PHE A CD2 
1060 C CE1 . PHE A 87  ? 0.5852 0.2614 0.4984 0.0415  0.1365  -0.0308 302 PHE A CE1 
1061 C CE2 . PHE A 87  ? 0.6851 0.4271 0.6466 0.0622  0.1006  -0.0076 302 PHE A CE2 
1062 C CZ  . PHE A 87  ? 0.6123 0.3297 0.5523 0.0553  0.1187  -0.0202 302 PHE A CZ  
1072 N N   . TRP A 88  ? 0.5657 0.1682 0.4425 0.0063  0.1463  -0.0205 303 TRP A N   
1073 C CA  . TRP A 88  ? 0.5837 0.1773 0.4452 -0.0174 0.1476  -0.0309 303 TRP A CA  
1074 C C   . TRP A 88  ? 0.5909 0.2138 0.4435 -0.0438 0.1436  -0.0549 303 TRP A C   
1075 O O   . TRP A 88  ? 0.6101 0.2104 0.4352 -0.0627 0.1591  -0.0715 303 TRP A O   
1076 C CB  . TRP A 88  ? 0.6298 0.1865 0.4642 -0.0249 0.1643  -0.0286 303 TRP A CB  
1077 C CG  . TRP A 88  ? 0.6266 0.1824 0.4752 0.0008  0.1615  -0.0045 303 TRP A CG  
1078 C CD1 . TRP A 88  ? 0.6206 0.1799 0.4748 0.0017  0.1553  0.0058  303 TRP A CD1 
1079 C CD2 . TRP A 88  ? 0.6298 0.1868 0.4889 0.0280  0.1647  0.0120  303 TRP A CD2 
1080 N NE1 . TRP A 88  ? 0.6235 0.1867 0.4905 0.0274  0.1544  0.0273  303 TRP A NE1 
1081 C CE2 . TRP A 88  ? 0.6251 0.1898 0.4963 0.0436  0.1597  0.0313  303 TRP A CE2 
1082 C CE3 . TRP A 88  ? 0.6370 0.1922 0.4960 0.0395  0.1715  0.0118  303 TRP A CE3 
1083 C CZ2 . TRP A 88  ? 0.6287 0.2017 0.5110 0.0689  0.1617  0.0495  303 TRP A CZ2 
1084 C CZ3 . TRP A 88  ? 0.6637 0.2254 0.5340 0.0655  0.1739  0.0306  303 TRP A CZ3 
1085 C CH2 . TRP A 88  ? 0.6378 0.2088 0.5188 0.0795  0.1695  0.0488  303 TRP A CH2 
1096 N N   . ALA A 89  ? 0.5773 0.2581 0.4535 -0.0439 0.1218  -0.0554 304 ALA A N   
1097 C CA  . ALA A 89  ? 0.5778 0.3075 0.4543 -0.0597 0.1130  -0.0722 304 ALA A CA  
1098 C C   . ALA A 89  ? 0.6955 0.4333 0.5483 -0.0936 0.1190  -0.0900 304 ALA A C   
1099 O O   . ALA A 89  ? 0.7014 0.4298 0.5495 -0.1021 0.1195  -0.0872 304 ALA A O   
1100 C CB  . ALA A 89  ? 0.5237 0.3083 0.4315 -0.0422 0.0894  -0.0637 304 ALA A CB  
1106 N N   . ASP A 90  ? 0.7809 0.5410 0.6180 -0.1152 0.1233  -0.1084 305 ASP A N   
1107 C CA  . ASP A 90  ? 0.9414 0.7323 0.7600 -0.1501 0.1248  -0.1261 305 ASP A CA  
1108 C C   . ASP A 90  ? 0.9085 0.7828 0.7522 -0.1445 0.1029  -0.1262 305 ASP A C   
1109 O O   . ASP A 90  ? 0.7696 0.6881 0.6222 -0.1390 0.0953  -0.1300 305 ASP A O   
1110 C CB  . ASP A 90  ? 0.8694 0.6480 0.6547 -0.1806 0.1414  -0.1468 305 ASP A CB  
1111 C CG  . ASP A 90  ? 0.9773 0.7612 0.7329 -0.2225 0.1505  -0.1640 305 ASP A CG  
1112 O OD1 . ASP A 90  ? 0.9854 0.8124 0.7559 -0.2245 0.1375  -0.1604 305 ASP A OD1 
1113 O OD2 . ASP A 90  ? 1.0710 0.8160 0.7888 -0.2521 0.1709  -0.1792 305 ASP A OD2 
1118 N N   . LEU A 91  ? 0.6695 0.5644 0.5232 -0.1440 0.0939  -0.1209 306 LEU A N   
1119 C CA  . LEU A 91  ? 0.7947 0.7638 0.6693 -0.1345 0.0756  -0.1197 306 LEU A CA  
1120 C C   . LEU A 91  ? 0.7969 0.8231 0.6583 -0.1662 0.0756  -0.1352 306 LEU A C   
1121 O O   . LEU A 91  ? 0.8093 0.8942 0.6870 -0.1556 0.0622  -0.1319 306 LEU A O   
1122 C CB  . LEU A 91  ? 0.5873 0.5505 0.4841 -0.1084 0.0639  -0.1027 306 LEU A CB  
1123 C CG  . LEU A 91  ? 0.6918 0.6345 0.6104 -0.0734 0.0554  -0.0854 306 LEU A CG  
1124 C CD1 . LEU A 91  ? 0.6523 0.6108 0.5883 -0.0551 0.0420  -0.0742 306 LEU A CD1 
1125 C CD2 . LEU A 91  ? 0.7395 0.7103 0.6664 -0.0595 0.0497  -0.0861 306 LEU A CD2 
1137 N N   . ASN A 92  ? 0.9741 0.9854 0.8043 -0.2048 0.0912  -0.1519 307 ASN A N   
1138 C CA  . ASN A 92  ? 1.0336 1.1084 0.8503 -0.2395 0.0909  -0.1671 307 ASN A CA  
1139 C C   . ASN A 92  ? 0.9407 1.0762 0.7516 -0.2535 0.0895  -0.1797 307 ASN A C   
1140 O O   . ASN A 92  ? 0.9086 1.0174 0.6910 -0.2830 0.1042  -0.1943 307 ASN A O   
1141 C CB  . ASN A 92  ? 1.1907 1.2184 0.9712 -0.2816 0.1093  -0.1792 307 ASN A CB  
1142 C CG  . ASN A 92  ? 1.2128 1.3141 0.9860 -0.3160 0.1079  -0.1894 307 ASN A CG  
1143 O OD1 . ASN A 92  ? 1.1721 1.3490 0.9563 -0.3222 0.1025  -0.1922 307 ASN A OD1 
1144 N ND2 . ASN A 92  ? 1.2385 1.3204 1.0016 -0.3318 0.1137  -0.1870 307 ASN A ND2 
1151 N N   . TRP A 93  ? 1.0947 1.3111 0.9303 -0.2318 0.0729  -0.1736 308 TRP A N   
1152 C CA  . TRP A 93  ? 1.1284 1.4205 0.9615 -0.2429 0.0694  -0.1825 308 TRP A CA  
1153 C C   . TRP A 93  ? 0.9135 1.3024 0.7708 -0.2363 0.0571  -0.1751 308 TRP A C   
1154 O O   . TRP A 93  ? 1.0022 1.4040 0.8606 -0.2506 0.0584  -0.1751 308 TRP A O   
1155 C CB  . TRP A 93  ? 0.8364 1.1236 0.6853 -0.2084 0.0632  -0.1727 308 TRP A CB  
1156 C CG  . TRP A 93  ? 0.7369 1.0652 0.6172 -0.1620 0.0459  -0.1541 308 TRP A CG  
1157 C CD1 . TRP A 93  ? 0.6613 1.0773 0.5530 -0.1468 0.0353  -0.1500 308 TRP A CD1 
1158 C CD2 . TRP A 93  ? 0.6663 0.9471 0.5662 -0.1255 0.0392  -0.1370 308 TRP A CD2 
1159 N NE1 . TRP A 93  ? 0.6228 1.0394 0.5369 -0.1019 0.0241  -0.1318 308 TRP A NE1 
1160 C CE2 . TRP A 93  ? 0.6463 0.9810 0.5653 -0.0909 0.0260  -0.1247 308 TRP A CE2 
1161 C CE3 . TRP A 93  ? 0.8280 1.0278 0.7292 -0.1190 0.0438  -0.1302 308 TRP A CE3 
1162 C CZ2 . TRP A 93  ? 0.6952 0.9989 0.6308 -0.0544 0.0181  -0.1085 308 TRP A CZ2 
1163 C CZ3 . TRP A 93  ? 0.8868 1.0665 0.8083 -0.0836 0.0341  -0.1135 308 TRP A CZ3 
1164 C CH2 . TRP A 93  ? 0.7606 0.9889 0.6975 -0.0536 0.0217  -0.1040 308 TRP A CH2 
1175 N N   . GLY A 110 ? 0.4850 1.2179 0.4535 0.1042  -0.0113 -0.0466 325 GLY A N   
1176 C CA  . GLY A 110 ? 0.7482 1.4408 0.7042 0.0674  -0.0099 -0.0620 325 GLY A CA  
1177 C C   . GLY A 110 ? 0.6446 1.2628 0.5922 0.0857  -0.0100 -0.0549 325 GLY A C   
1178 O O   . GLY A 110 ? 0.7022 1.2767 0.6536 0.1207  -0.0125 -0.0398 325 GLY A O   
1181 N N   . PHE A 111 ? 0.4457 1.0409 0.3872 0.0601  -0.0056 -0.0649 326 PHE A N   
1182 C CA  . PHE A 111 ? 0.3765 0.8987 0.3193 0.0749  -0.0045 -0.0567 326 PHE A CA  
1183 C C   . PHE A 111 ? 0.3705 0.8056 0.3131 0.0529  0.0018  -0.0665 326 PHE A C   
1184 O O   . PHE A 111 ? 0.4196 0.8461 0.3533 0.0173  0.0094  -0.0835 326 PHE A O   
1185 C CB  . PHE A 111 ? 0.3907 0.9484 0.3273 0.0722  -0.0037 -0.0561 326 PHE A CB  
1186 C CG  . PHE A 111 ? 0.5657 1.0575 0.5035 0.0877  -0.0025 -0.0466 326 PHE A CG  
1187 C CD1 . PHE A 111 ? 0.6787 1.1503 0.6196 0.1278  -0.0071 -0.0257 326 PHE A CD1 
1188 C CD2 . PHE A 111 ? 0.5665 1.0142 0.4994 0.0620  0.0046  -0.0586 326 PHE A CD2 
1189 C CE1 . PHE A 111 ? 0.5694 0.9825 0.5099 0.1382  -0.0059 -0.0171 326 PHE A CE1 
1190 C CE2 . PHE A 111 ? 0.6822 1.0759 0.6174 0.0761  0.0058  -0.0492 326 PHE A CE2 
1191 C CZ  . PHE A 111 ? 0.5923 0.9710 0.5318 0.1125  -0.0001 -0.0285 326 PHE A CZ  
1201 N N   . TYR A 112 ? 0.5318 0.9024 0.4817 0.0755  -0.0004 -0.0547 327 TYR A N   
1202 C CA  . TYR A 112 ? 0.4855 0.7778 0.4379 0.0633  0.0044  -0.0583 327 TYR A CA  
1203 C C   . TYR A 112 ? 0.4754 0.7262 0.4290 0.0736  0.0059  -0.0503 327 TYR A C   
1204 O O   . TYR A 112 ? 0.4267 0.6718 0.3827 0.1012  0.0008  -0.0351 327 TYR A O   
1205 C CB  . TYR A 112 ? 0.4672 0.7241 0.4266 0.0782  0.0005  -0.0504 327 TYR A CB  
1206 C CG  . TYR A 112 ? 0.4636 0.7571 0.4222 0.0666  -0.0002 -0.0586 327 TYR A CG  
1207 C CD1 . TYR A 112 ? 0.4757 0.8398 0.4335 0.0804  -0.0047 -0.0555 327 TYR A CD1 
1208 C CD2 . TYR A 112 ? 0.5767 0.8368 0.5344 0.0426  0.0045  -0.0681 327 TYR A CD2 
1209 C CE1 . TYR A 112 ? 0.5560 0.9595 0.5137 0.0688  -0.0051 -0.0628 327 TYR A CE1 
1210 C CE2 . TYR A 112 ? 0.5983 0.8920 0.5541 0.0296  0.0042  -0.0755 327 TYR A CE2 
1211 C CZ  . TYR A 112 ? 0.5339 0.9003 0.4905 0.0417  -0.0008 -0.0734 327 TYR A CZ  
1212 O OH  . TYR A 112 ? 0.7146 1.1190 0.6698 0.0274  -0.0007 -0.0807 327 TYR A OH  
1222 N N   . GLY A 113 ? 0.4312 0.6506 0.3806 0.0516  0.0144  -0.0602 328 GLY A N   
1223 C CA  . GLY A 113 ? 0.4263 0.6155 0.3765 0.0596  0.0169  -0.0537 328 GLY A CA  
1224 C C   . GLY A 113 ? 0.3728 0.5000 0.3240 0.0485  0.0256  -0.0569 328 GLY A C   
1225 O O   . GLY A 113 ? 0.3604 0.4627 0.3086 0.0318  0.0317  -0.0656 328 GLY A O   
1229 N N   . VAL A 114 ? 0.3518 0.4548 0.3065 0.0601  0.0265  -0.0477 329 VAL A N   
1230 C CA  . VAL A 114 ? 0.3497 0.4018 0.3061 0.0545  0.0356  -0.0480 329 VAL A CA  
1231 C C   . VAL A 114 ? 0.3771 0.4352 0.3274 0.0529  0.0416  -0.0500 329 VAL A C   
1232 O O   . VAL A 114 ? 0.3803 0.4660 0.3319 0.0658  0.0350  -0.0419 329 VAL A O   
1233 C CB  . VAL A 114 ? 0.3649 0.3791 0.3346 0.0717  0.0303  -0.0315 329 VAL A CB  
1234 C CG1 . VAL A 114 ? 0.4003 0.3743 0.3730 0.0697  0.0399  -0.0288 329 VAL A CG1 
1235 C CG2 . VAL A 114 ? 0.3522 0.3584 0.3262 0.0709  0.0255  -0.0309 329 VAL A CG2 
1245 N N   . SER A 115 ? 0.4961 0.5265 0.4371 0.0376  0.0554  -0.0609 330 SER A N   
1246 C CA  . SER A 115 ? 0.5287 0.5603 0.4619 0.0349  0.0634  -0.0646 330 SER A CA  
1247 C C   . SER A 115 ? 0.4840 0.4631 0.4193 0.0390  0.0749  -0.0609 330 SER A C   
1248 O O   . SER A 115 ? 0.5151 0.4594 0.4453 0.0314  0.0841  -0.0661 330 SER A O   
1249 C CB  . SER A 115 ? 0.4718 0.5317 0.3837 0.0092  0.0717  -0.0853 330 SER A CB  
1250 O OG  . SER A 115 ? 0.5398 0.6631 0.4522 0.0108  0.0601  -0.0843 330 SER A OG  
1256 N N   . SER A 116 ? 0.4733 0.4486 0.4161 0.0532  0.0745  -0.0495 331 SER A N   
1257 C CA  . SER A 116 ? 0.4304 0.3663 0.3758 0.0600  0.0864  -0.0444 331 SER A CA  
1258 C C   . SER A 116 ? 0.4342 0.3792 0.3723 0.0609  0.0941  -0.0468 331 SER A C   
1259 O O   . SER A 116 ? 0.4412 0.4233 0.3787 0.0617  0.0859  -0.0456 331 SER A O   
1260 C CB  . SER A 116 ? 0.4047 0.3277 0.3708 0.0777  0.0773  -0.0239 331 SER A CB  
1261 O OG  . SER A 116 ? 0.5718 0.5206 0.5459 0.0874  0.0644  -0.0125 331 SER A OG  
1267 N N   . GLN A 117 ? 0.4661 0.3772 0.3964 0.0615  0.1114  -0.0506 332 GLN A N   
1268 C CA  . GLN A 117 ? 0.5245 0.4393 0.4466 0.0630  0.1214  -0.0536 332 GLN A CA  
1269 C C   . GLN A 117 ? 0.4832 0.3619 0.4105 0.0790  0.1352  -0.0437 332 GLN A C   
1270 O O   . GLN A 117 ? 0.5146 0.3546 0.4350 0.0803  0.1478  -0.0462 332 GLN A O   
1271 C CB  . GLN A 117 ? 0.7854 0.7030 0.6788 0.0400  0.1341  -0.0778 332 GLN A CB  
1272 C CG  . GLN A 117 ? 1.0094 0.9425 0.8937 0.0400  0.1412  -0.0815 332 GLN A CG  
1273 C CD  . GLN A 117 ? 0.9261 0.8600 0.7777 0.0137  0.1558  -0.1073 332 GLN A CD  
1274 O OE1 . GLN A 117 ? 1.1309 1.0884 0.9710 -0.0073 0.1510  -0.1204 332 GLN A OE1 
1275 N NE2 . GLN A 117 ? 0.7958 0.7062 0.6308 0.0136  0.1744  -0.1149 332 GLN A NE2 
1284 N N   . TYR A 118 ? 0.4619 0.3574 0.4016 0.0924  0.1323  -0.0302 333 TYR A N   
1285 C CA  . TYR A 118 ? 0.4748 0.3529 0.4231 0.1101  0.1434  -0.0174 333 TYR A CA  
1286 C C   . TYR A 118 ? 0.4791 0.3637 0.4152 0.1107  0.1561  -0.0239 333 TYR A C   
1287 O O   . TYR A 118 ? 0.5241 0.4354 0.4520 0.0993  0.1504  -0.0325 333 TYR A O   
1288 C CB  . TYR A 118 ? 0.4245 0.3234 0.3998 0.1235  0.1277  0.0067  333 TYR A CB  
1289 C CG  . TYR A 118 ? 0.5205 0.4171 0.5084 0.1229  0.1133  0.0147  333 TYR A CG  
1290 C CD1 . TYR A 118 ? 0.5233 0.4392 0.5131 0.1151  0.0958  0.0141  333 TYR A CD1 
1291 C CD2 . TYR A 118 ? 0.6061 0.4827 0.6031 0.1323  0.1179  0.0245  333 TYR A CD2 
1292 C CE1 . TYR A 118 ? 0.4926 0.4045 0.4917 0.1150  0.0840  0.0208  333 TYR A CE1 
1293 C CE2 . TYR A 118 ? 0.5901 0.4662 0.5976 0.1304  0.1047  0.0316  333 TYR A CE2 
1294 C CZ  . TYR A 118 ? 0.5502 0.4425 0.5581 0.1210  0.0881  0.0286  333 TYR A CZ  
1295 O OH  . TYR A 118 ? 0.5538 0.4442 0.5698 0.1195  0.0761  0.0347  333 TYR A OH  
1305 N N   . GLU A 119 ? 0.5258 0.3909 0.4616 0.1262  0.1729  -0.0177 334 GLU A N   
1306 C CA  . GLU A 119 ? 0.5404 0.4150 0.4669 0.1296  0.1848  -0.0215 334 GLU A CA  
1307 C C   . GLU A 119 ? 0.5287 0.4103 0.4733 0.1533  0.1909  -0.0007 334 GLU A C   
1308 O O   . GLU A 119 ? 0.5501 0.4209 0.5086 0.1676  0.1918  0.0137  334 GLU A O   
1309 C CB  . GLU A 119 ? 0.6393 0.4769 0.5307 0.1190  0.2088  -0.0459 334 GLU A CB  
1310 C CG  . GLU A 119 ? 0.6982 0.4837 0.5782 0.1340  0.2316  -0.0451 334 GLU A CG  
1311 C CD  . GLU A 119 ? 0.8734 0.6084 0.7104 0.1188  0.2570  -0.0717 334 GLU A CD  
1312 O OE1 . GLU A 119 ? 0.8095 0.5556 0.6257 0.0986  0.2604  -0.0907 334 GLU A OE1 
1313 O OE2 . GLU A 119 ? 1.0190 0.7121 0.8461 0.1207  0.2649  -0.0696 334 GLU A OE2 
1320 N N   . SER A 120 ? 0.5087 0.4143 0.4528 0.1566  0.1946  0.0014  335 SER A N   
1321 C CA  . SER A 120 ? 0.5102 0.4306 0.4687 0.1777  0.2029  0.0194  335 SER A CA  
1322 C C   . SER A 120 ? 0.5304 0.4626 0.4748 0.1777  0.2157  0.0112  335 SER A C   
1323 O O   . SER A 120 ? 0.5354 0.4732 0.4629 0.1601  0.2134  -0.0052 335 SER A O   
1324 C CB  . SER A 120 ? 0.4682 0.4289 0.4570 0.1809  0.1813  0.0439  335 SER A CB  
1325 O OG  . SER A 120 ? 0.4761 0.4637 0.4663 0.1653  0.1633  0.0436  335 SER A OG  
1331 N N   . LEU A 121 ? 0.5428 0.4832 0.4945 0.1988  0.2296  0.0239  336 LEU A N   
1332 C CA  . LEU A 121 ? 0.5570 0.5178 0.5007 0.2018  0.2403  0.0211  336 LEU A CA  
1333 C C   . LEU A 121 ? 0.5191 0.5341 0.4853 0.1974  0.2208  0.0391  336 LEU A C   
1334 O O   . LEU A 121 ? 0.5261 0.5633 0.4858 0.1955  0.2258  0.0368  336 LEU A O   
1335 C CB  . LEU A 121 ? 0.5934 0.5383 0.5325 0.2251  0.2626  0.0265  336 LEU A CB  
1336 C CG  . LEU A 121 ? 0.7068 0.5904 0.6186 0.2222  0.2763  0.0098  336 LEU A CG  
1337 C CD1 . LEU A 121 ? 0.8532 0.7210 0.7611 0.2431  0.2903  0.0206  336 LEU A CD1 
1338 C CD2 . LEU A 121 ? 0.6720 0.5299 0.5488 0.2007  0.2873  -0.0202 336 LEU A CD2 
1350 N N   . GLU A 122 ? 0.4836 0.5179 0.4729 0.1942  0.1997  0.0565  337 GLU A N   
1351 C CA  . GLU A 122 ? 0.4573 0.5347 0.4611 0.1869  0.1836  0.0726  337 GLU A CA  
1352 C C   . GLU A 122 ? 0.4351 0.5137 0.4366 0.1680  0.1617  0.0704  337 GLU A C   
1353 O O   . GLU A 122 ? 0.4276 0.4844 0.4285 0.1632  0.1538  0.0650  337 GLU A O   
1354 C CB  . GLU A 122 ? 0.6524 0.7590 0.6819 0.1980  0.1797  0.0981  337 GLU A CB  
1355 C CG  . GLU A 122 ? 0.6581 0.7570 0.7021 0.1967  0.1669  0.1082  337 GLU A CG  
1356 C CD  . GLU A 122 ? 0.7709 0.9027 0.8373 0.2104  0.1694  0.1313  337 GLU A CD  
1357 O OE1 . GLU A 122 ? 0.7640 0.8850 0.8327 0.2315  0.1855  0.1335  337 GLU A OE1 
1358 O OE2 . GLU A 122 ? 0.8024 0.9715 0.8818 0.1996  0.1561  0.1480  337 GLU A OE2 
1365 N N   . HIS A 123 ? 0.4284 0.5332 0.4268 0.1592  0.1536  0.0751  338 HIS A N   
1366 C CA  . HIS A 123 ? 0.4341 0.5419 0.4260 0.1453  0.1355  0.0751  338 HIS A CA  
1367 C C   . HIS A 123 ? 0.4400 0.5503 0.4462 0.1417  0.1187  0.0941  338 HIS A C   
1368 O O   . HIS A 123 ? 0.4480 0.5795 0.4635 0.1404  0.1157  0.1115  338 HIS A O   
1369 C CB  . HIS A 123 ? 0.5176 0.6509 0.4978 0.1394  0.1352  0.0754  338 HIS A CB  
1370 C CG  . HIS A 123 ? 0.5245 0.6613 0.4939 0.1298  0.1196  0.0755  338 HIS A CG  
1371 N ND1 . HIS A 123 ? 0.5186 0.6545 0.4923 0.1264  0.1037  0.0927  338 HIS A ND1 
1372 C CD2 . HIS A 123 ? 0.4410 0.5834 0.3933 0.1238  0.1186  0.0611  338 HIS A CD2 
1373 C CE1 . HIS A 123 ? 0.5355 0.6735 0.4954 0.1230  0.0945  0.0903  338 HIS A CE1 
1374 N NE2 . HIS A 123 ? 0.4735 0.6210 0.4222 0.1213  0.1024  0.0719  338 HIS A NE2 
1382 N N   . MET A 124 ? 0.4236 0.5126 0.4291 0.1381  0.1085  0.0900  339 MET A N   
1383 C CA  . MET A 124 ? 0.4323 0.5167 0.4464 0.1332  0.0939  0.1048  339 MET A CA  
1384 C C   . MET A 124 ? 0.3962 0.4666 0.3978 0.1274  0.0811  0.1003  339 MET A C   
1385 O O   . MET A 124 ? 0.3969 0.4667 0.3868 0.1274  0.0830  0.0860  339 MET A O   
1386 C CB  . MET A 124 ? 0.3685 0.4412 0.3971 0.1386  0.0959  0.1075  339 MET A CB  
1387 C CG  . MET A 124 ? 0.3703 0.4607 0.4123 0.1492  0.1089  0.1156  339 MET A CG  
1388 S SD  . MET A 124 ? 0.4120 0.4897 0.4688 0.1594  0.1123  0.1197  339 MET A SD  
1389 C CE  . MET A 124 ? 0.3942 0.4312 0.4348 0.1645  0.1238  0.0946  339 MET A CE  
1399 N N   . THR A 125 ? 0.4019 0.4631 0.4043 0.1220  0.0690  0.1134  340 THR A N   
1400 C CA  . THR A 125 ? 0.4104 0.4514 0.4037 0.1208  0.0581  0.1108  340 THR A CA  
1401 C C   . THR A 125 ? 0.3521 0.3757 0.3568 0.1196  0.0541  0.1119  340 THR A C   
1402 O O   . THR A 125 ? 0.3531 0.3797 0.3674 0.1147  0.0527  0.1241  340 THR A O   
1403 C CB  . THR A 125 ? 0.4419 0.4764 0.4203 0.1164  0.0494  0.1243  340 THR A CB  
1404 O OG1 . THR A 125 ? 0.4386 0.4917 0.4064 0.1185  0.0531  0.1244  340 THR A OG1 
1405 C CG2 . THR A 125 ? 0.3977 0.4090 0.3645 0.1196  0.0401  0.1224  340 THR A CG2 
1413 N N   . LEU A 126 ? 0.3669 0.3777 0.3706 0.1227  0.0531  0.0990  341 LEU A N   
1414 C CA  . LEU A 126 ? 0.4042 0.3998 0.4179 0.1220  0.0501  0.0990  341 LEU A CA  
1415 C C   . LEU A 126 ? 0.4064 0.3837 0.4114 0.1185  0.0378  0.1029  341 LEU A C   
1416 O O   . LEU A 126 ? 0.3571 0.3308 0.3482 0.1215  0.0334  0.0991  341 LEU A O   
1417 C CB  . LEU A 126 ? 0.3834 0.3724 0.3995 0.1261  0.0583  0.0825  341 LEU A CB  
1418 C CG  . LEU A 126 ? 0.4350 0.4296 0.4542 0.1312  0.0743  0.0758  341 LEU A CG  
1419 C CD1 . LEU A 126 ? 0.4935 0.4687 0.5090 0.1316  0.0814  0.0602  341 LEU A CD1 
1420 C CD2 . LEU A 126 ? 0.4427 0.4474 0.4765 0.1365  0.0796  0.0906  341 LEU A CD2 
1432 N N   . THR A 127 ? 0.3782 0.3459 0.3901 0.1130  0.0332  0.1113  342 THR A N   
1433 C CA  . THR A 127 ? 0.3795 0.3246 0.3825 0.1097  0.0238  0.1122  342 THR A CA  
1434 C C   . THR A 127 ? 0.3524 0.2933 0.3675 0.1114  0.0246  0.1045  342 THR A C   
1435 O O   . THR A 127 ? 0.3706 0.3214 0.4007 0.1110  0.0293  0.1086  342 THR A O   
1436 C CB  . THR A 127 ? 0.5184 0.4532 0.5146 0.0974  0.0181  0.1267  342 THR A CB  
1437 O OG1 . THR A 127 ? 0.5202 0.4528 0.5005 0.0952  0.0184  0.1340  342 THR A OG1 
1438 C CG2 . THR A 127 ? 0.5149 0.4215 0.4990 0.0939  0.0107  0.1255  342 THR A CG2 
1446 N N   . CYS A 128 ? 0.3812 0.3106 0.3893 0.1150  0.0211  0.0943  343 CYS A N   
1447 C CA  . CYS A 128 ? 0.3482 0.2725 0.3650 0.1156  0.0223  0.0858  343 CYS A CA  
1448 C C   . CYS A 128 ? 0.5153 0.4218 0.5252 0.1121  0.0129  0.0884  343 CYS A C   
1449 O O   . CYS A 128 ? 0.3530 0.2518 0.3490 0.1162  0.0085  0.0849  343 CYS A O   
1450 C CB  . CYS A 128 ? 0.5568 0.4871 0.5700 0.1194  0.0279  0.0694  343 CYS A CB  
1451 S SG  . CYS A 128 ? 0.6802 0.6277 0.6921 0.1214  0.0407  0.0627  343 CYS A SG  
1457 N N   . SER A 129 ? 0.3554 0.2574 0.3734 0.1054  0.0103  0.0957  344 SER A N   
1458 C CA  . SER A 129 ? 0.3585 0.2421 0.3679 0.1007  0.0026  0.0959  344 SER A CA  
1459 C C   . SER A 129 ? 0.3584 0.2414 0.3770 0.1022  0.0032  0.0879  344 SER A C   
1460 O O   . SER A 129 ? 0.3684 0.2607 0.4015 0.1017  0.0076  0.0910  344 SER A O   
1461 C CB  . SER A 129 ? 0.4335 0.3130 0.4405 0.0875  -0.0017 0.1088  344 SER A CB  
1462 O OG  . SER A 129 ? 0.6395 0.5020 0.6391 0.0812  -0.0075 0.1074  344 SER A OG  
1468 N N   . SER A 130 ? 0.3138 0.1875 0.3230 0.1057  -0.0001 0.0785  345 SER A N   
1469 C CA  . SER A 130 ? 0.3076 0.1805 0.3228 0.1051  0.0002  0.0705  345 SER A CA  
1470 C C   . SER A 130 ? 0.3094 0.1700 0.3170 0.0987  -0.0079 0.0705  345 SER A C   
1471 O O   . SER A 130 ? 0.3205 0.1716 0.3129 0.1011  -0.0116 0.0687  345 SER A O   
1472 C CB  . SER A 130 ? 0.3077 0.1900 0.3189 0.1104  0.0037  0.0563  345 SER A CB  
1473 O OG  . SER A 130 ? 0.3779 0.2715 0.3919 0.1120  0.0112  0.0533  345 SER A OG  
1479 N N   . LYS A 131 ? 0.2976 0.1585 0.3139 0.0920  -0.0092 0.0731  346 LYS A N   
1480 C CA  . LYS A 131 ? 0.3036 0.1520 0.3119 0.0856  -0.0157 0.0743  346 LYS A CA  
1481 C C   . LYS A 131 ? 0.2946 0.1460 0.3089 0.0860  -0.0152 0.0670  346 LYS A C   
1482 O O   . LYS A 131 ? 0.2869 0.1471 0.3129 0.0863  -0.0102 0.0670  346 LYS A O   
1483 C CB  . LYS A 131 ? 0.3491 0.1971 0.3604 0.0750  -0.0181 0.0892  346 LYS A CB  
1484 C CG  . LYS A 131 ? 0.4213 0.2675 0.4253 0.0700  -0.0182 0.0978  346 LYS A CG  
1485 C CD  . LYS A 131 ? 0.6345 0.4880 0.6380 0.0519  -0.0223 0.1096  346 LYS A CD  
1486 C CE  . LYS A 131 ? 0.8225 0.6751 0.8159 0.0419  -0.0220 0.1180  346 LYS A CE  
1487 N NZ  . LYS A 131 ? 0.7956 0.6790 0.8096 0.0484  -0.0170 0.1254  346 LYS A NZ  
1501 N N   . VAL A 132 ? 0.2994 0.1418 0.3036 0.0865  -0.0188 0.0612  347 VAL A N   
1502 C CA  . VAL A 132 ? 0.2940 0.1371 0.3011 0.0857  -0.0189 0.0562  347 VAL A CA  
1503 C C   . VAL A 132 ? 0.3012 0.1341 0.3034 0.0768  -0.0242 0.0631  347 VAL A C   
1504 O O   . VAL A 132 ? 0.3176 0.1344 0.3032 0.0731  -0.0278 0.0646  347 VAL A O   
1505 C CB  . VAL A 132 ? 0.2964 0.1413 0.2929 0.0941  -0.0189 0.0445  347 VAL A CB  
1506 C CG1 . VAL A 132 ? 0.2902 0.1405 0.2909 0.0891  -0.0188 0.0386  347 VAL A CG1 
1507 C CG2 . VAL A 132 ? 0.2926 0.1527 0.2906 0.1012  -0.0141 0.0382  347 VAL A CG2 
1517 N N   . CYS A 133 ? 0.3790 0.2209 0.3933 0.0714  -0.0238 0.0671  348 CYS A N   
1518 C CA  . CYS A 133 ? 0.4126 0.2535 0.4238 0.0601  -0.0293 0.0736  348 CYS A CA  
1519 C C   . CYS A 133 ? 0.4024 0.2439 0.4131 0.0596  -0.0299 0.0665  348 CYS A C   
1520 O O   . CYS A 133 ? 0.3783 0.2268 0.3991 0.0634  -0.0249 0.0643  348 CYS A O   
1521 C CB  . CYS A 133 ? 0.5818 0.4411 0.6077 0.0543  -0.0291 0.0890  348 CYS A CB  
1522 S SG  . CYS A 133 ? 0.5575 0.4210 0.5829 0.0525  -0.0285 0.0973  348 CYS A SG  
1528 N N   . SER A 134 ? 0.4102 0.2409 0.4056 0.0538  -0.0347 0.0625  349 SER A N   
1529 C CA  . SER A 134 ? 0.4187 0.2515 0.4116 0.0522  -0.0357 0.0560  349 SER A CA  
1530 C C   . SER A 134 ? 0.5055 0.3375 0.4915 0.0382  -0.0411 0.0612  349 SER A C   
1531 O O   . SER A 134 ? 0.4380 0.2531 0.4048 0.0312  -0.0438 0.0596  349 SER A O   
1532 C CB  . SER A 134 ? 0.5466 0.3706 0.5246 0.0616  -0.0349 0.0430  349 SER A CB  
1533 O OG  . SER A 134 ? 0.5532 0.3818 0.5280 0.0582  -0.0361 0.0375  349 SER A OG  
1539 N N   . PHE A 135 ? 0.4745 0.3226 0.4726 0.0334  -0.0416 0.0673  350 PHE A N   
1540 C CA  . PHE A 135 ? 0.5956 0.4510 0.5884 0.0187  -0.0471 0.0735  350 PHE A CA  
1541 C C   . PHE A 135 ? 0.5664 0.4271 0.5556 0.0063  -0.0508 0.0837  350 PHE A C   
1542 O O   . PHE A 135 ? 0.5245 0.3753 0.4942 -0.0088 -0.0547 0.0810  350 PHE A O   
1543 C CB  . PHE A 135 ? 0.4755 0.3145 0.4470 0.0153  -0.0490 0.0605  350 PHE A CB  
1544 C CG  . PHE A 135 ? 0.5584 0.4039 0.5347 0.0221  -0.0465 0.0531  350 PHE A CG  
1545 C CD1 . PHE A 135 ? 0.4173 0.2778 0.3996 0.0142  -0.0482 0.0586  350 PHE A CD1 
1546 C CD2 . PHE A 135 ? 0.3877 0.2288 0.3623 0.0350  -0.0423 0.0418  350 PHE A CD2 
1547 C CE1 . PHE A 135 ? 0.4390 0.3050 0.4241 0.0175  -0.0453 0.0524  350 PHE A CE1 
1548 C CE2 . PHE A 135 ? 0.4095 0.2618 0.3879 0.0372  -0.0398 0.0350  350 PHE A CE2 
1549 C CZ  . PHE A 135 ? 0.4458 0.3080 0.4286 0.0277  -0.0410 0.0399  350 PHE A CZ  
1559 N N   . GLY A 136 ? 0.5982 0.4733 0.6033 0.0113  -0.0485 0.0942  351 GLY A N   
1560 C CA  . GLY A 136 ? 0.6423 0.5316 0.6467 -0.0017 -0.0517 0.1054  351 GLY A CA  
1561 C C   . GLY A 136 ? 0.7223 0.5855 0.7064 -0.0078 -0.0517 0.0985  351 GLY A C   
1562 O O   . GLY A 136 ? 0.9789 0.8520 0.9596 -0.0213 -0.0536 0.1069  351 GLY A O   
1566 N N   . LYS A 137 ? 0.4718 0.3031 0.4410 0.0027  -0.0489 0.0845  352 LYS A N   
1567 C CA  . LYS A 137 ? 0.5795 0.3795 0.5252 0.0014  -0.0470 0.0791  352 LYS A CA  
1568 C C   . LYS A 137 ? 0.4903 0.2846 0.4429 0.0215  -0.0422 0.0759  352 LYS A C   
1569 O O   . LYS A 137 ? 0.3997 0.2012 0.3641 0.0369  -0.0398 0.0699  352 LYS A O   
1570 C CB  . LYS A 137 ? 0.6824 0.4474 0.5974 -0.0013 -0.0462 0.0670  352 LYS A CB  
1571 C CG  . LYS A 137 ? 0.7488 0.5110 0.6461 -0.0277 -0.0500 0.0685  352 LYS A CG  
1572 C CD  . LYS A 137 ? 0.9336 0.6583 0.7984 -0.0290 -0.0472 0.0553  352 LYS A CD  
1573 C CE  . LYS A 137 ? 0.9702 0.6795 0.8054 -0.0609 -0.0487 0.0547  352 LYS A CE  
1574 N NZ  . LYS A 137 ? 0.8815 0.6041 0.7138 -0.0724 -0.0522 0.0508  352 LYS A NZ  
1588 N N   . GLN A 138 ? 0.4873 0.2685 0.4292 0.0189  -0.0406 0.0793  353 GLN A N   
1589 C CA  . GLN A 138 ? 0.5368 0.3144 0.4825 0.0363  -0.0364 0.0771  353 GLN A CA  
1590 C C   . GLN A 138 ? 0.5437 0.2914 0.4660 0.0508  -0.0333 0.0668  353 GLN A C   
1591 O O   . GLN A 138 ? 0.5302 0.2478 0.4256 0.0455  -0.0311 0.0654  353 GLN A O   
1592 C CB  . GLN A 138 ? 0.5631 0.3414 0.5066 0.0278  -0.0357 0.0865  353 GLN A CB  
1593 C CG  . GLN A 138 ? 0.6663 0.4495 0.6181 0.0441  -0.0315 0.0863  353 GLN A CG  
1594 C CD  . GLN A 138 ? 0.7302 0.5005 0.6674 0.0358  -0.0302 0.0933  353 GLN A CD  
1595 O OE1 . GLN A 138 ? 0.6667 0.4585 0.6148 0.0226  -0.0314 0.1032  353 GLN A OE1 
1596 N NE2 . GLN A 138 ? 0.8656 0.6013 0.7758 0.0436  -0.0270 0.0894  353 GLN A NE2 
1605 N N   . VAL A 139 ? 0.3686 0.1352 0.3043 0.0667  -0.0305 0.0586  354 VAL A N   
1606 C CA  . VAL A 139 ? 0.3809 0.1409 0.3024 0.0800  -0.0264 0.0494  354 VAL A CA  
1607 C C   . VAL A 139 ? 0.3882 0.1633 0.3152 0.0929  -0.0227 0.0486  354 VAL A C   
1608 O O   . VAL A 139 ? 0.3900 0.1611 0.3026 0.1054  -0.0193 0.0446  354 VAL A O   
1609 C CB  . VAL A 139 ? 0.3704 0.1411 0.2958 0.0864  -0.0277 0.0416  354 VAL A CB  
1610 C CG1 . VAL A 139 ? 0.4102 0.1625 0.3257 0.0729  -0.0324 0.0430  354 VAL A CG1 
1611 C CG2 . VAL A 139 ? 0.3450 0.1439 0.2950 0.0888  -0.0286 0.0406  354 VAL A CG2 
1621 N N   . VAL A 140 ? 0.3549 0.1481 0.3005 0.0912  -0.0231 0.0527  355 VAL A N   
1622 C CA  . VAL A 140 ? 0.3533 0.1577 0.3001 0.1011  -0.0204 0.0526  355 VAL A CA  
1623 C C   . VAL A 140 ? 0.3516 0.1552 0.3049 0.0939  -0.0204 0.0614  355 VAL A C   
1624 O O   . VAL A 140 ? 0.3385 0.1491 0.3062 0.0862  -0.0218 0.0662  355 VAL A O   
1625 C CB  . VAL A 140 ? 0.3338 0.1652 0.2925 0.1114  -0.0193 0.0455  355 VAL A CB  
1626 C CG1 . VAL A 140 ? 0.3366 0.1806 0.2919 0.1225  -0.0167 0.0462  355 VAL A CG1 
1627 C CG2 . VAL A 140 ? 0.3365 0.1728 0.2880 0.1197  -0.0196 0.0381  355 VAL A CG2 
1637 N N   . GLU A 141 ? 0.3669 0.1633 0.3086 0.0984  -0.0183 0.0647  356 GLU A N   
1638 C CA  . GLU A 141 ? 0.3629 0.1650 0.3114 0.0955  -0.0177 0.0721  356 GLU A CA  
1639 C C   . GLU A 141 ? 0.3667 0.1785 0.3097 0.1086  -0.0148 0.0706  356 GLU A C   
1640 O O   . GLU A 141 ? 0.3887 0.1880 0.3132 0.1156  -0.0129 0.0708  356 GLU A O   
1641 C CB  . GLU A 141 ? 0.3856 0.1634 0.3202 0.0823  -0.0184 0.0827  356 GLU A CB  
1642 C CG  . GLU A 141 ? 0.5831 0.3725 0.5274 0.0791  -0.0175 0.0927  356 GLU A CG  
1643 C CD  . GLU A 141 ? 0.7933 0.5581 0.7161 0.0663  -0.0166 0.1045  356 GLU A CD  
1644 O OE1 . GLU A 141 ? 0.7890 0.5240 0.6868 0.0609  -0.0155 0.1028  356 GLU A OE1 
1645 O OE2 . GLU A 141 ? 0.8852 0.6705 0.8208 0.0583  -0.0159 0.1129  356 GLU A OE2 
1652 N N   . LYS A 142 ? 0.3486 0.1824 0.3059 0.1129  -0.0131 0.0695  357 LYS A N   
1653 C CA  . LYS A 142 ? 0.3506 0.1990 0.3036 0.1252  -0.0101 0.0690  357 LYS A CA  
1654 C C   . LYS A 142 ? 0.3501 0.2007 0.3078 0.1219  -0.0076 0.0771  357 LYS A C   
1655 O O   . LYS A 142 ? 0.3350 0.1949 0.3091 0.1174  -0.0052 0.0780  357 LYS A O   
1656 C CB  . LYS A 142 ? 0.3344 0.2082 0.2959 0.1349  -0.0083 0.0596  357 LYS A CB  
1657 C CG  . LYS A 142 ? 0.3940 0.2906 0.3487 0.1501  -0.0058 0.0594  357 LYS A CG  
1658 C CD  . LYS A 142 ? 0.5119 0.4436 0.4786 0.1455  -0.0026 0.0462  357 LYS A CD  
1659 C CE  . LYS A 142 ? 0.7262 0.6820 0.6891 0.1515  -0.0044 0.0376  357 LYS A CE  
1660 N NZ  . LYS A 142 ? 0.7507 0.7469 0.7178 0.1446  -0.0007 0.0253  357 LYS A NZ  
1674 N N   . VAL A 143 ? 0.3685 0.2120 0.3116 0.1258  -0.0065 0.0839  358 VAL A N   
1675 C CA  . VAL A 143 ? 0.4345 0.2832 0.3804 0.1243  -0.0033 0.0927  358 VAL A CA  
1676 C C   . VAL A 143 ? 0.3808 0.2497 0.3219 0.1389  0.0000  0.0924  358 VAL A C   
1677 O O   . VAL A 143 ? 0.3875 0.2538 0.3124 0.1477  -0.0006 0.0932  358 VAL A O   
1678 C CB  . VAL A 143 ? 0.3949 0.2166 0.3247 0.1130  -0.0041 0.1047  358 VAL A CB  
1679 C CG1 . VAL A 143 ? 0.4112 0.2453 0.3455 0.1112  0.0000  0.1148  358 VAL A CG1 
1680 C CG2 . VAL A 143 ? 0.4170 0.2233 0.3495 0.0978  -0.0073 0.1068  358 VAL A CG2 
1690 N N   . GLU A 144 ? 0.3985 0.2929 0.3555 0.1360  0.0040  0.0881  359 GLU A N   
1691 C CA  . GLU A 144 ? 0.4164 0.3370 0.3707 0.1431  0.0073  0.0852  359 GLU A CA  
1692 C C   . GLU A 144 ? 0.4728 0.4029 0.4349 0.1359  0.0123  0.0895  359 GLU A C   
1693 O O   . GLU A 144 ? 0.4546 0.3798 0.4292 0.1268  0.0143  0.0925  359 GLU A O   
1694 C CB  . GLU A 144 ? 0.5041 0.4529 0.4662 0.1443  0.0094  0.0695  359 GLU A CB  
1695 C CG  . GLU A 144 ? 0.8132 0.7635 0.7698 0.1513  0.0050  0.0644  359 GLU A CG  
1696 C CD  . GLU A 144 ? 0.9377 0.9281 0.8930 0.1544  0.0062  0.0528  359 GLU A CD  
1697 O OE1 . GLU A 144 ? 0.9134 0.9250 0.8566 0.1676  0.0045  0.0581  359 GLU A OE1 
1698 O OE2 . GLU A 144 ? 0.9994 1.0008 0.9639 0.1429  0.0095  0.0392  359 GLU A OE2 
1705 N N   . THR A 145 ? 0.3834 0.3327 0.3380 0.1416  0.0147  0.0902  360 THR A N   
1706 C CA  . THR A 145 ? 0.4499 0.4090 0.4065 0.1372  0.0194  0.0960  360 THR A CA  
1707 C C   . THR A 145 ? 0.5041 0.4957 0.4612 0.1397  0.0244  0.0849  360 THR A C   
1708 O O   . THR A 145 ? 0.3987 0.4076 0.3460 0.1474  0.0220  0.0811  360 THR A O   
1709 C CB  . THR A 145 ? 0.5474 0.4890 0.4859 0.1394  0.0168  0.1121  360 THR A CB  
1710 O OG1 . THR A 145 ? 0.6149 0.5306 0.5544 0.1283  0.0148  0.1205  360 THR A OG1 
1711 C CG2 . THR A 145 ? 0.4007 0.3611 0.3366 0.1383  0.0213  0.1174  360 THR A CG2 
1719 N N   . GLU A 146 ? 0.3886 0.3904 0.3561 0.1331  0.0324  0.0795  361 GLU A N   
1720 C CA  . GLU A 146 ? 0.4904 0.5188 0.4551 0.1313  0.0395  0.0665  361 GLU A CA  
1721 C C   . GLU A 146 ? 0.4678 0.5051 0.4349 0.1285  0.0477  0.0700  361 GLU A C   
1722 O O   . GLU A 146 ? 0.3887 0.4154 0.3675 0.1264  0.0526  0.0747  361 GLU A O   
1723 C CB  . GLU A 146 ? 0.5622 0.5886 0.5324 0.1249  0.0454  0.0486  361 GLU A CB  
1724 C CG  . GLU A 146 ? 0.6030 0.6553 0.5630 0.1180  0.0523  0.0311  361 GLU A CG  
1725 C CD  . GLU A 146 ? 0.6780 0.7631 0.6262 0.1222  0.0445  0.0322  361 GLU A CD  
1726 O OE1 . GLU A 146 ? 0.8285 0.9140 0.7755 0.1298  0.0355  0.0377  361 GLU A OE1 
1727 O OE2 . GLU A 146 ? 0.8871 1.0001 0.8262 0.1192  0.0483  0.0282  361 GLU A OE2 
1734 N N   . ARG A 147 ? 0.4244 0.4866 0.3805 0.1294  0.0495  0.0681  362 ARG A N   
1735 C CA  . ARG A 147 ? 0.4257 0.5006 0.3812 0.1272  0.0574  0.0706  362 ARG A CA  
1736 C C   . ARG A 147 ? 0.4316 0.5151 0.3864 0.1210  0.0700  0.0512  362 ARG A C   
1737 O O   . ARG A 147 ? 0.4877 0.5781 0.4356 0.1160  0.0709  0.0360  362 ARG A O   
1738 C CB  . ARG A 147 ? 0.4596 0.5563 0.4007 0.1311  0.0534  0.0800  362 ARG A CB  
1739 C CG  . ARG A 147 ? 0.6088 0.7129 0.5503 0.1288  0.0591  0.0899  362 ARG A CG  
1740 C CD  . ARG A 147 ? 0.6894 0.8235 0.6156 0.1305  0.0597  0.0925  362 ARG A CD  
1741 N NE  . ARG A 147 ? 0.7219 0.8621 0.6481 0.1277  0.0646  0.1035  362 ARG A NE  
1742 C CZ  . ARG A 147 ? 0.9802 1.1488 0.8978 0.1258  0.0705  0.1013  362 ARG A CZ  
1743 N NH1 . ARG A 147 ? 1.0466 1.2422 0.9541 0.1247  0.0723  0.0877  362 ARG A NH1 
1744 N NH2 . ARG A 147 ? 0.9281 1.1023 0.8466 0.1231  0.0748  0.1126  362 ARG A NH2 
1758 N N   . ALA A 148 ? 0.4123 0.4952 0.3715 0.1207  0.0808  0.0518  363 ALA A N   
1759 C CA  . ALA A 148 ? 0.4337 0.5167 0.3865 0.1160  0.0967  0.0336  363 ALA A CA  
1760 C C   . ALA A 148 ? 0.4221 0.5323 0.3566 0.1078  0.0988  0.0204  363 ALA A C   
1761 O O   . ALA A 148 ? 0.4122 0.5478 0.3415 0.1096  0.0916  0.0301  363 ALA A O   
1762 C CB  . ALA A 148 ? 0.4171 0.4991 0.3764 0.1212  0.1077  0.0399  363 ALA A CB  
1768 N N   . GLN A 149 ? 0.4715 0.5756 0.3940 0.0975  0.1096  -0.0014 364 GLN A N   
1769 C CA  . GLN A 149 ? 0.4412 0.5728 0.3433 0.0845  0.1152  -0.0179 364 GLN A CA  
1770 C C   . GLN A 149 ? 0.4704 0.5827 0.3586 0.0775  0.1369  -0.0354 364 GLN A C   
1771 O O   . GLN A 149 ? 0.4841 0.5591 0.3695 0.0761  0.1485  -0.0455 364 GLN A O   
1772 C CB  . GLN A 149 ? 0.4588 0.6044 0.3521 0.0728  0.1087  -0.0307 364 GLN A CB  
1773 C CG  . GLN A 149 ? 0.6156 0.7877 0.4848 0.0522  0.1173  -0.0531 364 GLN A CG  
1774 C CD  . GLN A 149 ? 0.8128 1.0355 0.6752 0.0527  0.1104  -0.0461 364 GLN A CD  
1775 O OE1 . GLN A 149 ? 1.0109 1.2594 0.8817 0.0651  0.0948  -0.0278 364 GLN A OE1 
1776 N NE2 . GLN A 149 ? 0.6410 0.8758 0.4854 0.0402  0.1234  -0.0599 364 GLN A NE2 
1785 N N   . LEU A 150 ? 0.4843 0.6198 0.3606 0.0736  0.1436  -0.0389 365 LEU A N   
1786 C CA  . LEU A 150 ? 0.5185 0.6344 0.3768 0.0679  0.1664  -0.0563 365 LEU A CA  
1787 C C   . LEU A 150 ? 0.5483 0.6566 0.3789 0.0447  0.1769  -0.0845 365 LEU A C   
1788 O O   . LEU A 150 ? 0.5748 0.7224 0.3944 0.0292  0.1682  -0.0919 365 LEU A O   
1789 C CB  . LEU A 150 ? 0.5250 0.6711 0.3779 0.0695  0.1700  -0.0517 365 LEU A CB  
1790 C CG  . LEU A 150 ? 0.5664 0.6956 0.3947 0.0621  0.1949  -0.0724 365 LEU A CG  
1791 C CD1 . LEU A 150 ? 0.5797 0.6627 0.4151 0.0791  0.2114  -0.0693 365 LEU A CD1 
1792 C CD2 . LEU A 150 ? 0.5935 0.7596 0.4142 0.0609  0.1973  -0.0693 365 LEU A CD2 
1804 N N   . GLU A 151 ? 0.7477 0.8063 0.5647 0.0418  0.1964  -0.0994 366 GLU A N   
1805 C CA  . GLU A 151 ? 0.6815 0.7229 0.4661 0.0155  0.2096  -0.1278 366 GLU A CA  
1806 C C   . GLU A 151 ? 0.7241 0.7017 0.4852 0.0166  0.2387  -0.1430 366 GLU A C   
1807 O O   . GLU A 151 ? 0.7873 0.7226 0.5592 0.0332  0.2445  -0.1345 366 GLU A O   
1808 C CB  . GLU A 151 ? 0.6710 0.7136 0.4619 0.0062  0.1963  -0.1293 366 GLU A CB  
1809 C CG  . GLU A 151 ? 0.8951 0.9052 0.6513 -0.0218 0.2135  -0.1581 366 GLU A CG  
1810 C CD  . GLU A 151 ? 1.0079 1.0250 0.7690 -0.0336 0.2010  -0.1605 366 GLU A CD  
1811 O OE1 . GLU A 151 ? 0.8658 0.9344 0.6480 -0.0290 0.1780  -0.1469 366 GLU A OE1 
1812 O OE2 . GLU A 151 ? 1.2167 1.1854 0.9582 -0.0467 0.2156  -0.1756 366 GLU A OE2 
1819 N N   . ASP A 152 ? 0.7686 0.7384 0.4952 -0.0006 0.2582  -0.1651 367 ASP A N   
1820 C CA  . ASP A 152 ? 0.9087 0.8128 0.6088 0.0000  0.2843  -0.1792 367 ASP A CA  
1821 C C   . ASP A 152 ? 0.8174 0.6918 0.5355 0.0361  0.2955  -0.1604 367 ASP A C   
1822 O O   . ASP A 152 ? 0.9997 0.8224 0.7172 0.0477  0.3045  -0.1572 367 ASP A O   
1823 C CB  . ASP A 152 ? 1.0092 0.8692 0.6964 -0.0159 0.2860  -0.1901 367 ASP A CB  
1824 C CG  . ASP A 152 ? 1.0760 0.9667 0.7448 -0.0542 0.2756  -0.2085 367 ASP A CG  
1825 O OD1 . ASP A 152 ? 1.1501 1.0386 0.8219 -0.0658 0.2673  -0.2107 367 ASP A OD1 
1826 O OD2 . ASP A 152 ? 1.0652 0.9855 0.7180 -0.0723 0.2752  -0.2193 367 ASP A OD2 
1831 N N   . GLY A 153 ? 0.8190 0.7314 0.5553 0.0535  0.2924  -0.1449 368 GLY A N   
1832 C CA  . GLY A 153 ? 0.8137 0.7117 0.5688 0.0869  0.3020  -0.1253 368 GLY A CA  
1833 C C   . GLY A 153 ? 0.7855 0.6793 0.5768 0.1103  0.2896  -0.0996 368 GLY A C   
1834 O O   . GLY A 153 ? 0.7609 0.6417 0.5652 0.1366  0.2993  -0.0844 368 GLY A O   
1838 N N   . ARG A 154 ? 0.6862 0.5947 0.4936 0.0997  0.2667  -0.0947 369 ARG A N   
1839 C CA  . ARG A 154 ? 0.6285 0.5402 0.4700 0.1167  0.2506  -0.0709 369 ARG A CA  
1840 C C   . ARG A 154 ? 0.5958 0.5551 0.4592 0.1067  0.2198  -0.0597 369 ARG A C   
1841 O O   . ARG A 154 ? 0.5863 0.5735 0.4378 0.0883  0.2120  -0.0705 369 ARG A O   
1842 C CB  . ARG A 154 ? 0.6729 0.5337 0.5044 0.1160  0.2595  -0.0783 369 ARG A CB  
1843 C CG  . ARG A 154 ? 0.8066 0.6652 0.6182 0.0853  0.2526  -0.0996 369 ARG A CG  
1844 C CD  . ARG A 154 ? 1.0538 0.8661 0.8562 0.0814  0.2588  -0.1058 369 ARG A CD  
1845 N NE  . ARG A 154 ? 0.9131 0.7382 0.7025 0.0512  0.2479  -0.1227 369 ARG A NE  
1846 C CZ  . ARG A 154 ? 1.1384 0.9377 0.8888 0.0237  0.2637  -0.1499 369 ARG A CZ  
1847 N NH1 . ARG A 154 ? 1.1659 0.9913 0.9100 -0.0032 0.2506  -0.1617 369 ARG A NH1 
1848 N NH2 . ARG A 154 ? 1.2401 0.9951 0.9639 0.0216  0.2849  -0.1605 369 ARG A NH2 
1862 N N   . PHE A 155 ? 0.5414 0.5096 0.4342 0.1195  0.2037  -0.0378 370 PHE A N   
1863 C CA  . PHE A 155 ? 0.5033 0.5021 0.4108 0.1118  0.1781  -0.0285 370 PHE A CA  
1864 C C   . PHE A 155 ? 0.5234 0.5000 0.4329 0.1064  0.1714  -0.0329 370 PHE A C   
1865 O O   . PHE A 155 ? 0.5036 0.4479 0.4188 0.1165  0.1792  -0.0289 370 PHE A O   
1866 C CB  . PHE A 155 ? 0.4809 0.5055 0.4150 0.1250  0.1637  -0.0019 370 PHE A CB  
1867 C CG  . PHE A 155 ? 0.4769 0.5279 0.4095 0.1286  0.1688  0.0039  370 PHE A CG  
1868 C CD1 . PHE A 155 ? 0.4732 0.5548 0.3961 0.1180  0.1605  0.0012  370 PHE A CD1 
1869 C CD2 . PHE A 155 ? 0.4873 0.5361 0.4276 0.1438  0.1826  0.0131  370 PHE A CD2 
1870 C CE1 . PHE A 155 ? 0.4796 0.5861 0.3998 0.1203  0.1655  0.0066  370 PHE A CE1 
1871 C CE2 . PHE A 155 ? 0.4930 0.5698 0.4317 0.1467  0.1880  0.0184  370 PHE A CE2 
1872 C CZ  . PHE A 155 ? 0.4891 0.5925 0.4174 0.1339  0.1794  0.0146  370 PHE A CZ  
1882 N N   . VAL A 156 ? 0.5786 0.5759 0.4826 0.0913  0.1576  -0.0403 371 VAL A N   
1883 C CA  . VAL A 156 ? 0.5569 0.5409 0.4630 0.0849  0.1498  -0.0444 371 VAL A CA  
1884 C C   . VAL A 156 ? 0.4626 0.4746 0.3874 0.0898  0.1262  -0.0276 371 VAL A C   
1885 O O   . VAL A 156 ? 0.4660 0.5109 0.3930 0.0918  0.1160  -0.0188 371 VAL A O   
1886 C CB  . VAL A 156 ? 0.5934 0.5755 0.4726 0.0613  0.1571  -0.0701 371 VAL A CB  
1887 C CG1 . VAL A 156 ? 0.6591 0.6021 0.5131 0.0551  0.1830  -0.0876 371 VAL A CG1 
1888 C CG2 . VAL A 156 ? 0.5166 0.5483 0.3876 0.0493  0.1473  -0.0751 371 VAL A CG2 
1898 N N   . TYR A 157 ? 0.5171 0.5116 0.4523 0.0924  0.1193  -0.0231 372 TYR A N   
1899 C CA  . TYR A 157 ? 0.4566 0.4657 0.4058 0.0979  0.0997  -0.0087 372 TYR A CA  
1900 C C   . TYR A 157 ? 0.4653 0.4736 0.4081 0.0874  0.0954  -0.0209 372 TYR A C   
1901 O O   . TYR A 157 ? 0.4237 0.4032 0.3688 0.0861  0.1001  -0.0244 372 TYR A O   
1902 C CB  . TYR A 157 ? 0.4560 0.4476 0.4248 0.1107  0.0957  0.0103  372 TYR A CB  
1903 C CG  . TYR A 157 ? 0.4782 0.4750 0.4532 0.1190  0.1026  0.0213  372 TYR A CG  
1904 C CD1 . TYR A 157 ? 0.4955 0.4761 0.4670 0.1237  0.1214  0.0158  372 TYR A CD1 
1905 C CD2 . TYR A 157 ? 0.3757 0.3924 0.3573 0.1227  0.0919  0.0377  372 TYR A CD2 
1906 C CE1 . TYR A 157 ? 0.4128 0.4051 0.3912 0.1334  0.1285  0.0272  372 TYR A CE1 
1907 C CE2 . TYR A 157 ? 0.4453 0.4722 0.4327 0.1282  0.0980  0.0484  372 TYR A CE2 
1908 C CZ  . TYR A 157 ? 0.3954 0.4139 0.3830 0.1341  0.1156  0.0434  372 TYR A CZ  
1909 O OH  . TYR A 157 ? 0.3982 0.4335 0.3924 0.1406  0.1213  0.0550  372 TYR A OH  
1919 N N   . ARG A 158 ? 0.5078 0.5515 0.4417 0.0804  0.0872  -0.0266 373 ARG A N   
1920 C CA  . ARG A 158 ? 0.4837 0.5408 0.4101 0.0686  0.0830  -0.0388 373 ARG A CA  
1921 C C   . ARG A 158 ? 0.4568 0.5312 0.3941 0.0804  0.0657  -0.0247 373 ARG A C   
1922 O O   . ARG A 158 ? 0.4869 0.5911 0.4233 0.0893  0.0568  -0.0147 373 ARG A O   
1923 C CB  . ARG A 158 ? 0.6523 0.7462 0.5588 0.0510  0.0877  -0.0560 373 ARG A CB  
1924 C CG  . ARG A 158 ? 0.8762 0.9434 0.7630 0.0325  0.1080  -0.0771 373 ARG A CG  
1925 C CD  . ARG A 158 ? 0.9046 1.0097 0.7681 0.0101  0.1132  -0.0957 373 ARG A CD  
1926 N NE  . ARG A 158 ? 0.7283 0.7947 0.5667 -0.0098 0.1353  -0.1177 373 ARG A NE  
1927 C CZ  . ARG A 158 ? 0.6695 0.7337 0.4886 -0.0190 0.1494  -0.1291 373 ARG A CZ  
1928 N NH1 . ARG A 158 ? 0.6603 0.7646 0.4845 -0.0111 0.1424  -0.1203 373 ARG A NH1 
1929 N NH2 . ARG A 158 ? 0.8044 0.8224 0.5961 -0.0361 0.1719  -0.1495 373 ARG A NH2 
1943 N N   . LEU A 159 ? 0.4492 0.5012 0.3943 0.0815  0.0625  -0.0236 374 LEU A N   
1944 C CA  . LEU A 159 ? 0.4611 0.5219 0.4134 0.0919  0.0487  -0.0131 374 LEU A CA  
1945 C C   . LEU A 159 ? 0.5048 0.5860 0.4498 0.0791  0.0482  -0.0280 374 LEU A C   
1946 O O   . LEU A 159 ? 0.4866 0.5450 0.4350 0.0734  0.0499  -0.0328 374 LEU A O   
1947 C CB  . LEU A 159 ? 0.4489 0.4715 0.4151 0.1013  0.0452  0.0001  374 LEU A CB  
1948 C CG  . LEU A 159 ? 0.5425 0.5489 0.5161 0.1096  0.0468  0.0146  374 LEU A CG  
1949 C CD1 . LEU A 159 ? 0.5411 0.5295 0.5167 0.1050  0.0610  0.0094  374 LEU A CD1 
1950 C CD2 . LEU A 159 ? 0.6048 0.5900 0.5881 0.1176  0.0381  0.0304  374 LEU A CD2 
1962 N N   . LEU A 160 ? 0.4047 0.5336 0.3393 0.0734  0.0461  -0.0348 375 LEU A N   
1963 C CA  . LEU A 160 ? 0.4189 0.5768 0.3440 0.0549  0.0476  -0.0515 375 LEU A CA  
1964 C C   . LEU A 160 ? 0.4260 0.6219 0.3555 0.0666  0.0350  -0.0439 375 LEU A C   
1965 O O   . LEU A 160 ? 0.4561 0.6751 0.3881 0.0876  0.0265  -0.0284 375 LEU A O   
1966 C CB  . LEU A 160 ? 0.4882 0.6836 0.3960 0.0350  0.0550  -0.0670 375 LEU A CB  
1967 C CG  . LEU A 160 ? 0.6740 0.8351 0.5730 0.0257  0.0694  -0.0750 375 LEU A CG  
1968 C CD1 . LEU A 160 ? 0.6726 0.8792 0.5533 0.0084  0.0741  -0.0879 375 LEU A CD1 
1969 C CD2 . LEU A 160 ? 0.7605 0.8663 0.6523 0.0110  0.0839  -0.0884 375 LEU A CD2 
1981 N N   . ARG A 161 ? 0.4978 0.6975 0.4261 0.0536  0.0355  -0.0545 376 ARG A N   
1982 C CA  . ARG A 161 ? 0.4537 0.6928 0.3854 0.0630  0.0257  -0.0498 376 ARG A CA  
1983 C C   . ARG A 161 ? 0.4399 0.6624 0.3812 0.0951  0.0162  -0.0280 376 ARG A C   
1984 O O   . ARG A 161 ? 0.4652 0.7260 0.4045 0.1145  0.0093  -0.0170 376 ARG A O   
1985 C CB  . ARG A 161 ? 0.4618 0.7775 0.3834 0.0548  0.0236  -0.0560 376 ARG A CB  
1986 C CG  . ARG A 161 ? 0.6169 0.9507 0.5230 0.0159  0.0338  -0.0808 376 ARG A CG  
1987 C CD  . ARG A 161 ? 0.6738 1.0960 0.5692 0.0034  0.0309  -0.0873 376 ARG A CD  
1988 N NE  . ARG A 161 ? 0.6272 1.1053 0.5321 0.0294  0.0187  -0.0714 376 ARG A NE  
1989 C CZ  . ARG A 161 ? 0.6723 1.1920 0.5785 0.0232  0.0150  -0.0756 376 ARG A CZ  
1990 N NH1 . ARG A 161 ? 0.6691 1.1819 0.5665 -0.0123 0.0221  -0.0960 376 ARG A NH1 
1991 N NH2 . ARG A 161 ? 0.6193 1.1862 0.5335 0.0537  0.0056  -0.0585 376 ARG A NH2 
2005 N N   . SER A 162 ? 0.5499 0.7142 0.4991 0.1007  0.0171  -0.0211 377 SER A N   
2006 C CA  . SER A 162 ? 0.6240 0.7648 0.5775 0.1245  0.0097  -0.0035 377 SER A CA  
2007 C C   . SER A 162 ? 0.5810 0.7295 0.5363 0.1276  0.0053  -0.0057 377 SER A C   
2008 O O   . SER A 162 ? 0.4715 0.6067 0.4308 0.1108  0.0084  -0.0167 377 SER A O   
2009 C CB  . SER A 162 ? 0.4608 0.5457 0.4213 0.1248  0.0119  0.0038  377 SER A CB  
2010 O OG  . SER A 162 ? 0.4648 0.5229 0.4256 0.1411  0.0057  0.0180  377 SER A OG  
2016 N N   . PRO A 163 ? 0.4078 0.5804 0.3582 0.1497  -0.0006 0.0047  378 PRO A N   
2017 C CA  . PRO A 163 ? 0.3801 0.5645 0.3321 0.1521  -0.0035 0.0013  378 PRO A CA  
2018 C C   . PRO A 163 ? 0.3542 0.4813 0.3117 0.1496  -0.0040 0.0030  378 PRO A C   
2019 O O   . PRO A 163 ? 0.3703 0.4531 0.3268 0.1589  -0.0050 0.0140  378 PRO A O   
2020 C CB  . PRO A 163 ? 0.3672 0.5812 0.3103 0.1826  -0.0076 0.0151  378 PRO A CB  
2021 C CG  . PRO A 163 ? 0.3503 0.5627 0.2864 0.1952  -0.0069 0.0267  378 PRO A CG  
2022 C CD  . PRO A 163 ? 0.4552 0.6582 0.3966 0.1716  -0.0031 0.0175  378 PRO A CD  
2030 N N   . MET A 164 ? 0.3361 0.4667 0.2983 0.1340  -0.0028 -0.0082 379 MET A N   
2031 C CA  . MET A 164 ? 0.3508 0.4361 0.3184 0.1300  -0.0034 -0.0070 379 MET A CA  
2032 C C   . MET A 164 ? 0.3105 0.3834 0.2720 0.1535  -0.0086 0.0047  379 MET A C   
2033 O O   . MET A 164 ? 0.3615 0.4704 0.3162 0.1696  -0.0104 0.0071  379 MET A O   
2034 C CB  . MET A 164 ? 0.3563 0.4539 0.3268 0.1084  -0.0003 -0.0214 379 MET A CB  
2035 C CG  . MET A 164 ? 0.4555 0.5118 0.4316 0.1009  0.0002  -0.0211 379 MET A CG  
2036 S SD  . MET A 164 ? 0.4511 0.5266 0.4252 0.0749  0.0052  -0.0378 379 MET A SD  
2037 C CE  . MET A 164 ? 0.4710 0.5440 0.4384 0.0523  0.0163  -0.0498 379 MET A CE  
2047 N N   . CYS A 165 ? 0.4017 0.4248 0.3627 0.1566  -0.0100 0.0127  380 CYS A N   
2048 C CA  . CYS A 165 ? 0.3904 0.3945 0.3383 0.1776  -0.0124 0.0226  380 CYS A CA  
2049 C C   . CYS A 165 ? 0.4150 0.4360 0.3622 0.1805  -0.0137 0.0165  380 CYS A C   
2050 O O   . CYS A 165 ? 0.3820 0.4125 0.3397 0.1620  -0.0136 0.0064  380 CYS A O   
2051 C CB  . CYS A 165 ? 0.7346 0.6829 0.6785 0.1748  -0.0131 0.0311  380 CYS A CB  
2052 S SG  . CYS A 165 ? 0.7689 0.6926 0.7201 0.1593  -0.0151 0.0263  380 CYS A SG  
2058 N N   . GLU A 166 ? 0.4896 0.5114 0.4219 0.2048  -0.0135 0.0235  381 GLU A N   
2059 C CA  . GLU A 166 ? 0.7364 0.7857 0.6661 0.2138  -0.0137 0.0191  381 GLU A CA  
2060 C C   . GLU A 166 ? 0.6120 0.6318 0.5460 0.1985  -0.0150 0.0132  381 GLU A C   
2061 O O   . GLU A 166 ? 0.5188 0.5694 0.4589 0.1921  -0.0156 0.0049  381 GLU A O   
2062 C CB  . GLU A 166 ? 0.7533 0.7960 0.6613 0.2313  -0.0086 0.0276  381 GLU A CB  
2063 C CG  . GLU A 166 ? 0.8804 0.9551 0.7820 0.2438  -0.0060 0.0346  381 GLU A CG  
2064 C CD  . GLU A 166 ? 1.0646 1.0932 0.9562 0.2409  -0.0032 0.0432  381 GLU A CD  
2065 O OE1 . GLU A 166 ? 0.7179 0.7239 0.6206 0.2252  -0.0062 0.0420  381 GLU A OE1 
2066 O OE2 . GLU A 166 ? 1.0378 1.0555 0.9097 0.2557  0.0029  0.0514  381 GLU A OE2 
2073 N N   . TYR A 167 ? 0.5076 0.4728 0.4382 0.1910  -0.0157 0.0177  382 TYR A N   
2074 C CA  . TYR A 167 ? 0.5747 0.5156 0.5096 0.1754  -0.0175 0.0136  382 TYR A CA  
2075 C C   . TYR A 167 ? 0.5033 0.4708 0.4573 0.1530  -0.0179 0.0040  382 TYR A C   
2076 O O   . TYR A 167 ? 0.4144 0.3934 0.3712 0.1461  -0.0184 -0.0022 382 TYR A O   
2077 C CB  . TYR A 167 ? 0.6695 0.5606 0.6009 0.1623  -0.0180 0.0203  382 TYR A CB  
2078 C CG  . TYR A 167 ? 0.6537 0.5240 0.5888 0.1489  -0.0208 0.0181  382 TYR A CG  
2079 C CD1 . TYR A 167 ? 0.5469 0.4217 0.5010 0.1295  -0.0221 0.0167  382 TYR A CD1 
2080 C CD2 . TYR A 167 ? 0.7686 0.6210 0.6891 0.1506  -0.0203 0.0170  382 TYR A CD2 
2081 C CE1 . TYR A 167 ? 0.7531 0.6160 0.7117 0.1158  -0.0242 0.0165  382 TYR A CE1 
2082 C CE2 . TYR A 167 ? 0.8970 0.7340 0.8200 0.1375  -0.0235 0.0153  382 TYR A CE2 
2083 C CZ  . TYR A 167 ? 0.7227 0.5695 0.6669 0.1186  -0.0257 0.0157  382 TYR A CZ  
2084 O OH  . TYR A 167 ? 0.7607 0.6007 0.7096 0.1038  -0.0282 0.0161  382 TYR A OH  
2094 N N   . LEU A 168 ? 0.3023 0.2779 0.2662 0.1419  -0.0163 0.0024  383 LEU A N   
2095 C CA  . LEU A 168 ? 0.2895 0.2798 0.2648 0.1205  -0.0136 -0.0070 383 LEU A CA  
2096 C C   . LEU A 168 ? 0.3276 0.3671 0.3023 0.1155  -0.0121 -0.0177 383 LEU A C   
2097 O O   . LEU A 168 ? 0.3424 0.3871 0.3205 0.0976  -0.0098 -0.0257 383 LEU A O   
2098 C CB  . LEU A 168 ? 0.3394 0.3224 0.3205 0.1114  -0.0096 -0.0068 383 LEU A CB  
2099 C CG  . LEU A 168 ? 0.4329 0.3763 0.4187 0.1097  -0.0095 0.0029  383 LEU A CG  
2100 C CD1 . LEU A 168 ? 0.4851 0.4280 0.4764 0.1012  -0.0032 0.0009  383 LEU A CD1 
2101 C CD2 . LEU A 168 ? 0.5239 0.4451 0.5149 0.1004  -0.0103 0.0049  383 LEU A CD2 
2113 N N   . VAL A 169 ? 0.2896 0.3684 0.2591 0.1290  -0.0126 -0.0175 384 VAL A N   
2114 C CA  . VAL A 169 ? 0.2871 0.4251 0.2560 0.1229  -0.0117 -0.0269 384 VAL A CA  
2115 C C   . VAL A 169 ? 0.2873 0.4319 0.2549 0.1262  -0.0134 -0.0286 384 VAL A C   
2116 O O   . VAL A 169 ? 0.2834 0.4539 0.2534 0.1071  -0.0118 -0.0385 384 VAL A O   
2117 C CB  . VAL A 169 ? 0.2997 0.4852 0.2633 0.1423  -0.0126 -0.0225 384 VAL A CB  
2118 C CG1 . VAL A 169 ? 0.2892 0.5502 0.2529 0.1343  -0.0122 -0.0315 384 VAL A CG1 
2119 C CG2 . VAL A 169 ? 0.2924 0.4677 0.2566 0.1380  -0.0108 -0.0206 384 VAL A CG2 
2129 N N   . ASN A 170 ? 0.3347 0.4513 0.2958 0.1484  -0.0156 -0.0194 385 ASN A N   
2130 C CA  . ASN A 170 ? 0.3390 0.4608 0.2961 0.1552  -0.0164 -0.0207 385 ASN A CA  
2131 C C   . ASN A 170 ? 0.3764 0.4711 0.3399 0.1310  -0.0167 -0.0261 385 ASN A C   
2132 O O   . ASN A 170 ? 0.3992 0.5203 0.3641 0.1215  -0.0162 -0.0329 385 ASN A O   
2133 C CB  . ASN A 170 ? 0.4548 0.5416 0.3973 0.1831  -0.0163 -0.0105 385 ASN A CB  
2134 C CG  . ASN A 170 ? 0.4205 0.5451 0.3524 0.2140  -0.0140 -0.0044 385 ASN A CG  
2135 O OD1 . ASN A 170 ? 0.5375 0.7257 0.4732 0.2180  -0.0136 -0.0083 385 ASN A OD1 
2136 N ND2 . ASN A 170 ? 0.5209 0.6079 0.4375 0.2347  -0.0117 0.0063  385 ASN A ND2 
2143 N N   . PHE A 171 ? 0.3095 0.3553 0.2767 0.1215  -0.0170 -0.0219 386 PHE A N   
2144 C CA  . PHE A 171 ? 0.3624 0.3818 0.3359 0.1009  -0.0165 -0.0236 386 PHE A CA  
2145 C C   . PHE A 171 ? 0.4438 0.4884 0.4216 0.0781  -0.0119 -0.0339 386 PHE A C   
2146 O O   . PHE A 171 ? 0.3379 0.3884 0.3155 0.0650  -0.0109 -0.0386 386 PHE A O   
2147 C CB  . PHE A 171 ? 0.3726 0.3465 0.3501 0.0977  -0.0170 -0.0150 386 PHE A CB  
2148 C CG  . PHE A 171 ? 0.3052 0.2566 0.2896 0.0802  -0.0155 -0.0137 386 PHE A CG  
2149 C CD1 . PHE A 171 ? 0.3831 0.3205 0.3656 0.0781  -0.0187 -0.0106 386 PHE A CD1 
2150 C CD2 . PHE A 171 ? 0.3683 0.3116 0.3585 0.0673  -0.0098 -0.0148 386 PHE A CD2 
2151 C CE1 . PHE A 171 ? 0.4103 0.3311 0.3988 0.0642  -0.0171 -0.0069 386 PHE A CE1 
2152 C CE2 . PHE A 171 ? 0.4249 0.3457 0.4192 0.0556  -0.0067 -0.0109 386 PHE A CE2 
2153 C CZ  . PHE A 171 ? 0.3787 0.2909 0.3731 0.0545  -0.0108 -0.0062 386 PHE A CZ  
2163 N N   . LEU A 172 ? 0.3439 0.4028 0.3224 0.0717  -0.0084 -0.0379 387 LEU A N   
2164 C CA  . LEU A 172 ? 0.3292 0.4094 0.3050 0.0466  -0.0020 -0.0498 387 LEU A CA  
2165 C C   . LEU A 172 ? 0.3397 0.4725 0.3117 0.0401  -0.0028 -0.0582 387 LEU A C   
2166 O O   . LEU A 172 ? 0.3920 0.5294 0.3597 0.0159  0.0019  -0.0666 387 LEU A O   
2167 C CB  . LEU A 172 ? 0.3624 0.4573 0.3355 0.0410  0.0020  -0.0546 387 LEU A CB  
2168 C CG  . LEU A 172 ? 0.4891 0.5404 0.4636 0.0380  0.0070  -0.0511 387 LEU A CG  
2169 C CD1 . LEU A 172 ? 0.4692 0.5459 0.4370 0.0275  0.0123  -0.0601 387 LEU A CD1 
2170 C CD2 . LEU A 172 ? 0.6202 0.6274 0.5936 0.0227  0.0139  -0.0512 387 LEU A CD2 
2182 N N   . HIS A 173 ? 0.3871 0.5604 0.3589 0.0619  -0.0076 -0.0551 388 HIS A N   
2183 C CA  . HIS A 173 ? 0.4469 0.6786 0.4164 0.0583  -0.0081 -0.0615 388 HIS A CA  
2184 C C   . HIS A 173 ? 0.4462 0.6606 0.4157 0.0525  -0.0086 -0.0619 388 HIS A C   
2185 O O   . HIS A 173 ? 0.4955 0.7439 0.4626 0.0335  -0.0064 -0.0702 388 HIS A O   
2186 C CB  . HIS A 173 ? 0.4862 0.7635 0.4544 0.0898  -0.0117 -0.0549 388 HIS A CB  
2187 C CG  . HIS A 173 ? 0.7499 1.0799 0.7173 0.0880  -0.0109 -0.0576 388 HIS A CG  
2188 N ND1 . HIS A 173 ? 0.8097 1.1569 0.7753 0.1180  -0.0129 -0.0475 388 HIS A ND1 
2189 C CD2 . HIS A 173 ? 0.7288 1.0966 0.6940 0.0577  -0.0074 -0.0693 388 HIS A CD2 
2190 C CE1 . HIS A 173 ? 0.7192 1.1194 0.6844 0.1074  -0.0120 -0.0521 388 HIS A CE1 
2191 N NE2 . HIS A 173 ? 0.7347 1.1479 0.6990 0.0694  -0.0086 -0.0663 388 HIS A NE2 
2199 N N   . LYS A 174 ? 0.3941 0.5582 0.3648 0.0669  -0.0115 -0.0531 389 LYS A N   
2200 C CA  . LYS A 174 ? 0.3736 0.5223 0.3435 0.0616  -0.0123 -0.0530 389 LYS A CA  
2201 C C   . LYS A 174 ? 0.4093 0.5322 0.3799 0.0318  -0.0079 -0.0570 389 LYS A C   
2202 O O   . LYS A 174 ? 0.4331 0.5734 0.4007 0.0147  -0.0056 -0.0628 389 LYS A O   
2203 C CB  . LYS A 174 ? 0.3516 0.4549 0.3195 0.0808  -0.0160 -0.0434 389 LYS A CB  
2204 C CG  . LYS A 174 ? 0.3730 0.4924 0.3328 0.1111  -0.0175 -0.0396 389 LYS A CG  
2205 C CD  . LYS A 174 ? 0.5287 0.5908 0.4816 0.1238  -0.0194 -0.0310 389 LYS A CD  
2206 C CE  . LYS A 174 ? 0.4239 0.4839 0.3615 0.1545  -0.0180 -0.0267 389 LYS A CE  
2207 N NZ  . LYS A 174 ? 0.5495 0.5459 0.4766 0.1572  -0.0189 -0.0199 389 LYS A NZ  
2221 N N   . LEU A 175 ? 0.3629 0.4439 0.3359 0.0268  -0.0054 -0.0530 390 LEU A N   
2222 C CA  . LEU A 175 ? 0.3496 0.3976 0.3201 0.0039  0.0015  -0.0542 390 LEU A CA  
2223 C C   . LEU A 175 ? 0.4345 0.5127 0.3953 -0.0228 0.0087  -0.0673 390 LEU A C   
2224 O O   . LEU A 175 ? 0.4335 0.4964 0.3869 -0.0432 0.0143  -0.0700 390 LEU A O   
2225 C CB  . LEU A 175 ? 0.3504 0.3599 0.3236 0.0069  0.0049  -0.0486 390 LEU A CB  
2226 C CG  . LEU A 175 ? 0.3891 0.3514 0.3608 -0.0038 0.0121  -0.0429 390 LEU A CG  
2227 C CD1 . LEU A 175 ? 0.4138 0.3576 0.3913 0.0043  0.0063  -0.0316 390 LEU A CD1 
2228 C CD2 . LEU A 175 ? 0.4755 0.4133 0.4505 0.0039  0.0154  -0.0379 390 LEU A CD2 
2240 N N   . ARG A 176 ? 0.5024 0.6247 0.4611 -0.0239 0.0087  -0.0750 391 ARG A N   
2241 C CA  . ARG A 176 ? 0.5237 0.6823 0.4710 -0.0528 0.0153  -0.0887 391 ARG A CA  
2242 C C   . ARG A 176 ? 0.4972 0.6927 0.4422 -0.0627 0.0137  -0.0925 391 ARG A C   
2243 O O   . ARG A 176 ? 0.5565 0.7614 0.4890 -0.0939 0.0209  -0.1023 391 ARG A O   
2244 C CB  . ARG A 176 ? 0.6397 0.8512 0.5870 -0.0487 0.0135  -0.0940 391 ARG A CB  
2245 C CG  . ARG A 176 ? 0.7993 1.0535 0.7324 -0.0832 0.0206  -0.1094 391 ARG A CG  
2246 C CD  . ARG A 176 ? 0.9396 1.1372 0.8562 -0.1113 0.0333  -0.1172 391 ARG A CD  
2247 N NE  . ARG A 176 ? 0.7743 1.0003 0.6699 -0.1528 0.0426  -0.1339 391 ARG A NE  
2248 C CZ  . ARG A 176 ? 0.9608 1.2551 0.8507 -0.1674 0.0419  -0.1442 391 ARG A CZ  
2249 N NH1 . ARG A 176 ? 0.8826 1.2235 0.7871 -0.1400 0.0325  -0.1378 391 ARG A NH1 
2250 N NH2 . ARG A 176 ? 1.1060 1.4235 0.9733 -0.2111 0.0512  -0.1603 391 ARG A NH2 
2264 N N   . GLN A 177 ? 0.4695 0.6821 0.4239 -0.0370 0.0054  -0.0851 392 GLN A N   
2265 C CA  . GLN A 177 ? 0.4651 0.7145 0.4182 -0.0419 0.0039  -0.0879 392 GLN A CA  
2266 C C   . GLN A 177 ? 0.5110 0.7196 0.4585 -0.0616 0.0079  -0.0870 392 GLN A C   
2267 O O   . GLN A 177 ? 0.5100 0.7514 0.4528 -0.0766 0.0091  -0.0921 392 GLN A O   
2268 C CB  . GLN A 177 ? 0.5126 0.7775 0.4731 -0.0061 -0.0037 -0.0797 392 GLN A CB  
2269 C CG  . GLN A 177 ? 0.7677 1.0963 0.7304 0.0166  -0.0066 -0.0797 392 GLN A CG  
2270 C CD  . GLN A 177 ? 0.6755 1.0036 0.6387 0.0526  -0.0105 -0.0716 392 GLN A CD  
2271 O OE1 . GLN A 177 ? 0.6606 1.0087 0.6218 0.0535  -0.0104 -0.0731 392 GLN A OE1 
2272 N NE2 . GLN A 177 ? 0.4781 0.7789 0.4408 0.0811  -0.0126 -0.0632 392 GLN A NE2 
2281 N N   . LEU A 178 ? 0.3713 0.5134 0.3197 -0.0592 0.0096  -0.0788 393 LEU A N   
2282 C CA  . LEU A 178 ? 0.3307 0.4350 0.2752 -0.0699 0.0122  -0.0734 393 LEU A CA  
2283 C C   . LEU A 178 ? 0.3562 0.4619 0.2843 -0.1059 0.0227  -0.0825 393 LEU A C   
2284 O O   . LEU A 178 ? 0.3719 0.4780 0.2898 -0.1238 0.0302  -0.0911 393 LEU A O   
2285 C CB  . LEU A 178 ? 0.3351 0.3766 0.2838 -0.0593 0.0130  -0.0612 393 LEU A CB  
2286 C CG  . LEU A 178 ? 0.3142 0.3467 0.2742 -0.0323 0.0029  -0.0506 393 LEU A CG  
2287 C CD1 . LEU A 178 ? 0.3308 0.4026 0.2949 -0.0120 -0.0036 -0.0545 393 LEU A CD1 
2288 C CD2 . LEU A 178 ? 0.3267 0.3111 0.2925 -0.0222 0.0027  -0.0385 393 LEU A CD2 
2300 N N   . PRO A 179 ? 0.3920 0.4985 0.3148 -0.1181 0.0239  -0.0813 394 PRO A N   
2301 C CA  . PRO A 179 ? 0.4326 0.5379 0.3358 -0.1547 0.0348  -0.0895 394 PRO A CA  
2302 C C   . PRO A 179 ? 0.4722 0.5053 0.3591 -0.1698 0.0476  -0.0854 394 PRO A C   
2303 O O   . PRO A 179 ? 0.4974 0.5219 0.3618 -0.2022 0.0596  -0.0950 394 PRO A O   
2304 C CB  . PRO A 179 ? 0.4470 0.5703 0.3514 -0.1565 0.0309  -0.0859 394 PRO A CB  
2305 C CG  . PRO A 179 ? 0.4298 0.5772 0.3531 -0.1215 0.0182  -0.0798 394 PRO A CG  
2306 C CD  . PRO A 179 ? 0.3932 0.5040 0.3253 -0.0998 0.0155  -0.0729 394 PRO A CD  
2314 N N   . GLU A 180 ? 0.5146 0.4967 0.4095 -0.1480 0.0465  -0.0709 395 GLU A N   
2315 C CA  . GLU A 180 ? 0.5157 0.4293 0.3938 -0.1572 0.0606  -0.0640 395 GLU A CA  
2316 C C   . GLU A 180 ? 0.5140 0.3918 0.4015 -0.1336 0.0610  -0.0551 395 GLU A C   
2317 O O   . GLU A 180 ? 0.4994 0.3932 0.4085 -0.1076 0.0487  -0.0481 395 GLU A O   
2318 C CB  . GLU A 180 ? 0.6115 0.4970 0.4854 -0.1575 0.0625  -0.0506 395 GLU A CB  
2319 C CG  . GLU A 180 ? 0.7343 0.6540 0.5983 -0.1813 0.0625  -0.0579 395 GLU A CG  
2320 C CD  . GLU A 180 ? 0.7327 0.6261 0.5641 -0.2191 0.0802  -0.0676 395 GLU A CD  
2321 O OE1 . GLU A 180 ? 0.7328 0.5627 0.5453 -0.2237 0.0950  -0.0641 395 GLU A OE1 
2322 O OE2 . GLU A 180 ? 0.7011 0.6370 0.5233 -0.2447 0.0805  -0.0789 395 GLU A OE2 
2329 N N   . ARG A 181 ? 0.5423 0.3682 0.4102 -0.1441 0.0771  -0.0553 396 ARG A N   
2330 C CA  . ARG A 181 ? 0.5491 0.3412 0.4221 -0.1247 0.0809  -0.0483 396 ARG A CA  
2331 C C   . ARG A 181 ? 0.5286 0.2990 0.4187 -0.0963 0.0751  -0.0262 396 ARG A C   
2332 O O   . ARG A 181 ? 0.5019 0.2718 0.4089 -0.0735 0.0692  -0.0183 396 ARG A O   
2333 C CB  . ARG A 181 ? 0.5896 0.3261 0.4309 -0.1440 0.1030  -0.0548 396 ARG A CB  
2334 C CG  . ARG A 181 ? 0.8393 0.5406 0.6808 -0.1269 0.1106  -0.0507 396 ARG A CG  
2335 C CD  . ARG A 181 ? 0.9110 0.5526 0.7138 -0.1489 0.1355  -0.0603 396 ARG A CD  
2336 N NE  . ARG A 181 ? 1.1771 0.7582 0.9566 -0.1520 0.1515  -0.0486 396 ARG A NE  
2337 C CZ  . ARG A 181 ? 1.1552 0.7051 0.9406 -0.1200 0.1559  -0.0274 396 ARG A CZ  
2338 N NH1 . ARG A 181 ? 1.0207 0.5758 0.8288 -0.0910 0.1500  -0.0170 396 ARG A NH1 
2339 N NH2 . ARG A 181 ? 1.2702 0.7910 1.0393 -0.1169 0.1653  -0.0165 396 ARG A NH2 
2353 N N   . TYR A 182 ? 0.4896 0.2459 0.3746 -0.0993 0.0768  -0.0157 397 TYR A N   
2354 C CA  . TYR A 182 ? 0.4788 0.2218 0.3784 -0.0755 0.0716  0.0061  397 TYR A CA  
2355 C C   . TYR A 182 ? 0.4310 0.2217 0.3561 -0.0609 0.0514  0.0069  397 TYR A C   
2356 O O   . TYR A 182 ? 0.4141 0.2039 0.3550 -0.0407 0.0442  0.0210  397 TYR A O   
2357 C CB  . TYR A 182 ? 0.5054 0.2244 0.3922 -0.0815 0.0784  0.0189  397 TYR A CB  
2358 C CG  . TYR A 182 ? 0.4953 0.2521 0.3840 -0.0954 0.0685  0.0135  397 TYR A CG  
2359 C CD1 . TYR A 182 ? 0.4541 0.2461 0.3637 -0.0816 0.0519  0.0206  397 TYR A CD1 
2360 C CD2 . TYR A 182 ? 0.5169 0.2722 0.3836 -0.1238 0.0774  0.0012  397 TYR A CD2 
2361 C CE1 . TYR A 182 ? 0.4638 0.2892 0.3735 -0.0926 0.0442  0.0152  397 TYR A CE1 
2362 C CE2 . TYR A 182 ? 0.5036 0.2968 0.3725 -0.1356 0.0691  -0.0031 397 TYR A CE2 
2363 C CZ  . TYR A 182 ? 0.4697 0.2974 0.3606 -0.1181 0.0527  0.0041  397 TYR A CZ  
2364 O OH  . TYR A 182 ? 0.5267 0.3920 0.4185 -0.1279 0.0453  -0.0007 397 TYR A OH  
2374 N N   . MET A 183 ? 0.4133 0.2457 0.3403 -0.0713 0.0433  -0.0080 398 MET A N   
2375 C CA  . MET A 183 ? 0.3766 0.2467 0.3220 -0.0555 0.0270  -0.0086 398 MET A CA  
2376 C C   . MET A 183 ? 0.3624 0.2352 0.3181 -0.0402 0.0233  -0.0103 398 MET A C   
2377 O O   . MET A 183 ? 0.3480 0.2224 0.3164 -0.0230 0.0144  -0.0013 398 MET A O   
2378 C CB  . MET A 183 ? 0.3798 0.2945 0.3230 -0.0655 0.0215  -0.0224 398 MET A CB  
2379 C CG  . MET A 183 ? 0.3928 0.3101 0.3260 -0.0818 0.0243  -0.0209 398 MET A CG  
2380 S SD  . MET A 183 ? 0.4448 0.4243 0.3805 -0.0847 0.0151  -0.0342 398 MET A SD  
2381 C CE  . MET A 183 ? 0.4963 0.4709 0.4195 -0.1055 0.0200  -0.0300 398 MET A CE  
2391 N N   . MET A 184 ? 0.3708 0.2446 0.3188 -0.0490 0.0307  -0.0221 399 MET A N   
2392 C CA  . MET A 184 ? 0.3615 0.2335 0.3165 -0.0363 0.0298  -0.0230 399 MET A CA  
2393 C C   . MET A 184 ? 0.3643 0.2010 0.3267 -0.0208 0.0319  -0.0062 399 MET A C   
2394 O O   . MET A 184 ? 0.3450 0.1889 0.3204 -0.0048 0.0236  0.0000  399 MET A O   
2395 C CB  . MET A 184 ? 0.3813 0.2530 0.3218 -0.0534 0.0407  -0.0376 399 MET A CB  
2396 C CG  . MET A 184 ? 0.3739 0.2960 0.3106 -0.0663 0.0366  -0.0530 399 MET A CG  
2397 S SD  . MET A 184 ? 0.4339 0.3580 0.3487 -0.0952 0.0506  -0.0706 399 MET A SD  
2398 C CE  . MET A 184 ? 0.3948 0.3940 0.3070 -0.1125 0.0445  -0.0856 399 MET A CE  
2408 N N   . ASN A 185 ? 0.3912 0.1915 0.3441 -0.0250 0.0436  0.0026  400 ASN A N   
2409 C CA  . ASN A 185 ? 0.3969 0.1706 0.3567 -0.0079 0.0473  0.0208  400 ASN A CA  
2410 C C   . ASN A 185 ? 0.3745 0.1653 0.3507 0.0046  0.0340  0.0363  400 ASN A C   
2411 O O   . ASN A 185 ? 0.3708 0.1632 0.3594 0.0194  0.0300  0.0479  400 ASN A O   
2412 C CB  . ASN A 185 ? 0.4400 0.1673 0.3809 -0.0123 0.0662  0.0276  400 ASN A CB  
2413 C CG  . ASN A 185 ? 0.4691 0.1709 0.3904 -0.0241 0.0816  0.0126  400 ASN A CG  
2414 O OD1 . ASN A 185 ? 0.4539 0.1721 0.3813 -0.0219 0.0780  0.0032  400 ASN A OD1 
2415 N ND2 . ASN A 185 ? 0.5136 0.1758 0.4087 -0.0390 0.0989  0.0095  400 ASN A ND2 
2422 N N   . SER A 186 ? 0.3683 0.1753 0.3435 -0.0031 0.0271  0.0357  401 SER A N   
2423 C CA  . SER A 186 ? 0.3487 0.1749 0.3360 0.0048  0.0140  0.0463  401 SER A CA  
2424 C C   . SER A 186 ? 0.3259 0.1703 0.3224 0.0129  0.0033  0.0413  401 SER A C   
2425 O O   . SER A 186 ? 0.3199 0.1674 0.3252 0.0211  -0.0028 0.0531  401 SER A O   
2426 C CB  . SER A 186 ? 0.3458 0.1891 0.3282 -0.0058 0.0082  0.0421  401 SER A CB  
2427 O OG  . SER A 186 ? 0.3969 0.2221 0.3686 -0.0145 0.0182  0.0478  401 SER A OG  
2433 N N   . VAL A 187 ? 0.3184 0.1771 0.3110 0.0099  0.0011  0.0247  402 VAL A N   
2434 C CA  . VAL A 187 ? 0.3034 0.1743 0.3004 0.0196  -0.0070 0.0206  402 VAL A CA  
2435 C C   . VAL A 187 ? 0.3025 0.1602 0.3065 0.0287  -0.0043 0.0279  402 VAL A C   
2436 O O   . VAL A 187 ? 0.2950 0.1535 0.3046 0.0358  -0.0109 0.0357  402 VAL A O   
2437 C CB  . VAL A 187 ? 0.2995 0.1919 0.2904 0.0181  -0.0076 0.0041  402 VAL A CB  
2438 C CG1 . VAL A 187 ? 0.2903 0.1895 0.2827 0.0318  -0.0137 0.0022  402 VAL A CG1 
2439 C CG2 . VAL A 187 ? 0.3145 0.2260 0.2993 0.0118  -0.0109 -0.0021 402 VAL A CG2 
2449 N N   . LEU A 188 ? 0.3137 0.1588 0.3148 0.0264  0.0065  0.0245  403 LEU A N   
2450 C CA  . LEU A 188 ? 0.3224 0.1561 0.3285 0.0352  0.0111  0.0295  403 LEU A CA  
2451 C C   . LEU A 188 ? 0.3218 0.1459 0.3374 0.0445  0.0116  0.0491  403 LEU A C   
2452 O O   . LEU A 188 ? 0.3130 0.1373 0.3354 0.0531  0.0116  0.0547  403 LEU A O   
2453 C CB  . LEU A 188 ? 0.3352 0.1523 0.3309 0.0283  0.0252  0.0205  403 LEU A CB  
2454 C CG  . LEU A 188 ? 0.3631 0.2021 0.3518 0.0200  0.0237  0.0019  403 LEU A CG  
2455 C CD1 . LEU A 188 ? 0.3586 0.1827 0.3316 0.0049  0.0381  -0.0095 403 LEU A CD1 
2456 C CD2 . LEU A 188 ? 0.3199 0.1735 0.3151 0.0307  0.0177  0.0003  403 LEU A CD2 
2468 N N   . GLU A 189 ? 0.3624 0.1839 0.3788 0.0430  0.0117  0.0605  404 GLU A N   
2469 C CA  . GLU A 189 ? 0.5474 0.3712 0.5740 0.0530  0.0117  0.0813  404 GLU A CA  
2470 C C   . GLU A 189 ? 0.3515 0.1974 0.3869 0.0538  -0.0017 0.0858  404 GLU A C   
2471 O O   . GLU A 189 ? 0.3669 0.2226 0.4118 0.0606  -0.0023 0.1011  404 GLU A O   
2472 C CB  . GLU A 189 ? 0.6981 0.5193 0.7226 0.0519  0.0145  0.0946  404 GLU A CB  
2473 C CG  . GLU A 189 ? 0.9164 0.7612 0.9440 0.0446  0.0013  0.0992  404 GLU A CG  
2474 C CD  . GLU A 189 ? 0.9545 0.7964 0.9768 0.0414  0.0052  0.1094  404 GLU A CD  
2475 O OE1 . GLU A 189 ? 0.8538 0.7064 0.8710 0.0301  -0.0023 0.1025  404 GLU A OE1 
2476 O OE2 . GLU A 189 ? 0.9261 0.7541 0.9476 0.0518  0.0165  0.1252  404 GLU A OE2 
2483 N N   . ASN A 190 ? 0.3323 0.1851 0.3622 0.0471  -0.0108 0.0727  405 ASN A N   
2484 C CA  . ASN A 190 ? 0.3996 0.2622 0.4300 0.0457  -0.0209 0.0748  405 ASN A CA  
2485 C C   . ASN A 190 ? 0.3344 0.1924 0.3639 0.0513  -0.0205 0.0681  405 ASN A C   
2486 O O   . ASN A 190 ? 0.3343 0.1926 0.3580 0.0493  -0.0273 0.0668  405 ASN A O   
2487 C CB  . ASN A 190 ? 0.3341 0.1996 0.3535 0.0377  -0.0287 0.0658  405 ASN A CB  
2488 C CG  . ASN A 190 ? 0.3966 0.2690 0.4161 0.0310  -0.0294 0.0722  405 ASN A CG  
2489 O OD1 . ASN A 190 ? 0.3948 0.2789 0.4192 0.0275  -0.0329 0.0866  405 ASN A OD1 
2490 N ND2 . ASN A 190 ? 0.3580 0.2270 0.3731 0.0290  -0.0249 0.0635  405 ASN A ND2 
2497 N N   . PHE A 191 ? 0.3602 0.2112 0.3920 0.0573  -0.0117 0.0638  406 PHE A N   
2498 C CA  . PHE A 191 ? 0.3495 0.1992 0.3796 0.0625  -0.0111 0.0570  406 PHE A CA  
2499 C C   . PHE A 191 ? 0.3703 0.2165 0.4084 0.0694  -0.0027 0.0648  406 PHE A C   
2500 O O   . PHE A 191 ? 0.3728 0.2100 0.4118 0.0715  0.0075  0.0671  406 PHE A O   
2501 C CB  . PHE A 191 ? 0.4174 0.2687 0.4388 0.0616  -0.0087 0.0398  406 PHE A CB  
2502 C CG  . PHE A 191 ? 0.5454 0.4037 0.5579 0.0604  -0.0163 0.0323  406 PHE A CG  
2503 C CD1 . PHE A 191 ? 0.7016 0.5607 0.7065 0.0674  -0.0209 0.0290  406 PHE A CD1 
2504 C CD2 . PHE A 191 ? 0.4198 0.2819 0.4291 0.0538  -0.0173 0.0291  406 PHE A CD2 
2505 C CE1 . PHE A 191 ? 0.7081 0.5694 0.7012 0.0703  -0.0253 0.0227  406 PHE A CE1 
2506 C CE2 . PHE A 191 ? 0.5308 0.3999 0.5307 0.0549  -0.0227 0.0219  406 PHE A CE2 
2507 C CZ  . PHE A 191 ? 0.5900 0.4576 0.5812 0.0643  -0.0261 0.0187  406 PHE A CZ  
2517 N N   . THR A 192 ? 0.2836 0.1352 0.3235 0.0724  -0.0059 0.0676  407 THR A N   
2518 C CA  . THR A 192 ? 0.2912 0.1469 0.3347 0.0769  0.0007  0.0707  407 THR A CA  
2519 C C   . THR A 192 ? 0.2892 0.1469 0.3302 0.0793  -0.0017 0.0664  407 THR A C   
2520 O O   . THR A 192 ? 0.2811 0.1375 0.3163 0.0776  -0.0095 0.0652  407 THR A O   
2521 C CB  . THR A 192 ? 0.3345 0.2052 0.3862 0.0777  0.0002  0.0864  407 THR A CB  
2522 O OG1 . THR A 192 ? 0.3865 0.2677 0.4400 0.0726  -0.0091 0.0942  407 THR A OG1 
2523 C CG2 . THR A 192 ? 0.4201 0.2916 0.4734 0.0766  0.0014  0.0931  407 THR A CG2 
2531 N N   . ILE A 193 ? 0.2867 0.1439 0.3294 0.0841  0.0065  0.0640  408 ILE A N   
2532 C CA  . ILE A 193 ? 0.2848 0.1457 0.3262 0.0875  0.0060  0.0621  408 ILE A CA  
2533 C C   . ILE A 193 ? 0.2867 0.1578 0.3355 0.0904  0.0099  0.0722  408 ILE A C   
2534 O O   . ILE A 193 ? 0.2936 0.1649 0.3464 0.0939  0.0181  0.0759  408 ILE A O   
2535 C CB  . ILE A 193 ? 0.3318 0.1850 0.3675 0.0917  0.0142  0.0499  408 ILE A CB  
2536 C CG1 . ILE A 193 ? 0.3267 0.1837 0.3538 0.0870  0.0079  0.0388  408 ILE A CG1 
2537 C CG2 . ILE A 193 ? 0.3214 0.1816 0.3554 0.0959  0.0149  0.0493  408 ILE A CG2 
2538 C CD1 . ILE A 193 ? 0.4246 0.2910 0.4428 0.0845  0.0123  0.0234  408 ILE A CD1 
2550 N N   . LEU A 194 ? 0.2842 0.1624 0.3332 0.0901  0.0052  0.0775  409 LEU A N   
2551 C CA  . LEU A 194 ? 0.3175 0.2093 0.3747 0.0936  0.0094  0.0885  409 LEU A CA  
2552 C C   . LEU A 194 ? 0.2893 0.1792 0.3422 0.0971  0.0113  0.0843  409 LEU A C   
2553 O O   . LEU A 194 ? 0.2880 0.1715 0.3318 0.0945  0.0045  0.0813  409 LEU A O   
2554 C CB  . LEU A 194 ? 0.2974 0.2029 0.3601 0.0874  0.0020  0.1042  409 LEU A CB  
2555 C CG  . LEU A 194 ? 0.3561 0.2859 0.4318 0.0911  0.0062  0.1205  409 LEU A CG  
2556 C CD1 . LEU A 194 ? 0.5235 0.4657 0.6088 0.1010  0.0161  0.1252  409 LEU A CD1 
2557 C CD2 . LEU A 194 ? 0.6044 0.5488 0.6831 0.0791  -0.0038 0.1378  409 LEU A CD2 
2569 N N   . GLN A 195 ? 0.3010 0.1948 0.3580 0.1043  0.0217  0.0845  410 GLN A N   
2570 C CA  . GLN A 195 ? 0.3055 0.2009 0.3593 0.1090  0.0252  0.0829  410 GLN A CA  
2571 C C   . GLN A 195 ? 0.2958 0.2085 0.3593 0.1132  0.0295  0.0968  410 GLN A C   
2572 O O   . GLN A 195 ? 0.3011 0.2203 0.3717 0.1194  0.0387  0.1011  410 GLN A O   
2573 C CB  . GLN A 195 ? 0.3536 0.2375 0.4014 0.1151  0.0370  0.0701  410 GLN A CB  
2574 C CG  . GLN A 195 ? 0.6163 0.4955 0.6527 0.1100  0.0328  0.0554  410 GLN A CG  
2575 C CD  . GLN A 195 ? 0.7151 0.5962 0.7421 0.1093  0.0422  0.0419  410 GLN A CD  
2576 O OE1 . GLN A 195 ? 0.4921 0.3611 0.5163 0.1100  0.0555  0.0370  410 GLN A OE1 
2577 N NE2 . GLN A 195 ? 0.7882 0.6835 0.8079 0.1084  0.0367  0.0369  410 GLN A NE2 
2586 N N   . VAL A 196 ? 0.2948 0.2144 0.3568 0.1105  0.0238  0.1051  411 VAL A N   
2587 C CA  . VAL A 196 ? 0.2963 0.2382 0.3667 0.1109  0.0263  0.1189  411 VAL A CA  
2588 C C   . VAL A 196 ? 0.3009 0.2442 0.3636 0.1132  0.0301  0.1136  411 VAL A C   
2589 O O   . VAL A 196 ? 0.3036 0.2372 0.3533 0.1076  0.0232  0.1092  411 VAL A O   
2590 C CB  . VAL A 196 ? 0.2979 0.2509 0.3678 0.0965  0.0155  0.1315  411 VAL A CB  
2591 C CG1 . VAL A 196 ? 0.2985 0.2819 0.3773 0.0947  0.0185  0.1457  411 VAL A CG1 
2592 C CG2 . VAL A 196 ? 0.3131 0.2684 0.3890 0.0923  0.0109  0.1363  411 VAL A CG2 
2602 N N   . VAL A 197 ? 0.3049 0.2597 0.3741 0.1228  0.0418  0.1149  412 VAL A N   
2603 C CA  . VAL A 197 ? 0.3102 0.2701 0.3725 0.1247  0.0465  0.1103  412 VAL A CA  
2604 C C   . VAL A 197 ? 0.3114 0.2992 0.3829 0.1243  0.0484  0.1262  412 VAL A C   
2605 O O   . VAL A 197 ? 0.3118 0.3183 0.3971 0.1319  0.0551  0.1370  412 VAL A O   
2606 C CB  . VAL A 197 ? 0.3192 0.2683 0.3767 0.1336  0.0600  0.0960  412 VAL A CB  
2607 C CG1 . VAL A 197 ? 0.3277 0.2851 0.3763 0.1337  0.0642  0.0901  412 VAL A CG1 
2608 C CG2 . VAL A 197 ? 0.3205 0.2492 0.3689 0.1297  0.0572  0.0815  412 VAL A CG2 
2618 N N   . THR A 198 ? 0.3142 0.3062 0.3766 0.1155  0.0424  0.1291  413 THR A N   
2619 C CA  . THR A 198 ? 0.3622 0.3810 0.4295 0.1091  0.0420  0.1441  413 THR A CA  
2620 C C   . THR A 198 ? 0.3737 0.3958 0.4311 0.1102  0.0458  0.1407  413 THR A C   
2621 O O   . THR A 198 ? 0.3282 0.3312 0.3708 0.1099  0.0427  0.1306  413 THR A O   
2622 C CB  . THR A 198 ? 0.3218 0.3382 0.3815 0.0902  0.0298  0.1540  413 THR A CB  
2623 O OG1 . THR A 198 ? 0.4567 0.4420 0.4958 0.0863  0.0238  0.1455  413 THR A OG1 
2624 C CG2 . THR A 198 ? 0.3301 0.3465 0.3976 0.0859  0.0247  0.1576  413 THR A CG2 
2632 N N   . ASN A 199 ? 0.4372 0.4886 0.5031 0.1121  0.0527  0.1505  414 ASN A N   
2633 C CA  . ASN A 199 ? 0.4122 0.4730 0.4692 0.1100  0.0555  0.1511  414 ASN A CA  
2634 C C   . ASN A 199 ? 0.3600 0.4108 0.4014 0.0920  0.0440  0.1593  414 ASN A C   
2635 O O   . ASN A 199 ? 0.4588 0.5227 0.5021 0.0777  0.0394  0.1725  414 ASN A O   
2636 C CB  . ASN A 199 ? 0.3506 0.4488 0.4215 0.1166  0.0662  0.1611  414 ASN A CB  
2637 C CG  . ASN A 199 ? 0.3641 0.4758 0.4262 0.1137  0.0697  0.1625  414 ASN A CG  
2638 O OD1 . ASN A 199 ? 0.4373 0.5430 0.4858 0.0993  0.0613  0.1677  414 ASN A OD1 
2639 N ND2 . ASN A 199 ? 0.4027 0.5298 0.4699 0.1278  0.0837  0.1583  414 ASN A ND2 
2646 N N   . ARG A 200 ? 0.4356 0.4628 0.4586 0.0923  0.0404  0.1521  415 ARG A N   
2647 C CA  . ARG A 200 ? 0.5379 0.5426 0.5402 0.0786  0.0318  0.1597  415 ARG A CA  
2648 C C   . ARG A 200 ? 0.5038 0.5245 0.4997 0.0641  0.0327  0.1741  415 ARG A C   
2649 O O   . ARG A 200 ? 0.5717 0.5784 0.5537 0.0459  0.0274  0.1834  415 ARG A O   
2650 C CB  . ARG A 200 ? 0.5779 0.5585 0.5614 0.0875  0.0296  0.1513  415 ARG A CB  
2651 C CG  . ARG A 200 ? 0.7191 0.6716 0.6752 0.0793  0.0248  0.1606  415 ARG A CG  
2652 C CD  . ARG A 200 ? 0.7189 0.6616 0.6605 0.0946  0.0248  0.1544  415 ARG A CD  
2653 N NE  . ARG A 200 ? 0.8112 0.7334 0.7251 0.0929  0.0244  0.1657  415 ARG A NE  
2654 C CZ  . ARG A 200 ? 0.9102 0.8490 0.8180 0.0942  0.0284  0.1716  415 ARG A CZ  
2655 N NH1 . ARG A 200 ? 0.6454 0.6229 0.5731 0.0964  0.0336  0.1660  415 ARG A NH1 
2656 N NH2 . ARG A 200 ? 1.0474 0.9601 0.9259 0.0937  0.0286  0.1836  415 ARG A NH2 
2670 N N   . ASP A 201 ? 0.4720 0.5212 0.4753 0.0700  0.0404  0.1755  416 ASP A N   
2671 C CA  . ASP A 201 ? 0.5116 0.5782 0.5076 0.0553  0.0415  0.1892  416 ASP A CA  
2672 C C   . ASP A 201 ? 0.5863 0.6882 0.5985 0.0416  0.0419  0.2015  416 ASP A C   
2673 O O   . ASP A 201 ? 0.6403 0.7557 0.6436 0.0217  0.0407  0.2141  416 ASP A O   
2674 C CB  . ASP A 201 ? 0.5373 0.6255 0.5347 0.0662  0.0499  0.1865  416 ASP A CB  
2675 C CG  . ASP A 201 ? 0.6388 0.7020 0.6184 0.0769  0.0487  0.1766  416 ASP A CG  
2676 O OD1 . ASP A 201 ? 0.7591 0.8375 0.7442 0.0900  0.0556  0.1661  416 ASP A OD1 
2677 O OD2 . ASP A 201 ? 0.5540 0.5832 0.5123 0.0726  0.0418  0.1795  416 ASP A OD2 
2682 N N   . THR A 202 ? 0.4327 0.5521 0.4671 0.0513  0.0436  0.1992  417 THR A N   
2683 C CA  . THR A 202 ? 0.3921 0.5558 0.4438 0.0416  0.0442  0.2130  417 THR A CA  
2684 C C   . THR A 202 ? 0.4491 0.6051 0.5046 0.0333  0.0365  0.2143  417 THR A C   
2685 O O   . THR A 202 ? 0.4594 0.6518 0.5237 0.0180  0.0339  0.2271  417 THR A O   
2686 C CB  . THR A 202 ? 0.4735 0.6788 0.5502 0.0640  0.0562  0.2146  417 THR A CB  
2687 O OG1 . THR A 202 ? 0.3786 0.5604 0.4623 0.0863  0.0608  0.2011  417 THR A OG1 
2688 C CG2 . THR A 202 ? 0.4012 0.6221 0.4741 0.0692  0.0646  0.2146  417 THR A CG2 
2696 N N   . GLN A 203 ? 0.4619 0.5765 0.5115 0.0432  0.0333  0.2012  418 GLN A N   
2697 C CA  . GLN A 203 ? 0.4311 0.5324 0.4819 0.0366  0.0261  0.2002  418 GLN A CA  
2698 C C   . GLN A 203 ? 0.4266 0.5657 0.5052 0.0508  0.0308  0.2054  418 GLN A C   
2699 O O   . GLN A 203 ? 0.4790 0.6210 0.5627 0.0449  0.0253  0.2082  418 GLN A O   
2700 C CB  . GLN A 203 ? 0.5821 0.6768 0.6136 0.0048  0.0178  0.2091  418 GLN A CB  
2701 C CG  . GLN A 203 ? 0.6272 0.6744 0.6254 -0.0057 0.0159  0.2056  418 GLN A CG  
2702 C CD  . GLN A 203 ? 0.9166 0.9223 0.8860 -0.0296 0.0090  0.2056  418 GLN A CD  
2703 O OE1 . GLN A 203 ? 0.9999 0.9992 0.9734 -0.0321 0.0044  0.2018  418 GLN A OE1 
2704 N NE2 . GLN A 203 ? 0.9472 0.9204 0.8841 -0.0472 0.0096  0.2097  418 GLN A NE2 
2713 N N   . GLU A 204 ? 0.4277 0.5928 0.5218 0.0714  0.0423  0.2066  419 GLU A N   
2714 C CA  . GLU A 204 ? 0.4635 0.6493 0.5785 0.0938  0.0509  0.2094  419 GLU A CA  
2715 C C   . GLU A 204 ? 0.3528 0.4949 0.4639 0.1065  0.0515  0.1941  419 GLU A C   
2716 O O   . GLU A 204 ? 0.3894 0.4957 0.4872 0.1102  0.0526  0.1786  419 GLU A O   
2717 C CB  . GLU A 204 ? 0.4602 0.6702 0.5852 0.1154  0.0663  0.2112  419 GLU A CB  
2718 C CG  . GLU A 204 ? 0.6063 0.8770 0.7442 0.1111  0.0694  0.2301  419 GLU A CG  
2719 C CD  . GLU A 204 ? 0.6073 0.8915 0.7463 0.1275  0.0835  0.2282  419 GLU A CD  
2720 O OE1 . GLU A 204 ? 0.6020 0.8479 0.7257 0.1298  0.0861  0.2122  419 GLU A OE1 
2721 O OE2 . GLU A 204 ? 0.8937 1.2303 1.0485 0.1386  0.0925  0.2429  419 GLU A OE2 
2728 N N   . LEU A 205 ? 0.3104 0.4617 0.4336 0.1131  0.0514  0.1998  420 LEU A N   
2729 C CA  . LEU A 205 ? 0.3360 0.4502 0.4564 0.1239  0.0528  0.1876  420 LEU A CA  
2730 C C   . LEU A 205 ? 0.3152 0.4212 0.4392 0.1496  0.0701  0.1817  420 LEU A C   
2731 O O   . LEU A 205 ? 0.3923 0.5301 0.5289 0.1644  0.0804  0.1945  420 LEU A O   
2732 C CB  . LEU A 205 ? 0.3345 0.4638 0.4649 0.1205  0.0466  0.1981  420 LEU A CB  
2733 C CG  . LEU A 205 ? 0.3636 0.4591 0.4924 0.1322  0.0493  0.1882  420 LEU A CG  
2734 C CD1 . LEU A 205 ? 0.5268 0.6004 0.6449 0.1122  0.0346  0.1818  420 LEU A CD1 
2735 C CD2 . LEU A 205 ? 0.4228 0.5439 0.5675 0.1497  0.0571  0.2029  420 LEU A CD2 
2747 N N   . LEU A 206 ? 0.3308 0.3957 0.4415 0.1543  0.0747  0.1627  421 LEU A N   
2748 C CA  . LEU A 206 ? 0.3401 0.3897 0.4472 0.1747  0.0936  0.1545  421 LEU A CA  
2749 C C   . LEU A 206 ? 0.3712 0.3896 0.4732 0.1815  0.0991  0.1465  421 LEU A C   
2750 O O   . LEU A 206 ? 0.3758 0.3836 0.4711 0.1929  0.1139  0.1433  421 LEU A O   
2751 C CB  . LEU A 206 ? 0.3653 0.3944 0.4558 0.1701  0.0969  0.1363  421 LEU A CB  
2752 C CG  . LEU A 206 ? 0.4232 0.4778 0.5130 0.1596  0.0905  0.1419  421 LEU A CG  
2753 C CD1 . LEU A 206 ? 0.3549 0.3912 0.4271 0.1527  0.0894  0.1252  421 LEU A CD1 
2754 C CD2 . LEU A 206 ? 0.4213 0.5083 0.5214 0.1731  0.1033  0.1540  421 LEU A CD2 
2766 N N   . LEU A 207 ? 0.3340 0.3339 0.4320 0.1685  0.0863  0.1398  422 LEU A N   
2767 C CA  . LEU A 207 ? 0.3738 0.3452 0.4627 0.1661  0.0880  0.1283  422 LEU A CA  
2768 C C   . LEU A 207 ? 0.3243 0.2967 0.4170 0.1524  0.0711  0.1306  422 LEU A C   
2769 O O   . LEU A 207 ? 0.3124 0.2832 0.4031 0.1423  0.0592  0.1295  422 LEU A O   
2770 C CB  . LEU A 207 ? 0.3785 0.3135 0.4497 0.1650  0.0957  0.1070  422 LEU A CB  
2771 C CG  . LEU A 207 ? 0.5917 0.5049 0.6491 0.1755  0.1164  0.0978  422 LEU A CG  
2772 C CD1 . LEU A 207 ? 0.7046 0.5858 0.7438 0.1689  0.1221  0.0762  422 LEU A CD1 
2773 C CD2 . LEU A 207 ? 0.7738 0.6765 0.8276 0.1814  0.1243  0.1027  422 LEU A CD2 
2785 N N   . CYS A 208 ? 0.3272 0.3013 0.4229 0.1529  0.0711  0.1348  423 CYS A N   
2786 C CA  . CYS A 208 ? 0.3151 0.2856 0.4115 0.1408  0.0576  0.1342  423 CYS A CA  
2787 C C   . CYS A 208 ? 0.3260 0.2720 0.4136 0.1423  0.0631  0.1241  423 CYS A C   
2788 O O   . CYS A 208 ? 0.3760 0.3265 0.4652 0.1523  0.0729  0.1313  423 CYS A O   
2789 C CB  . CYS A 208 ? 0.3209 0.3280 0.4322 0.1376  0.0498  0.1548  423 CYS A CB  
2790 S SG  . CYS A 208 ? 0.3427 0.3410 0.4512 0.1217  0.0340  0.1532  423 CYS A SG  
2796 N N   . THR A 209 ? 0.3224 0.2437 0.3996 0.1334  0.0578  0.1090  424 THR A N   
2797 C CA  . THR A 209 ? 0.3350 0.2315 0.4021 0.1330  0.0638  0.0990  424 THR A CA  
2798 C C   . THR A 209 ? 0.3223 0.2153 0.3888 0.1222  0.0510  0.0959  424 THR A C   
2799 O O   . THR A 209 ? 0.3376 0.2282 0.4015 0.1141  0.0408  0.0893  424 THR A O   
2800 C CB  . THR A 209 ? 0.3508 0.2192 0.4029 0.1330  0.0744  0.0820  424 THR A CB  
2801 O OG1 . THR A 209 ? 0.4351 0.3025 0.4844 0.1436  0.0885  0.0838  424 THR A OG1 
2802 C CG2 . THR A 209 ? 0.3683 0.2084 0.4074 0.1301  0.0825  0.0727  424 THR A CG2 
2810 N N   . ALA A 210 ? 0.3289 0.2205 0.3962 0.1235  0.0527  0.1009  425 ALA A N   
2811 C CA  . ALA A 210 ? 0.3205 0.2062 0.3854 0.1143  0.0429  0.0973  425 ALA A CA  
2812 C C   . ALA A 210 ? 0.3351 0.1917 0.3869 0.1122  0.0510  0.0842  425 ALA A C   
2813 O O   . ALA A 210 ? 0.3582 0.1999 0.4031 0.1191  0.0651  0.0846  425 ALA A O   
2814 C CB  . ALA A 210 ? 0.3191 0.2244 0.3931 0.1161  0.0394  0.1127  425 ALA A CB  
2820 N N   . TYR A 211 ? 0.3368 0.1842 0.3834 0.1033  0.0440  0.0734  426 TYR A N   
2821 C CA  . TYR A 211 ? 0.3514 0.1734 0.3858 0.0988  0.0519  0.0621  426 TYR A CA  
2822 C C   . TYR A 211 ? 0.3521 0.1728 0.3864 0.0925  0.0446  0.0633  426 TYR A C   
2823 O O   . TYR A 211 ? 0.3388 0.1720 0.3780 0.0882  0.0316  0.0639  426 TYR A O   
2824 C CB  . TYR A 211 ? 0.4056 0.2171 0.4319 0.0947  0.0545  0.0473  426 TYR A CB  
2825 C CG  . TYR A 211 ? 0.4543 0.2647 0.4780 0.0998  0.0624  0.0435  426 TYR A CG  
2826 C CD1 . TYR A 211 ? 0.5056 0.2899 0.5132 0.0983  0.0800  0.0319  426 TYR A CD1 
2827 C CD2 . TYR A 211 ? 0.4388 0.2711 0.4723 0.1040  0.0534  0.0500  426 TYR A CD2 
2828 C CE1 . TYR A 211 ? 0.5051 0.2884 0.5079 0.1019  0.0880  0.0265  426 TYR A CE1 
2829 C CE2 . TYR A 211 ? 0.4415 0.2735 0.4722 0.1093  0.0612  0.0469  426 TYR A CE2 
2830 C CZ  . TYR A 211 ? 0.5066 0.3159 0.5225 0.1085  0.0782  0.0347  426 TYR A CZ  
2831 O OH  . TYR A 211 ? 0.5158 0.3286 0.5257 0.1099  0.0855  0.0285  426 TYR A OH  
2841 N N   . VAL A 212 ? 0.3558 0.1582 0.3818 0.0919  0.0543  0.0635  427 VAL A N   
2842 C CA  . VAL A 212 ? 0.3548 0.1519 0.3784 0.0854  0.0501  0.0637  427 VAL A CA  
2843 C C   . VAL A 212 ? 0.3787 0.1436 0.3842 0.0766  0.0634  0.0496  427 VAL A C   
2844 O O   . VAL A 212 ? 0.4033 0.1468 0.3955 0.0759  0.0779  0.0420  427 VAL A O   
2845 C CB  . VAL A 212 ? 0.3929 0.1986 0.4214 0.0909  0.0495  0.0792  427 VAL A CB  
2846 C CG1 . VAL A 212 ? 0.3719 0.2094 0.4152 0.0945  0.0374  0.0915  427 VAL A CG1 
2847 C CG2 . VAL A 212 ? 0.4068 0.1965 0.4272 0.0995  0.0654  0.0834  427 VAL A CG2 
2857 N N   . PHE A 213 ? 0.3747 0.1352 0.3773 0.0679  0.0594  0.0455  428 PHE A N   
2858 C CA  . PHE A 213 ? 0.4042 0.1503 0.3888 0.0515  0.0667  0.0271  428 PHE A CA  
2859 C C   . PHE A 213 ? 0.4046 0.1380 0.3802 0.0420  0.0695  0.0279  428 PHE A C   
2860 O O   . PHE A 213 ? 0.3888 0.1363 0.3751 0.0453  0.0592  0.0384  428 PHE A O   
2861 C CB  . PHE A 213 ? 0.4540 0.2340 0.4423 0.0434  0.0532  0.0134  428 PHE A CB  
2862 C CG  . PHE A 213 ? 0.4094 0.2028 0.4042 0.0513  0.0500  0.0122  428 PHE A CG  
2863 C CD1 . PHE A 213 ? 0.4005 0.2078 0.4110 0.0642  0.0392  0.0254  428 PHE A CD1 
2864 C CD2 . PHE A 213 ? 0.4336 0.2259 0.4166 0.0438  0.0583  -0.0019 428 PHE A CD2 
2865 C CE1 . PHE A 213 ? 0.3297 0.1479 0.3444 0.0706  0.0369  0.0251  428 PHE A CE1 
2866 C CE2 . PHE A 213 ? 0.4017 0.2078 0.3901 0.0515  0.0555  -0.0021 428 PHE A CE2 
2867 C CZ  . PHE A 213 ? 0.3661 0.1836 0.3705 0.0657  0.0450  0.0120  428 PHE A CZ  
2877 N N   . GLU A 214 ? 0.4379 0.1436 0.3909 0.0277  0.0845  0.0157  429 GLU A N   
2878 C CA  . GLU A 214 ? 0.4561 0.1521 0.3950 0.0110  0.0879  0.0103  429 GLU A CA  
2879 C C   . GLU A 214 ? 0.4696 0.1687 0.3892 -0.0134 0.0939  -0.0131 429 GLU A C   
2880 O O   . GLU A 214 ? 0.4826 0.1855 0.3980 -0.0156 0.0976  -0.0233 429 GLU A O   
2881 C CB  . GLU A 214 ? 0.4948 0.1446 0.4188 0.0163  0.1046  0.0236  429 GLU A CB  
2882 C CG  . GLU A 214 ? 0.7490 0.4199 0.6930 0.0347  0.0936  0.0462  429 GLU A CG  
2883 C CD  . GLU A 214 ? 0.5727 0.2217 0.5034 0.0397  0.1053  0.0566  429 GLU A CD  
2884 O OE1 . GLU A 214 ? 0.5547 0.1712 0.4600 0.0244  0.1192  0.0465  429 GLU A OE1 
2885 O OE2 . GLU A 214 ? 0.7986 0.4629 0.7421 0.0580  0.1018  0.0741  429 GLU A OE2 
2892 N N   . VAL A 215 ? 0.4812 0.1824 0.3881 -0.0333 0.0952  -0.0213 430 VAL A N   
2893 C CA  . VAL A 215 ? 0.5234 0.2344 0.4097 -0.0616 0.1013  -0.0432 430 VAL A CA  
2894 C C   . VAL A 215 ? 0.5653 0.2179 0.4177 -0.0794 0.1242  -0.0473 430 VAL A C   
2895 O O   . VAL A 215 ? 0.5811 0.2068 0.4281 -0.0769 0.1289  -0.0354 430 VAL A O   
2896 C CB  . VAL A 215 ? 0.5741 0.3359 0.4683 -0.0737 0.0868  -0.0506 430 VAL A CB  
2897 C CG1 . VAL A 215 ? 0.5621 0.3386 0.4329 -0.1068 0.0947  -0.0716 430 VAL A CG1 
2898 C CG2 . VAL A 215 ? 0.5102 0.3211 0.4304 -0.0553 0.0678  -0.0479 430 VAL A CG2 
2908 N N   . SER A 216 ? 0.6460 0.2774 0.4726 -0.0984 0.1393  -0.0639 431 SER A N   
2909 C CA  . SER A 216 ? 0.7306 0.3019 0.5165 -0.1211 0.1634  -0.0713 431 SER A CA  
2910 C C   . SER A 216 ? 0.9165 0.5091 0.6831 -0.1601 0.1639  -0.0893 431 SER A C   
2911 O O   . SER A 216 ? 0.7507 0.4124 0.5361 -0.1678 0.1461  -0.0974 431 SER A O   
2912 C CB  . SER A 216 ? 0.8078 0.3562 0.5733 -0.1229 0.1787  -0.0794 431 SER A CB  
2913 O OG  . SER A 216 ? 0.8870 0.3934 0.6189 -0.1325 0.1979  -0.0789 431 SER A OG  
2919 N N   . THR A 217 ? 1.0678 0.6257 0.8024 -0.1756 0.1803  -0.0905 432 THR A N   
2920 C CA  . THR A 217 ? 1.0208 0.5985 0.7298 -0.2167 0.1848  -0.1087 432 THR A CA  
2921 C C   . THR A 217 ? 1.1889 0.7717 0.8724 -0.2414 0.1962  -0.1279 432 THR A C   
2922 O O   . THR A 217 ? 1.2363 0.7768 0.9047 -0.2296 0.2106  -0.1250 432 THR A O   
2923 C CB  . THR A 217 ? 1.0252 0.5620 0.7077 -0.2226 0.1979  -0.1008 432 THR A CB  
2924 O OG1 . THR A 217 ? 1.0596 0.5732 0.7620 -0.1877 0.1934  -0.0769 432 THR A OG1 
2925 C CG2 . THR A 217 ? 1.1817 0.7578 0.8559 -0.2569 0.1923  -0.1123 432 THR A CG2 
2933 N N   . SER A 218 ? 1.6772 1.3171 1.3558 -0.2754 0.1903  -0.1460 433 SER A N   
2934 C CA  . SER A 218 ? 1.6005 1.2684 1.2638 -0.2994 0.1960  -0.1633 433 SER A CA  
2935 C C   . SER A 218 ? 1.4353 1.0434 1.0553 -0.3122 0.2222  -0.1668 433 SER A C   
2936 O O   . SER A 218 ? 1.4186 1.0264 1.0309 -0.3167 0.2288  -0.1746 433 SER A O   
2937 C CB  . SER A 218 ? 1.4753 1.2224 1.1390 -0.3338 0.1869  -0.1770 433 SER A CB  
2938 O OG  . SER A 218 ? 1.5582 1.2944 1.2047 -0.3496 0.1924  -0.1741 433 SER A OG  
2944 N N   . GLU A 219 ? 1.2596 0.8188 0.8496 -0.3189 0.2372  -0.1618 434 GLU A N   
2945 C CA  . GLU A 219 ? 1.3955 0.8847 0.9404 -0.3244 0.2641  -0.1628 434 GLU A CA  
2946 C C   . GLU A 219 ? 1.3996 0.8459 0.9535 -0.2876 0.2701  -0.1518 434 GLU A C   
2947 O O   . GLU A 219 ? 1.3163 0.7355 0.8445 -0.2955 0.2868  -0.1591 434 GLU A O   
2948 C CB  . GLU A 219 ? 1.3446 0.7859 0.8633 -0.3251 0.2755  -0.1549 434 GLU A CB  
2949 C CG  . GLU A 219 ? 1.2729 0.7059 0.8264 -0.2866 0.2617  -0.1338 434 GLU A CG  
2950 C CD  . GLU A 219 ? 1.4259 0.8633 0.9734 -0.2987 0.2580  -0.1306 434 GLU A CD  
2951 O OE1 . GLU A 219 ? 1.4695 0.8711 0.9735 -0.3215 0.2758  -0.1367 434 GLU A OE1 
2952 O OE2 . GLU A 219 ? 1.2651 0.7408 0.8502 -0.2859 0.2377  -0.1219 434 GLU A OE2 
2959 N N   . ARG A 220 ? 1.0390 0.4817 0.6285 -0.2483 0.2571  -0.1331 435 ARG A N   
2960 C CA  . ARG A 220 ? 0.9740 0.3972 0.5836 -0.2098 0.2568  -0.1198 435 ARG A CA  
2961 C C   . ARG A 220 ? 1.0503 0.5280 0.6936 -0.2073 0.2380  -0.1268 435 ARG A C   
2962 O O   . ARG A 220 ? 1.1695 0.6871 0.8460 -0.1988 0.2177  -0.1228 435 ARG A O   
2963 C CB  . ARG A 220 ? 1.0389 0.4461 0.6733 -0.1708 0.2499  -0.0952 435 ARG A CB  
2964 C CG  . ARG A 220 ? 0.9735 0.3299 0.5796 -0.1658 0.2664  -0.0850 435 ARG A CG  
2965 C CD  . ARG A 220 ? 0.9557 0.3005 0.5881 -0.1199 0.2624  -0.0587 435 ARG A CD  
2966 N NE  . ARG A 220 ? 0.9657 0.2955 0.6004 -0.0956 0.2711  -0.0528 435 ARG A NE  
2967 C CZ  . ARG A 220 ? 0.9819 0.2904 0.6215 -0.0609 0.2784  -0.0328 435 ARG A CZ  
2968 N NH1 . ARG A 220 ? 0.9898 0.2890 0.6334 -0.0453 0.2778  -0.0163 435 ARG A NH1 
2969 N NH2 . ARG A 220 ? 0.9906 0.2911 0.6315 -0.0421 0.2861  -0.0291 435 ARG A NH2 
2983 N N   . GLY A 221 ? 0.9286 0.4077 0.5621 -0.2146 0.2450  -0.1375 436 GLY A N   
2984 C CA  . GLY A 221 ? 0.9585 0.4898 0.6211 -0.2118 0.2276  -0.1451 436 GLY A CA  
2985 C C   . GLY A 221 ? 0.9060 0.4332 0.6045 -0.1675 0.2165  -0.1264 436 GLY A C   
2986 O O   . GLY A 221 ? 0.8343 0.3298 0.5388 -0.1416 0.2197  -0.1067 436 GLY A O   
2990 N N   . ALA A 222 ? 0.7995 0.3637 0.5210 -0.1591 0.2034  -0.1318 437 ALA A N   
2991 C CA  . ALA A 222 ? 0.7601 0.3232 0.5139 -0.1187 0.1940  -0.1138 437 ALA A CA  
2992 C C   . ALA A 222 ? 0.7633 0.2829 0.5102 -0.0935 0.2092  -0.0979 437 ALA A C   
2993 O O   . ALA A 222 ? 0.8447 0.3346 0.5603 -0.1074 0.2274  -0.1060 437 ALA A O   
2994 C CB  . ALA A 222 ? 0.7264 0.3451 0.5024 -0.1141 0.1781  -0.1213 437 ALA A CB  
3000 N N   . GLN A 223 ? 0.7088 0.2304 0.4843 -0.0575 0.2012  -0.0749 438 GLN A N   
3001 C CA  . GLN A 223 ? 0.7350 0.2291 0.5073 -0.0321 0.2131  -0.0585 438 GLN A CA  
3002 C C   . GLN A 223 ? 0.6823 0.2090 0.4946 0.0001  0.1966  -0.0391 438 GLN A C   
3003 O O   . GLN A 223 ? 0.6362 0.1937 0.4741 0.0042  0.1782  -0.0338 438 GLN A O   
3004 C CB  . GLN A 223 ? 0.7783 0.2366 0.5313 -0.0289 0.2257  -0.0478 438 GLN A CB  
3005 C CG  . GLN A 223 ? 0.8238 0.2478 0.5620 -0.0067 0.2444  -0.0356 438 GLN A CG  
3006 C CD  . GLN A 223 ? 0.8757 0.2602 0.5897 -0.0025 0.2597  -0.0260 438 GLN A CD  
3007 O OE1 . GLN A 223 ? 0.8628 0.2543 0.5838 -0.0056 0.2514  -0.0207 438 GLN A OE1 
3008 N NE2 . GLN A 223 ? 0.9370 0.2788 0.6213 0.0051  0.2828  -0.0238 438 GLN A NE2 
3017 N N   . HIS A 224 ? 0.6909 0.2130 0.5073 0.0216  0.2031  -0.0287 439 HIS A N   
3018 C CA  . HIS A 224 ? 0.6448 0.2029 0.4976 0.0493  0.1876  -0.0089 439 HIS A CA  
3019 C C   . HIS A 224 ? 0.6715 0.2174 0.5225 0.0727  0.1987  0.0090  439 HIS A C   
3020 O O   . HIS A 224 ? 0.7265 0.2329 0.5473 0.0706  0.2200  0.0044  439 HIS A O   
3021 C CB  . HIS A 224 ? 0.6137 0.1976 0.4809 0.0513  0.1796  -0.0157 439 HIS A CB  
3022 C CG  . HIS A 224 ? 0.6523 0.2122 0.4956 0.0463  0.1974  -0.0276 439 HIS A CG  
3023 N ND1 . HIS A 224 ? 0.6611 0.2213 0.5094 0.0677  0.2041  -0.0156 439 HIS A ND1 
3024 C CD2 . HIS A 224 ? 0.6903 0.2251 0.5013 0.0202  0.2112  -0.0505 439 HIS A CD2 
3025 C CE1 . HIS A 224 ? 0.7021 0.2349 0.5228 0.0571  0.2213  -0.0304 439 HIS A CE1 
3026 N NE2 . HIS A 224 ? 0.7557 0.2736 0.5531 0.0269  0.2256  -0.0519 439 HIS A NE2 
3034 N N   . HIS A 225 ? 0.6374 0.2173 0.5179 0.0938  0.1855  0.0290  440 HIS A N   
3035 C CA  . HIS A 225 ? 0.6983 0.2776 0.5802 0.1174  0.1955  0.0457  440 HIS A CA  
3036 C C   . HIS A 225 ? 0.6315 0.2591 0.5461 0.1326  0.1800  0.0585  440 HIS A C   
3037 O O   . HIS A 225 ? 0.6072 0.2713 0.5473 0.1320  0.1599  0.0654  440 HIS A O   
3038 C CB  . HIS A 225 ? 0.7901 0.3567 0.6658 0.1273  0.2019  0.0597  440 HIS A CB  
3039 C CG  . HIS A 225 ? 0.9269 0.4376 0.7630 0.1158  0.2238  0.0494  440 HIS A CG  
3040 N ND1 . HIS A 225 ? 1.0030 0.4732 0.8082 0.1177  0.2473  0.0435  440 HIS A ND1 
3041 C CD2 . HIS A 225 ? 0.8335 0.3205 0.6528 0.0995  0.2265  0.0429  440 HIS A CD2 
3042 C CE1 . HIS A 225 ? 0.9614 0.3839 0.7309 0.1021  0.2639  0.0335  440 HIS A CE1 
3043 N NE2 . HIS A 225 ? 0.8960 0.3290 0.6739 0.0907  0.2515  0.0331  440 HIS A NE2 
3051 N N   . ILE A 226 ? 0.6296 0.2549 0.5402 0.1447  0.1909  0.0612  441 ILE A N   
3052 C CA  . ILE A 226 ? 0.5940 0.2620 0.5308 0.1573  0.1799  0.0720  441 ILE A CA  
3053 C C   . ILE A 226 ? 0.6062 0.2912 0.5513 0.1796  0.1853  0.0939  441 ILE A C   
3054 O O   . ILE A 226 ? 0.6560 0.3106 0.5799 0.1912  0.2053  0.0989  441 ILE A O   
3055 C CB  . ILE A 226 ? 0.6377 0.2968 0.5655 0.1568  0.1887  0.0616  441 ILE A CB  
3056 C CG1 . ILE A 226 ? 0.6831 0.3275 0.6005 0.1344  0.1854  0.0393  441 ILE A CG1 
3057 C CG2 . ILE A 226 ? 0.7626 0.4667 0.7168 0.1690  0.1778  0.0737  441 ILE A CG2 
3058 C CD1 . ILE A 226 ? 0.7255 0.3487 0.6235 0.1305  0.2000  0.0253  441 ILE A CD1 
3070 N N   . TYR A 227 ? 0.6189 0.3524 0.5928 0.1853  0.1686  0.1072  442 TYR A N   
3071 C CA  . TYR A 227 ? 0.5705 0.3310 0.5557 0.2042  0.1711  0.1292  442 TYR A CA  
3072 C C   . TYR A 227 ? 0.6502 0.4574 0.6583 0.2105  0.1618  0.1394  442 TYR A C   
3073 O O   . TYR A 227 ? 0.5648 0.3893 0.5857 0.1971  0.1461  0.1315  442 TYR A O   
3074 C CB  . TYR A 227 ? 0.5542 0.3293 0.5495 0.2000  0.1595  0.1367  442 TYR A CB  
3075 C CG  . TYR A 227 ? 0.7308 0.4616 0.7037 0.1926  0.1681  0.1277  442 TYR A CG  
3076 C CD1 . TYR A 227 ? 0.8315 0.5318 0.7832 0.2074  0.1894  0.1356  442 TYR A CD1 
3077 C CD2 . TYR A 227 ? 0.6288 0.3475 0.5997 0.1714  0.1566  0.1121  442 TYR A CD2 
3078 C CE1 . TYR A 227 ? 0.8462 0.5029 0.7742 0.1991  0.1989  0.1276  442 TYR A CE1 
3079 C CE2 . TYR A 227 ? 0.9054 0.5847 0.8544 0.1630  0.1657  0.1044  442 TYR A CE2 
3080 C CZ  . TYR A 227 ? 0.9356 0.5832 0.8629 0.1761  0.1868  0.1120  442 TYR A CZ  
3081 O OH  . TYR A 227 ? 0.8659 0.4714 0.7683 0.1665  0.1974  0.1046  442 TYR A OH  
3091 N N   . ARG A 228 ? 0.7444 0.5717 0.7558 0.2311  0.1725  0.1577  443 ARG A N   
3092 C CA  . ARG A 228 ? 0.7499 0.6307 0.7849 0.2371  0.1636  0.1721  443 ARG A CA  
3093 C C   . ARG A 228 ? 0.8053 0.7265 0.8610 0.2314  0.1470  0.1843  443 ARG A C   
3094 O O   . ARG A 228 ? 0.7100 0.6233 0.7613 0.2345  0.1493  0.1896  443 ARG A O   
3095 C CB  . ARG A 228 ? 0.8132 0.7053 0.8431 0.2623  0.1825  0.1890  443 ARG A CB  
3096 C CG  . ARG A 228 ? 0.8032 0.6910 0.8283 0.2663  0.1898  0.1830  443 ARG A CG  
3097 C CD  . ARG A 228 ? 0.9644 0.8579 0.9797 0.2934  0.2109  0.1995  443 ARG A CD  
3098 N NE  . ARG A 228 ? 1.1901 1.0300 1.1751 0.3054  0.2327  0.1972  443 ARG A NE  
3099 C CZ  . ARG A 228 ? 1.2057 1.0441 1.1843 0.3203  0.2421  0.2123  443 ARG A CZ  
3100 N NH1 . ARG A 228 ? 1.3429 1.2349 1.3445 0.3255  0.2314  0.2313  443 ARG A NH1 
3101 N NH2 . ARG A 228 ? 1.0405 0.8227 0.9874 0.3298  0.2635  0.2088  443 ARG A NH2 
3115 N N   . LEU A 229 ? 0.7411 0.7039 0.8177 0.2222  0.1309  0.1889  444 LEU A N   
3116 C CA  . LEU A 229 ? 0.6932 0.7014 0.7889 0.2172  0.1171  0.2039  444 LEU A CA  
3117 C C   . LEU A 229 ? 0.8658 0.9301 0.9760 0.2315  0.1216  0.2282  444 LEU A C   
3118 O O   . LEU A 229 ? 0.9025 0.9872 1.0188 0.2337  0.1226  0.2313  444 LEU A O   
3119 C CB  . LEU A 229 ? 0.7486 0.7672 0.8551 0.1951  0.0965  0.1952  444 LEU A CB  
3120 C CG  . LEU A 229 ? 0.6308 0.6107 0.7272 0.1788  0.0872  0.1756  444 LEU A CG  
3121 C CD1 . LEU A 229 ? 0.5717 0.5694 0.6785 0.1610  0.0681  0.1732  444 LEU A CD1 
3122 C CD2 . LEU A 229 ? 0.8111 0.7802 0.9022 0.1802  0.0884  0.1787  444 LEU A CD2 
3134 N N   . VAL A 230 ? 0.8763 0.9698 0.9922 0.2405  0.1239  0.2463  445 VAL A N   
3135 C CA  . VAL A 230 ? 0.7387 0.8939 0.8677 0.2545  0.1289  0.2719  445 VAL A CA  
3136 C C   . VAL A 230 ? 0.7836 0.9919 0.9296 0.2445  0.1155  0.2877  445 VAL A C   
3137 O O   . VAL A 230 ? 0.7479 0.9381 0.8930 0.2315  0.1053  0.2796  445 VAL A O   
3138 C CB  . VAL A 230 ? 0.8694 1.0117 0.9830 0.2835  0.1527  0.2831  445 VAL A CB  
3139 C CG1 . VAL A 230 ? 0.8557 0.9519 0.9516 0.2921  0.1665  0.2696  445 VAL A CG1 
3140 C CG2 . VAL A 230 ? 0.7543 0.8642 0.8557 0.2892  0.1588  0.2825  445 VAL A CG2 
3150 N N   . ARG A 231 ? 1.0581 1.3346 1.2181 0.2497  0.1158  0.3107  446 ARG A N   
3151 C CA  . ARG A 231 ? 1.0112 1.3474 1.1864 0.2380  0.1039  0.3275  446 ARG A CA  
3152 C C   . ARG A 231 ? 0.8057 1.2009 0.9850 0.2589  0.1168  0.3550  446 ARG A C   
3153 O O   . ARG A 231 ? 0.9551 1.3285 1.1215 0.2861  0.1366  0.3597  446 ARG A O   
3154 C CB  . ARG A 231 ? 1.0522 1.4259 1.2418 0.2090  0.0835  0.3267  446 ARG A CB  
3155 C CG  . ARG A 231 ? 1.0405 1.4564 1.2400 0.1871  0.0673  0.3356  446 ARG A CG  
3156 C CD  . ARG A 231 ? 0.9725 1.3933 1.1769 0.1548  0.0464  0.3265  446 ARG A CD  
3157 N NE  . ARG A 231 ? 0.9940 1.4553 1.2056 0.1464  0.0439  0.3342  446 ARG A NE  
3158 C CZ  . ARG A 231 ? 0.9555 1.4344 1.1704 0.1167  0.0267  0.3322  446 ARG A CZ  
3159 N NH1 . ARG A 231 ? 0.8684 1.3855 1.0885 0.1090  0.0256  0.3402  446 ARG A NH1 
3160 N NH2 . ARG A 231 ? 1.0222 1.4794 1.2318 0.0936  0.0105  0.3228  446 ARG A NH2 
3174 N N   . ALA B 5   ? 0.6735 0.9104 0.8330 0.2229  -0.1559 -0.0853 220 ALA B N   
3175 C CA  . ALA B 5   ? 0.6692 0.8525 0.8037 0.1987  -0.1558 -0.0726 220 ALA B CA  
3176 C C   . ALA B 5   ? 0.6687 0.7808 0.7893 0.2198  -0.1836 -0.0868 220 ALA B C   
3177 O O   . ALA B 5   ? 0.6127 0.7332 0.7400 0.2517  -0.1864 -0.1167 220 ALA B O   
3178 C CB  . ALA B 5   ? 0.4555 0.6812 0.5861 0.1765  -0.1194 -0.0739 220 ALA B CB  
3183 N N   . ARG B 6   ? 0.5885 0.6286 0.6810 0.1905  -0.1994 -0.0630 221 ARG B N   
3184 C CA  . ARG B 6   ? 0.6589 0.6187 0.7315 0.1990  -0.2324 -0.0674 221 ARG B CA  
3185 C C   . ARG B 6   ? 0.6744 0.6167 0.7257 0.1733  -0.2127 -0.0638 221 ARG B C   
3186 O O   . ARG B 6   ? 0.7645 0.6553 0.8025 0.1850  -0.2327 -0.0752 221 ARG B O   
3187 C CB  . ARG B 6   ? 0.7878 0.6791 0.8415 0.1784  -0.2729 -0.0376 221 ARG B CB  
3188 C CG  . ARG B 6   ? 0.8602 0.7414 0.9285 0.2048  -0.2999 -0.0459 221 ARG B CG  
3189 C CD  . ARG B 6   ? 0.8935 0.7848 0.9612 0.1785  -0.3057 -0.0143 221 ARG B CD  
3190 N NE  . ARG B 6   ? 0.9472 0.8458 1.0337 0.2041  -0.3202 -0.0260 221 ARG B NE  
3191 C CZ  . ARG B 6   ? 1.2496 1.0812 1.3256 0.2082  -0.3604 -0.0248 221 ARG B CZ  
3192 N NH1 . ARG B 6   ? 1.2634 1.0144 1.3086 0.1837  -0.3907 -0.0098 221 ARG B NH1 
3193 N NH2 . ARG B 6   ? 1.3070 1.1540 1.4032 0.2342  -0.3722 -0.0382 221 ARG B NH2 
3207 N N   . GLY B 7   ? 0.4722 0.4545 0.5200 0.1394  -0.1774 -0.0491 222 GLY B N   
3208 C CA  . GLY B 7   ? 0.4647 0.4348 0.4946 0.1139  -0.1599 -0.0447 222 GLY B CA  
3209 C C   . GLY B 7   ? 0.3794 0.4138 0.4207 0.1032  -0.1207 -0.0497 222 GLY B C   
3210 O O   . GLY B 7   ? 0.3469 0.4328 0.4071 0.1110  -0.1091 -0.0529 222 GLY B O   
3214 N N   . LEU B 8   ? 0.3586 0.3884 0.3881 0.0834  -0.1046 -0.0487 223 LEU B N   
3215 C CA  . LEU B 8   ? 0.3135 0.3932 0.3518 0.0719  -0.0758 -0.0523 223 LEU B CA  
3216 C C   . LEU B 8   ? 0.2961 0.3913 0.3317 0.0453  -0.0693 -0.0348 223 LEU B C   
3217 O O   . LEU B 8   ? 0.2709 0.3528 0.2928 0.0226  -0.0667 -0.0265 223 LEU B O   
3218 C CB  . LEU B 8   ? 0.3397 0.4081 0.3682 0.0636  -0.0645 -0.0600 223 LEU B CB  
3219 C CG  . LEU B 8   ? 0.3022 0.4189 0.3417 0.0622  -0.0433 -0.0694 223 LEU B CG  
3220 C CD1 . LEU B 8   ? 0.3765 0.4745 0.4048 0.0553  -0.0371 -0.0766 223 LEU B CD1 
3221 C CD2 . LEU B 8   ? 0.2492 0.3944 0.2942 0.0405  -0.0342 -0.0573 223 LEU B CD2 
3233 N N   . GLY B 9   ? 0.2374 0.3673 0.2869 0.0495  -0.0674 -0.0317 224 GLY B N   
3234 C CA  . GLY B 9   ? 0.2204 0.3641 0.2664 0.0284  -0.0650 -0.0184 224 GLY B CA  
3235 C C   . GLY B 9   ? 0.2193 0.3898 0.2795 0.0374  -0.0709 -0.0134 224 GLY B C   
3236 O O   . GLY B 9   ? 0.2337 0.4124 0.3075 0.0614  -0.0786 -0.0201 224 GLY B O   
3240 N N   . THR B 10  ? 0.2877 0.4759 0.3454 0.0197  -0.0681 -0.0043 225 THR B N   
3241 C CA  . THR B 10  ? 0.2520 0.4642 0.3200 0.0220  -0.0749 0.0040  225 THR B CA  
3242 C C   . THR B 10  ? 0.2707 0.4696 0.3221 0.0031  -0.0839 0.0177  225 THR B C   
3243 O O   . THR B 10  ? 0.2616 0.4430 0.2951 -0.0123 -0.0827 0.0196  225 THR B O   
3244 C CB  . THR B 10  ? 0.2708 0.5224 0.3495 0.0150  -0.0657 0.0022  225 THR B CB  
3245 O OG1 . THR B 10  ? 0.2412 0.4872 0.3065 -0.0053 -0.0630 0.0023  225 THR B OG1 
3246 C CG2 . THR B 10  ? 0.3007 0.5720 0.3893 0.0224  -0.0553 -0.0086 225 THR B CG2 
3254 N N   . ALA B 11  ? 0.2999 0.5140 0.3565 0.0024  -0.0930 0.0277  226 ALA B N   
3255 C CA  . ALA B 11  ? 0.3386 0.5491 0.3772 -0.0186 -0.1015 0.0412  226 ALA B CA  
3256 C C   . ALA B 11  ? 0.2793 0.5082 0.3054 -0.0368 -0.0890 0.0330  226 ALA B C   
3257 O O   . ALA B 11  ? 0.2856 0.5201 0.2932 -0.0550 -0.0917 0.0382  226 ALA B O   
3258 C CB  . ALA B 11  ? 0.3313 0.5575 0.3790 -0.0156 -0.1133 0.0521  226 ALA B CB  
3264 N N   . ARG B 12  ? 0.2734 0.5144 0.3095 -0.0317 -0.0784 0.0191  227 ARG B N   
3265 C CA  . ARG B 12  ? 0.2859 0.5391 0.3135 -0.0422 -0.0739 0.0061  227 ARG B CA  
3266 C C   . ARG B 12  ? 0.2567 0.5016 0.2772 -0.0445 -0.0651 -0.0070 227 ARG B C   
3267 O O   . ARG B 12  ? 0.2169 0.4732 0.2277 -0.0510 -0.0629 -0.0198 227 ARG B O   
3268 C CB  . ARG B 12  ? 0.3021 0.5605 0.3415 -0.0386 -0.0749 0.0007  227 ARG B CB  
3269 C CG  . ARG B 12  ? 0.3533 0.6116 0.3885 -0.0432 -0.0811 0.0042  227 ARG B CG  
3270 C CD  . ARG B 12  ? 0.2279 0.4742 0.2676 -0.0443 -0.0855 0.0002  227 ARG B CD  
3271 N NE  . ARG B 12  ? 0.2565 0.4857 0.2837 -0.0466 -0.0932 -0.0135 227 ARG B NE  
3272 C CZ  . ARG B 12  ? 0.3976 0.6038 0.4248 -0.0475 -0.1063 -0.0193 227 ARG B CZ  
3273 N NH1 . ARG B 12  ? 0.2955 0.4984 0.3323 -0.0515 -0.1092 -0.0097 227 ARG B NH1 
3274 N NH2 . ARG B 12  ? 0.3287 0.5164 0.3450 -0.0449 -0.1186 -0.0344 227 ARG B NH2 
3288 N N   . LEU B 13  ? 0.1849 0.4109 0.2114 -0.0360 -0.0601 -0.0067 228 LEU B N   
3289 C CA  . LEU B 13  ? 0.1690 0.3863 0.1903 -0.0384 -0.0527 -0.0177 228 LEU B CA  
3290 C C   . LEU B 13  ? 0.2052 0.3963 0.2268 -0.0314 -0.0521 -0.0117 228 LEU B C   
3291 O O   . LEU B 13  ? 0.1963 0.3820 0.2303 -0.0166 -0.0518 -0.0124 228 LEU B O   
3292 C CB  . LEU B 13  ? 0.1516 0.3710 0.1815 -0.0347 -0.0505 -0.0329 228 LEU B CB  
3293 C CG  . LEU B 13  ? 0.1472 0.3595 0.1734 -0.0362 -0.0451 -0.0465 228 LEU B CG  
3294 C CD1 . LEU B 13  ? 0.1532 0.3816 0.1706 -0.0407 -0.0445 -0.0576 228 LEU B CD1 
3295 C CD2 . LEU B 13  ? 0.1383 0.3402 0.1735 -0.0324 -0.0475 -0.0552 228 LEU B CD2 
3307 N N   . GLN B 14  ? 0.1947 0.3744 0.2022 -0.0424 -0.0535 -0.0075 229 GLN B N   
3308 C CA  . GLN B 14  ? 0.2247 0.3701 0.2283 -0.0374 -0.0584 -0.0029 229 GLN B CA  
3309 C C   . GLN B 14  ? 0.2426 0.3837 0.2413 -0.0439 -0.0501 -0.0121 229 GLN B C   
3310 O O   . GLN B 14  ? 0.1989 0.3650 0.1910 -0.0590 -0.0449 -0.0163 229 GLN B O   
3311 C CB  . GLN B 14  ? 0.2590 0.3823 0.2466 -0.0499 -0.0769 0.0173  229 GLN B CB  
3312 C CG  . GLN B 14  ? 0.3103 0.4335 0.3018 -0.0445 -0.0897 0.0283  229 GLN B CG  
3313 C CD  . GLN B 14  ? 0.5867 0.7457 0.5695 -0.0645 -0.0876 0.0355  229 GLN B CD  
3314 O OE1 . GLN B 14  ? 0.5056 0.6839 0.4716 -0.0885 -0.0859 0.0404  229 GLN B OE1 
3315 N NE2 . GLN B 14  ? 0.4981 0.6733 0.4920 -0.0554 -0.0883 0.0351  229 GLN B NE2 
3324 N N   . LEU B 15  ? 0.2629 0.3776 0.2654 -0.0309 -0.0499 -0.0173 230 LEU B N   
3325 C CA  . LEU B 15  ? 0.2986 0.3990 0.2940 -0.0374 -0.0466 -0.0219 230 LEU B CA  
3326 C C   . LEU B 15  ? 0.3608 0.4409 0.3374 -0.0560 -0.0607 -0.0051 230 LEU B C   
3327 O O   . LEU B 15  ? 0.4062 0.4533 0.3756 -0.0525 -0.0788 0.0065  230 LEU B O   
3328 C CB  . LEU B 15  ? 0.3145 0.3931 0.3160 -0.0189 -0.0445 -0.0322 230 LEU B CB  
3329 C CG  . LEU B 15  ? 0.3519 0.4148 0.3470 -0.0246 -0.0406 -0.0385 230 LEU B CG  
3330 C CD1 . LEU B 15  ? 0.2978 0.3891 0.2999 -0.0331 -0.0292 -0.0478 230 LEU B CD1 
3331 C CD2 . LEU B 15  ? 0.5699 0.6148 0.5678 -0.0059 -0.0399 -0.0494 230 LEU B CD2 
3343 N N   . VAL B 16  ? 0.2854 0.3876 0.2535 -0.0774 -0.0562 -0.0031 231 VAL B N   
3344 C CA  . VAL B 16  ? 0.3007 0.3893 0.2483 -0.1031 -0.0719 0.0177  231 VAL B CA  
3345 C C   . VAL B 16  ? 0.3121 0.3658 0.2550 -0.1020 -0.0757 0.0152  231 VAL B C   
3346 O O   . VAL B 16  ? 0.3777 0.3836 0.3051 -0.1089 -0.0979 0.0299  231 VAL B O   
3347 C CB  . VAL B 16  ? 0.2750 0.4238 0.2148 -0.1311 -0.0653 0.0226  231 VAL B CB  
3348 C CG1 . VAL B 16  ? 0.3315 0.4790 0.2503 -0.1649 -0.0792 0.0447  231 VAL B CG1 
3349 C CG2 . VAL B 16  ? 0.3074 0.4799 0.2441 -0.1366 -0.0689 0.0307  231 VAL B CG2 
3359 N N   . GLU B 17  ? 0.3222 0.3968 0.2770 -0.0947 -0.0578 -0.0035 232 GLU B N   
3360 C CA  . GLU B 17  ? 0.3059 0.3551 0.2557 -0.0973 -0.0599 -0.0059 232 GLU B CA  
3361 C C   . GLU B 17  ? 0.3123 0.3711 0.2783 -0.0799 -0.0433 -0.0283 232 GLU B C   
3362 O O   . GLU B 17  ? 0.3012 0.3970 0.2810 -0.0752 -0.0318 -0.0413 232 GLU B O   
3363 C CB  . GLU B 17  ? 0.3540 0.4274 0.2900 -0.1307 -0.0650 0.0087  232 GLU B CB  
3364 C CG  . GLU B 17  ? 0.7143 0.7352 0.6345 -0.1401 -0.0822 0.0197  232 GLU B CG  
3365 C CD  . GLU B 17  ? 0.8699 0.9007 0.7686 -0.1812 -0.0999 0.0476  232 GLU B CD  
3366 O OE1 . GLU B 17  ? 0.9577 0.9991 0.8442 -0.2011 -0.1130 0.0682  232 GLU B OE1 
3367 O OE2 . GLU B 17  ? 0.7531 0.7827 0.6460 -0.1965 -0.1022 0.0508  232 GLU B OE2 
3374 N N   . PHE B 18  ? 0.2991 0.3199 0.2615 -0.0708 -0.0466 -0.0329 233 PHE B N   
3375 C CA  . PHE B 18  ? 0.2692 0.2957 0.2426 -0.0606 -0.0349 -0.0497 233 PHE B CA  
3376 C C   . PHE B 18  ? 0.2825 0.2765 0.2448 -0.0656 -0.0405 -0.0496 233 PHE B C   
3377 O O   . PHE B 18  ? 0.3207 0.2730 0.2687 -0.0623 -0.0545 -0.0436 233 PHE B O   
3378 C CB  . PHE B 18  ? 0.2425 0.2671 0.2255 -0.0392 -0.0297 -0.0594 233 PHE B CB  
3379 C CG  . PHE B 18  ? 0.2467 0.2754 0.2362 -0.0355 -0.0225 -0.0710 233 PHE B CG  
3380 C CD1 . PHE B 18  ? 0.2451 0.2991 0.2464 -0.0404 -0.0188 -0.0775 233 PHE B CD1 
3381 C CD2 . PHE B 18  ? 0.3724 0.3780 0.3545 -0.0276 -0.0234 -0.0766 233 PHE B CD2 
3382 C CE1 . PHE B 18  ? 0.2936 0.3450 0.2990 -0.0407 -0.0185 -0.0848 233 PHE B CE1 
3383 C CE2 . PHE B 18  ? 0.3712 0.3837 0.3566 -0.0290 -0.0182 -0.0845 233 PHE B CE2 
3384 C CZ  . PHE B 18  ? 0.3940 0.4269 0.3907 -0.0376 -0.0171 -0.0862 233 PHE B CZ  
3394 N N   . SER B 19  ? 0.2951 0.3049 0.2638 -0.0720 -0.0335 -0.0574 234 SER B N   
3395 C CA  . SER B 19  ? 0.2770 0.2563 0.2353 -0.0769 -0.0388 -0.0577 234 SER B CA  
3396 C C   . SER B 19  ? 0.2432 0.2384 0.2136 -0.0756 -0.0307 -0.0706 234 SER B C   
3397 O O   . SER B 19  ? 0.2082 0.2386 0.1944 -0.0746 -0.0255 -0.0767 234 SER B O   
3398 C CB  . SER B 19  ? 0.3772 0.3524 0.3218 -0.1017 -0.0503 -0.0410 234 SER B CB  
3399 O OG  . SER B 19  ? 0.3429 0.3746 0.2998 -0.1150 -0.0419 -0.0426 234 SER B OG  
3405 N N   . ALA B 20  ? 0.2563 0.2215 0.2183 -0.0729 -0.0332 -0.0744 235 ALA B N   
3406 C CA  . ALA B 20  ? 0.2182 0.1892 0.1903 -0.0683 -0.0305 -0.0752 235 ALA B CA  
3407 C C   . ALA B 20  ? 0.2280 0.1807 0.1919 -0.0784 -0.0369 -0.0691 235 ALA B C   
3408 O O   . ALA B 20  ? 0.2576 0.1765 0.2042 -0.0804 -0.0440 -0.0669 235 ALA B O   
3409 C CB  . ALA B 20  ? 0.2147 0.1760 0.1847 -0.0561 -0.0277 -0.0795 235 ALA B CB  
3415 N N   . PHE B 21  ? 0.2169 0.1897 0.1919 -0.0828 -0.0363 -0.0665 236 PHE B N   
3416 C CA  . PHE B 21  ? 0.2365 0.2020 0.2038 -0.0972 -0.0415 -0.0582 236 PHE B CA  
3417 C C   . PHE B 21  ? 0.2245 0.2036 0.2053 -0.0945 -0.0413 -0.0605 236 PHE B C   
3418 O O   . PHE B 21  ? 0.2337 0.2268 0.2282 -0.0827 -0.0405 -0.0668 236 PHE B O   
3419 C CB  . PHE B 21  ? 0.2495 0.2405 0.2098 -0.1190 -0.0446 -0.0464 236 PHE B CB  
3420 C CG  . PHE B 21  ? 0.2242 0.2739 0.2032 -0.1184 -0.0361 -0.0534 236 PHE B CG  
3421 C CD1 . PHE B 21  ? 0.2191 0.3056 0.2092 -0.1227 -0.0338 -0.0558 236 PHE B CD1 
3422 C CD2 . PHE B 21  ? 0.2422 0.3124 0.2280 -0.1104 -0.0308 -0.0603 236 PHE B CD2 
3423 C CE1 . PHE B 21  ? 0.2525 0.3969 0.2598 -0.1160 -0.0263 -0.0681 236 PHE B CE1 
3424 C CE2 . PHE B 21  ? 0.1915 0.3155 0.1936 -0.1045 -0.0236 -0.0703 236 PHE B CE2 
3425 C CZ  . PHE B 21  ? 0.1983 0.3602 0.2108 -0.1061 -0.0213 -0.0759 236 PHE B CZ  
3435 N N   . VAL B 22  ? 0.3097 0.2777 0.2817 -0.1065 -0.0457 -0.0526 237 VAL B N   
3436 C CA  . VAL B 22  ? 0.2827 0.2683 0.2671 -0.1078 -0.0469 -0.0543 237 VAL B CA  
3437 C C   . VAL B 22  ? 0.3188 0.3256 0.2943 -0.1318 -0.0503 -0.0417 237 VAL B C   
3438 O O   . VAL B 22  ? 0.3376 0.3188 0.2901 -0.1467 -0.0574 -0.0264 237 VAL B O   
3439 C CB  . VAL B 22  ? 0.2876 0.2453 0.2730 -0.0972 -0.0481 -0.0570 237 VAL B CB  
3440 C CG1 . VAL B 22  ? 0.3538 0.2758 0.3154 -0.1035 -0.0510 -0.0494 237 VAL B CG1 
3441 C CG2 . VAL B 22  ? 0.2822 0.2572 0.2821 -0.0988 -0.0521 -0.0590 237 VAL B CG2 
3451 N N   . GLU B 23  ? 0.2463 0.3016 0.2391 -0.1344 -0.0479 -0.0475 238 GLU B N   
3452 C CA  . GLU B 23  ? 0.2803 0.3716 0.2673 -0.1573 -0.0496 -0.0353 238 GLU B CA  
3453 C C   . GLU B 23  ? 0.2713 0.3586 0.2673 -0.1554 -0.0540 -0.0384 238 GLU B C   
3454 O O   . GLU B 23  ? 0.3101 0.4064 0.3283 -0.1372 -0.0547 -0.0548 238 GLU B O   
3455 C CB  . GLU B 23  ? 0.2973 0.4643 0.2983 -0.1600 -0.0410 -0.0429 238 GLU B CB  
3456 C CG  . GLU B 23  ? 0.3133 0.4920 0.3036 -0.1659 -0.0368 -0.0368 238 GLU B CG  
3457 C CD  . GLU B 23  ? 0.2676 0.5215 0.2741 -0.1576 -0.0254 -0.0529 238 GLU B CD  
3458 O OE1 . GLU B 23  ? 0.3376 0.6291 0.3656 -0.1420 -0.0220 -0.0731 238 GLU B OE1 
3459 O OE2 . GLU B 23  ? 0.2908 0.5659 0.2872 -0.1651 -0.0211 -0.0467 238 GLU B OE2 
3466 N N   . PRO B 24  ? 0.2801 0.5366 0.3617 -0.1495 -0.0785 -0.0880 239 PRO B N   
3467 C CA  . PRO B 24  ? 0.2884 0.5878 0.3835 -0.1484 -0.0889 -0.0883 239 PRO B CA  
3468 C C   . PRO B 24  ? 0.2820 0.6472 0.4092 -0.1373 -0.0902 -0.0849 239 PRO B C   
3469 O O   . PRO B 24  ? 0.3486 0.7311 0.4882 -0.1368 -0.0798 -0.0848 239 PRO B O   
3470 C CB  . PRO B 24  ? 0.3166 0.6059 0.4098 -0.1755 -0.0848 -0.0943 239 PRO B CB  
3471 C CG  . PRO B 24  ? 0.3751 0.6421 0.4698 -0.1909 -0.0698 -0.0916 239 PRO B CG  
3472 C CD  . PRO B 24  ? 0.3541 0.5790 0.4288 -0.1745 -0.0677 -0.0891 239 PRO B CD  
3480 N N   . PRO B 25  ? 0.3109 0.7161 0.4521 -0.1268 -0.1024 -0.0819 240 PRO B N   
3481 C CA  . PRO B 25  ? 0.2882 0.7573 0.4643 -0.1128 -0.1033 -0.0787 240 PRO B CA  
3482 C C   . PRO B 25  ? 0.3320 0.8350 0.5269 -0.1342 -0.0898 -0.0819 240 PRO B C   
3483 O O   . PRO B 25  ? 0.4226 0.9671 0.6414 -0.1216 -0.0817 -0.0812 240 PRO B O   
3484 C CB  . PRO B 25  ? 0.2923 0.7903 0.4745 -0.1066 -0.1193 -0.0739 240 PRO B CB  
3485 C CG  . PRO B 25  ? 0.3667 0.8189 0.5165 -0.1064 -0.1276 -0.0724 240 PRO B CG  
3486 C CD  . PRO B 25  ? 0.3968 0.7933 0.5219 -0.1271 -0.1153 -0.0811 240 PRO B CD  
3494 N N   . ASP B 26  ? 0.5327 1.0189 0.7188 -0.1650 -0.0865 -0.0855 241 ASP B N   
3495 C CA  . ASP B 26  ? 0.7002 1.2170 0.9064 -0.1884 -0.0741 -0.0852 241 ASP B CA  
3496 C C   . ASP B 26  ? 0.7224 1.2122 0.9196 -0.2005 -0.0566 -0.0812 241 ASP B C   
3497 O O   . ASP B 26  ? 0.7078 1.2066 0.9151 -0.2256 -0.0449 -0.0770 241 ASP B O   
3498 C CB  . ASP B 26  ? 0.6953 1.2061 0.9020 -0.2166 -0.0793 -0.0911 241 ASP B CB  
3499 C CG  . ASP B 26  ? 0.8076 1.2458 0.9849 -0.2320 -0.0784 -0.0968 241 ASP B CG  
3500 O OD1 . ASP B 26  ? 0.9476 1.3762 1.1241 -0.2504 -0.0845 -0.1058 241 ASP B OD1 
3501 O OD2 . ASP B 26  ? 0.7777 1.1700 0.9346 -0.2245 -0.0719 -0.0937 241 ASP B OD2 
3506 N N   . ALA B 27  ? 0.5654 1.0240 0.7448 -0.1831 -0.0551 -0.0809 242 ALA B N   
3507 C CA  . ALA B 27  ? 0.4356 0.8703 0.6032 -0.1935 -0.0402 -0.0760 242 ALA B CA  
3508 C C   . ALA B 27  ? 0.3714 0.8698 0.5624 -0.1922 -0.0250 -0.0709 242 ALA B C   
3509 O O   . ALA B 27  ? 0.4148 0.9086 0.5990 -0.2075 -0.0093 -0.0619 242 ALA B O   
3510 C CB  . ALA B 27  ? 0.3311 0.7248 0.4766 -0.1729 -0.0444 -0.0792 242 ALA B CB  
3516 N N   . VAL B 28  ? 0.4335 0.9910 0.6507 -0.1717 -0.0287 -0.0752 243 VAL B N   
3517 C CA  . VAL B 28  ? 0.4054 1.0291 0.6465 -0.1643 -0.0136 -0.0733 243 VAL B CA  
3518 C C   . VAL B 28  ? 0.4563 1.1039 0.7105 -0.1976 -0.0032 -0.0637 243 VAL B C   
3519 O O   . VAL B 28  ? 0.4117 1.1030 0.6768 -0.2010 0.0144  -0.0573 243 VAL B O   
3520 C CB  . VAL B 28  ? 0.3882 1.0598 0.6557 -0.1286 -0.0219 -0.0813 243 VAL B CB  
3521 C CG1 . VAL B 28  ? 0.3547 1.0009 0.6144 -0.0932 -0.0302 -0.0898 243 VAL B CG1 
3522 C CG2 . VAL B 28  ? 0.5556 1.2346 0.8351 -0.1349 -0.0386 -0.0801 243 VAL B CG2 
3532 N N   . ASP B 29  ? 0.5043 1.1231 0.7571 -0.2211 -0.0138 -0.0637 244 ASP B N   
3533 C CA  . ASP B 29  ? 0.7088 1.3395 0.9768 -0.2551 -0.0057 -0.0560 244 ASP B CA  
3534 C C   . ASP B 29  ? 0.7398 1.3122 0.9872 -0.2807 0.0057  -0.0443 244 ASP B C   
3535 O O   . ASP B 29  ? 0.8190 1.4084 1.0708 -0.2941 0.0237  -0.0292 244 ASP B O   
3536 C CB  . ASP B 29  ? 0.7165 1.3445 0.9958 -0.2679 -0.0225 -0.0646 244 ASP B CB  
3537 C CG  . ASP B 29  ? 0.6691 1.3496 0.9668 -0.2417 -0.0362 -0.0721 244 ASP B CG  
3538 O OD1 . ASP B 29  ? 0.5935 1.3291 0.9108 -0.2206 -0.0291 -0.0701 244 ASP B OD1 
3539 O OD2 . ASP B 29  ? 0.7646 1.4310 1.0569 -0.2408 -0.0539 -0.0796 244 ASP B OD2 
3544 N N   . SER B 30  ? 0.5023 1.0051 0.7268 -0.2853 -0.0048 -0.0498 245 SER B N   
3545 C CA  . SER B 30  ? 0.5107 0.9482 0.7142 -0.3017 0.0037  -0.0390 245 SER B CA  
3546 C C   . SER B 30  ? 0.5548 0.9479 0.7284 -0.2799 -0.0031 -0.0451 245 SER B C   
3547 O O   . SER B 30  ? 0.5840 0.9616 0.7495 -0.2644 -0.0185 -0.0592 245 SER B O   
3548 C CB  . SER B 30  ? 0.5313 0.9217 0.7410 -0.3277 -0.0013 -0.0418 245 SER B CB  
3549 O OG  . SER B 30  ? 0.7622 1.1032 0.9652 -0.3454 0.0113  -0.0248 245 SER B OG  
3555 N N   . TYR B 31  ? 0.4666 0.8433 0.6234 -0.2781 0.0086  -0.0329 246 TYR B N   
3556 C CA  . TYR B 31  ? 0.4130 0.7574 0.5462 -0.2575 0.0021  -0.0394 246 TYR B CA  
3557 C C   . TYR B 31  ? 0.4566 0.7154 0.5668 -0.2631 -0.0049 -0.0414 246 TYR B C   
3558 O O   . TYR B 31  ? 0.4294 0.6450 0.5353 -0.2816 0.0025  -0.0292 246 TYR B O   
3559 C CB  . TYR B 31  ? 0.4272 0.7728 0.5404 -0.2374 0.0156  -0.0263 246 TYR B CB  
3560 C CG  . TYR B 31  ? 0.3418 0.6398 0.4267 -0.2045 0.0066  -0.0345 246 TYR B CG  
3561 C CD1 . TYR B 31  ? 0.3130 0.6336 0.4026 -0.1732 -0.0025 -0.0501 246 TYR B CD1 
3562 C CD2 . TYR B 31  ? 0.3498 0.5795 0.4085 -0.2057 0.0062  -0.0262 246 TYR B CD2 
3563 C CE1 . TYR B 31  ? 0.2991 0.5747 0.3675 -0.1467 -0.0109 -0.0569 246 TYR B CE1 
3564 C CE2 . TYR B 31  ? 0.3478 0.5387 0.3854 -0.1779 -0.0024 -0.0341 246 TYR B CE2 
3565 C CZ  . TYR B 31  ? 0.3021 0.5160 0.3449 -0.1506 -0.0107 -0.0494 246 TYR B CZ  
3566 O OH  . TYR B 31  ? 0.3038 0.4776 0.3296 -0.1272 -0.0188 -0.0560 246 TYR B OH  
3576 N N   . GLN B 32  ? 0.4700 0.7040 0.5666 -0.2427 -0.0186 -0.0558 247 GLN B N   
3577 C CA  . GLN B 32  ? 0.4007 0.5601 0.4749 -0.2399 -0.0226 -0.0585 247 GLN B CA  
3578 C C   . GLN B 32  ? 0.3765 0.5238 0.4339 -0.2130 -0.0321 -0.0673 247 GLN B C   
3579 O O   . GLN B 32  ? 0.3477 0.5367 0.4133 -0.1935 -0.0382 -0.0722 247 GLN B O   
3580 C CB  . GLN B 32  ? 0.4360 0.5757 0.5171 -0.2487 -0.0291 -0.0684 247 GLN B CB  
3581 C CG  . GLN B 32  ? 0.4641 0.6436 0.5522 -0.2381 -0.0418 -0.0812 247 GLN B CG  
3582 C CD  . GLN B 32  ? 0.6627 0.8361 0.7594 -0.2527 -0.0479 -0.0918 247 GLN B CD  
3583 O OE1 . GLN B 32  ? 0.8502 0.9729 0.9370 -0.2554 -0.0487 -0.0982 247 GLN B OE1 
3584 N NE2 . GLN B 32  ? 0.6115 0.8402 0.7293 -0.2613 -0.0527 -0.0952 247 GLN B NE2 
3593 N N   . ARG B 33  ? 0.3960 0.4829 0.4322 -0.2054 -0.0323 -0.0664 248 ARG B N   
3594 C CA  . ARG B 33  ? 0.4521 0.5210 0.4739 -0.1788 -0.0407 -0.0730 248 ARG B CA  
3595 C C   . ARG B 33  ? 0.4113 0.4232 0.4208 -0.1747 -0.0412 -0.0756 248 ARG B C   
3596 O O   . ARG B 33  ? 0.4229 0.4008 0.4319 -0.1855 -0.0343 -0.0700 248 ARG B O   
3597 C CB  . ARG B 33  ? 0.4005 0.4665 0.4126 -0.1529 -0.0367 -0.0647 248 ARG B CB  
3598 C CG  . ARG B 33  ? 0.4983 0.5144 0.4922 -0.1492 -0.0316 -0.0551 248 ARG B CG  
3599 C CD  . ARG B 33  ? 0.4320 0.4505 0.4155 -0.1219 -0.0324 -0.0533 248 ARG B CD  
3600 N NE  . ARG B 33  ? 0.5247 0.5935 0.5141 -0.1147 -0.0270 -0.0522 248 ARG B NE  
3601 C CZ  . ARG B 33  ? 0.6450 0.7244 0.6259 -0.0937 -0.0264 -0.0549 248 ARG B CZ  
3602 N NH1 . ARG B 33  ? 0.7169 0.7609 0.6848 -0.0792 -0.0325 -0.0572 248 ARG B NH1 
3603 N NH2 . ARG B 33  ? 0.7952 0.9251 0.7821 -0.0874 -0.0197 -0.0580 248 ARG B NH2 
3617 N N   . HIS B 34  ? 0.3287 0.3370 0.3328 -0.1582 -0.0491 -0.0831 249 HIS B N   
3618 C CA  . HIS B 34  ? 0.3745 0.3428 0.3696 -0.1491 -0.0490 -0.0871 249 HIS B CA  
3619 C C   . HIS B 34  ? 0.3111 0.2565 0.2961 -0.1289 -0.0489 -0.0830 249 HIS B C   
3620 O O   . HIS B 34  ? 0.3437 0.3072 0.3270 -0.1179 -0.0546 -0.0825 249 HIS B O   
3621 C CB  . HIS B 34  ? 0.3320 0.3182 0.3252 -0.1470 -0.0568 -0.0966 249 HIS B CB  
3622 C CG  . HIS B 34  ? 0.3921 0.3488 0.3742 -0.1366 -0.0567 -0.1024 249 HIS B CG  
3623 N ND1 . HIS B 34  ? 0.3842 0.3163 0.3672 -0.1439 -0.0541 -0.1108 249 HIS B ND1 
3624 C CD2 . HIS B 34  ? 0.3661 0.3156 0.3379 -0.1204 -0.0585 -0.1015 249 HIS B CD2 
3625 C CE1 . HIS B 34  ? 0.3869 0.3020 0.3589 -0.1319 -0.0541 -0.1161 249 HIS B CE1 
3626 N NE2 . HIS B 34  ? 0.3546 0.2811 0.3199 -0.1187 -0.0558 -0.1096 249 HIS B NE2 
3634 N N   . LEU B 35  ? 0.3205 0.2289 0.3031 -0.1234 -0.0436 -0.0805 250 LEU B N   
3635 C CA  . LEU B 35  ? 0.3048 0.1966 0.2828 -0.1048 -0.0429 -0.0768 250 LEU B CA  
3636 C C   . LEU B 35  ? 0.3001 0.1856 0.2794 -0.0924 -0.0437 -0.0833 250 LEU B C   
3637 O O   . LEU B 35  ? 0.3178 0.1860 0.3001 -0.0939 -0.0415 -0.0881 250 LEU B O   
3638 C CB  . LEU B 35  ? 0.3469 0.2089 0.3228 -0.1057 -0.0368 -0.0678 250 LEU B CB  
3639 C CG  . LEU B 35  ? 0.4405 0.3028 0.4080 -0.1228 -0.0349 -0.0575 250 LEU B CG  
3640 C CD1 . LEU B 35  ? 0.5025 0.3270 0.4682 -0.1271 -0.0292 -0.0446 250 LEU B CD1 
3641 C CD2 . LEU B 35  ? 0.3966 0.2782 0.3555 -0.1112 -0.0397 -0.0551 250 LEU B CD2 
3653 N N   . PHE B 36  ? 0.2811 0.1799 0.2580 -0.0822 -0.0469 -0.0836 251 PHE B N   
3654 C CA  . PHE B 36  ? 0.2800 0.1750 0.2543 -0.0749 -0.0458 -0.0879 251 PHE B CA  
3655 C C   . PHE B 36  ? 0.2770 0.1525 0.2594 -0.0657 -0.0366 -0.0857 251 PHE B C   
3656 O O   . PHE B 36  ? 0.2909 0.1543 0.2739 -0.0630 -0.0358 -0.0904 251 PHE B O   
3657 C CB  . PHE B 36  ? 0.2810 0.1915 0.2490 -0.0715 -0.0503 -0.0849 251 PHE B CB  
3658 C CG  . PHE B 36  ? 0.2726 0.2088 0.2346 -0.0798 -0.0612 -0.0862 251 PHE B CG  
3659 C CD1 . PHE B 36  ? 0.3078 0.2567 0.2596 -0.0888 -0.0642 -0.0927 251 PHE B CD1 
3660 C CD2 . PHE B 36  ? 0.2758 0.2279 0.2431 -0.0784 -0.0689 -0.0811 251 PHE B CD2 
3661 C CE1 . PHE B 36  ? 0.2947 0.2781 0.2445 -0.0963 -0.0734 -0.0926 251 PHE B CE1 
3662 C CE2 . PHE B 36  ? 0.2656 0.2522 0.2337 -0.0851 -0.0796 -0.0810 251 PHE B CE2 
3663 C CZ  . PHE B 36  ? 0.3250 0.3300 0.2855 -0.0936 -0.0811 -0.0856 251 PHE B CZ  
3673 N N   . VAL B 37  ? 0.2857 0.1574 0.2674 -0.0611 -0.0324 -0.0771 252 VAL B N   
3674 C CA  . VAL B 37  ? 0.3030 0.1571 0.2859 -0.0538 -0.0260 -0.0713 252 VAL B CA  
3675 C C   . VAL B 37  ? 0.3413 0.1875 0.3190 -0.0528 -0.0314 -0.0628 252 VAL B C   
3676 O O   . VAL B 37  ? 0.3605 0.2180 0.3331 -0.0562 -0.0385 -0.0627 252 VAL B O   
3677 C CB  . VAL B 37  ? 0.3033 0.1584 0.2836 -0.0450 -0.0255 -0.0671 252 VAL B CB  
3678 C CG1 . VAL B 37  ? 0.2839 0.1407 0.2631 -0.0477 -0.0223 -0.0749 252 VAL B CG1 
3679 C CG2 . VAL B 37  ? 0.3483 0.2151 0.3281 -0.0404 -0.0347 -0.0621 252 VAL B CG2 
3689 N N   . HIS B 38  ? 0.3553 0.1817 0.3326 -0.0477 -0.0304 -0.0566 253 HIS B N   
3690 C CA  . HIS B 38  ? 0.4281 0.2389 0.3952 -0.0490 -0.0389 -0.0474 253 HIS B CA  
3691 C C   . HIS B 38  ? 0.4087 0.1990 0.3763 -0.0379 -0.0423 -0.0387 253 HIS B C   
3692 O O   . HIS B 38  ? 0.4076 0.1847 0.3845 -0.0349 -0.0339 -0.0379 253 HIS B O   
3693 C CB  . HIS B 38  ? 0.5228 0.3199 0.4859 -0.0658 -0.0361 -0.0436 253 HIS B CB  
3694 C CG  . HIS B 38  ? 0.5975 0.3774 0.5434 -0.0740 -0.0419 -0.0281 253 HIS B CG  
3695 N ND1 . HIS B 38  ? 0.6960 0.5127 0.6349 -0.0689 -0.0448 -0.0257 253 HIS B ND1 
3696 C CD2 . HIS B 38  ? 0.6012 0.3588 0.5458 -0.0796 -0.0376 -0.0101 253 HIS B CD2 
3697 C CE1 . HIS B 38  ? 0.5882 0.4105 0.5181 -0.0717 -0.0418 -0.0075 253 HIS B CE1 
3698 N NE2 . HIS B 38  ? 0.6926 0.4779 0.6263 -0.0788 -0.0376 0.0055  253 HIS B NE2 
3706 N N   . ILE B 39  ? 0.3680 0.1569 0.3267 -0.0309 -0.0561 -0.0352 254 ILE B N   
3707 C CA  . ILE B 39  ? 0.4060 0.1822 0.3637 -0.0197 -0.0637 -0.0235 254 ILE B CA  
3708 C C   . ILE B 39  ? 0.3944 0.1915 0.3352 -0.0207 -0.0660 -0.0094 254 ILE B C   
3709 O O   . ILE B 39  ? 0.4203 0.2478 0.3536 -0.0197 -0.0694 -0.0177 254 ILE B O   
3710 C CB  . ILE B 39  ? 0.3586 0.1481 0.3284 -0.0064 -0.0726 -0.0323 254 ILE B CB  
3711 C CG1 . ILE B 39  ? 0.3240 0.1291 0.3107 -0.0066 -0.0586 -0.0391 254 ILE B CG1 
3712 C CG2 . ILE B 39  ? 0.4030 0.1916 0.3770 0.0067  -0.0797 -0.0192 254 ILE B CG2 
3713 C CD1 . ILE B 39  ? 0.3889 0.2140 0.3897 0.0007  -0.0645 -0.0446 254 ILE B CD1 
3725 N N   . SER B 40  ? 0.4378 0.2196 0.3733 -0.0212 -0.0637 0.0122  255 SER B N   
3726 C CA  . SER B 40  ? 0.5141 0.3205 0.4312 -0.0185 -0.0669 0.0312  255 SER B CA  
3727 C C   . SER B 40  ? 0.5213 0.3245 0.4391 -0.0023 -0.0764 0.0486  255 SER B C   
3728 O O   . SER B 40  ? 0.5319 0.3004 0.4632 0.0015  -0.0744 0.0603  255 SER B O   
3729 C CB  . SER B 40  ? 0.5535 0.3513 0.4626 -0.0352 -0.0560 0.0509  255 SER B CB  
3730 O OG  . SER B 40  ? 0.7817 0.6060 0.6706 -0.0323 -0.0577 0.0747  255 SER B OG  
3736 N N   . GLN B 41  ? 0.4944 0.3354 0.3983 0.0079  -0.0871 0.0499  256 GLN B N   
3737 C CA  . GLN B 41  ? 0.5369 0.3832 0.4411 0.0238  -0.0986 0.0685  256 GLN B CA  
3738 C C   . GLN B 41  ? 0.5259 0.4092 0.3998 0.0265  -0.1035 0.0914  256 GLN B C   
3739 O O   . GLN B 41  ? 0.6084 0.5186 0.4620 0.0169  -0.0973 0.0869  256 GLN B O   
3740 C CB  . GLN B 41  ? 0.4872 0.3510 0.4074 0.0360  -0.1117 0.0461  256 GLN B CB  
3741 C CG  . GLN B 41  ? 0.5151 0.3484 0.4656 0.0362  -0.1070 0.0300  256 GLN B CG  
3742 C CD  . GLN B 41  ? 0.4568 0.3104 0.4280 0.0470  -0.1195 0.0147  256 GLN B CD  
3743 O OE1 . GLN B 41  ? 0.4566 0.2962 0.4521 0.0551  -0.1193 0.0163  256 GLN B OE1 
3744 N NE2 . GLN B 41  ? 0.4604 0.3488 0.4247 0.0466  -0.1299 -0.0016 256 GLN B NE2 
3753 N N   . ALA B 48  ? 1.2379 1.0105 1.2992 0.1864  -0.1383 0.2134  263 ALA B N   
3754 C CA  . ALA B 48  ? 1.2936 1.1092 1.3635 0.2105  -0.1574 0.2274  263 ALA B CA  
3755 C C   . ALA B 48  ? 1.2474 1.0850 1.3589 0.2236  -0.1567 0.2024  263 ALA B C   
3756 O O   . ALA B 48  ? 1.2415 1.1348 1.3646 0.2360  -0.1748 0.2029  263 ALA B O   
3757 C CB  . ALA B 48  ? 1.1641 0.9497 1.2253 0.2262  -0.1599 0.2606  263 ALA B CB  
3762 N N   . PRO B 49  ? 1.1461 0.9457 1.2788 0.2196  -0.1360 0.1790  264 PRO B N   
3763 C CA  . PRO B 49  ? 0.9852 0.8139 1.1559 0.2327  -0.1358 0.1590  264 PRO B CA  
3764 C C   . PRO B 49  ? 0.9957 0.8634 1.1772 0.2158  -0.1412 0.1323  264 PRO B C   
3765 O O   . PRO B 49  ? 0.7879 0.6509 0.9457 0.1950  -0.1438 0.1252  264 PRO B O   
3766 C CB  . PRO B 49  ? 0.8999 0.6771 1.0827 0.2350  -0.1122 0.1424  264 PRO B CB  
3767 C CG  . PRO B 49  ? 1.1391 0.8609 1.2908 0.2174  -0.1006 0.1484  264 PRO B CG  
3768 C CD  . PRO B 49  ? 1.1803 0.9216 1.3040 0.2027  -0.1136 0.1656  264 PRO B CD  
3776 N N   . PRO B 50  ? 0.8434 0.7484 1.0605 0.2246  -0.1439 0.1171  265 PRO B N   
3777 C CA  . PRO B 50  ? 0.7691 0.7030 0.9993 0.2072  -0.1473 0.0891  265 PRO B CA  
3778 C C   . PRO B 50  ? 0.7689 0.6637 0.9957 0.1911  -0.1248 0.0649  265 PRO B C   
3779 O O   . PRO B 50  ? 0.6824 0.5391 0.9087 0.1966  -0.1052 0.0630  265 PRO B O   
3780 C CB  . PRO B 50  ? 0.6834 0.6676 0.9566 0.2223  -0.1535 0.0842  265 PRO B CB  
3781 C CG  . PRO B 50  ? 0.7090 0.7009 0.9853 0.2486  -0.1604 0.1122  265 PRO B CG  
3782 C CD  . PRO B 50  ? 0.7933 0.7196 1.0408 0.2516  -0.1460 0.1262  265 PRO B CD  
3790 N N   . LEU B 51  ? 0.4954 0.4009 0.7172 0.1715  -0.1282 0.0452  266 LEU B N   
3791 C CA  . LEU B 51  ? 0.4128 0.2927 0.6314 0.1566  -0.1078 0.0233  266 LEU B CA  
3792 C C   . LEU B 51  ? 0.4373 0.3390 0.6937 0.1657  -0.0967 0.0103  266 LEU B C   
3793 O O   . LEU B 51  ? 0.4410 0.3875 0.7300 0.1761  -0.1088 0.0127  266 LEU B O   
3794 C CB  . LEU B 51  ? 0.3767 0.2644 0.5824 0.1363  -0.1153 0.0086  266 LEU B CB  
3795 C CG  . LEU B 51  ? 0.3791 0.2498 0.5468 0.1263  -0.1255 0.0162  266 LEU B CG  
3796 C CD1 . LEU B 51  ? 0.4916 0.3789 0.6492 0.1064  -0.1289 -0.0026 266 LEU B CD1 
3797 C CD2 . LEU B 51  ? 0.4185 0.2429 0.5593 0.1185  -0.1064 0.0208  266 LEU B CD2 
3809 N N   . GLU B 52  ? 0.4212 0.2982 0.6734 0.1610  -0.0744 -0.0045 267 GLU B N   
3810 C CA  . GLU B 52  ? 0.3990 0.3031 0.6855 0.1665  -0.0628 -0.0198 267 GLU B CA  
3811 C C   . GLU B 52  ? 0.3575 0.2972 0.6622 0.1510  -0.0710 -0.0298 267 GLU B C   
3812 O O   . GLU B 52  ? 0.3471 0.2768 0.6291 0.1346  -0.0806 -0.0306 267 GLU B O   
3813 C CB  . GLU B 52  ? 0.4261 0.3011 0.6984 0.1628  -0.0385 -0.0363 267 GLU B CB  
3814 C CG  . GLU B 52  ? 0.8165 0.6456 1.0662 0.1722  -0.0294 -0.0317 267 GLU B CG  
3815 C CD  . GLU B 52  ? 0.8643 0.6704 1.0987 0.1664  -0.0084 -0.0537 267 GLU B CD  
3816 O OE1 . GLU B 52  ? 0.8464 0.6803 1.1027 0.1696  0.0030  -0.0704 267 GLU B OE1 
3817 O OE2 . GLU B 52  ? 0.9261 0.6903 1.1277 0.1580  -0.0035 -0.0547 267 GLU B OE2 
3824 N N   . SER B 53  ? 0.3938 0.4665 0.5342 0.1877  -0.1060 -0.2400 268 SER B N   
3825 C CA  . SER B 53  ? 0.3715 0.4979 0.5299 0.1653  -0.0880 -0.2252 268 SER B CA  
3826 C C   . SER B 53  ? 0.4035 0.5282 0.5159 0.1723  -0.0711 -0.2293 268 SER B C   
3827 O O   . SER B 53  ? 0.4643 0.5656 0.5306 0.2074  -0.0648 -0.2478 268 SER B O   
3828 C CB  . SER B 53  ? 0.3385 0.5442 0.5492 0.1701  -0.0711 -0.2103 268 SER B CB  
3829 O OG  . SER B 53  ? 0.8325 1.0787 1.0322 0.2065  -0.0449 -0.2100 268 SER B OG  
3835 N N   . VAL B 54  ? 0.3795 0.5254 0.5000 0.1418  -0.0653 -0.2120 269 VAL B N   
3836 C CA  . VAL B 54  ? 0.4091 0.5779 0.5003 0.1452  -0.0456 -0.2052 269 VAL B CA  
3837 C C   . VAL B 54  ? 0.3781 0.6147 0.5199 0.1181  -0.0319 -0.1730 269 VAL B C   
3838 O O   . VAL B 54  ? 0.3456 0.5665 0.5150 0.0856  -0.0476 -0.1639 269 VAL B O   
3839 C CB  . VAL B 54  ? 0.4250 0.5369 0.4686 0.1293  -0.0600 -0.2099 269 VAL B CB  
3840 C CG1 . VAL B 54  ? 0.4472 0.5946 0.4687 0.1275  -0.0392 -0.1956 269 VAL B CG1 
3841 C CG2 . VAL B 54  ? 0.6716 0.7155 0.6630 0.1494  -0.0811 -0.2369 269 VAL B CG2 
3851 N N   . ASP B 55  ? 0.3983 0.7074 0.5486 0.1318  -0.0057 -0.1531 270 ASP B N   
3852 C CA  . ASP B 55  ? 0.3785 0.7531 0.5825 0.0975  0.0008  -0.1124 270 ASP B CA  
3853 C C   . ASP B 55  ? 0.3798 0.7250 0.5702 0.0650  -0.0042 -0.0979 270 ASP B C   
3854 O O   . ASP B 55  ? 0.4058 0.7468 0.5522 0.0803  0.0081  -0.1004 270 ASP B O   
3855 C CB  . ASP B 55  ? 0.4000 0.8811 0.6256 0.1229  0.0312  -0.0818 270 ASP B CB  
3856 C CG  . ASP B 55  ? 0.4638 1.0233 0.7670 0.0797  0.0277  -0.0309 270 ASP B CG  
3857 O OD1 . ASP B 55  ? 0.5959 1.2187 0.9475 0.0826  0.0284  -0.0135 270 ASP B OD1 
3858 O OD2 . ASP B 55  ? 0.4887 1.0428 0.8055 0.0397  0.0200  -0.0053 270 ASP B OD2 
3863 N N   . VAL B 56  ? 0.3619 0.6841 0.5858 0.0228  -0.0239 -0.0826 271 VAL B N   
3864 C CA  . VAL B 56  ? 0.3701 0.6460 0.5782 -0.0035 -0.0317 -0.0708 271 VAL B CA  
3865 C C   . VAL B 56  ? 0.3900 0.7271 0.6119 -0.0136 -0.0126 -0.0312 271 VAL B C   
3866 O O   . VAL B 56  ? 0.4022 0.7131 0.5986 -0.0207 -0.0097 -0.0218 271 VAL B O   
3867 C CB  . VAL B 56  ? 0.3694 0.5912 0.5981 -0.0378 -0.0601 -0.0679 271 VAL B CB  
3868 C CG1 . VAL B 56  ? 0.5593 0.8285 0.8450 -0.0744 -0.0693 -0.0320 271 VAL B CG1 
3869 C CG2 . VAL B 56  ? 0.4206 0.5733 0.6145 -0.0465 -0.0670 -0.0659 271 VAL B CG2 
3879 N N   . ARG B 57  ? 0.5151 0.9445 0.7817 -0.0130 0.0012  -0.0010 272 ARG B N   
3880 C CA  . ARG B 57  ? 0.6183 1.1321 0.9091 -0.0206 0.0215  0.0492  272 ARG B CA  
3881 C C   . ARG B 57  ? 0.5495 1.0699 0.7761 0.0192  0.0463  0.0355  272 ARG B C   
3882 O O   . ARG B 57  ? 0.5979 1.1492 0.8240 0.0087  0.0572  0.0687  272 ARG B O   
3883 C CB  . ARG B 57  ? 0.5602 1.1945 0.9101 -0.0150 0.0356  0.0888  272 ARG B CB  
3884 C CG  . ARG B 57  ? 0.6135 1.2587 1.0375 -0.0725 0.0039  0.1226  272 ARG B CG  
3885 C CD  . ARG B 57  ? 0.5863 1.3304 1.0633 -0.0627 0.0088  0.1440  272 ARG B CD  
3886 N NE  . ARG B 57  ? 0.6355 1.3723 1.1735 -0.1258 -0.0324 0.1710  272 ARG B NE  
3887 C CZ  . ARG B 57  ? 0.8028 1.6392 1.4095 -0.1441 -0.0402 0.2140  272 ARG B CZ  
3888 N NH1 . ARG B 57  ? 0.6981 1.6624 1.3269 -0.0968 -0.0030 0.2404  272 ARG B NH1 
3889 N NH2 . ARG B 57  ? 0.8631 1.6700 1.5132 -0.2090 -0.0881 0.2329  272 ARG B NH2 
3903 N N   . GLN B 58  ? 0.4648 0.9477 0.6347 0.0615  0.0499  -0.0130 273 GLN B N   
3904 C CA  . GLN B 58  ? 0.5621 1.0390 0.6585 0.0998  0.0647  -0.0335 273 GLN B CA  
3905 C C   . GLN B 58  ? 0.6837 1.0933 0.7431 0.0779  0.0509  -0.0393 273 GLN B C   
3906 O O   . GLN B 58  ? 0.8231 1.2447 0.8296 0.0977  0.0615  -0.0415 273 GLN B O   
3907 C CB  . GLN B 58  ? 0.5795 1.0112 0.6228 0.1452  0.0610  -0.0853 273 GLN B CB  
3908 C CG  . GLN B 58  ? 0.6299 1.1375 0.6878 0.1890  0.0841  -0.0802 273 GLN B CG  
3909 C CD  . GLN B 58  ? 0.8216 1.4118 0.8372 0.2396  0.1183  -0.0649 273 GLN B CD  
3910 O OE1 . GLN B 58  ? 0.9526 1.6216 0.9951 0.2239  0.1349  -0.0174 273 GLN B OE1 
3911 N NE2 . GLN B 58  ? 0.9237 1.4934 0.8684 0.3043  0.1279  -0.1039 273 GLN B NE2 
3920 N N   . ILE B 59  ? 0.4533 0.7965 0.5352 0.0421  0.0274  -0.0403 274 ILE B N   
3921 C CA  . ILE B 59  ? 0.4510 0.7386 0.5013 0.0273  0.0163  -0.0395 274 ILE B CA  
3922 C C   . ILE B 59  ? 0.4772 0.7594 0.5684 -0.0095 0.0132  0.0013  274 ILE B C   
3923 O O   . ILE B 59  ? 0.4964 0.7323 0.5673 -0.0189 0.0054  0.0075  274 ILE B O   
3924 C CB  . ILE B 59  ? 0.4361 0.6428 0.4612 0.0296  -0.0089 -0.0745 274 ILE B CB  
3925 C CG1 . ILE B 59  ? 0.4061 0.5785 0.4742 0.0103  -0.0244 -0.0742 274 ILE B CG1 
3926 C CG2 . ILE B 59  ? 0.4885 0.6840 0.4777 0.0615  -0.0133 -0.1131 274 ILE B CG2 
3927 C CD1 . ILE B 59  ? 0.4699 0.5809 0.5176 0.0161  -0.0461 -0.0970 274 ILE B CD1 
3939 N N   . TYR B 60  ? 0.5200 0.8461 0.6683 -0.0305 0.0160  0.0321  275 TYR B N   
3940 C CA  . TYR B 60  ? 0.5658 0.8721 0.7516 -0.0692 0.0055  0.0724  275 TYR B CA  
3941 C C   . TYR B 60  ? 0.5297 0.8414 0.6923 -0.0700 0.0176  0.0999  275 TYR B C   
3942 O O   . TYR B 60  ? 0.5961 0.8426 0.7562 -0.0871 0.0050  0.1126  275 TYR B O   
3943 C CB  . TYR B 60  ? 0.6084 0.9892 0.8623 -0.0960 0.0064  0.1172  275 TYR B CB  
3944 C CG  . TYR B 60  ? 0.6155 0.9721 0.9091 -0.1197 -0.0196 0.1088  275 TYR B CG  
3945 C CD1 . TYR B 60  ? 0.5761 0.8355 0.8436 -0.1187 -0.0438 0.0650  275 TYR B CD1 
3946 C CD2 . TYR B 60  ? 0.6673 1.1102 1.0264 -0.1432 -0.0213 0.1511  275 TYR B CD2 
3947 C CE1 . TYR B 60  ? 0.6081 0.8487 0.9056 -0.1395 -0.0698 0.0565  275 TYR B CE1 
3948 C CE2 . TYR B 60  ? 0.6771 1.1034 1.0725 -0.1696 -0.0498 0.1465  275 TYR B CE2 
3949 C CZ  . TYR B 60  ? 0.6209 0.9415 0.9813 -0.1674 -0.0747 0.0956  275 TYR B CZ  
3950 O OH  . TYR B 60  ? 0.6329 0.9381 1.0220 -0.1923 -0.1052 0.0893  275 TYR B OH  
3960 N N   . ASP B 61  ? 0.5139 0.9010 0.6525 -0.0458 0.0420  0.1078  276 ASP B N   
3961 C CA  . ASP B 61  ? 0.5788 0.9975 0.7023 -0.0475 0.0561  0.1435  276 ASP B CA  
3962 C C   . ASP B 61  ? 0.6002 0.9555 0.6667 -0.0377 0.0479  0.1209  276 ASP B C   
3963 O O   . ASP B 61  ? 0.6104 0.9764 0.6683 -0.0440 0.0545  0.1530  276 ASP B O   
3964 C CB  . ASP B 61  ? 0.6090 1.1412 0.7188 -0.0190 0.0854  0.1613  276 ASP B CB  
3965 C CG  . ASP B 61  ? 0.6966 1.2230 0.7303 0.0267  0.0900  0.1055  276 ASP B CG  
3966 O OD1 . ASP B 61  ? 0.8485 1.4368 0.8367 0.0568  0.1091  0.1105  276 ASP B OD1 
3967 O OD2 . ASP B 61  ? 0.7076 1.1657 0.7228 0.0340  0.0723  0.0579  276 ASP B OD2 
3972 N N   . LYS B 62  ? 0.6128 0.9097 0.6467 -0.0244 0.0321  0.0735  277 LYS B N   
3973 C CA  . LYS B 62  ? 0.5168 0.7683 0.5056 -0.0189 0.0205  0.0622  277 LYS B CA  
3974 C C   . LYS B 62  ? 0.4830 0.6653 0.4897 -0.0319 0.0067  0.0736  277 LYS B C   
3975 O O   . LYS B 62  ? 0.5054 0.6590 0.4847 -0.0259 -0.0016 0.0758  277 LYS B O   
3976 C CB  . LYS B 62  ? 0.5587 0.7879 0.5040 0.0009  0.0066  0.0145  277 LYS B CB  
3977 C CG  . LYS B 62  ? 0.6918 0.9714 0.5984 0.0262  0.0187  -0.0044 277 LYS B CG  
3978 C CD  . LYS B 62  ? 0.8347 1.1060 0.6695 0.0355  0.0070  -0.0167 277 LYS B CD  
3979 C CE  . LYS B 62  ? 0.8041 1.1403 0.5922 0.0619  0.0263  -0.0163 277 LYS B CE  
3980 N NZ  . LYS B 62  ? 1.0162 1.3232 0.7312 0.0957  0.0136  -0.0685 277 LYS B NZ  
3994 N N   . PHE B 63  ? 0.7288 0.5530 0.5996 -0.0225 -0.0417 0.1426  278 PHE B N   
3995 C CA  . PHE B 63  ? 0.8120 0.6252 0.7155 -0.0165 -0.0660 0.1326  278 PHE B CA  
3996 C C   . PHE B 63  ? 0.6074 0.4025 0.5255 -0.0355 -0.0844 0.1479  278 PHE B C   
3997 O O   . PHE B 63  ? 0.6401 0.4351 0.5437 -0.0551 -0.0763 0.1683  278 PHE B O   
3998 C CB  . PHE B 63  ? 0.7494 0.5946 0.6841 -0.0010 -0.0574 0.1149  278 PHE B CB  
3999 C CG  . PHE B 63  ? 0.6538 0.5043 0.5734 0.0173  -0.0462 0.1012  278 PHE B CG  
4000 C CD1 . PHE B 63  ? 0.6375 0.4737 0.5592 0.0284  -0.0612 0.0885  278 PHE B CD1 
4001 C CD2 . PHE B 63  ? 0.7914 0.6583 0.6924 0.0224  -0.0210 0.1017  278 PHE B CD2 
4002 C CE1 . PHE B 63  ? 0.6052 0.4436 0.5119 0.0412  -0.0517 0.0780  278 PHE B CE1 
4003 C CE2 . PHE B 63  ? 0.6416 0.5053 0.5264 0.0377  -0.0125 0.0898  278 PHE B CE2 
4004 C CZ  . PHE B 63  ? 0.5822 0.4305 0.4693 0.0452  -0.0283 0.0791  278 PHE B CZ  
4014 N N   . PRO B 64  ? 1.0078 0.7849 0.9522 -0.0302 -0.1096 0.1384  279 PRO B N   
4015 C CA  . PRO B 64  ? 0.9754 0.7236 0.9262 -0.0482 -0.1297 0.1536  279 PRO B CA  
4016 C C   . PRO B 64  ? 0.8785 0.6415 0.8506 -0.0683 -0.1236 0.1659  279 PRO B C   
4017 O O   . PRO B 64  ? 0.8639 0.6675 0.8535 -0.0654 -0.1046 0.1580  279 PRO B O   
4018 C CB  . PRO B 64  ? 0.9709 0.7099 0.9487 -0.0332 -0.1520 0.1300  279 PRO B CB  
4019 C CG  . PRO B 64  ? 0.9524 0.7128 0.9459 -0.0130 -0.1468 0.1103  279 PRO B CG  
4020 C CD  . PRO B 64  ? 1.0080 0.7934 0.9786 -0.0098 -0.1193 0.1140  279 PRO B CD  
4028 N N   . GLU B 65  ? 1.1279 0.8649 1.0999 -0.0878 -0.1380 0.1818  280 GLU B N   
4029 C CA  . GLU B 65  ? 1.1982 0.9384 1.1967 -0.1108 -0.1415 0.1942  280 GLU B CA  
4030 C C   . GLU B 65  ? 1.2736 0.9829 1.2897 -0.1091 -0.1699 0.1831  280 GLU B C   
4031 O O   . GLU B 65  ? 1.3793 1.0689 1.3783 -0.0983 -0.1808 0.1775  280 GLU B O   
4032 C CB  . GLU B 65  ? 1.2810 1.0334 1.2574 -0.1370 -0.1228 0.2214  280 GLU B CB  
4033 C CG  . GLU B 65  ? 1.2546 1.0557 1.2204 -0.1360 -0.0885 0.2244  280 GLU B CG  
4034 C CD  . GLU B 65  ? 1.2893 1.1378 1.2971 -0.1388 -0.0764 0.2149  280 GLU B CD  
4035 O OE1 . GLU B 65  ? 1.2017 1.0400 1.2433 -0.1495 -0.0958 0.2124  280 GLU B OE1 
4036 O OE2 . GLU B 65  ? 1.3217 1.2169 1.3290 -0.1297 -0.0488 0.2091  280 GLU B OE2 
4043 N N   . LYS B 66  ? 1.0397 0.7461 1.0906 -0.1192 -0.1827 0.1788  281 LYS B N   
4044 C CA  . LYS B 66  ? 0.8417 0.5780 0.9223 -0.1328 -0.1725 0.1814  281 LYS B CA  
4045 C C   . LYS B 66  ? 0.6397 0.3868 0.7486 -0.1082 -0.1835 0.1476  281 LYS B C   
4046 O O   . LYS B 66  ? 0.6161 0.4041 0.7274 -0.0896 -0.1660 0.1317  281 LYS B O   
4047 C CB  . LYS B 66  ? 0.8359 0.5675 0.9334 -0.1643 -0.1785 0.1977  281 LYS B CB  
4048 C CG  . LYS B 66  ? 0.7905 0.4980 0.8558 -0.1764 -0.1797 0.2174  281 LYS B CG  
4049 C CD  . LYS B 66  ? 0.9772 0.6850 1.0550 -0.2079 -0.1809 0.2356  281 LYS B CD  
4050 C CE  . LYS B 66  ? 1.0015 0.6728 1.1010 -0.2079 -0.2109 0.2236  281 LYS B CE  
4051 N NZ  . LYS B 66  ? 1.1899 0.8399 1.2790 -0.2338 -0.2157 0.2470  281 LYS B NZ  
4065 N N   . LYS B 67  ? 0.7535 0.4641 0.8792 -0.1057 -0.2120 0.1354  282 LYS B N   
4066 C CA  . LYS B 67  ? 0.7122 0.4246 0.8594 -0.0809 -0.2258 0.1028  282 LYS B CA  
4067 C C   . LYS B 67  ? 0.5707 0.2949 0.6982 -0.0523 -0.2163 0.0903  282 LYS B C   
4068 O O   . LYS B 67  ? 0.5207 0.2342 0.6215 -0.0459 -0.2151 0.0951  282 LYS B O   
4069 C CB  . LYS B 67  ? 0.8140 0.5000 0.9705 -0.0756 -0.2506 0.0883  282 LYS B CB  
4070 C CG  . LYS B 67  ? 0.8260 0.5155 1.0168 -0.0798 -0.2645 0.0696  282 LYS B CG  
4071 C CD  . LYS B 67  ? 0.8902 0.5770 1.0918 -0.1141 -0.2636 0.0914  282 LYS B CD  
4072 C CE  . LYS B 67  ? 0.8592 0.5388 1.0882 -0.1190 -0.2821 0.0737  282 LYS B CE  
4073 N NZ  . LYS B 67  ? 0.9561 0.6185 1.1848 -0.1501 -0.2846 0.0987  282 LYS B NZ  
4087 N N   . GLY B 68  ? 0.5186 0.2867 0.6557 -0.0355 -0.2022 0.0702  283 GLY B N   
4088 C CA  . GLY B 68  ? 0.5508 0.3343 0.6725 -0.0107 -0.1923 0.0573  283 GLY B CA  
4089 C C   . GLY B 68  ? 0.5765 0.3791 0.6695 -0.0119 -0.1661 0.0734  283 GLY B C   
4090 O O   . GLY B 68  ? 0.4777 0.2879 0.5549 0.0055  -0.1581 0.0653  283 GLY B O   
4094 N N   . GLY B 69  ? 0.5523 0.3617 0.6380 -0.0331 -0.1529 0.0957  284 GLY B N   
4095 C CA  . GLY B 69  ? 0.4984 0.3336 0.5597 -0.0324 -0.1247 0.1067  284 GLY B CA  
4096 C C   . GLY B 69  ? 0.5611 0.4462 0.6391 -0.0227 -0.1054 0.0959  284 GLY B C   
4097 O O   . GLY B 69  ? 0.4374 0.3403 0.5460 -0.0223 -0.1137 0.0839  284 GLY B O   
4101 N N   . LEU B 70  ? 0.5986 0.5046 0.6558 -0.0142 -0.0811 0.0995  285 LEU B N   
4102 C CA  . LEU B 70  ? 0.6693 0.6185 0.7396 -0.0003 -0.0641 0.0898  285 LEU B CA  
4103 C C   . LEU B 70  ? 0.5442 0.5284 0.6471 -0.0130 -0.0612 0.0937  285 LEU B C   
4104 O O   . LEU B 70  ? 0.4085 0.4200 0.5350 -0.0029 -0.0642 0.0803  285 LEU B O   
4105 C CB  . LEU B 70  ? 0.6092 0.5698 0.6514 0.0092  -0.0384 0.0950  285 LEU B CB  
4106 C CG  . LEU B 70  ? 0.4768 0.4224 0.4972 0.0291  -0.0372 0.0831  285 LEU B CG  
4107 C CD1 . LEU B 70  ? 0.7005 0.6474 0.6902 0.0349  -0.0145 0.0884  285 LEU B CD1 
4108 C CD2 . LEU B 70  ? 0.3832 0.3512 0.4249 0.0465  -0.0406 0.0665  285 LEU B CD2 
4120 N N   . ARG B 71  ? 0.5177 0.5040 0.6225 -0.0363 -0.0562 0.1123  286 ARG B N   
4121 C CA  . ARG B 71  ? 0.4924 0.5218 0.6309 -0.0485 -0.0503 0.1158  286 ARG B CA  
4122 C C   . ARG B 71  ? 0.5233 0.5501 0.6950 -0.0538 -0.0754 0.1028  286 ARG B C   
4123 O O   . ARG B 71  ? 0.4648 0.5322 0.6638 -0.0473 -0.0742 0.0922  286 ARG B O   
4124 C CB  . ARG B 71  ? 0.5304 0.5672 0.6671 -0.0765 -0.0393 0.1397  286 ARG B CB  
4125 C CG  . ARG B 71  ? 0.5576 0.6505 0.7331 -0.0884 -0.0297 0.1429  286 ARG B CG  
4126 C CD  . ARG B 71  ? 0.7876 0.8906 0.9667 -0.1212 -0.0209 0.1673  286 ARG B CD  
4127 N NE  . ARG B 71  ? 0.9271 1.0364 1.0708 -0.1192 0.0055  0.1804  286 ARG B NE  
4128 C CZ  . ARG B 71  ? 0.9564 1.0822 1.0937 -0.1447 0.0211  0.2028  286 ARG B CZ  
4129 N NH1 . ARG B 71  ? 0.7613 0.8980 0.9276 -0.1772 0.0128  0.2172  286 ARG B NH1 
4130 N NH2 . ARG B 71  ? 0.8665 0.9982 0.9669 -0.1391 0.0454  0.2104  286 ARG B NH2 
4144 N N   . GLU B 72  ? 0.5853 0.5648 0.7543 -0.0645 -0.0989 0.1029  287 GLU B N   
4145 C CA  . GLU B 72  ? 0.5879 0.5557 0.7851 -0.0690 -0.1251 0.0875  287 GLU B CA  
4146 C C   . GLU B 72  ? 0.4587 0.4396 0.6598 -0.0409 -0.1304 0.0612  287 GLU B C   
4147 O O   . GLU B 72  ? 0.4628 0.4643 0.6894 -0.0397 -0.1413 0.0458  287 GLU B O   
4148 C CB  . GLU B 72  ? 0.6293 0.5363 0.8187 -0.0813 -0.1494 0.0925  287 GLU B CB  
4149 C CG  . GLU B 72  ? 0.8379 0.7217 1.0543 -0.0838 -0.1796 0.0728  287 GLU B CG  
4150 C CD  . GLU B 72  ? 0.9527 0.8251 1.1651 -0.0537 -0.1919 0.0444  287 GLU B CD  
4151 O OE1 . GLU B 72  ? 0.9830 0.8849 1.2133 -0.0423 -0.1954 0.0224  287 GLU B OE1 
4152 O OE2 . GLU B 72  ? 0.7260 0.5631 0.9180 -0.0421 -0.1986 0.0440  287 GLU B OE2 
4159 N N   . LEU B 73  ? 0.3480 0.3177 0.5227 -0.0200 -0.1231 0.0563  288 LEU B N   
4160 C CA  . LEU B 73  ? 0.3047 0.2897 0.4802 0.0048  -0.1254 0.0343  288 LEU B CA  
4161 C C   . LEU B 73  ? 0.2803 0.3165 0.4671 0.0133  -0.1096 0.0323  288 LEU B C   
4162 O O   . LEU B 73  ? 0.2677 0.3259 0.4702 0.0224  -0.1183 0.0160  288 LEU B O   
4163 C CB  . LEU B 73  ? 0.2948 0.2605 0.4410 0.0219  -0.1191 0.0321  288 LEU B CB  
4164 C CG  . LEU B 73  ? 0.3624 0.2847 0.5016 0.0230  -0.1388 0.0263  288 LEU B CG  
4165 C CD1 . LEU B 73  ? 0.4355 0.3468 0.5461 0.0362  -0.1290 0.0284  288 LEU B CD1 
4166 C CD2 . LEU B 73  ? 0.3397 0.2634 0.4992 0.0333  -0.1583 0.0012  288 LEU B CD2 
4178 N N   . TYR B 74  ? 0.3913 0.4466 0.5693 0.0114  -0.0871 0.0486  289 TYR B N   
4179 C CA  . TYR B 74  ? 0.4165 0.5204 0.6064 0.0226  -0.0719 0.0481  289 TYR B CA  
4180 C C   . TYR B 74  ? 0.4561 0.5946 0.6834 0.0095  -0.0817 0.0453  289 TYR B C   
4181 O O   . TYR B 74  ? 0.3631 0.5385 0.6052 0.0224  -0.0822 0.0360  289 TYR B O   
4182 C CB  . TYR B 74  ? 0.3940 0.5114 0.5693 0.0240  -0.0457 0.0643  289 TYR B CB  
4183 C CG  . TYR B 74  ? 0.4102 0.5604 0.5843 0.0481  -0.0304 0.0602  289 TYR B CG  
4184 C CD1 . TYR B 74  ? 0.3612 0.4909 0.5051 0.0673  -0.0218 0.0569  289 TYR B CD1 
4185 C CD2 . TYR B 74  ? 0.3608 0.5616 0.5652 0.0514  -0.0266 0.0600  289 TYR B CD2 
4186 C CE1 . TYR B 74  ? 0.3537 0.5057 0.4949 0.0890  -0.0097 0.0548  289 TYR B CE1 
4187 C CE2 . TYR B 74  ? 0.4073 0.6346 0.6103 0.0756  -0.0147 0.0578  289 TYR B CE2 
4188 C CZ  . TYR B 74  ? 0.4681 0.6675 0.6381 0.0946  -0.0064 0.0557  289 TYR B CZ  
4189 O OH  . TYR B 74  ? 0.3745 0.5914 0.5402 0.1188  0.0037  0.0549  289 TYR B OH  
4199 N N   . ASP B 75  ? 0.5178 0.6446 0.7599 -0.0173 -0.0904 0.0544  290 ASP B N   
4200 C CA  . ASP B 75  ? 0.5097 0.6671 0.7898 -0.0348 -0.1022 0.0515  290 ASP B CA  
4201 C C   . ASP B 75  ? 0.4845 0.6343 0.7759 -0.0277 -0.1275 0.0272  290 ASP B C   
4202 O O   . ASP B 75  ? 0.4934 0.6809 0.8105 -0.0286 -0.1354 0.0175  290 ASP B O   
4203 C CB  . ASP B 75  ? 0.5561 0.6947 0.8473 -0.0686 -0.1076 0.0681  290 ASP B CB  
4204 C CG  . ASP B 75  ? 0.6785 0.8415 0.9649 -0.0797 -0.0810 0.0918  290 ASP B CG  
4205 O OD1 . ASP B 75  ? 0.5138 0.7147 0.7959 -0.0609 -0.0589 0.0930  290 ASP B OD1 
4206 O OD2 . ASP B 75  ? 0.8486 0.9921 1.1349 -0.1076 -0.0825 0.1093  290 ASP B OD2 
4211 N N   . ARG B 76  ? 0.5438 0.6470 0.8158 -0.0201 -0.1404 0.0165  291 ARG B N   
4212 C CA  . ARG B 76  ? 0.4773 0.5731 0.7555 -0.0100 -0.1621 -0.0093 291 ARG B CA  
4213 C C   . ARG B 76  ? 0.3555 0.4917 0.6283 0.0150  -0.1542 -0.0209 291 ARG B C   
4214 O O   . ARG B 76  ? 0.3903 0.5466 0.6760 0.0197  -0.1688 -0.0398 291 ARG B O   
4215 C CB  . ARG B 76  ? 0.4506 0.4926 0.7091 -0.0031 -0.1742 -0.0179 291 ARG B CB  
4216 C CG  . ARG B 76  ? 0.5126 0.5538 0.7678 0.0176  -0.1879 -0.0463 291 ARG B CG  
4217 C CD  . ARG B 76  ? 0.6365 0.6261 0.8911 0.0166  -0.2100 -0.0598 291 ARG B CD  
4218 N NE  . ARG B 76  ? 0.5308 0.4916 0.7614 0.0282  -0.2033 -0.0531 291 ARG B NE  
4219 C CZ  . ARG B 76  ? 0.7723 0.7150 0.9956 0.0460  -0.2132 -0.0719 291 ARG B CZ  
4220 N NH1 . ARG B 76  ? 0.8731 0.8208 1.1083 0.0558  -0.2295 -0.1003 291 ARG B NH1 
4221 N NH2 . ARG B 76  ? 0.7393 0.6614 0.9436 0.0544  -0.2069 -0.0635 291 ARG B NH2 
4235 N N   . GLY B 77  ? 0.4295 0.5748 0.6810 0.0306  -0.1321 -0.0095 292 GLY B N   
4236 C CA  . GLY B 77  ? 0.2399 0.4171 0.4824 0.0540  -0.1236 -0.0155 292 GLY B CA  
4237 C C   . GLY B 77  ? 0.3541 0.5165 0.5798 0.0699  -0.1338 -0.0348 292 GLY B C   
4238 O O   . GLY B 77  ? 0.3090 0.4369 0.5321 0.0653  -0.1478 -0.0460 292 GLY B O   
4242 N N   . PRO B 78  ? 0.2503 0.4392 0.4637 0.0887  -0.1265 -0.0383 293 PRO B N   
4243 C CA  . PRO B 78  ? 0.2177 0.4432 0.4331 0.0959  -0.1121 -0.0255 293 PRO B CA  
4244 C C   . PRO B 78  ? 0.1875 0.4068 0.3879 0.1067  -0.0913 -0.0085 293 PRO B C   
4245 O O   . PRO B 78  ? 0.2145 0.4006 0.3898 0.1110  -0.0854 -0.0081 293 PRO B O   
4246 C CB  . PRO B 78  ? 0.2750 0.5051 0.4672 0.1036  -0.1103 -0.0335 293 PRO B CB  
4247 C CG  . PRO B 78  ? 0.3311 0.5274 0.4980 0.1070  -0.1097 -0.0434 293 PRO B CG  
4248 C CD  . PRO B 78  ? 0.2732 0.4458 0.4568 0.0972  -0.1244 -0.0513 293 PRO B CD  
4256 N N   . PRO B 79  ? 0.1851 0.4322 0.3976 0.1088  -0.0784 0.0050  294 PRO B N   
4257 C CA  . PRO B 79  ? 0.1940 0.4307 0.3893 0.1173  -0.0557 0.0201  294 PRO B CA  
4258 C C   . PRO B 79  ? 0.2505 0.4569 0.4091 0.1296  -0.0451 0.0202  294 PRO B C   
4259 O O   . PRO B 79  ? 0.2067 0.3890 0.3455 0.1338  -0.0322 0.0272  294 PRO B O   
4260 C CB  . PRO B 79  ? 0.2997 0.5818 0.5192 0.1219  -0.0470 0.0286  294 PRO B CB  
4261 C CG  . PRO B 79  ? 0.2039 0.5170 0.4575 0.1066  -0.0639 0.0223  294 PRO B CG  
4262 C CD  . PRO B 79  ? 0.1862 0.4783 0.4332 0.1016  -0.0853 0.0053  294 PRO B CD  
4270 N N   . HIS B 80  ? 0.2499 0.4555 0.3970 0.1315  -0.0493 0.0139  295 HIS B N   
4271 C CA  . HIS B 80  ? 0.2203 0.4013 0.3347 0.1382  -0.0386 0.0166  295 HIS B CA  
4272 C C   . HIS B 80  ? 0.2155 0.3661 0.3101 0.1343  -0.0396 0.0115  295 HIS B C   
4273 O O   . HIS B 80  ? 0.2269 0.3583 0.2967 0.1372  -0.0315 0.0141  295 HIS B O   
4274 C CB  . HIS B 80  ? 0.2271 0.4225 0.3344 0.1428  -0.0430 0.0143  295 HIS B CB  
4275 C CG  . HIS B 80  ? 0.2270 0.4285 0.3340 0.1378  -0.0565 0.0016  295 HIS B CG  
4276 N ND1 . HIS B 80  ? 0.2929 0.5149 0.4242 0.1311  -0.0707 -0.0074 295 HIS B ND1 
4277 C CD2 . HIS B 80  ? 0.2899 0.4813 0.3746 0.1391  -0.0577 -0.0053 295 HIS B CD2 
4278 C CE1 . HIS B 80  ? 0.2442 0.4643 0.3657 0.1293  -0.0801 -0.0215 295 HIS B CE1 
4279 N NE2 . HIS B 80  ? 0.2878 0.4925 0.3817 0.1349  -0.0716 -0.0203 295 HIS B NE2 
4287 N N   . ALA B 81  ? 0.1882 0.3362 0.2954 0.1274  -0.0515 0.0036  296 ALA B N   
4288 C CA  . ALA B 81  ? 0.1873 0.3096 0.2792 0.1240  -0.0544 -0.0034 296 ALA B CA  
4289 C C   . ALA B 81  ? 0.1881 0.2830 0.2688 0.1235  -0.0473 0.0041  296 ALA B C   
4290 O O   . ALA B 81  ? 0.1886 0.2624 0.2590 0.1199  -0.0509 -0.0011 296 ALA B O   
4291 C CB  . ALA B 81  ? 0.1890 0.3139 0.2973 0.1179  -0.0726 -0.0181 296 ALA B CB  
4297 N N   . PHE B 82  ? 0.1911 0.2884 0.2732 0.1278  -0.0371 0.0156  297 PHE B N   
4298 C CA  . PHE B 82  ? 0.1981 0.2709 0.2681 0.1275  -0.0313 0.0235  297 PHE B CA  
4299 C C   . PHE B 82  ? 0.2068 0.2593 0.2484 0.1323  -0.0141 0.0299  297 PHE B C   
4300 O O   . PHE B 82  ? 0.2119 0.2746 0.2508 0.1385  -0.0024 0.0348  297 PHE B O   
4301 C CB  . PHE B 82  ? 0.2052 0.2889 0.2919 0.1154  -0.0280 0.0316  297 PHE B CB  
4302 C CG  . PHE B 82  ? 0.2077 0.2904 0.3157 0.0993  -0.0461 0.0261  297 PHE B CG  
4303 C CD1 . PHE B 82  ? 0.2217 0.2724 0.3222 0.0847  -0.0520 0.0299  297 PHE B CD1 
4304 C CD2 . PHE B 82  ? 0.2010 0.3108 0.3341 0.0992  -0.0591 0.0168  297 PHE B CD2 
4305 C CE1 . PHE B 82  ? 0.2306 0.2724 0.3496 0.0708  -0.0708 0.0253  297 PHE B CE1 
4306 C CE2 . PHE B 82  ? 0.2092 0.3118 0.3607 0.0846  -0.0773 0.0096  297 PHE B CE2 
4307 C CZ  . PHE B 82  ? 0.2250 0.2912 0.3701 0.0704  -0.0833 0.0143  297 PHE B CZ  
4317 N N   . PHE B 83  ? 0.2118 0.2346 0.2332 0.1282  -0.0148 0.0283  298 PHE B N   
4318 C CA  . PHE B 83  ? 0.2236 0.2241 0.2179 0.1300  -0.0019 0.0320  298 PHE B CA  
4319 C C   . PHE B 83  ? 0.2386 0.2087 0.2134 0.1276  0.0006  0.0369  298 PHE B C   
4320 O O   . PHE B 83  ? 0.2388 0.2002 0.2186 0.1157  -0.0112 0.0353  298 PHE B O   
4321 C CB  . PHE B 83  ? 0.2190 0.2151 0.2042 0.1267  -0.0051 0.0257  298 PHE B CB  
4322 C CG  . PHE B 83  ? 0.2117 0.2326 0.2072 0.1297  -0.0072 0.0231  298 PHE B CG  
4323 C CD1 . PHE B 83  ? 0.2225 0.2450 0.2071 0.1364  0.0019  0.0290  298 PHE B CD1 
4324 C CD2 . PHE B 83  ? 0.2002 0.2406 0.2137 0.1269  -0.0192 0.0149  298 PHE B CD2 
4325 C CE1 . PHE B 83  ? 0.2203 0.2639 0.2106 0.1404  -0.0013 0.0286  298 PHE B CE1 
4326 C CE2 . PHE B 83  ? 0.2172 0.2795 0.2348 0.1305  -0.0210 0.0128  298 PHE B CE2 
4327 C CZ  . PHE B 83  ? 0.2089 0.2732 0.2142 0.1374  -0.0123 0.0207  298 PHE B CZ  
4337 N N   . LEU B 84  ? 0.2687 0.2211 0.2201 0.1317  0.0148  0.0406  299 LEU B N   
4338 C CA  . LEU B 84  ? 0.2884 0.2097 0.2131 0.1242  0.0186  0.0426  299 LEU B CA  
4339 C C   . LEU B 84  ? 0.3144 0.2118 0.2166 0.1254  0.0207  0.0386  299 LEU B C   
4340 O O   . LEU B 84  ? 0.3084 0.2077 0.2061 0.1311  0.0296  0.0379  299 LEU B O   
4341 C CB  . LEU B 84  ? 0.3140 0.2359 0.2283 0.1262  0.0349  0.0479  299 LEU B CB  
4342 C CG  . LEU B 84  ? 0.4772 0.3674 0.3565 0.1201  0.0418  0.0478  299 LEU B CG  
4343 C CD1 . LEU B 84  ? 0.4083 0.2899 0.2845 0.1026  0.0290  0.0512  299 LEU B CD1 
4344 C CD2 . LEU B 84  ? 0.5916 0.4877 0.4601 0.1272  0.0614  0.0499  299 LEU B CD2 
4356 N N   . VAL B 85  ? 0.3218 0.1991 0.2122 0.1158  0.0109  0.0358  300 VAL B N   
4357 C CA  . VAL B 85  ? 0.3091 0.1659 0.1803 0.1121  0.0121  0.0319  300 VAL B CA  
4358 C C   . VAL B 85  ? 0.3363 0.1597 0.1759 0.1062  0.0141  0.0326  300 VAL B C   
4359 O O   . VAL B 85  ? 0.3415 0.1616 0.1796 0.0958  0.0036  0.0331  300 VAL B O   
4360 C CB  . VAL B 85  ? 0.3318 0.1984 0.2169 0.1062  -0.0019 0.0266  300 VAL B CB  
4361 C CG1 . VAL B 85  ? 0.3840 0.2261 0.2476 0.1021  -0.0012 0.0251  300 VAL B CG1 
4362 C CG2 . VAL B 85  ? 0.2802 0.1784 0.1895 0.1112  -0.0030 0.0246  300 VAL B CG2 
4372 N N   . LYS B 86  ? 0.3582 0.1585 0.1730 0.1108  0.0263  0.0313  301 LYS B N   
4373 C CA  . LYS B 86  ? 0.3896 0.1591 0.1717 0.1018  0.0269  0.0276  301 LYS B CA  
4374 C C   . LYS B 86  ? 0.3964 0.1492 0.1714 0.0931  0.0174  0.0231  301 LYS B C   
4375 O O   . LYS B 86  ? 0.4124 0.1588 0.1879 0.0974  0.0221  0.0226  301 LYS B O   
4376 C CB  . LYS B 86  ? 0.4676 0.2171 0.2236 0.1113  0.0449  0.0248  301 LYS B CB  
4377 C CG  . LYS B 86  ? 0.6640 0.4362 0.4285 0.1207  0.0580  0.0288  301 LYS B CG  
4378 C CD  . LYS B 86  ? 0.8424 0.5988 0.5854 0.1353  0.0770  0.0232  301 LYS B CD  
4379 C CE  . LYS B 86  ? 0.7458 0.5211 0.4835 0.1373  0.0909  0.0245  301 LYS B CE  
4380 N NZ  . LYS B 86  ? 0.9513 0.7613 0.7170 0.1539  0.1037  0.0281  301 LYS B NZ  
4394 N N   . PHE B 87  ? 0.4365 0.1839 0.2054 0.0797  0.0035  0.0209  302 PHE B N   
4395 C CA  . PHE B 87  ? 0.4136 0.1483 0.1758 0.0686  -0.0063 0.0159  302 PHE B CA  
4396 C C   . PHE B 87  ? 0.4542 0.1547 0.1784 0.0599  -0.0056 0.0106  302 PHE B C   
4397 O O   . PHE B 87  ? 0.4700 0.1644 0.1761 0.0573  -0.0067 0.0112  302 PHE B O   
4398 C CB  . PHE B 87  ? 0.3925 0.1486 0.1773 0.0608  -0.0250 0.0152  302 PHE B CB  
4399 C CG  . PHE B 87  ? 0.3578 0.1457 0.1774 0.0668  -0.0281 0.0153  302 PHE B CG  
4400 C CD1 . PHE B 87  ? 0.3898 0.1835 0.2153 0.0676  -0.0220 0.0148  302 PHE B CD1 
4401 C CD2 . PHE B 87  ? 0.3539 0.1644 0.1981 0.0703  -0.0384 0.0155  302 PHE B CD2 
4402 C CE1 . PHE B 87  ? 0.3517 0.1780 0.2053 0.0723  -0.0246 0.0139  302 PHE B CE1 
4403 C CE2 . PHE B 87  ? 0.3312 0.1721 0.2057 0.0765  -0.0419 0.0120  302 PHE B CE2 
4404 C CZ  . PHE B 87  ? 0.3201 0.1709 0.1978 0.0776  -0.0341 0.0110  302 PHE B CZ  
4414 N N   . TRP B 88  ? 0.4702 0.1488 0.1818 0.0539  -0.0048 0.0056  303 TRP B N   
4415 C CA  . TRP B 88  ? 0.5076 0.1574 0.1886 0.0403  -0.0118 -0.0020 303 TRP B CA  
4416 C C   . TRP B 88  ? 0.4945 0.1612 0.1950 0.0257  -0.0299 -0.0029 303 TRP B C   
4417 O O   . TRP B 88  ? 0.5286 0.2009 0.2446 0.0210  -0.0299 -0.0024 303 TRP B O   
4418 C CB  . TRP B 88  ? 0.5475 0.1582 0.2017 0.0419  -0.0003 -0.0084 303 TRP B CB  
4419 C CG  . TRP B 88  ? 0.5673 0.1639 0.2018 0.0582  0.0170  -0.0106 303 TRP B CG  
4420 C CD1 . TRP B 88  ? 0.6051 0.1804 0.2036 0.0585  0.0221  -0.0190 303 TRP B CD1 
4421 C CD2 . TRP B 88  ? 0.5527 0.1602 0.2028 0.0773  0.0317  -0.0051 303 TRP B CD2 
4422 N NE1 . TRP B 88  ? 0.6141 0.1884 0.2072 0.0774  0.0410  -0.0198 303 TRP B NE1 
4423 C CE2 . TRP B 88  ? 0.5791 0.1765 0.2074 0.0888  0.0457  -0.0103 303 TRP B CE2 
4424 C CE3 . TRP B 88  ? 0.5401 0.1767 0.2251 0.0842  0.0332  0.0041  303 TRP B CE3 
4425 C CZ2 . TRP B 88  ? 0.5696 0.1867 0.2145 0.1066  0.0601  -0.0058 303 TRP B CZ2 
4426 C CZ3 . TRP B 88  ? 0.5084 0.1631 0.2064 0.1007  0.0462  0.0079  303 TRP B CZ3 
4427 C CH2 . TRP B 88  ? 0.5338 0.1789 0.2136 0.1119  0.0589  0.0035  303 TRP B CH2 
4438 N N   . ALA B 89  ? 0.4907 0.1680 0.1914 0.0192  -0.0452 -0.0031 304 ALA B N   
4439 C CA  . ALA B 89  ? 0.4760 0.1762 0.2000 0.0086  -0.0644 -0.0045 304 ALA B CA  
4440 C C   . ALA B 89  ? 0.5099 0.1913 0.2145 -0.0094 -0.0742 -0.0122 304 ALA B C   
4441 O O   . ALA B 89  ? 0.5478 0.2005 0.2155 -0.0153 -0.0763 -0.0170 304 ALA B O   
4442 C CB  . ALA B 89  ? 0.4641 0.1808 0.1976 0.0113  -0.0789 -0.0003 304 ALA B CB  
4448 N N   . ASP B 90  ? 0.4972 0.1991 0.2279 -0.0190 -0.0810 -0.0140 305 ASP B N   
4449 C CA  . ASP B 90  ? 0.5247 0.2187 0.2472 -0.0392 -0.0934 -0.0208 305 ASP B CA  
4450 C C   . ASP B 90  ? 0.5197 0.2392 0.2558 -0.0450 -0.1171 -0.0228 305 ASP B C   
4451 O O   . ASP B 90  ? 0.4874 0.2485 0.2641 -0.0426 -0.1260 -0.0216 305 ASP B O   
4452 C CB  . ASP B 90  ? 0.5156 0.2244 0.2623 -0.0489 -0.0880 -0.0197 305 ASP B CB  
4453 C CG  . ASP B 90  ? 0.5494 0.2473 0.2882 -0.0737 -0.0989 -0.0264 305 ASP B CG  
4454 O OD1 . ASP B 90  ? 0.5756 0.2604 0.2939 -0.0823 -0.1136 -0.0332 305 ASP B OD1 
4455 O OD2 . ASP B 90  ? 0.5736 0.2795 0.3281 -0.0863 -0.0940 -0.0239 305 ASP B OD2 
4460 N N   . LEU B 91  ? 0.5542 0.2505 0.2563 -0.0509 -0.1280 -0.0261 306 LEU B N   
4461 C CA  . LEU B 91  ? 0.6536 0.3705 0.3643 -0.0564 -0.1537 -0.0265 306 LEU B CA  
4462 C C   . LEU B 91  ? 0.6709 0.3836 0.3719 -0.0780 -0.1689 -0.0355 306 LEU B C   
4463 O O   . LEU B 91  ? 0.6294 0.3445 0.3184 -0.0841 -0.1892 -0.0370 306 LEU B O   
4464 C CB  . LEU B 91  ? 0.6144 0.3128 0.2922 -0.0495 -0.1594 -0.0213 306 LEU B CB  
4465 C CG  . LEU B 91  ? 0.6446 0.3470 0.3309 -0.0313 -0.1475 -0.0113 306 LEU B CG  
4466 C CD1 . LEU B 91  ? 0.7372 0.4266 0.3936 -0.0300 -0.1587 -0.0035 306 LEU B CD1 
4467 C CD2 . LEU B 91  ? 0.5806 0.3214 0.3192 -0.0215 -0.1529 -0.0084 306 LEU B CD2 
4479 N N   . ASN B 92  ? 0.8396 0.5458 0.5459 -0.0907 -0.1594 -0.0404 307 ASN B N   
4480 C CA  . ASN B 92  ? 0.9449 0.6420 0.6401 -0.1148 -0.1729 -0.0497 307 ASN B CA  
4481 C C   . ASN B 92  ? 0.7851 0.5306 0.5322 -0.1266 -0.1795 -0.0492 307 ASN B C   
4482 O O   . ASN B 92  ? 0.7727 0.5167 0.5314 -0.1362 -0.1656 -0.0480 307 ASN B O   
4483 C CB  . ASN B 92  ? 1.0223 0.6651 0.6763 -0.1218 -0.1565 -0.0559 307 ASN B CB  
4484 C CG  . ASN B 92  ? 1.0344 0.6732 0.6930 -0.1454 -0.1617 -0.0622 307 ASN B CG  
4485 O OD1 . ASN B 92  ? 1.0670 0.7339 0.7413 -0.1577 -0.1799 -0.0652 307 ASN B OD1 
4486 N ND2 . ASN B 92  ? 1.0441 0.6478 0.6906 -0.1515 -0.1458 -0.0634 307 ASN B ND2 
4493 N N   . TRP B 93  ? 0.8566 0.6465 0.6348 -0.1249 -0.2008 -0.0493 308 TRP B N   
4494 C CA  . TRP B 93  ? 0.9479 0.7966 0.7826 -0.1289 -0.2052 -0.0491 308 TRP B CA  
4495 C C   . TRP B 93  ? 0.9566 0.8479 0.8197 -0.1393 -0.2310 -0.0544 308 TRP B C   
4496 O O   . TRP B 93  ? 0.8247 0.7040 0.6676 -0.1397 -0.2411 -0.0559 308 TRP B O   
4497 C CB  . TRP B 93  ? 0.6365 0.5155 0.5029 -0.1025 -0.1971 -0.0432 308 TRP B CB  
4498 C CG  . TRP B 93  ? 0.5869 0.4894 0.4707 -0.0857 -0.2180 -0.0424 308 TRP B CG  
4499 C CD1 . TRP B 93  ? 0.5462 0.5017 0.4758 -0.0826 -0.2370 -0.0464 308 TRP B CD1 
4500 C CD2 . TRP B 93  ? 0.6088 0.4823 0.4658 -0.0687 -0.2225 -0.0363 308 TRP B CD2 
4501 N NE1 . TRP B 93  ? 0.5969 0.5549 0.5313 -0.0614 -0.2465 -0.0418 308 TRP B NE1 
4502 C CE2 . TRP B 93  ? 0.6112 0.5190 0.5014 -0.0549 -0.2397 -0.0346 308 TRP B CE2 
4503 C CE3 . TRP B 93  ? 0.8506 0.6763 0.6627 -0.0630 -0.2086 -0.0309 308 TRP B CE3 
4504 C CZ2 . TRP B 93  ? 0.6615 0.5514 0.5391 -0.0388 -0.2440 -0.0258 308 TRP B CZ2 
4505 C CZ3 . TRP B 93  ? 0.9715 0.7843 0.7692 -0.0491 -0.2176 -0.0234 308 TRP B CZ3 
4506 C CH2 . TRP B 93  ? 0.7823 0.6261 0.6144 -0.0377 -0.2335 -0.0195 308 TRP B CH2 
4517 N N   . GLY B 109 ? 0.5694 0.7866 0.7325 0.0056  -0.3265 -0.0531 324 GLY B N   
4518 C CA  . GLY B 109 ? 0.5905 0.8049 0.7731 0.0283  -0.3147 -0.0552 324 GLY B CA  
4519 C C   . GLY B 109 ? 0.7202 0.9325 0.8995 0.0211  -0.2931 -0.0598 324 GLY B C   
4520 O O   . GLY B 109 ? 0.8007 0.9787 0.9436 0.0050  -0.2876 -0.0564 324 GLY B O   
4523 N N   . GLY B 110 ? 0.7021 0.9492 0.9171 0.0331  -0.2807 -0.0678 325 GLY B N   
4524 C CA  . GLY B 110 ? 0.6889 0.9402 0.9029 0.0266  -0.2607 -0.0721 325 GLY B CA  
4525 C C   . GLY B 110 ? 0.5104 0.7391 0.7223 0.0479  -0.2477 -0.0748 325 GLY B C   
4526 O O   . GLY B 110 ? 0.5125 0.7135 0.7198 0.0657  -0.2544 -0.0729 325 GLY B O   
4530 N N   . PHE B 111 ? 0.3034 0.5902 0.3250 -0.0295 -0.0629 -0.0250 326 PHE B N   
4531 C CA  . PHE B 111 ? 0.3838 0.6692 0.4222 -0.0089 -0.0605 -0.0370 326 PHE B CA  
4532 C C   . PHE B 111 ? 0.2036 0.4223 0.2182 -0.0093 -0.0589 -0.0226 326 PHE B C   
4533 O O   . PHE B 111 ? 0.3049 0.5025 0.2861 -0.0305 -0.0572 -0.0088 326 PHE B O   
4534 C CB  . PHE B 111 ? 0.2825 0.6329 0.3272 -0.0171 -0.0550 -0.0504 326 PHE B CB  
4535 C CG  . PHE B 111 ? 0.1913 0.5328 0.2464 0.0004  -0.0526 -0.0603 326 PHE B CG  
4536 C CD1 . PHE B 111 ? 0.2259 0.5774 0.3132 0.0315  -0.0568 -0.0795 326 PHE B CD1 
4537 C CD2 . PHE B 111 ? 0.2629 0.5776 0.2922 -0.0138 -0.0486 -0.0492 326 PHE B CD2 
4538 C CE1 . PHE B 111 ? 0.1871 0.5252 0.2804 0.0455  -0.0559 -0.0872 326 PHE B CE1 
4539 C CE2 . PHE B 111 ? 0.2404 0.5462 0.2782 0.0008  -0.0468 -0.0568 326 PHE B CE2 
4540 C CZ  . PHE B 111 ? 0.2117 0.5299 0.2816 0.0295  -0.0498 -0.0757 326 PHE B CZ  
4550 N N   . TYR B 112 ? 0.2173 0.4033 0.2474 0.0141  -0.0612 -0.0262 327 TYR B N   
4551 C CA  . TYR B 112 ? 0.2076 0.3407 0.2216 0.0177  -0.0596 -0.0155 327 TYR B CA  
4552 C C   . TYR B 112 ? 0.1933 0.3387 0.2194 0.0284  -0.0571 -0.0255 327 TYR B C   
4553 O O   . TYR B 112 ? 0.1830 0.3468 0.2353 0.0457  -0.0601 -0.0402 327 TYR B O   
4554 C CB  . TYR B 112 ? 0.2300 0.3227 0.2499 0.0313  -0.0638 -0.0111 327 TYR B CB  
4555 C CG  . TYR B 112 ? 0.2560 0.3290 0.2594 0.0199  -0.0661 0.0004  327 TYR B CG  
4556 C CD1 . TYR B 112 ? 0.2398 0.3429 0.2556 0.0166  -0.0702 -0.0044 327 TYR B CD1 
4557 C CD2 . TYR B 112 ? 0.2312 0.2574 0.2057 0.0134  -0.0648 0.0148  327 TYR B CD2 
4558 C CE1 . TYR B 112 ? 0.2664 0.3517 0.2658 0.0043  -0.0728 0.0067  327 TYR B CE1 
4559 C CE2 . TYR B 112 ? 0.3143 0.3190 0.2702 0.0026  -0.0675 0.0249  327 TYR B CE2 
4560 C CZ  . TYR B 112 ? 0.2656 0.2993 0.2338 -0.0035 -0.0713 0.0217  327 TYR B CZ  
4561 O OH  . TYR B 112 ? 0.4441 0.4569 0.3925 -0.0164 -0.0745 0.0324  327 TYR B OH  
4571 N N   . GLY B 113 ? 0.2078 0.3391 0.2123 0.0188  -0.0537 -0.0177 328 GLY B N   
4572 C CA  . GLY B 113 ? 0.1884 0.3312 0.2027 0.0271  -0.0515 -0.0261 328 GLY B CA  
4573 C C   . GLY B 113 ? 0.1959 0.3017 0.1919 0.0276  -0.0507 -0.0157 328 GLY B C   
4574 O O   . GLY B 113 ? 0.2117 0.2802 0.1820 0.0216  -0.0521 -0.0018 328 GLY B O   
4578 N N   . VAL B 114 ? 0.2098 0.3268 0.2192 0.0370  -0.0495 -0.0241 329 VAL B N   
4579 C CA  . VAL B 114 ? 0.2259 0.3197 0.2238 0.0395  -0.0492 -0.0174 329 VAL B CA  
4580 C C   . VAL B 114 ? 0.2159 0.3395 0.2137 0.0329  -0.0472 -0.0248 329 VAL B C   
4581 O O   . VAL B 114 ? 0.2063 0.3665 0.2245 0.0372  -0.0458 -0.0402 329 VAL B O   
4582 C CB  . VAL B 114 ? 0.2062 0.2813 0.2206 0.0566  -0.0507 -0.0187 329 VAL B CB  
4583 C CG1 . VAL B 114 ? 0.2505 0.3081 0.2535 0.0595  -0.0504 -0.0114 329 VAL B CG1 
4584 C CG2 . VAL B 114 ? 0.2207 0.2701 0.2344 0.0607  -0.0525 -0.0119 329 VAL B CG2 
4594 N N   . SER B 115 ? 0.2224 0.3298 0.1945 0.0227  -0.0484 -0.0147 330 SER B N   
4595 C CA  . SER B 115 ? 0.2250 0.3558 0.1908 0.0127  -0.0475 -0.0188 330 SER B CA  
4596 C C   . SER B 115 ? 0.2333 0.3356 0.1867 0.0181  -0.0509 -0.0106 330 SER B C   
4597 O O   . SER B 115 ? 0.2628 0.3264 0.1955 0.0206  -0.0558 0.0018  330 SER B O   
4598 C CB  . SER B 115 ? 0.2386 0.3846 0.1775 -0.0136 -0.0485 -0.0136 330 SER B CB  
4599 O OG  . SER B 115 ? 0.2790 0.4699 0.2341 -0.0190 -0.0444 -0.0247 330 SER B OG  
4605 N N   . SER B 116 ? 0.2401 0.3630 0.2056 0.0212  -0.0493 -0.0189 331 SER B N   
4606 C CA  . SER B 116 ? 0.2429 0.3480 0.2037 0.0283  -0.0525 -0.0136 331 SER B CA  
4607 C C   . SER B 116 ? 0.2485 0.3767 0.2016 0.0156  -0.0525 -0.0177 331 SER B C   
4608 O O   . SER B 116 ? 0.2695 0.4344 0.2369 0.0118  -0.0478 -0.0313 331 SER B O   
4609 C CB  . SER B 116 ? 0.2862 0.3922 0.2745 0.0465  -0.0512 -0.0198 331 SER B CB  
4610 O OG  . SER B 116 ? 0.3553 0.4349 0.3432 0.0569  -0.0527 -0.0117 331 SER B OG  
4616 N N   . GLN B 117 ? 0.2532 0.3607 0.1831 0.0106  -0.0587 -0.0073 332 GLN B N   
4617 C CA  . GLN B 117 ? 0.2597 0.3857 0.1806 -0.0021 -0.0599 -0.0097 332 GLN B CA  
4618 C C   . GLN B 117 ? 0.2754 0.3782 0.1898 0.0077  -0.0668 -0.0018 332 GLN B C   
4619 O O   . GLN B 117 ? 0.2885 0.3552 0.1858 0.0157  -0.0746 0.0097  332 GLN B O   
4620 C CB  . GLN B 117 ? 0.2994 0.4277 0.1860 -0.0295 -0.0637 -0.0028 332 GLN B CB  
4621 C CG  . GLN B 117 ? 0.5329 0.6929 0.4124 -0.0469 -0.0627 -0.0084 332 GLN B CG  
4622 C CD  . GLN B 117 ? 0.5672 0.7365 0.4104 -0.0803 -0.0668 -0.0014 332 GLN B CD  
4623 O OE1 . GLN B 117 ? 0.6547 0.8209 0.4847 -0.0921 -0.0675 0.0034  332 GLN B OE1 
4624 N NE2 . GLN B 117 ? 0.7463 0.9249 0.5728 -0.0974 -0.0694 0.0003  332 GLN B NE2 
4633 N N   . TYR B 118 ? 0.2609 0.3864 0.1895 0.0088  -0.0645 -0.0097 333 TYR B N   
4634 C CA  . TYR B 118 ? 0.2657 0.3802 0.1935 0.0173  -0.0702 -0.0043 333 TYR B CA  
4635 C C   . TYR B 118 ? 0.2761 0.4053 0.1892 0.0006  -0.0729 -0.0053 333 TYR B C   
4636 O O   . TYR B 118 ? 0.2716 0.4299 0.1853 -0.0138 -0.0670 -0.0150 333 TYR B O   
4637 C CB  . TYR B 118 ? 0.2454 0.3718 0.2044 0.0333  -0.0661 -0.0118 333 TYR B CB  
4638 C CG  . TYR B 118 ? 0.2338 0.3494 0.2087 0.0478  -0.0636 -0.0112 333 TYR B CG  
4639 C CD1 . TYR B 118 ? 0.2507 0.3483 0.2238 0.0610  -0.0677 -0.0019 333 TYR B CD1 
4640 C CD2 . TYR B 118 ? 0.2385 0.3641 0.2296 0.0491  -0.0580 -0.0210 333 TYR B CD2 
4641 C CE1 . TYR B 118 ? 0.2273 0.3189 0.2135 0.0717  -0.0648 -0.0017 333 TYR B CE1 
4642 C CE2 . TYR B 118 ? 0.2361 0.3498 0.2393 0.0599  -0.0569 -0.0194 333 TYR B CE2 
4643 C CZ  . TYR B 118 ? 0.2433 0.3408 0.2431 0.0693  -0.0596 -0.0095 333 TYR B CZ  
4644 O OH  . TYR B 118 ? 0.2757 0.3654 0.2859 0.0773  -0.0580 -0.0083 333 TYR B OH  
4654 N N   . GLU B 119 ? 0.3031 0.4163 0.2043 0.0037  -0.0818 0.0036  334 GLU B N   
4655 C CA  . GLU B 119 ? 0.3075 0.4319 0.1934 -0.0124 -0.0859 0.0040  334 GLU B CA  
4656 C C   . GLU B 119 ? 0.3131 0.4418 0.2126 -0.0008 -0.0892 0.0044  334 GLU B C   
4657 O O   . GLU B 119 ? 0.2983 0.4130 0.2069 0.0182  -0.0935 0.0102  334 GLU B O   
4658 C CB  . GLU B 119 ? 0.3708 0.4646 0.2136 -0.0284 -0.0992 0.0184  334 GLU B CB  
4659 C CG  . GLU B 119 ? 0.8052 0.9072 0.6259 -0.0544 -0.0968 0.0183  334 GLU B CG  
4660 C CD  . GLU B 119 ? 0.9428 1.0022 0.7157 -0.0720 -0.1126 0.0347  334 GLU B CD  
4661 O OE1 . GLU B 119 ? 0.7196 0.7503 0.4777 -0.0669 -0.1241 0.0430  334 GLU B OE1 
4662 O OE2 . GLU B 119 ? 0.8521 0.9045 0.6123 -0.0871 -0.1094 0.0370  334 GLU B OE2 
4669 N N   . SER B 120 ? 0.3210 0.4725 0.2202 -0.0135 -0.0876 -0.0018 335 SER B N   
4670 C CA  . SER B 120 ? 0.3194 0.4767 0.2275 -0.0075 -0.0918 -0.0007 335 SER B CA  
4671 C C   . SER B 120 ? 0.3524 0.5202 0.2401 -0.0281 -0.0957 -0.0005 335 SER B C   
4672 O O   . SER B 120 ? 0.3419 0.5233 0.2151 -0.0474 -0.0916 -0.0058 335 SER B O   
4673 C CB  . SER B 120 ? 0.2974 0.4749 0.2373 0.0028  -0.0835 -0.0130 335 SER B CB  
4674 O OG  . SER B 120 ? 0.5405 0.7226 0.4866 0.0067  -0.0891 -0.0091 335 SER B OG  
4680 N N   . LEU B 121 ? 0.3383 0.5045 0.2253 -0.0250 -0.1036 0.0052  336 LEU B N   
4681 C CA  . LEU B 121 ? 0.3581 0.5369 0.2294 -0.0440 -0.1069 0.0041  336 LEU B CA  
4682 C C   . LEU B 121 ? 0.3362 0.5449 0.2287 -0.0455 -0.0969 -0.0121 336 LEU B C   
4683 O O   . LEU B 121 ? 0.3467 0.5736 0.2275 -0.0630 -0.0949 -0.0192 336 LEU B O   
4684 C CB  . LEU B 121 ? 0.4412 0.6034 0.3000 -0.0400 -0.1221 0.0180  336 LEU B CB  
4685 C CG  . LEU B 121 ? 0.5021 0.6277 0.3259 -0.0435 -0.1378 0.0331  336 LEU B CG  
4686 C CD1 . LEU B 121 ? 0.7544 0.8632 0.5761 -0.0256 -0.1533 0.0436  336 LEU B CD1 
4687 C CD2 . LEU B 121 ? 0.6506 0.7691 0.4479 -0.0704 -0.1365 0.0336  336 LEU B CD2 
4699 N N   . GLU B 122 ? 0.3208 0.5329 0.2407 -0.0284 -0.0921 -0.0182 337 GLU B N   
4700 C CA  . GLU B 122 ? 0.3520 0.5833 0.2861 -0.0294 -0.0857 -0.0349 337 GLU B CA  
4701 C C   . GLU B 122 ? 0.3068 0.5475 0.2521 -0.0244 -0.0761 -0.0512 337 GLU B C   
4702 O O   . GLU B 122 ? 0.3093 0.5405 0.2609 -0.0159 -0.0735 -0.0482 337 GLU B O   
4703 C CB  . GLU B 122 ? 0.3190 0.5472 0.2709 -0.0187 -0.0896 -0.0328 337 GLU B CB  
4704 C CG  . GLU B 122 ? 0.4282 0.6452 0.3899 -0.0051 -0.0936 -0.0194 337 GLU B CG  
4705 C CD  . GLU B 122 ? 0.5575 0.7810 0.5349 -0.0003 -0.0974 -0.0169 337 GLU B CD  
4706 O OE1 . GLU B 122 ? 0.4793 0.7073 0.4591 -0.0071 -0.0973 -0.0265 337 GLU B OE1 
4707 O OE2 . GLU B 122 ? 0.4219 0.6467 0.4073 0.0099  -0.1012 -0.0058 337 GLU B OE2 
4714 N N   . HIS B 123 ? 0.2865 0.5462 0.2333 -0.0283 -0.0721 -0.0693 338 HIS B N   
4715 C CA  . HIS B 123 ? 0.2669 0.5392 0.2258 -0.0192 -0.0657 -0.0899 338 HIS B CA  
4716 C C   . HIS B 123 ? 0.2582 0.5095 0.2342 -0.0029 -0.0700 -0.0922 338 HIS B C   
4717 O O   . HIS B 123 ? 0.2956 0.5384 0.2710 -0.0037 -0.0760 -0.0917 338 HIS B O   
4718 C CB  . HIS B 123 ? 0.3138 0.6144 0.2647 -0.0270 -0.0623 -0.1107 338 HIS B CB  
4719 C CG  . HIS B 123 ? 0.3745 0.6951 0.3364 -0.0147 -0.0567 -0.1347 338 HIS B CG  
4720 N ND1 . HIS B 123 ? 0.5399 0.8446 0.5151 0.0048  -0.0612 -0.1487 338 HIS B ND1 
4721 C CD2 . HIS B 123 ? 0.4998 0.8524 0.4619 -0.0185 -0.0477 -0.1451 338 HIS B CD2 
4722 C CE1 . HIS B 123 ? 0.6412 0.9687 0.6242 0.0160  -0.0568 -0.1698 338 HIS B CE1 
4723 N NE2 . HIS B 123 ? 0.4391 0.7994 0.4173 0.0022  -0.0469 -0.1673 338 HIS B NE2 
4731 N N   . MET B 124 ? 0.2899 0.5314 0.2783 0.0092  -0.0681 -0.0928 339 MET B N   
4732 C CA  . MET B 124 ? 0.2687 0.4880 0.2694 0.0213  -0.0738 -0.0938 339 MET B CA  
4733 C C   . MET B 124 ? 0.2643 0.4828 0.2748 0.0339  -0.0718 -0.1081 339 MET B C   
4734 O O   . MET B 124 ? 0.2775 0.5160 0.2882 0.0334  -0.0648 -0.1142 339 MET B O   
4735 C CB  . MET B 124 ? 0.2566 0.4603 0.2625 0.0228  -0.0764 -0.0727 339 MET B CB  
4736 C CG  . MET B 124 ? 0.2858 0.4938 0.2837 0.0140  -0.0796 -0.0576 339 MET B CG  
4737 S SD  . MET B 124 ? 0.3309 0.5301 0.3374 0.0217  -0.0826 -0.0370 339 MET B SD  
4738 C CE  . MET B 124 ? 0.2747 0.4686 0.2707 0.0246  -0.0793 -0.0283 339 MET B CE  
4748 N N   . THR B 125 ? 0.2460 0.4411 0.2628 0.0437  -0.0795 -0.1124 340 THR B N   
4749 C CA  . THR B 125 ? 0.2453 0.4316 0.2718 0.0567  -0.0804 -0.1203 340 THR B CA  
4750 C C   . THR B 125 ? 0.2379 0.4020 0.2698 0.0561  -0.0828 -0.1006 340 THR B C   
4751 O O   . THR B 125 ? 0.2468 0.3957 0.2757 0.0505  -0.0896 -0.0909 340 THR B O   
4752 C CB  . THR B 125 ? 0.3177 0.4895 0.3430 0.0697  -0.0906 -0.1422 340 THR B CB  
4753 O OG1 . THR B 125 ? 0.3418 0.5408 0.3623 0.0722  -0.0875 -0.1629 340 THR B OG1 
4754 C CG2 . THR B 125 ? 0.3133 0.4761 0.3489 0.0846  -0.0932 -0.1496 340 THR B CG2 
4762 N N   . LEU B 126 ? 0.2467 0.4140 0.2851 0.0599  -0.0767 -0.0951 341 LEU B N   
4763 C CA  . LEU B 126 ? 0.2536 0.4053 0.2967 0.0607  -0.0767 -0.0784 341 LEU B CA  
4764 C C   . LEU B 126 ? 0.2456 0.3766 0.2950 0.0693  -0.0830 -0.0836 341 LEU B C   
4765 O O   . LEU B 126 ? 0.2611 0.3949 0.3144 0.0783  -0.0838 -0.0986 341 LEU B O   
4766 C CB  . LEU B 126 ? 0.3184 0.4792 0.3597 0.0591  -0.0682 -0.0684 341 LEU B CB  
4767 C CG  . LEU B 126 ? 0.2820 0.4551 0.3115 0.0499  -0.0646 -0.0595 341 LEU B CG  
4768 C CD1 . LEU B 126 ? 0.2499 0.4171 0.2726 0.0495  -0.0609 -0.0487 341 LEU B CD1 
4769 C CD2 . LEU B 126 ? 0.2514 0.4216 0.2789 0.0469  -0.0692 -0.0492 341 LEU B CD2 
4781 N N   . THR B 127 ? 0.2308 0.3441 0.2806 0.0659  -0.0881 -0.0713 342 THR B N   
4782 C CA  . THR B 127 ? 0.2374 0.3292 0.2903 0.0703  -0.0939 -0.0707 342 THR B CA  
4783 C C   . THR B 127 ? 0.2175 0.3136 0.2746 0.0691  -0.0859 -0.0549 342 THR B C   
4784 O O   . THR B 127 ? 0.2152 0.3203 0.2714 0.0634  -0.0832 -0.0423 342 THR B O   
4785 C CB  . THR B 127 ? 0.2646 0.3309 0.3093 0.0632  -0.1080 -0.0684 342 THR B CB  
4786 O OG1 . THR B 127 ? 0.3267 0.3825 0.3627 0.0654  -0.1177 -0.0837 342 THR B OG1 
4787 C CG2 . THR B 127 ? 0.2752 0.3166 0.3196 0.0660  -0.1156 -0.0674 342 THR B CG2 
4795 N N   . CYS B 128 ? 0.2685 0.3602 0.3298 0.0757  -0.0830 -0.0570 343 CYS B N   
4796 C CA  . CYS B 128 ? 0.2534 0.3456 0.3155 0.0757  -0.0762 -0.0444 343 CYS B CA  
4797 C C   . CYS B 128 ? 0.2608 0.3329 0.3248 0.0764  -0.0821 -0.0423 343 CYS B C   
4798 O O   . CYS B 128 ? 0.2830 0.3450 0.3497 0.0822  -0.0868 -0.0520 343 CYS B O   
4799 C CB  . CYS B 128 ? 0.2860 0.3890 0.3464 0.0786  -0.0681 -0.0465 343 CYS B CB  
4800 S SG  . CYS B 128 ? 0.4615 0.5864 0.5135 0.0730  -0.0632 -0.0487 343 CYS B SG  
4806 N N   . SER B 129 ? 0.2044 0.2741 0.2666 0.0702  -0.0826 -0.0300 344 SER B N   
4807 C CA  . SER B 129 ? 0.2143 0.2666 0.2750 0.0661  -0.0884 -0.0252 344 SER B CA  
4808 C C   . SER B 129 ? 0.1991 0.2571 0.2603 0.0685  -0.0794 -0.0157 344 SER B C   
4809 O O   . SER B 129 ? 0.2352 0.3107 0.2959 0.0688  -0.0731 -0.0083 344 SER B O   
4810 C CB  . SER B 129 ? 0.2352 0.2842 0.2898 0.0526  -0.0972 -0.0189 344 SER B CB  
4811 O OG  . SER B 129 ? 0.5218 0.5617 0.5725 0.0445  -0.1002 -0.0102 344 SER B OG  
4817 N N   . SER B 130 ? 0.2735 0.3168 0.3349 0.0718  -0.0800 -0.0171 345 SER B N   
4818 C CA  . SER B 130 ? 0.2565 0.2993 0.3151 0.0732  -0.0733 -0.0088 345 SER B CA  
4819 C C   . SER B 130 ? 0.2778 0.3061 0.3332 0.0648  -0.0799 -0.0036 345 SER B C   
4820 O O   . SER B 130 ? 0.3287 0.3360 0.3835 0.0632  -0.0898 -0.0083 345 SER B O   
4821 C CB  . SER B 130 ? 0.2452 0.2836 0.3031 0.0802  -0.0686 -0.0127 345 SER B CB  
4822 O OG  . SER B 130 ? 0.3036 0.3553 0.3594 0.0834  -0.0634 -0.0154 345 SER B OG  
4828 N N   . LYS B 131 ? 0.1995 0.2406 0.2517 0.0597  -0.0753 0.0054  346 LYS B N   
4829 C CA  . LYS B 131 ? 0.2172 0.2505 0.2635 0.0469  -0.0808 0.0119  346 LYS B CA  
4830 C C   . LYS B 131 ? 0.2274 0.2650 0.2699 0.0507  -0.0720 0.0169  346 LYS B C   
4831 O O   . LYS B 131 ? 0.1990 0.2579 0.2417 0.0592  -0.0625 0.0183  346 LYS B O   
4832 C CB  . LYS B 131 ? 0.2314 0.2853 0.2748 0.0324  -0.0837 0.0179  346 LYS B CB  
4833 C CG  . LYS B 131 ? 0.5252 0.5795 0.5692 0.0278  -0.0912 0.0143  346 LYS B CG  
4834 C CD  . LYS B 131 ? 0.6893 0.7675 0.7278 0.0081  -0.0948 0.0228  346 LYS B CD  
4835 C CE  . LYS B 131 ? 0.8139 0.8809 0.8456 -0.0037 -0.1074 0.0212  346 LYS B CE  
4836 N NZ  . LYS B 131 ? 0.4770 0.5682 0.5189 0.0079  -0.0995 0.0169  346 LYS B NZ  
4850 N N   . VAL B 132 ? 0.2313 0.2465 0.2688 0.0455  -0.0770 0.0187  347 VAL B N   
4851 C CA  . VAL B 132 ? 0.2142 0.2296 0.2454 0.0461  -0.0704 0.0234  347 VAL B CA  
4852 C C   . VAL B 132 ? 0.2526 0.2811 0.2767 0.0286  -0.0728 0.0307  347 VAL B C   
4853 O O   . VAL B 132 ? 0.2559 0.2691 0.2743 0.0121  -0.0852 0.0340  347 VAL B O   
4854 C CB  . VAL B 132 ? 0.2352 0.2217 0.2641 0.0483  -0.0747 0.0219  347 VAL B CB  
4855 C CG1 . VAL B 132 ? 0.2146 0.1999 0.2344 0.0488  -0.0675 0.0267  347 VAL B CG1 
4856 C CG2 . VAL B 132 ? 0.1960 0.1786 0.2309 0.0611  -0.0724 0.0148  347 VAL B CG2 
4866 N N   . CYS B 133 ? 0.3042 0.3622 0.3265 0.0321  -0.0621 0.0325  348 CYS B N   
4867 C CA  . CYS B 133 ? 0.3435 0.4227 0.3583 0.0144  -0.0622 0.0386  348 CYS B CA  
4868 C C   . CYS B 133 ? 0.4044 0.4793 0.4104 0.0172  -0.0559 0.0396  348 CYS B C   
4869 O O   . CYS B 133 ? 0.3285 0.4007 0.3338 0.0369  -0.0476 0.0350  348 CYS B O   
4870 C CB  . CYS B 133 ? 0.5339 0.6634 0.5541 0.0142  -0.0554 0.0381  348 CYS B CB  
4871 S SG  . CYS B 133 ? 0.4747 0.6066 0.5010 0.0043  -0.0649 0.0389  348 CYS B SG  
4877 N N   . SER B 134 ? 0.5008 0.5717 0.4963 -0.0050 -0.0620 0.0463  349 SER B N   
4878 C CA  . SER B 134 ? 0.5546 0.6216 0.5390 -0.0085 -0.0577 0.0485  349 SER B CA  
4879 C C   . SER B 134 ? 0.5227 0.6317 0.4996 -0.0291 -0.0550 0.0527  349 SER B C   
4880 O O   . SER B 134 ? 0.4909 0.5999 0.4603 -0.0564 -0.0660 0.0605  349 SER B O   
4881 C CB  . SER B 134 ? 0.6698 0.6884 0.6462 -0.0189 -0.0703 0.0532  349 SER B CB  
4882 O OG  . SER B 134 ? 0.5429 0.5578 0.5071 -0.0247 -0.0666 0.0562  349 SER B OG  
4888 N N   . PHE B 135 ? 0.5045 0.6505 0.4806 -0.0168 -0.0414 0.0471  350 PHE B N   
4889 C CA  . PHE B 135 ? 0.4879 0.6890 0.4587 -0.0348 -0.0362 0.0485  350 PHE B CA  
4890 C C   . PHE B 135 ? 0.5980 0.8361 0.5765 -0.0496 -0.0399 0.0514  350 PHE B C   
4891 O O   . PHE B 135 ? 0.4468 0.7174 0.4162 -0.0807 -0.0434 0.0584  350 PHE B O   
4892 C CB  . PHE B 135 ? 0.4530 0.6378 0.4055 -0.0652 -0.0434 0.0579  350 PHE B CB  
4893 C CG  . PHE B 135 ? 0.4359 0.5931 0.3798 -0.0525 -0.0386 0.0550  350 PHE B CG  
4894 C CD1 . PHE B 135 ? 0.6076 0.8032 0.5465 -0.0411 -0.0247 0.0468  350 PHE B CD1 
4895 C CD2 . PHE B 135 ? 0.4715 0.5671 0.4125 -0.0491 -0.0479 0.0586  350 PHE B CD2 
4896 C CE1 . PHE B 135 ? 0.5045 0.6709 0.4320 -0.0294 -0.0210 0.0439  350 PHE B CE1 
4897 C CE2 . PHE B 135 ? 0.4956 0.5667 0.4276 -0.0386 -0.0437 0.0566  350 PHE B CE2 
4898 C CZ  . PHE B 135 ? 0.5433 0.6467 0.4669 -0.0298 -0.0305 0.0498  350 PHE B CZ  
4908 N N   . GLY B 136 ? 0.6010 0.8348 0.5937 -0.0300 -0.0398 0.0468  351 GLY B N   
4909 C CA  . GLY B 136 ? 0.7749 1.0442 0.7751 -0.0415 -0.0430 0.0489  351 GLY B CA  
4910 C C   . GLY B 136 ? 0.7719 1.0011 0.7652 -0.0658 -0.0601 0.0580  351 GLY B C   
4911 O O   . GLY B 136 ? 0.8175 1.0617 0.8166 -0.0706 -0.0641 0.0588  351 GLY B O   
4915 N N   . LYS B 137 ? 0.6394 0.4850 0.4273 0.0782  -0.0627 -0.0950 352 LYS B N   
4916 C CA  . LYS B 137 ? 0.6171 0.4619 0.4104 0.0890  -0.0622 -0.0781 352 LYS B CA  
4917 C C   . LYS B 137 ? 0.5917 0.4570 0.4058 0.0943  -0.0794 -0.0719 352 LYS B C   
4918 O O   . LYS B 137 ? 0.5280 0.4091 0.3380 0.0922  -0.0949 -0.0722 352 LYS B O   
4919 C CB  . LYS B 137 ? 0.6329 0.4708 0.3917 0.0951  -0.0594 -0.0609 352 LYS B CB  
4920 C CG  . LYS B 137 ? 0.8711 0.6913 0.5998 0.0902  -0.0432 -0.0647 352 LYS B CG  
4921 C CD  . LYS B 137 ? 0.9813 0.7790 0.7290 0.0859  -0.0195 -0.0755 352 LYS B CD  
4922 C CE  . LYS B 137 ? 1.0991 0.8739 0.8162 0.0854  0.0026  -0.0700 352 LYS B CE  
4923 N NZ  . LYS B 137 ? 1.2100 0.9754 0.9243 0.0729  0.0136  -0.0915 352 LYS B NZ  
4937 N N   . GLN B 138 ? 0.6000 0.4665 0.4387 0.1007  -0.0751 -0.0683 353 GLN B N   
4938 C CA  . GLN B 138 ? 0.6398 0.5248 0.4986 0.1062  -0.0883 -0.0622 353 GLN B CA  
4939 C C   . GLN B 138 ? 0.5175 0.4080 0.3611 0.1124  -0.0988 -0.0451 353 GLN B C   
4940 O O   . GLN B 138 ? 0.5804 0.4586 0.4087 0.1177  -0.0904 -0.0333 353 GLN B O   
4941 C CB  . GLN B 138 ? 0.5420 0.4298 0.4291 0.1116  -0.0798 -0.0656 353 GLN B CB  
4942 C CG  . GLN B 138 ? 0.4673 0.3731 0.3731 0.1184  -0.0904 -0.0577 353 GLN B CG  
4943 C CD  . GLN B 138 ? 0.4868 0.4027 0.4207 0.1230  -0.0830 -0.0667 353 GLN B CD  
4944 O OE1 . GLN B 138 ? 0.6197 0.5331 0.5615 0.1213  -0.0722 -0.0809 353 GLN B OE1 
4945 N NE2 . GLN B 138 ? 0.6367 0.5675 0.5873 0.1293  -0.0888 -0.0606 353 GLN B NE2 
4954 N N   . VAL B 139 ? 0.4416 0.3510 0.2908 0.1125  -0.1159 -0.0432 354 VAL B N   
4955 C CA  . VAL B 139 ? 0.4595 0.3800 0.2972 0.1195  -0.1287 -0.0287 354 VAL B CA  
4956 C C   . VAL B 139 ? 0.4799 0.4162 0.3463 0.1251  -0.1382 -0.0226 354 VAL B C   
4957 O O   . VAL B 139 ? 0.4482 0.3919 0.3134 0.1337  -0.1456 -0.0084 354 VAL B O   
4958 C CB  . VAL B 139 ? 0.7261 0.6602 0.5410 0.1142  -0.1421 -0.0354 354 VAL B CB  
4959 C CG1 . VAL B 139 ? 0.8376 0.7565 0.6234 0.1083  -0.1308 -0.0426 354 VAL B CG1 
4960 C CG2 . VAL B 139 ? 0.4596 0.4091 0.2982 0.1054  -0.1514 -0.0510 354 VAL B CG2 
4970 N N   . VAL B 140 ? 0.4079 0.3500 0.3001 0.1217  -0.1370 -0.0318 355 VAL B N   
4971 C CA  . VAL B 140 ? 0.3875 0.3439 0.3068 0.1272  -0.1425 -0.0263 355 VAL B CA  
4972 C C   . VAL B 140 ? 0.3621 0.3195 0.3019 0.1276  -0.1326 -0.0338 355 VAL B C   
4973 O O   . VAL B 140 ? 0.3572 0.3104 0.2948 0.1227  -0.1271 -0.0438 355 VAL B O   
4974 C CB  . VAL B 140 ? 0.3847 0.3595 0.3145 0.1244  -0.1576 -0.0280 355 VAL B CB  
4975 C CG1 . VAL B 140 ? 0.5930 0.5804 0.5540 0.1285  -0.1587 -0.0247 355 VAL B CG1 
4976 C CG2 . VAL B 140 ? 0.4091 0.3926 0.3229 0.1281  -0.1706 -0.0203 355 VAL B CG2 
4986 N N   . GLU B 141 ? 0.3479 0.3140 0.3079 0.1344  -0.1306 -0.0296 356 GLU B N   
4987 C CA  . GLU B 141 ? 0.3255 0.3028 0.3047 0.1374  -0.1242 -0.0364 356 GLU B CA  
4988 C C   . GLU B 141 ? 0.3129 0.3074 0.3132 0.1427  -0.1296 -0.0300 356 GLU B C   
4989 O O   . GLU B 141 ? 0.3172 0.3130 0.3247 0.1460  -0.1320 -0.0225 356 GLU B O   
4990 C CB  . GLU B 141 ? 0.3222 0.2954 0.3067 0.1403  -0.1109 -0.0451 356 GLU B CB  
4991 C CG  . GLU B 141 ? 0.5541 0.5452 0.5532 0.1444  -0.1059 -0.0563 356 GLU B CG  
4992 C CD  . GLU B 141 ? 0.5868 0.5788 0.5947 0.1458  -0.0933 -0.0720 356 GLU B CD  
4993 O OE1 . GLU B 141 ? 0.5440 0.5161 0.5462 0.1419  -0.0852 -0.0738 356 GLU B OE1 
4994 O OE2 . GLU B 141 ? 0.6025 0.6175 0.6243 0.1516  -0.0905 -0.0834 356 GLU B OE2 
5001 N N   . LYS B 142 ? 0.2995 0.3065 0.3105 0.1421  -0.1270 -0.0315 357 LYS B N   
5002 C CA  . LYS B 142 ? 0.2893 0.3117 0.3184 0.1411  -0.1225 -0.0255 357 LYS B CA  
5003 C C   . LYS B 142 ? 0.2774 0.3143 0.3122 0.1451  -0.1116 -0.0305 357 LYS B C   
5004 O O   . LYS B 142 ? 0.2754 0.3151 0.3050 0.1469  -0.1080 -0.0331 357 LYS B O   
5005 C CB  . LYS B 142 ? 0.4425 0.4688 0.4806 0.1377  -0.1274 -0.0196 357 LYS B CB  
5006 C CG  . LYS B 142 ? 0.4894 0.5283 0.5471 0.1373  -0.1257 -0.0123 357 LYS B CG  
5007 C CD  . LYS B 142 ? 0.6213 0.6700 0.6934 0.1397  -0.1191 -0.0078 357 LYS B CD  
5008 C CE  . LYS B 142 ? 0.8247 0.8816 0.9201 0.1389  -0.1222 -0.0020 357 LYS B CE  
5009 N NZ  . LYS B 142 ? 0.8498 0.9030 0.9556 0.1357  -0.1348 -0.0062 357 LYS B NZ  
5023 N N   . VAL B 143 ? 0.2716 0.3203 0.3180 0.1475  -0.1068 -0.0321 358 VAL B N   
5024 C CA  . VAL B 143 ? 0.2640 0.3317 0.3138 0.1523  -0.0984 -0.0403 358 VAL B CA  
5025 C C   . VAL B 143 ? 0.2600 0.3441 0.3219 0.1538  -0.0944 -0.0337 358 VAL B C   
5026 O O   . VAL B 143 ? 0.2591 0.3437 0.3341 0.1528  -0.0954 -0.0318 358 VAL B O   
5027 C CB  . VAL B 143 ? 0.2625 0.3335 0.3181 0.1558  -0.0950 -0.0560 358 VAL B CB  
5028 C CG1 . VAL B 143 ? 0.2570 0.3535 0.3144 0.1603  -0.0882 -0.0691 358 VAL B CG1 
5029 C CG2 . VAL B 143 ? 0.2686 0.3215 0.3147 0.1562  -0.0973 -0.0624 358 VAL B CG2 
5039 N N   . GLU B 144 ? 0.2598 0.3574 0.3180 0.1577  -0.0891 -0.0294 359 GLU B N   
5040 C CA  . GLU B 144 ? 0.2596 0.3730 0.3275 0.1617  -0.0841 -0.0217 359 GLU B CA  
5041 C C   . GLU B 144 ? 0.2623 0.4011 0.3206 0.1707  -0.0772 -0.0289 359 GLU B C   
5042 O O   . GLU B 144 ? 0.2652 0.4078 0.3103 0.1737  -0.0762 -0.0338 359 GLU B O   
5043 C CB  . GLU B 144 ? 0.4698 0.5762 0.5440 0.1615  -0.0834 -0.0052 359 GLU B CB  
5044 C CG  . GLU B 144 ? 0.6673 0.7559 0.7516 0.1543  -0.0916 -0.0002 359 GLU B CG  
5045 C CD  . GLU B 144 ? 0.7498 0.8309 0.8406 0.1559  -0.0908 0.0087  359 GLU B CD  
5046 O OE1 . GLU B 144 ? 0.8751 0.9591 0.9862 0.1584  -0.0885 0.0172  359 GLU B OE1 
5047 O OE2 . GLU B 144 ? 0.8582 0.9306 0.9381 0.1559  -0.0916 0.0060  359 GLU B OE2 
5054 N N   . THR B 145 ? 0.2702 0.4290 0.3348 0.1759  -0.0727 -0.0300 360 THR B N   
5055 C CA  . THR B 145 ? 0.2717 0.4599 0.3229 0.1868  -0.0667 -0.0352 360 THR B CA  
5056 C C   . THR B 145 ? 0.2811 0.4780 0.3322 0.1946  -0.0599 -0.0171 360 THR B C   
5057 O O   . THR B 145 ? 0.3042 0.4916 0.3724 0.1914  -0.0594 -0.0078 360 THR B O   
5058 C CB  . THR B 145 ? 0.2917 0.5035 0.3477 0.1890  -0.0659 -0.0567 360 THR B CB  
5059 O OG1 . THR B 145 ? 0.5247 0.7366 0.5999 0.1869  -0.0642 -0.0538 360 THR B OG1 
5060 C CG2 . THR B 145 ? 0.3139 0.5161 0.3756 0.1822  -0.0700 -0.0751 360 THR B CG2 
5068 N N   . GLU B 146 ? 0.2948 0.5108 0.3275 0.2063  -0.0540 -0.0115 361 GLU B N   
5069 C CA  . GLU B 146 ? 0.3093 0.5356 0.3394 0.2174  -0.0441 0.0084  361 GLU B CA  
5070 C C   . GLU B 146 ? 0.3271 0.5920 0.3321 0.2340  -0.0383 0.0050  361 GLU B C   
5071 O O   . GLU B 146 ? 0.3345 0.6107 0.3214 0.2394  -0.0397 -0.0006 361 GLU B O   
5072 C CB  . GLU B 146 ? 0.3152 0.5174 0.3502 0.2169  -0.0400 0.0293  361 GLU B CB  
5073 C CG  . GLU B 146 ? 0.3754 0.5827 0.4133 0.2289  -0.0258 0.0529  361 GLU B CG  
5074 C CD  . GLU B 146 ? 0.4164 0.6218 0.4763 0.2267  -0.0226 0.0565  361 GLU B CD  
5075 O OE1 . GLU B 146 ? 0.4827 0.6724 0.5627 0.2133  -0.0329 0.0454  361 GLU B OE1 
5076 O OE2 . GLU B 146 ? 0.5344 0.7547 0.5919 0.2396  -0.0085 0.0722  361 GLU B OE2 
5083 N N   . ARG B 147 ? 0.3486 0.6360 0.3527 0.2430  -0.0317 0.0084  362 ARG B N   
5084 C CA  . ARG B 147 ? 0.3694 0.7010 0.3474 0.2612  -0.0262 0.0051  362 ARG B CA  
5085 C C   . ARG B 147 ? 0.3935 0.7269 0.3579 0.2766  -0.0125 0.0367  362 ARG B C   
5086 O O   . ARG B 147 ? 0.4449 0.7515 0.4279 0.2729  -0.0050 0.0574  362 ARG B O   
5087 C CB  . ARG B 147 ? 0.3928 0.7505 0.3775 0.2638  -0.0248 -0.0081 362 ARG B CB  
5088 C CG  . ARG B 147 ? 0.6537 1.0660 0.6096 0.2818  -0.0231 -0.0207 362 ARG B CG  
5089 C CD  . ARG B 147 ? 0.6947 1.1318 0.6621 0.2825  -0.0205 -0.0336 362 ARG B CD  
5090 N NE  . ARG B 147 ? 0.7921 1.2822 0.7292 0.3044  -0.0149 -0.0323 362 ARG B NE  
5091 C CZ  . ARG B 147 ? 0.7562 1.2919 0.6733 0.3115  -0.0239 -0.0590 362 ARG B CZ  
5092 N NH1 . ARG B 147 ? 0.6347 1.1654 0.5631 0.2971  -0.0366 -0.0892 362 ARG B NH1 
5093 N NH2 . ARG B 147 ? 0.6489 1.2373 0.5361 0.3335  -0.0210 -0.0553 362 ARG B NH2 
5107 N N   . ALA B 148 ? 0.3584 0.5590 0.3104 0.1131  -0.0266 -0.1271 363 ALA B N   
5108 C CA  . ALA B 148 ? 0.3616 0.6207 0.3355 0.0952  -0.0117 -0.1052 363 ALA B CA  
5109 C C   . ALA B 148 ? 0.3395 0.6970 0.3106 0.1078  -0.0104 -0.1045 363 ALA B C   
5110 O O   . ALA B 148 ? 0.3603 0.7531 0.3223 0.1390  -0.0249 -0.1251 363 ALA B O   
5111 C CB  . ALA B 148 ? 0.3293 0.5757 0.3097 0.0921  -0.0145 -0.1043 363 ALA B CB  
5117 N N   . GLN B 149 ? 0.2605 0.6583 0.2470 0.0778  0.0013  -0.0753 364 GLN B N   
5118 C CA  . GLN B 149 ? 0.2178 0.7233 0.2029 0.0741  0.0038  -0.0643 364 GLN B CA  
5119 C C   . GLN B 149 ? 0.3201 0.8399 0.3152 0.0400  0.0051  -0.0310 364 GLN B C   
5120 O O   . GLN B 149 ? 0.2114 0.6636 0.2194 0.0147  0.0045  -0.0120 364 GLN B O   
5121 C CB  . GLN B 149 ? 0.4292 0.9636 0.4191 0.0618  0.0061  -0.0545 364 GLN B CB  
5122 C CG  . GLN B 149 ? 0.4893 1.0456 0.4781 0.0976  -0.0089 -0.0827 364 GLN B CG  
5123 C CD  . GLN B 149 ? 0.5051 1.0501 0.4941 0.0938  -0.0069 -0.0830 364 GLN B CD  
5124 O OE1 . GLN B 149 ? 0.3945 0.8824 0.3813 0.0751  0.0056  -0.0730 364 GLN B OE1 
5125 N NE2 . GLN B 149 ? 0.4747 1.0762 0.4696 0.1128  -0.0178 -0.0960 364 GLN B NE2 
5134 N N   . LEU B 150 ? 0.3491 0.9542 0.3377 0.0419  0.0023  -0.0263 365 LEU B N   
5135 C CA  . LEU B 150 ? 0.3477 0.9661 0.3368 0.0117  -0.0014 0.0048  365 LEU B CA  
5136 C C   . LEU B 150 ? 0.6083 1.2649 0.5991 -0.0357 -0.0035 0.0473  365 LEU B C   
5137 O O   . LEU B 150 ? 0.7654 1.4823 0.7674 -0.0411 -0.0031 0.0491  365 LEU B O   
5138 C CB  . LEU B 150 ? 0.4428 1.1268 0.4358 0.0314  -0.0012 -0.0075 365 LEU B CB  
5139 C CG  . LEU B 150 ? 0.4537 1.1681 0.4435 0.0013  -0.0037 0.0239  365 LEU B CG  
5140 C CD1 . LEU B 150 ? 0.3664 0.9978 0.3466 -0.0107 -0.0195 0.0371  365 LEU B CD1 
5141 C CD2 . LEU B 150 ? 0.6559 1.4381 0.6549 0.0302  0.0001  0.0012  365 LEU B CD2 
5153 N N   . GLU B 151 ? 0.6450 1.2298 0.6434 -0.0678 -0.0150 0.0762  366 GLU B N   
5154 C CA  . GLU B 151 ? 0.4429 1.0378 0.4398 -0.1165 -0.0271 0.1189  366 GLU B CA  
5155 C C   . GLU B 151 ? 0.5020 1.0890 0.4892 -0.1469 -0.0472 0.1525  366 GLU B C   
5156 O O   . GLU B 151 ? 0.6741 1.2863 0.6546 -0.1291 -0.0451 0.1417  366 GLU B O   
5157 C CB  . GLU B 151 ? 0.7203 1.2184 0.7325 -0.1229 -0.0323 0.1184  366 GLU B CB  
5158 C CG  . GLU B 151 ? 0.7533 1.2669 0.7632 -0.1664 -0.0449 0.1539  366 GLU B CG  
5159 C CD  . GLU B 151 ? 0.7187 1.2721 0.7329 -0.1549 -0.0281 0.1375  366 GLU B CD  
5160 O OE1 . GLU B 151 ? 0.7572 1.3679 0.7630 -0.1195 -0.0126 0.1071  366 GLU B OE1 
5161 O OE2 . GLU B 151 ? 0.7179 1.2299 0.7390 -0.1756 -0.0371 0.1505  366 GLU B OE2 
5168 N N   . ASP B 152 ? 0.7246 1.2690 0.7088 -0.1918 -0.0717 0.1923  367 ASP B N   
5169 C CA  . ASP B 152 ? 0.6439 1.1661 0.6166 -0.2251 -0.0974 0.2274  367 ASP B CA  
5170 C C   . ASP B 152 ? 0.6593 1.0849 0.6391 -0.1999 -0.1127 0.2101  367 ASP B C   
5171 O O   . ASP B 152 ? 0.9176 1.2451 0.9079 -0.2036 -0.1353 0.2110  367 ASP B O   
5172 C CB  . ASP B 152 ? 0.7642 1.2495 0.7364 -0.2793 -0.1259 0.2691  367 ASP B CB  
5173 C CG  . ASP B 152 ? 0.9897 1.4560 0.9537 -0.3191 -0.1556 0.3034  367 ASP B CG  
5174 O OD1 . ASP B 152 ? 1.0403 1.5710 1.0084 -0.3606 -0.1652 0.3265  367 ASP B OD1 
5175 O OD2 . ASP B 152 ? 0.9771 1.3653 0.9307 -0.3054 -0.1756 0.3026  367 ASP B OD2 
5180 N N   . GLY B 153 ? 0.3808 0.8357 0.3587 -0.1710 -0.1001 0.1886  368 GLY B N   
5181 C CA  . GLY B 153 ? 0.3951 0.7707 0.3834 -0.1480 -0.1114 0.1699  368 GLY B CA  
5182 C C   . GLY B 153 ? 0.5536 0.8645 0.5684 -0.1081 -0.0959 0.1240  368 GLY B C   
5183 O O   . GLY B 153 ? 0.6447 0.8860 0.6730 -0.0958 -0.1096 0.1101  368 GLY B O   
5187 N N   . ARG B 154 ? 0.5742 0.9126 0.5948 -0.0894 -0.0699 0.1008  369 ARG B N   
5188 C CA  . ARG B 154 ? 0.4743 0.7596 0.5135 -0.0599 -0.0559 0.0630  369 ARG B CA  
5189 C C   . ARG B 154 ? 0.3684 0.6934 0.4031 -0.0437 -0.0336 0.0448  369 ARG B C   
5190 O O   . ARG B 154 ? 0.3589 0.7539 0.3809 -0.0531 -0.0293 0.0586  369 ARG B O   
5191 C CB  . ARG B 154 ? 0.5378 0.7501 0.5932 -0.0692 -0.0703 0.0638  369 ARG B CB  
5192 C CG  . ARG B 154 ? 0.5169 0.7346 0.5651 -0.1009 -0.0839 0.0955  369 ARG B CG  
5193 C CD  . ARG B 154 ? 0.6408 0.8032 0.7045 -0.0988 -0.0881 0.0835  369 ARG B CD  
5194 N NE  . ARG B 154 ? 0.8484 0.9910 0.9053 -0.1326 -0.1161 0.1167  369 ARG B NE  
5195 C CZ  . ARG B 154 ? 0.8340 1.0181 0.8819 -0.1553 -0.1106 0.1373  369 ARG B CZ  
5196 N NH1 . ARG B 154 ? 0.8746 1.1252 0.9197 -0.1420 -0.0782 0.1243  369 ARG B NH1 
5197 N NH2 . ARG B 154 ? 0.8003 0.9579 0.8409 -0.1910 -0.1420 0.1699  369 ARG B NH2 
5211 N N   . PHE B 155 ? 0.2896 0.5740 0.3328 -0.0206 -0.0223 0.0139  370 PHE B N   
5212 C CA  . PHE B 155 ? 0.3098 0.6114 0.3454 -0.0046 -0.0088 -0.0038 370 PHE B CA  
5213 C C   . PHE B 155 ? 0.3256 0.5901 0.3708 -0.0165 -0.0057 -0.0009 370 PHE B C   
5214 O O   . PHE B 155 ? 0.3077 0.5185 0.3682 -0.0251 -0.0115 -0.0013 370 PHE B O   
5215 C CB  . PHE B 155 ? 0.2632 0.5387 0.2939 0.0232  -0.0050 -0.0356 370 PHE B CB  
5216 C CG  . PHE B 155 ? 0.4396 0.7546 0.4592 0.0404  -0.0103 -0.0435 370 PHE B CG  
5217 C CD1 . PHE B 155 ? 0.2989 0.6863 0.3015 0.0586  -0.0103 -0.0513 370 PHE B CD1 
5218 C CD2 . PHE B 155 ? 0.2670 0.5576 0.2937 0.0405  -0.0167 -0.0456 370 PHE B CD2 
5219 C CE1 . PHE B 155 ? 0.3148 0.7484 0.3064 0.0786  -0.0169 -0.0630 370 PHE B CE1 
5220 C CE2 . PHE B 155 ? 0.2658 0.5959 0.2813 0.0576  -0.0226 -0.0538 370 PHE B CE2 
5221 C CZ  . PHE B 155 ? 0.2584 0.6598 0.2557 0.0770  -0.0228 -0.0628 370 PHE B CZ  
5231 N N   . VAL B 156 ? 0.2215 0.5195 0.2581 -0.0138 0.0014  -0.0017 371 VAL B N   
5232 C CA  . VAL B 156 ? 0.3173 0.5825 0.3613 -0.0236 0.0042  -0.0002 371 VAL B CA  
5233 C C   . VAL B 156 ? 0.2047 0.4631 0.2373 -0.0009 0.0133  -0.0247 371 VAL B C   
5234 O O   . VAL B 156 ? 0.2408 0.5352 0.2583 0.0209  0.0131  -0.0387 371 VAL B O   
5235 C CB  . VAL B 156 ? 0.2691 0.5720 0.3135 -0.0495 -0.0016 0.0276  371 VAL B CB  
5236 C CG1 . VAL B 156 ? 0.3681 0.6698 0.4154 -0.0755 -0.0194 0.0563  371 VAL B CG1 
5237 C CG2 . VAL B 156 ? 0.3465 0.7348 0.3770 -0.0413 0.0058  0.0262  371 VAL B CG2 
5247 N N   . TYR B 157 ? 0.2251 0.4343 0.2629 -0.0047 0.0169  -0.0318 372 TYR B N   
5248 C CA  . TYR B 157 ? 0.2246 0.4109 0.2477 0.0104  0.0207  -0.0508 372 TYR B CA  
5249 C C   . TYR B 157 ? 0.2263 0.4109 0.2533 -0.0001 0.0243  -0.0439 372 TYR B C   
5250 O O   . TYR B 157 ? 0.2522 0.4064 0.2939 -0.0157 0.0250  -0.0387 372 TYR B O   
5251 C CB  . TYR B 157 ? 0.2355 0.3661 0.2581 0.0092  0.0214  -0.0642 372 TYR B CB  
5252 C CG  . TYR B 157 ? 0.2647 0.3924 0.2852 0.0170  0.0162  -0.0711 372 TYR B CG  
5253 C CD1 . TYR B 157 ? 0.2687 0.3853 0.2665 0.0357  0.0069  -0.0866 372 TYR B CD1 
5254 C CD2 . TYR B 157 ? 0.2375 0.3693 0.2776 0.0076  0.0153  -0.0637 372 TYR B CD2 
5255 C CE1 . TYR B 157 ? 0.2931 0.4055 0.2891 0.0431  -0.0005 -0.0940 372 TYR B CE1 
5256 C CE2 . TYR B 157 ? 0.2445 0.3752 0.2838 0.0147  0.0104  -0.0706 372 TYR B CE2 
5257 C CZ  . TYR B 157 ? 0.2813 0.4042 0.2996 0.0313  0.0040  -0.0852 372 TYR B CZ  
5258 O OH  . TYR B 157 ? 0.3094 0.4316 0.3276 0.0383  -0.0031 -0.0922 372 TYR B OH  
5268 N N   . ARG B 158 ? 0.2588 0.4792 0.2731 0.0116  0.0241  -0.0477 373 ARG B N   
5269 C CA  . ARG B 158 ? 0.4238 0.6529 0.4422 0.0012  0.0266  -0.0401 373 ARG B CA  
5270 C C   . ARG B 158 ? 0.3426 0.5460 0.3424 0.0188  0.0259  -0.0587 373 ARG B C   
5271 O O   . ARG B 158 ? 0.2603 0.4830 0.2414 0.0444  0.0186  -0.0751 373 ARG B O   
5272 C CB  . ARG B 158 ? 0.3856 0.6939 0.4068 -0.0062 0.0252  -0.0253 373 ARG B CB  
5273 C CG  . ARG B 158 ? 0.5383 0.8623 0.5733 -0.0343 0.0198  0.0018  373 ARG B CG  
5274 C CD  . ARG B 158 ? 0.6751 1.0898 0.7032 -0.0351 0.0189  0.0108  373 ARG B CD  
5275 N NE  . ARG B 158 ? 0.6565 1.1406 0.6839 -0.0465 0.0199  0.0201  373 ARG B NE  
5276 C CZ  . ARG B 158 ? 0.6537 1.1460 0.6899 -0.0854 0.0124  0.0511  373 ARG B CZ  
5277 N NH1 . ARG B 158 ? 0.4102 0.8391 0.4546 -0.1111 -0.0006 0.0727  373 ARG B NH1 
5278 N NH2 . ARG B 158 ? 0.5683 1.1049 0.5938 -0.0929 0.0084  0.0563  373 ARG B NH2 
5292 N N   . LEU B 159 ? 0.3072 0.4676 0.3106 0.0066  0.0296  -0.0575 374 LEU B N   
5293 C CA  . LEU B 159 ? 0.3331 0.4660 0.3169 0.0162  0.0273  -0.0694 374 LEU B CA  
5294 C C   . LEU B 159 ? 0.2906 0.4409 0.2861 0.0047  0.0310  -0.0605 374 LEU B C   
5295 O O   . LEU B 159 ? 0.2977 0.4161 0.3000 -0.0087 0.0347  -0.0588 374 LEU B O   
5296 C CB  . LEU B 159 ? 0.3218 0.3952 0.2954 0.0076  0.0281  -0.0753 374 LEU B CB  
5297 C CG  . LEU B 159 ? 0.5584 0.6113 0.5224 0.0120  0.0222  -0.0813 374 LEU B CG  
5298 C CD1 . LEU B 159 ? 0.4197 0.4864 0.4110 -0.0005 0.0295  -0.0742 374 LEU B CD1 
5299 C CD2 . LEU B 159 ? 0.4748 0.4733 0.4135 0.0025  0.0157  -0.0864 374 LEU B CD2 
5311 N N   . LEU B 160 ? 0.2256 0.4355 0.2242 0.0091  0.0290  -0.0559 375 LEU B N   
5312 C CA  . LEU B 160 ? 0.2433 0.4742 0.2558 -0.0085 0.0300  -0.0430 375 LEU B CA  
5313 C C   . LEU B 160 ? 0.2213 0.4535 0.2195 0.0061  0.0281  -0.0560 375 LEU B C   
5314 O O   . LEU B 160 ? 0.2701 0.5230 0.2500 0.0327  0.0223  -0.0731 375 LEU B O   
5315 C CB  . LEU B 160 ? 0.2127 0.5182 0.2378 -0.0237 0.0275  -0.0242 375 LEU B CB  
5316 C CG  . LEU B 160 ? 0.2205 0.5244 0.2567 -0.0415 0.0245  -0.0067 375 LEU B CG  
5317 C CD1 . LEU B 160 ? 0.2520 0.6403 0.2924 -0.0609 0.0204  0.0150  375 LEU B CD1 
5318 C CD2 . LEU B 160 ? 0.2435 0.4856 0.2946 -0.0618 0.0177  0.0037  375 LEU B CD2 
5330 N N   . ARG B 161 ? 0.2511 0.4638 0.2576 -0.0088 0.0292  -0.0501 376 ARG B N   
5331 C CA  . ARG B 161 ? 0.2532 0.4728 0.2484 0.0024  0.0265  -0.0601 376 ARG B CA  
5332 C C   . ARG B 161 ? 0.2365 0.4109 0.1997 0.0281  0.0207  -0.0806 376 ARG B C   
5333 O O   . ARG B 161 ? 0.2531 0.4482 0.2005 0.0509  0.0113  -0.0948 376 ARG B O   
5334 C CB  . ARG B 161 ? 0.2089 0.5162 0.2104 0.0062  0.0235  -0.0578 376 ARG B CB  
5335 C CG  . ARG B 161 ? 0.2266 0.5762 0.2529 -0.0297 0.0230  -0.0301 376 ARG B CG  
5336 C CD  . ARG B 161 ? 0.2100 0.6644 0.2417 -0.0347 0.0209  -0.0253 376 ARG B CD  
5337 N NE  . ARG B 161 ? 0.2128 0.6737 0.2402 -0.0230 0.0187  -0.0388 376 ARG B NE  
5338 C CZ  . ARG B 161 ? 0.2456 0.6914 0.2845 -0.0475 0.0146  -0.0254 376 ARG B CZ  
5339 N NH1 . ARG B 161 ? 0.2223 0.6387 0.2766 -0.0839 0.0079  0.0009  376 ARG B NH1 
5340 N NH2 . ARG B 161 ? 0.2225 0.6777 0.2556 -0.0328 0.0126  -0.0404 376 ARG B NH2 
5354 N N   . SER B 162 ? 0.2685 0.3832 0.2205 0.0226  0.0221  -0.0820 377 SER B N   
5355 C CA  . SER B 162 ? 0.3456 0.4045 0.2622 0.0335  0.0115  -0.0932 377 SER B CA  
5356 C C   . SER B 162 ? 0.3195 0.3607 0.2284 0.0270  0.0120  -0.0933 377 SER B C   
5357 O O   . SER B 162 ? 0.3335 0.3760 0.2624 0.0069  0.0236  -0.0858 377 SER B O   
5358 C CB  . SER B 162 ? 0.4406 0.4513 0.3477 0.0175  0.0138  -0.0896 377 SER B CB  
5359 O OG  . SER B 162 ? 0.7097 0.7284 0.6214 0.0234  0.0118  -0.0905 377 SER B OG  
5365 N N   . PRO B 163 ? 0.3484 0.3690 0.2266 0.0464  -0.0044 -0.1044 378 PRO B N   
5366 C CA  . PRO B 163 ? 0.3465 0.3480 0.2142 0.0394  -0.0046 -0.1037 378 PRO B CA  
5367 C C   . PRO B 163 ? 0.3664 0.3237 0.2222 0.0122  0.0027  -0.0951 378 PRO B C   
5368 O O   . PRO B 163 ? 0.4222 0.3415 0.2551 0.0034  -0.0038 -0.0919 378 PRO B O   
5369 C CB  . PRO B 163 ? 0.5140 0.4926 0.3451 0.0685  -0.0303 -0.1186 378 PRO B CB  
5370 C CG  . PRO B 163 ? 0.4865 0.5108 0.3263 0.0962  -0.0386 -0.1317 378 PRO B CG  
5371 C CD  . PRO B 163 ? 0.3652 0.3855 0.2187 0.0801  -0.0272 -0.1215 378 PRO B CD  
5379 N N   . MET B 164 ? 0.3703 0.3421 0.2440 -0.0024 0.0153  -0.0924 379 MET B N   
5380 C CA  . MET B 164 ? 0.3741 0.3265 0.2372 -0.0252 0.0228  -0.0897 379 MET B CA  
5381 C C   . MET B 164 ? 0.4280 0.3337 0.2403 -0.0289 0.0068  -0.0868 379 MET B C   
5382 O O   . MET B 164 ? 0.4486 0.3427 0.2435 -0.0133 -0.0061 -0.0910 379 MET B O   
5383 C CB  . MET B 164 ? 0.3693 0.3502 0.2606 -0.0315 0.0334  -0.0942 379 MET B CB  
5384 C CG  . MET B 164 ? 0.4624 0.4521 0.3581 -0.0494 0.0437  -0.0988 379 MET B CG  
5385 S SD  . MET B 164 ? 0.3507 0.3704 0.2804 -0.0460 0.0465  -0.1125 379 MET B SD  
5386 C CE  . MET B 164 ? 0.2877 0.3217 0.2638 -0.0405 0.0426  -0.1126 379 MET B CE  
5396 N N   . CYS B 165 ? 0.4574 0.3364 0.2445 -0.0515 0.0041  -0.0785 380 CYS B N   
5397 C CA  . CYS B 165 ? 0.5171 0.3489 0.2509 -0.0696 -0.0135 -0.0685 380 CYS B CA  
5398 C C   . CYS B 165 ? 0.5246 0.3679 0.2515 -0.0719 -0.0096 -0.0707 380 CYS B C   
5399 O O   . CYS B 165 ? 0.4757 0.3675 0.2352 -0.0768 0.0117  -0.0780 380 CYS B O   
5400 C CB  . CYS B 165 ? 0.6306 0.4615 0.3493 -0.1080 -0.0083 -0.0560 380 CYS B CB  
5401 S SG  . CYS B 165 ? 0.7381 0.5252 0.3902 -0.1466 -0.0285 -0.0356 380 CYS B SG  
5407 N N   . GLU B 166 ? 0.3231 0.5153 0.4426 0.0748  0.0512  -0.0084 381 GLU B N   
5408 C CA  . GLU B 166 ? 0.3618 0.5318 0.4554 0.0722  0.0396  0.0151  381 GLU B CA  
5409 C C   . GLU B 166 ? 0.3802 0.5190 0.4456 0.0648  0.0460  0.0107  381 GLU B C   
5410 O O   . GLU B 166 ? 0.3922 0.5220 0.4335 0.0637  0.0310  0.0218  381 GLU B O   
5411 C CB  . GLU B 166 ? 0.3828 0.5427 0.4758 0.0807  0.0437  0.0321  381 GLU B CB  
5412 C CG  . GLU B 166 ? 0.7381 0.8854 0.8022 0.0876  0.0284  0.0510  381 GLU B CG  
5413 C CD  . GLU B 166 ? 0.9211 1.0410 0.9646 0.1040  0.0439  0.0658  381 GLU B CD  
5414 O OE1 . GLU B 166 ? 0.8768 0.9580 0.8871 0.1097  0.0619  0.0688  381 GLU B OE1 
5415 O OE2 . GLU B 166 ? 0.8890 1.0221 0.9465 0.1139  0.0419  0.0762  381 GLU B OE2 
5422 N N   . TYR B 167 ? 0.2378 0.3639 0.3116 0.0598  0.0692  -0.0101 382 TYR B N   
5423 C CA  . TYR B 167 ? 0.2650 0.3611 0.3174 0.0521  0.0806  -0.0176 382 TYR B CA  
5424 C C   . TYR B 167 ? 0.2580 0.3699 0.3000 0.0470  0.0601  -0.0216 382 TYR B C   
5425 O O   . TYR B 167 ? 0.3141 0.4030 0.3277 0.0424  0.0568  -0.0163 382 TYR B O   
5426 C CB  . TYR B 167 ? 0.3149 0.4027 0.3962 0.0446  0.1134  -0.0491 382 TYR B CB  
5427 C CG  . TYR B 167 ? 0.6599 0.7297 0.7287 0.0349  0.1213  -0.0637 382 TYR B CG  
5428 C CD1 . TYR B 167 ? 0.9078 0.9232 0.9471 0.0334  0.1456  -0.0529 382 TYR B CD1 
5429 C CD2 . TYR B 167 ? 0.6129 0.7143 0.6892 0.0318  0.1024  -0.0819 382 TYR B CD2 
5430 C CE1 . TYR B 167 ? 0.6961 0.6932 0.7226 0.0247  0.1533  -0.0648 382 TYR B CE1 
5431 C CE2 . TYR B 167 ? 0.4073 0.4904 0.4692 0.0233  0.1051  -0.0907 382 TYR B CE2 
5432 C CZ  . TYR B 167 ? 0.5723 0.6068 0.6138 0.0176  0.1300  -0.0842 382 TYR B CZ  
5433 O OH  . TYR B 167 ? 0.8431 0.8593 0.8720 0.0093  0.1321  -0.0912 382 TYR B OH  
5443 N N   . LEU B 168 ? 0.2297 0.3783 0.2921 0.0513  0.0502  -0.0314 383 LEU B N   
5444 C CA  . LEU B 168 ? 0.2207 0.3795 0.2729 0.0512  0.0399  -0.0353 383 LEU B CA  
5445 C C   . LEU B 168 ? 0.2126 0.3661 0.2520 0.0489  0.0236  -0.0116 383 LEU B C   
5446 O O   . LEU B 168 ? 0.2617 0.4025 0.2842 0.0418  0.0181  -0.0095 383 LEU B O   
5447 C CB  . LEU B 168 ? 0.2235 0.4114 0.2902 0.0634  0.0379  -0.0508 383 LEU B CB  
5448 C CG  . LEU B 168 ? 0.4641 0.6414 0.5286 0.0570  0.0400  -0.0734 383 LEU B CG  
5449 C CD1 . LEU B 168 ? 0.5309 0.7200 0.5992 0.0641  0.0301  -0.0842 383 LEU B CD1 
5450 C CD2 . LEU B 168 ? 0.5341 0.7083 0.5775 0.0576  0.0367  -0.0712 383 LEU B CD2 
5462 N N   . VAL B 169 ? 0.2041 0.3691 0.2574 0.0538  0.0174  0.0020  384 VAL B N   
5463 C CA  . VAL B 169 ? 0.1855 0.3526 0.2413 0.0500  0.0039  0.0155  384 VAL B CA  
5464 C C   . VAL B 169 ? 0.2213 0.3692 0.2529 0.0436  -0.0057 0.0168  384 VAL B C   
5465 O O   . VAL B 169 ? 0.2215 0.3694 0.2508 0.0359  -0.0146 0.0138  384 VAL B O   
5466 C CB  . VAL B 169 ? 0.1695 0.3541 0.2485 0.0566  -0.0002 0.0263  384 VAL B CB  
5467 C CG1 . VAL B 169 ? 0.1797 0.3740 0.2748 0.0508  -0.0130 0.0309  384 VAL B CG1 
5468 C CG2 . VAL B 169 ? 0.1300 0.3329 0.2263 0.0682  0.0104  0.0251  384 VAL B CG2 
5478 N N   . ASN B 170 ? 0.3307 0.4601 0.3428 0.0495  0.0002  0.0199  385 ASN B N   
5479 C CA  . ASN B 170 ? 0.3170 0.4256 0.2939 0.0542  -0.0065 0.0240  385 ASN B CA  
5480 C C   . ASN B 170 ? 0.3324 0.4217 0.2885 0.0444  -0.0027 0.0145  385 ASN B C   
5481 O O   . ASN B 170 ? 0.3377 0.4240 0.2740 0.0443  -0.0165 0.0127  385 ASN B O   
5482 C CB  . ASN B 170 ? 0.3826 0.4634 0.3354 0.0697  0.0105  0.0346  385 ASN B CB  
5483 C CG  . ASN B 170 ? 0.4201 0.5184 0.3863 0.0833  0.0044  0.0464  385 ASN B CG  
5484 O OD1 . ASN B 170 ? 0.3771 0.5102 0.3676 0.0820  -0.0175 0.0458  385 ASN B OD1 
5485 N ND2 . ASN B 170 ? 0.4890 0.5613 0.4442 0.0958  0.0283  0.0559  385 ASN B ND2 
5492 N N   . PHE B 171 ? 0.2937 0.3752 0.2574 0.0375  0.0149  0.0042  386 PHE B N   
5493 C CA  . PHE B 171 ? 0.2835 0.3482 0.2305 0.0288  0.0201  -0.0060 386 PHE B CA  
5494 C C   . PHE B 171 ? 0.2481 0.3285 0.2010 0.0210  0.0048  -0.0082 386 PHE B C   
5495 O O   . PHE B 171 ? 0.2613 0.3278 0.1937 0.0153  -0.0005 -0.0112 386 PHE B O   
5496 C CB  . PHE B 171 ? 0.2290 0.2947 0.1939 0.0258  0.0406  -0.0236 386 PHE B CB  
5497 C CG  . PHE B 171 ? 0.2218 0.2769 0.1764 0.0180  0.0466  -0.0375 386 PHE B CG  
5498 C CD1 . PHE B 171 ? 0.2930 0.3101 0.2200 0.0140  0.0595  -0.0378 386 PHE B CD1 
5499 C CD2 . PHE B 171 ? 0.1977 0.2785 0.1663 0.0191  0.0425  -0.0496 386 PHE B CD2 
5500 C CE1 . PHE B 171 ? 0.3500 0.3583 0.2712 0.0062  0.0663  -0.0520 386 PHE B CE1 
5501 C CE2 . PHE B 171 ? 0.2011 0.2751 0.1608 0.0147  0.0481  -0.0634 386 PHE B CE2 
5502 C CZ  . PHE B 171 ? 0.2268 0.2660 0.1664 0.0057  0.0591  -0.0658 386 PHE B CZ  
5512 N N   . LEU B 172 ? 0.2517 0.3573 0.2332 0.0225  0.0022  -0.0062 387 LEU B N   
5513 C CA  . LEU B 172 ? 0.2453 0.3575 0.2376 0.0165  -0.0010 -0.0067 387 LEU B CA  
5514 C C   . LEU B 172 ? 0.2245 0.3395 0.2195 0.0090  -0.0169 -0.0085 387 LEU B C   
5515 O O   . LEU B 172 ? 0.2519 0.3615 0.2471 -0.0010 -0.0181 -0.0167 387 LEU B O   
5516 C CB  . LEU B 172 ? 0.2191 0.3505 0.2391 0.0252  0.0071  -0.0001 387 LEU B CB  
5517 C CG  . LEU B 172 ? 0.2438 0.3823 0.2577 0.0403  0.0200  -0.0048 387 LEU B CG  
5518 C CD1 . LEU B 172 ? 0.2883 0.4413 0.3183 0.0565  0.0298  0.0052  387 LEU B CD1 
5519 C CD2 . LEU B 172 ? 0.1948 0.3212 0.1890 0.0400  0.0268  -0.0127 387 LEU B CD2 
5531 N N   . HIS B 173 ? 0.2592 0.3874 0.2595 0.0159  -0.0292 -0.0047 388 HIS B N   
5532 C CA  . HIS B 173 ? 0.2974 0.4425 0.3056 0.0142  -0.0488 -0.0151 388 HIS B CA  
5533 C C   . HIS B 173 ? 0.3270 0.4550 0.2930 0.0171  -0.0577 -0.0223 388 HIS B C   
5534 O O   . HIS B 173 ? 0.3521 0.4930 0.3266 0.0102  -0.0702 -0.0397 388 HIS B O   
5535 C CB  . HIS B 173 ? 0.3182 0.4877 0.3395 0.0274  -0.0622 -0.0113 388 HIS B CB  
5536 C CG  . HIS B 173 ? 0.5046 0.6967 0.5771 0.0212  -0.0563 -0.0106 388 HIS B CG  
5537 N ND1 . HIS B 173 ? 0.5986 0.8060 0.7155 0.0067  -0.0530 -0.0255 388 HIS B ND1 
5538 C CD2 . HIS B 173 ? 0.4852 0.6821 0.5730 0.0278  -0.0469 0.0030  388 HIS B CD2 
5539 C CE1 . HIS B 173 ? 0.3961 0.6133 0.5509 0.0061  -0.0398 -0.0186 388 HIS B CE1 
5540 N NE2 . HIS B 173 ? 0.4251 0.6382 0.5602 0.0198  -0.0387 -0.0008 388 HIS B NE2 
5548 N N   . LYS B 174 ? 0.3096 0.4074 0.2345 0.0268  -0.0471 -0.0117 389 LYS B N   
5549 C CA  . LYS B 174 ? 0.3692 0.4416 0.2478 0.0330  -0.0484 -0.0144 389 LYS B CA  
5550 C C   . LYS B 174 ? 0.3250 0.3843 0.2036 0.0148  -0.0416 -0.0245 389 LYS B C   
5551 O O   . LYS B 174 ? 0.3801 0.4372 0.2407 0.0136  -0.0524 -0.0355 389 LYS B O   
5552 C CB  . LYS B 174 ? 0.3918 0.4270 0.2347 0.0468  -0.0267 0.0001  389 LYS B CB  
5553 C CG  . LYS B 174 ? 0.4288 0.4658 0.2594 0.0705  -0.0274 0.0139  389 LYS B CG  
5554 C CD  . LYS B 174 ? 0.4691 0.4614 0.2804 0.0777  0.0088  0.0263  389 LYS B CD  
5555 C CE  . LYS B 174 ? 0.5185 0.4987 0.3092 0.1050  0.0181  0.0440  389 LYS B CE  
5556 N NZ  . LYS B 174 ? 0.6638 0.6003 0.4570 0.1031  0.0627  0.0494  389 LYS B NZ  
5570 N N   . LEU B 175 ? 0.3367 0.3907 0.2344 0.0043  -0.0242 -0.0227 390 LEU B N   
5571 C CA  . LEU B 175 ? 0.2972 0.3394 0.1930 -0.0080 -0.0158 -0.0305 390 LEU B CA  
5572 C C   . LEU B 175 ? 0.3067 0.3636 0.2251 -0.0191 -0.0247 -0.0409 390 LEU B C   
5573 O O   . LEU B 175 ? 0.3312 0.3761 0.2371 -0.0276 -0.0252 -0.0507 390 LEU B O   
5574 C CB  . LEU B 175 ? 0.2634 0.3097 0.1767 -0.0075 0.0009  -0.0289 390 LEU B CB  
5575 C CG  . LEU B 175 ? 0.4696 0.5024 0.3714 -0.0111 0.0135  -0.0366 390 LEU B CG  
5576 C CD1 . LEU B 175 ? 0.4228 0.4287 0.2952 -0.0129 0.0195  -0.0415 390 LEU B CD1 
5577 C CD2 . LEU B 175 ? 0.4561 0.5074 0.3751 0.0001  0.0243  -0.0394 390 LEU B CD2 
5589 N N   . ARG B 176 ? 0.3359 0.4179 0.2928 -0.0200 -0.0282 -0.0410 391 ARG B N   
5590 C CA  . ARG B 176 ? 0.3720 0.4697 0.3694 -0.0329 -0.0280 -0.0554 391 ARG B CA  
5591 C C   . ARG B 176 ? 0.3704 0.4793 0.3622 -0.0375 -0.0482 -0.0781 391 ARG B C   
5592 O O   . ARG B 176 ? 0.4645 0.5782 0.4862 -0.0528 -0.0430 -0.0973 391 ARG B O   
5593 C CB  . ARG B 176 ? 0.3349 0.4599 0.3765 -0.0309 -0.0293 -0.0544 391 ARG B CB  
5594 C CG  . ARG B 176 ? 0.4842 0.6114 0.5762 -0.0425 -0.0068 -0.0596 391 ARG B CG  
5595 C CD  . ARG B 176 ? 0.4929 0.6513 0.6321 -0.0414 -0.0120 -0.0642 391 ARG B CD  
5596 N NE  . ARG B 176 ? 0.5948 0.7566 0.7960 -0.0561 0.0128  -0.0777 391 ARG B NE  
5597 C CZ  . ARG B 176 ? 0.6945 0.8771 0.9465 -0.0573 0.0198  -0.0815 391 ARG B CZ  
5598 N NH1 . ARG B 176 ? 0.5899 0.7939 0.8327 -0.0435 -0.0006 -0.0711 391 ARG B NH1 
5599 N NH2 . ARG B 176 ? 0.8164 0.9948 1.1309 -0.0724 0.0520  -0.0957 391 ARG B NH2 
5613 N N   . GLN B 177 ? 0.3933 0.5059 0.3464 -0.0207 -0.0685 -0.0773 392 GLN B N   
5614 C CA  . GLN B 177 ? 0.4112 0.5471 0.3570 -0.0146 -0.0931 -0.1024 392 GLN B CA  
5615 C C   . GLN B 177 ? 0.3673 0.4740 0.2598 -0.0111 -0.0936 -0.1044 392 GLN B C   
5616 O O   . GLN B 177 ? 0.4149 0.5410 0.2975 -0.0045 -0.1136 -0.1285 392 GLN B O   
5617 C CB  . GLN B 177 ? 0.5764 0.7423 0.5099 0.0122  -0.1171 -0.1032 392 GLN B CB  
5618 C CG  . GLN B 177 ? 0.5481 0.6828 0.4140 0.0404  -0.1139 -0.0758 392 GLN B CG  
5619 C CD  . GLN B 177 ? 0.6651 0.8265 0.5289 0.0669  -0.1286 -0.0699 392 GLN B CD  
5620 O OE1 . GLN B 177 ? 0.7144 0.9053 0.6309 0.0579  -0.1313 -0.0735 392 GLN B OE1 
5621 N NE2 . GLN B 177 ? 0.8355 0.9832 0.6352 0.1032  -0.1348 -0.0592 392 GLN B NE2 
5630 N N   . LEU B 178 ? 0.3833 0.4486 0.2484 -0.0160 -0.0714 -0.0845 393 LEU B N   
5631 C CA  . LEU B 178 ? 0.3816 0.4166 0.2060 -0.0178 -0.0661 -0.0872 393 LEU B CA  
5632 C C   . LEU B 178 ? 0.3830 0.4302 0.2364 -0.0372 -0.0692 -0.1127 393 LEU B C   
5633 O O   . LEU B 178 ? 0.3932 0.4506 0.2974 -0.0549 -0.0572 -0.1188 393 LEU B O   
5634 C CB  . LEU B 178 ? 0.3646 0.3629 0.1743 -0.0236 -0.0396 -0.0689 393 LEU B CB  
5635 C CG  . LEU B 178 ? 0.4063 0.3769 0.1776 -0.0070 -0.0277 -0.0519 393 LEU B CG  
5636 C CD1 . LEU B 178 ? 0.3919 0.3786 0.1607 0.0131  -0.0380 -0.0427 393 LEU B CD1 
5637 C CD2 . LEU B 178 ? 0.3533 0.3090 0.1387 -0.0153 -0.0035 -0.0458 393 LEU B CD2 
5649 N N   . PRO B 179 ? 0.4168 0.4586 0.2368 -0.0320 -0.0806 -0.1275 394 PRO B N   
5650 C CA  . PRO B 179 ? 0.4306 0.4884 0.2825 -0.0503 -0.0845 -0.1591 394 PRO B CA  
5651 C C   . PRO B 179 ? 0.4092 0.4331 0.2710 -0.0728 -0.0563 -0.1535 394 PRO B C   
5652 O O   . PRO B 179 ? 0.4156 0.4484 0.3119 -0.0901 -0.0520 -0.1787 394 PRO B O   
5653 C CB  . PRO B 179 ? 0.4715 0.5285 0.2743 -0.0297 -0.1044 -0.1689 394 PRO B CB  
5654 C CG  . PRO B 179 ? 0.4926 0.5257 0.2336 -0.0013 -0.1040 -0.1400 394 PRO B CG  
5655 C CD  . PRO B 179 ? 0.4568 0.4717 0.2058 -0.0072 -0.0846 -0.1158 394 PRO B CD  
5663 N N   . GLU B 180 ? 0.4616 0.4504 0.2955 -0.0703 -0.0369 -0.1253 395 GLU B N   
5664 C CA  . GLU B 180 ? 0.4343 0.3932 0.2658 -0.0830 -0.0128 -0.1200 395 GLU B CA  
5665 C C   . GLU B 180 ? 0.4471 0.3948 0.2796 -0.0770 0.0057  -0.0966 395 GLU B C   
5666 O O   . GLU B 180 ? 0.4000 0.3475 0.2142 -0.0645 0.0018  -0.0844 395 GLU B O   
5667 C CB  . GLU B 180 ? 0.4665 0.3975 0.2498 -0.0790 -0.0137 -0.1204 395 GLU B CB  
5668 C CG  . GLU B 180 ? 0.6229 0.5671 0.3991 -0.0729 -0.0349 -0.1410 395 GLU B CG  
5669 C CD  . GLU B 180 ? 0.6648 0.6120 0.4786 -0.0924 -0.0264 -0.1608 395 GLU B CD  
5670 O OE1 . GLU B 180 ? 0.5731 0.5074 0.4132 -0.1092 -0.0001 -0.1560 395 GLU B OE1 
5671 O OE2 . GLU B 180 ? 0.8509 0.8102 0.6647 -0.0883 -0.0432 -0.1812 395 GLU B OE2 
5678 N N   . ARG B 181 ? 0.5029 0.3287 0.3090 -0.0611 0.0011  -0.0626 396 ARG B N   
5679 C CA  . ARG B 181 ? 0.4891 0.3218 0.3240 -0.0466 0.0035  -0.0573 396 ARG B CA  
5680 C C   . ARG B 181 ? 0.4870 0.3168 0.3206 -0.0482 0.0143  -0.0609 396 ARG B C   
5681 O O   . ARG B 181 ? 0.4413 0.2753 0.2823 -0.0401 0.0100  -0.0528 396 ARG B O   
5682 C CB  . ARG B 181 ? 0.4373 0.2688 0.2982 -0.0409 0.0101  -0.0626 396 ARG B CB  
5683 C CG  . ARG B 181 ? 0.5258 0.3620 0.4083 -0.0275 0.0044  -0.0527 396 ARG B CG  
5684 C CD  . ARG B 181 ? 0.6598 0.4846 0.5567 -0.0247 0.0053  -0.0537 396 ARG B CD  
5685 N NE  . ARG B 181 ? 0.7755 0.5878 0.6882 -0.0203 0.0131  -0.0651 396 ARG B NE  
5686 C CZ  . ARG B 181 ? 0.8466 0.6574 0.7802 -0.0081 0.0119  -0.0656 396 ARG B CZ  
5687 N NH1 . ARG B 181 ? 0.6077 0.4268 0.5443 -0.0003 0.0045  -0.0534 396 ARG B NH1 
5688 N NH2 . ARG B 181 ? 0.9036 0.7063 0.8585 -0.0031 0.0174  -0.0813 396 ARG B NH2 
5702 N N   . TYR B 182 ? 0.3988 0.2233 0.2238 -0.0607 0.0301  -0.0759 397 TYR B N   
5703 C CA  . TYR B 182 ? 0.4145 0.2404 0.2389 -0.0673 0.0444  -0.0846 397 TYR B CA  
5704 C C   . TYR B 182 ? 0.4116 0.2285 0.2022 -0.0752 0.0359  -0.0712 397 TYR B C   
5705 O O   . TYR B 182 ? 0.4209 0.2411 0.2187 -0.0748 0.0422  -0.0715 397 TYR B O   
5706 C CB  . TYR B 182 ? 0.4250 0.2497 0.2424 -0.0844 0.0650  -0.1076 397 TYR B CB  
5707 C CG  . TYR B 182 ? 0.5452 0.3563 0.3103 -0.1097 0.0686  -0.1098 397 TYR B CG  
5708 C CD1 . TYR B 182 ? 0.5572 0.3603 0.2888 -0.1266 0.0734  -0.1059 397 TYR B CD1 
5709 C CD2 . TYR B 182 ? 0.6092 0.4163 0.3597 -0.1176 0.0665  -0.1135 397 TYR B CD2 
5710 C CE1 . TYR B 182 ? 0.6052 0.3963 0.2924 -0.1491 0.0731  -0.1004 397 TYR B CE1 
5711 C CE2 . TYR B 182 ? 0.7101 0.5095 0.4189 -0.1385 0.0664  -0.1098 397 TYR B CE2 
5712 C CZ  . TYR B 182 ? 0.7707 0.5602 0.4473 -0.1541 0.0690  -0.1023 397 TYR B CZ  
5713 O OH  . TYR B 182 ? 0.7582 0.5330 0.3904 -0.1765 0.0670  -0.0961 397 TYR B OH  
5723 N N   . MET B 183 ? 0.4470 0.2510 0.2033 -0.0815 0.0193  -0.0601 398 MET B N   
5724 C CA  . MET B 183 ? 0.4550 0.2417 0.1765 -0.0876 0.0051  -0.0462 398 MET B CA  
5725 C C   . MET B 183 ? 0.4760 0.2717 0.2244 -0.0668 -0.0094 -0.0338 398 MET B C   
5726 O O   . MET B 183 ? 0.4516 0.2387 0.1906 -0.0686 -0.0110 -0.0276 398 MET B O   
5727 C CB  . MET B 183 ? 0.5360 0.3035 0.2153 -0.0975 -0.0146 -0.0389 398 MET B CB  
5728 C CG  . MET B 183 ? 0.6338 0.3872 0.2728 -0.1238 -0.0006 -0.0507 398 MET B CG  
5729 S SD  . MET B 183 ? 0.6442 0.3785 0.2446 -0.1318 -0.0274 -0.0363 398 MET B SD  
5730 C CE  . MET B 183 ? 0.7913 0.5220 0.3665 -0.1602 -0.0029 -0.0480 398 MET B CE  
5740 N N   . MET B 184 ? 0.3915 0.2037 0.1703 -0.0505 -0.0186 -0.0316 399 MET B N   
5741 C CA  . MET B 184 ? 0.3717 0.1974 0.1794 -0.0327 -0.0279 -0.0243 399 MET B CA  
5742 C C   . MET B 184 ? 0.3489 0.1815 0.1782 -0.0278 -0.0138 -0.0268 399 MET B C   
5743 O O   . MET B 184 ? 0.3541 0.1879 0.1890 -0.0212 -0.0195 -0.0205 399 MET B O   
5744 C CB  . MET B 184 ? 0.3747 0.2181 0.2094 -0.0228 -0.0319 -0.0260 399 MET B CB  
5745 C CG  . MET B 184 ? 0.4124 0.2574 0.2368 -0.0258 -0.0468 -0.0270 399 MET B CG  
5746 S SD  . MET B 184 ? 0.4594 0.3255 0.3135 -0.0216 -0.0436 -0.0326 399 MET B SD  
5747 C CE  . MET B 184 ? 0.3654 0.2365 0.2090 -0.0275 -0.0608 -0.0385 399 MET B CE  
5757 N N   . ASN B 185 ? 0.3364 0.1741 0.1813 -0.0299 0.0028  -0.0380 400 ASN B N   
5758 C CA  . ASN B 185 ? 0.3226 0.1688 0.1926 -0.0242 0.0134  -0.0439 400 ASN B CA  
5759 C C   . ASN B 185 ? 0.3553 0.1955 0.2082 -0.0371 0.0226  -0.0474 400 ASN B C   
5760 O O   . ASN B 185 ? 0.3627 0.2100 0.2321 -0.0306 0.0229  -0.0460 400 ASN B O   
5761 C CB  . ASN B 185 ? 0.3196 0.1710 0.2147 -0.0216 0.0253  -0.0584 400 ASN B CB  
5762 C CG  . ASN B 185 ? 0.3088 0.1610 0.2214 -0.0089 0.0154  -0.0523 400 ASN B CG  
5763 O OD1 . ASN B 185 ? 0.3004 0.1562 0.2120 -0.0021 0.0032  -0.0395 400 ASN B OD1 
5764 N ND2 . ASN B 185 ? 0.3159 0.1634 0.2434 -0.0077 0.0211  -0.0633 400 ASN B ND2 
5771 N N   . SER B 186 ? 0.3771 0.2028 0.1938 -0.0578 0.0303  -0.0523 401 SER B N   
5772 C CA  . SER B 186 ? 0.4059 0.2195 0.1948 -0.0761 0.0388  -0.0536 401 SER B CA  
5773 C C   . SER B 186 ? 0.4085 0.2081 0.1816 -0.0710 0.0199  -0.0354 401 SER B C   
5774 O O   . SER B 186 ? 0.4120 0.2104 0.1863 -0.0757 0.0260  -0.0361 401 SER B O   
5775 C CB  . SER B 186 ? 0.4560 0.2483 0.1937 -0.1039 0.0467  -0.0580 401 SER B CB  
5776 O OG  . SER B 186 ? 0.5295 0.3342 0.2810 -0.1088 0.0630  -0.0765 401 SER B OG  
5782 N N   . VAL B 187 ? 0.4101 0.1994 0.1702 -0.0622 -0.0030 -0.0219 402 VAL B N   
5783 C CA  . VAL B 187 ? 0.4125 0.1896 0.1657 -0.0533 -0.0242 -0.0078 402 VAL B CA  
5784 C C   . VAL B 187 ? 0.3748 0.1748 0.1715 -0.0353 -0.0222 -0.0085 402 VAL B C   
5785 O O   . VAL B 187 ? 0.3752 0.1674 0.1695 -0.0349 -0.0261 -0.0039 402 VAL B O   
5786 C CB  . VAL B 187 ? 0.4165 0.1876 0.1631 -0.0430 -0.0504 0.0005  402 VAL B CB  
5787 C CG1 . VAL B 187 ? 0.4119 0.1773 0.1679 -0.0276 -0.0737 0.0098  402 VAL B CG1 
5788 C CG2 . VAL B 187 ? 0.4668 0.2094 0.1633 -0.0616 -0.0580 0.0034  402 VAL B CG2 
5798 N N   . LEU B 188 ? 0.3604 0.1849 0.1929 -0.0216 -0.0180 -0.0137 403 LEU B N   
5799 C CA  . LEU B 188 ? 0.3210 0.1647 0.1889 -0.0057 -0.0189 -0.0133 403 LEU B CA  
5800 C C   . LEU B 188 ? 0.3692 0.2202 0.2526 -0.0088 -0.0039 -0.0215 403 LEU B C   
5801 O O   . LEU B 188 ? 0.3743 0.2367 0.2799 0.0018  -0.0070 -0.0203 403 LEU B O   
5802 C CB  . LEU B 188 ? 0.2885 0.1489 0.1811 0.0054  -0.0195 -0.0153 403 LEU B CB  
5803 C CG  . LEU B 188 ? 0.3189 0.1831 0.2097 0.0114  -0.0348 -0.0099 403 LEU B CG  
5804 C CD1 . LEU B 188 ? 0.2996 0.1742 0.2047 0.0138  -0.0303 -0.0132 403 LEU B CD1 
5805 C CD2 . LEU B 188 ? 0.2747 0.1478 0.1787 0.0222  -0.0466 -0.0060 403 LEU B CD2 
5817 N N   . GLU B 189 ? 0.4286 0.2757 0.3022 -0.0243 0.0128  -0.0324 404 GLU B N   
5818 C CA  . GLU B 189 ? 0.4105 0.2700 0.3049 -0.0286 0.0280  -0.0453 404 GLU B CA  
5819 C C   . GLU B 189 ? 0.3682 0.2178 0.2489 -0.0344 0.0243  -0.0386 404 GLU B C   
5820 O O   . GLU B 189 ? 0.4025 0.2662 0.3066 -0.0341 0.0326  -0.0475 404 GLU B O   
5821 C CB  . GLU B 189 ? 0.4615 0.3219 0.3480 -0.0490 0.0502  -0.0638 404 GLU B CB  
5822 C CG  . GLU B 189 ? 0.6530 0.5303 0.5730 -0.0403 0.0578  -0.0794 404 GLU B CG  
5823 C CD  . GLU B 189 ? 0.8633 0.7430 0.7746 -0.0623 0.0808  -0.1012 404 GLU B CD  
5824 O OE1 . GLU B 189 ? 0.8619 0.7437 0.7630 -0.0815 0.0962  -0.1114 404 GLU B OE1 
5825 O OE2 . GLU B 189 ? 0.9754 0.8547 0.8879 -0.0631 0.0848  -0.1094 404 GLU B OE2 
5832 N N   . ASN B 190 ? 0.4552 0.2785 0.2980 -0.0406 0.0107  -0.0244 405 ASN B N   
5833 C CA  . ASN B 190 ? 0.4654 0.2709 0.2905 -0.0476 0.0052  -0.0176 405 ASN B CA  
5834 C C   . ASN B 190 ? 0.4515 0.2599 0.2937 -0.0264 -0.0158 -0.0073 405 ASN B C   
5835 O O   . ASN B 190 ? 0.4597 0.2485 0.2867 -0.0296 -0.0252 -0.0007 405 ASN B O   
5836 C CB  . ASN B 190 ? 0.6108 0.3772 0.3780 -0.0710 0.0018  -0.0099 405 ASN B CB  
5837 C CG  . ASN B 190 ? 0.6528 0.4197 0.4015 -0.0968 0.0274  -0.0244 405 ASN B CG  
5838 O OD1 . ASN B 190 ? 0.5639 0.3480 0.3308 -0.1073 0.0490  -0.0400 405 ASN B OD1 
5839 N ND2 . ASN B 190 ? 0.6486 0.4018 0.3672 -0.1062 0.0256  -0.0227 405 ASN B ND2 
5846 N N   . PHE B 191 ? 0.3668 0.1989 0.2402 -0.0069 -0.0218 -0.0077 406 PHE B N   
5847 C CA  . PHE B 191 ? 0.3626 0.2032 0.2543 0.0103  -0.0378 -0.0027 406 PHE B CA  
5848 C C   . PHE B 191 ? 0.2803 0.1483 0.2067 0.0219  -0.0325 -0.0081 406 PHE B C   
5849 O O   . PHE B 191 ? 0.3599 0.2407 0.2995 0.0247  -0.0253 -0.0123 406 PHE B O   
5850 C CB  . PHE B 191 ? 0.4360 0.2759 0.3247 0.0191  -0.0538 0.0017  406 PHE B CB  
5851 C CG  . PHE B 191 ? 0.6582 0.4665 0.5131 0.0122  -0.0697 0.0087  406 PHE B CG  
5852 C CD1 . PHE B 191 ? 0.7471 0.5394 0.5989 0.0183  -0.0877 0.0126  406 PHE B CD1 
5853 C CD2 . PHE B 191 ? 0.6271 0.4173 0.4506 -0.0011 -0.0687 0.0111  406 PHE B CD2 
5854 C CE1 . PHE B 191 ? 0.6317 0.3864 0.4494 0.0132  -0.1085 0.0205  406 PHE B CE1 
5855 C CE2 . PHE B 191 ? 0.7142 0.4679 0.4989 -0.0087 -0.0881 0.0195  406 PHE B CE2 
5856 C CZ  . PHE B 191 ? 0.6849 0.4187 0.4665 -0.0006 -0.1101 0.0251  406 PHE B CZ  
5866 N N   . THR B 192 ? 0.3152 0.1891 0.2545 0.0284  -0.0375 -0.0082 407 THR B N   
5867 C CA  . THR B 192 ? 0.2626 0.1600 0.2300 0.0388  -0.0360 -0.0123 407 THR B CA  
5868 C C   . THR B 192 ? 0.2667 0.1711 0.2427 0.0481  -0.0476 -0.0111 407 THR B C   
5869 O O   . THR B 192 ? 0.3253 0.2154 0.2915 0.0476  -0.0564 -0.0093 407 THR B O   
5870 C CB  . THR B 192 ? 0.2899 0.1942 0.2709 0.0341  -0.0252 -0.0202 407 THR B CB  
5871 O OG1 . THR B 192 ? 0.3999 0.2918 0.3709 0.0266  -0.0257 -0.0200 407 THR B OG1 
5872 C CG2 . THR B 192 ? 0.3718 0.2737 0.3498 0.0239  -0.0115 -0.0273 407 THR B CG2 
5880 N N   . ILE B 193 ? 0.2405 0.1642 0.2325 0.0557  -0.0488 -0.0130 408 ILE B N   
5881 C CA  . ILE B 193 ? 0.1938 0.1294 0.1951 0.0620  -0.0563 -0.0159 408 ILE B CA  
5882 C C   . ILE B 193 ? 0.2030 0.1509 0.2170 0.0641  -0.0541 -0.0189 408 ILE B C   
5883 O O   . ILE B 193 ? 0.2184 0.1700 0.2365 0.0646  -0.0515 -0.0179 408 ILE B O   
5884 C CB  . ILE B 193 ? 0.1883 0.1357 0.1901 0.0641  -0.0595 -0.0172 408 ILE B CB  
5885 C CG1 . ILE B 193 ? 0.2587 0.1954 0.2530 0.0639  -0.0660 -0.0170 408 ILE B CG1 
5886 C CG2 . ILE B 193 ? 0.1965 0.1622 0.2100 0.0675  -0.0629 -0.0250 408 ILE B CG2 
5887 C CD1 . ILE B 193 ? 0.2294 0.1812 0.2286 0.0643  -0.0679 -0.0219 408 ILE B CD1 
5899 N N   . LEU B 194 ? 0.1872 0.1384 0.2082 0.0658  -0.0575 -0.0234 409 LEU B N   
5900 C CA  . LEU B 194 ? 0.2182 0.1822 0.2509 0.0676  -0.0579 -0.0277 409 LEU B CA  
5901 C C   . LEU B 194 ? 0.2122 0.1901 0.2476 0.0705  -0.0631 -0.0330 409 LEU B C   
5902 O O   . LEU B 194 ? 0.2640 0.2401 0.3034 0.0724  -0.0665 -0.0385 409 LEU B O   
5903 C CB  . LEU B 194 ? 0.2331 0.1905 0.2721 0.0635  -0.0545 -0.0319 409 LEU B CB  
5904 C CG  . LEU B 194 ? 0.3179 0.2903 0.3730 0.0650  -0.0555 -0.0386 409 LEU B CG  
5905 C CD1 . LEU B 194 ? 0.2797 0.2598 0.3453 0.0671  -0.0545 -0.0395 409 LEU B CD1 
5906 C CD2 . LEU B 194 ? 0.5814 0.5470 0.6415 0.0582  -0.0516 -0.0448 409 LEU B CD2 
5918 N N   . GLN B 195 ? 0.2277 0.2171 0.2591 0.0695  -0.0644 -0.0324 410 GLN B N   
5919 C CA  . GLN B 195 ? 0.2189 0.2240 0.2497 0.0675  -0.0663 -0.0403 410 GLN B CA  
5920 C C   . GLN B 195 ? 0.2351 0.2468 0.2694 0.0675  -0.0703 -0.0435 410 GLN B C   
5921 O O   . GLN B 195 ? 0.2937 0.3019 0.3244 0.0679  -0.0751 -0.0377 410 GLN B O   
5922 C CB  . GLN B 195 ? 0.2570 0.2675 0.2709 0.0604  -0.0646 -0.0379 410 GLN B CB  
5923 C CG  . GLN B 195 ? 0.5885 0.6023 0.6047 0.0593  -0.0605 -0.0416 410 GLN B CG  
5924 C CD  . GLN B 195 ? 0.5345 0.5578 0.5350 0.0478  -0.0556 -0.0437 410 GLN B CD  
5925 O OE1 . GLN B 195 ? 0.3758 0.3895 0.3541 0.0402  -0.0569 -0.0342 410 GLN B OE1 
5926 N NE2 . GLN B 195 ? 0.4854 0.5259 0.4969 0.0453  -0.0512 -0.0571 410 GLN B NE2 
5935 N N   . VAL B 196 ? 0.1920 0.2128 0.2356 0.0679  -0.0705 -0.0544 411 VAL B N   
5936 C CA  . VAL B 196 ? 0.1801 0.2092 0.2276 0.0668  -0.0744 -0.0600 411 VAL B CA  
5937 C C   . VAL B 196 ? 0.2258 0.2714 0.2662 0.0608  -0.0733 -0.0711 411 VAL B C   
5938 O O   . VAL B 196 ? 0.2120 0.2655 0.2641 0.0620  -0.0698 -0.0836 411 VAL B O   
5939 C CB  . VAL B 196 ? 0.2210 0.2445 0.2862 0.0698  -0.0739 -0.0656 411 VAL B CB  
5940 C CG1 . VAL B 196 ? 0.2434 0.2779 0.3148 0.0681  -0.0783 -0.0723 411 VAL B CG1 
5941 C CG2 . VAL B 196 ? 0.1940 0.2023 0.2624 0.0704  -0.0707 -0.0575 411 VAL B CG2 
5951 N N   . VAL B 197 ? 0.1922 0.2420 0.2133 0.0539  -0.0780 -0.0682 412 VAL B N   
5952 C CA  . VAL B 197 ? 0.2075 0.2724 0.2135 0.0428  -0.0754 -0.0790 412 VAL B CA  
5953 C C   . VAL B 197 ? 0.2154 0.2860 0.2224 0.0419  -0.0825 -0.0849 412 VAL B C   
5954 O O   . VAL B 197 ? 0.2235 0.2855 0.2246 0.0442  -0.0942 -0.0754 412 VAL B O   
5955 C CB  . VAL B 197 ? 0.2308 0.2898 0.2016 0.0298  -0.0755 -0.0699 412 VAL B CB  
5956 C CG1 . VAL B 197 ? 0.2736 0.3503 0.2240 0.0122  -0.0681 -0.0848 412 VAL B CG1 
5957 C CG2 . VAL B 197 ? 0.2286 0.2826 0.2017 0.0307  -0.0684 -0.0649 412 VAL B CG2 
5967 N N   . THR B 198 ? 0.2307 0.3173 0.2491 0.0392  -0.0769 -0.1033 413 THR B N   
5968 C CA  . THR B 198 ? 0.2223 0.3164 0.2432 0.0372  -0.0825 -0.1121 413 THR B CA  
5969 C C   . THR B 198 ? 0.2413 0.3545 0.2475 0.0233  -0.0760 -0.1301 413 THR B C   
5970 O O   . THR B 198 ? 0.2574 0.3825 0.2622 0.0167  -0.0646 -0.1412 413 THR B O   
5971 C CB  . THR B 198 ? 0.2246 0.3163 0.2790 0.0476  -0.0820 -0.1199 413 THR B CB  
5972 O OG1 . THR B 198 ? 0.2926 0.3871 0.3638 0.0512  -0.0744 -0.1323 413 THR B OG1 
5973 C CG2 . THR B 198 ? 0.2409 0.3156 0.3067 0.0562  -0.0847 -0.1054 413 THR B CG2 
5981 N N   . ASN B 199 ? 0.2566 0.3750 0.2528 0.0175  -0.0832 -0.1352 414 ASN B N   
5982 C CA  . ASN B 199 ? 0.2833 0.4205 0.2648 0.0024  -0.0764 -0.1552 414 ASN B CA  
5983 C C   . ASN B 199 ? 0.2918 0.4422 0.3143 0.0110  -0.0680 -0.1781 414 ASN B C   
5984 O O   . ASN B 199 ? 0.2481 0.3923 0.2930 0.0209  -0.0746 -0.1791 414 ASN B O   
5985 C CB  . ASN B 199 ? 0.3048 0.4392 0.2593 -0.0061 -0.0906 -0.1512 414 ASN B CB  
5986 C CG  . ASN B 199 ? 0.3477 0.4944 0.2825 -0.0246 -0.0800 -0.1656 414 ASN B CG  
5987 O OD1 . ASN B 199 ? 0.3644 0.5281 0.3264 -0.0239 -0.0647 -0.1855 414 ASN B OD1 
5988 N ND2 . ASN B 199 ? 0.4028 0.5374 0.2896 -0.0408 -0.0896 -0.1549 414 ASN B ND2 
5995 N N   . ARG B 200 ? 0.3207 0.4858 0.3563 0.0077  -0.0532 -0.1937 415 ARG B N   
5996 C CA  . ARG B 200 ? 0.3273 0.4985 0.4069 0.0199  -0.0486 -0.2110 415 ARG B CA  
5997 C C   . ARG B 200 ? 0.3600 0.5375 0.4482 0.0173  -0.0485 -0.2223 415 ARG B C   
5998 O O   . ARG B 200 ? 0.3501 0.5201 0.4695 0.0292  -0.0523 -0.2286 415 ARG B O   
5999 C CB  . ARG B 200 ? 0.2893 0.4820 0.3887 0.0174  -0.0353 -0.2277 415 ARG B CB  
6000 C CG  . ARG B 200 ? 0.3407 0.5368 0.4897 0.0328  -0.0380 -0.2429 415 ARG B CG  
6001 C CD  . ARG B 200 ? 0.4744 0.7014 0.6519 0.0290  -0.0278 -0.2643 415 ARG B CD  
6002 N NE  . ARG B 200 ? 0.7902 1.0429 0.9637 0.0130  -0.0152 -0.2819 415 ARG B NE  
6003 C CZ  . ARG B 200 ? 0.7643 1.0505 0.9681 0.0065  -0.0049 -0.3065 415 ARG B CZ  
6004 N NH1 . ARG B 200 ? 0.5203 0.8191 0.7623 0.0154  -0.0087 -0.3164 415 ARG B NH1 
6005 N NH2 . ARG B 200 ? 0.7658 1.0738 0.9622 -0.0101 0.0075  -0.3220 415 ARG B NH2 
6019 N N   . ASP B 201 ? 0.3413 0.5290 0.3988 0.0002  -0.0452 -0.2241 416 ASP B N   
6020 C CA  . ASP B 201 ? 0.4580 0.6537 0.5226 -0.0037 -0.0443 -0.2367 416 ASP B CA  
6021 C C   . ASP B 201 ? 0.5230 0.7030 0.5860 0.0023  -0.0592 -0.2258 416 ASP B C   
6022 O O   . ASP B 201 ? 0.5017 0.6820 0.5883 0.0072  -0.0600 -0.2358 416 ASP B O   
6023 C CB  . ASP B 201 ? 0.4708 0.6816 0.5001 -0.0265 -0.0351 -0.2437 416 ASP B CB  
6024 C CG  . ASP B 201 ? 0.6683 0.9029 0.7102 -0.0349 -0.0164 -0.2611 416 ASP B CG  
6025 O OD1 . ASP B 201 ? 0.6653 0.9120 0.7556 -0.0212 -0.0120 -0.2766 416 ASP B OD1 
6026 O OD2 . ASP B 201 ? 0.9373 1.1776 0.9420 -0.0557 -0.0078 -0.2590 416 ASP B OD2 
6031 N N   . THR B 202 ? 0.4438 0.6114 0.4833 0.0020  -0.0715 -0.2061 417 THR B N   
6032 C CA  . THR B 202 ? 0.3907 0.5504 0.4327 0.0061  -0.0859 -0.1976 417 THR B CA  
6033 C C   . THR B 202 ? 0.3840 0.5301 0.4514 0.0207  -0.0920 -0.1878 417 THR B C   
6034 O O   . THR B 202 ? 0.3642 0.5071 0.4437 0.0243  -0.1006 -0.1841 417 THR B O   
6035 C CB  . THR B 202 ? 0.3889 0.5437 0.3901 -0.0039 -0.1003 -0.1824 417 THR B CB  
6036 O OG1 . THR B 202 ? 0.4313 0.5738 0.4210 0.0012  -0.1075 -0.1645 417 THR B OG1 
6037 C CG2 . THR B 202 ? 0.3997 0.5602 0.3611 -0.0240 -0.0948 -0.1881 417 THR B CG2 
6045 N N   . GLN B 203 ? 0.3099 0.4490 0.3838 0.0273  -0.0874 -0.1840 418 GLN B N   
6046 C CA  . GLN B 203 ? 0.2571 0.3792 0.3487 0.0383  -0.0903 -0.1717 418 GLN B CA  
6047 C C   . GLN B 203 ? 0.2594 0.3756 0.3401 0.0404  -0.1000 -0.1516 418 GLN B C   
6048 O O   . GLN B 203 ? 0.2886 0.3932 0.3852 0.0472  -0.0997 -0.1424 418 GLN B O   
6049 C CB  . GLN B 203 ? 0.4755 0.5894 0.5945 0.0414  -0.0900 -0.1810 418 GLN B CB  
6050 C CG  . GLN B 203 ? 0.7080 0.8216 0.8416 0.0423  -0.0828 -0.1986 418 GLN B CG  
6051 C CD  . GLN B 203 ? 0.7385 0.8407 0.8790 0.0503  -0.0796 -0.1970 418 GLN B CD  
6052 O OE1 . GLN B 203 ? 0.5984 0.6782 0.7422 0.0561  -0.0821 -0.1843 418 GLN B OE1 
6053 N NE2 . GLN B 203 ? 0.6220 0.7411 0.7637 0.0492  -0.0727 -0.2074 418 GLN B NE2 
6062 N N   . GLU B 204 ? 0.2441 0.3655 0.2969 0.0341  -0.1097 -0.1457 419 GLU B N   
6063 C CA  . GLU B 204 ? 0.2453 0.3579 0.2954 0.0399  -0.1228 -0.1293 419 GLU B CA  
6064 C C   . GLU B 204 ? 0.2396 0.3386 0.2781 0.0430  -0.1184 -0.1138 419 GLU B C   
6065 O O   . GLU B 204 ? 0.2463 0.3450 0.2641 0.0360  -0.1102 -0.1136 419 GLU B O   
6066 C CB  . GLU B 204 ? 0.3974 0.5099 0.4206 0.0336  -0.1394 -0.1240 419 GLU B CB  
6067 C CG  . GLU B 204 ? 0.7614 0.8717 0.7391 0.0184  -0.1392 -0.1224 419 GLU B CG  
6068 C CD  . GLU B 204 ? 0.7390 0.8519 0.6921 0.0060  -0.1489 -0.1257 419 GLU B CD  
6069 O OE1 . GLU B 204 ? 0.4825 0.5958 0.3972 -0.0119 -0.1434 -0.1298 419 GLU B OE1 
6070 O OE2 . GLU B 204 ? 0.6599 0.7748 0.6314 0.0123  -0.1610 -0.1253 419 GLU B OE2 
6077 N N   . LEU B 205 ? 0.2589 0.3492 0.3132 0.0524  -0.1232 -0.1035 420 LEU B N   
6078 C CA  . LEU B 205 ? 0.2237 0.3000 0.2694 0.0560  -0.1203 -0.0891 420 LEU B CA  
6079 C C   . LEU B 205 ? 0.2537 0.3187 0.2636 0.0514  -0.1344 -0.0765 420 LEU B C   
6080 O O   . LEU B 205 ? 0.2728 0.3349 0.2766 0.0528  -0.1530 -0.0739 420 LEU B O   
6081 C CB  . LEU B 205 ? 0.2066 0.2786 0.2816 0.0654  -0.1196 -0.0862 420 LEU B CB  
6082 C CG  . LEU B 205 ? 0.2848 0.3422 0.3523 0.0696  -0.1183 -0.0724 420 LEU B CG  
6083 C CD1 . LEU B 205 ? 0.5166 0.5687 0.5873 0.0684  -0.1014 -0.0722 420 LEU B CD1 
6084 C CD2 . LEU B 205 ? 0.3490 0.4052 0.4400 0.0774  -0.1243 -0.0721 420 LEU B CD2 
6096 N N   . LEU B 206 ? 0.2584 0.3140 0.2443 0.0452  -0.1267 -0.0683 421 LEU B N   
6097 C CA  . LEU B 206 ? 0.2949 0.3328 0.2383 0.0361  -0.1391 -0.0551 421 LEU B CA  
6098 C C   . LEU B 206 ? 0.2927 0.3112 0.2370 0.0435  -0.1426 -0.0405 421 LEU B C   
6099 O O   . LEU B 206 ? 0.3222 0.3191 0.2458 0.0444  -0.1616 -0.0281 421 LEU B O   
6100 C CB  . LEU B 206 ? 0.3132 0.3564 0.2223 0.0167  -0.1257 -0.0603 421 LEU B CB  
6101 C CG  . LEU B 206 ? 0.3213 0.3848 0.2263 0.0066  -0.1208 -0.0782 421 LEU B CG  
6102 C CD1 . LEU B 206 ? 0.3305 0.4081 0.2173 -0.0112 -0.1009 -0.0911 421 LEU B CD1 
6103 C CD2 . LEU B 206 ? 0.3626 0.4147 0.2336 -0.0012 -0.1425 -0.0721 421 LEU B CD2 
6115 N N   . LEU B 207 ? 0.2623 0.2854 0.2291 0.0489  -0.1262 -0.0423 422 LEU B N   
6116 C CA  . LEU B 207 ? 0.2599 0.2662 0.2271 0.0542  -0.1266 -0.0307 422 LEU B CA  
6117 C C   . LEU B 207 ? 0.2250 0.2391 0.2256 0.0627  -0.1119 -0.0360 422 LEU B C   
6118 O O   . LEU B 207 ? 0.2099 0.2351 0.2182 0.0601  -0.0994 -0.0442 422 LEU B O   
6119 C CB  . LEU B 207 ? 0.2996 0.2940 0.2299 0.0403  -0.1209 -0.0226 422 LEU B CB  
6120 C CG  . LEU B 207 ? 0.3996 0.3663 0.3105 0.0404  -0.1307 -0.0071 422 LEU B CG  
6121 C CD1 . LEU B 207 ? 0.4213 0.3648 0.3113 0.0422  -0.1582 0.0027  422 LEU B CD1 
6122 C CD2 . LEU B 207 ? 0.5156 0.4787 0.3926 0.0215  -0.1179 -0.0047 422 LEU B CD2 
6134 N N   . CYS B 208 ? 0.2176 0.2242 0.2371 0.0720  -0.1149 -0.0326 423 CYS B N   
6135 C CA  . CYS B 208 ? 0.1939 0.2025 0.2342 0.0753  -0.1004 -0.0359 423 CYS B CA  
6136 C C   . CYS B 208 ? 0.1964 0.1905 0.2350 0.0785  -0.1002 -0.0278 423 CYS B C   
6137 O O   . CYS B 208 ? 0.2087 0.1953 0.2521 0.0816  -0.1083 -0.0257 423 CYS B O   
6138 C CB  . CYS B 208 ? 0.2068 0.2265 0.2781 0.0792  -0.0978 -0.0470 423 CYS B CB  
6139 S SG  . CYS B 208 ? 0.2503 0.2640 0.3351 0.0773  -0.0804 -0.0493 423 CYS B SG  
6145 N N   . THR B 209 ? 0.2066 0.1960 0.2368 0.0747  -0.0889 -0.0244 424 THR B N   
6146 C CA  . THR B 209 ? 0.2081 0.1832 0.2316 0.0754  -0.0880 -0.0170 424 THR B CA  
6147 C C   . THR B 209 ? 0.1808 0.1555 0.2151 0.0753  -0.0749 -0.0200 424 THR B C   
6148 O O   . THR B 209 ? 0.2057 0.1836 0.2357 0.0718  -0.0682 -0.0216 424 THR B O   
6149 C CB  . THR B 209 ? 0.2266 0.1934 0.2193 0.0664  -0.0887 -0.0089 424 THR B CB  
6150 O OG1 . THR B 209 ? 0.3264 0.2890 0.2985 0.0616  -0.1008 -0.0053 424 THR B OG1 
6151 C CG2 . THR B 209 ? 0.2429 0.1914 0.2281 0.0666  -0.0896 -0.0012 424 THR B CG2 
6159 N N   . ALA B 210 ? 0.1903 0.1602 0.2381 0.0781  -0.0725 -0.0221 425 ALA B N   
6160 C CA  . ALA B 210 ? 0.1740 0.1388 0.2243 0.0750  -0.0606 -0.0243 425 ALA B CA  
6161 C C   . ALA B 210 ? 0.2017 0.1541 0.2379 0.0738  -0.0602 -0.0174 425 ALA B C   
6162 O O   . ALA B 210 ? 0.2025 0.1477 0.2392 0.0773  -0.0676 -0.0148 425 ALA B O   
6163 C CB  . ALA B 210 ? 0.1912 0.1618 0.2660 0.0754  -0.0545 -0.0360 425 ALA B CB  
6169 N N   . TYR B 211 ? 0.2482 0.1964 0.2715 0.0684  -0.0533 -0.0146 426 TYR B N   
6170 C CA  . TYR B 211 ? 0.2714 0.2101 0.2817 0.0655  -0.0519 -0.0096 426 TYR B CA  
6171 C C   . TYR B 211 ? 0.2592 0.1908 0.2690 0.0614  -0.0428 -0.0129 426 TYR B C   
6172 O O   . TYR B 211 ? 0.2571 0.1873 0.2619 0.0571  -0.0389 -0.0144 426 TYR B O   
6173 C CB  . TYR B 211 ? 0.2692 0.2122 0.2656 0.0613  -0.0527 -0.0066 426 TYR B CB  
6174 C CG  . TYR B 211 ? 0.3046 0.2554 0.2943 0.0595  -0.0579 -0.0054 426 TYR B CG  
6175 C CD1 . TYR B 211 ? 0.2826 0.2249 0.2558 0.0537  -0.0608 0.0003  426 TYR B CD1 
6176 C CD2 . TYR B 211 ? 0.2858 0.2497 0.2818 0.0609  -0.0596 -0.0106 426 TYR B CD2 
6177 C CE1 . TYR B 211 ? 0.3521 0.2983 0.3102 0.0466  -0.0640 0.0014  426 TYR B CE1 
6178 C CE2 . TYR B 211 ? 0.2693 0.2414 0.2549 0.0557  -0.0624 -0.0117 426 TYR B CE2 
6179 C CZ  . TYR B 211 ? 0.3151 0.2781 0.2793 0.0471  -0.0639 -0.0054 426 TYR B CZ  
6180 O OH  . TYR B 211 ? 0.3746 0.3419 0.3191 0.0365  -0.0654 -0.0060 426 TYR B OH  
6190 N N   . VAL B 212 ? 0.2410 0.1649 0.2533 0.0616  -0.0406 -0.0145 427 VAL B N   
6191 C CA  . VAL B 212 ? 0.2362 0.1534 0.2436 0.0550  -0.0308 -0.0189 427 VAL B CA  
6192 C C   . VAL B 212 ? 0.2677 0.1753 0.2623 0.0526  -0.0319 -0.0143 427 VAL B C   
6193 O O   . VAL B 212 ? 0.2584 0.1611 0.2519 0.0559  -0.0391 -0.0096 427 VAL B O   
6194 C CB  . VAL B 212 ? 0.2824 0.2034 0.3108 0.0553  -0.0232 -0.0320 427 VAL B CB  
6195 C CG1 . VAL B 212 ? 0.2607 0.1925 0.3001 0.0535  -0.0198 -0.0380 427 VAL B CG1 
6196 C CG2 . VAL B 212 ? 0.2451 0.1641 0.2938 0.0659  -0.0318 -0.0360 427 VAL B CG2 
6206 N N   . PHE B 213 ? 0.2425 0.1445 0.2237 0.0447  -0.0255 -0.0156 428 PHE B N   
6207 C CA  . PHE B 213 ? 0.2526 0.1483 0.2204 0.0405  -0.0266 -0.0123 428 PHE B CA  
6208 C C   . PHE B 213 ? 0.2582 0.1444 0.2202 0.0335  -0.0181 -0.0189 428 PHE B C   
6209 O O   . PHE B 213 ? 0.2939 0.1780 0.2508 0.0266  -0.0098 -0.0253 428 PHE B O   
6210 C CB  . PHE B 213 ? 0.2809 0.1811 0.2359 0.0375  -0.0317 -0.0083 428 PHE B CB  
6211 C CG  . PHE B 213 ? 0.2325 0.1447 0.1942 0.0428  -0.0385 -0.0060 428 PHE B CG  
6212 C CD1 . PHE B 213 ? 0.2676 0.1821 0.2345 0.0463  -0.0403 -0.0066 428 PHE B CD1 
6213 C CD2 . PHE B 213 ? 0.2729 0.1938 0.2346 0.0417  -0.0414 -0.0051 428 PHE B CD2 
6214 C CE1 . PHE B 213 ? 0.2415 0.1678 0.2162 0.0510  -0.0459 -0.0070 428 PHE B CE1 
6215 C CE2 . PHE B 213 ? 0.2526 0.1877 0.2205 0.0441  -0.0452 -0.0066 428 PHE B CE2 
6216 C CZ  . PHE B 213 ? 0.2446 0.1827 0.2204 0.0501  -0.0480 -0.0078 428 PHE B CZ  
6226 N N   . GLU B 214 ? 0.3020 0.1814 0.2613 0.0326  -0.0197 -0.0177 429 GLU B N   
6227 C CA  . GLU B 214 ? 0.3471 0.2178 0.2975 0.0249  -0.0135 -0.0232 429 GLU B CA  
6228 C C   . GLU B 214 ? 0.3248 0.1948 0.2627 0.0202  -0.0186 -0.0176 429 GLU B C   
6229 O O   . GLU B 214 ? 0.3673 0.2428 0.3060 0.0223  -0.0246 -0.0113 429 GLU B O   
6230 C CB  . GLU B 214 ? 0.3529 0.2141 0.3193 0.0285  -0.0101 -0.0320 429 GLU B CB  
6231 C CG  . GLU B 214 ? 0.5111 0.3792 0.4962 0.0304  -0.0015 -0.0455 429 GLU B CG  
6232 C CD  . GLU B 214 ? 0.6646 0.5263 0.6687 0.0323  0.0040  -0.0614 429 GLU B CD  
6233 O OE1 . GLU B 214 ? 0.5073 0.3536 0.5076 0.0333  -0.0013 -0.0589 429 GLU B OE1 
6234 O OE2 . GLU B 214 ? 0.5406 0.4132 0.5645 0.0313  0.0145  -0.0788 429 GLU B OE2 
6241 N N   . VAL B 215 ? 0.3873 0.2522 0.3139 0.0118  -0.0150 -0.0220 430 VAL B N   
6242 C CA  . VAL B 215 ? 0.3321 0.2003 0.2510 0.0058  -0.0191 -0.0199 430 VAL B CA  
6243 C C   . VAL B 215 ? 0.3099 0.1622 0.2300 0.0027  -0.0159 -0.0214 430 VAL B C   
6244 O O   . VAL B 215 ? 0.4209 0.2610 0.3457 0.0035  -0.0105 -0.0285 430 VAL B O   
6245 C CB  . VAL B 215 ? 0.3494 0.2222 0.2551 -0.0016 -0.0218 -0.0237 430 VAL B CB  
6246 C CG1 . VAL B 215 ? 0.4330 0.3129 0.3348 0.0026  -0.0304 -0.0207 430 VAL B CG1 
6247 C CG2 . VAL B 215 ? 0.6812 0.5410 0.5766 -0.0089 -0.0138 -0.0309 430 VAL B CG2 
6257 N N   . SER B 216 ? 0.5018 0.1669 0.3429 -0.0992 -0.0324 -0.0301 431 SER B N   
6258 C CA  . SER B 216 ? 0.5342 0.1737 0.3727 -0.0997 -0.0313 -0.0344 431 SER B CA  
6259 C C   . SER B 216 ? 0.5778 0.1971 0.3988 -0.1159 -0.0416 -0.0421 431 SER B C   
6260 O O   . SER B 216 ? 0.5768 0.2084 0.3987 -0.1291 -0.0523 -0.0388 431 SER B O   
6261 C CB  . SER B 216 ? 0.5181 0.1673 0.3839 -0.1007 -0.0287 -0.0226 431 SER B CB  
6262 O OG  . SER B 216 ? 0.5556 0.1742 0.4155 -0.1008 -0.0277 -0.0242 431 SER B OG  
6268 N N   . THR B 217 ? 0.6862 0.2730 0.4923 -0.1147 -0.0399 -0.0532 432 THR B N   
6269 C CA  . THR B 217 ? 0.8341 0.3991 0.6272 -0.1315 -0.0495 -0.0610 432 THR B CA  
6270 C C   . THR B 217 ? 0.7887 0.3667 0.6081 -0.1467 -0.0565 -0.0496 432 THR B C   
6271 O O   . THR B 217 ? 0.8393 0.4348 0.6851 -0.1428 -0.0505 -0.0375 432 THR B O   
6272 C CB  . THR B 217 ? 0.7617 0.2867 0.5427 -0.1260 -0.0452 -0.0753 432 THR B CB  
6273 O OG1 . THR B 217 ? 0.7839 0.3024 0.5860 -0.1157 -0.0393 -0.0655 432 THR B OG1 
6274 C CG2 . THR B 217 ? 0.7732 0.2873 0.5314 -0.1130 -0.0372 -0.0926 432 THR B CG2 
6282 N N   . SER B 218 ? 1.1078 0.6771 0.9192 -0.1653 -0.0686 -0.0552 433 SER B N   
6283 C CA  . SER B 218 ? 1.1394 0.7256 0.9788 -0.1827 -0.0763 -0.0473 433 SER B CA  
6284 C C   . SER B 218 ? 1.0631 0.6392 0.9240 -0.1857 -0.0674 -0.0410 433 SER B C   
6285 O O   . SER B 218 ? 1.0194 0.6210 0.9113 -0.1921 -0.0642 -0.0306 433 SER B O   
6286 C CB  . SER B 218 ? 0.9594 0.5337 0.7825 -0.2033 -0.0931 -0.0570 433 SER B CB  
6287 O OG  . SER B 218 ? 1.0554 0.5890 0.8481 -0.2045 -0.0918 -0.0724 433 SER B OG  
6293 N N   . GLU B 219 ? 0.8154 0.3523 0.6592 -0.1817 -0.0633 -0.0474 434 GLU B N   
6294 C CA  . GLU B 219 ? 0.9710 0.4882 0.8268 -0.1865 -0.0572 -0.0392 434 GLU B CA  
6295 C C   . GLU B 219 ? 0.8359 0.3648 0.7027 -0.1711 -0.0457 -0.0245 434 GLU B C   
6296 O O   . GLU B 219 ? 0.7983 0.3246 0.6775 -0.1798 -0.0409 -0.0125 434 GLU B O   
6297 C CB  . GLU B 219 ? 0.9349 0.4001 0.7686 -0.1859 -0.0586 -0.0511 434 GLU B CB  
6298 C CG  . GLU B 219 ? 1.1152 0.5631 0.9307 -0.2001 -0.0695 -0.0693 434 GLU B CG  
6299 C CD  . GLU B 219 ? 1.2596 0.6548 1.0543 -0.1954 -0.0687 -0.0857 434 GLU B CD  
6300 O OE1 . GLU B 219 ? 1.2522 0.6164 1.0533 -0.1953 -0.0651 -0.0798 434 GLU B OE1 
6301 O OE2 . GLU B 219 ? 1.3163 0.6989 1.0874 -0.1923 -0.0715 -0.1052 434 GLU B OE2 
6308 N N   . ARG B 220 ? 0.6942 0.2348 0.5538 -0.1506 -0.0416 -0.0258 435 ARG B N   
6309 C CA  . ARG B 220 ? 0.6644 0.2161 0.5310 -0.1359 -0.0331 -0.0138 435 ARG B CA  
6310 C C   . ARG B 220 ? 0.7406 0.3384 0.6285 -0.1363 -0.0294 -0.0058 435 ARG B C   
6311 O O   . ARG B 220 ? 0.5909 0.2131 0.4833 -0.1359 -0.0330 -0.0110 435 ARG B O   
6312 C CB  . ARG B 220 ? 0.6638 0.2021 0.5151 -0.1135 -0.0305 -0.0213 435 ARG B CB  
6313 C CG  . ARG B 220 ? 0.7212 0.2119 0.5582 -0.1078 -0.0321 -0.0298 435 ARG B CG  
6314 C CD  . ARG B 220 ? 0.7211 0.2027 0.5517 -0.0841 -0.0284 -0.0394 435 ARG B CD  
6315 N NE  . ARG B 220 ? 0.7062 0.1911 0.5438 -0.0697 -0.0254 -0.0257 435 ARG B NE  
6316 C CZ  . ARG B 220 ? 0.7229 0.1898 0.5602 -0.0482 -0.0242 -0.0313 435 ARG B CZ  
6317 N NH1 . ARG B 220 ? 0.7533 0.1994 0.5873 -0.0377 -0.0229 -0.0525 435 ARG B NH1 
6318 N NH2 . ARG B 220 ? 0.7137 0.1834 0.5548 -0.0369 -0.0243 -0.0173 435 ARG B NH2 
6332 N N   . GLY B 221 ? 0.5991 0.2052 0.4981 -0.1381 -0.0225 0.0070  436 GLY B N   
6333 C CA  . GLY B 221 ? 0.5663 0.2118 0.4875 -0.1388 -0.0171 0.0129  436 GLY B CA  
6334 C C   . GLY B 221 ? 0.5189 0.1769 0.4334 -0.1186 -0.0142 0.0122  436 GLY B C   
6335 O O   . GLY B 221 ? 0.5292 0.1688 0.4248 -0.1057 -0.0168 0.0053  436 GLY B O   
6339 N N   . ALA B 222 ? 0.5456 0.2334 0.4768 -0.1170 -0.0083 0.0176  437 ALA B N   
6340 C CA  . ALA B 222 ? 0.4774 0.1794 0.4048 -0.1006 -0.0055 0.0168  437 ALA B CA  
6341 C C   . ALA B 222 ? 0.4840 0.1630 0.3895 -0.0895 -0.0037 0.0218  437 ALA B C   
6342 O O   . ALA B 222 ? 0.5001 0.1599 0.3964 -0.0958 -0.0024 0.0309  437 ALA B O   
6343 C CB  . ALA B 222 ? 0.4621 0.1970 0.4133 -0.1039 0.0003  0.0205  437 ALA B CB  
6349 N N   . GLN B 223 ? 0.4624 0.1418 0.3592 -0.0739 -0.0044 0.0161  438 GLN B N   
6350 C CA  . GLN B 223 ? 0.5060 0.1639 0.3862 -0.0608 -0.0047 0.0197  438 GLN B CA  
6351 C C   . GLN B 223 ? 0.4505 0.1272 0.3321 -0.0479 -0.0023 0.0145  438 GLN B C   
6352 O O   . GLN B 223 ? 0.4222 0.1202 0.3130 -0.0486 -0.0009 0.0068  438 GLN B O   
6353 C CB  . GLN B 223 ? 0.5930 0.2149 0.4613 -0.0538 -0.0098 0.0134  438 GLN B CB  
6354 C CG  . GLN B 223 ? 0.8106 0.4005 0.6658 -0.0419 -0.0135 0.0211  438 GLN B CG  
6355 C CD  . GLN B 223 ? 0.8256 0.3733 0.6733 -0.0416 -0.0187 0.0191  438 GLN B CD  
6356 O OE1 . GLN B 223 ? 0.7303 0.2704 0.5800 -0.0450 -0.0189 0.0059  438 GLN B OE1 
6357 N NE2 . GLN B 223 ? 0.7601 0.2771 0.5964 -0.0382 -0.0236 0.0327  438 GLN B NE2 
6366 N N   . HIS B 224 ? 0.4605 0.1259 0.3309 -0.0369 -0.0029 0.0197  439 HIS B N   
6367 C CA  . HIS B 224 ? 0.4322 0.1116 0.3031 -0.0251 -0.0006 0.0145  439 HIS B CA  
6368 C C   . HIS B 224 ? 0.4625 0.1169 0.3227 -0.0057 -0.0063 0.0147  439 HIS B C   
6369 O O   . HIS B 224 ? 0.5008 0.1278 0.3515 -0.0022 -0.0129 0.0231  439 HIS B O   
6370 C CB  . HIS B 224 ? 0.4466 0.1471 0.3189 -0.0331 0.0044  0.0215  439 HIS B CB  
6371 C CG  . HIS B 224 ? 0.4896 0.1730 0.3437 -0.0387 0.0031  0.0360  439 HIS B CG  
6372 N ND1 . HIS B 224 ? 0.5377 0.2040 0.3709 -0.0280 -0.0021 0.0434  439 HIS B ND1 
6373 C CD2 . HIS B 224 ? 0.5471 0.2258 0.3974 -0.0545 0.0055  0.0455  439 HIS B CD2 
6374 C CE1 . HIS B 224 ? 0.5766 0.2282 0.3895 -0.0385 -0.0035 0.0585  439 HIS B CE1 
6375 N NE2 . HIS B 224 ? 0.5693 0.2284 0.3924 -0.0556 0.0031  0.0593  439 HIS B NE2 
6383 N N   . HIS B 225 ? 0.4567 0.1210 0.3214 0.0081  -0.0043 0.0046  440 HIS B N   
6384 C CA  . HIS B 225 ? 0.4748 0.1238 0.3374 0.0313  -0.0116 0.0033  440 HIS B CA  
6385 C C   . HIS B 225 ? 0.4501 0.1193 0.3136 0.0376  -0.0091 0.0001  440 HIS B C   
6386 O O   . HIS B 225 ? 0.4566 0.1493 0.3292 0.0311  0.0018  -0.0116 440 HIS B O   
6387 C CB  . HIS B 225 ? 0.5253 0.1659 0.4012 0.0480  -0.0104 -0.0148 440 HIS B CB  
6388 C CG  . HIS B 225 ? 0.6751 0.3012 0.5596 0.0757  -0.0210 -0.0159 440 HIS B CG  
6389 N ND1 . HIS B 225 ? 0.7864 0.4316 0.6815 0.0955  -0.0262 -0.0196 440 HIS B ND1 
6390 C CD2 . HIS B 225 ? 0.9413 0.5385 0.8299 0.0887  -0.0298 -0.0138 440 HIS B CD2 
6391 C CE1 . HIS B 225 ? 0.8065 0.4412 0.7159 0.1204  -0.0397 -0.0191 440 HIS B CE1 
6392 N NE2 . HIS B 225 ? 0.8021 0.4043 0.7065 0.1165  -0.0412 -0.0150 440 HIS B NE2 
6400 N N   . ILE B 226 ? 0.4666 0.1303 0.3208 0.0484  -0.0204 0.0115  441 ILE B N   
6401 C CA  . ILE B 226 ? 0.4374 0.1496 0.3033 0.0469  -0.0186 0.0096  441 ILE B CA  
6402 C C   . ILE B 226 ? 0.4383 0.1748 0.3290 0.0731  -0.0283 -0.0007 441 ILE B C   
6403 O O   . ILE B 226 ? 0.4786 0.1894 0.3669 0.0925  -0.0443 0.0059  441 ILE B O   
6404 C CB  . ILE B 226 ? 0.4494 0.1580 0.2900 0.0339  -0.0241 0.0285  441 ILE B CB  
6405 C CG1 . ILE B 226 ? 0.4487 0.1394 0.2727 0.0081  -0.0126 0.0367  441 ILE B CG1 
6406 C CG2 . ILE B 226 ? 0.4184 0.1762 0.2693 0.0296  -0.0209 0.0221  441 ILE B CG2 
6407 C CD1 . ILE B 226 ? 0.4834 0.1618 0.2752 -0.0063 -0.0156 0.0559  441 ILE B CD1 
6419 N N   . TYR B 227 ? 0.4005 0.1856 0.3174 0.0730  -0.0191 -0.0168 442 TYR B N   
6420 C CA  . TYR B 227 ? 0.3997 0.2213 0.3493 0.0947  -0.0262 -0.0295 442 TYR B CA  
6421 C C   . TYR B 227 ? 0.3751 0.2416 0.3329 0.0859  -0.0286 -0.0298 442 TYR B C   
6422 O O   . TYR B 227 ? 0.3487 0.2246 0.2970 0.0640  -0.0166 -0.0298 442 TYR B O   
6423 C CB  . TYR B 227 ? 0.3868 0.2298 0.3639 0.1002  -0.0097 -0.0534 442 TYR B CB  
6424 C CG  . TYR B 227 ? 0.4118 0.2135 0.3804 0.1077  -0.0048 -0.0598 442 TYR B CG  
6425 C CD1 . TYR B 227 ? 0.5331 0.3223 0.5210 0.1364  -0.0133 -0.0692 442 TYR B CD1 
6426 C CD2 . TYR B 227 ? 0.4504 0.2240 0.3933 0.0872  0.0065  -0.0578 442 TYR B CD2 
6427 C CE1 . TYR B 227 ? 0.5431 0.2888 0.5210 0.1427  -0.0082 -0.0783 442 TYR B CE1 
6428 C CE2 . TYR B 227 ? 0.5735 0.3073 0.5045 0.0913  0.0096  -0.0653 442 TYR B CE2 
6429 C CZ  . TYR B 227 ? 0.7053 0.4236 0.6519 0.1181  0.0037  -0.0765 442 TYR B CZ  
6430 O OH  . TYR B 227 ? 0.6002 0.2938 0.5422 0.1122  0.0093  -0.0824 442 TYR B OH  
6440 N N   . ARG B 228 ? 0.4177 0.3133 0.3970 0.1035  -0.0451 -0.0322 443 ARG B N   
6441 C CA  . ARG B 228 ? 0.4039 0.3525 0.4016 0.0948  -0.0453 -0.0411 443 ARG B CA  
6442 C C   . ARG B 228 ? 0.3837 0.3706 0.4173 0.0905  -0.0256 -0.0638 443 ARG B C   
6443 O O   . ARG B 228 ? 0.3791 0.3704 0.4367 0.1063  -0.0204 -0.0760 443 ARG B O   
6444 C CB  . ARG B 228 ? 0.4320 0.4034 0.4439 0.1140  -0.0729 -0.0367 443 ARG B CB  
6445 C CG  . ARG B 228 ? 0.5582 0.4980 0.5250 0.1105  -0.0934 -0.0122 443 ARG B CG  
6446 C CD  . ARG B 228 ? 0.7139 0.6712 0.6931 0.1326  -0.1269 -0.0052 443 ARG B CD  
6447 N NE  . ARG B 228 ? 0.8183 0.7495 0.8179 0.1637  -0.1408 -0.0020 443 ARG B NE  
6448 C CZ  . ARG B 228 ? 0.7017 0.6689 0.7571 0.1913  -0.1517 -0.0175 443 ARG B CZ  
6449 N NH1 . ARG B 228 ? 0.7641 0.7992 0.8612 0.1895  -0.1513 -0.0359 443 ARG B NH1 
6450 N NH2 . ARG B 228 ? 0.7353 0.6706 0.8083 0.2206  -0.1624 -0.0163 443 ARG B NH2 
6464 N N   . LEU B 229 ? 0.3601 0.3722 0.3957 0.0680  -0.0133 -0.0703 444 LEU B N   
6465 C CA  . LEU B 229 ? 0.3442 0.3959 0.4124 0.0607  0.0034  -0.0899 444 LEU B CA  
6466 C C   . LEU B 229 ? 0.3221 0.4299 0.4275 0.0657  -0.0072 -0.1011 444 LEU B C   
6467 O O   . LEU B 229 ? 0.3138 0.4341 0.4115 0.0567  -0.0189 -0.0967 444 LEU B O   
6468 C CB  . LEU B 229 ? 0.2826 0.3273 0.3356 0.0324  0.0212  -0.0905 444 LEU B CB  
6469 C CG  . LEU B 229 ? 0.3768 0.3819 0.4066 0.0243  0.0348  -0.0860 444 LEU B CG  
6470 C CD1 . LEU B 229 ? 0.3151 0.3091 0.3299 0.0006  0.0416  -0.0807 444 LEU B CD1 
6471 C CD2 . LEU B 229 ? 0.3810 0.3983 0.4241 0.0240  0.0511  -0.1003 444 LEU B CD2 
6483 N N   . VAL B 230 ? 0.3391 0.4840 0.4869 0.0789  -0.0019 -0.1181 445 VAL B N   
6484 C CA  . VAL B 230 ? 0.3124 0.5172 0.5062 0.0874  -0.0153 -0.1301 445 VAL B CA  
6485 C C   . VAL B 230 ? 0.3596 0.6138 0.5913 0.0719  0.0089  -0.1524 445 VAL B C   
6486 O O   . VAL B 230 ? 0.2852 0.5253 0.5081 0.0621  0.0343  -0.1589 445 VAL B O   
6487 C CB  . VAL B 230 ? 0.3272 0.5381 0.5490 0.1249  -0.0386 -0.1297 445 VAL B CB  
6488 C CG1 . VAL B 230 ? 0.3717 0.5225 0.5464 0.1362  -0.0608 -0.1037 445 VAL B CG1 
6489 C CG2 . VAL B 230 ? 0.3100 0.5277 0.5642 0.1426  -0.0204 -0.1482 445 VAL B CG2 
6499 N N   . ARG B 231 ? 0.3399 0.6527 0.6117 0.0671  0.0007  -0.1641 446 ARG B N   
6500 C CA  . ARG B 231 ? 0.4238 0.7904 0.7375 0.0509  0.0239  -0.1861 446 ARG B CA  
6501 C C   . ARG B 231 ? 0.3550 0.7961 0.7364 0.0658  0.0090  -0.2032 446 ARG B C   
6502 O O   . ARG B 231 ? 0.4969 0.9589 0.8858 0.0656  -0.0178 -0.1986 446 ARG B O   
6503 C CB  . ARG B 231 ? 0.4302 0.7921 0.7210 0.0113  0.0378  -0.1843 446 ARG B CB  
6504 C CG  . ARG B 231 ? 0.5938 0.9856 0.9050 -0.0130 0.0702  -0.2007 446 ARG B CG  
6505 C CD  . ARG B 231 ? 0.5028 0.8796 0.7890 -0.0524 0.0813  -0.1962 446 ARG B CD  
6506 N NE  . ARG B 231 ? 0.4126 0.8124 0.7119 -0.0605 0.0606  -0.1976 446 ARG B NE  
6507 C CZ  . ARG B 231 ? 0.4827 0.8588 0.7571 -0.0884 0.0612  -0.1929 446 ARG B CZ  
6508 N NH1 . ARG B 231 ? 0.5414 0.8693 0.7796 -0.1089 0.0794  -0.1835 446 ARG B NH1 
6509 N NH2 . ARG B 231 ? 0.5783 0.9769 0.8636 -0.0953 0.0418  -0.1981 446 ARG B NH2 
6523 N N   . ASP B 232 ? 0.4975 0.9715 0.9196 0.0748  0.0262  -0.2212 447 ASP B N   
6524 C CA  . ASP B 232 ? 0.5940 1.1249 1.0684 0.0802  0.0165  -0.2330 447 ASP B CA  
6525 C C   . ASP B 232 ? 0.6274 1.1930 1.1098 0.0523  0.0070  -0.2340 447 ASP B C   
6526 O O   . ASP B 232 ? 0.6742 1.2263 1.1278 0.0171  0.0257  -0.2329 447 ASP B O   
6527 C CB  . ASP B 232 ? 0.6852 1.2341 1.1790 0.0726  0.0478  -0.2495 447 ASP B CB  
6528 C CG  . ASP B 232 ? 0.7607 1.3143 1.2876 0.1105  0.0418  -0.2571 447 ASP B CG  
6529 O OD1 . ASP B 232 ? 0.5573 1.0676 1.0657 0.1379  0.0258  -0.2460 447 ASP B OD1 
6530 O OD2 . ASP B 232 ? 0.8321 1.4300 1.4031 0.1126  0.0528  -0.2740 447 ASP B OD2 
6535 N N   . VAL B 233 ? 0.5647 1.1685 1.0828 0.0680  -0.0236 -0.2348 448 VAL B N   
6536 C CA  . VAL B 233 ? 0.5083 1.1480 1.0382 0.0435  -0.0354 -0.2381 448 VAL B CA  
6537 C C   . VAL B 233 ? 0.4752 1.0868 0.9596 0.0292  -0.0542 -0.2252 448 VAL B C   
6538 O O   . VAL B 233 ? 0.6314 1.2151 1.0915 0.0506  -0.0770 -0.2118 448 VAL B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   216 ?   ?   ?   A . n 
A 1 2   ALA 2   217 ?   ?   ?   A . n 
A 1 3   TRP 3   218 ?   ?   ?   A . n 
A 1 4   GLN 4   219 ?   ?   ?   A . n 
A 1 5   ALA 5   220 ?   ?   ?   A . n 
A 1 6   ARG 6   221 ?   ?   ?   A . n 
A 1 7   GLY 7   222 222 GLY GLY A . n 
A 1 8   LEU 8   223 223 LEU LEU A . n 
A 1 9   GLY 9   224 224 GLY GLY A . n 
A 1 10  THR 10  225 225 THR THR A . n 
A 1 11  ALA 11  226 226 ALA ALA A . n 
A 1 12  ARG 12  227 227 ARG ARG A . n 
A 1 13  LEU 13  228 228 LEU LEU A . n 
A 1 14  GLN 14  229 229 GLN GLN A . n 
A 1 15  LEU 15  230 230 LEU LEU A . n 
A 1 16  VAL 16  231 231 VAL VAL A . n 
A 1 17  GLU 17  232 232 GLU GLU A . n 
A 1 18  PHE 18  233 233 PHE PHE A . n 
A 1 19  SER 19  234 234 SER SER A . n 
A 1 20  ALA 20  235 235 ALA ALA A . n 
A 1 21  PHE 21  236 236 PHE PHE A . n 
A 1 22  VAL 22  237 237 VAL VAL A . n 
A 1 23  GLU 23  238 238 GLU GLU A . n 
A 1 24  PRO 24  239 239 PRO PRO A . n 
A 1 25  PRO 25  240 ?   ?   ?   A . n 
A 1 26  ASP 26  241 ?   ?   ?   A . n 
A 1 27  ALA 27  242 ?   ?   ?   A . n 
A 1 28  VAL 28  243 ?   ?   ?   A . n 
A 1 29  ASP 29  244 ?   ?   ?   A . n 
A 1 30  SER 30  245 ?   ?   ?   A . n 
A 1 31  TYR 31  246 ?   ?   ?   A . n 
A 1 32  GLN 32  247 247 GLN GLN A . n 
A 1 33  ARG 33  248 248 ARG ARG A . n 
A 1 34  HIS 34  249 249 HIS HIS A . n 
A 1 35  LEU 35  250 250 LEU LEU A . n 
A 1 36  PHE 36  251 251 PHE PHE A . n 
A 1 37  VAL 37  252 252 VAL VAL A . n 
A 1 38  HIS 38  253 253 HIS HIS A . n 
A 1 39  ILE 39  254 254 ILE ILE A . n 
A 1 40  SER 40  255 255 SER SER A . n 
A 1 41  GLN 41  256 256 GLN GLN A . n 
A 1 42  HIS 42  257 ?   ?   ?   A . n 
A 1 43  CYS 43  258 ?   ?   ?   A . n 
A 1 44  PRO 44  259 ?   ?   ?   A . n 
A 1 45  SER 45  260 ?   ?   ?   A . n 
A 1 46  PRO 46  261 ?   ?   ?   A . n 
A 1 47  GLY 47  262 ?   ?   ?   A . n 
A 1 48  ALA 48  263 ?   ?   ?   A . n 
A 1 49  PRO 49  264 ?   ?   ?   A . n 
A 1 50  PRO 50  265 ?   ?   ?   A . n 
A 1 51  LEU 51  266 266 LEU LEU A . n 
A 1 52  GLU 52  267 267 GLU GLU A . n 
A 1 53  SER 53  268 268 SER SER A . n 
A 1 54  VAL 54  269 269 VAL VAL A . n 
A 1 55  ASP 55  270 270 ASP ASP A . n 
A 1 56  VAL 56  271 271 VAL VAL A . n 
A 1 57  ARG 57  272 272 ARG ARG A . n 
A 1 58  GLN 58  273 273 GLN GLN A . n 
A 1 59  ILE 59  274 274 ILE ILE A . n 
A 1 60  TYR 60  275 275 TYR TYR A . n 
A 1 61  ASP 61  276 276 ASP ASP A . n 
A 1 62  LYS 62  277 277 LYS LYS A . n 
A 1 63  PHE 63  278 278 PHE PHE A . n 
A 1 64  PRO 64  279 279 PRO PRO A . n 
A 1 65  GLU 65  280 280 GLU GLU A . n 
A 1 66  LYS 66  281 281 LYS LYS A . n 
A 1 67  LYS 67  282 282 LYS LYS A . n 
A 1 68  GLY 68  283 283 GLY GLY A . n 
A 1 69  GLY 69  284 284 GLY GLY A . n 
A 1 70  LEU 70  285 285 LEU LEU A . n 
A 1 71  ARG 71  286 286 ARG ARG A . n 
A 1 72  GLU 72  287 287 GLU GLU A . n 
A 1 73  LEU 73  288 288 LEU LEU A . n 
A 1 74  TYR 74  289 289 TYR TYR A . n 
A 1 75  ASP 75  290 290 ASP ASP A . n 
A 1 76  ARG 76  291 291 ARG ARG A . n 
A 1 77  GLY 77  292 292 GLY GLY A . n 
A 1 78  PRO 78  293 293 PRO PRO A . n 
A 1 79  PRO 79  294 294 PRO PRO A . n 
A 1 80  HIS 80  295 295 HIS HIS A . n 
A 1 81  ALA 81  296 296 ALA ALA A . n 
A 1 82  PHE 82  297 297 PHE PHE A . n 
A 1 83  PHE 83  298 298 PHE PHE A . n 
A 1 84  LEU 84  299 299 LEU LEU A . n 
A 1 85  VAL 85  300 300 VAL VAL A . n 
A 1 86  LYS 86  301 301 LYS LYS A . n 
A 1 87  PHE 87  302 302 PHE PHE A . n 
A 1 88  TRP 88  303 303 TRP TRP A . n 
A 1 89  ALA 89  304 304 ALA ALA A . n 
A 1 90  ASP 90  305 305 ASP ASP A . n 
A 1 91  LEU 91  306 306 LEU LEU A . n 
A 1 92  ASN 92  307 307 ASN ASN A . n 
A 1 93  TRP 93  308 308 TRP TRP A . n 
A 1 94  GLY 94  309 ?   ?   ?   A . n 
A 1 95  PRO 95  310 ?   ?   ?   A . n 
A 1 96  SER 96  311 ?   ?   ?   A . n 
A 1 97  GLY 97  312 ?   ?   ?   A . n 
A 1 98  GLU 98  313 ?   ?   ?   A . n 
A 1 99  GLU 99  314 ?   ?   ?   A . n 
A 1 100 ALA 100 315 ?   ?   ?   A . n 
A 1 101 GLY 101 316 ?   ?   ?   A . n 
A 1 102 ALA 102 317 ?   ?   ?   A . n 
A 1 103 GLY 103 318 ?   ?   ?   A . n 
A 1 104 GLY 104 319 ?   ?   ?   A . n 
A 1 105 SER 105 320 ?   ?   ?   A . n 
A 1 106 ILE 106 321 ?   ?   ?   A . n 
A 1 107 SER 107 322 ?   ?   ?   A . n 
A 1 108 SER 108 323 ?   ?   ?   A . n 
A 1 109 GLY 109 324 ?   ?   ?   A . n 
A 1 110 GLY 110 325 325 GLY GLY A . n 
A 1 111 PHE 111 326 326 PHE PHE A . n 
A 1 112 TYR 112 327 327 TYR TYR A . n 
A 1 113 GLY 113 328 328 GLY GLY A . n 
A 1 114 VAL 114 329 329 VAL VAL A . n 
A 1 115 SER 115 330 330 SER SER A . n 
A 1 116 SER 116 331 331 SER SER A . n 
A 1 117 GLN 117 332 332 GLN GLN A . n 
A 1 118 TYR 118 333 333 TYR TYR A . n 
A 1 119 GLU 119 334 334 GLU GLU A . n 
A 1 120 SER 120 335 335 SER SER A . n 
A 1 121 LEU 121 336 336 LEU LEU A . n 
A 1 122 GLU 122 337 337 GLU GLU A . n 
A 1 123 HIS 123 338 338 HIS HIS A . n 
A 1 124 MET 124 339 339 MET MET A . n 
A 1 125 THR 125 340 340 THR THR A . n 
A 1 126 LEU 126 341 341 LEU LEU A . n 
A 1 127 THR 127 342 342 THR THR A . n 
A 1 128 CYS 128 343 343 CYS CYS A . n 
A 1 129 SER 129 344 344 SER SER A . n 
A 1 130 SER 130 345 345 SER SER A . n 
A 1 131 LYS 131 346 346 LYS LYS A . n 
A 1 132 VAL 132 347 347 VAL VAL A . n 
A 1 133 CYS 133 348 348 CYS CYS A . n 
A 1 134 SER 134 349 349 SER SER A . n 
A 1 135 PHE 135 350 350 PHE PHE A . n 
A 1 136 GLY 136 351 351 GLY GLY A . n 
A 1 137 LYS 137 352 352 LYS LYS A . n 
A 1 138 GLN 138 353 353 GLN GLN A . n 
A 1 139 VAL 139 354 354 VAL VAL A . n 
A 1 140 VAL 140 355 355 VAL VAL A . n 
A 1 141 GLU 141 356 356 GLU GLU A . n 
A 1 142 LYS 142 357 357 LYS LYS A . n 
A 1 143 VAL 143 358 358 VAL VAL A . n 
A 1 144 GLU 144 359 359 GLU GLU A . n 
A 1 145 THR 145 360 360 THR THR A . n 
A 1 146 GLU 146 361 361 GLU GLU A . n 
A 1 147 ARG 147 362 362 ARG ARG A . n 
A 1 148 ALA 148 363 363 ALA ALA A . n 
A 1 149 GLN 149 364 364 GLN GLN A . n 
A 1 150 LEU 150 365 365 LEU LEU A . n 
A 1 151 GLU 151 366 366 GLU GLU A . n 
A 1 152 ASP 152 367 367 ASP ASP A . n 
A 1 153 GLY 153 368 368 GLY GLY A . n 
A 1 154 ARG 154 369 369 ARG ARG A . n 
A 1 155 PHE 155 370 370 PHE PHE A . n 
A 1 156 VAL 156 371 371 VAL VAL A . n 
A 1 157 TYR 157 372 372 TYR TYR A . n 
A 1 158 ARG 158 373 373 ARG ARG A . n 
A 1 159 LEU 159 374 374 LEU LEU A . n 
A 1 160 LEU 160 375 375 LEU LEU A . n 
A 1 161 ARG 161 376 376 ARG ARG A . n 
A 1 162 SER 162 377 377 SER SER A . n 
A 1 163 PRO 163 378 378 PRO PRO A . n 
A 1 164 MET 164 379 379 MET MET A . n 
A 1 165 CYS 165 380 380 CYS CYS A . n 
A 1 166 GLU 166 381 381 GLU GLU A . n 
A 1 167 TYR 167 382 382 TYR TYR A . n 
A 1 168 LEU 168 383 383 LEU LEU A . n 
A 1 169 VAL 169 384 384 VAL VAL A . n 
A 1 170 ASN 170 385 385 ASN ASN A . n 
A 1 171 PHE 171 386 386 PHE PHE A . n 
A 1 172 LEU 172 387 387 LEU LEU A . n 
A 1 173 HIS 173 388 388 HIS HIS A . n 
A 1 174 LYS 174 389 389 LYS LYS A . n 
A 1 175 LEU 175 390 390 LEU LEU A . n 
A 1 176 ARG 176 391 391 ARG ARG A . n 
A 1 177 GLN 177 392 392 GLN GLN A . n 
A 1 178 LEU 178 393 393 LEU LEU A . n 
A 1 179 PRO 179 394 394 PRO PRO A . n 
A 1 180 GLU 180 395 395 GLU GLU A . n 
A 1 181 ARG 181 396 396 ARG ARG A . n 
A 1 182 TYR 182 397 397 TYR TYR A . n 
A 1 183 MET 183 398 398 MET MET A . n 
A 1 184 MET 184 399 399 MET MET A . n 
A 1 185 ASN 185 400 400 ASN ASN A . n 
A 1 186 SER 186 401 401 SER SER A . n 
A 1 187 VAL 187 402 402 VAL VAL A . n 
A 1 188 LEU 188 403 403 LEU LEU A . n 
A 1 189 GLU 189 404 404 GLU GLU A . n 
A 1 190 ASN 190 405 405 ASN ASN A . n 
A 1 191 PHE 191 406 406 PHE PHE A . n 
A 1 192 THR 192 407 407 THR THR A . n 
A 1 193 ILE 193 408 408 ILE ILE A . n 
A 1 194 LEU 194 409 409 LEU LEU A . n 
A 1 195 GLN 195 410 410 GLN GLN A . n 
A 1 196 VAL 196 411 411 VAL VAL A . n 
A 1 197 VAL 197 412 412 VAL VAL A . n 
A 1 198 THR 198 413 413 THR THR A . n 
A 1 199 ASN 199 414 414 ASN ASN A . n 
A 1 200 ARG 200 415 415 ARG ARG A . n 
A 1 201 ASP 201 416 416 ASP ASP A . n 
A 1 202 THR 202 417 417 THR THR A . n 
A 1 203 GLN 203 418 418 GLN GLN A . n 
A 1 204 GLU 204 419 419 GLU GLU A . n 
A 1 205 LEU 205 420 420 LEU LEU A . n 
A 1 206 LEU 206 421 421 LEU LEU A . n 
A 1 207 LEU 207 422 422 LEU LEU A . n 
A 1 208 CYS 208 423 423 CYS CYS A . n 
A 1 209 THR 209 424 424 THR THR A . n 
A 1 210 ALA 210 425 425 ALA ALA A . n 
A 1 211 TYR 211 426 426 TYR TYR A . n 
A 1 212 VAL 212 427 427 VAL VAL A . n 
A 1 213 PHE 213 428 428 PHE PHE A . n 
A 1 214 GLU 214 429 429 GLU GLU A . n 
A 1 215 VAL 215 430 430 VAL VAL A . n 
A 1 216 SER 216 431 431 SER SER A . n 
A 1 217 THR 217 432 432 THR THR A . n 
A 1 218 SER 218 433 433 SER SER A . n 
A 1 219 GLU 219 434 434 GLU GLU A . n 
A 1 220 ARG 220 435 435 ARG ARG A . n 
A 1 221 GLY 221 436 436 GLY GLY A . n 
A 1 222 ALA 222 437 437 ALA ALA A . n 
A 1 223 GLN 223 438 438 GLN GLN A . n 
A 1 224 HIS 224 439 439 HIS HIS A . n 
A 1 225 HIS 225 440 440 HIS HIS A . n 
A 1 226 ILE 226 441 441 ILE ILE A . n 
A 1 227 TYR 227 442 442 TYR TYR A . n 
A 1 228 ARG 228 443 443 ARG ARG A . n 
A 1 229 LEU 229 444 444 LEU LEU A . n 
A 1 230 VAL 230 445 445 VAL VAL A . n 
A 1 231 ARG 231 446 446 ARG ARG A . n 
A 1 232 ASP 232 447 ?   ?   ?   A . n 
A 1 233 VAL 233 448 ?   ?   ?   A . n 
A 1 234 GLU 234 449 ?   ?   ?   A . n 
A 1 235 HIS 235 450 ?   ?   ?   A . n 
A 1 236 HIS 236 451 ?   ?   ?   A . n 
A 1 237 HIS 237 452 ?   ?   ?   A . n 
A 1 238 HIS 238 453 ?   ?   ?   A . n 
A 1 239 HIS 239 454 ?   ?   ?   A . n 
A 1 240 HIS 240 455 ?   ?   ?   A . n 
B 1 1   MET 1   216 ?   ?   ?   B . n 
B 1 2   ALA 2   217 ?   ?   ?   B . n 
B 1 3   TRP 3   218 ?   ?   ?   B . n 
B 1 4   GLN 4   219 ?   ?   ?   B . n 
B 1 5   ALA 5   220 220 ALA ALA B . n 
B 1 6   ARG 6   221 221 ARG ARG B . n 
B 1 7   GLY 7   222 222 GLY GLY B . n 
B 1 8   LEU 8   223 223 LEU LEU B . n 
B 1 9   GLY 9   224 224 GLY GLY B . n 
B 1 10  THR 10  225 225 THR THR B . n 
B 1 11  ALA 11  226 226 ALA ALA B . n 
B 1 12  ARG 12  227 227 ARG ARG B . n 
B 1 13  LEU 13  228 228 LEU LEU B . n 
B 1 14  GLN 14  229 229 GLN GLN B . n 
B 1 15  LEU 15  230 230 LEU LEU B . n 
B 1 16  VAL 16  231 231 VAL VAL B . n 
B 1 17  GLU 17  232 232 GLU GLU B . n 
B 1 18  PHE 18  233 233 PHE PHE B . n 
B 1 19  SER 19  234 234 SER SER B . n 
B 1 20  ALA 20  235 235 ALA ALA B . n 
B 1 21  PHE 21  236 236 PHE PHE B . n 
B 1 22  VAL 22  237 237 VAL VAL B . n 
B 1 23  GLU 23  238 238 GLU GLU B . n 
B 1 24  PRO 24  239 239 PRO PRO B . n 
B 1 25  PRO 25  240 240 PRO PRO B . n 
B 1 26  ASP 26  241 241 ASP ASP B . n 
B 1 27  ALA 27  242 242 ALA ALA B . n 
B 1 28  VAL 28  243 243 VAL VAL B . n 
B 1 29  ASP 29  244 244 ASP ASP B . n 
B 1 30  SER 30  245 245 SER SER B . n 
B 1 31  TYR 31  246 246 TYR TYR B . n 
B 1 32  GLN 32  247 247 GLN GLN B . n 
B 1 33  ARG 33  248 248 ARG ARG B . n 
B 1 34  HIS 34  249 249 HIS HIS B . n 
B 1 35  LEU 35  250 250 LEU LEU B . n 
B 1 36  PHE 36  251 251 PHE PHE B . n 
B 1 37  VAL 37  252 252 VAL VAL B . n 
B 1 38  HIS 38  253 253 HIS HIS B . n 
B 1 39  ILE 39  254 254 ILE ILE B . n 
B 1 40  SER 40  255 255 SER SER B . n 
B 1 41  GLN 41  256 256 GLN GLN B . n 
B 1 42  HIS 42  257 ?   ?   ?   B . n 
B 1 43  CYS 43  258 ?   ?   ?   B . n 
B 1 44  PRO 44  259 ?   ?   ?   B . n 
B 1 45  SER 45  260 ?   ?   ?   B . n 
B 1 46  PRO 46  261 ?   ?   ?   B . n 
B 1 47  GLY 47  262 ?   ?   ?   B . n 
B 1 48  ALA 48  263 263 ALA ALA B . n 
B 1 49  PRO 49  264 264 PRO PRO B . n 
B 1 50  PRO 50  265 265 PRO PRO B . n 
B 1 51  LEU 51  266 266 LEU LEU B . n 
B 1 52  GLU 52  267 267 GLU GLU B . n 
B 1 53  SER 53  268 268 SER SER B . n 
B 1 54  VAL 54  269 269 VAL VAL B . n 
B 1 55  ASP 55  270 270 ASP ASP B . n 
B 1 56  VAL 56  271 271 VAL VAL B . n 
B 1 57  ARG 57  272 272 ARG ARG B . n 
B 1 58  GLN 58  273 273 GLN GLN B . n 
B 1 59  ILE 59  274 274 ILE ILE B . n 
B 1 60  TYR 60  275 275 TYR TYR B . n 
B 1 61  ASP 61  276 276 ASP ASP B . n 
B 1 62  LYS 62  277 277 LYS LYS B . n 
B 1 63  PHE 63  278 278 PHE PHE B . n 
B 1 64  PRO 64  279 279 PRO PRO B . n 
B 1 65  GLU 65  280 280 GLU GLU B . n 
B 1 66  LYS 66  281 281 LYS LYS B . n 
B 1 67  LYS 67  282 282 LYS LYS B . n 
B 1 68  GLY 68  283 283 GLY GLY B . n 
B 1 69  GLY 69  284 284 GLY GLY B . n 
B 1 70  LEU 70  285 285 LEU LEU B . n 
B 1 71  ARG 71  286 286 ARG ARG B . n 
B 1 72  GLU 72  287 287 GLU GLU B . n 
B 1 73  LEU 73  288 288 LEU LEU B . n 
B 1 74  TYR 74  289 289 TYR TYR B . n 
B 1 75  ASP 75  290 290 ASP ASP B . n 
B 1 76  ARG 76  291 291 ARG ARG B . n 
B 1 77  GLY 77  292 292 GLY GLY B . n 
B 1 78  PRO 78  293 293 PRO PRO B . n 
B 1 79  PRO 79  294 294 PRO PRO B . n 
B 1 80  HIS 80  295 295 HIS HIS B . n 
B 1 81  ALA 81  296 296 ALA ALA B . n 
B 1 82  PHE 82  297 297 PHE PHE B . n 
B 1 83  PHE 83  298 298 PHE PHE B . n 
B 1 84  LEU 84  299 299 LEU LEU B . n 
B 1 85  VAL 85  300 300 VAL VAL B . n 
B 1 86  LYS 86  301 301 LYS LYS B . n 
B 1 87  PHE 87  302 302 PHE PHE B . n 
B 1 88  TRP 88  303 303 TRP TRP B . n 
B 1 89  ALA 89  304 304 ALA ALA B . n 
B 1 90  ASP 90  305 305 ASP ASP B . n 
B 1 91  LEU 91  306 306 LEU LEU B . n 
B 1 92  ASN 92  307 307 ASN ASN B . n 
B 1 93  TRP 93  308 308 TRP TRP B . n 
B 1 94  GLY 94  309 ?   ?   ?   B . n 
B 1 95  PRO 95  310 ?   ?   ?   B . n 
B 1 96  SER 96  311 ?   ?   ?   B . n 
B 1 97  GLY 97  312 ?   ?   ?   B . n 
B 1 98  GLU 98  313 ?   ?   ?   B . n 
B 1 99  GLU 99  314 ?   ?   ?   B . n 
B 1 100 ALA 100 315 ?   ?   ?   B . n 
B 1 101 GLY 101 316 ?   ?   ?   B . n 
B 1 102 ALA 102 317 ?   ?   ?   B . n 
B 1 103 GLY 103 318 ?   ?   ?   B . n 
B 1 104 GLY 104 319 ?   ?   ?   B . n 
B 1 105 SER 105 320 ?   ?   ?   B . n 
B 1 106 ILE 106 321 ?   ?   ?   B . n 
B 1 107 SER 107 322 ?   ?   ?   B . n 
B 1 108 SER 108 323 ?   ?   ?   B . n 
B 1 109 GLY 109 324 324 GLY GLY B . n 
B 1 110 GLY 110 325 325 GLY GLY B . n 
B 1 111 PHE 111 326 326 PHE PHE B . n 
B 1 112 TYR 112 327 327 TYR TYR B . n 
B 1 113 GLY 113 328 328 GLY GLY B . n 
B 1 114 VAL 114 329 329 VAL VAL B . n 
B 1 115 SER 115 330 330 SER SER B . n 
B 1 116 SER 116 331 331 SER SER B . n 
B 1 117 GLN 117 332 332 GLN GLN B . n 
B 1 118 TYR 118 333 333 TYR TYR B . n 
B 1 119 GLU 119 334 334 GLU GLU B . n 
B 1 120 SER 120 335 335 SER SER B . n 
B 1 121 LEU 121 336 336 LEU LEU B . n 
B 1 122 GLU 122 337 337 GLU GLU B . n 
B 1 123 HIS 123 338 338 HIS HIS B . n 
B 1 124 MET 124 339 339 MET MET B . n 
B 1 125 THR 125 340 340 THR THR B . n 
B 1 126 LEU 126 341 341 LEU LEU B . n 
B 1 127 THR 127 342 342 THR THR B . n 
B 1 128 CYS 128 343 343 CYS CYS B . n 
B 1 129 SER 129 344 344 SER SER B . n 
B 1 130 SER 130 345 345 SER SER B . n 
B 1 131 LYS 131 346 346 LYS LYS B . n 
B 1 132 VAL 132 347 347 VAL VAL B . n 
B 1 133 CYS 133 348 348 CYS CYS B . n 
B 1 134 SER 134 349 349 SER SER B . n 
B 1 135 PHE 135 350 350 PHE PHE B . n 
B 1 136 GLY 136 351 351 GLY GLY B . n 
B 1 137 LYS 137 352 352 LYS LYS B . n 
B 1 138 GLN 138 353 353 GLN GLN B . n 
B 1 139 VAL 139 354 354 VAL VAL B . n 
B 1 140 VAL 140 355 355 VAL VAL B . n 
B 1 141 GLU 141 356 356 GLU GLU B . n 
B 1 142 LYS 142 357 357 LYS LYS B . n 
B 1 143 VAL 143 358 358 VAL VAL B . n 
B 1 144 GLU 144 359 359 GLU GLU B . n 
B 1 145 THR 145 360 360 THR THR B . n 
B 1 146 GLU 146 361 361 GLU GLU B . n 
B 1 147 ARG 147 362 362 ARG ARG B . n 
B 1 148 ALA 148 363 363 ALA ALA B . n 
B 1 149 GLN 149 364 364 GLN GLN B . n 
B 1 150 LEU 150 365 365 LEU LEU B . n 
B 1 151 GLU 151 366 366 GLU GLU B . n 
B 1 152 ASP 152 367 367 ASP ASP B . n 
B 1 153 GLY 153 368 368 GLY GLY B . n 
B 1 154 ARG 154 369 369 ARG ARG B . n 
B 1 155 PHE 155 370 370 PHE PHE B . n 
B 1 156 VAL 156 371 371 VAL VAL B . n 
B 1 157 TYR 157 372 372 TYR TYR B . n 
B 1 158 ARG 158 373 373 ARG ARG B . n 
B 1 159 LEU 159 374 374 LEU LEU B . n 
B 1 160 LEU 160 375 375 LEU LEU B . n 
B 1 161 ARG 161 376 376 ARG ARG B . n 
B 1 162 SER 162 377 377 SER SER B . n 
B 1 163 PRO 163 378 378 PRO PRO B . n 
B 1 164 MET 164 379 379 MET MET B . n 
B 1 165 CYS 165 380 380 CYS CYS B . n 
B 1 166 GLU 166 381 381 GLU GLU B . n 
B 1 167 TYR 167 382 382 TYR TYR B . n 
B 1 168 LEU 168 383 383 LEU LEU B . n 
B 1 169 VAL 169 384 384 VAL VAL B . n 
B 1 170 ASN 170 385 385 ASN ASN B . n 
B 1 171 PHE 171 386 386 PHE PHE B . n 
B 1 172 LEU 172 387 387 LEU LEU B . n 
B 1 173 HIS 173 388 388 HIS HIS B . n 
B 1 174 LYS 174 389 389 LYS LYS B . n 
B 1 175 LEU 175 390 390 LEU LEU B . n 
B 1 176 ARG 176 391 391 ARG ARG B . n 
B 1 177 GLN 177 392 392 GLN GLN B . n 
B 1 178 LEU 178 393 393 LEU LEU B . n 
B 1 179 PRO 179 394 394 PRO PRO B . n 
B 1 180 GLU 180 395 395 GLU GLU B . n 
B 1 181 ARG 181 396 396 ARG ARG B . n 
B 1 182 TYR 182 397 397 TYR TYR B . n 
B 1 183 MET 183 398 398 MET MET B . n 
B 1 184 MET 184 399 399 MET MET B . n 
B 1 185 ASN 185 400 400 ASN ASN B . n 
B 1 186 SER 186 401 401 SER SER B . n 
B 1 187 VAL 187 402 402 VAL VAL B . n 
B 1 188 LEU 188 403 403 LEU LEU B . n 
B 1 189 GLU 189 404 404 GLU GLU B . n 
B 1 190 ASN 190 405 405 ASN ASN B . n 
B 1 191 PHE 191 406 406 PHE PHE B . n 
B 1 192 THR 192 407 407 THR THR B . n 
B 1 193 ILE 193 408 408 ILE ILE B . n 
B 1 194 LEU 194 409 409 LEU LEU B . n 
B 1 195 GLN 195 410 410 GLN GLN B . n 
B 1 196 VAL 196 411 411 VAL VAL B . n 
B 1 197 VAL 197 412 412 VAL VAL B . n 
B 1 198 THR 198 413 413 THR THR B . n 
B 1 199 ASN 199 414 414 ASN ASN B . n 
B 1 200 ARG 200 415 415 ARG ARG B . n 
B 1 201 ASP 201 416 416 ASP ASP B . n 
B 1 202 THR 202 417 417 THR THR B . n 
B 1 203 GLN 203 418 418 GLN GLN B . n 
B 1 204 GLU 204 419 419 GLU GLU B . n 
B 1 205 LEU 205 420 420 LEU LEU B . n 
B 1 206 LEU 206 421 421 LEU LEU B . n 
B 1 207 LEU 207 422 422 LEU LEU B . n 
B 1 208 CYS 208 423 423 CYS CYS B . n 
B 1 209 THR 209 424 424 THR THR B . n 
B 1 210 ALA 210 425 425 ALA ALA B . n 
B 1 211 TYR 211 426 426 TYR TYR B . n 
B 1 212 VAL 212 427 427 VAL VAL B . n 
B 1 213 PHE 213 428 428 PHE PHE B . n 
B 1 214 GLU 214 429 429 GLU GLU B . n 
B 1 215 VAL 215 430 430 VAL VAL B . n 
B 1 216 SER 216 431 431 SER SER B . n 
B 1 217 THR 217 432 432 THR THR B . n 
B 1 218 SER 218 433 433 SER SER B . n 
B 1 219 GLU 219 434 434 GLU GLU B . n 
B 1 220 ARG 220 435 435 ARG ARG B . n 
B 1 221 GLY 221 436 436 GLY GLY B . n 
B 1 222 ALA 222 437 437 ALA ALA B . n 
B 1 223 GLN 223 438 438 GLN GLN B . n 
B 1 224 HIS 224 439 439 HIS HIS B . n 
B 1 225 HIS 225 440 440 HIS HIS B . n 
B 1 226 ILE 226 441 441 ILE ILE B . n 
B 1 227 TYR 227 442 442 TYR TYR B . n 
B 1 228 ARG 228 443 443 ARG ARG B . n 
B 1 229 LEU 229 444 444 LEU LEU B . n 
B 1 230 VAL 230 445 445 VAL VAL B . n 
B 1 231 ARG 231 446 446 ARG ARG B . n 
B 1 232 ASP 232 447 447 ASP ASP B . n 
B 1 233 VAL 233 448 448 VAL VAL B . n 
B 1 234 GLU 234 449 ?   ?   ?   B . n 
B 1 235 HIS 235 450 ?   ?   ?   B . n 
B 1 236 HIS 236 451 ?   ?   ?   B . n 
B 1 237 HIS 237 452 ?   ?   ?   B . n 
B 1 238 HIS 238 453 ?   ?   ?   B . n 
B 1 239 HIS 239 454 ?   ?   ?   B . n 
B 1 240 HIS 240 455 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 5E4 1  501 2   5E4 BFA A . 
D 2 5E4 1  501 1   5E4 BFA B . 
E 2 5E4 1  502 3   5E4 BFA B . 
F 3 HOH 1  601 45  HOH HOH A . 
F 3 HOH 2  602 9   HOH HOH A . 
F 3 HOH 3  603 95  HOH HOH A . 
F 3 HOH 4  604 31  HOH HOH A . 
F 3 HOH 5  605 62  HOH HOH A . 
F 3 HOH 6  606 85  HOH HOH A . 
F 3 HOH 7  607 43  HOH HOH A . 
F 3 HOH 8  608 106 HOH HOH A . 
F 3 HOH 9  609 84  HOH HOH A . 
F 3 HOH 10 610 78  HOH HOH A . 
F 3 HOH 11 611 35  HOH HOH A . 
F 3 HOH 12 612 47  HOH HOH A . 
F 3 HOH 13 613 25  HOH HOH A . 
F 3 HOH 14 614 26  HOH HOH A . 
F 3 HOH 15 615 75  HOH HOH A . 
F 3 HOH 16 616 32  HOH HOH A . 
F 3 HOH 17 617 12  HOH HOH A . 
F 3 HOH 18 618 15  HOH HOH A . 
F 3 HOH 19 619 72  HOH HOH A . 
F 3 HOH 20 620 29  HOH HOH A . 
F 3 HOH 21 621 63  HOH HOH A . 
F 3 HOH 22 622 79  HOH HOH A . 
F 3 HOH 23 623 55  HOH HOH A . 
F 3 HOH 24 624 92  HOH HOH A . 
F 3 HOH 25 625 98  HOH HOH A . 
F 3 HOH 26 626 22  HOH HOH A . 
F 3 HOH 27 627 24  HOH HOH A . 
F 3 HOH 28 628 51  HOH HOH A . 
F 3 HOH 29 629 52  HOH HOH A . 
F 3 HOH 30 630 46  HOH HOH A . 
F 3 HOH 31 631 34  HOH HOH A . 
F 3 HOH 32 632 71  HOH HOH A . 
F 3 HOH 33 633 93  HOH HOH A . 
F 3 HOH 34 634 40  HOH HOH A . 
F 3 HOH 35 635 21  HOH HOH A . 
F 3 HOH 36 636 86  HOH HOH A . 
F 3 HOH 37 637 44  HOH HOH A . 
F 3 HOH 38 638 82  HOH HOH A . 
F 3 HOH 39 639 50  HOH HOH A . 
F 3 HOH 40 640 107 HOH HOH A . 
F 3 HOH 41 641 69  HOH HOH A . 
F 3 HOH 42 642 101 HOH HOH A . 
F 3 HOH 43 643 96  HOH HOH A . 
G 3 HOH 1  601 77  HOH HOH B . 
G 3 HOH 2  602 76  HOH HOH B . 
G 3 HOH 3  603 38  HOH HOH B . 
G 3 HOH 4  604 91  HOH HOH B . 
G 3 HOH 5  605 61  HOH HOH B . 
G 3 HOH 6  606 1   HOH HOH B . 
G 3 HOH 7  607 2   HOH HOH B . 
G 3 HOH 8  608 14  HOH HOH B . 
G 3 HOH 9  609 60  HOH HOH B . 
G 3 HOH 10 610 89  HOH HOH B . 
G 3 HOH 11 611 17  HOH HOH B . 
G 3 HOH 12 612 19  HOH HOH B . 
G 3 HOH 13 613 3   HOH HOH B . 
G 3 HOH 14 614 5   HOH HOH B . 
G 3 HOH 15 615 49  HOH HOH B . 
G 3 HOH 16 616 103 HOH HOH B . 
G 3 HOH 17 617 4   HOH HOH B . 
G 3 HOH 18 618 7   HOH HOH B . 
G 3 HOH 19 619 18  HOH HOH B . 
G 3 HOH 20 620 59  HOH HOH B . 
G 3 HOH 21 621 10  HOH HOH B . 
G 3 HOH 22 622 53  HOH HOH B . 
G 3 HOH 23 623 94  HOH HOH B . 
G 3 HOH 24 624 41  HOH HOH B . 
G 3 HOH 25 625 64  HOH HOH B . 
G 3 HOH 26 626 27  HOH HOH B . 
G 3 HOH 27 627 23  HOH HOH B . 
G 3 HOH 28 628 16  HOH HOH B . 
G 3 HOH 29 629 54  HOH HOH B . 
G 3 HOH 30 630 8   HOH HOH B . 
G 3 HOH 31 631 104 HOH HOH B . 
G 3 HOH 32 632 28  HOH HOH B . 
G 3 HOH 33 633 57  HOH HOH B . 
G 3 HOH 34 634 67  HOH HOH B . 
G 3 HOH 35 635 37  HOH HOH B . 
G 3 HOH 36 636 11  HOH HOH B . 
G 3 HOH 37 637 13  HOH HOH B . 
G 3 HOH 38 638 90  HOH HOH B . 
G 3 HOH 39 639 30  HOH HOH B . 
G 3 HOH 40 640 74  HOH HOH B . 
G 3 HOH 41 641 33  HOH HOH B . 
G 3 HOH 42 642 6   HOH HOH B . 
G 3 HOH 43 643 36  HOH HOH B . 
G 3 HOH 44 644 83  HOH HOH B . 
G 3 HOH 45 645 73  HOH HOH B . 
G 3 HOH 46 646 58  HOH HOH B . 
G 3 HOH 47 647 65  HOH HOH B . 
G 3 HOH 48 648 88  HOH HOH B . 
G 3 HOH 49 649 70  HOH HOH B . 
G 3 HOH 50 650 42  HOH HOH B . 
G 3 HOH 51 651 48  HOH HOH B . 
G 3 HOH 52 652 56  HOH HOH B . 
G 3 HOH 53 653 105 HOH HOH B . 
G 3 HOH 54 654 87  HOH HOH B . 
G 3 HOH 55 655 99  HOH HOH B . 
G 3 HOH 56 656 102 HOH HOH B . 
G 3 HOH 57 657 68  HOH HOH B . 
G 3 HOH 58 658 108 HOH HOH B . 
G 3 HOH 59 659 100 HOH HOH B . 
G 3 HOH 60 660 81  HOH HOH B . 
G 3 HOH 61 661 80  HOH HOH B . 
G 3 HOH 62 662 109 HOH HOH B . 
G 3 HOH 63 663 66  HOH HOH B . 
G 3 HOH 64 664 97  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F   
2 1 B,D,E,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-25 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2018-05-16 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Database references'        
3 2 'Structure model' 'Derived calculations'       
4 2 'Structure model' 'Refinement description'     
5 3 'Structure model' 'Data collection'            
6 3 'Structure model' 'Database references'        
7 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' pdbx_audit_support    
3 2 'Structure model' pdbx_struct_oper_list 
4 2 'Structure model' software              
5 3 'Structure model' citation              
6 3 'Structure model' citation_author       
7 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_CSD'                  
2 2 'Structure model' '_pdbx_audit_support.funding_organization'  
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 2 'Structure model' '_software.classification'                  
5 3 'Structure model' '_citation.journal_id_ISSN'                 
6 3 'Structure model' '_citation.pdbx_database_id_PubMed'         
7 3 'Structure model' '_citation.title'                           
8 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 36.7522 49.8259 -15.8666 0.4001 0.4671 0.4307 0.0567  0.0647  0.0425  4.8253 4.1576 4.5924 
-0.1203 -1.0480 -0.2975 -0.1313 0.9546  0.0796  -0.3926 0.4244  0.6916  -0.6131 -0.2912 -0.3690 
'X-RAY DIFFRACTION' 2  ? refined 42.4106 48.1277 -14.4196 0.3264 0.1782 0.3372 0.0891  0.0493  0.0154  1.8124 0.5205 5.1941 0.4705 
-1.4714 -0.6483 0.1993  -0.2896 0.2640  0.1205  0.2050  0.2115  -0.4276 0.1998  -0.1664 
'X-RAY DIFFRACTION' 3  ? refined 47.2990 17.0928 -7.6331  0.2210 0.2811 0.2094 -0.0345 -0.0442 -0.0325 4.8603 1.4144 5.9794 1.2857 
4.7655  0.4026  0.3909  -0.4384 -0.4837 0.0837  -0.1624 -0.1824 0.7500  -0.0190 -0.4160 
'X-RAY DIFFRACTION' 4  ? refined 37.6617 11.9901 -14.0751 0.3302 0.1839 0.2854 -0.1122 -0.0371 -0.0487 6.2734 2.5629 3.7130 
-0.0717 0.0707  0.0034  -0.1551 -0.2830 -0.6160 0.1018  0.0620  0.1119  0.6014  -0.6660 -0.0315 
'X-RAY DIFFRACTION' 5  ? refined 63.4224 21.0527 -22.0647 0.4173 0.7639 0.5638 0.0276  0.0139  -0.0433 6.8475 3.6905 9.1953 
-2.4350 2.8370  -5.7231 0.1697  1.5492  0.6508  -0.5510 -0.5413 -0.9405 0.1286  1.6446  0.0945  
'X-RAY DIFFRACTION' 6  ? refined 54.3769 22.8053 -17.6071 0.2787 0.1725 0.2446 0.0762  -0.0504 0.0434  3.3737 2.3773 3.5868 0.2201 
0.9046  0.1875  -0.3761 0.0454  0.4646  -0.4951 0.0466  -0.1532 -0.0863 0.3491  0.3070  
'X-RAY DIFFRACTION' 7  ? refined 45.7933 25.3418 -10.0180 0.1667 0.2637 0.2078 0.0773  -0.0565 -0.0268 1.4884 0.9542 4.9715 0.9561 
2.0955  0.5004  0.0170  -0.3708 0.2067  0.0647  -0.1652 0.0091  0.0953  -0.0795 0.0207  
'X-RAY DIFFRACTION' 8  ? refined 45.5641 31.8808 -14.0261 0.2697 0.3187 0.3054 0.1615  -0.1144 -0.0395 4.7143 2.2149 1.0625 
-0.9373 -1.9659 1.0723  -0.1115 -0.2706 0.0630  -0.2180 0.2758  0.1985  0.0287  -0.0277 -0.1329 
'X-RAY DIFFRACTION' 9  ? refined 40.2725 22.7394 -2.2362  0.1889 0.4485 0.2158 -0.0090 0.0241  -0.0260 5.1330 1.1553 7.6577 0.4234 
5.4395  1.4681  0.0099  -0.9949 -0.2851 0.0219  0.0796  -0.1219 -0.0767 -1.1692 -0.1337 
'X-RAY DIFFRACTION' 10 ? refined 37.9968 20.2163 -30.6102 0.2461 0.3273 0.1833 0.0134  -0.0206 -0.0108 4.9352 4.3762 3.4023 
-4.1123 -4.1100 3.1948  0.1004  0.3536  -0.1027 -0.6625 -0.0010 0.3909  -0.1479 -0.4957 0.1323  
'X-RAY DIFFRACTION' 11 ? refined 50.7612 22.4140 -19.0936 0.1711 0.1230 0.1829 0.0645  -0.0526 -0.0152 2.5469 3.9323 3.0877 1.9064 
1.1036  2.5656  -0.0607 -0.1557 0.0419  -0.0953 0.0660  -0.1947 0.0402  -0.0222 -0.0551 
'X-RAY DIFFRACTION' 12 ? refined 54.7288 11.5987 -18.3856 0.4314 0.1185 0.3154 0.0501  0.0080  -0.0372 4.0120 4.6760 4.0540 1.6758 
0.6760  1.0598  0.0653  -0.0642 -0.6954 -0.0113 0.2307  -0.4480 0.9021  0.5239  -0.4777 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 222 through 293 )
;
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 294 through 446 )
;
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 220 through 238 )
;
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 239 through 267 )
;
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 268 through 277 )
;
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 278 through 325 )
;
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 326 through 351 )
;
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 352 through 362 )
;
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 363 through 380 )
;
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 381 through 395 )
;
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 396 through 430 )
;
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 431 through 448 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: dev_1951)' 1 
? phasing          ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                           2 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                           3 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                           4 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .                           5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HH11 B ARG 248 ? ? O    B HOH 601 ? ? 1.31 
2  1 HH12 B ARG 396 ? ? O    B HOH 604 ? ? 1.39 
3  1 HG1  A THR 225 ? ? O    A HOH 604 ? ? 1.46 
4  1 HH   B TYR 333 ? ? O    B HOH 608 ? ? 1.50 
5  1 OE1  A GLU 238 ? ? HH12 A ARG 376 ? ? 1.58 
6  1 NH1  B ARG 248 ? ? O    B HOH 601 ? ? 2.03 
7  1 O    B HOH 634 ? ? O    B HOH 652 ? ? 2.06 
8  1 O    B GLN 256 ? ? O    B HOH 602 ? ? 2.06 
9  1 O    B HOH 605 ? ? O    B HOH 616 ? ? 2.10 
10 1 O    B HOH 660 ? ? O    B HOH 664 ? ? 2.13 
11 1 O    B HOH 653 ? ? O    B HOH 662 ? ? 2.16 
12 1 O    B HOH 660 ? ? O    B HOH 661 ? ? 2.16 
13 1 OE1  A GLU 334 ? ? O    A HOH 601 ? ? 2.18 
14 1 O    A PHE 406 ? ? O    A HOH 602 ? ? 2.18 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 HZ3 A LYS 301 ? ? 1_555 OE1 B GLU 434 ? ? 1_565 1.52 
2 1 O   B HOH 626 ? ? 1_555 O   B HOH 626 ? ? 2_655 2.04 
3 1 O   A HOH 636 ? ? 1_555 O   B HOH 658 ? ? 4_554 2.14 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 267 ? ? -49.28  165.59  
2 1 GLU B 366 ? ? -125.58 -159.36 
3 1 LEU B 374 ? ? -119.08 76.17   
4 1 ASP B 447 ? ? -38.88  135.76  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 216 ? A MET 1   
2  1 Y 1 A ALA 217 ? A ALA 2   
3  1 Y 1 A TRP 218 ? A TRP 3   
4  1 Y 1 A GLN 219 ? A GLN 4   
5  1 Y 1 A ALA 220 ? A ALA 5   
6  1 Y 1 A ARG 221 ? A ARG 6   
7  1 Y 1 A PRO 240 ? A PRO 25  
8  1 Y 1 A ASP 241 ? A ASP 26  
9  1 Y 1 A ALA 242 ? A ALA 27  
10 1 Y 1 A VAL 243 ? A VAL 28  
11 1 Y 1 A ASP 244 ? A ASP 29  
12 1 Y 1 A SER 245 ? A SER 30  
13 1 Y 1 A TYR 246 ? A TYR 31  
14 1 Y 1 A HIS 257 ? A HIS 42  
15 1 Y 1 A CYS 258 ? A CYS 43  
16 1 Y 1 A PRO 259 ? A PRO 44  
17 1 Y 1 A SER 260 ? A SER 45  
18 1 Y 1 A PRO 261 ? A PRO 46  
19 1 Y 1 A GLY 262 ? A GLY 47  
20 1 Y 1 A ALA 263 ? A ALA 48  
21 1 Y 1 A PRO 264 ? A PRO 49  
22 1 Y 1 A PRO 265 ? A PRO 50  
23 1 Y 1 A GLY 309 ? A GLY 94  
24 1 Y 1 A PRO 310 ? A PRO 95  
25 1 Y 1 A SER 311 ? A SER 96  
26 1 Y 1 A GLY 312 ? A GLY 97  
27 1 Y 1 A GLU 313 ? A GLU 98  
28 1 Y 1 A GLU 314 ? A GLU 99  
29 1 Y 1 A ALA 315 ? A ALA 100 
30 1 Y 1 A GLY 316 ? A GLY 101 
31 1 Y 1 A ALA 317 ? A ALA 102 
32 1 Y 1 A GLY 318 ? A GLY 103 
33 1 Y 1 A GLY 319 ? A GLY 104 
34 1 Y 1 A SER 320 ? A SER 105 
35 1 Y 1 A ILE 321 ? A ILE 106 
36 1 Y 1 A SER 322 ? A SER 107 
37 1 Y 1 A SER 323 ? A SER 108 
38 1 Y 1 A GLY 324 ? A GLY 109 
39 1 Y 1 A ASP 447 ? A ASP 232 
40 1 Y 1 A VAL 448 ? A VAL 233 
41 1 Y 1 A GLU 449 ? A GLU 234 
42 1 Y 1 A HIS 450 ? A HIS 235 
43 1 Y 1 A HIS 451 ? A HIS 236 
44 1 Y 1 A HIS 452 ? A HIS 237 
45 1 Y 1 A HIS 453 ? A HIS 238 
46 1 Y 1 A HIS 454 ? A HIS 239 
47 1 Y 1 A HIS 455 ? A HIS 240 
48 1 Y 1 B MET 216 ? B MET 1   
49 1 Y 1 B ALA 217 ? B ALA 2   
50 1 Y 1 B TRP 218 ? B TRP 3   
51 1 Y 1 B GLN 219 ? B GLN 4   
52 1 Y 1 B HIS 257 ? B HIS 42  
53 1 Y 1 B CYS 258 ? B CYS 43  
54 1 Y 1 B PRO 259 ? B PRO 44  
55 1 Y 1 B SER 260 ? B SER 45  
56 1 Y 1 B PRO 261 ? B PRO 46  
57 1 Y 1 B GLY 262 ? B GLY 47  
58 1 Y 1 B GLY 309 ? B GLY 94  
59 1 Y 1 B PRO 310 ? B PRO 95  
60 1 Y 1 B SER 311 ? B SER 96  
61 1 Y 1 B GLY 312 ? B GLY 97  
62 1 Y 1 B GLU 313 ? B GLU 98  
63 1 Y 1 B GLU 314 ? B GLU 99  
64 1 Y 1 B ALA 315 ? B ALA 100 
65 1 Y 1 B GLY 316 ? B GLY 101 
66 1 Y 1 B ALA 317 ? B ALA 102 
67 1 Y 1 B GLY 318 ? B GLY 103 
68 1 Y 1 B GLY 319 ? B GLY 104 
69 1 Y 1 B SER 320 ? B SER 105 
70 1 Y 1 B ILE 321 ? B ILE 106 
71 1 Y 1 B SER 322 ? B SER 107 
72 1 Y 1 B SER 323 ? B SER 108 
73 1 Y 1 B GLU 449 ? B GLU 234 
74 1 Y 1 B HIS 450 ? B HIS 235 
75 1 Y 1 B HIS 451 ? B HIS 236 
76 1 Y 1 B HIS 452 ? B HIS 237 
77 1 Y 1 B HIS 453 ? B HIS 238 
78 1 Y 1 B HIS 454 ? B HIS 239 
79 1 Y 1 B HIS 455 ? B HIS 240 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           5R01GM107415 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-[(3-bromophenyl)amino]benzoic acid' 5E4 
3 water                                  HOH 
#