data_5DST
# 
_entry.id   5DST 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DST         
WWPDB D_1000213737 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DST 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Toma-Fukai, S.' 1 
'Shimizu, T.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            428 
_citation.language                  ? 
_citation.page_first                1197 
_citation.page_last                 1208 
_citation.title                     'Novel helical assembly in arginine methyltransferase 8' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2016.02.007 
_citation.pdbx_database_id_PubMed   26876602 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Toma-Fukai, S.' 1 ? 
primary 'Kim, J.D.'      2 ? 
primary 'Park, K.E.'     3 ? 
primary 'Kuwabara, N.'   4 ? 
primary 'Shimizu, N.'    5 ? 
primary 'Krayukhina, E.' 6 ? 
primary 'Uchiyama, S.'   7 ? 
primary 'Fukamizu, A.'   8 ? 
primary 'Shimizu, T.'    9 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   106.48 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5DST 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     199.983 
_cell.length_a_esd                 ? 
_cell.length_b                     130.943 
_cell.length_b_esd                 ? 
_cell.length_c                     294.377 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        60 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5DST 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein arginine N-methyltransferase 8' 38512.094 15 2.1.1.- ? 'UNP residues 68-394' ? 
2 non-polymer man S-ADENOSYL-L-HOMOCYSTEINE                384.411   15 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIEC
SSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALY
VVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQL
CETSVSNDYKMR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIEC
SSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALY
VVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQL
CETSVSNDYKMR
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   GLU n 
1 7   GLU n 
1 8   MET n 
1 9   THR n 
1 10  SER n 
1 11  ARG n 
1 12  ASP n 
1 13  TYR n 
1 14  TYR n 
1 15  PHE n 
1 16  ASP n 
1 17  SER n 
1 18  TYR n 
1 19  ALA n 
1 20  HIS n 
1 21  PHE n 
1 22  GLY n 
1 23  ILE n 
1 24  HIS n 
1 25  GLU n 
1 26  GLU n 
1 27  MET n 
1 28  LEU n 
1 29  LYS n 
1 30  ASP n 
1 31  GLU n 
1 32  VAL n 
1 33  ARG n 
1 34  THR n 
1 35  LEU n 
1 36  THR n 
1 37  TYR n 
1 38  ARG n 
1 39  ASN n 
1 40  SER n 
1 41  MET n 
1 42  TYR n 
1 43  HIS n 
1 44  ASN n 
1 45  LYS n 
1 46  HIS n 
1 47  VAL n 
1 48  PHE n 
1 49  LYS n 
1 50  ASP n 
1 51  LYS n 
1 52  VAL n 
1 53  VAL n 
1 54  LEU n 
1 55  ASP n 
1 56  VAL n 
1 57  GLY n 
1 58  SER n 
1 59  GLY n 
1 60  THR n 
1 61  GLY n 
1 62  ILE n 
1 63  LEU n 
1 64  SER n 
1 65  MET n 
1 66  PHE n 
1 67  ALA n 
1 68  ALA n 
1 69  LYS n 
1 70  ALA n 
1 71  GLY n 
1 72  ALA n 
1 73  LYS n 
1 74  LYS n 
1 75  VAL n 
1 76  PHE n 
1 77  GLY n 
1 78  ILE n 
1 79  GLU n 
1 80  CYS n 
1 81  SER n 
1 82  SER n 
1 83  ILE n 
1 84  SER n 
1 85  ASP n 
1 86  TYR n 
1 87  SER n 
1 88  GLU n 
1 89  LYS n 
1 90  ILE n 
1 91  ILE n 
1 92  LYS n 
1 93  ALA n 
1 94  ASN n 
1 95  HIS n 
1 96  LEU n 
1 97  ASP n 
1 98  ASN n 
1 99  ILE n 
1 100 ILE n 
1 101 THR n 
1 102 ILE n 
1 103 PHE n 
1 104 LYS n 
1 105 GLY n 
1 106 LYS n 
1 107 VAL n 
1 108 GLU n 
1 109 GLU n 
1 110 VAL n 
1 111 GLU n 
1 112 LEU n 
1 113 PRO n 
1 114 VAL n 
1 115 GLU n 
1 116 LYS n 
1 117 VAL n 
1 118 ASP n 
1 119 ILE n 
1 120 ILE n 
1 121 ILE n 
1 122 SER n 
1 123 GLU n 
1 124 TRP n 
1 125 MET n 
1 126 GLY n 
1 127 TYR n 
1 128 CYS n 
1 129 LEU n 
1 130 PHE n 
1 131 TYR n 
1 132 GLU n 
1 133 SER n 
1 134 MET n 
1 135 LEU n 
1 136 ASN n 
1 137 THR n 
1 138 VAL n 
1 139 ILE n 
1 140 PHE n 
1 141 ALA n 
1 142 ARG n 
1 143 ASP n 
1 144 LYS n 
1 145 TRP n 
1 146 LEU n 
1 147 LYS n 
1 148 PRO n 
1 149 GLY n 
1 150 GLY n 
1 151 LEU n 
1 152 MET n 
1 153 PHE n 
1 154 PRO n 
1 155 ASP n 
1 156 ARG n 
1 157 ALA n 
1 158 ALA n 
1 159 LEU n 
1 160 TYR n 
1 161 VAL n 
1 162 VAL n 
1 163 ALA n 
1 164 ILE n 
1 165 GLU n 
1 166 ASP n 
1 167 ARG n 
1 168 GLN n 
1 169 TYR n 
1 170 LYS n 
1 171 ASP n 
1 172 PHE n 
1 173 LYS n 
1 174 ILE n 
1 175 HIS n 
1 176 TRP n 
1 177 TRP n 
1 178 GLU n 
1 179 ASN n 
1 180 VAL n 
1 181 TYR n 
1 182 GLY n 
1 183 PHE n 
1 184 ASP n 
1 185 MET n 
1 186 THR n 
1 187 CYS n 
1 188 ILE n 
1 189 ARG n 
1 190 ASP n 
1 191 VAL n 
1 192 ALA n 
1 193 MET n 
1 194 LYS n 
1 195 GLU n 
1 196 PRO n 
1 197 LEU n 
1 198 VAL n 
1 199 ASP n 
1 200 ILE n 
1 201 VAL n 
1 202 ASP n 
1 203 PRO n 
1 204 LYS n 
1 205 GLN n 
1 206 VAL n 
1 207 VAL n 
1 208 THR n 
1 209 ASN n 
1 210 ALA n 
1 211 CYS n 
1 212 LEU n 
1 213 ILE n 
1 214 LYS n 
1 215 GLU n 
1 216 VAL n 
1 217 ASP n 
1 218 ILE n 
1 219 TYR n 
1 220 THR n 
1 221 VAL n 
1 222 LYS n 
1 223 THR n 
1 224 GLU n 
1 225 GLU n 
1 226 LEU n 
1 227 SER n 
1 228 PHE n 
1 229 THR n 
1 230 SER n 
1 231 ALA n 
1 232 PHE n 
1 233 CYS n 
1 234 LEU n 
1 235 GLN n 
1 236 ILE n 
1 237 GLN n 
1 238 ARG n 
1 239 ASN n 
1 240 ASP n 
1 241 TYR n 
1 242 VAL n 
1 243 HIS n 
1 244 ALA n 
1 245 LEU n 
1 246 VAL n 
1 247 THR n 
1 248 TYR n 
1 249 PHE n 
1 250 ASN n 
1 251 ILE n 
1 252 GLU n 
1 253 PHE n 
1 254 THR n 
1 255 LYS n 
1 256 CYS n 
1 257 HIS n 
1 258 LYS n 
1 259 LYS n 
1 260 MET n 
1 261 GLY n 
1 262 PHE n 
1 263 SER n 
1 264 THR n 
1 265 ALA n 
1 266 PRO n 
1 267 ASP n 
1 268 ALA n 
1 269 PRO n 
1 270 TYR n 
1 271 THR n 
1 272 HIS n 
1 273 TRP n 
1 274 LYS n 
1 275 GLN n 
1 276 THR n 
1 277 VAL n 
1 278 PHE n 
1 279 TYR n 
1 280 LEU n 
1 281 GLU n 
1 282 ASP n 
1 283 TYR n 
1 284 LEU n 
1 285 THR n 
1 286 VAL n 
1 287 ARG n 
1 288 ARG n 
1 289 GLY n 
1 290 GLU n 
1 291 GLU n 
1 292 ILE n 
1 293 TYR n 
1 294 GLY n 
1 295 THR n 
1 296 ILE n 
1 297 SER n 
1 298 MET n 
1 299 LYS n 
1 300 PRO n 
1 301 ASN n 
1 302 ALA n 
1 303 LYS n 
1 304 ASN n 
1 305 VAL n 
1 306 ARG n 
1 307 ASP n 
1 308 LEU n 
1 309 ASP n 
1 310 PHE n 
1 311 THR n 
1 312 VAL n 
1 313 ASP n 
1 314 LEU n 
1 315 ASP n 
1 316 PHE n 
1 317 LYS n 
1 318 GLY n 
1 319 GLN n 
1 320 LEU n 
1 321 CYS n 
1 322 GLU n 
1 323 THR n 
1 324 SER n 
1 325 VAL n 
1 326 SER n 
1 327 ASN n 
1 328 ASP n 
1 329 TYR n 
1 330 LYS n 
1 331 MET n 
1 332 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   332 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PRMT8, HRMT1L3, HRMT1L4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANM8_HUMAN 
_struct_ref.pdbx_db_accession          Q9NR22 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISD
YSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIE
DRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHAL
VTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSV
SNDYKMR
;
_struct_ref.pdbx_align_begin           68 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5DST A 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
2  1 5DST B 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
3  1 5DST C 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
4  1 5DST D 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
5  1 5DST E 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
6  1 5DST F 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
7  1 5DST G 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
8  1 5DST H 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
9  1 5DST I 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
10 1 5DST J 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
11 1 5DST K 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
12 1 5DST L 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
13 1 5DST M 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
14 1 5DST N 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
15 1 5DST O 6 ? 332 ? Q9NR22 68 ? 394 ? 68 394 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5DST GLY A 1 ? UNP Q9NR22 ? ? 'expression tag' 63 1  
1  5DST PRO A 2 ? UNP Q9NR22 ? ? 'expression tag' 64 2  
1  5DST LEU A 3 ? UNP Q9NR22 ? ? 'expression tag' 65 3  
1  5DST GLY A 4 ? UNP Q9NR22 ? ? 'expression tag' 66 4  
1  5DST SER A 5 ? UNP Q9NR22 ? ? 'expression tag' 67 5  
2  5DST GLY B 1 ? UNP Q9NR22 ? ? 'expression tag' 63 6  
2  5DST PRO B 2 ? UNP Q9NR22 ? ? 'expression tag' 64 7  
2  5DST LEU B 3 ? UNP Q9NR22 ? ? 'expression tag' 65 8  
2  5DST GLY B 4 ? UNP Q9NR22 ? ? 'expression tag' 66 9  
2  5DST SER B 5 ? UNP Q9NR22 ? ? 'expression tag' 67 10 
3  5DST GLY C 1 ? UNP Q9NR22 ? ? 'expression tag' 63 11 
3  5DST PRO C 2 ? UNP Q9NR22 ? ? 'expression tag' 64 12 
3  5DST LEU C 3 ? UNP Q9NR22 ? ? 'expression tag' 65 13 
3  5DST GLY C 4 ? UNP Q9NR22 ? ? 'expression tag' 66 14 
3  5DST SER C 5 ? UNP Q9NR22 ? ? 'expression tag' 67 15 
4  5DST GLY D 1 ? UNP Q9NR22 ? ? 'expression tag' 63 16 
4  5DST PRO D 2 ? UNP Q9NR22 ? ? 'expression tag' 64 17 
4  5DST LEU D 3 ? UNP Q9NR22 ? ? 'expression tag' 65 18 
4  5DST GLY D 4 ? UNP Q9NR22 ? ? 'expression tag' 66 19 
4  5DST SER D 5 ? UNP Q9NR22 ? ? 'expression tag' 67 20 
5  5DST GLY E 1 ? UNP Q9NR22 ? ? 'expression tag' 63 21 
5  5DST PRO E 2 ? UNP Q9NR22 ? ? 'expression tag' 64 22 
5  5DST LEU E 3 ? UNP Q9NR22 ? ? 'expression tag' 65 23 
5  5DST GLY E 4 ? UNP Q9NR22 ? ? 'expression tag' 66 24 
5  5DST SER E 5 ? UNP Q9NR22 ? ? 'expression tag' 67 25 
6  5DST GLY F 1 ? UNP Q9NR22 ? ? 'expression tag' 63 26 
6  5DST PRO F 2 ? UNP Q9NR22 ? ? 'expression tag' 64 27 
6  5DST LEU F 3 ? UNP Q9NR22 ? ? 'expression tag' 65 28 
6  5DST GLY F 4 ? UNP Q9NR22 ? ? 'expression tag' 66 29 
6  5DST SER F 5 ? UNP Q9NR22 ? ? 'expression tag' 67 30 
7  5DST GLY G 1 ? UNP Q9NR22 ? ? 'expression tag' 63 31 
7  5DST PRO G 2 ? UNP Q9NR22 ? ? 'expression tag' 64 32 
7  5DST LEU G 3 ? UNP Q9NR22 ? ? 'expression tag' 65 33 
7  5DST GLY G 4 ? UNP Q9NR22 ? ? 'expression tag' 66 34 
7  5DST SER G 5 ? UNP Q9NR22 ? ? 'expression tag' 67 35 
8  5DST GLY H 1 ? UNP Q9NR22 ? ? 'expression tag' 63 36 
8  5DST PRO H 2 ? UNP Q9NR22 ? ? 'expression tag' 64 37 
8  5DST LEU H 3 ? UNP Q9NR22 ? ? 'expression tag' 65 38 
8  5DST GLY H 4 ? UNP Q9NR22 ? ? 'expression tag' 66 39 
8  5DST SER H 5 ? UNP Q9NR22 ? ? 'expression tag' 67 40 
9  5DST GLY I 1 ? UNP Q9NR22 ? ? 'expression tag' 63 41 
9  5DST PRO I 2 ? UNP Q9NR22 ? ? 'expression tag' 64 42 
9  5DST LEU I 3 ? UNP Q9NR22 ? ? 'expression tag' 65 43 
9  5DST GLY I 4 ? UNP Q9NR22 ? ? 'expression tag' 66 44 
9  5DST SER I 5 ? UNP Q9NR22 ? ? 'expression tag' 67 45 
10 5DST GLY J 1 ? UNP Q9NR22 ? ? 'expression tag' 63 46 
10 5DST PRO J 2 ? UNP Q9NR22 ? ? 'expression tag' 64 47 
10 5DST LEU J 3 ? UNP Q9NR22 ? ? 'expression tag' 65 48 
10 5DST GLY J 4 ? UNP Q9NR22 ? ? 'expression tag' 66 49 
10 5DST SER J 5 ? UNP Q9NR22 ? ? 'expression tag' 67 50 
11 5DST GLY K 1 ? UNP Q9NR22 ? ? 'expression tag' 63 51 
11 5DST PRO K 2 ? UNP Q9NR22 ? ? 'expression tag' 64 52 
11 5DST LEU K 3 ? UNP Q9NR22 ? ? 'expression tag' 65 53 
11 5DST GLY K 4 ? UNP Q9NR22 ? ? 'expression tag' 66 54 
11 5DST SER K 5 ? UNP Q9NR22 ? ? 'expression tag' 67 55 
12 5DST GLY L 1 ? UNP Q9NR22 ? ? 'expression tag' 63 56 
12 5DST PRO L 2 ? UNP Q9NR22 ? ? 'expression tag' 64 57 
12 5DST LEU L 3 ? UNP Q9NR22 ? ? 'expression tag' 65 58 
12 5DST GLY L 4 ? UNP Q9NR22 ? ? 'expression tag' 66 59 
12 5DST SER L 5 ? UNP Q9NR22 ? ? 'expression tag' 67 60 
13 5DST GLY M 1 ? UNP Q9NR22 ? ? 'expression tag' 63 61 
13 5DST PRO M 2 ? UNP Q9NR22 ? ? 'expression tag' 64 62 
13 5DST LEU M 3 ? UNP Q9NR22 ? ? 'expression tag' 65 63 
13 5DST GLY M 4 ? UNP Q9NR22 ? ? 'expression tag' 66 64 
13 5DST SER M 5 ? UNP Q9NR22 ? ? 'expression tag' 67 65 
14 5DST GLY N 1 ? UNP Q9NR22 ? ? 'expression tag' 63 66 
14 5DST PRO N 2 ? UNP Q9NR22 ? ? 'expression tag' 64 67 
14 5DST LEU N 3 ? UNP Q9NR22 ? ? 'expression tag' 65 68 
14 5DST GLY N 4 ? UNP Q9NR22 ? ? 'expression tag' 66 69 
14 5DST SER N 5 ? UNP Q9NR22 ? ? 'expression tag' 67 70 
15 5DST GLY O 1 ? UNP Q9NR22 ? ? 'expression tag' 63 71 
15 5DST PRO O 2 ? UNP Q9NR22 ? ? 'expression tag' 64 72 
15 5DST LEU O 3 ? UNP Q9NR22 ? ? 'expression tag' 65 73 
15 5DST GLY O 4 ? UNP Q9NR22 ? ? 'expression tag' 66 74 
15 5DST SER O 5 ? UNP Q9NR22 ? ? 'expression tag' 67 75 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DST 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.17 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.18 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Tris-Cl, NaCl, PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-11-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9922 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NE3A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9922 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   AR-NE3A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DST 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.963 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       145707 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            0.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.05 
_refine.aniso_B[2][2]                            -0.09 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            0.02 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               32.741 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.890 
_refine.correlation_coeff_Fo_to_Fc_free          0.853 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5DST 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.963 
_refine.ls_d_res_low                             49.65 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     140423 
_refine.ls_number_reflns_R_free                  7424 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.71 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.22542 
_refine.ls_R_factor_R_free                       0.25960 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.22360 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.416 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             20.515 
_refine.overall_SU_ML                            0.349 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        39062 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               39062 
_refine_hist.d_res_high                       2.963 
_refine_hist.d_res_low                        49.65 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.019  40007 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  37771 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.504  1.956  54089 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.899  3.000  87130 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.658  5.000  4729  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.642 24.240 1849  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.994 15.000 7144  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 19.083 15.000 165   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.083  0.200  5959  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.020  44099 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  9214  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.547  3.154  19006 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.547  3.154  19005 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.567  4.729  23705 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.567  4.729  23706 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.777  3.337  21000 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.777  3.337  21000 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.988  4.909  30385 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.273  24.712 44099 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 4.273  24.712 44100 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
2   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
3   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
4   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
5   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
6   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
7   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
8   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
9   'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
10  'X-RAY DIFFRACTION' 1   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
11  'X-RAY DIFFRACTION' 1   1 'TIGHT THERMAL'    A 2995 2.980 1.870 ? ? ? 
12  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
13  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
14  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
15  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
16  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
17  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
18  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
19  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
20  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
21  'X-RAY DIFFRACTION' 2   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
22  'X-RAY DIFFRACTION' 2   1 'TIGHT THERMAL'    A 2977 4.660 1.870 ? ? ? 
23  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 3002 0.070 0.190 ? ? ? 
24  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
25  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 3002 0.060 0.190 ? ? ? 
26  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 3002 0.070 0.190 ? ? ? 
27  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
28  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
29  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
30  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
31  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
32  'X-RAY DIFFRACTION' 3   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
33  'X-RAY DIFFRACTION' 3   1 'TIGHT THERMAL'    A 2995 3.050 1.870 ? ? ? 
34  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
35  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
36  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
37  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2977 0.050 0.190 ? ? ? 
38  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
39  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
40  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
41  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
42  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
43  'X-RAY DIFFRACTION' 4   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
44  'X-RAY DIFFRACTION' 4   1 'TIGHT THERMAL'    A 2995 2.780 1.870 ? ? ? 
45  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
46  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
47  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
48  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
49  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
50  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
51  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
52  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
53  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
54  'X-RAY DIFFRACTION' 5   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
55  'X-RAY DIFFRACTION' 5   1 'TIGHT THERMAL'    A 2977 2.890 1.870 ? ? ? 
56  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
57  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
58  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 3002 0.070 0.190 ? ? ? 
59  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 3002 0.070 0.190 ? ? ? 
60  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
61  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
62  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
63  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
64  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
65  'X-RAY DIFFRACTION' 6   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
66  'X-RAY DIFFRACTION' 6   1 'TIGHT THERMAL'    A 2995 5.030 1.870 ? ? ? 
67  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
68  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
69  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
70  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
71  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
72  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
73  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
74  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
75  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 3002 0.070 0.190 ? ? ? 
76  'X-RAY DIFFRACTION' 7   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
77  'X-RAY DIFFRACTION' 7   1 'TIGHT THERMAL'    A 2977 3.070 1.870 ? ? ? 
78  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.050 0.190 ? ? ? 
79  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
80  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
81  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.050 0.190 ? ? ? 
82  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
83  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
84  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.070 0.190 ? ? ? 
85  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
86  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
87  'X-RAY DIFFRACTION' 8   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
88  'X-RAY DIFFRACTION' 8   1 'TIGHT THERMAL'    A 2977 4.710 1.870 ? ? ? 
89  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2977 0.060 0.190 ? ? ? 
90  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
91  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
92  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
93  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
94  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
95  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
96  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.070 0.190 ? ? ? 
97  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
98  'X-RAY DIFFRACTION' 9   1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
99  'X-RAY DIFFRACTION' 9   1 'TIGHT THERMAL'    A 2995 3.300 1.870 ? ? ? 
100 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
101 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
102 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
103 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
104 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' A 2995 0.060 0.190 ? ? ? 
105 'X-RAY DIFFRACTION' 10  1 'TIGHT POSITIONAL' A 2995 0.050 0.190 ? ? ? 
106 'X-RAY DIFFRACTION' 10  1 'TIGHT THERMAL'    A 2995 3.210 1.870 ? ? ? 
107 'X-RAY DIFFRACTION' 11  1 'TIGHT THERMAL'    A 2995 2.900 1.870 ? ? ? 
108 'X-RAY DIFFRACTION' 12  1 'TIGHT THERMAL'    A 2995 4.690 1.870 ? ? ? 
109 'X-RAY DIFFRACTION' 13  1 'TIGHT THERMAL'    A 2995 3.120 1.870 ? ? ? 
110 'X-RAY DIFFRACTION' 14  1 'TIGHT THERMAL'    A 2995 3.440 1.870 ? ? ? 
111 'X-RAY DIFFRACTION' 15  1 'TIGHT THERMAL'    B 2977 4.640 1.870 ? ? ? 
112 'X-RAY DIFFRACTION' 16  1 'TIGHT THERMAL'    B 2995 3.180 1.870 ? ? ? 
113 'X-RAY DIFFRACTION' 17  1 'TIGHT THERMAL'    B 2995 2.560 1.870 ? ? ? 
114 'X-RAY DIFFRACTION' 18  1 'TIGHT THERMAL'    B 2977 2.680 1.870 ? ? ? 
115 'X-RAY DIFFRACTION' 19  1 'TIGHT THERMAL'    B 2995 5.120 1.870 ? ? ? 
116 'X-RAY DIFFRACTION' 20  1 'TIGHT THERMAL'    B 2977 3.070 1.870 ? ? ? 
117 'X-RAY DIFFRACTION' 21  1 'TIGHT THERMAL'    B 2977 4.840 1.870 ? ? ? 
118 'X-RAY DIFFRACTION' 22  1 'TIGHT THERMAL'    B 2995 3.160 1.870 ? ? ? 
119 'X-RAY DIFFRACTION' 23  1 'TIGHT THERMAL'    B 2995 3.230 1.870 ? ? ? 
120 'X-RAY DIFFRACTION' 24  1 'TIGHT THERMAL'    B 2995 2.940 1.870 ? ? ? 
121 'X-RAY DIFFRACTION' 25  1 'TIGHT THERMAL'    B 2995 4.730 1.870 ? ? ? 
122 'X-RAY DIFFRACTION' 26  1 'TIGHT THERMAL'    B 2995 3.200 1.870 ? ? ? 
123 'X-RAY DIFFRACTION' 27  1 'TIGHT THERMAL'    B 2995 3.150 1.870 ? ? ? 
124 'X-RAY DIFFRACTION' 28  1 'TIGHT THERMAL'    C 2977 3.640 1.870 ? ? ? 
125 'X-RAY DIFFRACTION' 29  1 'TIGHT THERMAL'    C 2977 4.360 1.870 ? ? ? 
126 'X-RAY DIFFRACTION' 30  1 'TIGHT THERMAL'    C 3002 3.850 1.870 ? ? ? 
127 'X-RAY DIFFRACTION' 31  1 'TIGHT THERMAL'    C 2977 2.570 1.870 ? ? ? 
128 'X-RAY DIFFRACTION' 32  1 'TIGHT THERMAL'    C 3002 3.710 1.870 ? ? ? 
129 'X-RAY DIFFRACTION' 33  1 'TIGHT THERMAL'    C 3002 2.020 1.870 ? ? ? 
130 'X-RAY DIFFRACTION' 34  1 'TIGHT THERMAL'    C 2977 3.300 1.870 ? ? ? 
131 'X-RAY DIFFRACTION' 35  1 'TIGHT THERMAL'    C 2977 3.390 1.870 ? ? ? 
132 'X-RAY DIFFRACTION' 36  1 'TIGHT THERMAL'    C 2977 3.760 1.870 ? ? ? 
133 'X-RAY DIFFRACTION' 37  1 'TIGHT THERMAL'    C 2977 2.270 1.870 ? ? ? 
134 'X-RAY DIFFRACTION' 38  1 'TIGHT THERMAL'    C 2977 3.520 1.870 ? ? ? 
135 'X-RAY DIFFRACTION' 39  1 'TIGHT THERMAL'    C 2977 4.960 1.870 ? ? ? 
136 'X-RAY DIFFRACTION' 40  1 'TIGHT THERMAL'    D 2995 2.940 1.870 ? ? ? 
137 'X-RAY DIFFRACTION' 41  1 'TIGHT THERMAL'    D 2977 2.830 1.870 ? ? ? 
138 'X-RAY DIFFRACTION' 42  1 'TIGHT THERMAL'    D 2995 4.130 1.870 ? ? ? 
139 'X-RAY DIFFRACTION' 43  1 'TIGHT THERMAL'    D 2977 2.370 1.870 ? ? ? 
140 'X-RAY DIFFRACTION' 44  1 'TIGHT THERMAL'    D 2977 3.760 1.870 ? ? ? 
141 'X-RAY DIFFRACTION' 45  1 'TIGHT THERMAL'    D 2995 2.570 1.870 ? ? ? 
142 'X-RAY DIFFRACTION' 46  1 'TIGHT THERMAL'    D 2995 2.830 1.870 ? ? ? 
143 'X-RAY DIFFRACTION' 47  1 'TIGHT THERMAL'    D 2995 2.490 1.870 ? ? ? 
144 'X-RAY DIFFRACTION' 48  1 'TIGHT THERMAL'    D 2995 3.800 1.870 ? ? ? 
145 'X-RAY DIFFRACTION' 49  1 'TIGHT THERMAL'    D 2995 2.660 1.870 ? ? ? 
146 'X-RAY DIFFRACTION' 50  1 'TIGHT THERMAL'    D 2995 3.310 1.870 ? ? ? 
147 'X-RAY DIFFRACTION' 51  1 'TIGHT THERMAL'    E 2977 2.830 1.870 ? ? ? 
148 'X-RAY DIFFRACTION' 52  1 'TIGHT THERMAL'    E 2995 4.800 1.870 ? ? ? 
149 'X-RAY DIFFRACTION' 53  1 'TIGHT THERMAL'    E 2977 2.790 1.870 ? ? ? 
150 'X-RAY DIFFRACTION' 54  1 'TIGHT THERMAL'    E 2977 4.470 1.870 ? ? ? 
151 'X-RAY DIFFRACTION' 55  1 'TIGHT THERMAL'    E 2995 3.130 1.870 ? ? ? 
152 'X-RAY DIFFRACTION' 56  1 'TIGHT THERMAL'    E 2995 2.790 1.870 ? ? ? 
153 'X-RAY DIFFRACTION' 57  1 'TIGHT THERMAL'    E 2995 2.710 1.870 ? ? ? 
154 'X-RAY DIFFRACTION' 58  1 'TIGHT THERMAL'    E 2995 4.490 1.870 ? ? ? 
155 'X-RAY DIFFRACTION' 59  1 'TIGHT THERMAL'    E 2995 2.980 1.870 ? ? ? 
156 'X-RAY DIFFRACTION' 60  1 'TIGHT THERMAL'    E 2995 3.420 1.870 ? ? ? 
157 'X-RAY DIFFRACTION' 61  1 'TIGHT THERMAL'    F 2977 4.180 1.870 ? ? ? 
158 'X-RAY DIFFRACTION' 62  1 'TIGHT THERMAL'    F 3002 2.630 1.870 ? ? ? 
159 'X-RAY DIFFRACTION' 63  1 'TIGHT THERMAL'    F 3002 3.920 1.870 ? ? ? 
160 'X-RAY DIFFRACTION' 64  1 'TIGHT THERMAL'    F 2977 2.500 1.870 ? ? ? 
161 'X-RAY DIFFRACTION' 65  1 'TIGHT THERMAL'    F 2977 2.720 1.870 ? ? ? 
162 'X-RAY DIFFRACTION' 66  1 'TIGHT THERMAL'    F 2977 2.550 1.870 ? ? ? 
163 'X-RAY DIFFRACTION' 67  1 'TIGHT THERMAL'    F 2977 3.860 1.870 ? ? ? 
164 'X-RAY DIFFRACTION' 68  1 'TIGHT THERMAL'    F 2977 2.530 1.870 ? ? ? 
165 'X-RAY DIFFRACTION' 69  1 'TIGHT THERMAL'    F 2977 3.290 1.870 ? ? ? 
166 'X-RAY DIFFRACTION' 70  1 'TIGHT THERMAL'    G 2977 4.060 1.870 ? ? ? 
167 'X-RAY DIFFRACTION' 71  1 'TIGHT THERMAL'    G 2977 2.540 1.870 ? ? ? 
168 'X-RAY DIFFRACTION' 72  1 'TIGHT THERMAL'    G 2995 3.770 1.870 ? ? ? 
169 'X-RAY DIFFRACTION' 73  1 'TIGHT THERMAL'    G 2995 3.580 1.870 ? ? ? 
170 'X-RAY DIFFRACTION' 74  1 'TIGHT THERMAL'    G 2995 4.090 1.870 ? ? ? 
171 'X-RAY DIFFRACTION' 75  1 'TIGHT THERMAL'    G 2995 2.480 1.870 ? ? ? 
172 'X-RAY DIFFRACTION' 76  1 'TIGHT THERMAL'    G 2995 3.850 1.870 ? ? ? 
173 'X-RAY DIFFRACTION' 77  1 'TIGHT THERMAL'    G 2995 5.560 1.870 ? ? ? 
174 'X-RAY DIFFRACTION' 78  1 'TIGHT THERMAL'    H 3002 3.790 1.870 ? ? ? 
175 'X-RAY DIFFRACTION' 79  1 'TIGHT THERMAL'    H 2977 2.560 1.870 ? ? ? 
176 'X-RAY DIFFRACTION' 80  1 'TIGHT THERMAL'    H 2977 2.540 1.870 ? ? ? 
177 'X-RAY DIFFRACTION' 81  1 'TIGHT THERMAL'    H 2977 2.440 1.870 ? ? ? 
178 'X-RAY DIFFRACTION' 82  1 'TIGHT THERMAL'    H 2977 3.810 1.870 ? ? ? 
179 'X-RAY DIFFRACTION' 83  1 'TIGHT THERMAL'    H 2977 2.460 1.870 ? ? ? 
180 'X-RAY DIFFRACTION' 84  1 'TIGHT THERMAL'    H 2977 3.460 1.870 ? ? ? 
181 'X-RAY DIFFRACTION' 85  1 'TIGHT THERMAL'    I 2977 3.350 1.870 ? ? ? 
182 'X-RAY DIFFRACTION' 86  1 'TIGHT THERMAL'    I 2977 3.490 1.870 ? ? ? 
183 'X-RAY DIFFRACTION' 87  1 'TIGHT THERMAL'    I 2977 3.880 1.870 ? ? ? 
184 'X-RAY DIFFRACTION' 88  1 'TIGHT THERMAL'    I 2977 2.170 1.870 ? ? ? 
185 'X-RAY DIFFRACTION' 89  1 'TIGHT THERMAL'    I 2977 3.550 1.870 ? ? ? 
186 'X-RAY DIFFRACTION' 90  1 'TIGHT THERMAL'    I 2977 5.020 1.870 ? ? ? 
187 'X-RAY DIFFRACTION' 91  1 'TIGHT THERMAL'    J 2995 2.810 1.870 ? ? ? 
188 'X-RAY DIFFRACTION' 92  1 'TIGHT THERMAL'    J 2995 2.490 1.870 ? ? ? 
189 'X-RAY DIFFRACTION' 93  1 'TIGHT THERMAL'    J 2995 3.260 1.870 ? ? ? 
190 'X-RAY DIFFRACTION' 94  1 'TIGHT THERMAL'    J 2995 2.130 1.870 ? ? ? 
191 'X-RAY DIFFRACTION' 95  1 'TIGHT THERMAL'    J 2995 3.410 1.870 ? ? ? 
192 'X-RAY DIFFRACTION' 96  1 'TIGHT THERMAL'    K 2995 2.600 1.870 ? ? ? 
193 'X-RAY DIFFRACTION' 97  1 'TIGHT THERMAL'    K 2995 3.480 1.870 ? ? ? 
194 'X-RAY DIFFRACTION' 98  1 'TIGHT THERMAL'    K 2995 2.640 1.870 ? ? ? 
195 'X-RAY DIFFRACTION' 99  1 'TIGHT THERMAL'    K 2995 3.700 1.870 ? ? ? 
196 'X-RAY DIFFRACTION' 100 1 'TIGHT THERMAL'    L 2995 3.780 1.870 ? ? ? 
197 'X-RAY DIFFRACTION' 101 1 'TIGHT THERMAL'    L 2995 2.670 1.870 ? ? ? 
198 'X-RAY DIFFRACTION' 102 1 'TIGHT THERMAL'    L 2995 3.130 1.870 ? ? ? 
199 'X-RAY DIFFRACTION' 103 1 'TIGHT THERMAL'    M 2995 3.610 1.870 ? ? ? 
200 'X-RAY DIFFRACTION' 104 1 'TIGHT THERMAL'    M 2995 4.930 1.870 ? ? ? 
201 'X-RAY DIFFRACTION' 105 1 'TIGHT THERMAL'    N 2995 3.540 1.870 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.963 
_refine_ls_shell.d_res_low                        3.040 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             472 
_refine_ls_shell.number_reflns_R_work             8627 
_refine_ls_shell.percent_reflns_obs               81.83 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.379 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.364 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_oper.code 
_struct_ncs_oper.id 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
_struct_ncs_oper.details 
given 1   1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 2   -0.020490 -0.918746 -0.394317 -0.918246 -0.138717 0.370921  -0.395481 0.369680  -0.840792 -4.243520  -14.826160 
23.846661   ? 
given 3   1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 4   0.069868  0.922590  0.379402  -0.924691 -0.082791 0.371607  0.374252  -0.376794 0.847326  5.871810   -14.422530 
-24.600229  ? 
given 5   1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 6   0.696213  0.200814  -0.689174 0.202694  -0.975999 -0.079625 -0.688623 -0.084255 -0.720208 18.745150  -27.412580 
36.530991   ? 
given 7   1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 8   -0.696815 -0.187239 0.692380  0.193779  -0.978572 -0.069613 0.690578  0.085661  0.718167  -18.010321 -27.160681 
-36.492439  ? 
given 9   1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 10  -0.432054 0.869536  -0.239242 0.871760  0.334727  -0.357760 -0.231004 -0.363133 -0.902647 35.512341  -8.247360  
51.331509   ? 
given 11  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 12  0.404557  -0.878792 0.253098  0.878605  0.296701  -0.374194 0.253745  0.373756  0.892144  -34.642281 -8.333290  
-52.117691  ? 
given 13  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 14  -0.919219 -0.393175 -0.021213 -0.391575 0.907171  0.153977  -0.041296 0.149845  -0.987847 25.197010  -1.753340  
77.810257   ? 
given 15  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 16  0.923135  0.383442  0.028174  -0.383431 0.912753  0.140932  0.028323  -0.140902 0.989618  -24.835190 -0.348430  
-78.038841  ? 
given 17  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 18  0.299529  -0.795908 -0.526130 -0.786419 -0.518192 0.336187  -0.540210 0.313061  -0.781131 28.381639  -21.834860 
98.161301   ? 
given 19  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 20  -0.289891 0.800897  0.523954  -0.795947 -0.505750 0.332694  0.531444  -0.320594 0.784083  -27.399500 -21.387159 
-98.876244  ? 
given 21  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 22  0.530001  0.550520  -0.645001 0.561614  -0.797772 -0.219431 -0.635364 -0.245943 -0.732000 55.957500  -25.118311 
108.295578  ? 
given 23  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 24  -0.538981 -0.545015 0.642229  0.534589  -0.810551 -0.239211 0.650933  0.214398  0.728230  -53.945938 -21.436100 
-110.570824 ? 
given 25  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 26  -0.724232 0.681696  -0.103819 0.679200  0.679229  -0.278093 -0.119058 -0.271918 -0.954927 62.061890  -5.521170  
128.585587  ? 
given 27  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 28  0.716426  -0.688024 0.115574  0.686236  0.665093  -0.294504 0.125758  0.290301  0.948636  -61.992470 -4.120180  
-128.822357 ? 
given 29  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 30  0.699666  0.206152  -0.684082 0.202416  -0.975434 -0.086925 -0.685197 -0.077651 -0.724207 18.582590  -27.259230 
36.896832   ? 
given 31  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 32  0.071947  0.925414  0.372066  -0.922332 -0.080258 0.377972  0.379641  -0.370363 0.847764  6.069880   -14.685540 
-24.398359  ? 
given 33  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 34  -0.436768 0.868529  -0.234287 0.868609  0.339436  -0.360972 -0.233989 -0.361165 -0.902668 35.471149  -7.947010  
51.585960   ? 
given 35  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 36  -0.700302 -0.181548 0.690375  0.190640  -0.979558 -0.064214 0.687920  0.086644  0.720596  -17.722540 -27.281481 
-36.343990  ? 
given 37  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 38  -0.915418 -0.402247 -0.014411 -0.399755 0.904400  0.149186  -0.046977 0.142328  -0.988704 24.703300  -1.054740  
78.265213   ? 
given 39  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 40  0.394707  -0.884225 0.249704  0.883598  0.290783  -0.367015 0.251914  0.365501  0.896074  -33.946259 -8.917170  
-52.132130  ? 
given 41  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 42  0.321997  -0.790262 -0.521348 -0.784485 -0.530991 0.320363  -0.530002 0.305834  -0.790926 27.420570  -20.751789 
99.156380   ? 
given 43  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 44  0.929631  0.368327  0.010999  -0.365807 0.918852  0.147976  0.044397  -0.141587 0.988930  -23.622681 -1.529320  
-77.947517  ? 
given 45  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 46  0.526640  0.574780  -0.626322 0.573211  -0.784183 -0.237668 -0.627758 -0.233849 -0.742452 55.033588  -23.183849 
109.881561  ? 
given 47  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 48  -0.275286 0.818536  0.504200  -0.799724 -0.486044 0.352424  0.533535  -0.306203 0.788404  -25.180691 -22.662580 
-98.559883  ? 
given 49  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 50  -0.737270 0.670663  -0.081507 0.661669  0.692425  -0.287648 -0.136478 -0.266005 -0.954262 60.247490  -3.111050  
130.163849  ? 
given 51  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 52  -0.561747 -0.530130 0.635140  0.527156  -0.821048 -0.219060 0.637610  0.211761  0.740682  -51.325119 -23.488501 
-110.757652 ? 
given 53  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 54  -0.694547 -0.711429 -0.107108 -0.706915 0.647179  0.285360  -0.133696 0.273912  -0.952417 51.730110  -4.867090  
155.105469  ? 
given 55  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 56  -0.396496 0.885000  -0.244063 0.885017  0.297820  -0.357839 -0.244001 -0.357882 -0.901324 35.789909  -10.083140 
51.855869   ? 
given 57  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 58  0.030561  0.923858  0.381514  -0.919133 -0.124008 0.373920  0.392759  -0.362090 0.845359  5.660240   -16.497410 
-23.870340  ? 
given 59  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 60  -0.922755 -0.384657 -0.023710 -0.383726 0.911333  0.149082  -0.035738 0.146665  -0.988541 24.778990  -1.781320  
77.881706   ? 
given 61  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 62  -0.689217 -0.195889 0.697573  0.204889  -0.976157 -0.071685 0.694983  0.093518  0.712919  -18.759130 -27.513041 
-36.424381  ? 
given 63  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 64  0.282409  -0.810218 -0.513608 -0.800103 -0.494312 0.339839  -0.529226 0.314965  -0.787856 27.965700  -21.800779 
98.811127   ? 
given 65  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 66  0.429652  -0.869953 0.242034  0.872741  0.331263  -0.358593 0.231782  0.365303  0.901571  -35.160099 -9.357300  
-51.698990  ? 
given 67  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 68  0.545956  0.540713  -0.639970 0.545004  -0.809357 -0.218888 -0.636320 -0.229283 -0.736564 54.370571  -24.877741 
109.805397  ? 
given 69  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 70  0.914636  0.403657  0.022396  -0.401816 0.901566  0.160381  0.044547  -0.155690 0.986801  -23.680321 -2.129430  
-78.146469  ? 
given 71  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 72  -0.720061 0.684129  -0.116104 0.681900  0.666626  -0.301036 -0.128550 -0.295936 -0.946518 63.125179  -2.988300  
127.637077  ? 
given 73  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 74  -0.288394 0.791666  0.538603  -0.786795 -0.516505 0.337898  0.545694  -0.326323 0.771836  -29.866810 -22.210529 
-98.145958  ? 
given 75  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 76  -0.723222 -0.682204 -0.107463 -0.679521 0.675156  0.287082  -0.123294 0.280647  -0.951859 53.022789  -6.621880  
154.427155  ? 
given 77  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 78  -0.537437 -0.554450 0.635411  0.556761  -0.799207 -0.226463 0.633387  0.232062  0.738220  -53.271172 -24.189501 
-110.230019 ? 
given 79  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 80  -0.921403 -0.387697 -0.026611 -0.387243 0.910268  0.146473  -0.032564 0.145265  -0.988857 24.746990  -1.474240  
77.902946   ? 
given 81  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 82  0.034961  0.923300  0.382486  -0.918141 -0.121482 0.377173  0.394708  -0.364362 0.843472  5.368410   -16.584311 
-23.740770  ? 
given 83  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 84  0.285011  -0.809064 -0.513988 -0.797658 -0.497544 0.340870  -0.531518 0.312835  -0.787162 27.743790  -21.873140 
99.119453   ? 
given 85  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 86  -0.690921 -0.193049 0.696678  0.201061  -0.976979 -0.071320 0.694408  0.090798  0.713830  -18.730570 -27.224730 
-36.219700  ? 
given 87  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 88  0.545490  0.548999  -0.633278 0.557225  -0.801974 -0.215264 -0.626052 -0.235454 -0.743385 54.039051  -25.513611 
110.394623  ? 
given 89  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 90  0.421135  -0.874738 0.239749  0.873209  0.319548  -0.367961 0.245258  0.364312  0.898402  -34.600330 -8.701090  
-51.471901  ? 
given 91  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 92  -0.729124 0.675852  -0.107718 0.673853  0.681455  -0.285555 -0.119588 -0.280791 -0.952289 62.339291  -3.738570  
128.843323  ? 
given 93  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 94  0.920357  0.390938  0.010535  -0.388171 0.909899  0.146312  0.047613  -0.138749 0.989182  -23.045731 -0.812700  
-77.513817  ? 
given 95  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 96  -0.715135 -0.691380 -0.102838 -0.684839 0.663586  0.301080  -0.139919 0.285741  -0.948037 51.900940  -8.036150  
155.564560  ? 
given 97  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 98  -0.284564 0.799530  0.528938  -0.798304 -0.503122 0.331027  0.530786  -0.328054 0.781439  -28.796049 -20.423349 
-97.894272  ? 
given 99  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 100 0.551283  -0.544110 -0.632481 -0.536492 -0.811755 0.230718  -0.638955 0.212130  -0.739417 62.376499  -25.014950 
172.876541  ? 
given 101 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 102 0.310487  -0.791821 -0.525944 -0.791974 -0.521475 0.317556  -0.525714 0.317937  -0.789012 27.016060  -21.005671 
98.813507   ? 
given 103 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 104 0.063586  0.927957  0.367224  -0.913792 -0.093782 0.395208  0.401175  -0.360696 0.841996  4.447150   -16.648300 
-24.047701  ? 
given 105 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 106 0.536144  0.553254  -0.637542 0.551759  -0.801277 -0.231338 -0.638836 -0.227739 -0.734863 53.747749  -23.160580 
110.236343  ? 
given 107 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 108 -0.698019 -0.187616 0.691065  0.204795  -0.977061 -0.058404 0.686170  0.100760  0.720430  -18.738220 -28.519470 
-36.430630  ? 
given 109 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 110 -0.734165 0.670379  -0.107670 0.667209  0.682930  -0.297385 -0.125830 -0.290168 -0.948667 61.694229  -2.363410  
128.453979  ? 
given 111 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 112 0.414765  -0.877477 0.240841  0.878694  0.317491  -0.356504 0.236359  0.359491  0.902718  -35.419590 -9.235710  
-51.704800  ? 
given 113 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 114 -0.699253 -0.708045 -0.098578 -0.703243 0.656531  0.272794  -0.128431 0.260076  -0.957009 48.841221  -3.445510  
155.053650  ? 
given 115 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 116 0.928683  0.370765  0.009033  -0.366455 0.913596  0.176216  0.057082  -0.166959 0.984310  -25.007351 -5.219030  
-78.480118  ? 
given 117 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 118 0.554052  -0.531175 -0.640998 -0.539240 -0.815608 0.209772  -0.634229 0.229427  -0.738320 62.397060  -22.027670 
172.487595  ? 
given 119 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 120 -0.279394 0.808783  0.517503  -0.794901 -0.497149 0.347815  0.538583  -0.314187 0.781803  -28.648640 -22.220800 
-98.364723  ? 
given 121 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 122 0.532534  0.552010  -0.641632 0.553728  -0.800547 -0.229152 -0.640151 -0.233259 -0.731982 54.132080  -23.464590 
110.192596  ? 
given 123 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 124 0.065341  0.926056  0.371686  -0.915411 -0.092631 0.391716  0.397181  -0.365841 0.841670  3.993350   -16.400339 
-23.749559  ? 
given 125 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 126 -0.739640 0.662585  -0.117958 0.664084  0.690102  -0.287665 -0.109200 -0.291103 -0.950439 62.847210  -2.853460  
128.387589  ? 
given 127 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 128 -0.690203 -0.180172 0.700826  0.193387  -0.979207 -0.061284 0.697295  0.093232  0.710695  -19.580620 -27.756571 
-35.704960  ? 
given 129 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 130 -0.691377 -0.712885 -0.117445 -0.711493 0.643534  0.282210  -0.125603 0.278674  -0.952137 50.421848  -4.554850  
155.336105  ? 
given 131 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 132 0.407352  -0.876526 0.256450  0.879582  0.300975  -0.368441 0.245763  0.375654  0.893580  -36.695591 -8.561620  
-50.278400  ? 
given 133 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 134 0.548556  -0.520654 -0.654222 -0.526101 -0.823080 0.213909  -0.649850 0.226845  -0.725422 64.550873  -23.408180 
172.261108  ? 
given 135 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 136 0.932516  0.360397  0.022981  -0.359148 0.918861  0.163425  0.037781  -0.160650 0.986288  -26.935829 -4.059280  
-77.063492  ? 
given 137 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 138 0.259653  0.810023  -0.525778 0.806986  -0.481049 -0.342587 -0.530429 -0.335342 -0.778583 87.337517  -17.979481 
184.467056  ? 
given 139 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 140 -0.726392 0.676012  -0.123948 0.676192  0.670687  -0.304866 -0.122963 -0.305265 -0.944295 62.956841  -2.074770  
128.597412  ? 
given 141 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 142 0.043758  0.921325  0.386322  -0.914429 -0.118808 0.386917  0.402375  -0.370195 0.837287  4.406200   -15.936570 
-23.631889  ? 
given 143 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 144 -0.706851 -0.697839 -0.115681 -0.698461 0.662698  0.270154  -0.111863 0.271757  -0.955842 51.766602  -3.223260  
155.073853  ? 
given 145 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 146 -0.681749 -0.201696 0.703233  0.217225  -0.973702 -0.068681 0.698593  0.105937  0.707634  -20.403851 -27.714149 
-34.997570  ? 
given 147 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 148 0.546632  -0.540618 -0.639473 -0.536600 -0.812414 0.228130  -0.642848 0.218438  -0.734187 62.609211  -24.643471 
172.323029  ? 
given 149 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 150 0.416812  -0.878243 0.234431  0.875558  0.318595  -0.363175 0.244267  0.356633  0.901746  -34.153629 -8.771540  
-52.131229  ? 
given 151 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 152 0.273545  0.803561  -0.528642 0.793470  -0.499172 -0.348185 -0.543671 -0.324217 -0.774148 87.445518  -16.609560 
184.636612  ? 
given 153 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 154 0.924675  0.379673  0.028716  -0.378981 0.910465  0.165610  0.036733  -0.164018 0.985773  -26.826481 -3.383160  
-76.930450  ? 
given 155 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 156 -0.699609 -0.704055 -0.121873 -0.706515 0.656161  0.265120  -0.106691 0.271586  -0.956482 51.870628  -2.410830  
155.230896  ? 
given 157 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 158 0.054912  0.921603  0.384230  -0.912138 -0.110241 0.394780  0.406188  -0.372149 0.834576  4.097570   -16.418320 
-23.264709  ? 
given 159 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 160 0.556209  -0.524933 -0.644264 -0.528430 -0.821738 0.213329  -0.641400 0.221793  -0.734448 63.329929  -23.610380 
172.630905  ? 
given 161 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 162 -0.680891 -0.183528 0.709017  0.205876  -0.977021 -0.055191 0.702853  0.108391  0.703029  -20.380720 -28.716209 
-34.369720  ? 
given 163 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 164 0.259243  0.809529  -0.526741 0.794431  -0.488891 -0.360368 -0.549248 -0.325037 -0.769856 88.234459  -14.969390 
184.739395  ? 
given 165 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 166 0.404685  -0.881374 0.243741  0.883050  0.307395  -0.354584 0.237597  0.358730  0.902696  -34.505482 -10.298350 
-51.523159  ? 
given 167 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 168 -0.932455 0.360031  -0.030075 0.359704  0.917371  -0.170423 -0.033768 -0.169730 -0.984912 89.603683  1.166450   
205.606995  ? 
given 169 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 170 0.562753  -0.527182 -0.636701 -0.526840 -0.822275 0.215184  -0.636984 0.214344  -0.740478 62.353069  -24.033819 
172.843582  ? 
given 171 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 172 0.052617  0.924190  0.378290  -0.912537 -0.109361 0.394101  0.405595  -0.365940 0.837604  5.113110   -17.250971 
-23.658119  ? 
given 173 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 174 0.255958  0.807151  -0.531971 0.805369  -0.482418 -0.344462 -0.534665 -0.340265 -0.773533 89.350807  -17.884991 
183.190750  ? 
given 175 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 176 -0.684114 -0.186263 0.705190  0.189568  -0.979023 -0.074689 0.704309  0.082586  0.705073  -19.705891 -25.826969 
-35.986389  ? 
given 177 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 178 -0.932359 0.361170  -0.016219 0.359022  0.919669  -0.159097 -0.042545 -0.154158 -0.987130 88.048012  -0.514340  
206.202118  ? 
given 179 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 180 0.401789  -0.881947 0.246446  0.883353  0.302350  -0.358151 0.241357  0.361600  0.900551  -34.288891 -10.535520 
-51.836029  ? 
given 181 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 182 0.252025  0.810813  -0.528267 0.809554  -0.475729 -0.343954 -0.530195 -0.340975 -0.776292 89.381561  -17.519890 
183.410828  ? 
given 183 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 184 0.060318  0.925141  0.374800  -0.911764 -0.101758 0.397909  0.406262  -0.365730 0.837373  5.367550   -17.073839 
-23.528540  ? 
given 185 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 186 -0.933492 0.358365  -0.012914 0.355742  0.920922  -0.159216 -0.045164 -0.153221 -0.987159 87.786491  -0.027460  
206.495926  ? 
given 187 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 188 -0.686748 -0.183079 0.703463  0.187194  -0.979665 -0.072215 0.702379  0.082090  0.707054  -19.176750 -25.735250 
-36.001091  ? 
given 189 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 190 -0.393013 -0.885949 -0.246241 -0.886442 0.293839  0.357602  -0.244462 0.358821  -0.900825 81.617996  -8.309530  
230.808014  ? 
given 191 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 192 -0.938318 0.344688  -0.027382 0.344134  0.923231  -0.170927 -0.033636 -0.169807 -0.984903 88.905602  2.229300   
204.873856  ? 
given 193 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 194 0.076675  0.917090  0.391238  -0.910724 -0.095299 0.401870  0.405835  -0.387123 0.827909  1.519440   -17.486441 
-23.094749  ? 
given 195 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 196 -0.393931 -0.882756 -0.256048 -0.885372 0.289622  0.363643  -0.246851 0.369948  -0.895658 82.320740  -9.298030  
230.501236  ? 
given 197 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 198 -0.687059 -0.175647 0.705051  0.186402  -0.980476 -0.062617 0.702285  0.088402  0.706386  -19.630060 -26.837839 
-35.860802  ? 
given 199 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 200 -0.399007 -0.880296 -0.256656 -0.883294 0.293863  0.365289  -0.246141 0.372456  -0.894813 82.879120  -9.612550  
230.289795  ? 
given 201 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 202 0.073249  0.915531  0.395522  -0.911269 -0.099707 0.399558  0.405244  -0.389695 0.826992  1.349800   -17.263741 
-23.089849  ? 
given 203 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 204 0.685205  -0.175576 -0.706872 -0.183982 -0.980761 0.065262  -0.704731 0.085334  -0.704324 99.935463  -23.368050 
245.040543  ? 
given 205 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 206 0.675945  -0.181314 -0.714300 -0.181335 -0.980382 0.077257  -0.714294 0.077306  -0.695563 101.656067 -24.851170 
244.857651  ? 
given 207 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 208 0.062572  0.915352  0.397763  -0.919729 -0.101868 0.379106  0.387535  -0.389555 0.835502  1.713940   -13.563030 
-22.601629  ? 
given 209 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.000000   0.000000   0.000000 
? 
given 210 -0.067740 0.915457  -0.396673 0.920300  -0.096210 -0.379199 -0.385304 -0.390745 -0.835978 121.442307 -13.622130 
258.295410  ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1   1 A 
1   2 B 
2   1 A 
2   2 C 
3   1 A 
3   2 D 
4   1 A 
4   2 E 
5   1 A 
5   2 F 
6   1 A 
6   2 G 
7   1 A 
7   2 H 
8   1 A 
8   2 I 
9   1 A 
9   2 J 
10  1 A 
10  2 K 
11  1 A 
11  2 L 
12  1 A 
12  2 M 
13  1 A 
13  2 N 
14  1 A 
14  2 O 
15  1 B 
15  2 C 
16  1 B 
16  2 D 
17  1 B 
17  2 E 
18  1 B 
18  2 F 
19  1 B 
19  2 G 
20  1 B 
20  2 H 
21  1 B 
21  2 I 
22  1 B 
22  2 J 
23  1 B 
23  2 K 
24  1 B 
24  2 L 
25  1 B 
25  2 M 
26  1 B 
26  2 N 
27  1 B 
27  2 O 
28  1 C 
28  2 D 
29  1 C 
29  2 E 
30  1 C 
30  2 F 
31  1 C 
31  2 G 
32  1 C 
32  2 H 
33  1 C 
33  2 I 
34  1 C 
34  2 J 
35  1 C 
35  2 K 
36  1 C 
36  2 L 
37  1 C 
37  2 M 
38  1 C 
38  2 N 
39  1 C 
39  2 O 
40  1 D 
40  2 E 
41  1 D 
41  2 F 
42  1 D 
42  2 G 
43  1 D 
43  2 H 
44  1 D 
44  2 I 
45  1 D 
45  2 J 
46  1 D 
46  2 K 
47  1 D 
47  2 L 
48  1 D 
48  2 M 
49  1 D 
49  2 N 
50  1 D 
50  2 O 
51  1 E 
51  2 F 
52  1 E 
52  2 G 
53  1 E 
53  2 H 
54  1 E 
54  2 I 
55  1 E 
55  2 J 
56  1 E 
56  2 K 
57  1 E 
57  2 L 
58  1 E 
58  2 M 
59  1 E 
59  2 N 
60  1 E 
60  2 O 
61  1 F 
61  2 G 
62  1 F 
62  2 H 
63  1 F 
63  2 I 
64  1 F 
64  2 J 
65  1 F 
65  2 K 
66  1 F 
66  2 L 
67  1 F 
67  2 M 
68  1 F 
68  2 N 
69  1 F 
69  2 O 
70  1 G 
70  2 H 
71  1 G 
71  2 I 
72  1 G 
72  2 J 
73  1 G 
73  2 K 
74  1 G 
74  2 L 
75  1 G 
75  2 M 
76  1 G 
76  2 N 
77  1 G 
77  2 O 
78  1 H 
78  2 I 
79  1 H 
79  2 J 
80  1 H 
80  2 K 
81  1 H 
81  2 L 
82  1 H 
82  2 M 
83  1 H 
83  2 N 
84  1 H 
84  2 O 
85  1 I 
85  2 J 
86  1 I 
86  2 K 
87  1 I 
87  2 L 
88  1 I 
88  2 M 
89  1 I 
89  2 N 
90  1 I 
90  2 O 
91  1 J 
91  2 K 
92  1 J 
92  2 L 
93  1 J 
93  2 M 
94  1 J 
94  2 N 
95  1 J 
95  2 O 
96  1 K 
96  2 L 
97  1 K 
97  2 M 
98  1 K 
98  2 N 
99  1 K 
99  2 O 
100 1 L 
100 2 M 
101 1 L 
101 2 N 
102 1 L 
102 2 O 
103 1 M 
103 2 N 
104 1 M 
104 2 O 
105 1 N 
105 2 O 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1   1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
1   2 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
2   1 1 1 A 79 A 393 ? ? ? ? ? ? ? ? ? 
2   2 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
3   1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
3   2 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
4   1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
4   2 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
5   1 1 1 A 79 A 393 ? ? ? ? ? ? ? ? ? 
5   2 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
6   1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
6   2 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
7   1 1 1 A 79 A 393 ? ? ? ? ? ? ? ? ? 
7   2 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
8   1 1 1 A 79 A 393 ? ? ? ? ? ? ? ? ? 
8   2 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
9   1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
9   2 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
10  1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
10  2 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
11  1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
11  2 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
12  1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
12  2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
13  1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
13  2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
14  1 1 1 A 79 A 394 ? ? ? ? ? ? ? ? ? 
14  2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
15  1 1 1 B 79 B 393 ? ? ? ? ? ? ? ? ? 
15  2 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
16  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
16  2 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
17  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
17  2 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
18  1 1 1 B 79 B 393 ? ? ? ? ? ? ? ? ? 
18  2 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
19  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
19  2 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
20  1 1 1 B 79 B 393 ? ? ? ? ? ? ? ? ? 
20  2 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
21  1 1 1 B 79 B 393 ? ? ? ? ? ? ? ? ? 
21  2 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
22  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
22  2 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
23  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
23  2 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
24  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
24  2 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
25  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
25  2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
26  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
26  2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
27  1 1 1 B 79 B 394 ? ? ? ? ? ? ? ? ? 
27  2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
28  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
28  2 1 1 D 79 D 393 ? ? ? ? ? ? ? ? ? 
29  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
29  2 1 1 E 79 E 393 ? ? ? ? ? ? ? ? ? 
30  1 1 1 C 78 C 394 ? ? ? ? ? ? ? ? ? 
30  2 1 1 F 78 F 394 ? ? ? ? ? ? ? ? ? 
31  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
31  2 1 1 G 79 G 393 ? ? ? ? ? ? ? ? ? 
32  1 1 1 C 78 C 394 ? ? ? ? ? ? ? ? ? 
32  2 1 1 H 78 H 394 ? ? ? ? ? ? ? ? ? 
33  1 1 1 C 78 C 394 ? ? ? ? ? ? ? ? ? 
33  2 1 1 I 78 I 394 ? ? ? ? ? ? ? ? ? 
34  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
34  2 1 1 J 79 J 393 ? ? ? ? ? ? ? ? ? 
35  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
35  2 1 1 K 79 K 393 ? ? ? ? ? ? ? ? ? 
36  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
36  2 1 1 L 79 L 393 ? ? ? ? ? ? ? ? ? 
37  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
37  2 1 1 M 79 M 393 ? ? ? ? ? ? ? ? ? 
38  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
38  2 1 1 N 79 N 393 ? ? ? ? ? ? ? ? ? 
39  1 1 1 C 79 C 393 ? ? ? ? ? ? ? ? ? 
39  2 1 1 O 79 O 393 ? ? ? ? ? ? ? ? ? 
40  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
40  2 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
41  1 1 1 D 79 D 393 ? ? ? ? ? ? ? ? ? 
41  2 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
42  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
42  2 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
43  1 1 1 D 79 D 393 ? ? ? ? ? ? ? ? ? 
43  2 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
44  1 1 1 D 79 D 393 ? ? ? ? ? ? ? ? ? 
44  2 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
45  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
45  2 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
46  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
46  2 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
47  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
47  2 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
48  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
48  2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
49  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
49  2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
50  1 1 1 D 79 D 394 ? ? ? ? ? ? ? ? ? 
50  2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
51  1 1 1 E 79 E 393 ? ? ? ? ? ? ? ? ? 
51  2 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
52  1 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
52  2 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
53  1 1 1 E 79 E 393 ? ? ? ? ? ? ? ? ? 
53  2 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
54  1 1 1 E 79 E 393 ? ? ? ? ? ? ? ? ? 
54  2 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
55  1 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
55  2 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
56  1 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
56  2 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
57  1 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
57  2 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
58  1 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
58  2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
59  1 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
59  2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
60  1 1 1 E 79 E 394 ? ? ? ? ? ? ? ? ? 
60  2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
61  1 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
61  2 1 1 G 79 G 393 ? ? ? ? ? ? ? ? ? 
62  1 1 1 F 78 F 394 ? ? ? ? ? ? ? ? ? 
62  2 1 1 H 78 H 394 ? ? ? ? ? ? ? ? ? 
63  1 1 1 F 78 F 394 ? ? ? ? ? ? ? ? ? 
63  2 1 1 I 78 I 394 ? ? ? ? ? ? ? ? ? 
64  1 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
64  2 1 1 J 79 J 393 ? ? ? ? ? ? ? ? ? 
65  1 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
65  2 1 1 K 79 K 393 ? ? ? ? ? ? ? ? ? 
66  1 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
66  2 1 1 L 79 L 393 ? ? ? ? ? ? ? ? ? 
67  1 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
67  2 1 1 M 79 M 393 ? ? ? ? ? ? ? ? ? 
68  1 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
68  2 1 1 N 79 N 393 ? ? ? ? ? ? ? ? ? 
69  1 1 1 F 79 F 393 ? ? ? ? ? ? ? ? ? 
69  2 1 1 O 79 O 393 ? ? ? ? ? ? ? ? ? 
70  1 1 1 G 79 G 393 ? ? ? ? ? ? ? ? ? 
70  2 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
71  1 1 1 G 79 G 393 ? ? ? ? ? ? ? ? ? 
71  2 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
72  1 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
72  2 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
73  1 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
73  2 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
74  1 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
74  2 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
75  1 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
75  2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
76  1 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
76  2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
77  1 1 1 G 79 G 394 ? ? ? ? ? ? ? ? ? 
77  2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
78  1 1 1 H 78 H 394 ? ? ? ? ? ? ? ? ? 
78  2 1 1 I 78 I 394 ? ? ? ? ? ? ? ? ? 
79  1 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
79  2 1 1 J 79 J 393 ? ? ? ? ? ? ? ? ? 
80  1 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
80  2 1 1 K 79 K 393 ? ? ? ? ? ? ? ? ? 
81  1 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
81  2 1 1 L 79 L 393 ? ? ? ? ? ? ? ? ? 
82  1 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
82  2 1 1 M 79 M 393 ? ? ? ? ? ? ? ? ? 
83  1 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
83  2 1 1 N 79 N 393 ? ? ? ? ? ? ? ? ? 
84  1 1 1 H 79 H 393 ? ? ? ? ? ? ? ? ? 
84  2 1 1 O 79 O 393 ? ? ? ? ? ? ? ? ? 
85  1 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
85  2 1 1 J 79 J 393 ? ? ? ? ? ? ? ? ? 
86  1 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
86  2 1 1 K 79 K 393 ? ? ? ? ? ? ? ? ? 
87  1 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
87  2 1 1 L 79 L 393 ? ? ? ? ? ? ? ? ? 
88  1 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
88  2 1 1 M 79 M 393 ? ? ? ? ? ? ? ? ? 
89  1 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
89  2 1 1 N 79 N 393 ? ? ? ? ? ? ? ? ? 
90  1 1 1 I 79 I 393 ? ? ? ? ? ? ? ? ? 
90  2 1 1 O 79 O 393 ? ? ? ? ? ? ? ? ? 
91  1 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
91  2 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
92  1 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
92  2 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
93  1 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
93  2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
94  1 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
94  2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
95  1 1 1 J 79 J 394 ? ? ? ? ? ? ? ? ? 
95  2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
96  1 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
96  2 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
97  1 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
97  2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
98  1 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
98  2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
99  1 1 1 K 79 K 394 ? ? ? ? ? ? ? ? ? 
99  2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
100 1 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
100 2 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
101 1 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
101 2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
102 1 1 1 L 79 L 394 ? ? ? ? ? ? ? ? ? 
102 2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
103 1 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
103 2 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
104 1 1 1 M 79 M 394 ? ? ? ? ? ? ? ? ? 
104 2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
105 1 1 1 N 79 N 394 ? ? ? ? ? ? ? ? ? 
105 2 1 1 O 79 O 394 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1   ? 
2   ? 
3   ? 
4   ? 
5   ? 
6   ? 
7   ? 
8   ? 
9   ? 
10  ? 
11  ? 
12  ? 
13  ? 
14  ? 
15  ? 
16  ? 
17  ? 
18  ? 
19  ? 
20  ? 
21  ? 
22  ? 
23  ? 
24  ? 
25  ? 
26  ? 
27  ? 
28  ? 
29  ? 
30  ? 
31  ? 
32  ? 
33  ? 
34  ? 
35  ? 
36  ? 
37  ? 
38  ? 
39  ? 
40  ? 
41  ? 
42  ? 
43  ? 
44  ? 
45  ? 
46  ? 
47  ? 
48  ? 
49  ? 
50  ? 
51  ? 
52  ? 
53  ? 
54  ? 
55  ? 
56  ? 
57  ? 
58  ? 
59  ? 
60  ? 
61  ? 
62  ? 
63  ? 
64  ? 
65  ? 
66  ? 
67  ? 
68  ? 
69  ? 
70  ? 
71  ? 
72  ? 
73  ? 
74  ? 
75  ? 
76  ? 
77  ? 
78  ? 
79  ? 
80  ? 
81  ? 
82  ? 
83  ? 
84  ? 
85  ? 
86  ? 
87  ? 
88  ? 
89  ? 
90  ? 
91  ? 
92  ? 
93  ? 
94  ? 
95  ? 
96  ? 
97  ? 
98  ? 
99  ? 
100 ? 
101 ? 
102 ? 
103 ? 
104 ? 
105 ? 
# 
_struct.entry_id                     5DST 
_struct.title                        'Crystal structure of human PRMT8 in complex with SAH' 
_struct.pdbx_descriptor              'Protein arginine N-methyltransferase 8 (E.C.2.1.1.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DST 
_struct_keywords.text            'methyltransferase, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 HIS A 20  ? ASP A 30  ? HIS A 82  ASP A 92  1 ? 11 
HELX_P HELX_P2   AA2 ASP A 30  ? HIS A 43  ? ASP A 92  HIS A 105 1 ? 14 
HELX_P HELX_P3   AA3 ASN A 44  ? LYS A 49  ? ASN A 106 LYS A 111 1 ? 6  
HELX_P HELX_P4   AA4 GLY A 61  ? ALA A 70  ? GLY A 123 ALA A 132 1 ? 10 
HELX_P HELX_P5   AA5 SER A 82  ? ASN A 94  ? SER A 144 ASN A 156 1 ? 13 
HELX_P HELX_P6   AA6 MET A 134 ? TRP A 145 ? MET A 196 TRP A 207 1 ? 12 
HELX_P HELX_P7   AA7 ASP A 166 ? ILE A 174 ? ASP A 228 ILE A 236 1 ? 9  
HELX_P HELX_P8   AA8 HIS A 175 ? ASN A 179 ? HIS A 237 ASN A 241 5 ? 5  
HELX_P HELX_P9   AA9 MET A 185 ? LYS A 194 ? MET A 247 LYS A 256 1 ? 10 
HELX_P HELX_P10  AB1 ASP A 202 ? VAL A 206 ? ASP A 264 VAL A 268 5 ? 5  
HELX_P HELX_P11  AB2 LYS A 222 ? SER A 227 ? LYS A 284 SER A 289 5 ? 6  
HELX_P HELX_P12  AB3 HIS B 20  ? ASP B 30  ? HIS B 82  ASP B 92  1 ? 11 
HELX_P HELX_P13  AB4 ASP B 30  ? HIS B 43  ? ASP B 92  HIS B 105 1 ? 14 
HELX_P HELX_P14  AB5 ASN B 44  ? LYS B 49  ? ASN B 106 LYS B 111 1 ? 6  
HELX_P HELX_P15  AB6 GLY B 61  ? ALA B 70  ? GLY B 123 ALA B 132 1 ? 10 
HELX_P HELX_P16  AB7 SER B 82  ? ASN B 94  ? SER B 144 ASN B 156 1 ? 13 
HELX_P HELX_P17  AB8 MET B 134 ? TRP B 145 ? MET B 196 TRP B 207 1 ? 12 
HELX_P HELX_P18  AB9 ASP B 166 ? ILE B 174 ? ASP B 228 ILE B 236 1 ? 9  
HELX_P HELX_P19  AC1 HIS B 175 ? ASN B 179 ? HIS B 237 ASN B 241 5 ? 5  
HELX_P HELX_P20  AC2 MET B 185 ? LYS B 194 ? MET B 247 LYS B 256 1 ? 10 
HELX_P HELX_P21  AC3 ASP B 202 ? VAL B 206 ? ASP B 264 VAL B 268 5 ? 5  
HELX_P HELX_P22  AC4 LYS B 222 ? SER B 227 ? LYS B 284 SER B 289 5 ? 6  
HELX_P HELX_P23  AC5 HIS C 20  ? ASP C 30  ? HIS C 82  ASP C 92  1 ? 11 
HELX_P HELX_P24  AC6 ASP C 30  ? HIS C 43  ? ASP C 92  HIS C 105 1 ? 14 
HELX_P HELX_P25  AC7 ASN C 44  ? LYS C 49  ? ASN C 106 LYS C 111 1 ? 6  
HELX_P HELX_P26  AC8 GLY C 61  ? ALA C 70  ? GLY C 123 ALA C 132 1 ? 10 
HELX_P HELX_P27  AC9 SER C 82  ? ASN C 94  ? SER C 144 ASN C 156 1 ? 13 
HELX_P HELX_P28  AD1 PHE C 130 ? SER C 133 ? PHE C 192 SER C 195 5 ? 4  
HELX_P HELX_P29  AD2 MET C 134 ? TRP C 145 ? MET C 196 TRP C 207 1 ? 12 
HELX_P HELX_P30  AD3 ASP C 166 ? ILE C 174 ? ASP C 228 ILE C 236 1 ? 9  
HELX_P HELX_P31  AD4 HIS C 175 ? ASN C 179 ? HIS C 237 ASN C 241 5 ? 5  
HELX_P HELX_P32  AD5 MET C 185 ? LYS C 194 ? MET C 247 LYS C 256 1 ? 10 
HELX_P HELX_P33  AD6 ASP C 202 ? VAL C 206 ? ASP C 264 VAL C 268 5 ? 5  
HELX_P HELX_P34  AD7 LYS C 222 ? SER C 227 ? LYS C 284 SER C 289 5 ? 6  
HELX_P HELX_P35  AD8 HIS D 20  ? ASP D 30  ? HIS D 82  ASP D 92  1 ? 11 
HELX_P HELX_P36  AD9 ASP D 30  ? HIS D 43  ? ASP D 92  HIS D 105 1 ? 14 
HELX_P HELX_P37  AE1 ASN D 44  ? LYS D 49  ? ASN D 106 LYS D 111 1 ? 6  
HELX_P HELX_P38  AE2 GLY D 61  ? ALA D 70  ? GLY D 123 ALA D 132 1 ? 10 
HELX_P HELX_P39  AE3 SER D 82  ? ASN D 94  ? SER D 144 ASN D 156 1 ? 13 
HELX_P HELX_P40  AE4 PHE D 130 ? SER D 133 ? PHE D 192 SER D 195 5 ? 4  
HELX_P HELX_P41  AE5 MET D 134 ? TRP D 145 ? MET D 196 TRP D 207 1 ? 12 
HELX_P HELX_P42  AE6 ASP D 166 ? ILE D 174 ? ASP D 228 ILE D 236 1 ? 9  
HELX_P HELX_P43  AE7 HIS D 175 ? ASN D 179 ? HIS D 237 ASN D 241 5 ? 5  
HELX_P HELX_P44  AE8 MET D 185 ? LYS D 194 ? MET D 247 LYS D 256 1 ? 10 
HELX_P HELX_P45  AE9 ASP D 202 ? VAL D 206 ? ASP D 264 VAL D 268 5 ? 5  
HELX_P HELX_P46  AF1 LYS D 222 ? SER D 227 ? LYS D 284 SER D 289 5 ? 6  
HELX_P HELX_P47  AF2 HIS E 20  ? ASP E 30  ? HIS E 82  ASP E 92  1 ? 11 
HELX_P HELX_P48  AF3 ASP E 30  ? HIS E 43  ? ASP E 92  HIS E 105 1 ? 14 
HELX_P HELX_P49  AF4 ASN E 44  ? LYS E 49  ? ASN E 106 LYS E 111 1 ? 6  
HELX_P HELX_P50  AF5 GLY E 61  ? ALA E 70  ? GLY E 123 ALA E 132 1 ? 10 
HELX_P HELX_P51  AF6 SER E 82  ? ASN E 94  ? SER E 144 ASN E 156 1 ? 13 
HELX_P HELX_P52  AF7 PHE E 130 ? SER E 133 ? PHE E 192 SER E 195 5 ? 4  
HELX_P HELX_P53  AF8 MET E 134 ? TRP E 145 ? MET E 196 TRP E 207 1 ? 12 
HELX_P HELX_P54  AF9 ASP E 166 ? ILE E 174 ? ASP E 228 ILE E 236 1 ? 9  
HELX_P HELX_P55  AG1 HIS E 175 ? ASN E 179 ? HIS E 237 ASN E 241 5 ? 5  
HELX_P HELX_P56  AG2 MET E 185 ? LYS E 194 ? MET E 247 LYS E 256 1 ? 10 
HELX_P HELX_P57  AG3 ASP E 202 ? VAL E 206 ? ASP E 264 VAL E 268 5 ? 5  
HELX_P HELX_P58  AG4 LYS E 222 ? SER E 227 ? LYS E 284 SER E 289 5 ? 6  
HELX_P HELX_P59  AG5 HIS F 20  ? ASP F 30  ? HIS F 82  ASP F 92  1 ? 11 
HELX_P HELX_P60  AG6 ASP F 30  ? HIS F 43  ? ASP F 92  HIS F 105 1 ? 14 
HELX_P HELX_P61  AG7 ASN F 44  ? LYS F 49  ? ASN F 106 LYS F 111 1 ? 6  
HELX_P HELX_P62  AG8 GLY F 61  ? ALA F 70  ? GLY F 123 ALA F 132 1 ? 10 
HELX_P HELX_P63  AG9 SER F 82  ? ASN F 94  ? SER F 144 ASN F 156 1 ? 13 
HELX_P HELX_P64  AH1 MET F 134 ? TRP F 145 ? MET F 196 TRP F 207 1 ? 12 
HELX_P HELX_P65  AH2 ASP F 166 ? ILE F 174 ? ASP F 228 ILE F 236 1 ? 9  
HELX_P HELX_P66  AH3 HIS F 175 ? ASN F 179 ? HIS F 237 ASN F 241 5 ? 5  
HELX_P HELX_P67  AH4 MET F 185 ? LYS F 194 ? MET F 247 LYS F 256 1 ? 10 
HELX_P HELX_P68  AH5 ASP F 202 ? VAL F 206 ? ASP F 264 VAL F 268 5 ? 5  
HELX_P HELX_P69  AH6 LYS F 222 ? SER F 227 ? LYS F 284 SER F 289 5 ? 6  
HELX_P HELX_P70  AH7 HIS G 20  ? ASP G 30  ? HIS G 82  ASP G 92  1 ? 11 
HELX_P HELX_P71  AH8 ASP G 30  ? HIS G 43  ? ASP G 92  HIS G 105 1 ? 14 
HELX_P HELX_P72  AH9 ASN G 44  ? LYS G 49  ? ASN G 106 LYS G 111 1 ? 6  
HELX_P HELX_P73  AI1 GLY G 61  ? ALA G 70  ? GLY G 123 ALA G 132 1 ? 10 
HELX_P HELX_P74  AI2 SER G 82  ? ASN G 94  ? SER G 144 ASN G 156 1 ? 13 
HELX_P HELX_P75  AI3 MET G 134 ? TRP G 145 ? MET G 196 TRP G 207 1 ? 12 
HELX_P HELX_P76  AI4 ASP G 166 ? ILE G 174 ? ASP G 228 ILE G 236 1 ? 9  
HELX_P HELX_P77  AI5 HIS G 175 ? ASN G 179 ? HIS G 237 ASN G 241 5 ? 5  
HELX_P HELX_P78  AI6 MET G 185 ? MET G 193 ? MET G 247 MET G 255 1 ? 9  
HELX_P HELX_P79  AI7 ASP G 202 ? VAL G 206 ? ASP G 264 VAL G 268 5 ? 5  
HELX_P HELX_P80  AI8 LYS G 222 ? SER G 227 ? LYS G 284 SER G 289 5 ? 6  
HELX_P HELX_P81  AI9 HIS H 20  ? ASP H 30  ? HIS H 82  ASP H 92  1 ? 11 
HELX_P HELX_P82  AJ1 ASP H 30  ? HIS H 43  ? ASP H 92  HIS H 105 1 ? 14 
HELX_P HELX_P83  AJ2 ASN H 44  ? LYS H 49  ? ASN H 106 LYS H 111 1 ? 6  
HELX_P HELX_P84  AJ3 GLY H 61  ? ALA H 70  ? GLY H 123 ALA H 132 1 ? 10 
HELX_P HELX_P85  AJ4 SER H 82  ? ASN H 94  ? SER H 144 ASN H 156 1 ? 13 
HELX_P HELX_P86  AJ5 PHE H 130 ? SER H 133 ? PHE H 192 SER H 195 5 ? 4  
HELX_P HELX_P87  AJ6 MET H 134 ? TRP H 145 ? MET H 196 TRP H 207 1 ? 12 
HELX_P HELX_P88  AJ7 ASP H 166 ? ILE H 174 ? ASP H 228 ILE H 236 1 ? 9  
HELX_P HELX_P89  AJ8 HIS H 175 ? ASN H 179 ? HIS H 237 ASN H 241 5 ? 5  
HELX_P HELX_P90  AJ9 MET H 185 ? LYS H 194 ? MET H 247 LYS H 256 1 ? 10 
HELX_P HELX_P91  AK1 ASP H 202 ? VAL H 206 ? ASP H 264 VAL H 268 5 ? 5  
HELX_P HELX_P92  AK2 LYS H 222 ? SER H 227 ? LYS H 284 SER H 289 5 ? 6  
HELX_P HELX_P93  AK3 HIS I 20  ? ASP I 30  ? HIS I 82  ASP I 92  1 ? 11 
HELX_P HELX_P94  AK4 ASP I 30  ? HIS I 43  ? ASP I 92  HIS I 105 1 ? 14 
HELX_P HELX_P95  AK5 ASN I 44  ? LYS I 49  ? ASN I 106 LYS I 111 1 ? 6  
HELX_P HELX_P96  AK6 GLY I 61  ? ALA I 70  ? GLY I 123 ALA I 132 1 ? 10 
HELX_P HELX_P97  AK7 SER I 82  ? ASN I 94  ? SER I 144 ASN I 156 1 ? 13 
HELX_P HELX_P98  AK8 MET I 134 ? TRP I 145 ? MET I 196 TRP I 207 1 ? 12 
HELX_P HELX_P99  AK9 ASP I 166 ? ILE I 174 ? ASP I 228 ILE I 236 1 ? 9  
HELX_P HELX_P100 AL1 HIS I 175 ? ASN I 179 ? HIS I 237 ASN I 241 5 ? 5  
HELX_P HELX_P101 AL2 MET I 185 ? LYS I 194 ? MET I 247 LYS I 256 1 ? 10 
HELX_P HELX_P102 AL3 ASP I 202 ? VAL I 206 ? ASP I 264 VAL I 268 5 ? 5  
HELX_P HELX_P103 AL4 LYS I 222 ? SER I 227 ? LYS I 284 SER I 289 5 ? 6  
HELX_P HELX_P104 AL5 HIS J 20  ? ASP J 30  ? HIS J 82  ASP J 92  1 ? 11 
HELX_P HELX_P105 AL6 ASP J 30  ? HIS J 43  ? ASP J 92  HIS J 105 1 ? 14 
HELX_P HELX_P106 AL7 ASN J 44  ? LYS J 49  ? ASN J 106 LYS J 111 1 ? 6  
HELX_P HELX_P107 AL8 GLY J 61  ? ALA J 70  ? GLY J 123 ALA J 132 1 ? 10 
HELX_P HELX_P108 AL9 SER J 82  ? ASN J 94  ? SER J 144 ASN J 156 1 ? 13 
HELX_P HELX_P109 AM1 MET J 134 ? TRP J 145 ? MET J 196 TRP J 207 1 ? 12 
HELX_P HELX_P110 AM2 ASP J 166 ? ILE J 174 ? ASP J 228 ILE J 236 1 ? 9  
HELX_P HELX_P111 AM3 HIS J 175 ? ASN J 179 ? HIS J 237 ASN J 241 5 ? 5  
HELX_P HELX_P112 AM4 MET J 185 ? LYS J 194 ? MET J 247 LYS J 256 1 ? 10 
HELX_P HELX_P113 AM5 ASP J 202 ? VAL J 206 ? ASP J 264 VAL J 268 5 ? 5  
HELX_P HELX_P114 AM6 LYS J 222 ? SER J 227 ? LYS J 284 SER J 289 5 ? 6  
HELX_P HELX_P115 AM7 HIS K 20  ? ASP K 30  ? HIS K 82  ASP K 92  1 ? 11 
HELX_P HELX_P116 AM8 ASP K 30  ? HIS K 43  ? ASP K 92  HIS K 105 1 ? 14 
HELX_P HELX_P117 AM9 ASN K 44  ? LYS K 49  ? ASN K 106 LYS K 111 1 ? 6  
HELX_P HELX_P118 AN1 GLY K 61  ? ALA K 70  ? GLY K 123 ALA K 132 1 ? 10 
HELX_P HELX_P119 AN2 SER K 82  ? ASN K 94  ? SER K 144 ASN K 156 1 ? 13 
HELX_P HELX_P120 AN3 PHE K 130 ? SER K 133 ? PHE K 192 SER K 195 5 ? 4  
HELX_P HELX_P121 AN4 MET K 134 ? TRP K 145 ? MET K 196 TRP K 207 1 ? 12 
HELX_P HELX_P122 AN5 ASP K 166 ? ILE K 174 ? ASP K 228 ILE K 236 1 ? 9  
HELX_P HELX_P123 AN6 HIS K 175 ? ASN K 179 ? HIS K 237 ASN K 241 5 ? 5  
HELX_P HELX_P124 AN7 MET K 185 ? MET K 193 ? MET K 247 MET K 255 1 ? 9  
HELX_P HELX_P125 AN8 ASP K 202 ? VAL K 206 ? ASP K 264 VAL K 268 5 ? 5  
HELX_P HELX_P126 AN9 LYS K 222 ? SER K 227 ? LYS K 284 SER K 289 5 ? 6  
HELX_P HELX_P127 AO1 HIS L 20  ? ASP L 30  ? HIS L 82  ASP L 92  1 ? 11 
HELX_P HELX_P128 AO2 ASP L 30  ? HIS L 43  ? ASP L 92  HIS L 105 1 ? 14 
HELX_P HELX_P129 AO3 ASN L 44  ? LYS L 49  ? ASN L 106 LYS L 111 1 ? 6  
HELX_P HELX_P130 AO4 GLY L 61  ? ALA L 70  ? GLY L 123 ALA L 132 1 ? 10 
HELX_P HELX_P131 AO5 SER L 82  ? ASN L 94  ? SER L 144 ASN L 156 1 ? 13 
HELX_P HELX_P132 AO6 PHE L 130 ? GLU L 132 ? PHE L 192 GLU L 194 5 ? 3  
HELX_P HELX_P133 AO7 SER L 133 ? TRP L 145 ? SER L 195 TRP L 207 1 ? 13 
HELX_P HELX_P134 AO8 ASP L 166 ? ILE L 174 ? ASP L 228 ILE L 236 1 ? 9  
HELX_P HELX_P135 AO9 HIS L 175 ? ASN L 179 ? HIS L 237 ASN L 241 5 ? 5  
HELX_P HELX_P136 AP1 MET L 185 ? MET L 193 ? MET L 247 MET L 255 1 ? 9  
HELX_P HELX_P137 AP2 ASP L 202 ? VAL L 206 ? ASP L 264 VAL L 268 5 ? 5  
HELX_P HELX_P138 AP3 LYS L 222 ? SER L 227 ? LYS L 284 SER L 289 5 ? 6  
HELX_P HELX_P139 AP4 HIS M 20  ? ASP M 30  ? HIS M 82  ASP M 92  1 ? 11 
HELX_P HELX_P140 AP5 ASP M 30  ? HIS M 43  ? ASP M 92  HIS M 105 1 ? 14 
HELX_P HELX_P141 AP6 ASN M 44  ? LYS M 49  ? ASN M 106 LYS M 111 1 ? 6  
HELX_P HELX_P142 AP7 GLY M 61  ? ALA M 70  ? GLY M 123 ALA M 132 1 ? 10 
HELX_P HELX_P143 AP8 SER M 82  ? ASN M 94  ? SER M 144 ASN M 156 1 ? 13 
HELX_P HELX_P144 AP9 PHE M 130 ? SER M 133 ? PHE M 192 SER M 195 5 ? 4  
HELX_P HELX_P145 AQ1 MET M 134 ? TRP M 145 ? MET M 196 TRP M 207 1 ? 12 
HELX_P HELX_P146 AQ2 ASP M 166 ? ILE M 174 ? ASP M 228 ILE M 236 1 ? 9  
HELX_P HELX_P147 AQ3 HIS M 175 ? ASN M 179 ? HIS M 237 ASN M 241 5 ? 5  
HELX_P HELX_P148 AQ4 MET M 185 ? LYS M 194 ? MET M 247 LYS M 256 1 ? 10 
HELX_P HELX_P149 AQ5 ASP M 202 ? VAL M 206 ? ASP M 264 VAL M 268 5 ? 5  
HELX_P HELX_P150 AQ6 LYS M 222 ? SER M 227 ? LYS M 284 SER M 289 5 ? 6  
HELX_P HELX_P151 AQ7 HIS N 20  ? ASP N 30  ? HIS N 82  ASP N 92  1 ? 11 
HELX_P HELX_P152 AQ8 ASP N 30  ? HIS N 43  ? ASP N 92  HIS N 105 1 ? 14 
HELX_P HELX_P153 AQ9 ASN N 44  ? LYS N 49  ? ASN N 106 LYS N 111 1 ? 6  
HELX_P HELX_P154 AR1 GLY N 61  ? ALA N 70  ? GLY N 123 ALA N 132 1 ? 10 
HELX_P HELX_P155 AR2 SER N 82  ? ASN N 94  ? SER N 144 ASN N 156 1 ? 13 
HELX_P HELX_P156 AR3 PHE N 130 ? SER N 133 ? PHE N 192 SER N 195 5 ? 4  
HELX_P HELX_P157 AR4 MET N 134 ? TRP N 145 ? MET N 196 TRP N 207 1 ? 12 
HELX_P HELX_P158 AR5 ASP N 166 ? ILE N 174 ? ASP N 228 ILE N 236 1 ? 9  
HELX_P HELX_P159 AR6 HIS N 175 ? ASN N 179 ? HIS N 237 ASN N 241 5 ? 5  
HELX_P HELX_P160 AR7 MET N 185 ? LYS N 194 ? MET N 247 LYS N 256 1 ? 10 
HELX_P HELX_P161 AR8 ASP N 202 ? VAL N 206 ? ASP N 264 VAL N 268 5 ? 5  
HELX_P HELX_P162 AR9 LYS N 222 ? SER N 227 ? LYS N 284 SER N 289 5 ? 6  
HELX_P HELX_P163 AS1 HIS O 20  ? ASP O 30  ? HIS O 82  ASP O 92  1 ? 11 
HELX_P HELX_P164 AS2 ASP O 30  ? HIS O 43  ? ASP O 92  HIS O 105 1 ? 14 
HELX_P HELX_P165 AS3 ASN O 44  ? LYS O 49  ? ASN O 106 LYS O 111 1 ? 6  
HELX_P HELX_P166 AS4 GLY O 61  ? ALA O 70  ? GLY O 123 ALA O 132 1 ? 10 
HELX_P HELX_P167 AS5 SER O 82  ? ASN O 94  ? SER O 144 ASN O 156 1 ? 13 
HELX_P HELX_P168 AS6 PHE O 130 ? SER O 133 ? PHE O 192 SER O 195 5 ? 4  
HELX_P HELX_P169 AS7 MET O 134 ? TRP O 145 ? MET O 196 TRP O 207 1 ? 12 
HELX_P HELX_P170 AS8 ASP O 166 ? ILE O 174 ? ASP O 228 ILE O 236 1 ? 9  
HELX_P HELX_P171 AS9 HIS O 175 ? ASN O 179 ? HIS O 237 ASN O 241 5 ? 5  
HELX_P HELX_P172 AT1 MET O 185 ? MET O 193 ? MET O 247 MET O 255 1 ? 9  
HELX_P HELX_P173 AT2 ASP O 202 ? VAL O 206 ? ASP O 264 VAL O 268 5 ? 5  
HELX_P HELX_P174 AT3 LYS O 222 ? SER O 227 ? LYS O 284 SER O 289 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 153 A . ? PHE 215 A PRO 154 A ? PRO 216 A 1 -12.39 
2  PHE 153 B . ? PHE 215 B PRO 154 B ? PRO 216 B 1 -12.72 
3  PHE 153 C . ? PHE 215 C PRO 154 C ? PRO 216 C 1 -3.02  
4  PHE 153 D . ? PHE 215 D PRO 154 D ? PRO 216 D 1 -7.59  
5  PHE 153 E . ? PHE 215 E PRO 154 E ? PRO 216 E 1 -16.94 
6  PHE 153 F . ? PHE 215 F PRO 154 F ? PRO 216 F 1 -14.11 
7  PHE 153 G . ? PHE 215 G PRO 154 G ? PRO 216 G 1 -8.45  
8  PHE 153 H . ? PHE 215 H PRO 154 H ? PRO 216 H 1 -11.46 
9  PHE 153 I . ? PHE 215 I PRO 154 I ? PRO 216 I 1 -10.95 
10 PHE 153 J . ? PHE 215 J PRO 154 J ? PRO 216 J 1 -3.98  
11 PHE 153 K . ? PHE 215 K PRO 154 K ? PRO 216 K 1 -11.35 
12 PHE 153 L . ? PHE 215 L PRO 154 L ? PRO 216 L 1 -15.14 
13 PHE 153 M . ? PHE 215 M PRO 154 M ? PRO 216 M 1 -9.53  
14 PHE 153 N . ? PHE 215 N PRO 154 N ? PRO 216 N 1 -9.23  
15 PHE 153 O . ? PHE 215 O PRO 154 O ? PRO 216 O 1 -2.81  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 5 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 5 ? 
AB1 ? 5 ? 
AB2 ? 4 ? 
AB3 ? 4 ? 
AB4 ? 5 ? 
AB5 ? 5 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 5 ? 
AB9 ? 5 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
AC3 ? 5 ? 
AC4 ? 5 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 5 ? 
AC8 ? 5 ? 
AC9 ? 4 ? 
AD1 ? 4 ? 
AD2 ? 5 ? 
AD3 ? 5 ? 
AD4 ? 4 ? 
AD5 ? 4 ? 
AD6 ? 5 ? 
AD7 ? 5 ? 
AD8 ? 4 ? 
AD9 ? 4 ? 
AE1 ? 5 ? 
AE2 ? 5 ? 
AE3 ? 4 ? 
AE4 ? 4 ? 
AE5 ? 5 ? 
AE6 ? 5 ? 
AE7 ? 4 ? 
AE8 ? 4 ? 
AE9 ? 5 ? 
AF1 ? 5 ? 
AF2 ? 4 ? 
AF3 ? 4 ? 
AF4 ? 5 ? 
AF5 ? 5 ? 
AF6 ? 4 ? 
AF7 ? 4 ? 
AF8 ? 5 ? 
AF9 ? 5 ? 
AG1 ? 4 ? 
AG2 ? 4 ? 
AG3 ? 5 ? 
AG4 ? 5 ? 
AG5 ? 4 ? 
AG6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? parallel      
AB4 3 4 ? parallel      
AB4 4 5 ? parallel      
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB8 4 5 ? parallel      
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? parallel      
AC3 2 3 ? parallel      
AC3 3 4 ? parallel      
AC3 4 5 ? parallel      
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? parallel      
AC7 3 4 ? parallel      
AC7 4 5 ? parallel      
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD2 3 4 ? parallel      
AD2 4 5 ? parallel      
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD6 1 2 ? parallel      
AD6 2 3 ? parallel      
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? parallel      
AE1 2 3 ? parallel      
AE1 3 4 ? parallel      
AE1 4 5 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE2 4 5 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE5 1 2 ? parallel      
AE5 2 3 ? parallel      
AE5 3 4 ? parallel      
AE5 4 5 ? parallel      
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE6 4 5 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE9 1 2 ? parallel      
AE9 2 3 ? parallel      
AE9 3 4 ? parallel      
AE9 4 5 ? parallel      
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF1 4 5 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? parallel      
AF4 2 3 ? parallel      
AF4 3 4 ? parallel      
AF4 4 5 ? parallel      
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF5 4 5 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF8 1 2 ? parallel      
AF8 2 3 ? parallel      
AF8 3 4 ? parallel      
AF8 4 5 ? parallel      
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AF9 4 5 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG2 3 4 ? anti-parallel 
AG3 1 2 ? parallel      
AG3 2 3 ? parallel      
AG3 3 4 ? parallel      
AG3 4 5 ? parallel      
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG4 3 4 ? anti-parallel 
AG4 4 5 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 100 ? LYS A 104 ? ILE A 162 LYS A 166 
AA1 2 LYS A 74  ? GLU A 79  ? LYS A 136 GLU A 141 
AA1 3 VAL A 52  ? VAL A 56  ? VAL A 114 VAL A 118 
AA1 4 VAL A 117 ? ILE A 121 ? VAL A 179 ILE A 183 
AA1 5 LEU A 146 ? PHE A 153 ? LEU A 208 PHE A 215 
AA2 1 LEU A 197 ? ASP A 199 ? LEU A 259 ASP A 261 
AA2 2 GLN A 275 ? VAL A 286 ? GLN A 337 VAL A 348 
AA2 3 ASP A 240 ? PHE A 253 ? ASP A 302 PHE A 315 
AA2 4 ARG A 156 ? ILE A 164 ? ARG A 218 ILE A 226 
AA2 5 CYS A 211 ? ASP A 217 ? CYS A 273 ASP A 279 
AA3 1 LEU A 197 ? ASP A 199 ? LEU A 259 ASP A 261 
AA3 2 GLN A 275 ? VAL A 286 ? GLN A 337 VAL A 348 
AA3 3 ASP A 240 ? PHE A 253 ? ASP A 302 PHE A 315 
AA3 4 MET A 260 ? SER A 263 ? MET A 322 SER A 325 
AA4 1 PHE A 228 ? GLN A 235 ? PHE A 290 GLN A 297 
AA4 2 GLU A 291 ? PRO A 300 ? GLU A 353 PRO A 362 
AA4 3 LEU A 308 ? LYS A 317 ? LEU A 370 LYS A 379 
AA4 4 GLU A 322 ? MET A 331 ? GLU A 384 MET A 393 
AA5 1 ILE B 100 ? LYS B 104 ? ILE B 162 LYS B 166 
AA5 2 LYS B 74  ? GLU B 79  ? LYS B 136 GLU B 141 
AA5 3 VAL B 52  ? VAL B 56  ? VAL B 114 VAL B 118 
AA5 4 VAL B 117 ? ILE B 121 ? VAL B 179 ILE B 183 
AA5 5 LEU B 146 ? PHE B 153 ? LEU B 208 PHE B 215 
AA6 1 LEU B 197 ? ASP B 199 ? LEU B 259 ASP B 261 
AA6 2 GLN B 275 ? VAL B 286 ? GLN B 337 VAL B 348 
AA6 3 ASP B 240 ? GLU B 252 ? ASP B 302 GLU B 314 
AA6 4 ARG B 156 ? ILE B 164 ? ARG B 218 ILE B 226 
AA6 5 CYS B 211 ? ASP B 217 ? CYS B 273 ASP B 279 
AA7 1 LEU B 197 ? ASP B 199 ? LEU B 259 ASP B 261 
AA7 2 GLN B 275 ? VAL B 286 ? GLN B 337 VAL B 348 
AA7 3 ASP B 240 ? GLU B 252 ? ASP B 302 GLU B 314 
AA7 4 GLY B 261 ? SER B 263 ? GLY B 323 SER B 325 
AA8 1 PHE B 228 ? GLN B 235 ? PHE B 290 GLN B 297 
AA8 2 GLU B 291 ? PRO B 300 ? GLU B 353 PRO B 362 
AA8 3 LEU B 308 ? LYS B 317 ? LEU B 370 LYS B 379 
AA8 4 GLU B 322 ? MET B 331 ? GLU B 384 MET B 393 
AA9 1 ILE C 100 ? LYS C 104 ? ILE C 162 LYS C 166 
AA9 2 LYS C 74  ? GLU C 79  ? LYS C 136 GLU C 141 
AA9 3 VAL C 52  ? VAL C 56  ? VAL C 114 VAL C 118 
AA9 4 VAL C 117 ? ILE C 121 ? VAL C 179 ILE C 183 
AA9 5 LEU C 146 ? PHE C 153 ? LEU C 208 PHE C 215 
AB1 1 LEU C 197 ? ASP C 199 ? LEU C 259 ASP C 261 
AB1 2 GLN C 275 ? VAL C 286 ? GLN C 337 VAL C 348 
AB1 3 ASP C 240 ? GLU C 252 ? ASP C 302 GLU C 314 
AB1 4 ARG C 156 ? ILE C 164 ? ARG C 218 ILE C 226 
AB1 5 CYS C 211 ? ASP C 217 ? CYS C 273 ASP C 279 
AB2 1 LEU C 197 ? ASP C 199 ? LEU C 259 ASP C 261 
AB2 2 GLN C 275 ? VAL C 286 ? GLN C 337 VAL C 348 
AB2 3 ASP C 240 ? GLU C 252 ? ASP C 302 GLU C 314 
AB2 4 GLY C 261 ? SER C 263 ? GLY C 323 SER C 325 
AB3 1 PHE C 228 ? GLN C 235 ? PHE C 290 GLN C 297 
AB3 2 GLU C 291 ? PRO C 300 ? GLU C 353 PRO C 362 
AB3 3 LEU C 308 ? LYS C 317 ? LEU C 370 LYS C 379 
AB3 4 GLU C 322 ? MET C 331 ? GLU C 384 MET C 393 
AB4 1 ILE D 100 ? LYS D 104 ? ILE D 162 LYS D 166 
AB4 2 LYS D 74  ? GLU D 79  ? LYS D 136 GLU D 141 
AB4 3 VAL D 52  ? VAL D 56  ? VAL D 114 VAL D 118 
AB4 4 VAL D 117 ? ILE D 121 ? VAL D 179 ILE D 183 
AB4 5 LEU D 146 ? PHE D 153 ? LEU D 208 PHE D 215 
AB5 1 LEU D 197 ? ASP D 199 ? LEU D 259 ASP D 261 
AB5 2 GLN D 275 ? VAL D 286 ? GLN D 337 VAL D 348 
AB5 3 ASP D 240 ? PHE D 253 ? ASP D 302 PHE D 315 
AB5 4 ARG D 156 ? ILE D 164 ? ARG D 218 ILE D 226 
AB5 5 CYS D 211 ? ASP D 217 ? CYS D 273 ASP D 279 
AB6 1 LEU D 197 ? ASP D 199 ? LEU D 259 ASP D 261 
AB6 2 GLN D 275 ? VAL D 286 ? GLN D 337 VAL D 348 
AB6 3 ASP D 240 ? PHE D 253 ? ASP D 302 PHE D 315 
AB6 4 MET D 260 ? SER D 263 ? MET D 322 SER D 325 
AB7 1 PHE D 228 ? GLN D 235 ? PHE D 290 GLN D 297 
AB7 2 GLU D 291 ? PRO D 300 ? GLU D 353 PRO D 362 
AB7 3 LEU D 308 ? LYS D 317 ? LEU D 370 LYS D 379 
AB7 4 GLU D 322 ? MET D 331 ? GLU D 384 MET D 393 
AB8 1 ILE E 100 ? LYS E 104 ? ILE E 162 LYS E 166 
AB8 2 LYS E 74  ? GLU E 79  ? LYS E 136 GLU E 141 
AB8 3 VAL E 52  ? VAL E 56  ? VAL E 114 VAL E 118 
AB8 4 VAL E 117 ? ILE E 121 ? VAL E 179 ILE E 183 
AB8 5 LEU E 146 ? PHE E 153 ? LEU E 208 PHE E 215 
AB9 1 LEU E 197 ? ASP E 199 ? LEU E 259 ASP E 261 
AB9 2 GLN E 275 ? VAL E 286 ? GLN E 337 VAL E 348 
AB9 3 ASP E 240 ? GLU E 252 ? ASP E 302 GLU E 314 
AB9 4 ARG E 156 ? ILE E 164 ? ARG E 218 ILE E 226 
AB9 5 CYS E 211 ? ASP E 217 ? CYS E 273 ASP E 279 
AC1 1 LEU E 197 ? ASP E 199 ? LEU E 259 ASP E 261 
AC1 2 GLN E 275 ? VAL E 286 ? GLN E 337 VAL E 348 
AC1 3 ASP E 240 ? GLU E 252 ? ASP E 302 GLU E 314 
AC1 4 GLY E 261 ? SER E 263 ? GLY E 323 SER E 325 
AC2 1 PHE E 228 ? GLN E 235 ? PHE E 290 GLN E 297 
AC2 2 GLU E 291 ? PRO E 300 ? GLU E 353 PRO E 362 
AC2 3 LEU E 308 ? LYS E 317 ? LEU E 370 LYS E 379 
AC2 4 GLU E 322 ? MET E 331 ? GLU E 384 MET E 393 
AC3 1 ILE F 100 ? LYS F 104 ? ILE F 162 LYS F 166 
AC3 2 LYS F 74  ? GLU F 79  ? LYS F 136 GLU F 141 
AC3 3 VAL F 52  ? VAL F 56  ? VAL F 114 VAL F 118 
AC3 4 VAL F 117 ? ILE F 121 ? VAL F 179 ILE F 183 
AC3 5 LEU F 146 ? PHE F 153 ? LEU F 208 PHE F 215 
AC4 1 LEU F 197 ? ASP F 199 ? LEU F 259 ASP F 261 
AC4 2 GLN F 275 ? VAL F 286 ? GLN F 337 VAL F 348 
AC4 3 ASP F 240 ? GLU F 252 ? ASP F 302 GLU F 314 
AC4 4 ARG F 156 ? ILE F 164 ? ARG F 218 ILE F 226 
AC4 5 CYS F 211 ? ASP F 217 ? CYS F 273 ASP F 279 
AC5 1 LEU F 197 ? ASP F 199 ? LEU F 259 ASP F 261 
AC5 2 GLN F 275 ? VAL F 286 ? GLN F 337 VAL F 348 
AC5 3 ASP F 240 ? GLU F 252 ? ASP F 302 GLU F 314 
AC5 4 GLY F 261 ? SER F 263 ? GLY F 323 SER F 325 
AC6 1 PHE F 228 ? GLN F 235 ? PHE F 290 GLN F 297 
AC6 2 GLU F 291 ? PRO F 300 ? GLU F 353 PRO F 362 
AC6 3 LEU F 308 ? LYS F 317 ? LEU F 370 LYS F 379 
AC6 4 GLU F 322 ? MET F 331 ? GLU F 384 MET F 393 
AC7 1 ILE G 100 ? LYS G 104 ? ILE G 162 LYS G 166 
AC7 2 LYS G 74  ? GLU G 79  ? LYS G 136 GLU G 141 
AC7 3 VAL G 52  ? VAL G 56  ? VAL G 114 VAL G 118 
AC7 4 VAL G 117 ? SER G 122 ? VAL G 179 SER G 184 
AC7 5 LEU G 146 ? PHE G 153 ? LEU G 208 PHE G 215 
AC8 1 LEU G 197 ? ASP G 199 ? LEU G 259 ASP G 261 
AC8 2 GLN G 275 ? VAL G 286 ? GLN G 337 VAL G 348 
AC8 3 ASP G 240 ? GLU G 252 ? ASP G 302 GLU G 314 
AC8 4 ARG G 156 ? ILE G 164 ? ARG G 218 ILE G 226 
AC8 5 CYS G 211 ? ASP G 217 ? CYS G 273 ASP G 279 
AC9 1 LEU G 197 ? ASP G 199 ? LEU G 259 ASP G 261 
AC9 2 GLN G 275 ? VAL G 286 ? GLN G 337 VAL G 348 
AC9 3 ASP G 240 ? GLU G 252 ? ASP G 302 GLU G 314 
AC9 4 GLY G 261 ? SER G 263 ? GLY G 323 SER G 325 
AD1 1 PHE G 228 ? GLN G 235 ? PHE G 290 GLN G 297 
AD1 2 GLU G 291 ? PRO G 300 ? GLU G 353 PRO G 362 
AD1 3 LEU G 308 ? LYS G 317 ? LEU G 370 LYS G 379 
AD1 4 GLU G 322 ? MET G 331 ? GLU G 384 MET G 393 
AD2 1 ILE H 100 ? LYS H 104 ? ILE H 162 LYS H 166 
AD2 2 LYS H 74  ? GLU H 79  ? LYS H 136 GLU H 141 
AD2 3 VAL H 52  ? VAL H 56  ? VAL H 114 VAL H 118 
AD2 4 VAL H 117 ? ILE H 121 ? VAL H 179 ILE H 183 
AD2 5 LEU H 146 ? PHE H 153 ? LEU H 208 PHE H 215 
AD3 1 LEU H 197 ? ASP H 199 ? LEU H 259 ASP H 261 
AD3 2 GLN H 275 ? VAL H 286 ? GLN H 337 VAL H 348 
AD3 3 ASP H 240 ? GLU H 252 ? ASP H 302 GLU H 314 
AD3 4 ARG H 156 ? ILE H 164 ? ARG H 218 ILE H 226 
AD3 5 CYS H 211 ? ASP H 217 ? CYS H 273 ASP H 279 
AD4 1 LEU H 197 ? ASP H 199 ? LEU H 259 ASP H 261 
AD4 2 GLN H 275 ? VAL H 286 ? GLN H 337 VAL H 348 
AD4 3 ASP H 240 ? GLU H 252 ? ASP H 302 GLU H 314 
AD4 4 GLY H 261 ? SER H 263 ? GLY H 323 SER H 325 
AD5 1 PHE H 228 ? GLN H 235 ? PHE H 290 GLN H 297 
AD5 2 GLU H 291 ? PRO H 300 ? GLU H 353 PRO H 362 
AD5 3 LEU H 308 ? LYS H 317 ? LEU H 370 LYS H 379 
AD5 4 GLU H 322 ? MET H 331 ? GLU H 384 MET H 393 
AD6 1 ILE I 100 ? LYS I 104 ? ILE I 162 LYS I 166 
AD6 2 LYS I 74  ? GLU I 79  ? LYS I 136 GLU I 141 
AD6 3 VAL I 52  ? VAL I 56  ? VAL I 114 VAL I 118 
AD6 4 VAL I 117 ? ILE I 121 ? VAL I 179 ILE I 183 
AD6 5 LEU I 146 ? PHE I 153 ? LEU I 208 PHE I 215 
AD7 1 LEU I 197 ? ASP I 199 ? LEU I 259 ASP I 261 
AD7 2 GLN I 275 ? VAL I 286 ? GLN I 337 VAL I 348 
AD7 3 ASP I 240 ? GLU I 252 ? ASP I 302 GLU I 314 
AD7 4 ARG I 156 ? ILE I 164 ? ARG I 218 ILE I 226 
AD7 5 CYS I 211 ? ASP I 217 ? CYS I 273 ASP I 279 
AD8 1 LEU I 197 ? ASP I 199 ? LEU I 259 ASP I 261 
AD8 2 GLN I 275 ? VAL I 286 ? GLN I 337 VAL I 348 
AD8 3 ASP I 240 ? GLU I 252 ? ASP I 302 GLU I 314 
AD8 4 GLY I 261 ? SER I 263 ? GLY I 323 SER I 325 
AD9 1 PHE I 228 ? GLN I 235 ? PHE I 290 GLN I 297 
AD9 2 GLU I 291 ? PRO I 300 ? GLU I 353 PRO I 362 
AD9 3 LEU I 308 ? LYS I 317 ? LEU I 370 LYS I 379 
AD9 4 GLU I 322 ? MET I 331 ? GLU I 384 MET I 393 
AE1 1 ILE J 100 ? LYS J 104 ? ILE J 162 LYS J 166 
AE1 2 LYS J 74  ? GLU J 79  ? LYS J 136 GLU J 141 
AE1 3 VAL J 52  ? VAL J 56  ? VAL J 114 VAL J 118 
AE1 4 VAL J 117 ? ILE J 121 ? VAL J 179 ILE J 183 
AE1 5 LEU J 146 ? PHE J 153 ? LEU J 208 PHE J 215 
AE2 1 LEU J 197 ? ASP J 199 ? LEU J 259 ASP J 261 
AE2 2 GLN J 275 ? VAL J 286 ? GLN J 337 VAL J 348 
AE2 3 ASP J 240 ? GLU J 252 ? ASP J 302 GLU J 314 
AE2 4 ARG J 156 ? ILE J 164 ? ARG J 218 ILE J 226 
AE2 5 CYS J 211 ? ASP J 217 ? CYS J 273 ASP J 279 
AE3 1 LEU J 197 ? ASP J 199 ? LEU J 259 ASP J 261 
AE3 2 GLN J 275 ? VAL J 286 ? GLN J 337 VAL J 348 
AE3 3 ASP J 240 ? GLU J 252 ? ASP J 302 GLU J 314 
AE3 4 GLY J 261 ? SER J 263 ? GLY J 323 SER J 325 
AE4 1 PHE J 228 ? GLN J 235 ? PHE J 290 GLN J 297 
AE4 2 GLU J 291 ? PRO J 300 ? GLU J 353 PRO J 362 
AE4 3 LEU J 308 ? LYS J 317 ? LEU J 370 LYS J 379 
AE4 4 GLU J 322 ? MET J 331 ? GLU J 384 MET J 393 
AE5 1 ILE K 100 ? LYS K 104 ? ILE K 162 LYS K 166 
AE5 2 LYS K 74  ? GLU K 79  ? LYS K 136 GLU K 141 
AE5 3 VAL K 52  ? VAL K 56  ? VAL K 114 VAL K 118 
AE5 4 VAL K 117 ? SER K 122 ? VAL K 179 SER K 184 
AE5 5 LEU K 146 ? PHE K 153 ? LEU K 208 PHE K 215 
AE6 1 LEU K 197 ? ASP K 199 ? LEU K 259 ASP K 261 
AE6 2 GLN K 275 ? VAL K 286 ? GLN K 337 VAL K 348 
AE6 3 ASP K 240 ? GLU K 252 ? ASP K 302 GLU K 314 
AE6 4 ARG K 156 ? ILE K 164 ? ARG K 218 ILE K 226 
AE6 5 CYS K 211 ? ASP K 217 ? CYS K 273 ASP K 279 
AE7 1 LEU K 197 ? ASP K 199 ? LEU K 259 ASP K 261 
AE7 2 GLN K 275 ? VAL K 286 ? GLN K 337 VAL K 348 
AE7 3 ASP K 240 ? GLU K 252 ? ASP K 302 GLU K 314 
AE7 4 GLY K 261 ? SER K 263 ? GLY K 323 SER K 325 
AE8 1 PHE K 228 ? GLN K 235 ? PHE K 290 GLN K 297 
AE8 2 GLU K 291 ? PRO K 300 ? GLU K 353 PRO K 362 
AE8 3 LEU K 308 ? LYS K 317 ? LEU K 370 LYS K 379 
AE8 4 GLU K 322 ? MET K 331 ? GLU K 384 MET K 393 
AE9 1 ILE L 100 ? LYS L 104 ? ILE L 162 LYS L 166 
AE9 2 LYS L 74  ? GLU L 79  ? LYS L 136 GLU L 141 
AE9 3 VAL L 52  ? VAL L 56  ? VAL L 114 VAL L 118 
AE9 4 VAL L 117 ? ILE L 121 ? VAL L 179 ILE L 183 
AE9 5 LEU L 146 ? PHE L 153 ? LEU L 208 PHE L 215 
AF1 1 LEU L 197 ? ASP L 199 ? LEU L 259 ASP L 261 
AF1 2 GLN L 275 ? VAL L 286 ? GLN L 337 VAL L 348 
AF1 3 ASP L 240 ? PHE L 253 ? ASP L 302 PHE L 315 
AF1 4 ARG L 156 ? ILE L 164 ? ARG L 218 ILE L 226 
AF1 5 CYS L 211 ? ASP L 217 ? CYS L 273 ASP L 279 
AF2 1 LEU L 197 ? ASP L 199 ? LEU L 259 ASP L 261 
AF2 2 GLN L 275 ? VAL L 286 ? GLN L 337 VAL L 348 
AF2 3 ASP L 240 ? PHE L 253 ? ASP L 302 PHE L 315 
AF2 4 MET L 260 ? SER L 263 ? MET L 322 SER L 325 
AF3 1 PHE L 228 ? GLN L 235 ? PHE L 290 GLN L 297 
AF3 2 GLU L 291 ? PRO L 300 ? GLU L 353 PRO L 362 
AF3 3 LEU L 308 ? LYS L 317 ? LEU L 370 LYS L 379 
AF3 4 GLU L 322 ? MET L 331 ? GLU L 384 MET L 393 
AF4 1 ILE M 100 ? LYS M 104 ? ILE M 162 LYS M 166 
AF4 2 LYS M 74  ? GLU M 79  ? LYS M 136 GLU M 141 
AF4 3 VAL M 52  ? VAL M 56  ? VAL M 114 VAL M 118 
AF4 4 VAL M 117 ? ILE M 121 ? VAL M 179 ILE M 183 
AF4 5 LEU M 146 ? PHE M 153 ? LEU M 208 PHE M 215 
AF5 1 LEU M 197 ? ASP M 199 ? LEU M 259 ASP M 261 
AF5 2 GLN M 275 ? VAL M 286 ? GLN M 337 VAL M 348 
AF5 3 ASP M 240 ? GLU M 252 ? ASP M 302 GLU M 314 
AF5 4 ARG M 156 ? ILE M 164 ? ARG M 218 ILE M 226 
AF5 5 CYS M 211 ? ASP M 217 ? CYS M 273 ASP M 279 
AF6 1 LEU M 197 ? ASP M 199 ? LEU M 259 ASP M 261 
AF6 2 GLN M 275 ? VAL M 286 ? GLN M 337 VAL M 348 
AF6 3 ASP M 240 ? GLU M 252 ? ASP M 302 GLU M 314 
AF6 4 GLY M 261 ? SER M 263 ? GLY M 323 SER M 325 
AF7 1 PHE M 228 ? GLN M 235 ? PHE M 290 GLN M 297 
AF7 2 GLU M 291 ? PRO M 300 ? GLU M 353 PRO M 362 
AF7 3 LEU M 308 ? LYS M 317 ? LEU M 370 LYS M 379 
AF7 4 GLU M 322 ? MET M 331 ? GLU M 384 MET M 393 
AF8 1 ILE N 100 ? LYS N 104 ? ILE N 162 LYS N 166 
AF8 2 LYS N 74  ? GLU N 79  ? LYS N 136 GLU N 141 
AF8 3 VAL N 52  ? VAL N 56  ? VAL N 114 VAL N 118 
AF8 4 VAL N 117 ? ILE N 121 ? VAL N 179 ILE N 183 
AF8 5 LEU N 146 ? PHE N 153 ? LEU N 208 PHE N 215 
AF9 1 LEU N 197 ? ASP N 199 ? LEU N 259 ASP N 261 
AF9 2 GLN N 275 ? VAL N 286 ? GLN N 337 VAL N 348 
AF9 3 ASP N 240 ? GLU N 252 ? ASP N 302 GLU N 314 
AF9 4 ARG N 156 ? ILE N 164 ? ARG N 218 ILE N 226 
AF9 5 CYS N 211 ? ASP N 217 ? CYS N 273 ASP N 279 
AG1 1 LEU N 197 ? ASP N 199 ? LEU N 259 ASP N 261 
AG1 2 GLN N 275 ? VAL N 286 ? GLN N 337 VAL N 348 
AG1 3 ASP N 240 ? GLU N 252 ? ASP N 302 GLU N 314 
AG1 4 GLY N 261 ? SER N 263 ? GLY N 323 SER N 325 
AG2 1 PHE N 228 ? GLN N 235 ? PHE N 290 GLN N 297 
AG2 2 GLU N 291 ? PRO N 300 ? GLU N 353 PRO N 362 
AG2 3 LEU N 308 ? LYS N 317 ? LEU N 370 LYS N 379 
AG2 4 GLU N 322 ? MET N 331 ? GLU N 384 MET N 393 
AG3 1 ILE O 100 ? LYS O 104 ? ILE O 162 LYS O 166 
AG3 2 LYS O 74  ? GLU O 79  ? LYS O 136 GLU O 141 
AG3 3 VAL O 52  ? VAL O 56  ? VAL O 114 VAL O 118 
AG3 4 VAL O 117 ? ILE O 121 ? VAL O 179 ILE O 183 
AG3 5 LEU O 146 ? PHE O 153 ? LEU O 208 PHE O 215 
AG4 1 LEU O 197 ? ASP O 199 ? LEU O 259 ASP O 261 
AG4 2 GLN O 275 ? VAL O 286 ? GLN O 337 VAL O 348 
AG4 3 ASP O 240 ? GLU O 252 ? ASP O 302 GLU O 314 
AG4 4 ARG O 156 ? ILE O 164 ? ARG O 218 ILE O 226 
AG4 5 CYS O 211 ? ASP O 217 ? CYS O 273 ASP O 279 
AG5 1 LEU O 197 ? ASP O 199 ? LEU O 259 ASP O 261 
AG5 2 GLN O 275 ? VAL O 286 ? GLN O 337 VAL O 348 
AG5 3 ASP O 240 ? GLU O 252 ? ASP O 302 GLU O 314 
AG5 4 GLY O 261 ? SER O 263 ? GLY O 323 SER O 325 
AG6 1 PHE O 228 ? GLN O 235 ? PHE O 290 GLN O 297 
AG6 2 GLU O 291 ? PRO O 300 ? GLU O 353 PRO O 362 
AG6 3 LEU O 308 ? LYS O 317 ? LEU O 370 LYS O 379 
AG6 4 GLU O 322 ? MET O 331 ? GLU O 384 MET O 393 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 103 ? O PHE A 165 N GLY A 77  ? N GLY A 139 
AA1 2 3 O PHE A 76  ? O PHE A 138 N VAL A 53  ? N VAL A 115 
AA1 3 4 N LEU A 54  ? N LEU A 116 O ILE A 121 ? O ILE A 183 
AA1 4 5 N ILE A 120 ? N ILE A 182 O PHE A 153 ? O PHE A 215 
AA2 1 2 N LEU A 197 ? N LEU A 259 O VAL A 277 ? O VAL A 339 
AA2 2 3 O PHE A 278 ? O PHE A 340 N LEU A 245 ? N LEU A 307 
AA2 3 4 O TYR A 248 ? O TYR A 310 N TYR A 160 ? N TYR A 222 
AA2 4 5 N LEU A 159 ? N LEU A 221 O ILE A 213 ? O ILE A 275 
AA3 1 2 N LEU A 197 ? N LEU A 259 O VAL A 277 ? O VAL A 339 
AA3 2 3 O PHE A 278 ? O PHE A 340 N LEU A 245 ? N LEU A 307 
AA3 3 4 N ILE A 251 ? N ILE A 313 O PHE A 262 ? O PHE A 324 
AA4 1 2 N PHE A 232 ? N PHE A 294 O GLY A 294 ? O GLY A 356 
AA4 2 3 N TYR A 293 ? N TYR A 355 O ASP A 315 ? O ASP A 377 
AA4 3 4 N PHE A 316 ? N PHE A 378 O THR A 323 ? O THR A 385 
AA5 1 2 O PHE B 103 ? O PHE B 165 N GLY B 77  ? N GLY B 139 
AA5 2 3 O PHE B 76  ? O PHE B 138 N VAL B 53  ? N VAL B 115 
AA5 3 4 N LEU B 54  ? N LEU B 116 O ILE B 121 ? O ILE B 183 
AA5 4 5 N ILE B 120 ? N ILE B 182 O LEU B 151 ? O LEU B 213 
AA6 1 2 N LEU B 197 ? N LEU B 259 O VAL B 277 ? O VAL B 339 
AA6 2 3 O LEU B 284 ? O LEU B 346 N VAL B 242 ? N VAL B 304 
AA6 3 4 O GLU B 252 ? O GLU B 314 N ARG B 156 ? N ARG B 218 
AA6 4 5 N LEU B 159 ? N LEU B 221 O ILE B 213 ? O ILE B 275 
AA7 1 2 N LEU B 197 ? N LEU B 259 O VAL B 277 ? O VAL B 339 
AA7 2 3 O LEU B 284 ? O LEU B 346 N VAL B 242 ? N VAL B 304 
AA7 3 4 N ILE B 251 ? N ILE B 313 O PHE B 262 ? O PHE B 324 
AA8 1 2 N PHE B 232 ? N PHE B 294 O GLY B 294 ? O GLY B 356 
AA8 2 3 N TYR B 293 ? N TYR B 355 O ASP B 315 ? O ASP B 377 
AA8 3 4 N LEU B 314 ? N LEU B 376 O VAL B 325 ? O VAL B 387 
AA9 1 2 O PHE C 103 ? O PHE C 165 N GLY C 77  ? N GLY C 139 
AA9 2 3 O PHE C 76  ? O PHE C 138 N VAL C 53  ? N VAL C 115 
AA9 3 4 N VAL C 56  ? N VAL C 118 O ILE C 121 ? O ILE C 183 
AA9 4 5 N VAL C 117 ? N VAL C 179 O LYS C 147 ? O LYS C 209 
AB1 1 2 N LEU C 197 ? N LEU C 259 O VAL C 277 ? O VAL C 339 
AB1 2 3 O PHE C 278 ? O PHE C 340 N LEU C 245 ? N LEU C 307 
AB1 3 4 O GLU C 252 ? O GLU C 314 N ARG C 156 ? N ARG C 218 
AB1 4 5 N LEU C 159 ? N LEU C 221 O ILE C 213 ? O ILE C 275 
AB2 1 2 N LEU C 197 ? N LEU C 259 O VAL C 277 ? O VAL C 339 
AB2 2 3 O PHE C 278 ? O PHE C 340 N LEU C 245 ? N LEU C 307 
AB2 3 4 N ILE C 251 ? N ILE C 313 O PHE C 262 ? O PHE C 324 
AB3 1 2 N PHE C 232 ? N PHE C 294 O GLY C 294 ? O GLY C 356 
AB3 2 3 N TYR C 293 ? N TYR C 355 O ASP C 315 ? O ASP C 377 
AB3 3 4 N VAL C 312 ? N VAL C 374 O ASN C 327 ? O ASN C 389 
AB4 1 2 O PHE D 103 ? O PHE D 165 N GLY D 77  ? N GLY D 139 
AB4 2 3 O PHE D 76  ? O PHE D 138 N ASP D 55  ? N ASP D 117 
AB4 3 4 N LEU D 54  ? N LEU D 116 O ILE D 121 ? O ILE D 183 
AB4 4 5 N VAL D 117 ? N VAL D 179 O LYS D 147 ? O LYS D 209 
AB5 1 2 N LEU D 197 ? N LEU D 259 O VAL D 277 ? O VAL D 339 
AB5 2 3 O PHE D 278 ? O PHE D 340 N LEU D 245 ? N LEU D 307 
AB5 3 4 O TYR D 248 ? O TYR D 310 N TYR D 160 ? N TYR D 222 
AB5 4 5 N LEU D 159 ? N LEU D 221 O ILE D 213 ? O ILE D 275 
AB6 1 2 N LEU D 197 ? N LEU D 259 O VAL D 277 ? O VAL D 339 
AB6 2 3 O PHE D 278 ? O PHE D 340 N LEU D 245 ? N LEU D 307 
AB6 3 4 N ILE D 251 ? N ILE D 313 O PHE D 262 ? O PHE D 324 
AB7 1 2 N LEU D 234 ? N LEU D 296 O ILE D 292 ? O ILE D 354 
AB7 2 3 N TYR D 293 ? N TYR D 355 O ASP D 315 ? O ASP D 377 
AB7 3 4 N PHE D 310 ? N PHE D 372 O TYR D 329 ? O TYR D 391 
AB8 1 2 O PHE E 103 ? O PHE E 165 N GLY E 77  ? N GLY E 139 
AB8 2 3 O PHE E 76  ? O PHE E 138 N VAL E 53  ? N VAL E 115 
AB8 3 4 N LEU E 54  ? N LEU E 116 O ILE E 121 ? O ILE E 183 
AB8 4 5 N ILE E 120 ? N ILE E 182 O LEU E 151 ? O LEU E 213 
AB9 1 2 N LEU E 197 ? N LEU E 259 O VAL E 277 ? O VAL E 339 
AB9 2 3 O PHE E 278 ? O PHE E 340 N LEU E 245 ? N LEU E 307 
AB9 3 4 O TYR E 248 ? O TYR E 310 N TYR E 160 ? N TYR E 222 
AB9 4 5 N LEU E 159 ? N LEU E 221 O LYS E 214 ? O LYS E 276 
AC1 1 2 N LEU E 197 ? N LEU E 259 O VAL E 277 ? O VAL E 339 
AC1 2 3 O PHE E 278 ? O PHE E 340 N LEU E 245 ? N LEU E 307 
AC1 3 4 N ILE E 251 ? N ILE E 313 O PHE E 262 ? O PHE E 324 
AC2 1 2 N LEU E 234 ? N LEU E 296 O ILE E 292 ? O ILE E 354 
AC2 2 3 N TYR E 293 ? N TYR E 355 O ASP E 315 ? O ASP E 377 
AC2 3 4 N LEU E 308 ? N LEU E 370 O MET E 331 ? O MET E 393 
AC3 1 2 O PHE F 103 ? O PHE F 165 N GLY F 77  ? N GLY F 139 
AC3 2 3 O PHE F 76  ? O PHE F 138 N VAL F 53  ? N VAL F 115 
AC3 3 4 N LEU F 54  ? N LEU F 116 O ILE F 121 ? O ILE F 183 
AC3 4 5 N VAL F 117 ? N VAL F 179 O LYS F 147 ? O LYS F 209 
AC4 1 2 N LEU F 197 ? N LEU F 259 O VAL F 277 ? O VAL F 339 
AC4 2 3 O PHE F 278 ? O PHE F 340 N LEU F 245 ? N LEU F 307 
AC4 3 4 O TYR F 248 ? O TYR F 310 N TYR F 160 ? N TYR F 222 
AC4 4 5 N LEU F 159 ? N LEU F 221 O ILE F 213 ? O ILE F 275 
AC5 1 2 N LEU F 197 ? N LEU F 259 O VAL F 277 ? O VAL F 339 
AC5 2 3 O PHE F 278 ? O PHE F 340 N LEU F 245 ? N LEU F 307 
AC5 3 4 N ILE F 251 ? N ILE F 313 O PHE F 262 ? O PHE F 324 
AC6 1 2 N LEU F 234 ? N LEU F 296 O ILE F 292 ? O ILE F 354 
AC6 2 3 N TYR F 293 ? N TYR F 355 O ASP F 315 ? O ASP F 377 
AC6 3 4 N LEU F 314 ? N LEU F 376 O VAL F 325 ? O VAL F 387 
AC7 1 2 O PHE G 103 ? O PHE G 165 N GLY G 77  ? N GLY G 139 
AC7 2 3 O PHE G 76  ? O PHE G 138 N ASP G 55  ? N ASP G 117 
AC7 3 4 N LEU G 54  ? N LEU G 116 O ILE G 121 ? O ILE G 183 
AC7 4 5 N ILE G 120 ? N ILE G 182 O LEU G 151 ? O LEU G 213 
AC8 1 2 N LEU G 197 ? N LEU G 259 O VAL G 277 ? O VAL G 339 
AC8 2 3 O PHE G 278 ? O PHE G 340 N LEU G 245 ? N LEU G 307 
AC8 3 4 O TYR G 248 ? O TYR G 310 N TYR G 160 ? N TYR G 222 
AC8 4 5 N LEU G 159 ? N LEU G 221 O ILE G 213 ? O ILE G 275 
AC9 1 2 N LEU G 197 ? N LEU G 259 O VAL G 277 ? O VAL G 339 
AC9 2 3 O PHE G 278 ? O PHE G 340 N LEU G 245 ? N LEU G 307 
AC9 3 4 N ILE G 251 ? N ILE G 313 O PHE G 262 ? O PHE G 324 
AD1 1 2 N PHE G 232 ? N PHE G 294 O GLY G 294 ? O GLY G 356 
AD1 2 3 N TYR G 293 ? N TYR G 355 O ASP G 315 ? O ASP G 377 
AD1 3 4 N LEU G 314 ? N LEU G 376 O VAL G 325 ? O VAL G 387 
AD2 1 2 O PHE H 103 ? O PHE H 165 N GLY H 77  ? N GLY H 139 
AD2 2 3 O PHE H 76  ? O PHE H 138 N ASP H 55  ? N ASP H 117 
AD2 3 4 N LEU H 54  ? N LEU H 116 O ILE H 121 ? O ILE H 183 
AD2 4 5 N VAL H 117 ? N VAL H 179 O LYS H 147 ? O LYS H 209 
AD3 1 2 N LEU H 197 ? N LEU H 259 O VAL H 277 ? O VAL H 339 
AD3 2 3 O PHE H 278 ? O PHE H 340 N LEU H 245 ? N LEU H 307 
AD3 3 4 O TYR H 248 ? O TYR H 310 N TYR H 160 ? N TYR H 222 
AD3 4 5 N LEU H 159 ? N LEU H 221 O ILE H 213 ? O ILE H 275 
AD4 1 2 N LEU H 197 ? N LEU H 259 O VAL H 277 ? O VAL H 339 
AD4 2 3 O PHE H 278 ? O PHE H 340 N LEU H 245 ? N LEU H 307 
AD4 3 4 N ILE H 251 ? N ILE H 313 O PHE H 262 ? O PHE H 324 
AD5 1 2 N PHE H 232 ? N PHE H 294 O GLY H 294 ? O GLY H 356 
AD5 2 3 N TYR H 293 ? N TYR H 355 O ASP H 315 ? O ASP H 377 
AD5 3 4 N PHE H 310 ? N PHE H 372 O TYR H 329 ? O TYR H 391 
AD6 1 2 O PHE I 103 ? O PHE I 165 N GLY I 77  ? N GLY I 139 
AD6 2 3 O PHE I 76  ? O PHE I 138 N VAL I 53  ? N VAL I 115 
AD6 3 4 N LEU I 54  ? N LEU I 116 O ILE I 121 ? O ILE I 183 
AD6 4 5 N VAL I 117 ? N VAL I 179 O LYS I 147 ? O LYS I 209 
AD7 1 2 N LEU I 197 ? N LEU I 259 O VAL I 277 ? O VAL I 339 
AD7 2 3 O PHE I 278 ? O PHE I 340 N LEU I 245 ? N LEU I 307 
AD7 3 4 O VAL I 246 ? O VAL I 308 N VAL I 162 ? N VAL I 224 
AD7 4 5 N LEU I 159 ? N LEU I 221 O ILE I 213 ? O ILE I 275 
AD8 1 2 N LEU I 197 ? N LEU I 259 O VAL I 277 ? O VAL I 339 
AD8 2 3 O PHE I 278 ? O PHE I 340 N LEU I 245 ? N LEU I 307 
AD8 3 4 N ILE I 251 ? N ILE I 313 O PHE I 262 ? O PHE I 324 
AD9 1 2 N PHE I 232 ? N PHE I 294 O GLY I 294 ? O GLY I 356 
AD9 2 3 N TYR I 293 ? N TYR I 355 O ASP I 315 ? O ASP I 377 
AD9 3 4 N LEU I 314 ? N LEU I 376 O VAL I 325 ? O VAL I 387 
AE1 1 2 O PHE J 103 ? O PHE J 165 N GLY J 77  ? N GLY J 139 
AE1 2 3 O PHE J 76  ? O PHE J 138 N VAL J 53  ? N VAL J 115 
AE1 3 4 N LEU J 54  ? N LEU J 116 O ILE J 121 ? O ILE J 183 
AE1 4 5 N VAL J 117 ? N VAL J 179 O LYS J 147 ? O LYS J 209 
AE2 1 2 N LEU J 197 ? N LEU J 259 O VAL J 277 ? O VAL J 339 
AE2 2 3 O PHE J 278 ? O PHE J 340 N LEU J 245 ? N LEU J 307 
AE2 3 4 O TYR J 248 ? O TYR J 310 N TYR J 160 ? N TYR J 222 
AE2 4 5 N LEU J 159 ? N LEU J 221 O ILE J 213 ? O ILE J 275 
AE3 1 2 N LEU J 197 ? N LEU J 259 O VAL J 277 ? O VAL J 339 
AE3 2 3 O PHE J 278 ? O PHE J 340 N LEU J 245 ? N LEU J 307 
AE3 3 4 N ILE J 251 ? N ILE J 313 O PHE J 262 ? O PHE J 324 
AE4 1 2 N PHE J 232 ? N PHE J 294 O GLY J 294 ? O GLY J 356 
AE4 2 3 N TYR J 293 ? N TYR J 355 O ASP J 315 ? O ASP J 377 
AE4 3 4 N LEU J 314 ? N LEU J 376 O VAL J 325 ? O VAL J 387 
AE5 1 2 O PHE K 103 ? O PHE K 165 N GLY K 77  ? N GLY K 139 
AE5 2 3 O PHE K 76  ? O PHE K 138 N VAL K 53  ? N VAL K 115 
AE5 3 4 N LEU K 54  ? N LEU K 116 O ILE K 121 ? O ILE K 183 
AE5 4 5 N ILE K 120 ? N ILE K 182 O LEU K 151 ? O LEU K 213 
AE6 1 2 N LEU K 197 ? N LEU K 259 O VAL K 277 ? O VAL K 339 
AE6 2 3 O PHE K 278 ? O PHE K 340 N LEU K 245 ? N LEU K 307 
AE6 3 4 O VAL K 246 ? O VAL K 308 N VAL K 162 ? N VAL K 224 
AE6 4 5 N LEU K 159 ? N LEU K 221 O ILE K 213 ? O ILE K 275 
AE7 1 2 N LEU K 197 ? N LEU K 259 O VAL K 277 ? O VAL K 339 
AE7 2 3 O PHE K 278 ? O PHE K 340 N LEU K 245 ? N LEU K 307 
AE7 3 4 N ILE K 251 ? N ILE K 313 O PHE K 262 ? O PHE K 324 
AE8 1 2 N PHE K 232 ? N PHE K 294 O GLY K 294 ? O GLY K 356 
AE8 2 3 N TYR K 293 ? N TYR K 355 O ASP K 315 ? O ASP K 377 
AE8 3 4 N PHE K 310 ? N PHE K 372 O TYR K 329 ? O TYR K 391 
AE9 1 2 O PHE L 103 ? O PHE L 165 N GLY L 77  ? N GLY L 139 
AE9 2 3 O PHE L 76  ? O PHE L 138 N ASP L 55  ? N ASP L 117 
AE9 3 4 N LEU L 54  ? N LEU L 116 O ILE L 119 ? O ILE L 181 
AE9 4 5 N ILE L 120 ? N ILE L 182 O PHE L 153 ? O PHE L 215 
AF1 1 2 N LEU L 197 ? N LEU L 259 O VAL L 277 ? O VAL L 339 
AF1 2 3 O PHE L 278 ? O PHE L 340 N LEU L 245 ? N LEU L 307 
AF1 3 4 O TYR L 248 ? O TYR L 310 N TYR L 160 ? N TYR L 222 
AF1 4 5 N LEU L 159 ? N LEU L 221 O LYS L 214 ? O LYS L 276 
AF2 1 2 N LEU L 197 ? N LEU L 259 O VAL L 277 ? O VAL L 339 
AF2 2 3 O PHE L 278 ? O PHE L 340 N LEU L 245 ? N LEU L 307 
AF2 3 4 N ILE L 251 ? N ILE L 313 O PHE L 262 ? O PHE L 324 
AF3 1 2 N PHE L 232 ? N PHE L 294 O GLY L 294 ? O GLY L 356 
AF3 2 3 N TYR L 293 ? N TYR L 355 O ASP L 315 ? O ASP L 377 
AF3 3 4 N PHE L 310 ? N PHE L 372 O TYR L 329 ? O TYR L 391 
AF4 1 2 O PHE M 103 ? O PHE M 165 N GLY M 77  ? N GLY M 139 
AF4 2 3 O PHE M 76  ? O PHE M 138 N ASP M 55  ? N ASP M 117 
AF4 3 4 N LEU M 54  ? N LEU M 116 O ILE M 121 ? O ILE M 183 
AF4 4 5 N VAL M 117 ? N VAL M 179 O LYS M 147 ? O LYS M 209 
AF5 1 2 N LEU M 197 ? N LEU M 259 O VAL M 277 ? O VAL M 339 
AF5 2 3 O PHE M 278 ? O PHE M 340 N LEU M 245 ? N LEU M 307 
AF5 3 4 O TYR M 248 ? O TYR M 310 N TYR M 160 ? N TYR M 222 
AF5 4 5 N LEU M 159 ? N LEU M 221 O LYS M 214 ? O LYS M 276 
AF6 1 2 N LEU M 197 ? N LEU M 259 O VAL M 277 ? O VAL M 339 
AF6 2 3 O PHE M 278 ? O PHE M 340 N LEU M 245 ? N LEU M 307 
AF6 3 4 N ILE M 251 ? N ILE M 313 O PHE M 262 ? O PHE M 324 
AF7 1 2 N SER M 230 ? N SER M 292 O ILE M 296 ? O ILE M 358 
AF7 2 3 N TYR M 293 ? N TYR M 355 O ASP M 315 ? O ASP M 377 
AF7 3 4 N PHE M 310 ? N PHE M 372 O TYR M 329 ? O TYR M 391 
AF8 1 2 O PHE N 103 ? O PHE N 165 N GLY N 77  ? N GLY N 139 
AF8 2 3 O PHE N 76  ? O PHE N 138 N VAL N 53  ? N VAL N 115 
AF8 3 4 N LEU N 54  ? N LEU N 116 O ILE N 121 ? O ILE N 183 
AF8 4 5 N ILE N 120 ? N ILE N 182 O LEU N 151 ? O LEU N 213 
AF9 1 2 N LEU N 197 ? N LEU N 259 O VAL N 277 ? O VAL N 339 
AF9 2 3 O PHE N 278 ? O PHE N 340 N LEU N 245 ? N LEU N 307 
AF9 3 4 O TYR N 248 ? O TYR N 310 N TYR N 160 ? N TYR N 222 
AF9 4 5 N LEU N 159 ? N LEU N 221 O ILE N 213 ? O ILE N 275 
AG1 1 2 N LEU N 197 ? N LEU N 259 O VAL N 277 ? O VAL N 339 
AG1 2 3 O PHE N 278 ? O PHE N 340 N LEU N 245 ? N LEU N 307 
AG1 3 4 N ILE N 251 ? N ILE N 313 O PHE N 262 ? O PHE N 324 
AG2 1 2 N PHE N 232 ? N PHE N 294 O GLY N 294 ? O GLY N 356 
AG2 2 3 N TYR N 293 ? N TYR N 355 O ASP N 315 ? O ASP N 377 
AG2 3 4 N LEU N 314 ? N LEU N 376 O VAL N 325 ? O VAL N 387 
AG3 1 2 O PHE O 103 ? O PHE O 165 N GLY O 77  ? N GLY O 139 
AG3 2 3 O PHE O 76  ? O PHE O 138 N VAL O 53  ? N VAL O 115 
AG3 3 4 N LEU O 54  ? N LEU O 116 O ILE O 121 ? O ILE O 183 
AG3 4 5 N VAL O 117 ? N VAL O 179 O LYS O 147 ? O LYS O 209 
AG4 1 2 N LEU O 197 ? N LEU O 259 O VAL O 277 ? O VAL O 339 
AG4 2 3 O PHE O 278 ? O PHE O 340 N LEU O 245 ? N LEU O 307 
AG4 3 4 O TYR O 248 ? O TYR O 310 N TYR O 160 ? N TYR O 222 
AG4 4 5 N LEU O 159 ? N LEU O 221 O ILE O 213 ? O ILE O 275 
AG5 1 2 N LEU O 197 ? N LEU O 259 O VAL O 277 ? O VAL O 339 
AG5 2 3 O PHE O 278 ? O PHE O 340 N LEU O 245 ? N LEU O 307 
AG5 3 4 N ILE O 251 ? N ILE O 313 O PHE O 262 ? O PHE O 324 
AG6 1 2 N LEU O 234 ? N LEU O 296 O ILE O 292 ? O ILE O 354 
AG6 2 3 N TYR O 293 ? N TYR O 355 O ASP O 315 ? O ASP O 377 
AG6 3 4 N LEU O 314 ? N LEU O 376 O VAL O 325 ? O VAL O 387 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SAH 401 ? 18 'binding site for residue SAH A 401' 
AC2 Software B SAH 401 ? 15 'binding site for residue SAH B 401' 
AC3 Software C SAH 401 ? 17 'binding site for residue SAH C 401' 
AC4 Software D SAH 401 ? 18 'binding site for residue SAH D 401' 
AC5 Software E SAH 401 ? 15 'binding site for residue SAH E 401' 
AC6 Software F SAH 401 ? 17 'binding site for residue SAH F 401' 
AC7 Software G SAH 401 ? 17 'binding site for residue SAH G 401' 
AC8 Software H SAH 401 ? 16 'binding site for residue SAH H 401' 
AC9 Software I SAH 401 ? 17 'binding site for residue SAH I 401' 
AD1 Software J SAH 401 ? 16 'binding site for residue SAH J 401' 
AD2 Software K SAH 401 ? 16 'binding site for residue SAH K 401' 
AD3 Software L SAH 401 ? 17 'binding site for residue SAH L 401' 
AD4 Software M SAH 401 ? 17 'binding site for residue SAH M 401' 
AD5 Software N SAH 401 ? 14 'binding site for residue SAH N 401' 
AD6 Software O SAH 401 ? 19 'binding site for residue SAH O 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 18 TYR A 18  ? TYR A 80  . ? 1_555 ? 
2   AC1 18 HIS A 24  ? HIS A 86  . ? 1_555 ? 
3   AC1 18 MET A 27  ? MET A 89  . ? 1_555 ? 
4   AC1 18 ARG A 33  ? ARG A 95  . ? 1_555 ? 
5   AC1 18 GLY A 57  ? GLY A 119 . ? 1_555 ? 
6   AC1 18 SER A 58  ? SER A 120 . ? 1_555 ? 
7   AC1 18 THR A 60  ? THR A 122 . ? 1_555 ? 
8   AC1 18 ILE A 62  ? ILE A 124 . ? 1_555 ? 
9   AC1 18 LEU A 63  ? LEU A 125 . ? 1_555 ? 
10  AC1 18 GLU A 79  ? GLU A 141 . ? 1_555 ? 
11  AC1 18 CYS A 80  ? CYS A 142 . ? 1_555 ? 
12  AC1 18 GLY A 105 ? GLY A 167 . ? 1_555 ? 
13  AC1 18 LYS A 106 ? LYS A 168 . ? 1_555 ? 
14  AC1 18 VAL A 107 ? VAL A 169 . ? 1_555 ? 
15  AC1 18 GLU A 108 ? GLU A 170 . ? 1_555 ? 
16  AC1 18 GLU A 123 ? GLU A 185 . ? 1_555 ? 
17  AC1 18 MET A 134 ? MET A 196 . ? 1_555 ? 
18  AC1 18 THR A 137 ? THR A 199 . ? 1_555 ? 
19  AC2 15 TYR B 18  ? TYR B 80  . ? 1_555 ? 
20  AC2 15 HIS B 24  ? HIS B 86  . ? 1_555 ? 
21  AC2 15 MET B 27  ? MET B 89  . ? 1_555 ? 
22  AC2 15 ARG B 33  ? ARG B 95  . ? 1_555 ? 
23  AC2 15 GLY B 57  ? GLY B 119 . ? 1_555 ? 
24  AC2 15 SER B 58  ? SER B 120 . ? 1_555 ? 
25  AC2 15 ILE B 62  ? ILE B 124 . ? 1_555 ? 
26  AC2 15 LEU B 63  ? LEU B 125 . ? 1_555 ? 
27  AC2 15 GLU B 79  ? GLU B 141 . ? 1_555 ? 
28  AC2 15 CYS B 80  ? CYS B 142 . ? 1_555 ? 
29  AC2 15 VAL B 107 ? VAL B 169 . ? 1_555 ? 
30  AC2 15 GLU B 108 ? GLU B 170 . ? 1_555 ? 
31  AC2 15 GLU B 123 ? GLU B 185 . ? 1_555 ? 
32  AC2 15 MET B 134 ? MET B 196 . ? 1_555 ? 
33  AC2 15 THR B 137 ? THR B 199 . ? 1_555 ? 
34  AC3 17 TYR C 18  ? TYR C 80  . ? 1_555 ? 
35  AC3 17 HIS C 24  ? HIS C 86  . ? 1_555 ? 
36  AC3 17 MET C 27  ? MET C 89  . ? 1_555 ? 
37  AC3 17 ARG C 33  ? ARG C 95  . ? 1_555 ? 
38  AC3 17 GLY C 57  ? GLY C 119 . ? 1_555 ? 
39  AC3 17 SER C 58  ? SER C 120 . ? 1_555 ? 
40  AC3 17 THR C 60  ? THR C 122 . ? 1_555 ? 
41  AC3 17 ILE C 62  ? ILE C 124 . ? 1_555 ? 
42  AC3 17 LEU C 63  ? LEU C 125 . ? 1_555 ? 
43  AC3 17 GLU C 79  ? GLU C 141 . ? 1_555 ? 
44  AC3 17 CYS C 80  ? CYS C 142 . ? 1_555 ? 
45  AC3 17 GLY C 105 ? GLY C 167 . ? 1_555 ? 
46  AC3 17 LYS C 106 ? LYS C 168 . ? 1_555 ? 
47  AC3 17 VAL C 107 ? VAL C 169 . ? 1_555 ? 
48  AC3 17 GLU C 108 ? GLU C 170 . ? 1_555 ? 
49  AC3 17 MET C 134 ? MET C 196 . ? 1_555 ? 
50  AC3 17 THR C 137 ? THR C 199 . ? 1_555 ? 
51  AC4 18 TYR D 18  ? TYR D 80  . ? 1_555 ? 
52  AC4 18 HIS D 24  ? HIS D 86  . ? 1_555 ? 
53  AC4 18 MET D 27  ? MET D 89  . ? 1_555 ? 
54  AC4 18 ARG D 33  ? ARG D 95  . ? 1_555 ? 
55  AC4 18 GLY D 57  ? GLY D 119 . ? 1_555 ? 
56  AC4 18 SER D 58  ? SER D 120 . ? 1_555 ? 
57  AC4 18 THR D 60  ? THR D 122 . ? 1_555 ? 
58  AC4 18 ILE D 62  ? ILE D 124 . ? 1_555 ? 
59  AC4 18 LEU D 63  ? LEU D 125 . ? 1_555 ? 
60  AC4 18 GLU D 79  ? GLU D 141 . ? 1_555 ? 
61  AC4 18 CYS D 80  ? CYS D 142 . ? 1_555 ? 
62  AC4 18 SER D 81  ? SER D 143 . ? 1_555 ? 
63  AC4 18 GLY D 105 ? GLY D 167 . ? 1_555 ? 
64  AC4 18 LYS D 106 ? LYS D 168 . ? 1_555 ? 
65  AC4 18 VAL D 107 ? VAL D 169 . ? 1_555 ? 
66  AC4 18 GLU D 108 ? GLU D 170 . ? 1_555 ? 
67  AC4 18 MET D 134 ? MET D 196 . ? 1_555 ? 
68  AC4 18 THR D 137 ? THR D 199 . ? 1_555 ? 
69  AC5 15 TYR E 18  ? TYR E 80  . ? 1_555 ? 
70  AC5 15 HIS E 24  ? HIS E 86  . ? 1_555 ? 
71  AC5 15 MET E 27  ? MET E 89  . ? 1_555 ? 
72  AC5 15 ARG E 33  ? ARG E 95  . ? 1_555 ? 
73  AC5 15 GLY E 57  ? GLY E 119 . ? 1_555 ? 
74  AC5 15 SER E 58  ? SER E 120 . ? 1_555 ? 
75  AC5 15 THR E 60  ? THR E 122 . ? 1_555 ? 
76  AC5 15 ILE E 62  ? ILE E 124 . ? 1_555 ? 
77  AC5 15 LEU E 63  ? LEU E 125 . ? 1_555 ? 
78  AC5 15 GLU E 79  ? GLU E 141 . ? 1_555 ? 
79  AC5 15 CYS E 80  ? CYS E 142 . ? 1_555 ? 
80  AC5 15 VAL E 107 ? VAL E 169 . ? 1_555 ? 
81  AC5 15 GLU E 108 ? GLU E 170 . ? 1_555 ? 
82  AC5 15 MET E 134 ? MET E 196 . ? 1_555 ? 
83  AC5 15 THR E 137 ? THR E 199 . ? 1_555 ? 
84  AC6 17 TYR F 18  ? TYR F 80  . ? 1_555 ? 
85  AC6 17 HIS F 24  ? HIS F 86  . ? 1_555 ? 
86  AC6 17 MET F 27  ? MET F 89  . ? 1_555 ? 
87  AC6 17 ARG F 33  ? ARG F 95  . ? 1_555 ? 
88  AC6 17 GLY F 57  ? GLY F 119 . ? 1_555 ? 
89  AC6 17 SER F 58  ? SER F 120 . ? 1_555 ? 
90  AC6 17 THR F 60  ? THR F 122 . ? 1_555 ? 
91  AC6 17 ILE F 62  ? ILE F 124 . ? 1_555 ? 
92  AC6 17 LEU F 63  ? LEU F 125 . ? 1_555 ? 
93  AC6 17 GLU F 79  ? GLU F 141 . ? 1_555 ? 
94  AC6 17 CYS F 80  ? CYS F 142 . ? 1_555 ? 
95  AC6 17 GLY F 105 ? GLY F 167 . ? 1_555 ? 
96  AC6 17 VAL F 107 ? VAL F 169 . ? 1_555 ? 
97  AC6 17 GLU F 108 ? GLU F 170 . ? 1_555 ? 
98  AC6 17 GLU F 123 ? GLU F 185 . ? 1_555 ? 
99  AC6 17 MET F 134 ? MET F 196 . ? 1_555 ? 
100 AC6 17 THR F 137 ? THR F 199 . ? 1_555 ? 
101 AC7 17 TYR G 18  ? TYR G 80  . ? 1_555 ? 
102 AC7 17 HIS G 24  ? HIS G 86  . ? 1_555 ? 
103 AC7 17 ARG G 33  ? ARG G 95  . ? 1_555 ? 
104 AC7 17 GLY G 57  ? GLY G 119 . ? 1_555 ? 
105 AC7 17 SER G 58  ? SER G 120 . ? 1_555 ? 
106 AC7 17 THR G 60  ? THR G 122 . ? 1_555 ? 
107 AC7 17 ILE G 62  ? ILE G 124 . ? 1_555 ? 
108 AC7 17 LEU G 63  ? LEU G 125 . ? 1_555 ? 
109 AC7 17 GLU G 79  ? GLU G 141 . ? 1_555 ? 
110 AC7 17 CYS G 80  ? CYS G 142 . ? 1_555 ? 
111 AC7 17 GLY G 105 ? GLY G 167 . ? 1_555 ? 
112 AC7 17 LYS G 106 ? LYS G 168 . ? 1_555 ? 
113 AC7 17 VAL G 107 ? VAL G 169 . ? 1_555 ? 
114 AC7 17 GLU G 108 ? GLU G 170 . ? 1_555 ? 
115 AC7 17 GLU G 123 ? GLU G 185 . ? 1_555 ? 
116 AC7 17 MET G 134 ? MET G 196 . ? 1_555 ? 
117 AC7 17 THR G 137 ? THR G 199 . ? 1_555 ? 
118 AC8 16 TYR H 18  ? TYR H 80  . ? 1_555 ? 
119 AC8 16 MET H 27  ? MET H 89  . ? 1_555 ? 
120 AC8 16 ARG H 33  ? ARG H 95  . ? 1_555 ? 
121 AC8 16 GLY H 57  ? GLY H 119 . ? 1_555 ? 
122 AC8 16 SER H 58  ? SER H 120 . ? 1_555 ? 
123 AC8 16 THR H 60  ? THR H 122 . ? 1_555 ? 
124 AC8 16 ILE H 62  ? ILE H 124 . ? 1_555 ? 
125 AC8 16 LEU H 63  ? LEU H 125 . ? 1_555 ? 
126 AC8 16 GLU H 79  ? GLU H 141 . ? 1_555 ? 
127 AC8 16 CYS H 80  ? CYS H 142 . ? 1_555 ? 
128 AC8 16 GLY H 105 ? GLY H 167 . ? 1_555 ? 
129 AC8 16 LYS H 106 ? LYS H 168 . ? 1_555 ? 
130 AC8 16 VAL H 107 ? VAL H 169 . ? 1_555 ? 
131 AC8 16 GLU H 108 ? GLU H 170 . ? 1_555 ? 
132 AC8 16 MET H 134 ? MET H 196 . ? 1_555 ? 
133 AC8 16 THR H 137 ? THR H 199 . ? 1_555 ? 
134 AC9 17 TYR I 18  ? TYR I 80  . ? 1_555 ? 
135 AC9 17 MET I 27  ? MET I 89  . ? 1_555 ? 
136 AC9 17 ARG I 33  ? ARG I 95  . ? 1_555 ? 
137 AC9 17 GLY I 57  ? GLY I 119 . ? 1_555 ? 
138 AC9 17 SER I 58  ? SER I 120 . ? 1_555 ? 
139 AC9 17 GLY I 59  ? GLY I 121 . ? 1_555 ? 
140 AC9 17 THR I 60  ? THR I 122 . ? 1_555 ? 
141 AC9 17 ILE I 62  ? ILE I 124 . ? 1_555 ? 
142 AC9 17 LEU I 63  ? LEU I 125 . ? 1_555 ? 
143 AC9 17 GLU I 79  ? GLU I 141 . ? 1_555 ? 
144 AC9 17 CYS I 80  ? CYS I 142 . ? 1_555 ? 
145 AC9 17 GLY I 105 ? GLY I 167 . ? 1_555 ? 
146 AC9 17 LYS I 106 ? LYS I 168 . ? 1_555 ? 
147 AC9 17 VAL I 107 ? VAL I 169 . ? 1_555 ? 
148 AC9 17 GLU I 108 ? GLU I 170 . ? 1_555 ? 
149 AC9 17 MET I 134 ? MET I 196 . ? 1_555 ? 
150 AC9 17 THR I 137 ? THR I 199 . ? 1_555 ? 
151 AD1 16 TYR J 18  ? TYR J 80  . ? 1_555 ? 
152 AD1 16 MET J 27  ? MET J 89  . ? 1_555 ? 
153 AD1 16 ARG J 33  ? ARG J 95  . ? 1_555 ? 
154 AD1 16 GLY J 57  ? GLY J 119 . ? 1_555 ? 
155 AD1 16 SER J 58  ? SER J 120 . ? 1_555 ? 
156 AD1 16 THR J 60  ? THR J 122 . ? 1_555 ? 
157 AD1 16 ILE J 62  ? ILE J 124 . ? 1_555 ? 
158 AD1 16 LEU J 63  ? LEU J 125 . ? 1_555 ? 
159 AD1 16 GLU J 79  ? GLU J 141 . ? 1_555 ? 
160 AD1 16 CYS J 80  ? CYS J 142 . ? 1_555 ? 
161 AD1 16 GLY J 105 ? GLY J 167 . ? 1_555 ? 
162 AD1 16 LYS J 106 ? LYS J 168 . ? 1_555 ? 
163 AD1 16 VAL J 107 ? VAL J 169 . ? 1_555 ? 
164 AD1 16 GLU J 108 ? GLU J 170 . ? 1_555 ? 
165 AD1 16 MET J 134 ? MET J 196 . ? 1_555 ? 
166 AD1 16 THR J 137 ? THR J 199 . ? 1_555 ? 
167 AD2 16 TYR K 18  ? TYR K 80  . ? 1_555 ? 
168 AD2 16 HIS K 24  ? HIS K 86  . ? 1_555 ? 
169 AD2 16 ARG K 33  ? ARG K 95  . ? 1_555 ? 
170 AD2 16 GLY K 57  ? GLY K 119 . ? 1_555 ? 
171 AD2 16 SER K 58  ? SER K 120 . ? 1_555 ? 
172 AD2 16 THR K 60  ? THR K 122 . ? 1_555 ? 
173 AD2 16 ILE K 62  ? ILE K 124 . ? 1_555 ? 
174 AD2 16 LEU K 63  ? LEU K 125 . ? 1_555 ? 
175 AD2 16 GLU K 79  ? GLU K 141 . ? 1_555 ? 
176 AD2 16 CYS K 80  ? CYS K 142 . ? 1_555 ? 
177 AD2 16 GLY K 105 ? GLY K 167 . ? 1_555 ? 
178 AD2 16 LYS K 106 ? LYS K 168 . ? 1_555 ? 
179 AD2 16 VAL K 107 ? VAL K 169 . ? 1_555 ? 
180 AD2 16 GLU K 108 ? GLU K 170 . ? 1_555 ? 
181 AD2 16 MET K 134 ? MET K 196 . ? 1_555 ? 
182 AD2 16 THR K 137 ? THR K 199 . ? 1_555 ? 
183 AD3 17 TYR L 18  ? TYR L 80  . ? 1_555 ? 
184 AD3 17 HIS L 24  ? HIS L 86  . ? 1_555 ? 
185 AD3 17 MET L 27  ? MET L 89  . ? 1_555 ? 
186 AD3 17 ARG L 33  ? ARG L 95  . ? 1_555 ? 
187 AD3 17 GLY L 57  ? GLY L 119 . ? 1_555 ? 
188 AD3 17 SER L 58  ? SER L 120 . ? 1_555 ? 
189 AD3 17 THR L 60  ? THR L 122 . ? 1_555 ? 
190 AD3 17 ILE L 62  ? ILE L 124 . ? 1_555 ? 
191 AD3 17 LEU L 63  ? LEU L 125 . ? 1_555 ? 
192 AD3 17 GLU L 79  ? GLU L 141 . ? 1_555 ? 
193 AD3 17 CYS L 80  ? CYS L 142 . ? 1_555 ? 
194 AD3 17 GLY L 105 ? GLY L 167 . ? 1_555 ? 
195 AD3 17 VAL L 107 ? VAL L 169 . ? 1_555 ? 
196 AD3 17 GLU L 108 ? GLU L 170 . ? 1_555 ? 
197 AD3 17 GLU L 123 ? GLU L 185 . ? 1_555 ? 
198 AD3 17 MET L 134 ? MET L 196 . ? 1_555 ? 
199 AD3 17 THR L 137 ? THR L 199 . ? 1_555 ? 
200 AD4 17 TYR M 18  ? TYR M 80  . ? 1_555 ? 
201 AD4 17 HIS M 24  ? HIS M 86  . ? 1_555 ? 
202 AD4 17 MET M 27  ? MET M 89  . ? 1_555 ? 
203 AD4 17 ARG M 33  ? ARG M 95  . ? 1_555 ? 
204 AD4 17 GLY M 57  ? GLY M 119 . ? 1_555 ? 
205 AD4 17 SER M 58  ? SER M 120 . ? 1_555 ? 
206 AD4 17 THR M 60  ? THR M 122 . ? 1_555 ? 
207 AD4 17 ILE M 62  ? ILE M 124 . ? 1_555 ? 
208 AD4 17 LEU M 63  ? LEU M 125 . ? 1_555 ? 
209 AD4 17 GLU M 79  ? GLU M 141 . ? 1_555 ? 
210 AD4 17 CYS M 80  ? CYS M 142 . ? 1_555 ? 
211 AD4 17 SER M 81  ? SER M 143 . ? 1_555 ? 
212 AD4 17 VAL M 107 ? VAL M 169 . ? 1_555 ? 
213 AD4 17 GLU M 108 ? GLU M 170 . ? 1_555 ? 
214 AD4 17 GLU M 123 ? GLU M 185 . ? 1_555 ? 
215 AD4 17 MET M 134 ? MET M 196 . ? 1_555 ? 
216 AD4 17 THR M 137 ? THR M 199 . ? 1_555 ? 
217 AD5 14 TYR N 18  ? TYR N 80  . ? 1_555 ? 
218 AD5 14 HIS N 24  ? HIS N 86  . ? 1_555 ? 
219 AD5 14 ARG N 33  ? ARG N 95  . ? 1_555 ? 
220 AD5 14 GLY N 57  ? GLY N 119 . ? 1_555 ? 
221 AD5 14 SER N 58  ? SER N 120 . ? 1_555 ? 
222 AD5 14 THR N 60  ? THR N 122 . ? 1_555 ? 
223 AD5 14 LEU N 63  ? LEU N 125 . ? 1_555 ? 
224 AD5 14 GLU N 79  ? GLU N 141 . ? 1_555 ? 
225 AD5 14 CYS N 80  ? CYS N 142 . ? 1_555 ? 
226 AD5 14 GLY N 105 ? GLY N 167 . ? 1_555 ? 
227 AD5 14 VAL N 107 ? VAL N 169 . ? 1_555 ? 
228 AD5 14 GLU N 108 ? GLU N 170 . ? 1_555 ? 
229 AD5 14 MET N 134 ? MET N 196 . ? 1_555 ? 
230 AD5 14 THR N 137 ? THR N 199 . ? 1_555 ? 
231 AD6 19 TYR O 18  ? TYR O 80  . ? 1_555 ? 
232 AD6 19 HIS O 24  ? HIS O 86  . ? 1_555 ? 
233 AD6 19 MET O 27  ? MET O 89  . ? 1_555 ? 
234 AD6 19 ARG O 33  ? ARG O 95  . ? 1_555 ? 
235 AD6 19 GLY O 57  ? GLY O 119 . ? 1_555 ? 
236 AD6 19 SER O 58  ? SER O 120 . ? 1_555 ? 
237 AD6 19 GLY O 59  ? GLY O 121 . ? 1_555 ? 
238 AD6 19 THR O 60  ? THR O 122 . ? 1_555 ? 
239 AD6 19 ILE O 62  ? ILE O 124 . ? 1_555 ? 
240 AD6 19 LEU O 63  ? LEU O 125 . ? 1_555 ? 
241 AD6 19 GLU O 79  ? GLU O 141 . ? 1_555 ? 
242 AD6 19 CYS O 80  ? CYS O 142 . ? 1_555 ? 
243 AD6 19 GLY O 105 ? GLY O 167 . ? 1_555 ? 
244 AD6 19 LYS O 106 ? LYS O 168 . ? 1_555 ? 
245 AD6 19 VAL O 107 ? VAL O 169 . ? 1_555 ? 
246 AD6 19 GLU O 108 ? GLU O 170 . ? 1_555 ? 
247 AD6 19 GLU O 123 ? GLU O 185 . ? 1_555 ? 
248 AD6 19 MET O 134 ? MET O 196 . ? 1_555 ? 
249 AD6 19 THR O 137 ? THR O 199 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5DST 
_atom_sites.fract_transf_matrix[1][1]   0.005000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001480 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007637 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003543 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . SER A  1 17  ? -25.190 21.318  16.972  1.00 29.44  ? 79  SER A N     1 
ATOM   2     C CA    . SER A  1 17  ? -24.384 20.021  16.922  1.00 31.15  ? 79  SER A CA    1 
ATOM   3     C C     . SER A  1 17  ? -23.421 19.846  15.713  1.00 32.40  ? 79  SER A C     1 
ATOM   4     O O     . SER A  1 17  ? -22.386 19.188  15.808  1.00 31.64  ? 79  SER A O     1 
ATOM   5     C CB    . SER A  1 17  ? -25.306 18.784  16.962  1.00 30.25  ? 79  SER A CB    1 
ATOM   6     O OG    . SER A  1 17  ? -25.506 18.248  15.662  1.00 27.42  ? 79  SER A OG    1 
ATOM   7     N N     . TYR A  1 18  ? -23.806 20.383  14.563  1.00 33.26  ? 80  TYR A N     1 
ATOM   8     C CA    . TYR A  1 18  ? -22.878 20.562  13.460  1.00 33.59  ? 80  TYR A CA    1 
ATOM   9     C C     . TYR A  1 18  ? -21.927 21.736  13.748  1.00 35.33  ? 80  TYR A C     1 
ATOM   10    O O     . TYR A  1 18  ? -21.069 22.037  12.947  1.00 40.43  ? 80  TYR A O     1 
ATOM   11    C CB    . TYR A  1 18  ? -23.629 20.798  12.130  1.00 33.56  ? 80  TYR A CB    1 
ATOM   12    C CG    . TYR A  1 18  ? -24.060 19.535  11.384  1.00 32.11  ? 80  TYR A CG    1 
ATOM   13    C CD1   . TYR A  1 18  ? -23.146 18.782  10.669  1.00 31.41  ? 80  TYR A CD1   1 
ATOM   14    C CD2   . TYR A  1 18  ? -25.384 19.125  11.378  1.00 31.20  ? 80  TYR A CD2   1 
ATOM   15    C CE1   . TYR A  1 18  ? -23.535 17.658  9.984   1.00 31.34  ? 80  TYR A CE1   1 
ATOM   16    C CE2   . TYR A  1 18  ? -25.780 17.991  10.706  1.00 31.59  ? 80  TYR A CE2   1 
ATOM   17    C CZ    . TYR A  1 18  ? -24.851 17.265  10.011  1.00 31.96  ? 80  TYR A CZ    1 
ATOM   18    O OH    . TYR A  1 18  ? -25.251 16.135  9.338   1.00 34.53  ? 80  TYR A OH    1 
ATOM   19    N N     . ALA A  1 19  ? -22.065 22.403  14.884  1.00 36.46  ? 81  ALA A N     1 
ATOM   20    C CA    . ALA A  1 19  ? -21.147 23.481  15.238  1.00 36.04  ? 81  ALA A CA    1 
ATOM   21    C C     . ALA A  1 19  ? -19.750 22.951  15.543  1.00 36.70  ? 81  ALA A C     1 
ATOM   22    O O     . ALA A  1 19  ? -18.768 23.691  15.496  1.00 42.08  ? 81  ALA A O     1 
ATOM   23    C CB    . ALA A  1 19  ? -21.678 24.231  16.443  1.00 35.49  ? 81  ALA A CB    1 
ATOM   24    N N     . HIS A  1 20  ? -19.656 21.669  15.853  1.00 34.56  ? 82  HIS A N     1 
ATOM   25    C CA    . HIS A  1 20  ? -18.434 21.124  16.348  1.00 35.26  ? 82  HIS A CA    1 
ATOM   26    C C     . HIS A  1 20  ? -17.408 20.867  15.224  1.00 34.11  ? 82  HIS A C     1 
ATOM   27    O O     . HIS A  1 20  ? -17.702 20.133  14.279  1.00 35.65  ? 82  HIS A O     1 
ATOM   28    C CB    . HIS A  1 20  ? -18.769 19.835  17.096  1.00 37.17  ? 82  HIS A CB    1 
ATOM   29    C CG    . HIS A  1 20  ? -17.619 19.280  17.859  1.00 40.01  ? 82  HIS A CG    1 
ATOM   30    N ND1   . HIS A  1 20  ? -16.884 20.052  18.733  1.00 40.72  ? 82  HIS A ND1   1 
ATOM   31    C CD2   . HIS A  1 20  ? -17.059 18.050  17.875  1.00 40.99  ? 82  HIS A CD2   1 
ATOM   32    C CE1   . HIS A  1 20  ? -15.922 19.323  19.256  1.00 41.81  ? 82  HIS A CE1   1 
ATOM   33    N NE2   . HIS A  1 20  ? -16.009 18.103  18.759  1.00 44.03  ? 82  HIS A NE2   1 
ATOM   34    N N     A PHE A  1 21  ? -16.196 21.415  15.342  0.50 28.94  ? 83  PHE A N     1 
ATOM   35    C CA    A PHE A  1 21  ? -15.206 21.220  14.295  0.50 25.93  ? 83  PHE A CA    1 
ATOM   36    C C     A PHE A  1 21  ? -15.135 19.756  13.873  0.50 26.82  ? 83  PHE A C     1 
ATOM   37    O O     A PHE A  1 21  ? -14.882 19.433  12.724  0.50 25.72  ? 83  PHE A O     1 
ATOM   38    C CB    A PHE A  1 21  ? -13.842 21.693  14.763  0.50 23.62  ? 83  PHE A CB    1 
ATOM   39    C CG    A PHE A  1 21  ? -13.258 20.867  15.853  0.50 21.80  ? 83  PHE A CG    1 
ATOM   40    C CD1   A PHE A  1 21  ? -12.676 19.651  15.568  0.50 21.01  ? 83  PHE A CD1   1 
ATOM   41    C CD2   A PHE A  1 21  ? -13.253 21.315  17.152  0.50 20.79  ? 83  PHE A CD2   1 
ATOM   42    C CE1   A PHE A  1 21  ? -12.121 18.878  16.563  0.50 20.30  ? 83  PHE A CE1   1 
ATOM   43    C CE2   A PHE A  1 21  ? -12.695 20.549  18.155  0.50 20.31  ? 83  PHE A CE2   1 
ATOM   44    C CZ    A PHE A  1 21  ? -12.128 19.327  17.860  0.50 20.05  ? 83  PHE A CZ    1 
ATOM   45    N N     . GLY A  1 22  ? -15.402 18.867  14.808  1.00 29.13  ? 84  GLY A N     1 
ATOM   46    C CA    . GLY A  1 22  ? -15.088 17.461  14.639  1.00 32.63  ? 84  GLY A CA    1 
ATOM   47    C C     . GLY A  1 22  ? -15.959 16.607  13.746  1.00 34.16  ? 84  GLY A C     1 
ATOM   48    O O     . GLY A  1 22  ? -15.471 15.644  13.163  1.00 36.29  ? 84  GLY A O     1 
ATOM   49    N N     . ILE A  1 23  ? -17.247 16.897  13.657  1.00 35.49  ? 85  ILE A N     1 
ATOM   50    C CA    . ILE A  1 23  ? -18.095 16.158  12.709  1.00 36.18  ? 85  ILE A CA    1 
ATOM   51    C C     . ILE A  1 23  ? -17.693 16.507  11.259  1.00 35.35  ? 85  ILE A C     1 
ATOM   52    O O     . ILE A  1 23  ? -17.719 15.657  10.369  1.00 34.65  ? 85  ILE A O     1 
ATOM   53    C CB    . ILE A  1 23  ? -19.598 16.412  12.990  1.00 37.79  ? 85  ILE A CB    1 
ATOM   54    C CG1   . ILE A  1 23  ? -20.478 15.228  12.539  1.00 39.35  ? 85  ILE A CG1   1 
ATOM   55    C CG2   . ILE A  1 23  ? -20.052 17.739  12.406  1.00 37.17  ? 85  ILE A CG2   1 
ATOM   56    C CD1   . ILE A  1 23  ? -20.299 14.732  11.111  1.00 39.82  ? 85  ILE A CD1   1 
ATOM   57    N N     . HIS A  1 24  ? -17.266 17.746  11.042  1.00 35.24  ? 86  HIS A N     1 
ATOM   58    C CA    . HIS A  1 24  ? -16.745 18.168  9.743   1.00 35.52  ? 86  HIS A CA    1 
ATOM   59    C C     . HIS A  1 24  ? -15.409 17.484  9.428   1.00 35.23  ? 86  HIS A C     1 
ATOM   60    O O     . HIS A  1 24  ? -15.172 17.053  8.295   1.00 32.92  ? 86  HIS A O     1 
ATOM   61    C CB    . HIS A  1 24  ? -16.604 19.702  9.691   1.00 36.05  ? 86  HIS A CB    1 
ATOM   62    C CG    . HIS A  1 24  ? -17.918 20.415  9.636   1.00 36.71  ? 86  HIS A CG    1 
ATOM   63    N ND1   . HIS A  1 24  ? -18.616 20.782  10.767  1.00 37.16  ? 86  HIS A ND1   1 
ATOM   64    C CD2   . HIS A  1 24  ? -18.691 20.777  8.588   1.00 38.32  ? 86  HIS A CD2   1 
ATOM   65    C CE1   . HIS A  1 24  ? -19.755 21.350  10.421  1.00 36.07  ? 86  HIS A CE1   1 
ATOM   66    N NE2   . HIS A  1 24  ? -19.828 21.357  9.105   1.00 38.82  ? 86  HIS A NE2   1 
ATOM   67    N N     . GLU A  1 25  ? -14.549 17.388  10.440  1.00 35.33  ? 87  GLU A N     1 
ATOM   68    C CA    . GLU A  1 25  ? -13.293 16.656  10.311  1.00 36.27  ? 87  GLU A CA    1 
ATOM   69    C C     . GLU A  1 25  ? -13.558 15.306  9.684   1.00 35.13  ? 87  GLU A C     1 
ATOM   70    O O     . GLU A  1 25  ? -12.845 14.918  8.770   1.00 38.56  ? 87  GLU A O     1 
ATOM   71    C CB    . GLU A  1 25  ? -12.602 16.459  11.676  1.00 37.76  ? 87  GLU A CB    1 
ATOM   72    C CG    . GLU A  1 25  ? -11.212 15.824  11.626  1.00 36.81  ? 87  GLU A CG    1 
ATOM   73    C CD    . GLU A  1 25  ? -10.514 15.800  12.978  1.00 37.00  ? 87  GLU A CD    1 
ATOM   74    O OE1   . GLU A  1 25  ? -10.827 16.599  13.878  1.00 37.28  ? 87  GLU A OE1   1 
ATOM   75    O OE2   . GLU A  1 25  ? -9.614  14.971  13.147  1.00 39.30  ? 87  GLU A OE2   1 
ATOM   76    N N     . GLU A  1 26  ? -14.571 14.588  10.170  1.00 32.69  ? 88  GLU A N     1 
ATOM   77    C CA    . GLU A  1 26  ? -14.879 13.252  9.626   1.00 31.94  ? 88  GLU A CA    1 
ATOM   78    C C     . GLU A  1 26  ? -15.292 13.264  8.142   1.00 30.36  ? 88  GLU A C     1 
ATOM   79    O O     . GLU A  1 26  ? -14.844 12.427  7.343   1.00 26.81  ? 88  GLU A O     1 
ATOM   80    C CB    . GLU A  1 26  ? -15.970 12.557  10.440  1.00 31.06  ? 88  GLU A CB    1 
ATOM   81    C CG    . GLU A  1 26  ? -16.024 11.074  10.129  1.00 30.56  ? 88  GLU A CG    1 
ATOM   82    C CD    . GLU A  1 26  ? -17.214 10.396  10.720  1.00 30.85  ? 88  GLU A CD    1 
ATOM   83    O OE1   . GLU A  1 26  ? -17.449 9.255   10.309  1.00 32.27  ? 88  GLU A OE1   1 
ATOM   84    O OE2   . GLU A  1 26  ? -17.914 10.989  11.562  1.00 30.96  ? 88  GLU A OE2   1 
ATOM   85    N N     . MET A  1 27  ? -16.160 14.212  7.810   1.00 30.20  ? 89  MET A N     1 
ATOM   86    C CA    . MET A  1 27  ? -16.674 14.348  6.468   1.00 30.26  ? 89  MET A CA    1 
ATOM   87    C C     . MET A  1 27  ? -15.565 14.690  5.503   1.00 28.31  ? 89  MET A C     1 
ATOM   88    O O     . MET A  1 27  ? -15.482 14.140  4.404   1.00 26.36  ? 89  MET A O     1 
ATOM   89    C CB    . MET A  1 27  ? -17.692 15.465  6.444   1.00 34.17  ? 89  MET A CB    1 
ATOM   90    C CG    . MET A  1 27  ? -18.997 15.110  7.108   1.00 38.05  ? 89  MET A CG    1 
ATOM   91    S SD    . MET A  1 27  ? -20.180 16.478  7.149   1.00 43.10  ? 89  MET A SD    1 
ATOM   92    C CE    . MET A  1 27  ? -21.675 15.459  7.013   1.00 44.95  ? 89  MET A CE    1 
ATOM   93    N N     . LEU A  1 28  ? -14.720 15.621  5.932   1.00 26.89  ? 90  LEU A N     1 
ATOM   94    C CA    . LEU A  1 28  ? -13.631 16.118  5.108   1.00 25.90  ? 90  LEU A CA    1 
ATOM   95    C C     . LEU A  1 28  ? -12.571 15.048  4.873   1.00 24.60  ? 90  LEU A C     1 
ATOM   96    O O     . LEU A  1 28  ? -12.040 14.919  3.788   1.00 23.81  ? 90  LEU A O     1 
ATOM   97    C CB    . LEU A  1 28  ? -13.007 17.350  5.763   1.00 26.22  ? 90  LEU A CB    1 
ATOM   98    C CG    . LEU A  1 28  ? -13.880 18.609  5.719   1.00 26.70  ? 90  LEU A CG    1 
ATOM   99    C CD1   . LEU A  1 28  ? -13.481 19.602  6.808   1.00 26.65  ? 90  LEU A CD1   1 
ATOM   100   C CD2   . LEU A  1 28  ? -13.821 19.259  4.331   1.00 26.17  ? 90  LEU A CD2   1 
ATOM   101   N N     . LYS A  1 29  ? -12.271 14.270  5.893   1.00 24.64  ? 91  LYS A N     1 
ATOM   102   C CA    . LYS A  1 29  ? -11.259 13.241  5.764   1.00 25.33  ? 91  LYS A CA    1 
ATOM   103   C C     . LYS A  1 29  ? -11.759 12.061  4.944   1.00 25.89  ? 91  LYS A C     1 
ATOM   104   O O     . LYS A  1 29  ? -10.958 11.243  4.517   1.00 25.86  ? 91  LYS A O     1 
ATOM   105   C CB    . LYS A  1 29  ? -10.783 12.784  7.150   1.00 25.85  ? 91  LYS A CB    1 
ATOM   106   C CG    . LYS A  1 29  ? -9.860  13.772  7.873   1.00 25.25  ? 91  LYS A CG    1 
ATOM   107   C CD    . LYS A  1 29  ? -9.346  13.222  9.195   1.00 24.30  ? 91  LYS A CD    1 
ATOM   108   C CE    . LYS A  1 29  ? -8.211  14.062  9.718   1.00 24.16  ? 91  LYS A CE    1 
ATOM   109   N NZ    . LYS A  1 29  ? -8.035  13.804  11.165  1.00 24.70  ? 91  LYS A NZ    1 
ATOM   110   N N     . ASP A  1 30  ? -13.074 11.964  4.737   1.00 26.96  ? 92  ASP A N     1 
ATOM   111   C CA    . ASP A  1 30  ? -13.620 11.025  3.758   1.00 27.59  ? 92  ASP A CA    1 
ATOM   112   C C     . ASP A  1 30  ? -13.224 11.515  2.378   1.00 28.03  ? 92  ASP A C     1 
ATOM   113   O O     . ASP A  1 30  ? -13.875 12.396  1.801   1.00 27.05  ? 92  ASP A O     1 
ATOM   114   C CB    . ASP A  1 30  ? -15.145 10.925  3.853   1.00 27.96  ? 92  ASP A CB    1 
ATOM   115   C CG    . ASP A  1 30  ? -15.741 9.854   2.904   1.00 28.61  ? 92  ASP A CG    1 
ATOM   116   O OD1   . ASP A  1 30  ? -14.991 9.322   2.028   1.00 29.94  ? 92  ASP A OD1   1 
ATOM   117   O OD2   . ASP A  1 30  ? -16.962 9.548   3.051   1.00 26.26  ? 92  ASP A OD2   1 
ATOM   118   N N     . GLU A  1 31  ? -12.149 10.934  1.857   1.00 28.61  ? 93  GLU A N     1 
ATOM   119   C CA    . GLU A  1 31  ? -11.608 11.334  0.556   1.00 29.17  ? 93  GLU A CA    1 
ATOM   120   C C     . GLU A  1 31  ? -12.527 10.971  -0.615  1.00 27.59  ? 93  GLU A C     1 
ATOM   121   O O     . GLU A  1 31  ? -12.679 11.742  -1.543  1.00 26.26  ? 93  GLU A O     1 
ATOM   122   C CB    . GLU A  1 31  ? -10.197 10.752  0.357   1.00 30.68  ? 93  GLU A CB    1 
ATOM   123   C CG    . GLU A  1 31  ? -9.178  11.306  1.348   1.00 31.64  ? 93  GLU A CG    1 
ATOM   124   C CD    . GLU A  1 31  ? -7.782  10.823  1.088   1.00 31.40  ? 93  GLU A CD    1 
ATOM   125   O OE1   . GLU A  1 31  ? -6.955  10.919  2.005   1.00 31.59  ? 93  GLU A OE1   1 
ATOM   126   O OE2   . GLU A  1 31  ? -7.507  10.374  -0.037  1.00 32.79  ? 93  GLU A OE2   1 
ATOM   127   N N     . VAL A  1 32  ? -13.163 9.811   -0.554  1.00 27.21  ? 94  VAL A N     1 
ATOM   128   C CA    . VAL A  1 32  ? -14.071 9.411   -1.612  1.00 26.69  ? 94  VAL A CA    1 
ATOM   129   C C     . VAL A  1 32  ? -15.119 10.501  -1.810  1.00 25.66  ? 94  VAL A C     1 
ATOM   130   O O     . VAL A  1 32  ? -15.336 10.975  -2.911  1.00 24.88  ? 94  VAL A O     1 
ATOM   131   C CB    . VAL A  1 32  ? -14.773 8.091   -1.271  1.00 27.88  ? 94  VAL A CB    1 
ATOM   132   C CG1   . VAL A  1 32  ? -15.875 7.798   -2.283  1.00 28.25  ? 94  VAL A CG1   1 
ATOM   133   C CG2   . VAL A  1 32  ? -13.764 6.952   -1.225  1.00 28.27  ? 94  VAL A CG2   1 
ATOM   134   N N     . ARG A  1 33  ? -15.757 10.895  -0.722  1.00 24.79  ? 95  ARG A N     1 
ATOM   135   C CA    . ARG A  1 33  ? -16.810 11.889  -0.772  1.00 24.87  ? 95  ARG A CA    1 
ATOM   136   C C     . ARG A  1 33  ? -16.306 13.225  -1.301  1.00 23.88  ? 95  ARG A C     1 
ATOM   137   O O     . ARG A  1 33  ? -16.738 13.703  -2.346  1.00 23.65  ? 95  ARG A O     1 
ATOM   138   C CB    . ARG A  1 33  ? -17.363 12.084  0.640   1.00 25.72  ? 95  ARG A CB    1 
ATOM   139   C CG    . ARG A  1 33  ? -18.510 13.065  0.760   1.00 25.52  ? 95  ARG A CG    1 
ATOM   140   C CD    . ARG A  1 33  ? -18.665 13.449  2.204   1.00 25.91  ? 95  ARG A CD    1 
ATOM   141   N NE    . ARG A  1 33  ? -17.727 14.518  2.470   1.00 27.59  ? 95  ARG A NE    1 
ATOM   142   C CZ    . ARG A  1 33  ? -18.066 15.780  2.717   1.00 28.67  ? 95  ARG A CZ    1 
ATOM   143   N NH1   . ARG A  1 33  ? -19.344 16.122  2.786   1.00 27.56  ? 95  ARG A NH1   1 
ATOM   144   N NH2   . ARG A  1 33  ? -17.113 16.702  2.937   1.00 28.96  ? 95  ARG A NH2   1 
ATOM   145   N N     . THR A  1 34  ? -15.379 13.812  -0.561  1.00 23.33  ? 96  THR A N     1 
ATOM   146   C CA    . THR A  1 34  ? -14.936 15.181  -0.799  1.00 23.14  ? 96  THR A CA    1 
ATOM   147   C C     . THR A  1 34  ? -14.259 15.317  -2.156  1.00 22.04  ? 96  THR A C     1 
ATOM   148   O O     . THR A  1 34  ? -14.535 16.257  -2.896  1.00 20.34  ? 96  THR A O     1 
ATOM   149   C CB    . THR A  1 34  ? -13.946 15.646  0.307   1.00 23.73  ? 96  THR A CB    1 
ATOM   150   O OG1   . THR A  1 34  ? -14.477 15.330  1.599   1.00 24.50  ? 96  THR A OG1   1 
ATOM   151   C CG2   . THR A  1 34  ? -13.702 17.141  0.221   1.00 23.64  ? 96  THR A CG2   1 
ATOM   152   N N     . LEU A  1 35  ? -13.352 14.382  -2.463  1.00 22.39  ? 97  LEU A N     1 
ATOM   153   C CA    . LEU A  1 35  ? -12.611 14.395  -3.745  1.00 21.79  ? 97  LEU A CA    1 
ATOM   154   C C     . LEU A  1 35  ? -13.533 14.204  -4.926  1.00 21.82  ? 97  LEU A C     1 
ATOM   155   O O     . LEU A  1 35  ? -13.281 14.781  -5.974  1.00 20.90  ? 97  LEU A O     1 
ATOM   156   C CB    . LEU A  1 35  ? -11.503 13.337  -3.811  1.00 20.73  ? 97  LEU A CB    1 
ATOM   157   C CG    . LEU A  1 35  ? -10.182 13.652  -3.120  1.00 19.73  ? 97  LEU A CG    1 
ATOM   158   C CD1   . LEU A  1 35  ? -9.243  12.490  -3.418  1.00 19.77  ? 97  LEU A CD1   1 
ATOM   159   C CD2   . LEU A  1 35  ? -9.612  14.963  -3.635  1.00 19.02  ? 97  LEU A CD2   1 
ATOM   160   N N     . THR A  1 36  ? -14.588 13.397  -4.760  1.00 22.49  ? 98  THR A N     1 
ATOM   161   C CA    . THR A  1 36  ? -15.579 13.267  -5.814  1.00 22.96  ? 98  THR A CA    1 
ATOM   162   C C     . THR A  1 36  ? -16.190 14.642  -6.018  1.00 23.51  ? 98  THR A C     1 
ATOM   163   O O     . THR A  1 36  ? -16.166 15.163  -7.141  1.00 22.31  ? 98  THR A O     1 
ATOM   164   C CB    . THR A  1 36  ? -16.642 12.188  -5.545  1.00 22.85  ? 98  THR A CB    1 
ATOM   165   O OG1   . THR A  1 36  ? -16.016 10.910  -5.502  1.00 22.91  ? 98  THR A OG1   1 
ATOM   166   C CG2   . THR A  1 36  ? -17.664 12.143  -6.674  1.00 23.11  ? 98  THR A CG2   1 
ATOM   167   N N     . TYR A  1 37  ? -16.689 15.250  -4.940  1.00 24.71  ? 99  TYR A N     1 
ATOM   168   C CA    . TYR A  1 37  ? -17.250 16.611  -5.053  1.00 25.93  ? 99  TYR A CA    1 
ATOM   169   C C     . TYR A  1 37  ? -16.288 17.585  -5.703  1.00 24.57  ? 99  TYR A C     1 
ATOM   170   O O     . TYR A  1 37  ? -16.702 18.387  -6.515  1.00 24.05  ? 99  TYR A O     1 
ATOM   171   C CB    . TYR A  1 37  ? -17.682 17.187  -3.705  1.00 27.15  ? 99  TYR A CB    1 
ATOM   172   C CG    . TYR A  1 37  ? -19.100 16.860  -3.345  1.00 27.98  ? 99  TYR A CG    1 
ATOM   173   C CD1   . TYR A  1 37  ? -19.413 15.674  -2.691  1.00 27.84  ? 99  TYR A CD1   1 
ATOM   174   C CD2   . TYR A  1 37  ? -20.139 17.732  -3.665  1.00 28.65  ? 99  TYR A CD2   1 
ATOM   175   C CE1   . TYR A  1 37  ? -20.719 15.376  -2.347  1.00 28.01  ? 99  TYR A CE1   1 
ATOM   176   C CE2   . TYR A  1 37  ? -21.450 17.430  -3.332  1.00 28.58  ? 99  TYR A CE2   1 
ATOM   177   C CZ    . TYR A  1 37  ? -21.726 16.258  -2.676  1.00 27.76  ? 99  TYR A CZ    1 
ATOM   178   O OH    . TYR A  1 37  ? -23.012 15.978  -2.358  1.00 28.09  ? 99  TYR A OH    1 
ATOM   179   N N     . ARG A  1 38  ? -15.015 17.527  -5.340  1.00 24.30  ? 100 ARG A N     1 
ATOM   180   C CA    . ARG A  1 38  ? -14.076 18.488  -5.892  1.00 24.54  ? 100 ARG A CA    1 
ATOM   181   C C     . ARG A  1 38  ? -13.915 18.239  -7.379  1.00 24.53  ? 100 ARG A C     1 
ATOM   182   O O     . ARG A  1 38  ? -14.032 19.155  -8.183  1.00 24.23  ? 100 ARG A O     1 
ATOM   183   C CB    . ARG A  1 38  ? -12.723 18.455  -5.189  1.00 24.04  ? 100 ARG A CB    1 
ATOM   184   C CG    . ARG A  1 38  ? -11.895 19.692  -5.506  1.00 23.84  ? 100 ARG A CG    1 
ATOM   185   C CD    . ARG A  1 38  ? -10.459 19.554  -5.051  1.00 24.14  ? 100 ARG A CD    1 
ATOM   186   N NE    . ARG A  1 38  ? -9.826  18.414  -5.710  1.00 24.94  ? 100 ARG A NE    1 
ATOM   187   C CZ    . ARG A  1 38  ? -8.623  17.933  -5.406  1.00 23.63  ? 100 ARG A CZ    1 
ATOM   188   N NH1   . ARG A  1 38  ? -7.908  18.506  -4.452  1.00 23.26  ? 100 ARG A NH1   1 
ATOM   189   N NH2   . ARG A  1 38  ? -8.152  16.869  -6.054  1.00 22.35  ? 100 ARG A NH2   1 
ATOM   190   N N     . ASN A  1 39  ? -13.681 16.992  -7.745  1.00 24.86  ? 101 ASN A N     1 
ATOM   191   C CA    . ASN A  1 39  ? -13.495 16.665  -9.136  1.00 25.42  ? 101 ASN A CA    1 
ATOM   192   C C     . ASN A  1 39  ? -14.695 17.095  -9.944  1.00 26.43  ? 101 ASN A C     1 
ATOM   193   O O     . ASN A  1 39  ? -14.541 17.610  -11.044 1.00 27.37  ? 101 ASN A O     1 
ATOM   194   C CB    . ASN A  1 39  ? -13.288 15.163  -9.346  1.00 25.77  ? 101 ASN A CB    1 
ATOM   195   C CG    . ASN A  1 39  ? -11.983 14.651  -8.794  1.00 25.89  ? 101 ASN A CG    1 
ATOM   196   O OD1   . ASN A  1 39  ? -11.738 13.458  -8.865  1.00 26.33  ? 101 ASN A OD1   1 
ATOM   197   N ND2   . ASN A  1 39  ? -11.140 15.528  -8.241  1.00 26.78  ? 101 ASN A ND2   1 
ATOM   198   N N     . SER A  1 40  ? -15.894 16.880  -9.420  1.00 27.64  ? 102 SER A N     1 
ATOM   199   C CA    . SER A  1 40  ? -17.096 17.196  -10.191 1.00 28.69  ? 102 SER A CA    1 
ATOM   200   C C     . SER A  1 40  ? -17.059 18.660  -10.644 1.00 28.30  ? 102 SER A C     1 
ATOM   201   O O     . SER A  1 40  ? -17.579 18.997  -11.714 1.00 28.32  ? 102 SER A O     1 
ATOM   202   C CB    . SER A  1 40  ? -18.379 16.892  -9.399  1.00 29.63  ? 102 SER A CB    1 
ATOM   203   O OG    . SER A  1 40  ? -18.623 17.857  -8.378  1.00 30.98  ? 102 SER A OG    1 
ATOM   204   N N     . MET A  1 41  ? -16.414 19.515  -9.852  1.00 26.93  ? 103 MET A N     1 
ATOM   205   C CA    . MET A  1 41  ? -16.326 20.918  -10.193 1.00 27.59  ? 103 MET A CA    1 
ATOM   206   C C     . MET A  1 41  ? -15.042 21.270  -10.954 1.00 27.86  ? 103 MET A C     1 
ATOM   207   O O     . MET A  1 41  ? -15.120 21.901  -12.013 1.00 28.10  ? 103 MET A O     1 
ATOM   208   C CB    . MET A  1 41  ? -16.471 21.776  -8.942  1.00 28.35  ? 103 MET A CB    1 
ATOM   209   C CG    . MET A  1 41  ? -17.669 21.395  -8.088  1.00 28.71  ? 103 MET A CG    1 
ATOM   210   S SD    . MET A  1 41  ? -17.958 22.558  -6.744  1.00 29.65  ? 103 MET A SD    1 
ATOM   211   C CE    . MET A  1 41  ? -18.701 21.454  -5.546  1.00 29.11  ? 103 MET A CE    1 
ATOM   212   N N     . TYR A  1 42  ? -13.878 20.861  -10.442 1.00 27.43  ? 104 TYR A N     1 
ATOM   213   C CA    . TYR A  1 42  ? -12.586 21.171  -11.089 1.00 27.53  ? 104 TYR A CA    1 
ATOM   214   C C     . TYR A  1 42  ? -12.467 20.578  -12.520 1.00 28.58  ? 104 TYR A C     1 
ATOM   215   O O     . TYR A  1 42  ? -11.967 21.232  -13.446 1.00 28.13  ? 104 TYR A O     1 
ATOM   216   C CB    . TYR A  1 42  ? -11.417 20.675  -10.218 1.00 27.76  ? 104 TYR A CB    1 
ATOM   217   C CG    . TYR A  1 42  ? -11.111 21.499  -8.974  1.00 27.30  ? 104 TYR A CG    1 
ATOM   218   C CD1   . TYR A  1 42  ? -12.047 22.373  -8.426  1.00 27.14  ? 104 TYR A CD1   1 
ATOM   219   C CD2   . TYR A  1 42  ? -9.886  21.371  -8.324  1.00 26.64  ? 104 TYR A CD2   1 
ATOM   220   C CE1   . TYR A  1 42  ? -11.763 23.097  -7.280  1.00 26.84  ? 104 TYR A CE1   1 
ATOM   221   C CE2   . TYR A  1 42  ? -9.598  22.097  -7.182  1.00 26.26  ? 104 TYR A CE2   1 
ATOM   222   C CZ    . TYR A  1 42  ? -10.540 22.956  -6.660  1.00 26.44  ? 104 TYR A CZ    1 
ATOM   223   O OH    . TYR A  1 42  ? -10.266 23.683  -5.513  1.00 26.38  ? 104 TYR A OH    1 
ATOM   224   N N     . HIS A  1 43  ? -12.940 19.346  -12.701 1.00 29.68  ? 105 HIS A N     1 
ATOM   225   C CA    . HIS A  1 43  ? -12.925 18.707  -14.021 1.00 30.61  ? 105 HIS A CA    1 
ATOM   226   C C     . HIS A  1 43  ? -14.010 19.246  -14.951 1.00 31.12  ? 105 HIS A C     1 
ATOM   227   O O     . HIS A  1 43  ? -14.099 18.809  -16.094 1.00 33.25  ? 105 HIS A O     1 
ATOM   228   C CB    . HIS A  1 43  ? -13.116 17.186  -13.920 1.00 29.89  ? 105 HIS A CB    1 
ATOM   229   C CG    . HIS A  1 43  ? -12.047 16.487  -13.150 1.00 29.62  ? 105 HIS A CG    1 
ATOM   230   N ND1   . HIS A  1 43  ? -11.994 15.113  -13.038 1.00 29.56  ? 105 HIS A ND1   1 
ATOM   231   C CD2   . HIS A  1 43  ? -10.987 16.966  -12.454 1.00 29.83  ? 105 HIS A CD2   1 
ATOM   232   C CE1   . HIS A  1 43  ? -10.955 14.776  -12.293 1.00 29.93  ? 105 HIS A CE1   1 
ATOM   233   N NE2   . HIS A  1 43  ? -10.327 15.881  -11.928 1.00 30.42  ? 105 HIS A NE2   1 
ATOM   234   N N     . ASN A  1 44  ? -14.868 20.138  -14.474 1.00 30.37  ? 106 ASN A N     1 
ATOM   235   C CA    . ASN A  1 44  ? -15.918 20.682  -15.331 1.00 30.55  ? 106 ASN A CA    1 
ATOM   236   C C     . ASN A  1 44  ? -16.084 22.174  -15.129 1.00 30.88  ? 106 ASN A C     1 
ATOM   237   O O     . ASN A  1 44  ? -17.192 22.674  -14.975 1.00 30.05  ? 106 ASN A O     1 
ATOM   238   C CB    . ASN A  1 44  ? -17.238 19.927  -15.114 1.00 29.25  ? 106 ASN A CB    1 
ATOM   239   C CG    . ASN A  1 44  ? -17.066 18.437  -15.226 1.00 28.25  ? 106 ASN A CG    1 
ATOM   240   O OD1   . ASN A  1 44  ? -17.233 17.723  -14.257 1.00 27.76  ? 106 ASN A OD1   1 
ATOM   241   N ND2   . ASN A  1 44  ? -16.651 17.972  -16.387 1.00 27.96  ? 106 ASN A ND2   1 
ATOM   242   N N     . LYS A  1 45  ? -14.969 22.884  -15.166 1.00 33.25  ? 107 LYS A N     1 
ATOM   243   C CA    . LYS A  1 45  ? -14.985 24.342  -15.015 1.00 36.97  ? 107 LYS A CA    1 
ATOM   244   C C     . LYS A  1 45  ? -15.935 25.043  -16.006 1.00 37.55  ? 107 LYS A C     1 
ATOM   245   O O     . LYS A  1 45  ? -16.512 26.098  -15.698 1.00 36.32  ? 107 LYS A O     1 
ATOM   246   C CB    . LYS A  1 45  ? -13.565 24.900  -15.175 1.00 39.23  ? 107 LYS A CB    1 
ATOM   247   C CG    . LYS A  1 45  ? -12.737 24.835  -13.909 1.00 41.20  ? 107 LYS A CG    1 
ATOM   248   C CD    . LYS A  1 45  ? -11.274 24.617  -14.212 1.00 44.89  ? 107 LYS A CD    1 
ATOM   249   C CE    . LYS A  1 45  ? -10.521 24.448  -12.914 1.00 49.99  ? 107 LYS A CE    1 
ATOM   250   N NZ    . LYS A  1 45  ? -9.567  23.314  -13.022 1.00 54.96  ? 107 LYS A NZ    1 
ATOM   251   N N     . HIS A  1 46  ? -16.082 24.450  -17.193 1.00 36.46  ? 108 HIS A N     1 
ATOM   252   C CA    . HIS A  1 46  ? -16.960 24.980  -18.220 1.00 34.87  ? 108 HIS A CA    1 
ATOM   253   C C     . HIS A  1 46  ? -18.391 25.118  -17.702 1.00 36.41  ? 108 HIS A C     1 
ATOM   254   O O     . HIS A  1 46  ? -19.113 25.989  -18.123 1.00 38.36  ? 108 HIS A O     1 
ATOM   255   C CB    . HIS A  1 46  ? -16.913 24.108  -19.479 1.00 33.67  ? 108 HIS A CB    1 
ATOM   256   C CG    . HIS A  1 46  ? -17.448 22.724  -19.287 1.00 33.94  ? 108 HIS A CG    1 
ATOM   257   N ND1   . HIS A  1 46  ? -16.667 21.666  -18.875 1.00 34.14  ? 108 HIS A ND1   1 
ATOM   258   C CD2   . HIS A  1 46  ? -18.689 22.219  -19.476 1.00 35.19  ? 108 HIS A CD2   1 
ATOM   259   C CE1   . HIS A  1 46  ? -17.405 20.571  -18.810 1.00 34.26  ? 108 HIS A CE1   1 
ATOM   260   N NE2   . HIS A  1 46  ? -18.637 20.880  -19.166 1.00 35.18  ? 108 HIS A NE2   1 
ATOM   261   N N     . VAL A  1 47  ? -18.800 24.268  -16.778 1.00 37.03  ? 109 VAL A N     1 
ATOM   262   C CA    . VAL A  1 47  ? -20.134 24.355  -16.230 1.00 36.48  ? 109 VAL A CA    1 
ATOM   263   C C     . VAL A  1 47  ? -20.248 25.496  -15.234 1.00 34.93  ? 109 VAL A C     1 
ATOM   264   O O     . VAL A  1 47  ? -21.303 26.078  -15.078 1.00 33.97  ? 109 VAL A O     1 
ATOM   265   C CB    . VAL A  1 47  ? -20.498 23.056  -15.512 1.00 38.94  ? 109 VAL A CB    1 
ATOM   266   C CG1   . VAL A  1 47  ? -21.849 23.176  -14.810 1.00 40.03  ? 109 VAL A CG1   1 
ATOM   267   C CG2   . VAL A  1 47  ? -20.495 21.895  -16.498 1.00 39.28  ? 109 VAL A CG2   1 
ATOM   268   N N     . PHE A  1 48  ? -19.165 25.806  -14.550 1.00 35.04  ? 110 PHE A N     1 
ATOM   269   C CA    . PHE A  1 48  ? -19.211 26.800  -13.485 1.00 36.57  ? 110 PHE A CA    1 
ATOM   270   C C     . PHE A  1 48  ? -18.776 28.203  -13.900 1.00 36.96  ? 110 PHE A C     1 
ATOM   271   O O     . PHE A  1 48  ? -19.126 29.168  -13.237 1.00 34.64  ? 110 PHE A O     1 
ATOM   272   C CB    . PHE A  1 48  ? -18.355 26.323  -12.308 1.00 36.78  ? 110 PHE A CB    1 
ATOM   273   C CG    . PHE A  1 48  ? -18.966 25.183  -11.552 1.00 35.99  ? 110 PHE A CG    1 
ATOM   274   C CD1   . PHE A  1 48  ? -18.721 23.872  -11.927 1.00 36.17  ? 110 PHE A CD1   1 
ATOM   275   C CD2   . PHE A  1 48  ? -19.800 25.424  -10.475 1.00 36.46  ? 110 PHE A CD2   1 
ATOM   276   C CE1   . PHE A  1 48  ? -19.289 22.819  -11.229 1.00 36.27  ? 110 PHE A CE1   1 
ATOM   277   C CE2   . PHE A  1 48  ? -20.375 24.376  -9.770  1.00 36.51  ? 110 PHE A CE2   1 
ATOM   278   C CZ    . PHE A  1 48  ? -20.121 23.072  -10.147 1.00 36.17  ? 110 PHE A CZ    1 
ATOM   279   N N     . LYS A  1 49  ? -18.021 28.325  -14.986 1.00 40.39  ? 111 LYS A N     1 
ATOM   280   C CA    . LYS A  1 49  ? -17.397 29.601  -15.299 1.00 42.86  ? 111 LYS A CA    1 
ATOM   281   C C     . LYS A  1 49  ? -18.431 30.717  -15.425 1.00 43.05  ? 111 LYS A C     1 
ATOM   282   O O     . LYS A  1 49  ? -19.400 30.595  -16.157 1.00 43.41  ? 111 LYS A O     1 
ATOM   283   C CB    . LYS A  1 49  ? -16.529 29.534  -16.554 1.00 45.19  ? 111 LYS A CB    1 
ATOM   284   C CG    . LYS A  1 49  ? -15.416 30.550  -16.471 1.00 49.15  ? 111 LYS A CG    1 
ATOM   285   C CD    . LYS A  1 49  ? -15.005 31.095  -17.815 1.00 54.25  ? 111 LYS A CD    1 
ATOM   286   C CE    . LYS A  1 49  ? -14.152 32.340  -17.608 1.00 59.13  ? 111 LYS A CE    1 
ATOM   287   N NZ    . LYS A  1 49  ? -13.586 32.851  -18.893 1.00 61.87  ? 111 LYS A NZ    1 
ATOM   288   N N     . ASP A  1 50  ? -18.208 31.794  -14.675 1.00 44.87  ? 112 ASP A N     1 
ATOM   289   C CA    . ASP A  1 50  ? -19.071 32.985  -14.655 1.00 44.59  ? 112 ASP A CA    1 
ATOM   290   C C     . ASP A  1 50  ? -20.511 32.731  -14.218 1.00 42.80  ? 112 ASP A C     1 
ATOM   291   O O     . ASP A  1 50  ? -21.378 33.527  -14.516 1.00 43.23  ? 112 ASP A O     1 
ATOM   292   C CB    . ASP A  1 50  ? -19.056 33.699  -16.018 1.00 45.75  ? 112 ASP A CB    1 
ATOM   293   C CG    . ASP A  1 50  ? -17.678 34.220  -16.392 1.00 47.57  ? 112 ASP A CG    1 
ATOM   294   O OD1   . ASP A  1 50  ? -16.999 34.771  -15.502 1.00 48.72  ? 112 ASP A OD1   1 
ATOM   295   O OD2   . ASP A  1 50  ? -17.274 34.085  -17.572 1.00 46.43  ? 112 ASP A OD2   1 
ATOM   296   N N     . LYS A  1 51  ? -20.768 31.657  -13.482 1.00 42.86  ? 113 LYS A N     1 
ATOM   297   C CA    . LYS A  1 51  ? -22.140 31.347  -13.051 1.00 43.15  ? 113 LYS A CA    1 
ATOM   298   C C     . LYS A  1 51  ? -22.354 31.626  -11.564 1.00 41.64  ? 113 LYS A C     1 
ATOM   299   O O     . LYS A  1 51  ? -21.398 31.915  -10.831 1.00 44.41  ? 113 LYS A O     1 
ATOM   300   C CB    . LYS A  1 51  ? -22.504 29.909  -13.425 1.00 43.30  ? 113 LYS A CB    1 
ATOM   301   C CG    . LYS A  1 51  ? -22.420 29.702  -14.925 1.00 45.94  ? 113 LYS A CG    1 
ATOM   302   C CD    . LYS A  1 51  ? -23.098 28.423  -15.397 1.00 49.56  ? 113 LYS A CD    1 
ATOM   303   C CE    . LYS A  1 51  ? -24.390 28.672  -16.165 1.00 50.28  ? 113 LYS A CE    1 
ATOM   304   N NZ    . LYS A  1 51  ? -24.093 29.166  -17.543 1.00 48.70  ? 113 LYS A NZ    1 
ATOM   305   N N     . VAL A  1 52  ? -23.612 31.571  -11.136 1.00 38.37  ? 114 VAL A N     1 
ATOM   306   C CA    . VAL A  1 52  ? -23.988 31.854  -9.754  1.00 37.34  ? 114 VAL A CA    1 
ATOM   307   C C     . VAL A  1 52  ? -24.335 30.538  -9.057  1.00 37.10  ? 114 VAL A C     1 
ATOM   308   O O     . VAL A  1 52  ? -25.179 29.794  -9.543  1.00 37.34  ? 114 VAL A O     1 
ATOM   309   C CB    . VAL A  1 52  ? -25.179 32.832  -9.712  1.00 36.05  ? 114 VAL A CB    1 
ATOM   310   C CG1   . VAL A  1 52  ? -25.674 33.044  -8.286  1.00 35.43  ? 114 VAL A CG1   1 
ATOM   311   C CG2   . VAL A  1 52  ? -24.764 34.158  -10.331 1.00 35.47  ? 114 VAL A CG2   1 
ATOM   312   N N     . VAL A  1 53  ? -23.682 30.259  -7.926  1.00 35.97  ? 115 VAL A N     1 
ATOM   313   C CA    . VAL A  1 53  ? -23.803 28.967  -7.262  1.00 35.58  ? 115 VAL A CA    1 
ATOM   314   C C     . VAL A  1 53  ? -24.307 29.093  -5.830  1.00 36.60  ? 115 VAL A C     1 
ATOM   315   O O     . VAL A  1 53  ? -23.850 29.951  -5.069  1.00 37.70  ? 115 VAL A O     1 
ATOM   316   C CB    . VAL A  1 53  ? -22.444 28.255  -7.190  1.00 35.52  ? 115 VAL A CB    1 
ATOM   317   C CG1   . VAL A  1 53  ? -22.621 26.846  -6.646  1.00 35.65  ? 115 VAL A CG1   1 
ATOM   318   C CG2   . VAL A  1 53  ? -21.795 28.191  -8.559  1.00 36.50  ? 115 VAL A CG2   1 
ATOM   319   N N     . LEU A  1 54  ? -25.218 28.200  -5.457  1.00 36.07  ? 116 LEU A N     1 
ATOM   320   C CA    . LEU A  1 54  ? -25.729 28.112  -4.097  1.00 34.65  ? 116 LEU A CA    1 
ATOM   321   C C     . LEU A  1 54  ? -25.239 26.818  -3.449  1.00 33.63  ? 116 LEU A C     1 
ATOM   322   O O     . LEU A  1 54  ? -25.574 25.724  -3.916  1.00 34.53  ? 116 LEU A O     1 
ATOM   323   C CB    . LEU A  1 54  ? -27.253 28.100  -4.135  1.00 36.92  ? 116 LEU A CB    1 
ATOM   324   C CG    . LEU A  1 54  ? -27.973 27.934  -2.801  1.00 39.35  ? 116 LEU A CG    1 
ATOM   325   C CD1   . LEU A  1 54  ? -27.680 29.134  -1.913  1.00 39.69  ? 116 LEU A CD1   1 
ATOM   326   C CD2   . LEU A  1 54  ? -29.475 27.758  -2.989  1.00 40.02  ? 116 LEU A CD2   1 
ATOM   327   N N     . ASP A  1 55  ? -24.458 26.949  -2.378  1.00 32.22  ? 117 ASP A N     1 
ATOM   328   C CA    . ASP A  1 55  ? -24.055 25.816  -1.522  1.00 29.89  ? 117 ASP A CA    1 
ATOM   329   C C     . ASP A  1 55  ? -25.111 25.722  -0.417  1.00 27.83  ? 117 ASP A C     1 
ATOM   330   O O     . ASP A  1 55  ? -25.187 26.565  0.468   1.00 26.07  ? 117 ASP A O     1 
ATOM   331   C CB    . ASP A  1 55  ? -22.633 26.054  -0.955  1.00 30.15  ? 117 ASP A CB    1 
ATOM   332   C CG    . ASP A  1 55  ? -22.055 24.848  -0.158  1.00 30.57  ? 117 ASP A CG    1 
ATOM   333   O OD1   . ASP A  1 55  ? -22.804 23.852  0.041   1.00 32.46  ? 117 ASP A OD1   1 
ATOM   334   O OD2   . ASP A  1 55  ? -20.850 24.911  0.281   1.00 27.51  ? 117 ASP A OD2   1 
ATOM   335   N N     . VAL A  1 56  ? -25.955 24.709  -0.509  1.00 27.24  ? 118 VAL A N     1 
ATOM   336   C CA    . VAL A  1 56  ? -26.970 24.456  0.503   1.00 28.71  ? 118 VAL A CA    1 
ATOM   337   C C     . VAL A  1 56  ? -26.348 23.688  1.668   1.00 29.18  ? 118 VAL A C     1 
ATOM   338   O O     . VAL A  1 56  ? -25.968 22.508  1.520   1.00 30.70  ? 118 VAL A O     1 
ATOM   339   C CB    . VAL A  1 56  ? -28.151 23.665  -0.104  1.00 29.04  ? 118 VAL A CB    1 
ATOM   340   C CG1   . VAL A  1 56  ? -29.185 23.268  0.949   1.00 29.75  ? 118 VAL A CG1   1 
ATOM   341   C CG2   . VAL A  1 56  ? -28.790 24.489  -1.205  1.00 28.48  ? 118 VAL A CG2   1 
ATOM   342   N N     . GLY A  1 57  ? -26.256 24.348  2.823   1.00 28.38  ? 119 GLY A N     1 
ATOM   343   C CA    . GLY A  1 57  ? -25.535 23.781  3.957   1.00 29.87  ? 119 GLY A CA    1 
ATOM   344   C C     . GLY A  1 57  ? -24.035 23.943  3.782   1.00 30.64  ? 119 GLY A C     1 
ATOM   345   O O     . GLY A  1 57  ? -23.283 22.950  3.687   1.00 30.05  ? 119 GLY A O     1 
ATOM   346   N N     . SER A  1 58  ? -23.609 25.202  3.758   1.00 31.10  ? 120 SER A N     1 
ATOM   347   C CA    . SER A  1 58  ? -22.225 25.567  3.426   1.00 32.40  ? 120 SER A CA    1 
ATOM   348   C C     . SER A  1 58  ? -21.174 24.814  4.268   1.00 32.86  ? 120 SER A C     1 
ATOM   349   O O     . SER A  1 58  ? -20.097 24.422  3.770   1.00 32.82  ? 120 SER A O     1 
ATOM   350   C CB    . SER A  1 58  ? -22.027 27.099  3.522   1.00 32.27  ? 120 SER A CB    1 
ATOM   351   O OG    . SER A  1 58  ? -21.662 27.551  4.837   1.00 33.12  ? 120 SER A OG    1 
ATOM   352   N N     . GLY A  1 59  ? -21.519 24.615  5.535   1.00 32.63  ? 121 GLY A N     1 
ATOM   353   C CA    . GLY A  1 59  ? -20.638 23.994  6.495   1.00 32.60  ? 121 GLY A CA    1 
ATOM   354   C C     . GLY A  1 59  ? -19.360 24.791  6.650   1.00 32.28  ? 121 GLY A C     1 
ATOM   355   O O     . GLY A  1 59  ? -19.357 26.036  6.709   1.00 31.65  ? 121 GLY A O     1 
ATOM   356   N N     . THR A  1 60  ? -18.275 24.041  6.720   1.00 32.20  ? 122 THR A N     1 
ATOM   357   C CA    . THR A  1 60  ? -16.937 24.578  6.680   1.00 32.67  ? 122 THR A CA    1 
ATOM   358   C C     . THR A  1 60  ? -16.730 25.592  5.576   1.00 32.23  ? 122 THR A C     1 
ATOM   359   O O     . THR A  1 60  ? -15.853 26.457  5.702   1.00 32.25  ? 122 THR A O     1 
ATOM   360   C CB    . THR A  1 60  ? -15.937 23.424  6.479   1.00 33.32  ? 122 THR A CB    1 
ATOM   361   O OG1   . THR A  1 60  ? -16.626 22.271  5.957   1.00 33.14  ? 122 THR A OG1   1 
ATOM   362   C CG2   . THR A  1 60  ? -15.338 23.056  7.799   1.00 34.26  ? 122 THR A CG2   1 
ATOM   363   N N     . GLY A  1 61  ? -17.518 25.462  4.499   1.00 31.66  ? 123 GLY A N     1 
ATOM   364   C CA    . GLY A  1 61  ? -17.363 26.266  3.282   1.00 31.67  ? 123 GLY A CA    1 
ATOM   365   C C     . GLY A  1 61  ? -16.602 25.545  2.169   1.00 31.77  ? 123 GLY A C     1 
ATOM   366   O O     . GLY A  1 61  ? -16.462 26.064  1.060   1.00 31.15  ? 123 GLY A O     1 
ATOM   367   N N     . ILE A  1 62  ? -16.105 24.348  2.470   1.00 32.35  ? 124 ILE A N     1 
ATOM   368   C CA    . ILE A  1 62  ? -15.270 23.592  1.549   1.00 32.80  ? 124 ILE A CA    1 
ATOM   369   C C     . ILE A  1 62  ? -15.895 23.495  0.147   1.00 34.57  ? 124 ILE A C     1 
ATOM   370   O O     . ILE A  1 62  ? -15.209 23.707  -0.859  1.00 36.04  ? 124 ILE A O     1 
ATOM   371   C CB    . ILE A  1 62  ? -14.934 22.190  2.118   1.00 32.26  ? 124 ILE A CB    1 
ATOM   372   C CG1   . ILE A  1 62  ? -13.916 21.480  1.239   1.00 31.90  ? 124 ILE A CG1   1 
ATOM   373   C CG2   . ILE A  1 62  ? -16.176 21.318  2.262   1.00 32.69  ? 124 ILE A CG2   1 
ATOM   374   C CD1   . ILE A  1 62  ? -12.570 22.145  1.253   1.00 32.47  ? 124 ILE A CD1   1 
ATOM   375   N N     . LEU A  1 63  ? -17.194 23.219  0.065   1.00 35.69  ? 125 LEU A N     1 
ATOM   376   C CA    . LEU A  1 63  ? -17.817 23.046  -1.251  1.00 35.04  ? 125 LEU A CA    1 
ATOM   377   C C     . LEU A  1 63  ? -17.916 24.374  -1.988  1.00 33.46  ? 125 LEU A C     1 
ATOM   378   O O     . LEU A  1 63  ? -17.679 24.434  -3.183  1.00 32.32  ? 125 LEU A O     1 
ATOM   379   C CB    . LEU A  1 63  ? -19.191 22.372  -1.147  1.00 33.85  ? 125 LEU A CB    1 
ATOM   380   C CG    . LEU A  1 63  ? -19.187 20.936  -0.651  1.00 32.70  ? 125 LEU A CG    1 
ATOM   381   C CD1   . LEU A  1 63  ? -20.586 20.407  -0.789  1.00 33.70  ? 125 LEU A CD1   1 
ATOM   382   C CD2   . LEU A  1 63  ? -18.230 20.051  -1.421  1.00 32.27  ? 125 LEU A CD2   1 
ATOM   383   N N     . SER A  1 64  ? -18.267 25.433  -1.273  1.00 34.09  ? 126 SER A N     1 
ATOM   384   C CA    . SER A  1 64  ? -18.288 26.763  -1.862  1.00 34.42  ? 126 SER A CA    1 
ATOM   385   C C     . SER A  1 64  ? -16.899 27.186  -2.355  1.00 36.11  ? 126 SER A C     1 
ATOM   386   O O     . SER A  1 64  ? -16.793 27.861  -3.383  1.00 37.23  ? 126 SER A O     1 
ATOM   387   C CB    . SER A  1 64  ? -18.827 27.776  -0.861  1.00 32.82  ? 126 SER A CB    1 
ATOM   388   O OG    . SER A  1 64  ? -20.172 27.467  -0.548  1.00 30.73  ? 126 SER A OG    1 
ATOM   389   N N     . MET A  1 65  ? -15.839 26.788  -1.650  1.00 35.67  ? 127 MET A N     1 
ATOM   390   C CA    . MET A  1 65  ? -14.485 27.112  -2.104  1.00 35.61  ? 127 MET A CA    1 
ATOM   391   C C     . MET A  1 65  ? -14.099 26.347  -3.379  1.00 35.42  ? 127 MET A C     1 
ATOM   392   O O     . MET A  1 65  ? -13.443 26.904  -4.270  1.00 34.01  ? 127 MET A O     1 
ATOM   393   C CB    . MET A  1 65  ? -13.473 26.910  -0.982  1.00 36.78  ? 127 MET A CB    1 
ATOM   394   C CG    . MET A  1 65  ? -13.580 27.982  0.099   1.00 38.64  ? 127 MET A CG    1 
ATOM   395   S SD    . MET A  1 65  ? -12.197 28.042  1.275   1.00 41.81  ? 127 MET A SD    1 
ATOM   396   C CE    . MET A  1 65  ? -12.306 26.388  1.979   1.00 43.75  ? 127 MET A CE    1 
ATOM   397   N N     . PHE A  1 66  ? -14.533 25.092  -3.494  1.00 35.30  ? 128 PHE A N     1 
ATOM   398   C CA    . PHE A  1 66  ? -14.351 24.353  -4.750  1.00 34.15  ? 128 PHE A CA    1 
ATOM   399   C C     . PHE A  1 66  ? -15.022 25.107  -5.908  1.00 34.35  ? 128 PHE A C     1 
ATOM   400   O O     . PHE A  1 66  ? -14.403 25.369  -6.930  1.00 33.78  ? 128 PHE A O     1 
ATOM   401   C CB    . PHE A  1 66  ? -14.922 22.931  -4.671  1.00 32.83  ? 128 PHE A CB    1 
ATOM   402   C CG    . PHE A  1 66  ? -14.190 22.010  -3.737  1.00 32.31  ? 128 PHE A CG    1 
ATOM   403   C CD1   . PHE A  1 66  ? -12.874 22.226  -3.371  1.00 32.61  ? 128 PHE A CD1   1 
ATOM   404   C CD2   . PHE A  1 66  ? -14.831 20.881  -3.247  1.00 32.92  ? 128 PHE A CD2   1 
ATOM   405   C CE1   . PHE A  1 66  ? -12.227 21.344  -2.518  1.00 32.96  ? 128 PHE A CE1   1 
ATOM   406   C CE2   . PHE A  1 66  ? -14.190 20.002  -2.396  1.00 33.30  ? 128 PHE A CE2   1 
ATOM   407   C CZ    . PHE A  1 66  ? -12.885 20.235  -2.028  1.00 32.96  ? 128 PHE A CZ    1 
ATOM   408   N N     . ALA A  1 67  ? -16.285 25.471  -5.734  1.00 35.28  ? 129 ALA A N     1 
ATOM   409   C CA    . ALA A  1 67  ? -17.037 26.188  -6.777  1.00 36.96  ? 129 ALA A CA    1 
ATOM   410   C C     . ALA A  1 67  ? -16.367 27.489  -7.215  1.00 36.11  ? 129 ALA A C     1 
ATOM   411   O O     . ALA A  1 67  ? -16.255 27.775  -8.391  1.00 33.94  ? 129 ALA A O     1 
ATOM   412   C CB    . ALA A  1 67  ? -18.458 26.474  -6.310  1.00 37.65  ? 129 ALA A CB    1 
ATOM   413   N N     . ALA A  1 68  ? -15.921 28.272  -6.254  1.00 39.60  ? 130 ALA A N     1 
ATOM   414   C CA    . ALA A  1 68  ? -15.186 29.486  -6.558  1.00 41.13  ? 130 ALA A CA    1 
ATOM   415   C C     . ALA A  1 68  ? -13.944 29.148  -7.380  1.00 40.94  ? 130 ALA A C     1 
ATOM   416   O O     . ALA A  1 68  ? -13.696 29.777  -8.396  1.00 39.25  ? 130 ALA A O     1 
ATOM   417   C CB    . ALA A  1 68  ? -14.812 30.219  -5.274  1.00 42.32  ? 130 ALA A CB    1 
ATOM   418   N N     . LYS A  1 69  ? -13.186 28.136  -6.969  1.00 42.95  ? 131 LYS A N     1 
ATOM   419   C CA    . LYS A  1 69  ? -11.971 27.777  -7.699  1.00 47.71  ? 131 LYS A CA    1 
ATOM   420   C C     . LYS A  1 69  ? -12.234 27.202  -9.079  1.00 49.74  ? 131 LYS A C     1 
ATOM   421   O O     . LYS A  1 69  ? -11.325 27.184  -9.901  1.00 54.47  ? 131 LYS A O     1 
ATOM   422   C CB    . LYS A  1 69  ? -11.121 26.786  -6.908  1.00 49.62  ? 131 LYS A CB    1 
ATOM   423   C CG    . LYS A  1 69  ? -10.276 27.444  -5.844  1.00 52.40  ? 131 LYS A CG    1 
ATOM   424   C CD    . LYS A  1 69  ? -9.243  28.374  -6.452  1.00 54.20  ? 131 LYS A CD    1 
ATOM   425   C CE    . LYS A  1 69  ? -8.150  28.644  -5.445  1.00 59.27  ? 131 LYS A CE    1 
ATOM   426   N NZ    . LYS A  1 69  ? -7.450  29.915  -5.753  1.00 63.69  ? 131 LYS A NZ    1 
ATOM   427   N N     . ALA A  1 70  ? -13.452 26.699  -9.317  1.00 49.60  ? 132 ALA A N     1 
ATOM   428   C CA    . ALA A  1 70  ? -13.881 26.229  -10.647 1.00 45.64  ? 132 ALA A CA    1 
ATOM   429   C C     . ALA A  1 70  ? -14.397 27.375  -11.511 1.00 43.05  ? 132 ALA A C     1 
ATOM   430   O O     . ALA A  1 70  ? -14.859 27.146  -12.630 1.00 43.59  ? 132 ALA A O     1 
ATOM   431   C CB    . ALA A  1 70  ? -14.950 25.157  -10.516 1.00 46.49  ? 132 ALA A CB    1 
ATOM   432   N N     . GLY A  1 71  ? -14.329 28.598  -10.980 1.00 41.97  ? 133 GLY A N     1 
ATOM   433   C CA    . GLY A  1 71  ? -14.511 29.829  -11.758 1.00 41.75  ? 133 GLY A CA    1 
ATOM   434   C C     . GLY A  1 71  ? -15.856 30.503  -11.610 1.00 40.43  ? 133 GLY A C     1 
ATOM   435   O O     . GLY A  1 71  ? -16.211 31.348  -12.410 1.00 41.08  ? 133 GLY A O     1 
ATOM   436   N N     . ALA A  1 72  ? -16.611 30.148  -10.587 1.00 40.38  ? 134 ALA A N     1 
ATOM   437   C CA    . ALA A  1 72  ? -17.917 30.738  -10.405 1.00 39.83  ? 134 ALA A CA    1 
ATOM   438   C C     . ALA A  1 72  ? -17.735 32.239  -10.256 1.00 41.90  ? 134 ALA A C     1 
ATOM   439   O O     . ALA A  1 72  ? -16.679 32.703  -9.797  1.00 38.92  ? 134 ALA A O     1 
ATOM   440   C CB    . ALA A  1 72  ? -18.600 30.153  -9.187  1.00 39.20  ? 134 ALA A CB    1 
ATOM   441   N N     . LYS A  1 73  ? -18.755 32.977  -10.696 1.00 45.80  ? 135 LYS A N     1 
ATOM   442   C CA    . LYS A  1 73  ? -18.810 34.438  -10.578 1.00 48.20  ? 135 LYS A CA    1 
ATOM   443   C C     . LYS A  1 73  ? -19.156 34.837  -9.152  1.00 47.98  ? 135 LYS A C     1 
ATOM   444   O O     . LYS A  1 73  ? -18.566 35.749  -8.587  1.00 46.04  ? 135 LYS A O     1 
ATOM   445   C CB    . LYS A  1 73  ? -19.871 35.012  -11.524 1.00 50.50  ? 135 LYS A CB    1 
ATOM   446   C CG    . LYS A  1 73  ? -19.809 36.523  -11.719 1.00 53.13  ? 135 LYS A CG    1 
ATOM   447   C CD    . LYS A  1 73  ? -21.163 37.227  -11.479 1.00 57.32  ? 135 LYS A CD    1 
ATOM   448   C CE    . LYS A  1 73  ? -22.338 36.740  -12.350 1.00 56.42  ? 135 LYS A CE    1 
ATOM   449   N NZ    . LYS A  1 73  ? -22.197 37.066  -13.799 1.00 55.90  ? 135 LYS A NZ    1 
ATOM   450   N N     . LYS A  1 74  ? -20.144 34.161  -8.590  1.00 48.93  ? 136 LYS A N     1 
ATOM   451   C CA    . LYS A  1 74  ? -20.536 34.383  -7.215  1.00 53.73  ? 136 LYS A CA    1 
ATOM   452   C C     . LYS A  1 74  ? -20.943 33.030  -6.634  1.00 51.36  ? 136 LYS A C     1 
ATOM   453   O O     . LYS A  1 74  ? -21.429 32.151  -7.360  1.00 50.19  ? 136 LYS A O     1 
ATOM   454   C CB    . LYS A  1 74  ? -21.717 35.375  -7.123  1.00 60.20  ? 136 LYS A CB    1 
ATOM   455   C CG    . LYS A  1 74  ? -21.395 36.856  -7.357  1.00 64.07  ? 136 LYS A CG    1 
ATOM   456   C CD    . LYS A  1 74  ? -21.430 37.684  -6.074  1.00 68.27  ? 136 LYS A CD    1 
ATOM   457   C CE    . LYS A  1 74  ? -20.451 37.155  -5.030  1.00 71.81  ? 136 LYS A CE    1 
ATOM   458   N NZ    . LYS A  1 74  ? -19.912 38.201  -4.116  1.00 74.55  ? 136 LYS A NZ    1 
ATOM   459   N N     . VAL A  1 75  ? -20.725 32.870  -5.329  1.00 46.95  ? 137 VAL A N     1 
ATOM   460   C CA    . VAL A  1 75  ? -21.179 31.697  -4.607  1.00 42.56  ? 137 VAL A CA    1 
ATOM   461   C C     . VAL A  1 75  ? -21.850 32.172  -3.336  1.00 39.37  ? 137 VAL A C     1 
ATOM   462   O O     . VAL A  1 75  ? -21.320 32.992  -2.599  1.00 38.18  ? 137 VAL A O     1 
ATOM   463   C CB    . VAL A  1 75  ? -20.019 30.739  -4.257  1.00 41.78  ? 137 VAL A CB    1 
ATOM   464   C CG1   . VAL A  1 75  ? -20.537 29.485  -3.563  1.00 41.55  ? 137 VAL A CG1   1 
ATOM   465   C CG2   . VAL A  1 75  ? -19.230 30.352  -5.502  1.00 41.70  ? 137 VAL A CG2   1 
ATOM   466   N N     . PHE A  1 76  ? -23.024 31.635  -3.081  1.00 38.39  ? 138 PHE A N     1 
ATOM   467   C CA    . PHE A  1 76  ? -23.702 31.878  -1.835  1.00 40.19  ? 138 PHE A CA    1 
ATOM   468   C C     . PHE A  1 76  ? -23.788 30.574  -1.013  1.00 40.78  ? 138 PHE A C     1 
ATOM   469   O O     . PHE A  1 76  ? -24.287 29.553  -1.495  1.00 42.83  ? 138 PHE A O     1 
ATOM   470   C CB    . PHE A  1 76  ? -25.115 32.415  -2.108  1.00 41.20  ? 138 PHE A CB    1 
ATOM   471   C CG    . PHE A  1 76  ? -25.160 33.625  -3.003  1.00 39.96  ? 138 PHE A CG    1 
ATOM   472   C CD1   . PHE A  1 76  ? -24.225 34.636  -2.885  1.00 39.74  ? 138 PHE A CD1   1 
ATOM   473   C CD2   . PHE A  1 76  ? -26.169 33.759  -3.945  1.00 39.66  ? 138 PHE A CD2   1 
ATOM   474   C CE1   . PHE A  1 76  ? -24.279 35.745  -3.711  1.00 39.44  ? 138 PHE A CE1   1 
ATOM   475   C CE2   . PHE A  1 76  ? -26.230 34.869  -4.764  1.00 39.84  ? 138 PHE A CE2   1 
ATOM   476   C CZ    . PHE A  1 76  ? -25.282 35.865  -4.645  1.00 38.84  ? 138 PHE A CZ    1 
ATOM   477   N N     . GLY A  1 77  ? -23.324 30.614  0.231   1.00 39.50  ? 139 GLY A N     1 
ATOM   478   C CA    . GLY A  1 77  ? -23.478 29.479  1.134   1.00 39.81  ? 139 GLY A CA    1 
ATOM   479   C C     . GLY A  1 77  ? -24.487 29.796  2.218   1.00 39.59  ? 139 GLY A C     1 
ATOM   480   O O     . GLY A  1 77  ? -24.449 30.881  2.792   1.00 40.25  ? 139 GLY A O     1 
ATOM   481   N N     . ILE A  1 78  ? -25.406 28.874  2.486   1.00 38.79  ? 140 ILE A N     1 
ATOM   482   C CA    . ILE A  1 78  ? -26.339 29.037  3.600   1.00 38.87  ? 140 ILE A CA    1 
ATOM   483   C C     . ILE A  1 78  ? -26.075 27.981  4.669   1.00 39.62  ? 140 ILE A C     1 
ATOM   484   O O     . ILE A  1 78  ? -25.961 26.787  4.369   1.00 41.36  ? 140 ILE A O     1 
ATOM   485   C CB    . ILE A  1 78  ? -27.804 28.933  3.155   1.00 39.11  ? 140 ILE A CB    1 
ATOM   486   C CG1   . ILE A  1 78  ? -28.112 29.950  2.059   1.00 39.16  ? 140 ILE A CG1   1 
ATOM   487   C CG2   . ILE A  1 78  ? -28.737 29.163  4.342   1.00 40.15  ? 140 ILE A CG2   1 
ATOM   488   C CD1   . ILE A  1 78  ? -29.435 29.707  1.355   1.00 39.64  ? 140 ILE A CD1   1 
ATOM   489   N N     . GLU A  1 79  ? -26.006 28.431  5.916   1.00 39.24  ? 141 GLU A N     1 
ATOM   490   C CA    . GLU A  1 79  ? -25.664 27.568  7.019   1.00 40.11  ? 141 GLU A CA    1 
ATOM   491   C C     . GLU A  1 79  ? -26.278 28.083  8.327   1.00 41.21  ? 141 GLU A C     1 
ATOM   492   O O     . GLU A  1 79  ? -25.987 29.198  8.746   1.00 38.98  ? 141 GLU A O     1 
ATOM   493   C CB    . GLU A  1 79  ? -24.142 27.473  7.118   1.00 40.18  ? 141 GLU A CB    1 
ATOM   494   C CG    . GLU A  1 79  ? -23.625 26.574  8.236   1.00 40.76  ? 141 GLU A CG    1 
ATOM   495   C CD    . GLU A  1 79  ? -24.167 25.149  8.165   1.00 39.80  ? 141 GLU A CD    1 
ATOM   496   O OE1   . GLU A  1 79  ? -23.788 24.410  7.232   1.00 41.70  ? 141 GLU A OE1   1 
ATOM   497   O OE2   . GLU A  1 79  ? -24.953 24.756  9.049   1.00 37.03  ? 141 GLU A OE2   1 
ATOM   498   N N     . CYS A  1 80  ? -27.100 27.248  8.971   1.00 45.02  ? 142 CYS A N     1 
ATOM   499   C CA    . CYS A  1 80  ? -27.789 27.613  10.213  1.00 49.07  ? 142 CYS A CA    1 
ATOM   500   C C     . CYS A  1 80  ? -26.858 27.495  11.430  1.00 48.80  ? 142 CYS A C     1 
ATOM   501   O O     . CYS A  1 80  ? -26.924 28.324  12.324  1.00 51.89  ? 142 CYS A O     1 
ATOM   502   C CB    . CYS A  1 80  ? -29.107 26.810  10.410  1.00 53.70  ? 142 CYS A CB    1 
ATOM   503   S SG    . CYS A  1 80  ? -29.063 24.989  10.577  1.00 62.68  ? 142 CYS A SG    1 
ATOM   504   N N     . SER A  1 81  ? -25.958 26.507  11.422  1.00 48.87  ? 143 SER A N     1 
ATOM   505   C CA    . SER A  1 81  ? -25.020 26.244  12.530  1.00 48.64  ? 143 SER A CA    1 
ATOM   506   C C     . SER A  1 81  ? -23.971 27.340  12.672  1.00 47.53  ? 143 SER A C     1 
ATOM   507   O O     . SER A  1 81  ? -23.670 28.050  11.709  1.00 47.02  ? 143 SER A O     1 
ATOM   508   C CB    . SER A  1 81  ? -24.291 24.908  12.321  1.00 49.83  ? 143 SER A CB    1 
ATOM   509   O OG    . SER A  1 81  ? -23.671 24.460  13.514  1.00 50.80  ? 143 SER A OG    1 
ATOM   510   N N     . SER A  1 82  ? -23.395 27.450  13.871  1.00 45.72  ? 144 SER A N     1 
ATOM   511   C CA    . SER A  1 82  ? -22.383 28.475  14.147  1.00 46.00  ? 144 SER A CA    1 
ATOM   512   C C     . SER A  1 82  ? -21.044 28.141  13.494  1.00 43.67  ? 144 SER A C     1 
ATOM   513   O O     . SER A  1 82  ? -20.095 28.912  13.606  1.00 44.13  ? 144 SER A O     1 
ATOM   514   C CB    . SER A  1 82  ? -22.196 28.684  15.651  1.00 46.29  ? 144 SER A CB    1 
ATOM   515   O OG    . SER A  1 82  ? -21.862 27.464  16.286  1.00 48.47  ? 144 SER A OG    1 
ATOM   516   N N     . ILE A  1 83  ? -20.968 26.992  12.825  1.00 41.48  ? 145 ILE A N     1 
ATOM   517   C CA    . ILE A  1 83  ? -19.812 26.656  11.999  1.00 40.63  ? 145 ILE A CA    1 
ATOM   518   C C     . ILE A  1 83  ? -19.594 27.708  10.892  1.00 40.76  ? 145 ILE A C     1 
ATOM   519   O O     . ILE A  1 83  ? -18.470 27.922  10.428  1.00 44.07  ? 145 ILE A O     1 
ATOM   520   C CB    . ILE A  1 83  ? -19.952 25.230  11.400  1.00 39.39  ? 145 ILE A CB    1 
ATOM   521   C CG1   . ILE A  1 83  ? -18.612 24.724  10.847  1.00 38.04  ? 145 ILE A CG1   1 
ATOM   522   C CG2   . ILE A  1 83  ? -21.033 25.192  10.334  1.00 38.69  ? 145 ILE A CG2   1 
ATOM   523   C CD1   . ILE A  1 83  ? -17.565 24.465  11.913  1.00 38.07  ? 145 ILE A CD1   1 
ATOM   524   N N     . SER A  1 84  ? -20.674 28.362  10.485  1.00 38.88  ? 146 SER A N     1 
ATOM   525   C CA    . SER A  1 84  ? -20.624 29.470  9.534   1.00 37.13  ? 146 SER A CA    1 
ATOM   526   C C     . SER A  1 84  ? -19.625 30.569  9.884   1.00 35.41  ? 146 SER A C     1 
ATOM   527   O O     . SER A  1 84  ? -18.948 31.069  8.994   1.00 33.94  ? 146 SER A O     1 
ATOM   528   C CB    . SER A  1 84  ? -22.015 30.085  9.409   1.00 37.80  ? 146 SER A CB    1 
ATOM   529   O OG    . SER A  1 84  ? -22.611 30.224  10.683  1.00 37.96  ? 146 SER A OG    1 
ATOM   530   N N     . ASP A  1 85  ? -19.537 30.937  11.169  1.00 35.87  ? 147 ASP A N     1 
ATOM   531   C CA    . ASP A  1 85  ? -18.593 31.971  11.643  1.00 35.23  ? 147 ASP A CA    1 
ATOM   532   C C     . ASP A  1 85  ? -17.171 31.603  11.250  1.00 33.46  ? 147 ASP A C     1 
ATOM   533   O O     . ASP A  1 85  ? -16.408 32.453  10.788  1.00 32.17  ? 147 ASP A O     1 
ATOM   534   C CB    . ASP A  1 85  ? -18.650 32.139  13.166  1.00 37.46  ? 147 ASP A CB    1 
ATOM   535   C CG    . ASP A  1 85  ? -20.018 32.581  13.677  1.00 39.38  ? 147 ASP A CG    1 
ATOM   536   O OD1   . ASP A  1 85  ? -20.751 33.269  12.932  1.00 43.02  ? 147 ASP A OD1   1 
ATOM   537   O OD2   . ASP A  1 85  ? -20.353 32.232  14.838  1.00 39.75  ? 147 ASP A OD2   1 
ATOM   538   N N     . TYR A  1 86  ? -16.834 30.328  11.418  1.00 32.00  ? 148 TYR A N     1 
ATOM   539   C CA    . TYR A  1 86  ? -15.557 29.812  10.965  1.00 32.87  ? 148 TYR A CA    1 
ATOM   540   C C     . TYR A  1 86  ? -15.442 29.778  9.422   1.00 34.12  ? 148 TYR A C     1 
ATOM   541   O O     . TYR A  1 86  ? -14.373 30.102  8.876   1.00 34.38  ? 148 TYR A O     1 
ATOM   542   C CB    . TYR A  1 86  ? -15.286 28.443  11.600  1.00 33.48  ? 148 TYR A CB    1 
ATOM   543   C CG    . TYR A  1 86  ? -15.122 28.547  13.102  1.00 34.12  ? 148 TYR A CG    1 
ATOM   544   C CD1   . TYR A  1 86  ? -13.934 29.013  13.647  1.00 35.95  ? 148 TYR A CD1   1 
ATOM   545   C CD2   . TYR A  1 86  ? -16.157 28.217  13.970  1.00 34.19  ? 148 TYR A CD2   1 
ATOM   546   C CE1   . TYR A  1 86  ? -13.772 29.138  15.015  1.00 36.21  ? 148 TYR A CE1   1 
ATOM   547   C CE2   . TYR A  1 86  ? -16.007 28.327  15.342  1.00 34.14  ? 148 TYR A CE2   1 
ATOM   548   C CZ    . TYR A  1 86  ? -14.818 28.791  15.856  1.00 35.67  ? 148 TYR A CZ    1 
ATOM   549   O OH    . TYR A  1 86  ? -14.660 28.905  17.208  1.00 36.45  ? 148 TYR A OH    1 
ATOM   550   N N     . SER A  1 87  ? -16.516 29.415  8.710   1.00 34.18  ? 149 SER A N     1 
ATOM   551   C CA    . SER A  1 87  ? -16.464 29.430  7.237   1.00 33.99  ? 149 SER A CA    1 
ATOM   552   C C     . SER A  1 87  ? -16.097 30.815  6.692   1.00 34.74  ? 149 SER A C     1 
ATOM   553   O O     . SER A  1 87  ? -15.318 30.904  5.748   1.00 36.80  ? 149 SER A O     1 
ATOM   554   C CB    . SER A  1 87  ? -17.739 28.863  6.586   1.00 33.72  ? 149 SER A CB    1 
ATOM   555   O OG    . SER A  1 87  ? -18.825 29.768  6.583   1.00 34.24  ? 149 SER A OG    1 
ATOM   556   N N     . GLU A  1 88  ? -16.592 31.885  7.320   1.00 35.74  ? 150 GLU A N     1 
ATOM   557   C CA    . GLU A  1 88  ? -16.210 33.265  6.939   1.00 35.60  ? 150 GLU A CA    1 
ATOM   558   C C     . GLU A  1 88  ? -14.735 33.558  7.125   1.00 35.33  ? 150 GLU A C     1 
ATOM   559   O O     . GLU A  1 88  ? -14.086 34.006  6.178   1.00 33.85  ? 150 GLU A O     1 
ATOM   560   C CB    . GLU A  1 88  ? -17.018 34.310  7.696   1.00 36.53  ? 150 GLU A CB    1 
ATOM   561   C CG    . GLU A  1 88  ? -18.439 34.425  7.169   1.00 39.74  ? 150 GLU A CG    1 
ATOM   562   C CD    . GLU A  1 88  ? -19.172 35.675  7.646   1.00 41.36  ? 150 GLU A CD    1 
ATOM   563   O OE1   . GLU A  1 88  ? -18.777 36.264  8.674   1.00 42.56  ? 150 GLU A OE1   1 
ATOM   564   O OE2   . GLU A  1 88  ? -20.164 36.055  6.991   1.00 40.65  ? 150 GLU A OE2   1 
ATOM   565   N N     . LYS A  1 89  ? -14.208 33.289  8.323   1.00 35.64  ? 151 LYS A N     1 
ATOM   566   C CA    . LYS A  1 89  ? -12.787 33.501  8.597   1.00 37.58  ? 151 LYS A CA    1 
ATOM   567   C C     . LYS A  1 89  ? -11.956 32.633  7.657   1.00 39.63  ? 151 LYS A C     1 
ATOM   568   O O     . LYS A  1 89  ? -10.925 33.095  7.145   1.00 38.86  ? 151 LYS A O     1 
ATOM   569   C CB    . LYS A  1 89  ? -12.403 33.175  10.053  1.00 39.58  ? 151 LYS A CB    1 
ATOM   570   C CG    . LYS A  1 89  ? -12.654 34.279  11.077  1.00 40.37  ? 151 LYS A CG    1 
ATOM   571   C CD    . LYS A  1 89  ? -12.282 33.835  12.501  1.00 41.33  ? 151 LYS A CD    1 
ATOM   572   C CE    . LYS A  1 89  ? -13.162 34.474  13.584  1.00 40.30  ? 151 LYS A CE    1 
ATOM   573   N NZ    . LYS A  1 89  ? -13.638 33.485  14.601  1.00 38.58  ? 151 LYS A NZ    1 
ATOM   574   N N     . ILE A  1 90  ? -12.399 31.383  7.449   1.00 40.87  ? 152 ILE A N     1 
ATOM   575   C CA    . ILE A  1 90  ? -11.707 30.437  6.567   1.00 41.60  ? 152 ILE A CA    1 
ATOM   576   C C     . ILE A  1 90  ? -11.660 30.964  5.151   1.00 44.12  ? 152 ILE A C     1 
ATOM   577   O O     . ILE A  1 90  ? -10.605 30.948  4.504   1.00 48.42  ? 152 ILE A O     1 
ATOM   578   C CB    . ILE A  1 90  ? -12.393 29.057  6.510   1.00 41.16  ? 152 ILE A CB    1 
ATOM   579   C CG1   . ILE A  1 90  ? -12.102 28.260  7.774   1.00 40.62  ? 152 ILE A CG1   1 
ATOM   580   C CG2   . ILE A  1 90  ? -11.868 28.245  5.327   1.00 42.56  ? 152 ILE A CG2   1 
ATOM   581   C CD1   . ILE A  1 90  ? -12.962 27.027  7.924   1.00 39.88  ? 152 ILE A CD1   1 
ATOM   582   N N     . ILE A  1 91  ? -12.814 31.388  4.650   1.00 44.97  ? 153 ILE A N     1 
ATOM   583   C CA    . ILE A  1 91  ? -12.900 31.879  3.283   1.00 45.22  ? 153 ILE A CA    1 
ATOM   584   C C     . ILE A  1 91  ? -12.001 33.075  3.090   1.00 45.79  ? 153 ILE A C     1 
ATOM   585   O O     . ILE A  1 91  ? -11.226 33.129  2.134   1.00 49.07  ? 153 ILE A O     1 
ATOM   586   C CB    . ILE A  1 91  ? -14.343 32.194  2.896   1.00 42.88  ? 153 ILE A CB    1 
ATOM   587   C CG1   . ILE A  1 91  ? -15.066 30.870  2.633   1.00 40.88  ? 153 ILE A CG1   1 
ATOM   588   C CG2   . ILE A  1 91  ? -14.385 33.092  1.664   1.00 42.85  ? 153 ILE A CG2   1 
ATOM   589   C CD1   . ILE A  1 91  ? -16.559 30.957  2.793   1.00 41.90  ? 153 ILE A CD1   1 
ATOM   590   N N     . LYS A  1 92  ? -12.079 34.011  4.018   1.00 45.58  ? 154 LYS A N     1 
ATOM   591   C CA    . LYS A  1 92  ? -11.234 35.187  3.955   1.00 47.25  ? 154 LYS A CA    1 
ATOM   592   C C     . LYS A  1 92  ? -9.733  34.830  3.924   1.00 43.76  ? 154 LYS A C     1 
ATOM   593   O O     . LYS A  1 92  ? -8.978  35.377  3.120   1.00 43.75  ? 154 LYS A O     1 
ATOM   594   C CB    . LYS A  1 92  ? -11.539 36.118  5.129   1.00 53.13  ? 154 LYS A CB    1 
ATOM   595   C CG    . LYS A  1 92  ? -11.247 37.565  4.798   1.00 57.68  ? 154 LYS A CG    1 
ATOM   596   C CD    . LYS A  1 92  ? -10.832 38.377  6.000   1.00 59.04  ? 154 LYS A CD    1 
ATOM   597   C CE    . LYS A  1 92  ? -9.977  39.521  5.508   1.00 62.28  ? 154 LYS A CE    1 
ATOM   598   N NZ    . LYS A  1 92  ? -9.766  40.489  6.606   1.00 66.11  ? 154 LYS A NZ    1 
ATOM   599   N N     . ALA A  1 93  ? -9.313  33.904  4.786   1.00 41.40  ? 155 ALA A N     1 
ATOM   600   C CA    . ALA A  1 93  ? -7.918  33.443  4.839   1.00 38.51  ? 155 ALA A CA    1 
ATOM   601   C C     . ALA A  1 93  ? -7.401  32.910  3.488   1.00 37.95  ? 155 ALA A C     1 
ATOM   602   O O     . ALA A  1 93  ? -6.215  33.032  3.183   1.00 35.68  ? 155 ALA A O     1 
ATOM   603   C CB    . ALA A  1 93  ? -7.767  32.382  5.914   1.00 37.46  ? 155 ALA A CB    1 
ATOM   604   N N     . ASN A  1 94  ? -8.294  32.327  2.688   1.00 38.20  ? 156 ASN A N     1 
ATOM   605   C CA    . ASN A  1 94  ? -7.937  31.790  1.374   1.00 38.91  ? 156 ASN A CA    1 
ATOM   606   C C     . ASN A  1 94  ? -8.176  32.748  0.200   1.00 39.91  ? 156 ASN A C     1 
ATOM   607   O O     . ASN A  1 94  ? -8.090  32.334  -0.955  1.00 39.90  ? 156 ASN A O     1 
ATOM   608   C CB    . ASN A  1 94  ? -8.708  30.489  1.120   1.00 38.91  ? 156 ASN A CB    1 
ATOM   609   C CG    . ASN A  1 94  ? -8.409  29.413  2.154   1.00 38.34  ? 156 ASN A CG    1 
ATOM   610   O OD1   . ASN A  1 94  ? -7.435  28.670  2.026   1.00 35.77  ? 156 ASN A OD1   1 
ATOM   611   N ND2   . ASN A  1 94  ? -9.258  29.309  3.169   1.00 36.91  ? 156 ASN A ND2   1 
ATOM   612   N N     . HIS A  1 95  ? -8.478  34.016  0.497   1.00 41.87  ? 157 HIS A N     1 
ATOM   613   C CA    . HIS A  1 95  ? -8.654  35.079  -0.522  1.00 42.26  ? 157 HIS A CA    1 
ATOM   614   C C     . HIS A  1 95  ? -9.842  34.851  -1.470  1.00 40.54  ? 157 HIS A C     1 
ATOM   615   O O     . HIS A  1 95  ? -9.766  35.118  -2.668  1.00 40.27  ? 157 HIS A O     1 
ATOM   616   C CB    . HIS A  1 95  ? -7.345  35.297  -1.308  1.00 42.55  ? 157 HIS A CB    1 
ATOM   617   C CG    . HIS A  1 95  ? -6.146  35.416  -0.426  1.00 44.14  ? 157 HIS A CG    1 
ATOM   618   N ND1   . HIS A  1 95  ? -6.038  36.367  0.572   1.00 44.63  ? 157 HIS A ND1   1 
ATOM   619   C CD2   . HIS A  1 95  ? -5.027  34.665  -0.353  1.00 45.82  ? 157 HIS A CD2   1 
ATOM   620   C CE1   . HIS A  1 95  ? -4.888  36.215  1.202   1.00 44.29  ? 157 HIS A CE1   1 
ATOM   621   N NE2   . HIS A  1 95  ? -4.258  35.185  0.662   1.00 47.74  ? 157 HIS A NE2   1 
ATOM   622   N N     . LEU A  1 96  ? -10.942 34.358  -0.927  1.00 38.84  ? 158 LEU A N     1 
ATOM   623   C CA    . LEU A  1 96  ? -12.104 34.094  -1.741  1.00 40.32  ? 158 LEU A CA    1 
ATOM   624   C C     . LEU A  1 96  ? -13.351 34.851  -1.259  1.00 41.44  ? 158 LEU A C     1 
ATOM   625   O O     . LEU A  1 96  ? -14.454 34.579  -1.737  1.00 41.77  ? 158 LEU A O     1 
ATOM   626   C CB    . LEU A  1 96  ? -12.367 32.586  -1.789  1.00 40.17  ? 158 LEU A CB    1 
ATOM   627   C CG    . LEU A  1 96  ? -11.325 31.709  -2.484  1.00 40.68  ? 158 LEU A CG    1 
ATOM   628   C CD1   . LEU A  1 96  ? -11.644 30.234  -2.268  1.00 41.44  ? 158 LEU A CD1   1 
ATOM   629   C CD2   . LEU A  1 96  ? -11.240 32.002  -3.969  1.00 40.29  ? 158 LEU A CD2   1 
ATOM   630   N N     . ASP A  1 97  ? -13.187 35.812  -0.347  1.00 42.04  ? 159 ASP A N     1 
ATOM   631   C CA    . ASP A  1 97  ? -14.346 36.540  0.235   1.00 41.93  ? 159 ASP A CA    1 
ATOM   632   C C     . ASP A  1 97  ? -15.051 37.504  -0.753  1.00 43.90  ? 159 ASP A C     1 
ATOM   633   O O     . ASP A  1 97  ? -16.243 37.782  -0.611  1.00 41.99  ? 159 ASP A O     1 
ATOM   634   C CB    . ASP A  1 97  ? -13.962 37.258  1.545   1.00 40.32  ? 159 ASP A CB    1 
ATOM   635   C CG    . ASP A  1 97  ? -12.677 38.074  1.430   1.00 39.05  ? 159 ASP A CG    1 
ATOM   636   O OD1   . ASP A  1 97  ? -11.721 37.602  0.782   1.00 39.11  ? 159 ASP A OD1   1 
ATOM   637   O OD2   . ASP A  1 97  ? -12.611 39.178  2.005   1.00 38.23  ? 159 ASP A OD2   1 
ATOM   638   N N     . ASN A  1 98  ? -14.304 37.983  -1.753  1.00 48.29  ? 160 ASN A N     1 
ATOM   639   C CA    . ASN A  1 98  ? -14.848 38.730  -2.912  1.00 48.30  ? 160 ASN A CA    1 
ATOM   640   C C     . ASN A  1 98  ? -15.854 37.902  -3.759  1.00 46.66  ? 160 ASN A C     1 
ATOM   641   O O     . ASN A  1 98  ? -16.741 38.471  -4.387  1.00 47.97  ? 160 ASN A O     1 
ATOM   642   C CB    . ASN A  1 98  ? -13.696 39.223  -3.811  1.00 48.30  ? 160 ASN A CB    1 
ATOM   643   C CG    . ASN A  1 98  ? -12.877 38.067  -4.401  1.00 52.14  ? 160 ASN A CG    1 
ATOM   644   O OD1   . ASN A  1 98  ? -12.641 37.055  -3.729  1.00 55.23  ? 160 ASN A OD1   1 
ATOM   645   N ND2   . ASN A  1 98  ? -12.425 38.212  -5.644  1.00 52.29  ? 160 ASN A ND2   1 
ATOM   646   N N     . ILE A  1 99  ? -15.702 36.574  -3.771  1.00 44.02  ? 161 ILE A N     1 
ATOM   647   C CA    . ILE A  1 99  ? -16.549 35.661  -4.561  1.00 42.51  ? 161 ILE A CA    1 
ATOM   648   C C     . ILE A  1 99  ? -17.631 34.942  -3.736  1.00 41.16  ? 161 ILE A C     1 
ATOM   649   O O     . ILE A  1 99  ? -18.744 34.742  -4.201  1.00 39.67  ? 161 ILE A O     1 
ATOM   650   C CB    . ILE A  1 99  ? -15.683 34.586  -5.268  1.00 42.02  ? 161 ILE A CB    1 
ATOM   651   C CG1   . ILE A  1 99  ? -14.765 35.249  -6.302  1.00 42.64  ? 161 ILE A CG1   1 
ATOM   652   C CG2   . ILE A  1 99  ? -16.550 33.512  -5.922  1.00 40.46  ? 161 ILE A CG2   1 
ATOM   653   C CD1   . ILE A  1 99  ? -13.612 34.378  -6.782  1.00 43.60  ? 161 ILE A CD1   1 
ATOM   654   N N     . ILE A  1 100 ? -17.292 34.510  -2.532  1.00 41.55  ? 162 ILE A N     1 
ATOM   655   C CA    . ILE A  1 100 ? -18.221 33.720  -1.734  1.00 42.58  ? 162 ILE A CA    1 
ATOM   656   C C     . ILE A  1 100 ? -18.839 34.629  -0.688  1.00 45.84  ? 162 ILE A C     1 
ATOM   657   O O     . ILE A  1 100 ? -18.145 35.469  -0.100  1.00 51.74  ? 162 ILE A O     1 
ATOM   658   C CB    . ILE A  1 100 ? -17.520 32.528  -1.043  1.00 40.92  ? 162 ILE A CB    1 
ATOM   659   C CG1   . ILE A  1 100 ? -16.823 31.629  -2.079  1.00 41.09  ? 162 ILE A CG1   1 
ATOM   660   C CG2   . ILE A  1 100 ? -18.524 31.718  -0.238  1.00 39.94  ? 162 ILE A CG2   1 
ATOM   661   C CD1   . ILE A  1 100 ? -15.860 30.620  -1.492  1.00 41.58  ? 162 ILE A CD1   1 
ATOM   662   N N     . THR A  1 101 ? -20.138 34.455  -0.455  1.00 44.73  ? 163 THR A N     1 
ATOM   663   C CA    . THR A  1 101 ? -20.839 35.157  0.623   1.00 42.19  ? 163 THR A CA    1 
ATOM   664   C C     . THR A  1 101 ? -21.632 34.124  1.430   1.00 41.96  ? 163 THR A C     1 
ATOM   665   O O     . THR A  1 101 ? -22.354 33.305  0.853   1.00 40.69  ? 163 THR A O     1 
ATOM   666   C CB    . THR A  1 101 ? -21.780 36.236  0.053   1.00 39.73  ? 163 THR A CB    1 
ATOM   667   O OG1   . THR A  1 101 ? -21.065 37.012  -0.912  1.00 36.77  ? 163 THR A OG1   1 
ATOM   668   C CG2   . THR A  1 101 ? -22.321 37.136  1.160   1.00 38.23  ? 163 THR A CG2   1 
ATOM   669   N N     . ILE A  1 102 ? -21.479 34.154  2.752   1.00 41.12  ? 164 ILE A N     1 
ATOM   670   C CA    . ILE A  1 102 ? -22.149 33.189  3.608   1.00 42.08  ? 164 ILE A CA    1 
ATOM   671   C C     . ILE A  1 102 ? -23.352 33.823  4.300   1.00 44.22  ? 164 ILE A C     1 
ATOM   672   O O     . ILE A  1 102 ? -23.237 34.884  4.881   1.00 47.94  ? 164 ILE A O     1 
ATOM   673   C CB    . ILE A  1 102 ? -21.199 32.637  4.682   1.00 41.90  ? 164 ILE A CB    1 
ATOM   674   C CG1   . ILE A  1 102 ? -19.989 31.943  4.054   1.00 41.95  ? 164 ILE A CG1   1 
ATOM   675   C CG2   . ILE A  1 102 ? -21.936 31.637  5.557   1.00 43.79  ? 164 ILE A CG2   1 
ATOM   676   C CD1   . ILE A  1 102 ? -20.311 30.753  3.162   1.00 41.45  ? 164 ILE A CD1   1 
ATOM   677   N N     . PHE A  1 103 ? -24.508 33.175  4.247   1.00 45.92  ? 165 PHE A N     1 
ATOM   678   C CA    . PHE A  1 103 ? -25.691 33.689  4.928   1.00 46.85  ? 165 PHE A CA    1 
ATOM   679   C C     . PHE A  1 103 ? -25.998 32.833  6.140   1.00 48.54  ? 165 PHE A C     1 
ATOM   680   O O     . PHE A  1 103 ? -26.433 31.685  6.032   1.00 46.66  ? 165 PHE A O     1 
ATOM   681   C CB    . PHE A  1 103 ? -26.871 33.759  3.975   1.00 47.93  ? 165 PHE A CB    1 
ATOM   682   C CG    . PHE A  1 103 ? -26.665 34.743  2.865   1.00 51.27  ? 165 PHE A CG    1 
ATOM   683   C CD1   . PHE A  1 103 ? -27.043 36.077  3.007   1.00 50.53  ? 165 PHE A CD1   1 
ATOM   684   C CD2   . PHE A  1 103 ? -26.037 34.343  1.685   1.00 52.50  ? 165 PHE A CD2   1 
ATOM   685   C CE1   . PHE A  1 103 ? -26.827 36.980  1.980   1.00 50.93  ? 165 PHE A CE1   1 
ATOM   686   C CE2   . PHE A  1 103 ? -25.816 35.247  0.657   1.00 52.13  ? 165 PHE A CE2   1 
ATOM   687   C CZ    . PHE A  1 103 ? -26.212 36.563  0.804   1.00 51.23  ? 165 PHE A CZ    1 
ATOM   688   N N     . LYS A  1 104 ? -25.737 33.411  7.304   1.00 50.29  ? 166 LYS A N     1 
ATOM   689   C CA    . LYS A  1 104 ? -25.874 32.709  8.562   1.00 49.99  ? 166 LYS A CA    1 
ATOM   690   C C     . LYS A  1 104 ? -27.379 32.609  8.866   1.00 47.61  ? 166 LYS A C     1 
ATOM   691   O O     . LYS A  1 104 ? -28.006 33.571  9.287   1.00 47.48  ? 166 LYS A O     1 
ATOM   692   C CB    . LYS A  1 104 ? -25.095 33.468  9.651   1.00 51.65  ? 166 LYS A CB    1 
ATOM   693   C CG    . LYS A  1 104 ? -24.176 32.621  10.535  1.00 56.45  ? 166 LYS A CG    1 
ATOM   694   C CD    . LYS A  1 104 ? -24.800 32.155  11.876  1.00 60.00  ? 166 LYS A CD    1 
ATOM   695   C CE    . LYS A  1 104 ? -23.789 32.218  13.038  1.00 56.79  ? 166 LYS A CE    1 
ATOM   696   N NZ    . LYS A  1 104 ? -24.292 31.710  14.344  1.00 54.51  ? 166 LYS A NZ    1 
ATOM   697   N N     . GLY A  1 105 ? -27.968 31.451  8.613   1.00 45.55  ? 167 GLY A N     1 
ATOM   698   C CA    . GLY A  1 105 ? -29.392 31.276  8.849   1.00 44.22  ? 167 GLY A CA    1 
ATOM   699   C C     . GLY A  1 105 ? -29.935 30.006  8.235   1.00 45.15  ? 167 GLY A C     1 
ATOM   700   O O     . GLY A  1 105 ? -29.220 29.270  7.558   1.00 47.12  ? 167 GLY A O     1 
ATOM   701   N N     . LYS A  1 106 ? -31.209 29.743  8.488   1.00 45.51  ? 168 LYS A N     1 
ATOM   702   C CA    . LYS A  1 106 ? -31.882 28.562  7.950   1.00 46.72  ? 168 LYS A CA    1 
ATOM   703   C C     . LYS A  1 106 ? -32.212 28.787  6.471   1.00 43.71  ? 168 LYS A C     1 
ATOM   704   O O     . LYS A  1 106 ? -32.593 29.878  6.088   1.00 45.11  ? 168 LYS A O     1 
ATOM   705   C CB    . LYS A  1 106 ? -33.146 28.282  8.764   1.00 49.41  ? 168 LYS A CB    1 
ATOM   706   C CG    . LYS A  1 106 ? -33.467 26.805  8.962   1.00 52.65  ? 168 LYS A CG    1 
ATOM   707   C CD    . LYS A  1 106 ? -34.540 26.584  10.024  1.00 54.78  ? 168 LYS A CD    1 
ATOM   708   C CE    . LYS A  1 106 ? -34.098 27.072  11.403  1.00 56.30  ? 168 LYS A CE    1 
ATOM   709   N NZ    . LYS A  1 106 ? -35.125 26.798  12.449  1.00 57.26  ? 168 LYS A NZ    1 
ATOM   710   N N     . VAL A  1 107 ? -32.024 27.769  5.637   1.00 41.18  ? 169 VAL A N     1 
ATOM   711   C CA    . VAL A  1 107 ? -32.282 27.874  4.187   1.00 37.80  ? 169 VAL A CA    1 
ATOM   712   C C     . VAL A  1 107 ? -33.735 28.331  3.954   1.00 37.47  ? 169 VAL A C     1 
ATOM   713   O O     . VAL A  1 107 ? -34.027 29.266  3.170   1.00 32.92  ? 169 VAL A O     1 
ATOM   714   C CB    . VAL A  1 107 ? -31.986 26.512  3.486   1.00 35.25  ? 169 VAL A CB    1 
ATOM   715   C CG1   . VAL A  1 107 ? -32.663 26.400  2.140   1.00 35.50  ? 169 VAL A CG1   1 
ATOM   716   C CG2   . VAL A  1 107 ? -30.501 26.319  3.303   1.00 34.16  ? 169 VAL A CG2   1 
ATOM   717   N N     . GLU A  1 108 ? -34.639 27.703  4.700   1.00 37.78  ? 170 GLU A N     1 
ATOM   718   C CA    . GLU A  1 108 ? -36.058 27.970  4.536   1.00 37.50  ? 170 GLU A CA    1 
ATOM   719   C C     . GLU A  1 108 ? -36.451 29.355  5.082   1.00 36.81  ? 170 GLU A C     1 
ATOM   720   O O     . GLU A  1 108 ? -37.616 29.718  5.040   1.00 37.00  ? 170 GLU A O     1 
ATOM   721   C CB    . GLU A  1 108 ? -36.938 26.836  5.100   1.00 36.97  ? 170 GLU A CB    1 
ATOM   722   C CG    . GLU A  1 108 ? -36.335 25.934  6.181   1.00 38.47  ? 170 GLU A CG    1 
ATOM   723   C CD    . GLU A  1 108 ? -35.408 24.846  5.617   1.00 38.37  ? 170 GLU A CD    1 
ATOM   724   O OE1   . GLU A  1 108 ? -35.873 23.881  4.977   1.00 39.37  ? 170 GLU A OE1   1 
ATOM   725   O OE2   . GLU A  1 108 ? -34.196 24.952  5.817   1.00 36.98  ? 170 GLU A OE2   1 
ATOM   726   N N     . GLU A  1 109 ? -35.470 30.137  5.533   1.00 36.06  ? 171 GLU A N     1 
ATOM   727   C CA    . GLU A  1 109 ? -35.714 31.469  6.070   1.00 36.54  ? 171 GLU A CA    1 
ATOM   728   C C     . GLU A  1 109 ? -34.913 32.597  5.420   1.00 38.55  ? 171 GLU A C     1 
ATOM   729   O O     . GLU A  1 109 ? -35.407 33.703  5.312   1.00 42.27  ? 171 GLU A O     1 
ATOM   730   C CB    . GLU A  1 109 ? -35.461 31.484  7.573   1.00 35.65  ? 171 GLU A CB    1 
ATOM   731   C CG    . GLU A  1 109 ? -36.563 30.810  8.372   1.00 36.71  ? 171 GLU A CG    1 
ATOM   732   C CD    . GLU A  1 109 ? -36.255 30.730  9.854   1.00 36.88  ? 171 GLU A CD    1 
ATOM   733   O OE1   . GLU A  1 109 ? -35.195 31.213  10.282  1.00 39.24  ? 171 GLU A OE1   1 
ATOM   734   O OE2   . GLU A  1 109 ? -37.072 30.184  10.603  1.00 36.19  ? 171 GLU A OE2   1 
ATOM   735   N N     . VAL A  1 110 ? -33.685 32.368  4.992   1.00 40.32  ? 172 VAL A N     1 
ATOM   736   C CA    . VAL A  1 110 ? -32.916 33.487  4.454   1.00 41.55  ? 172 VAL A CA    1 
ATOM   737   C C     . VAL A  1 110 ? -33.392 33.887  3.049   1.00 40.46  ? 172 VAL A C     1 
ATOM   738   O O     . VAL A  1 110 ? -34.157 33.163  2.391   1.00 36.38  ? 172 VAL A O     1 
ATOM   739   C CB    . VAL A  1 110 ? -31.378 33.233  4.458   1.00 44.63  ? 172 VAL A CB    1 
ATOM   740   C CG1   . VAL A  1 110 ? -30.883 32.850  5.853   1.00 46.03  ? 172 VAL A CG1   1 
ATOM   741   C CG2   . VAL A  1 110 ? -30.959 32.187  3.426   1.00 45.44  ? 172 VAL A CG2   1 
ATOM   742   N N     . GLU A  1 111 ? -32.904 35.046  2.616   1.00 40.81  ? 173 GLU A N     1 
ATOM   743   C CA    . GLU A  1 111 ? -33.219 35.602  1.322   1.00 40.88  ? 173 GLU A CA    1 
ATOM   744   C C     . GLU A  1 111 ? -31.936 36.022  0.614   1.00 40.94  ? 173 GLU A C     1 
ATOM   745   O O     . GLU A  1 111 ? -31.018 36.561  1.222   1.00 38.95  ? 173 GLU A O     1 
ATOM   746   C CB    . GLU A  1 111 ? -34.140 36.795  1.505   1.00 41.93  ? 173 GLU A CB    1 
ATOM   747   C CG    . GLU A  1 111 ? -35.380 36.720  0.624   1.00 43.20  ? 173 GLU A CG    1 
ATOM   748   C CD    . GLU A  1 111 ? -36.326 35.548  0.973   1.00 42.03  ? 173 GLU A CD    1 
ATOM   749   O OE1   . GLU A  1 111 ? -36.816 34.876  0.050   1.00 38.65  ? 173 GLU A OE1   1 
ATOM   750   O OE2   . GLU A  1 111 ? -36.605 35.293  2.164   1.00 41.59  ? 173 GLU A OE2   1 
ATOM   751   N N     . LEU A  1 112 ? -31.874 35.757  -0.680  1.00 42.98  ? 174 LEU A N     1 
ATOM   752   C CA    . LEU A  1 112 ? -30.641 35.943  -1.428  1.00 45.13  ? 174 LEU A CA    1 
ATOM   753   C C     . LEU A  1 112 ? -30.702 37.232  -2.217  1.00 43.93  ? 174 LEU A C     1 
ATOM   754   O O     . LEU A  1 112 ? -31.773 37.708  -2.515  1.00 46.78  ? 174 LEU A O     1 
ATOM   755   C CB    . LEU A  1 112 ? -30.432 34.755  -2.373  1.00 47.53  ? 174 LEU A CB    1 
ATOM   756   C CG    . LEU A  1 112 ? -30.248 33.376  -1.711  1.00 48.94  ? 174 LEU A CG    1 
ATOM   757   C CD1   . LEU A  1 112 ? -30.284 32.268  -2.749  1.00 49.13  ? 174 LEU A CD1   1 
ATOM   758   C CD2   . LEU A  1 112 ? -28.928 33.312  -0.945  1.00 50.57  ? 174 LEU A CD2   1 
ATOM   759   N N     . PRO A  1 113 ? -29.550 37.795  -2.582  1.00 42.10  ? 175 PRO A N     1 
ATOM   760   C CA    . PRO A  1 113 ? -29.550 39.031  -3.367  1.00 40.79  ? 175 PRO A CA    1 
ATOM   761   C C     . PRO A  1 113 ? -29.970 38.880  -4.840  1.00 40.34  ? 175 PRO A C     1 
ATOM   762   O O     . PRO A  1 113 ? -29.952 39.854  -5.563  1.00 39.24  ? 175 PRO A O     1 
ATOM   763   C CB    . PRO A  1 113 ? -28.091 39.494  -3.275  1.00 41.48  ? 175 PRO A CB    1 
ATOM   764   C CG    . PRO A  1 113 ? -27.310 38.250  -3.016  1.00 42.12  ? 175 PRO A CG    1 
ATOM   765   C CD    . PRO A  1 113 ? -28.196 37.393  -2.171  1.00 42.31  ? 175 PRO A CD    1 
ATOM   766   N N     . VAL A  1 114 ? -30.305 37.674  -5.292  1.00 42.10  ? 176 VAL A N     1 
ATOM   767   C CA    . VAL A  1 114 ? -30.769 37.444  -6.675  1.00 42.64  ? 176 VAL A CA    1 
ATOM   768   C C     . VAL A  1 114 ? -32.038 36.620  -6.625  1.00 45.57  ? 176 VAL A C     1 
ATOM   769   O O     . VAL A  1 114 ? -32.362 36.020  -5.593  1.00 48.66  ? 176 VAL A O     1 
ATOM   770   C CB    . VAL A  1 114 ? -29.736 36.683  -7.546  1.00 41.97  ? 176 VAL A CB    1 
ATOM   771   C CG1   . VAL A  1 114 ? -28.442 37.468  -7.653  1.00 40.66  ? 176 VAL A CG1   1 
ATOM   772   C CG2   . VAL A  1 114 ? -29.453 35.273  -7.015  1.00 41.90  ? 176 VAL A CG2   1 
ATOM   773   N N     . GLU A  1 115 ? -32.766 36.571  -7.722  1.00 47.53  ? 177 GLU A N     1 
ATOM   774   C CA    . GLU A  1 115 ? -34.006 35.812  -7.704  1.00 53.58  ? 177 GLU A CA    1 
ATOM   775   C C     . GLU A  1 115 ? -33.744 34.349  -7.961  1.00 51.41  ? 177 GLU A C     1 
ATOM   776   O O     . GLU A  1 115 ? -34.370 33.480  -7.356  1.00 50.55  ? 177 GLU A O     1 
ATOM   777   C CB    . GLU A  1 115 ? -34.997 36.354  -8.729  1.00 60.22  ? 177 GLU A CB    1 
ATOM   778   C CG    . GLU A  1 115 ? -35.768 37.562  -8.230  1.00 65.13  ? 177 GLU A CG    1 
ATOM   779   C CD    . GLU A  1 115 ? -36.888 37.958  -9.160  1.00 72.07  ? 177 GLU A CD    1 
ATOM   780   O OE1   . GLU A  1 115 ? -37.652 38.874  -8.784  1.00 79.80  ? 177 GLU A OE1   1 
ATOM   781   O OE2   . GLU A  1 115 ? -37.005 37.361  -10.258 1.00 74.59  ? 177 GLU A OE2   1 
ATOM   782   N N     . LYS A  1 116 ? -32.821 34.091  -8.874  1.00 50.94  ? 178 LYS A N     1 
ATOM   783   C CA    . LYS A  1 116 ? -32.583 32.753  -9.365  1.00 48.86  ? 178 LYS A CA    1 
ATOM   784   C C     . LYS A  1 116 ? -31.100 32.489  -9.423  1.00 47.10  ? 178 LYS A C     1 
ATOM   785   O O     . LYS A  1 116 ? -30.294 33.403  -9.399  1.00 47.07  ? 178 LYS A O     1 
ATOM   786   C CB    . LYS A  1 116 ? -33.215 32.584  -10.745 1.00 48.42  ? 178 LYS A CB    1 
ATOM   787   C CG    . LYS A  1 116 ? -34.384 31.612  -10.807 1.00 49.06  ? 178 LYS A CG    1 
ATOM   788   C CD    . LYS A  1 116 ? -35.554 31.927  -9.883  1.00 48.41  ? 178 LYS A CD    1 
ATOM   789   C CE    . LYS A  1 116 ? -36.665 30.915  -10.116 1.00 48.56  ? 178 LYS A CE    1 
ATOM   790   N NZ    . LYS A  1 116 ? -37.793 31.052  -9.162  1.00 48.77  ? 178 LYS A NZ    1 
ATOM   791   N N     . VAL A  1 117 ? -30.765 31.214  -9.483  1.00 47.90  ? 179 VAL A N     1 
ATOM   792   C CA    . VAL A  1 117 ? -29.397 30.745  -9.355  1.00 49.10  ? 179 VAL A CA    1 
ATOM   793   C C     . VAL A  1 117 ? -29.125 29.690  -10.434 1.00 46.24  ? 179 VAL A C     1 
ATOM   794   O O     . VAL A  1 117 ? -29.988 28.850  -10.726 1.00 42.55  ? 179 VAL A O     1 
ATOM   795   C CB    . VAL A  1 117 ? -29.193 30.145  -7.939  1.00 53.24  ? 179 VAL A CB    1 
ATOM   796   C CG1   . VAL A  1 117 ? -28.070 29.119  -7.909  1.00 56.54  ? 179 VAL A CG1   1 
ATOM   797   C CG2   . VAL A  1 117 ? -28.926 31.242  -6.914  1.00 54.24  ? 179 VAL A CG2   1 
ATOM   798   N N     . ASP A  1 118 ? -27.913 29.715  -10.992 1.00 43.29  ? 180 ASP A N     1 
ATOM   799   C CA    . ASP A  1 118 ? -27.541 28.794  -12.067 1.00 41.51  ? 180 ASP A CA    1 
ATOM   800   C C     . ASP A  1 118 ? -27.361 27.333  -11.585 1.00 41.11  ? 180 ASP A C     1 
ATOM   801   O O     . ASP A  1 118 ? -27.843 26.393  -12.237 1.00 40.31  ? 180 ASP A O     1 
ATOM   802   C CB    . ASP A  1 118 ? -26.259 29.267  -12.764 1.00 40.56  ? 180 ASP A CB    1 
ATOM   803   C CG    . ASP A  1 118 ? -26.435 30.581  -13.498 1.00 40.47  ? 180 ASP A CG    1 
ATOM   804   O OD1   . ASP A  1 118 ? -27.328 30.659  -14.364 1.00 40.29  ? 180 ASP A OD1   1 
ATOM   805   O OD2   . ASP A  1 118 ? -25.669 31.534  -13.226 1.00 40.41  ? 180 ASP A OD2   1 
ATOM   806   N N     . ILE A  1 119 ? -26.668 27.153  -10.456 1.00 39.51  ? 181 ILE A N     1 
ATOM   807   C CA    . ILE A  1 119 ? -26.250 25.832  -9.962  1.00 38.04  ? 181 ILE A CA    1 
ATOM   808   C C     . ILE A  1 119 ? -26.453 25.719  -8.455  1.00 38.03  ? 181 ILE A C     1 
ATOM   809   O O     . ILE A  1 119 ? -26.091 26.630  -7.713  1.00 39.04  ? 181 ILE A O     1 
ATOM   810   C CB    . ILE A  1 119 ? -24.752 25.594  -10.229 1.00 36.70  ? 181 ILE A CB    1 
ATOM   811   C CG1   . ILE A  1 119 ? -24.459 25.640  -11.722 1.00 37.15  ? 181 ILE A CG1   1 
ATOM   812   C CG2   . ILE A  1 119 ? -24.307 24.252  -9.668  1.00 36.19  ? 181 ILE A CG2   1 
ATOM   813   C CD1   . ILE A  1 119 ? -22.984 25.723  -12.044 1.00 38.34  ? 181 ILE A CD1   1 
ATOM   814   N N     . ILE A  1 120 ? -26.993 24.586  -8.013  1.00 38.29  ? 182 ILE A N     1 
ATOM   815   C CA    . ILE A  1 120 ? -27.020 24.218  -6.593  1.00 39.36  ? 182 ILE A CA    1 
ATOM   816   C C     . ILE A  1 120 ? -26.075 23.042  -6.263  1.00 38.69  ? 182 ILE A C     1 
ATOM   817   O O     . ILE A  1 120 ? -26.135 21.969  -6.883  1.00 38.44  ? 182 ILE A O     1 
ATOM   818   C CB    . ILE A  1 120 ? -28.432 23.818  -6.163  1.00 40.66  ? 182 ILE A CB    1 
ATOM   819   C CG1   . ILE A  1 120 ? -29.271 25.077  -5.958  1.00 42.02  ? 182 ILE A CG1   1 
ATOM   820   C CG2   . ILE A  1 120 ? -28.382 22.975  -4.895  1.00 40.50  ? 182 ILE A CG2   1 
ATOM   821   C CD1   . ILE A  1 120 ? -30.739 24.789  -5.706  1.00 43.41  ? 182 ILE A CD1   1 
ATOM   822   N N     . ILE A  1 121 ? -25.221 23.240  -5.267  1.00 35.97  ? 183 ILE A N     1 
ATOM   823   C CA    . ILE A  1 121 ? -24.342 22.173  -4.792  1.00 34.26  ? 183 ILE A CA    1 
ATOM   824   C C     . ILE A  1 121 ? -24.748 21.871  -3.357  1.00 32.60  ? 183 ILE A C     1 
ATOM   825   O O     . ILE A  1 121 ? -25.174 22.769  -2.644  1.00 32.11  ? 183 ILE A O     1 
ATOM   826   C CB    . ILE A  1 121 ? -22.840 22.551  -4.892  1.00 32.73  ? 183 ILE A CB    1 
ATOM   827   C CG1   . ILE A  1 121 ? -22.506 23.741  -4.010  1.00 33.29  ? 183 ILE A CG1   1 
ATOM   828   C CG2   . ILE A  1 121 ? -22.458 22.897  -6.317  1.00 31.33  ? 183 ILE A CG2   1 
ATOM   829   C CD1   . ILE A  1 121 ? -21.094 24.226  -4.205  1.00 34.61  ? 183 ILE A CD1   1 
ATOM   830   N N     . SER A  1 122 ? -24.650 20.613  -2.939  1.00 32.53  ? 184 SER A N     1 
ATOM   831   C CA    . SER A  1 122 ? -24.982 20.248  -1.557  1.00 32.30  ? 184 SER A CA    1 
ATOM   832   C C     . SER A  1 122 ? -24.538 18.836  -1.240  1.00 31.99  ? 184 SER A C     1 
ATOM   833   O O     . SER A  1 122 ? -24.700 17.960  -2.093  1.00 29.25  ? 184 SER A O     1 
ATOM   834   C CB    . SER A  1 122 ? -26.491 20.330  -1.349  1.00 31.47  ? 184 SER A CB    1 
ATOM   835   O OG    . SER A  1 122 ? -26.807 20.270  0.020   1.00 31.01  ? 184 SER A OG    1 
ATOM   836   N N     . GLU A  1 123 ? -23.953 18.631  -0.047  1.00 33.15  ? 185 GLU A N     1 
ATOM   837   C CA    . GLU A  1 123 ? -23.854 17.280  0.551   1.00 34.04  ? 185 GLU A CA    1 
ATOM   838   C C     . GLU A  1 123 ? -24.928 17.240  1.616   1.00 31.05  ? 185 GLU A C     1 
ATOM   839   O O     . GLU A  1 123 ? -24.781 17.783  2.694   1.00 29.71  ? 185 GLU A O     1 
ATOM   840   C CB    . GLU A  1 123 ? -22.440 16.909  1.067   1.00 35.78  ? 185 GLU A CB    1 
ATOM   841   C CG    . GLU A  1 123 ? -22.343 16.380  2.518   1.00 40.61  ? 185 GLU A CG    1 
ATOM   842   C CD    . GLU A  1 123 ? -22.844 14.952  2.736   1.00 41.75  ? 185 GLU A CD    1 
ATOM   843   O OE1   . GLU A  1 123 ? -22.999 14.309  1.677   1.00 40.93  ? 185 GLU A OE1   1 
ATOM   844   O OE2   . GLU A  1 123 ? -23.082 14.506  3.930   1.00 39.25  ? 185 GLU A OE2   1 
ATOM   845   N N     . TRP A  1 124 ? -26.036 16.611  1.259   1.00 31.32  ? 186 TRP A N     1 
ATOM   846   C CA    . TRP A  1 124 ? -27.248 16.576  2.082   1.00 30.51  ? 186 TRP A CA    1 
ATOM   847   C C     . TRP A  1 124 ? -27.485 15.186  2.594   1.00 29.40  ? 186 TRP A C     1 
ATOM   848   O O     . TRP A  1 124 ? -28.481 14.932  3.243   1.00 28.11  ? 186 TRP A O     1 
ATOM   849   C CB    . TRP A  1 124 ? -28.455 16.981  1.248   1.00 29.80  ? 186 TRP A CB    1 
ATOM   850   C CG    . TRP A  1 124 ? -28.539 16.237  -0.022  1.00 30.08  ? 186 TRP A CG    1 
ATOM   851   C CD1   . TRP A  1 124 ? -28.044 16.632  -1.229  1.00 30.73  ? 186 TRP A CD1   1 
ATOM   852   C CD2   . TRP A  1 124 ? -29.130 14.953  -0.227  1.00 30.48  ? 186 TRP A CD2   1 
ATOM   853   N NE1   . TRP A  1 124 ? -28.306 15.679  -2.186  1.00 31.49  ? 186 TRP A NE1   1 
ATOM   854   C CE2   . TRP A  1 124 ? -28.968 14.634  -1.596  1.00 30.68  ? 186 TRP A CE2   1 
ATOM   855   C CE3   . TRP A  1 124 ? -29.801 14.048  0.605   1.00 31.80  ? 186 TRP A CE3   1 
ATOM   856   C CZ2   . TRP A  1 124 ? -29.453 13.447  -2.156  1.00 30.74  ? 186 TRP A CZ2   1 
ATOM   857   C CZ3   . TRP A  1 124 ? -30.281 12.853  0.048   1.00 32.35  ? 186 TRP A CZ3   1 
ATOM   858   C CH2   . TRP A  1 124 ? -30.102 12.571  -1.325  1.00 31.85  ? 186 TRP A CH2   1 
ATOM   859   N N     . MET A  1 125 ? -26.566 14.282  2.280   1.00 30.08  ? 187 MET A N     1 
ATOM   860   C CA    . MET A  1 125 ? -26.783 12.877  2.535   1.00 29.48  ? 187 MET A CA    1 
ATOM   861   C C     . MET A  1 125 ? -26.434 12.529  3.978   1.00 28.59  ? 187 MET A C     1 
ATOM   862   O O     . MET A  1 125 ? -25.480 13.096  4.624   1.00 28.78  ? 187 MET A O     1 
ATOM   863   C CB    . MET A  1 125 ? -25.998 11.993  1.536   1.00 29.78  ? 187 MET A CB    1 
ATOM   864   C CG    . MET A  1 125 ? -26.439 12.120  0.072   1.00 28.94  ? 187 MET A CG    1 
ATOM   865   S SD    . MET A  1 125 ? -25.744 13.558  -0.803  1.00 28.34  ? 187 MET A SD    1 
ATOM   866   C CE    . MET A  1 125 ? -24.099 12.949  -1.178  1.00 28.72  ? 187 MET A CE    1 
ATOM   867   N N     . GLY A  1 126 ? -27.248 11.597  4.464   1.00 26.90  ? 188 GLY A N     1 
ATOM   868   C CA    . GLY A  1 126 ? -27.126 11.058  5.803   1.00 27.39  ? 188 GLY A CA    1 
ATOM   869   C C     . GLY A  1 126 ? -27.032 9.567   5.703   1.00 26.71  ? 188 GLY A C     1 
ATOM   870   O O     . GLY A  1 126 ? -27.186 9.011   4.622   1.00 26.78  ? 188 GLY A O     1 
ATOM   871   N N     . TYR A  1 127 ? -26.786 8.922   6.833   1.00 27.10  ? 189 TYR A N     1 
ATOM   872   C CA    . TYR A  1 127 ? -26.700 7.466   6.888   1.00 28.15  ? 189 TYR A CA    1 
ATOM   873   C C     . TYR A  1 127 ? -27.945 6.880   6.269   1.00 29.50  ? 189 TYR A C     1 
ATOM   874   O O     . TYR A  1 127 ? -29.012 7.497   6.338   1.00 32.58  ? 189 TYR A O     1 
ATOM   875   C CB    . TYR A  1 127 ? -26.650 7.033   8.334   1.00 28.59  ? 189 TYR A CB    1 
ATOM   876   C CG    . TYR A  1 127 ? -25.460 7.542   9.078   1.00 28.66  ? 189 TYR A CG    1 
ATOM   877   C CD1   . TYR A  1 127 ? -24.199 7.366   8.574   1.00 30.00  ? 189 TYR A CD1   1 
ATOM   878   C CD2   . TYR A  1 127 ? -25.596 8.196   10.287  1.00 28.90  ? 189 TYR A CD2   1 
ATOM   879   C CE1   . TYR A  1 127 ? -23.098 7.830   9.250   1.00 31.20  ? 189 TYR A CE1   1 
ATOM   880   C CE2   . TYR A  1 127 ? -24.498 8.666   10.968  1.00 29.58  ? 189 TYR A CE2   1 
ATOM   881   C CZ    . TYR A  1 127 ? -23.259 8.475   10.446  1.00 30.25  ? 189 TYR A CZ    1 
ATOM   882   O OH    . TYR A  1 127 ? -22.166 8.915   11.115  1.00 32.56  ? 189 TYR A OH    1 
ATOM   883   N N     . CYS A  1 128 ? -27.859 5.705   5.658   1.00 29.23  ? 190 CYS A N     1 
ATOM   884   C CA    . CYS A  1 128 ? -29.047 5.185   4.943   1.00 27.68  ? 190 CYS A CA    1 
ATOM   885   C C     . CYS A  1 128 ? -29.675 6.249   3.989   1.00 26.89  ? 190 CYS A C     1 
ATOM   886   O O     . CYS A  1 128 ? -30.885 6.266   3.749   1.00 26.77  ? 190 CYS A O     1 
ATOM   887   C CB    . CYS A  1 128 ? -30.099 4.678   5.933   1.00 25.99  ? 190 CYS A CB    1 
ATOM   888   S SG    . CYS A  1 128 ? -31.236 3.525   5.151   1.00 24.89  ? 190 CYS A SG    1 
ATOM   889   N N     . LEU A  1 129 ? -28.819 7.123   3.461   1.00 26.29  ? 191 LEU A N     1 
ATOM   890   C CA    . LEU A  1 129 ? -29.163 8.171   2.507   1.00 26.17  ? 191 LEU A CA    1 
ATOM   891   C C     . LEU A  1 129 ? -29.958 9.349   3.078   1.00 26.70  ? 191 LEU A C     1 
ATOM   892   O O     . LEU A  1 129 ? -29.552 10.508  2.900   1.00 25.84  ? 191 LEU A O     1 
ATOM   893   C CB    . LEU A  1 129 ? -29.878 7.580   1.279   1.00 25.92  ? 191 LEU A CB    1 
ATOM   894   C CG    . LEU A  1 129 ? -30.035 8.549   0.108   1.00 25.87  ? 191 LEU A CG    1 
ATOM   895   C CD1   . LEU A  1 129 ? -28.726 9.233   -0.233  1.00 25.72  ? 191 LEU A CD1   1 
ATOM   896   C CD2   . LEU A  1 129 ? -30.639 7.858   -1.110  1.00 25.72  ? 191 LEU A CD2   1 
ATOM   897   N N     . PHE A  1 130 ? -31.088 9.057   3.730   1.00 27.73  ? 192 PHE A N     1 
ATOM   898   C CA    . PHE A  1 130 ? -32.093 10.079  4.064   1.00 28.80  ? 192 PHE A CA    1 
ATOM   899   C C     . PHE A  1 130 ? -32.100 10.549  5.504   1.00 30.87  ? 192 PHE A C     1 
ATOM   900   O O     . PHE A  1 130 ? -32.813 11.488  5.826   1.00 32.29  ? 192 PHE A O     1 
ATOM   901   C CB    . PHE A  1 130 ? -33.481 9.558   3.724   1.00 28.24  ? 192 PHE A CB    1 
ATOM   902   C CG    . PHE A  1 130 ? -33.670 9.263   2.260   1.00 27.39  ? 192 PHE A CG    1 
ATOM   903   C CD1   . PHE A  1 130 ? -33.598 10.280  1.311   1.00 26.02  ? 192 PHE A CD1   1 
ATOM   904   C CD2   . PHE A  1 130 ? -33.933 7.970   1.837   1.00 27.02  ? 192 PHE A CD2   1 
ATOM   905   C CE1   . PHE A  1 130 ? -33.780 10.004  -0.028  1.00 25.64  ? 192 PHE A CE1   1 
ATOM   906   C CE2   . PHE A  1 130 ? -34.116 7.690   0.500   1.00 26.70  ? 192 PHE A CE2   1 
ATOM   907   C CZ    . PHE A  1 130 ? -34.038 8.706   -0.434  1.00 26.24  ? 192 PHE A CZ    1 
ATOM   908   N N     . TYR A  1 131 ? -31.314 9.911   6.363   1.00 33.33  ? 193 TYR A N     1 
ATOM   909   C CA    . TYR A  1 131 ? -31.279 10.262  7.775   1.00 34.51  ? 193 TYR A CA    1 
ATOM   910   C C     . TYR A  1 131 ? -30.915 11.739  7.895   1.00 33.59  ? 193 TYR A C     1 
ATOM   911   O O     . TYR A  1 131 ? -30.109 12.240  7.135   1.00 29.83  ? 193 TYR A O     1 
ATOM   912   C CB    . TYR A  1 131 ? -30.282 9.373   8.539   1.00 36.32  ? 193 TYR A CB    1 
ATOM   913   C CG    . TYR A  1 131 ? -30.198 9.659   10.017  1.00 38.43  ? 193 TYR A CG    1 
ATOM   914   C CD1   . TYR A  1 131 ? -31.284 9.427   10.865  1.00 40.11  ? 193 TYR A CD1   1 
ATOM   915   C CD2   . TYR A  1 131 ? -29.034 10.184  10.574  1.00 40.73  ? 193 TYR A CD2   1 
ATOM   916   C CE1   . TYR A  1 131 ? -31.205 9.714   12.231  1.00 41.41  ? 193 TYR A CE1   1 
ATOM   917   C CE2   . TYR A  1 131 ? -28.937 10.468  11.937  1.00 41.51  ? 193 TYR A CE2   1 
ATOM   918   C CZ    . TYR A  1 131 ? -30.005 10.241  12.764  1.00 41.19  ? 193 TYR A CZ    1 
ATOM   919   O OH    . TYR A  1 131 ? -29.817 10.556  14.095  1.00 38.70  ? 193 TYR A OH    1 
ATOM   920   N N     . GLU A  1 132 ? -31.570 12.410  8.845   1.00 36.00  ? 194 GLU A N     1 
ATOM   921   C CA    . GLU A  1 132 ? -31.577 13.880  9.031   1.00 35.84  ? 194 GLU A CA    1 
ATOM   922   C C     . GLU A  1 132 ? -32.470 14.646  8.030   1.00 34.61  ? 194 GLU A C     1 
ATOM   923   O O     . GLU A  1 132 ? -32.600 15.874  8.133   1.00 33.60  ? 194 GLU A O     1 
ATOM   924   C CB    . GLU A  1 132 ? -30.165 14.463  9.066   1.00 37.27  ? 194 GLU A CB    1 
ATOM   925   C CG    . GLU A  1 132 ? -29.307 13.933  10.199  1.00 38.84  ? 194 GLU A CG    1 
ATOM   926   C CD    . GLU A  1 132 ? -27.864 14.400  10.118  1.00 41.89  ? 194 GLU A CD    1 
ATOM   927   O OE1   . GLU A  1 132 ? -27.434 14.871  9.030   1.00 43.64  ? 194 GLU A OE1   1 
ATOM   928   O OE2   . GLU A  1 132 ? -27.155 14.272  11.144  1.00 43.52  ? 194 GLU A OE2   1 
ATOM   929   N N     . SER A  1 133 ? -33.081 13.914  7.088   1.00 33.70  ? 195 SER A N     1 
ATOM   930   C CA    . SER A  1 133 ? -34.070 14.435  6.149   1.00 32.47  ? 195 SER A CA    1 
ATOM   931   C C     . SER A  1 133 ? -33.627 15.689  5.415   1.00 31.61  ? 195 SER A C     1 
ATOM   932   O O     . SER A  1 133 ? -34.457 16.468  4.997   1.00 33.65  ? 195 SER A O     1 
ATOM   933   C CB    . SER A  1 133 ? -35.379 14.693  6.898   1.00 32.71  ? 195 SER A CB    1 
ATOM   934   O OG    . SER A  1 133 ? -36.007 13.465  7.217   1.00 33.87  ? 195 SER A OG    1 
ATOM   935   N N     . MET A  1 134 ? -32.326 15.900  5.248   1.00 30.65  ? 196 MET A N     1 
ATOM   936   C CA    . MET A  1 134 ? -31.840 17.181  4.703   1.00 28.52  ? 196 MET A CA    1 
ATOM   937   C C     . MET A  1 134 ? -32.212 17.390  3.225   1.00 27.80  ? 196 MET A C     1 
ATOM   938   O O     . MET A  1 134 ? -32.145 18.506  2.733   1.00 26.26  ? 196 MET A O     1 
ATOM   939   C CB    . MET A  1 134 ? -30.317 17.334  4.896   1.00 26.71  ? 196 MET A CB    1 
ATOM   940   C CG    . MET A  1 134 ? -29.773 18.643  4.341   1.00 25.67  ? 196 MET A CG    1 
ATOM   941   S SD    . MET A  1 134 ? -28.076 19.045  4.781   1.00 24.52  ? 196 MET A SD    1 
ATOM   942   C CE    . MET A  1 134 ? -27.728 20.400  3.651   1.00 24.28  ? 196 MET A CE    1 
ATOM   943   N N     . LEU A  1 135 ? -32.586 16.323  2.519   1.00 28.81  ? 197 LEU A N     1 
ATOM   944   C CA    . LEU A  1 135 ? -33.041 16.453  1.136   1.00 29.72  ? 197 LEU A CA    1 
ATOM   945   C C     . LEU A  1 135 ? -34.227 17.422  1.006   1.00 29.74  ? 197 LEU A C     1 
ATOM   946   O O     . LEU A  1 135 ? -34.334 18.149  0.027   1.00 30.37  ? 197 LEU A O     1 
ATOM   947   C CB    . LEU A  1 135 ? -33.434 15.089  0.569   1.00 30.90  ? 197 LEU A CB    1 
ATOM   948   C CG    . LEU A  1 135 ? -33.855 15.018  -0.907  1.00 31.32  ? 197 LEU A CG    1 
ATOM   949   C CD1   . LEU A  1 135 ? -32.845 15.726  -1.790  1.00 32.21  ? 197 LEU A CD1   1 
ATOM   950   C CD2   . LEU A  1 135 ? -33.996 13.571  -1.365  1.00 31.20  ? 197 LEU A CD2   1 
ATOM   951   N N     . ASN A  1 136 ? -35.103 17.435  2.006   1.00 30.04  ? 198 ASN A N     1 
ATOM   952   C CA    . ASN A  1 136 ? -36.255 18.345  2.038   1.00 28.76  ? 198 ASN A CA    1 
ATOM   953   C C     . ASN A  1 136 ? -35.800 19.787  1.928   1.00 28.19  ? 198 ASN A C     1 
ATOM   954   O O     . ASN A  1 136 ? -36.451 20.591  1.280   1.00 31.68  ? 198 ASN A O     1 
ATOM   955   C CB    . ASN A  1 136 ? -37.070 18.176  3.321   1.00 28.04  ? 198 ASN A CB    1 
ATOM   956   C CG    . ASN A  1 136 ? -37.535 16.751  3.546   1.00 29.49  ? 198 ASN A CG    1 
ATOM   957   O OD1   . ASN A  1 136 ? -37.250 15.847  2.780   1.00 29.60  ? 198 ASN A OD1   1 
ATOM   958   N ND2   . ASN A  1 136 ? -38.222 16.541  4.645   1.00 34.03  ? 198 ASN A ND2   1 
ATOM   959   N N     . THR A  1 137 ? -34.697 20.121  2.582   1.00 26.25  ? 199 THR A N     1 
ATOM   960   C CA    . THR A  1 137 ? -34.146 21.445  2.497   1.00 25.78  ? 199 THR A CA    1 
ATOM   961   C C     . THR A  1 137 ? -33.668 21.697  1.070   1.00 26.45  ? 199 THR A C     1 
ATOM   962   O O     . THR A  1 137 ? -33.974 22.733  0.496   1.00 26.47  ? 199 THR A O     1 
ATOM   963   C CB    . THR A  1 137 ? -32.971 21.607  3.476   1.00 26.56  ? 199 THR A CB    1 
ATOM   964   O OG1   . THR A  1 137 ? -33.432 21.409  4.816   1.00 25.52  ? 199 THR A OG1   1 
ATOM   965   C CG2   . THR A  1 137 ? -32.312 22.984  3.328   1.00 27.19  ? 199 THR A CG2   1 
ATOM   966   N N     . VAL A  1 138 ? -32.923 20.754  0.495   1.00 26.90  ? 200 VAL A N     1 
ATOM   967   C CA    . VAL A  1 138 ? -32.413 20.911  -0.867  1.00 27.61  ? 200 VAL A CA    1 
ATOM   968   C C     . VAL A  1 138 ? -33.586 21.096  -1.836  1.00 29.32  ? 200 VAL A C     1 
ATOM   969   O O     . VAL A  1 138 ? -33.556 21.992  -2.688  1.00 32.14  ? 200 VAL A O     1 
ATOM   970   C CB    . VAL A  1 138 ? -31.535 19.721  -1.296  1.00 27.18  ? 200 VAL A CB    1 
ATOM   971   C CG1   . VAL A  1 138 ? -31.216 19.770  -2.779  1.00 26.85  ? 200 VAL A CG1   1 
ATOM   972   C CG2   . VAL A  1 138 ? -30.249 19.715  -0.507  1.00 27.43  ? 200 VAL A CG2   1 
ATOM   973   N N     . ILE A  1 139 ? -34.623 20.273  -1.689  1.00 29.98  ? 201 ILE A N     1 
ATOM   974   C CA    . ILE A  1 139 ? -35.880 20.443  -2.451  1.00 31.55  ? 201 ILE A CA    1 
ATOM   975   C C     . ILE A  1 139 ? -36.346 21.904  -2.352  1.00 31.71  ? 201 ILE A C     1 
ATOM   976   O O     . ILE A  1 139 ? -36.507 22.588  -3.360  1.00 31.30  ? 201 ILE A O     1 
ATOM   977   C CB    . ILE A  1 139 ? -37.021 19.517  -1.924  1.00 31.93  ? 201 ILE A CB    1 
ATOM   978   C CG1   . ILE A  1 139 ? -36.568 18.043  -1.929  1.00 33.45  ? 201 ILE A CG1   1 
ATOM   979   C CG2   . ILE A  1 139 ? -38.326 19.752  -2.688  1.00 31.31  ? 201 ILE A CG2   1 
ATOM   980   C CD1   . ILE A  1 139 ? -37.277 17.119  -2.888  1.00 34.49  ? 201 ILE A CD1   1 
ATOM   981   N N     . PHE A  1 140 ? -36.530 22.377  -1.123  1.00 32.20  ? 202 PHE A N     1 
ATOM   982   C CA    . PHE A  1 140 ? -36.969 23.738  -0.892  1.00 33.10  ? 202 PHE A CA    1 
ATOM   983   C C     . PHE A  1 140 ? -36.107 24.723  -1.692  1.00 33.95  ? 202 PHE A C     1 
ATOM   984   O O     . PHE A  1 140 ? -36.616 25.590  -2.399  1.00 36.27  ? 202 PHE A O     1 
ATOM   985   C CB    . PHE A  1 140 ? -36.912 24.068  0.592   1.00 31.99  ? 202 PHE A CB    1 
ATOM   986   C CG    . PHE A  1 140 ? -37.367 25.458  0.912   1.00 32.63  ? 202 PHE A CG    1 
ATOM   987   C CD1   . PHE A  1 140 ? -36.512 26.548  0.730   1.00 32.21  ? 202 PHE A CD1   1 
ATOM   988   C CD2   . PHE A  1 140 ? -38.649 25.680  1.386   1.00 33.18  ? 202 PHE A CD2   1 
ATOM   989   C CE1   . PHE A  1 140 ? -36.916 27.828  1.024   1.00 31.70  ? 202 PHE A CE1   1 
ATOM   990   C CE2   . PHE A  1 140 ? -39.063 26.958  1.689   1.00 33.85  ? 202 PHE A CE2   1 
ATOM   991   C CZ    . PHE A  1 140 ? -38.191 28.032  1.507   1.00 33.84  ? 202 PHE A CZ    1 
ATOM   992   N N     . ALA A  1 141 ? -34.800 24.585  -1.573  1.00 33.43  ? 203 ALA A N     1 
ATOM   993   C CA    . ALA A  1 141 ? -33.898 25.491  -2.249  1.00 33.78  ? 203 ALA A CA    1 
ATOM   994   C C     . ALA A  1 141 ? -34.068 25.388  -3.750  1.00 32.36  ? 203 ALA A C     1 
ATOM   995   O O     . ALA A  1 141 ? -34.110 26.410  -4.435  1.00 33.72  ? 203 ALA A O     1 
ATOM   996   C CB    . ALA A  1 141 ? -32.458 25.205  -1.848  1.00 34.49  ? 203 ALA A CB    1 
ATOM   997   N N     . ARG A  1 142 ? -34.158 24.167  -4.267  1.00 30.26  ? 204 ARG A N     1 
ATOM   998   C CA    . ARG A  1 142 ? -34.289 23.981  -5.718  1.00 29.98  ? 204 ARG A CA    1 
ATOM   999   C C     . ARG A  1 142 ? -35.482 24.769  -6.246  1.00 30.06  ? 204 ARG A C     1 
ATOM   1000  O O     . ARG A  1 142 ? -35.328 25.692  -7.058  1.00 29.12  ? 204 ARG A O     1 
ATOM   1001  C CB    . ARG A  1 142 ? -34.446 22.500  -6.053  1.00 28.80  ? 204 ARG A CB    1 
ATOM   1002  C CG    . ARG A  1 142 ? -34.653 22.188  -7.537  1.00 27.85  ? 204 ARG A CG    1 
ATOM   1003  C CD    . ARG A  1 142 ? -35.251 20.798  -7.704  1.00 27.28  ? 204 ARG A CD    1 
ATOM   1004  N NE    . ARG A  1 142 ? -36.546 20.716  -7.036  1.00 26.30  ? 204 ARG A NE    1 
ATOM   1005  C CZ    . ARG A  1 142 ? -37.173 19.601  -6.671  1.00 25.37  ? 204 ARG A CZ    1 
ATOM   1006  N NH1   . ARG A  1 142 ? -36.672 18.400  -6.904  1.00 25.95  ? 204 ARG A NH1   1 
ATOM   1007  N NH2   . ARG A  1 142 ? -38.333 19.699  -6.050  1.00 25.54  ? 204 ARG A NH2   1 
ATOM   1008  N N     . ASP A  1 143 ? -36.653 24.411  -5.714  1.00 30.58  ? 205 ASP A N     1 
ATOM   1009  C CA    . ASP A  1 143 ? -37.943 25.044  -6.020  1.00 29.59  ? 205 ASP A CA    1 
ATOM   1010  C C     . ASP A  1 143 ? -37.846 26.562  -5.936  1.00 29.60  ? 205 ASP A C     1 
ATOM   1011  O O     . ASP A  1 143 ? -38.247 27.261  -6.858  1.00 30.73  ? 205 ASP A O     1 
ATOM   1012  C CB    . ASP A  1 143 ? -39.047 24.518  -5.069  1.00 28.58  ? 205 ASP A CB    1 
ATOM   1013  C CG    . ASP A  1 143 ? -39.405 23.043  -5.340  1.00 27.86  ? 205 ASP A CG    1 
ATOM   1014  O OD1   . ASP A  1 143 ? -39.036 22.572  -6.417  1.00 27.59  ? 205 ASP A OD1   1 
ATOM   1015  O OD2   . ASP A  1 143 ? -40.023 22.345  -4.503  1.00 26.14  ? 205 ASP A OD2   1 
ATOM   1016  N N     . LYS A  1 144 ? -37.280 27.073  -4.855  1.00 29.39  ? 206 LYS A N     1 
ATOM   1017  C CA    . LYS A  1 144 ? -37.215 28.506  -4.679  1.00 31.29  ? 206 LYS A CA    1 
ATOM   1018  C C     . LYS A  1 144 ? -36.251 29.200  -5.643  1.00 33.99  ? 206 LYS A C     1 
ATOM   1019  O O     . LYS A  1 144 ? -36.631 30.127  -6.359  1.00 37.11  ? 206 LYS A O     1 
ATOM   1020  C CB    . LYS A  1 144 ? -36.864 28.842  -3.232  1.00 31.47  ? 206 LYS A CB    1 
ATOM   1021  C CG    . LYS A  1 144 ? -36.893 30.329  -2.910  1.00 31.51  ? 206 LYS A CG    1 
ATOM   1022  C CD    . LYS A  1 144 ? -36.983 30.564  -1.420  1.00 31.17  ? 206 LYS A CD    1 
ATOM   1023  C CE    . LYS A  1 144 ? -37.208 32.025  -1.116  1.00 31.52  ? 206 LYS A CE    1 
ATOM   1024  N NZ    . LYS A  1 144 ? -37.522 32.215  0.320   1.00 32.52  ? 206 LYS A NZ    1 
ATOM   1025  N N     . TRP A  1 145 ? -35.007 28.768  -5.679  1.00 36.60  ? 207 TRP A N     1 
ATOM   1026  C CA    . TRP A  1 145 ? -33.995 29.582  -6.328  1.00 37.65  ? 207 TRP A CA    1 
ATOM   1027  C C     . TRP A  1 145 ? -33.453 29.023  -7.622  1.00 36.20  ? 207 TRP A C     1 
ATOM   1028  O O     . TRP A  1 145 ? -32.917 29.785  -8.414  1.00 36.08  ? 207 TRP A O     1 
ATOM   1029  C CB    . TRP A  1 145 ? -32.836 29.828  -5.375  1.00 40.25  ? 207 TRP A CB    1 
ATOM   1030  C CG    . TRP A  1 145 ? -33.167 30.713  -4.220  1.00 43.42  ? 207 TRP A CG    1 
ATOM   1031  C CD1   . TRP A  1 145 ? -33.486 32.033  -4.260  1.00 44.42  ? 207 TRP A CD1   1 
ATOM   1032  C CD2   . TRP A  1 145 ? -33.175 30.339  -2.837  1.00 48.21  ? 207 TRP A CD2   1 
ATOM   1033  N NE1   . TRP A  1 145 ? -33.698 32.514  -2.985  1.00 45.51  ? 207 TRP A NE1   1 
ATOM   1034  C CE2   . TRP A  1 145 ? -33.516 31.493  -2.093  1.00 47.58  ? 207 TRP A CE2   1 
ATOM   1035  C CE3   . TRP A  1 145 ? -32.937 29.134  -2.155  1.00 49.90  ? 207 TRP A CE3   1 
ATOM   1036  C CZ2   . TRP A  1 145 ? -33.618 31.482  -0.697  1.00 49.96  ? 207 TRP A CZ2   1 
ATOM   1037  C CZ3   . TRP A  1 145 ? -33.043 29.123  -0.771  1.00 51.95  ? 207 TRP A CZ3   1 
ATOM   1038  C CH2   . TRP A  1 145 ? -33.381 30.295  -0.055  1.00 51.16  ? 207 TRP A CH2   1 
ATOM   1039  N N     . LEU A  1 146 ? -33.547 27.722  -7.854  1.00 34.51  ? 208 LEU A N     1 
ATOM   1040  C CA    . LEU A  1 146 ? -32.887 27.194  -9.031  1.00 36.41  ? 208 LEU A CA    1 
ATOM   1041  C C     . LEU A  1 146 ? -33.590 27.734  -10.274 1.00 37.95  ? 208 LEU A C     1 
ATOM   1042  O O     . LEU A  1 146 ? -34.814 27.775  -10.305 1.00 41.78  ? 208 LEU A O     1 
ATOM   1043  C CB    . LEU A  1 146 ? -32.894 25.671  -9.027  1.00 37.34  ? 208 LEU A CB    1 
ATOM   1044  C CG    . LEU A  1 146 ? -32.048 25.015  -10.126 1.00 38.24  ? 208 LEU A CG    1 
ATOM   1045  C CD1   . LEU A  1 146 ? -30.582 25.411  -10.032 1.00 38.36  ? 208 LEU A CD1   1 
ATOM   1046  C CD2   . LEU A  1 146 ? -32.189 23.499  -10.083 1.00 39.65  ? 208 LEU A CD2   1 
ATOM   1047  N N     . LYS A  1 147 ? -32.828 28.167  -11.283 1.00 39.16  ? 209 LYS A N     1 
ATOM   1048  C CA    . LYS A  1 147 ? -33.400 28.611  -12.575 1.00 38.75  ? 209 LYS A CA    1 
ATOM   1049  C C     . LYS A  1 147 ? -33.900 27.434  -13.386 1.00 39.71  ? 209 LYS A C     1 
ATOM   1050  O O     . LYS A  1 147 ? -33.412 26.325  -13.231 1.00 41.02  ? 209 LYS A O     1 
ATOM   1051  C CB    . LYS A  1 147 ? -32.360 29.346  -13.418 1.00 38.50  ? 209 LYS A CB    1 
ATOM   1052  C CG    . LYS A  1 147 ? -31.371 28.425  -14.133 1.00 39.36  ? 209 LYS A CG    1 
ATOM   1053  C CD    . LYS A  1 147 ? -30.356 29.178  -14.986 1.00 40.24  ? 209 LYS A CD    1 
ATOM   1054  C CE    . LYS A  1 147 ? -29.517 28.225  -15.828 1.00 39.28  ? 209 LYS A CE    1 
ATOM   1055  N NZ    . LYS A  1 147 ? -28.226 28.840  -16.241 1.00 40.08  ? 209 LYS A NZ    1 
ATOM   1056  N N     . PRO A  1 148 ? -34.853 27.665  -14.286 1.00 41.65  ? 210 PRO A N     1 
ATOM   1057  C CA    . PRO A  1 148 ? -35.231 26.527  -15.135 1.00 42.45  ? 210 PRO A CA    1 
ATOM   1058  C C     . PRO A  1 148 ? -34.029 26.005  -15.922 1.00 40.92  ? 210 PRO A C     1 
ATOM   1059  O O     . PRO A  1 148 ? -33.205 26.800  -16.387 1.00 42.26  ? 210 PRO A O     1 
ATOM   1060  C CB    . PRO A  1 148 ? -36.298 27.114  -16.068 1.00 43.57  ? 210 PRO A CB    1 
ATOM   1061  C CG    . PRO A  1 148 ? -36.788 28.346  -15.364 1.00 43.25  ? 210 PRO A CG    1 
ATOM   1062  C CD    . PRO A  1 148 ? -35.626 28.880  -14.583 1.00 41.72  ? 210 PRO A CD    1 
ATOM   1063  N N     . GLY A  1 149 ? -33.902 24.684  -16.019 1.00 38.90  ? 211 GLY A N     1 
ATOM   1064  C CA    . GLY A  1 149 ? -32.734 24.083  -16.646 1.00 37.78  ? 211 GLY A CA    1 
ATOM   1065  C C     . GLY A  1 149 ? -31.459 24.227  -15.834 1.00 37.08  ? 211 GLY A C     1 
ATOM   1066  O O     . GLY A  1 149 ? -30.382 23.918  -16.324 1.00 37.26  ? 211 GLY A O     1 
ATOM   1067  N N     . GLY A  1 150 ? -31.552 24.707  -14.600 1.00 37.08  ? 212 GLY A N     1 
ATOM   1068  C CA    . GLY A  1 150 ? -30.378 24.809  -13.753 1.00 38.49  ? 212 GLY A CA    1 
ATOM   1069  C C     . GLY A  1 150 ? -29.891 23.426  -13.391 1.00 39.12  ? 212 GLY A C     1 
ATOM   1070  O O     . GLY A  1 150 ? -30.638 22.453  -13.523 1.00 39.81  ? 212 GLY A O     1 
ATOM   1071  N N     . LEU A  1 151 ? -28.638 23.345  -12.940 1.00 37.31  ? 213 LEU A N     1 
ATOM   1072  C CA    . LEU A  1 151 ? -27.989 22.071  -12.668 1.00 36.84  ? 213 LEU A CA    1 
ATOM   1073  C C     . LEU A  1 151 ? -27.858 21.833  -11.179 1.00 36.27  ? 213 LEU A C     1 
ATOM   1074  O O     . LEU A  1 151 ? -27.853 22.784  -10.401 1.00 36.02  ? 213 LEU A O     1 
ATOM   1075  C CB    . LEU A  1 151 ? -26.587 22.039  -13.297 1.00 37.17  ? 213 LEU A CB    1 
ATOM   1076  C CG    . LEU A  1 151 ? -26.477 22.325  -14.796 1.00 35.22  ? 213 LEU A CG    1 
ATOM   1077  C CD1   . LEU A  1 151 ? -25.035 22.204  -15.224 1.00 33.60  ? 213 LEU A CD1   1 
ATOM   1078  C CD2   . LEU A  1 151 ? -27.347 21.395  -15.612 1.00 35.44  ? 213 LEU A CD2   1 
ATOM   1079  N N     . MET A  1 152 ? -27.717 20.560  -10.794 1.00 35.21  ? 214 MET A N     1 
ATOM   1080  C CA    . MET A  1 152 ? -27.496 20.197  -9.398  1.00 33.58  ? 214 MET A CA    1 
ATOM   1081  C C     . MET A  1 152 ? -26.340 19.212  -9.223  1.00 32.08  ? 214 MET A C     1 
ATOM   1082  O O     . MET A  1 152 ? -26.141 18.311  -10.049 1.00 33.98  ? 214 MET A O     1 
ATOM   1083  C CB    . MET A  1 152 ? -28.789 19.644  -8.797  1.00 34.59  ? 214 MET A CB    1 
ATOM   1084  C CG    . MET A  1 152 ? -29.918 20.677  -8.723  1.00 34.16  ? 214 MET A CG    1 
ATOM   1085  S SD    . MET A  1 152 ? -31.437 20.109  -7.912  1.00 32.25  ? 214 MET A SD    1 
ATOM   1086  C CE    . MET A  1 152 ? -31.074 20.578  -6.226  1.00 32.45  ? 214 MET A CE    1 
ATOM   1087  N N     . PHE A  1 153 ? -25.580 19.410  -8.141  1.00 30.21  ? 215 PHE A N     1 
ATOM   1088  C CA    . PHE A  1 153 ? -24.396 18.608  -7.822  1.00 29.08  ? 215 PHE A CA    1 
ATOM   1089  C C     . PHE A  1 153 ? -24.510 18.042  -6.410  1.00 29.81  ? 215 PHE A C     1 
ATOM   1090  O O     . PHE A  1 153 ? -24.502 18.800  -5.455  1.00 31.50  ? 215 PHE A O     1 
ATOM   1091  C CB    . PHE A  1 153 ? -23.160 19.475  -7.909  1.00 27.60  ? 215 PHE A CB    1 
ATOM   1092  C CG    . PHE A  1 153 ? -22.660 19.689  -9.314  1.00 27.96  ? 215 PHE A CG    1 
ATOM   1093  C CD1   . PHE A  1 153 ? -23.381 20.449  -10.216 1.00 28.87  ? 215 PHE A CD1   1 
ATOM   1094  C CD2   . PHE A  1 153 ? -21.454 19.152  -9.726  1.00 27.92  ? 215 PHE A CD2   1 
ATOM   1095  C CE1   . PHE A  1 153 ? -22.919 20.648  -11.509 1.00 29.06  ? 215 PHE A CE1   1 
ATOM   1096  C CE2   . PHE A  1 153 ? -20.985 19.349  -11.011 1.00 28.03  ? 215 PHE A CE2   1 
ATOM   1097  C CZ    . PHE A  1 153 ? -21.720 20.094  -11.909 1.00 28.31  ? 215 PHE A CZ    1 
ATOM   1098  N N     . PRO A  1 154 ? -24.707 16.737  -6.249  1.00 30.46  ? 216 PRO A N     1 
ATOM   1099  C CA    . PRO A  1 154 ? -25.081 15.798  -7.300  1.00 30.28  ? 216 PRO A CA    1 
ATOM   1100  C C     . PRO A  1 154 ? -26.578 15.865  -7.674  1.00 29.19  ? 216 PRO A C     1 
ATOM   1101  O O     . PRO A  1 154 ? -27.337 16.613  -7.027  1.00 29.03  ? 216 PRO A O     1 
ATOM   1102  C CB    . PRO A  1 154 ? -24.778 14.461  -6.644  1.00 30.86  ? 216 PRO A CB    1 
ATOM   1103  C CG    . PRO A  1 154 ? -24.988 14.702  -5.170  1.00 30.94  ? 216 PRO A CG    1 
ATOM   1104  C CD    . PRO A  1 154 ? -24.986 16.181  -4.918  1.00 30.80  ? 216 PRO A CD    1 
ATOM   1105  N N     . ASP A  1 155 ? -26.984 15.079  -8.676  1.00 27.10  ? 217 ASP A N     1 
ATOM   1106  C CA    . ASP A  1 155 ? -28.363 15.099  -9.156  1.00 27.88  ? 217 ASP A CA    1 
ATOM   1107  C C     . ASP A  1 155 ? -29.092 13.738  -9.252  1.00 28.09  ? 217 ASP A C     1 
ATOM   1108  O O     . ASP A  1 155 ? -30.293 13.693  -9.528  1.00 26.36  ? 217 ASP A O     1 
ATOM   1109  C CB    . ASP A  1 155 ? -28.430 15.844  -10.488 1.00 28.82  ? 217 ASP A CB    1 
ATOM   1110  C CG    . ASP A  1 155 ? -27.378 15.405  -11.441 1.00 29.16  ? 217 ASP A CG    1 
ATOM   1111  O OD1   . ASP A  1 155 ? -26.970 14.242  -11.320 1.00 29.92  ? 217 ASP A OD1   1 
ATOM   1112  O OD2   . ASP A  1 155 ? -26.961 16.202  -12.312 1.00 30.46  ? 217 ASP A OD2   1 
ATOM   1113  N N     . ARG A  1 156 ? -28.382 12.647  -8.994  1.00 30.55  ? 218 ARG A N     1 
ATOM   1114  C CA    . ARG A  1 156 ? -28.989 11.312  -8.913  1.00 32.81  ? 218 ARG A CA    1 
ATOM   1115  C C     . ARG A  1 156 ? -28.513 10.610  -7.656  1.00 31.92  ? 218 ARG A C     1 
ATOM   1116  O O     . ARG A  1 156 ? -27.350 10.739  -7.276  1.00 32.64  ? 218 ARG A O     1 
ATOM   1117  C CB    . ARG A  1 156 ? -28.603 10.445  -10.109 1.00 36.67  ? 218 ARG A CB    1 
ATOM   1118  C CG    . ARG A  1 156 ? -29.644 10.363  -11.218 1.00 42.95  ? 218 ARG A CG    1 
ATOM   1119  C CD    . ARG A  1 156 ? -29.435 9.130   -12.096 1.00 49.13  ? 218 ARG A CD    1 
ATOM   1120  N NE    . ARG A  1 156 ? -29.862 7.883   -11.426 1.00 56.58  ? 218 ARG A NE    1 
ATOM   1121  C CZ    . ARG A  1 156 ? -29.060 7.005   -10.793 1.00 59.05  ? 218 ARG A CZ    1 
ATOM   1122  N NH1   . ARG A  1 156 ? -27.733 7.183   -10.717 1.00 57.00  ? 218 ARG A NH1   1 
ATOM   1123  N NH2   . ARG A  1 156 ? -29.598 5.923   -10.219 1.00 57.62  ? 218 ARG A NH2   1 
ATOM   1124  N N     . ALA A  1 157 ? -29.416 9.882   -7.007  1.00 30.78  ? 219 ALA A N     1 
ATOM   1125  C CA    . ALA A  1 157 ? -29.077 9.022   -5.862  1.00 29.46  ? 219 ALA A CA    1 
ATOM   1126  C C     . ALA A  1 157 ? -29.949 7.775   -5.878  1.00 28.75  ? 219 ALA A C     1 
ATOM   1127  O O     . ALA A  1 157 ? -31.105 7.788   -6.352  1.00 27.44  ? 219 ALA A O     1 
ATOM   1128  C CB    . ALA A  1 157 ? -29.254 9.760   -4.536  1.00 29.54  ? 219 ALA A CB    1 
ATOM   1129  N N     . ALA A  1 158 ? -29.398 6.703   -5.328  1.00 28.28  ? 220 ALA A N     1 
ATOM   1130  C CA    . ALA A  1 158 ? -30.077 5.422   -5.336  1.00 27.61  ? 220 ALA A CA    1 
ATOM   1131  C C     . ALA A  1 158 ? -29.746 4.597   -4.092  1.00 26.33  ? 220 ALA A C     1 
ATOM   1132  O O     . ALA A  1 158 ? -28.596 4.510   -3.679  1.00 27.26  ? 220 ALA A O     1 
ATOM   1133  C CB    . ALA A  1 158 ? -29.721 4.667   -6.599  1.00 27.76  ? 220 ALA A CB    1 
ATOM   1134  N N     . LEU A  1 159 ? -30.773 3.987   -3.524  1.00 25.08  ? 221 LEU A N     1 
ATOM   1135  C CA    . LEU A  1 159 ? -30.676 3.256   -2.288  1.00 24.58  ? 221 LEU A CA    1 
ATOM   1136  C C     . LEU A  1 159 ? -30.931 1.782   -2.560  1.00 25.12  ? 221 LEU A C     1 
ATOM   1137  O O     . LEU A  1 159 ? -31.919 1.458   -3.226  1.00 25.43  ? 221 LEU A O     1 
ATOM   1138  C CB    . LEU A  1 159 ? -31.740 3.784   -1.345  1.00 23.73  ? 221 LEU A CB    1 
ATOM   1139  C CG    . LEU A  1 159 ? -31.754 3.149   0.023   1.00 24.64  ? 221 LEU A CG    1 
ATOM   1140  C CD1   . LEU A  1 159 ? -30.471 3.490   0.759   1.00 25.60  ? 221 LEU A CD1   1 
ATOM   1141  C CD2   . LEU A  1 159 ? -32.965 3.599   0.838   1.00 25.30  ? 221 LEU A CD2   1 
ATOM   1142  N N     . TYR A  1 160 ? -30.075 0.899   -2.029  1.00 24.36  ? 222 TYR A N     1 
ATOM   1143  C CA    . TYR A  1 160 ? -30.214 -0.550  -2.247  1.00 24.48  ? 222 TYR A CA    1 
ATOM   1144  C C     . TYR A  1 160 ? -30.288 -1.364  -0.964  1.00 25.58  ? 222 TYR A C     1 
ATOM   1145  O O     . TYR A  1 160 ? -29.885 -0.910  0.094   1.00 25.44  ? 222 TYR A O     1 
ATOM   1146  C CB    . TYR A  1 160 ? -29.041 -1.083  -3.065  1.00 24.69  ? 222 TYR A CB    1 
ATOM   1147  C CG    . TYR A  1 160 ? -28.879 -0.473  -4.450  1.00 25.19  ? 222 TYR A CG    1 
ATOM   1148  C CD1   . TYR A  1 160 ? -28.235 0.770   -4.616  1.00 25.46  ? 222 TYR A CD1   1 
ATOM   1149  C CD2   . TYR A  1 160 ? -29.331 -1.142  -5.593  1.00 24.50  ? 222 TYR A CD2   1 
ATOM   1150  C CE1   . TYR A  1 160 ? -28.063 1.329   -5.872  1.00 25.32  ? 222 TYR A CE1   1 
ATOM   1151  C CE2   . TYR A  1 160 ? -29.173 -0.580  -6.849  1.00 25.05  ? 222 TYR A CE2   1 
ATOM   1152  C CZ    . TYR A  1 160 ? -28.537 0.662   -6.979  1.00 25.36  ? 222 TYR A CZ    1 
ATOM   1153  O OH    . TYR A  1 160 ? -28.358 1.276   -8.195  1.00 24.01  ? 222 TYR A OH    1 
ATOM   1154  N N     . VAL A  1 161 ? -30.820 -2.577  -1.070  1.00 27.55  ? 223 VAL A N     1 
ATOM   1155  C CA    . VAL A  1 161 ? -30.736 -3.566  0.011   1.00 28.72  ? 223 VAL A CA    1 
ATOM   1156  C C     . VAL A  1 161 ? -30.021 -4.782  -0.477  1.00 29.83  ? 223 VAL A C     1 
ATOM   1157  O O     . VAL A  1 161 ? -29.944 -5.043  -1.682  1.00 29.63  ? 223 VAL A O     1 
ATOM   1158  C CB    . VAL A  1 161 ? -32.074 -4.144  0.514   1.00 30.12  ? 223 VAL A CB    1 
ATOM   1159  C CG1   . VAL A  1 161 ? -32.515 -3.448  1.775   1.00 31.77  ? 223 VAL A CG1   1 
ATOM   1160  C CG2   . VAL A  1 161 ? -33.152 -4.117  -0.564  1.00 31.70  ? 223 VAL A CG2   1 
ATOM   1161  N N     . VAL A  1 162 ? -29.594 -5.564  0.507   1.00 30.43  ? 224 VAL A N     1 
ATOM   1162  C CA    . VAL A  1 162 ? -28.784 -6.741  0.328   1.00 28.80  ? 224 VAL A CA    1 
ATOM   1163  C C     . VAL A  1 162 ? -28.952 -7.517  1.621   1.00 27.61  ? 224 VAL A C     1 
ATOM   1164  O O     . VAL A  1 162 ? -29.149 -6.905  2.651   1.00 28.27  ? 224 VAL A O     1 
ATOM   1165  C CB    . VAL A  1 162 ? -27.338 -6.281  0.109   1.00 29.27  ? 224 VAL A CB    1 
ATOM   1166  C CG1   . VAL A  1 162 ? -26.368 -6.982  1.040   1.00 30.33  ? 224 VAL A CG1   1 
ATOM   1167  C CG2   . VAL A  1 162 ? -26.950 -6.447  -1.354  1.00 29.75  ? 224 VAL A CG2   1 
ATOM   1168  N N     . ALA A  1 163 ? -28.906 -8.842  1.590   1.00 26.87  ? 225 ALA A N     1 
ATOM   1169  C CA    . ALA A  1 163 ? -28.941 -9.621  2.837   1.00 26.60  ? 225 ALA A CA    1 
ATOM   1170  C C     . ALA A  1 163 ? -27.547 -10.156 3.183   1.00 26.15  ? 225 ALA A C     1 
ATOM   1171  O O     . ALA A  1 163 ? -26.758 -10.456 2.285   1.00 25.70  ? 225 ALA A O     1 
ATOM   1172  C CB    . ALA A  1 163 ? -29.939 -10.763 2.731   1.00 26.74  ? 225 ALA A CB    1 
ATOM   1173  N N     . ILE A  1 164 ? -27.250 -10.282 4.479   1.00 26.10  ? 226 ILE A N     1 
ATOM   1174  C CA    . ILE A  1 164 ? -25.927 -10.764 4.934   1.00 25.71  ? 226 ILE A CA    1 
ATOM   1175  C C     . ILE A  1 164 ? -25.977 -11.828 6.045   1.00 24.59  ? 226 ILE A C     1 
ATOM   1176  O O     . ILE A  1 164 ? -26.980 -11.982 6.723   1.00 24.24  ? 226 ILE A O     1 
ATOM   1177  C CB    . ILE A  1 164 ? -25.043 -9.598  5.452   1.00 25.90  ? 226 ILE A CB    1 
ATOM   1178  C CG1   . ILE A  1 164 ? -25.660 -8.967  6.693   1.00 26.05  ? 226 ILE A CG1   1 
ATOM   1179  C CG2   . ILE A  1 164 ? -24.833 -8.532  4.382   1.00 25.81  ? 226 ILE A CG2   1 
ATOM   1180  C CD1   . ILE A  1 164 ? -24.663 -8.153  7.485   1.00 26.33  ? 226 ILE A CD1   1 
ATOM   1181  N N     . GLU A  1 165 ? -24.871 -12.542 6.223   1.00 24.13  ? 227 GLU A N     1 
ATOM   1182  C CA    . GLU A  1 165 ? -24.663 -13.389 7.390   1.00 23.87  ? 227 GLU A CA    1 
ATOM   1183  C C     . GLU A  1 165 ? -23.821 -12.577 8.357   1.00 24.29  ? 227 GLU A C     1 
ATOM   1184  O O     . GLU A  1 165 ? -22.887 -11.905 7.952   1.00 23.66  ? 227 GLU A O     1 
ATOM   1185  C CB    . GLU A  1 165 ? -23.923 -14.664 7.002   1.00 24.19  ? 227 GLU A CB    1 
ATOM   1186  C CG    . GLU A  1 165 ? -23.494 -15.554 8.174   1.00 24.38  ? 227 GLU A CG    1 
ATOM   1187  C CD    . GLU A  1 165 ? -22.171 -15.165 8.804   1.00 24.02  ? 227 GLU A CD    1 
ATOM   1188  O OE1   . GLU A  1 165 ? -22.002 -15.361 10.037  1.00 23.54  ? 227 GLU A OE1   1 
ATOM   1189  O OE2   . GLU A  1 165 ? -21.310 -14.655 8.057   1.00 24.20  ? 227 GLU A OE2   1 
ATOM   1190  N N     . ASP A  1 166 ? -24.157 -12.637 9.634   1.00 26.09  ? 228 ASP A N     1 
ATOM   1191  C CA    . ASP A  1 166 ? -23.483 -11.848 10.632  1.00 28.67  ? 228 ASP A CA    1 
ATOM   1192  C C     . ASP A  1 166 ? -23.738 -12.407 12.023  1.00 30.86  ? 228 ASP A C     1 
ATOM   1193  O O     . ASP A  1 166 ? -24.043 -11.637 12.932  1.00 32.69  ? 228 ASP A O     1 
ATOM   1194  C CB    . ASP A  1 166 ? -24.006 -10.411 10.583  1.00 29.61  ? 228 ASP A CB    1 
ATOM   1195  C CG    . ASP A  1 166 ? -23.028 -9.429  11.136  1.00 30.85  ? 228 ASP A CG    1 
ATOM   1196  O OD1   . ASP A  1 166 ? -21.824 -9.778  11.222  1.00 31.34  ? 228 ASP A OD1   1 
ATOM   1197  O OD2   . ASP A  1 166 ? -23.473 -8.311  11.481  1.00 31.27  ? 228 ASP A OD2   1 
ATOM   1198  N N     . ARG A  1 167 ? -23.617 -13.724 12.212  1.00 32.30  ? 229 ARG A N     1 
ATOM   1199  C CA    . ARG A  1 167 ? -23.940 -14.305 13.529  1.00 32.50  ? 229 ARG A CA    1 
ATOM   1200  C C     . ARG A  1 167 ? -22.998 -13.848 14.608  1.00 32.95  ? 229 ARG A C     1 
ATOM   1201  O O     . ARG A  1 167 ? -23.449 -13.605 15.723  1.00 33.67  ? 229 ARG A O     1 
ATOM   1202  C CB    . ARG A  1 167 ? -24.070 -15.846 13.531  1.00 32.99  ? 229 ARG A CB    1 
ATOM   1203  C CG    . ARG A  1 167 ? -22.810 -16.673 13.426  1.00 33.41  ? 229 ARG A CG    1 
ATOM   1204  C CD    . ARG A  1 167 ? -22.893 -17.989 14.198  1.00 32.36  ? 229 ARG A CD    1 
ATOM   1205  N NE    . ARG A  1 167 ? -22.129 -17.852 15.434  1.00 33.48  ? 229 ARG A NE    1 
ATOM   1206  C CZ    . ARG A  1 167 ? -20.792 -17.831 15.501  1.00 34.30  ? 229 ARG A CZ    1 
ATOM   1207  N NH1   . ARG A  1 167 ? -20.055 -17.986 14.399  1.00 35.41  ? 229 ARG A NH1   1 
ATOM   1208  N NH2   . ARG A  1 167 ? -20.178 -17.647 16.668  1.00 32.23  ? 229 ARG A NH2   1 
ATOM   1209  N N     . GLN A  1 168 ? -21.714 -13.685 14.275  1.00 34.97  ? 230 GLN A N     1 
ATOM   1210  C CA    . GLN A  1 168 ? -20.696 -13.327 15.281  1.00 35.84  ? 230 GLN A CA    1 
ATOM   1211  C C     . GLN A  1 168 ? -20.871 -11.921 15.841  1.00 32.90  ? 230 GLN A C     1 
ATOM   1212  O O     . GLN A  1 168 ? -20.805 -11.721 17.049  1.00 31.60  ? 230 GLN A O     1 
ATOM   1213  C CB    . GLN A  1 168 ? -19.290 -13.448 14.723  1.00 38.28  ? 230 GLN A CB    1 
ATOM   1214  C CG    . GLN A  1 168 ? -18.231 -13.283 15.798  1.00 42.01  ? 230 GLN A CG    1 
ATOM   1215  C CD    . GLN A  1 168 ? -16.827 -13.411 15.247  1.00 45.95  ? 230 GLN A CD    1 
ATOM   1216  O OE1   . GLN A  1 168 ? -16.114 -14.370 15.547  1.00 47.07  ? 230 GLN A OE1   1 
ATOM   1217  N NE2   . GLN A  1 168 ? -16.424 -12.442 14.420  1.00 48.28  ? 230 GLN A NE2   1 
ATOM   1218  N N     . TYR A  1 169 ? -21.063 -10.950 14.957  1.00 31.00  ? 231 TYR A N     1 
ATOM   1219  C CA    . TYR A  1 169 ? -21.279 -9.579  15.395  1.00 29.59  ? 231 TYR A CA    1 
ATOM   1220  C C     . TYR A  1 169 ? -22.669 -9.405  16.006  1.00 27.64  ? 231 TYR A C     1 
ATOM   1221  O O     . TYR A  1 169 ? -22.846 -8.600  16.892  1.00 26.22  ? 231 TYR A O     1 
ATOM   1222  C CB    . TYR A  1 169 ? -21.028 -8.576  14.256  1.00 30.09  ? 231 TYR A CB    1 
ATOM   1223  C CG    . TYR A  1 169 ? -20.731 -7.181  14.743  1.00 31.40  ? 231 TYR A CG    1 
ATOM   1224  C CD1   . TYR A  1 169 ? -19.473 -6.854  15.265  1.00 33.88  ? 231 TYR A CD1   1 
ATOM   1225  C CD2   . TYR A  1 169 ? -21.704 -6.177  14.687  1.00 32.42  ? 231 TYR A CD2   1 
ATOM   1226  C CE1   . TYR A  1 169 ? -19.191 -5.559  15.727  1.00 35.35  ? 231 TYR A CE1   1 
ATOM   1227  C CE2   . TYR A  1 169 ? -21.440 -4.884  15.127  1.00 33.93  ? 231 TYR A CE2   1 
ATOM   1228  C CZ    . TYR A  1 169 ? -20.193 -4.570  15.659  1.00 35.96  ? 231 TYR A CZ    1 
ATOM   1229  O OH    . TYR A  1 169 ? -19.964 -3.277  16.104  1.00 35.74  ? 231 TYR A OH    1 
ATOM   1230  N N     . LYS A  1 170 ? -23.655 -10.157 15.547  1.00 28.00  ? 232 LYS A N     1 
ATOM   1231  C CA    . LYS A  1 170 ? -24.995 -10.044 16.121  1.00 29.53  ? 232 LYS A CA    1 
ATOM   1232  C C     . LYS A  1 170 ? -24.970 -10.538 17.560  1.00 29.54  ? 232 LYS A C     1 
ATOM   1233  O O     . LYS A  1 170 ? -25.628 -9.998  18.445  1.00 28.03  ? 232 LYS A O     1 
ATOM   1234  C CB    . LYS A  1 170 ? -26.030 -10.832 15.309  1.00 30.40  ? 232 LYS A CB    1 
ATOM   1235  C CG    . LYS A  1 170 ? -27.451 -10.681 15.845  1.00 31.65  ? 232 LYS A CG    1 
ATOM   1236  C CD    . LYS A  1 170 ? -28.454 -11.555 15.105  1.00 33.16  ? 232 LYS A CD    1 
ATOM   1237  C CE    . LYS A  1 170 ? -29.822 -11.535 15.775  1.00 33.64  ? 232 LYS A CE    1 
ATOM   1238  N NZ    . LYS A  1 170 ? -30.782 -12.493 15.156  1.00 33.87  ? 232 LYS A NZ    1 
ATOM   1239  N N     . ASP A  1 171 ? -24.208 -11.588 17.776  1.00 31.78  ? 233 ASP A N     1 
ATOM   1240  C CA    . ASP A  1 171 ? -23.919 -12.036 19.121  1.00 33.86  ? 233 ASP A CA    1 
ATOM   1241  C C     . ASP A  1 171 ? -23.366 -10.944 19.991  1.00 32.03  ? 233 ASP A C     1 
ATOM   1242  O O     . ASP A  1 171 ? -23.873 -10.693 21.057  1.00 30.22  ? 233 ASP A O     1 
ATOM   1243  C CB    . ASP A  1 171 ? -22.920 -13.188 19.108  1.00 36.03  ? 233 ASP A CB    1 
ATOM   1244  C CG    . ASP A  1 171 ? -23.502 -14.402 19.671  1.00 38.07  ? 233 ASP A CG    1 
ATOM   1245  O OD1   . ASP A  1 171 ? -24.481 -14.924 19.070  1.00 40.15  ? 233 ASP A OD1   1 
ATOM   1246  O OD2   . ASP A  1 171 ? -23.019 -14.774 20.756  1.00 40.18  ? 233 ASP A OD2   1 
ATOM   1247  N N     . PHE A  1 172 ? -22.307 -10.315 19.513  1.00 33.36  ? 234 PHE A N     1 
ATOM   1248  C CA    . PHE A  1 172 ? -21.616 -9.265  20.243  1.00 34.87  ? 234 PHE A CA    1 
ATOM   1249  C C     . PHE A  1 172 ? -22.509 -8.028  20.497  1.00 34.31  ? 234 PHE A C     1 
ATOM   1250  O O     . PHE A  1 172 ? -22.394 -7.388  21.544  1.00 34.17  ? 234 PHE A O     1 
ATOM   1251  C CB    . PHE A  1 172 ? -20.351 -8.856  19.463  1.00 36.00  ? 234 PHE A CB    1 
ATOM   1252  C CG    . PHE A  1 172 ? -19.578 -7.737  20.097  1.00 36.32  ? 234 PHE A CG    1 
ATOM   1253  C CD1   . PHE A  1 172 ? -18.953 -7.922  21.315  1.00 35.24  ? 234 PHE A CD1   1 
ATOM   1254  C CD2   . PHE A  1 172 ? -19.487 -6.487  19.466  1.00 37.58  ? 234 PHE A CD2   1 
ATOM   1255  C CE1   . PHE A  1 172 ? -18.254 -6.888  21.893  1.00 36.85  ? 234 PHE A CE1   1 
ATOM   1256  C CE2   . PHE A  1 172 ? -18.792 -5.441  20.045  1.00 37.33  ? 234 PHE A CE2   1 
ATOM   1257  C CZ    . PHE A  1 172 ? -18.172 -5.645  21.256  1.00 38.09  ? 234 PHE A CZ    1 
ATOM   1258  N N     . LYS A  1 173 ? -23.395 -7.702  19.554  1.00 32.97  ? 235 LYS A N     1 
ATOM   1259  C CA    . LYS A  1 173 ? -24.150 -6.454  19.616  1.00 31.92  ? 235 LYS A CA    1 
ATOM   1260  C C     . LYS A  1 173 ? -25.518 -6.569  20.225  1.00 31.65  ? 235 LYS A C     1 
ATOM   1261  O O     . LYS A  1 173 ? -26.008 -5.605  20.833  1.00 31.64  ? 235 LYS A O     1 
ATOM   1262  C CB    . LYS A  1 173 ? -24.292 -5.839  18.225  1.00 32.66  ? 235 LYS A CB    1 
ATOM   1263  C CG    . LYS A  1 173 ? -23.161 -4.891  17.908  1.00 33.58  ? 235 LYS A CG    1 
ATOM   1264  C CD    . LYS A  1 173 ? -23.320 -3.587  18.673  1.00 33.37  ? 235 LYS A CD    1 
ATOM   1265  C CE    . LYS A  1 173 ? -21.988 -2.914  18.909  1.00 33.47  ? 235 LYS A CE    1 
ATOM   1266  N NZ    . LYS A  1 173 ? -22.243 -1.654  19.637  1.00 33.92  ? 235 LYS A NZ    1 
ATOM   1267  N N     . ILE A  1 174 ? -26.161 -7.716  20.043  1.00 31.24  ? 236 ILE A N     1 
ATOM   1268  C CA    . ILE A  1 174 ? -27.524 -7.835  20.513  1.00 32.42  ? 236 ILE A CA    1 
ATOM   1269  C C     . ILE A  1 174 ? -27.777 -9.071  21.436  1.00 33.22  ? 236 ILE A C     1 
ATOM   1270  O O     . ILE A  1 174 ? -28.396 -8.929  22.483  1.00 36.45  ? 236 ILE A O     1 
ATOM   1271  C CB    . ILE A  1 174 ? -28.561 -7.504  19.371  1.00 31.79  ? 236 ILE A CB    1 
ATOM   1272  C CG1   . ILE A  1 174 ? -29.745 -8.452  19.344  1.00 34.06  ? 236 ILE A CG1   1 
ATOM   1273  C CG2   . ILE A  1 174 ? -27.940 -7.505  17.998  1.00 31.50  ? 236 ILE A CG2   1 
ATOM   1274  C CD1   . ILE A  1 174 ? -29.424 -9.860  18.899  1.00 35.16  ? 236 ILE A CD1   1 
ATOM   1275  N N     . HIS A  1 175 ? -27.268 -10.256 21.130  1.00 32.75  ? 237 HIS A N     1 
ATOM   1276  C CA    . HIS A  1 175 ? -27.492 -11.407 22.038  1.00 31.10  ? 237 HIS A CA    1 
ATOM   1277  C C     . HIS A  1 175 ? -26.688 -11.285 23.318  1.00 30.17  ? 237 HIS A C     1 
ATOM   1278  O O     . HIS A  1 175 ? -27.014 -11.919 24.300  1.00 31.80  ? 237 HIS A O     1 
ATOM   1279  C CB    . HIS A  1 175 ? -27.143 -12.740 21.372  1.00 31.37  ? 237 HIS A CB    1 
ATOM   1280  C CG    . HIS A  1 175 ? -28.098 -13.137 20.290  1.00 31.29  ? 237 HIS A CG    1 
ATOM   1281  N ND1   . HIS A  1 175 ? -29.425 -13.400 20.539  1.00 31.59  ? 237 HIS A ND1   1 
ATOM   1282  C CD2   . HIS A  1 175 ? -27.926 -13.304 18.956  1.00 31.36  ? 237 HIS A CD2   1 
ATOM   1283  C CE1   . HIS A  1 175 ? -30.032 -13.714 19.407  1.00 30.87  ? 237 HIS A CE1   1 
ATOM   1284  N NE2   . HIS A  1 175 ? -29.146 -13.665 18.431  1.00 30.24  ? 237 HIS A NE2   1 
ATOM   1285  N N     . TRP A  1 176 ? -25.617 -10.497 23.286  1.00 29.24  ? 238 TRP A N     1 
ATOM   1286  C CA    . TRP A  1 176 ? -24.824 -10.159 24.462  1.00 27.74  ? 238 TRP A CA    1 
ATOM   1287  C C     . TRP A  1 176 ? -25.694 -9.724  25.638  1.00 27.80  ? 238 TRP A C     1 
ATOM   1288  O O     . TRP A  1 176 ? -25.418 -10.073 26.784  1.00 27.68  ? 238 TRP A O     1 
ATOM   1289  C CB    . TRP A  1 176 ? -23.897 -9.023  24.091  1.00 27.88  ? 238 TRP A CB    1 
ATOM   1290  C CG    . TRP A  1 176 ? -23.170 -8.476  25.213  1.00 30.69  ? 238 TRP A CG    1 
ATOM   1291  C CD1   . TRP A  1 176 ? -22.038 -8.990  25.792  1.00 32.50  ? 238 TRP A CD1   1 
ATOM   1292  C CD2   . TRP A  1 176 ? -23.487 -7.283  25.939  1.00 32.02  ? 238 TRP A CD2   1 
ATOM   1293  N NE1   . TRP A  1 176 ? -21.632 -8.186  26.837  1.00 33.11  ? 238 TRP A NE1   1 
ATOM   1294  C CE2   . TRP A  1 176 ? -22.512 -7.140  26.954  1.00 31.81  ? 238 TRP A CE2   1 
ATOM   1295  C CE3   . TRP A  1 176 ? -24.497 -6.325  25.835  1.00 32.11  ? 238 TRP A CE3   1 
ATOM   1296  C CZ2   . TRP A  1 176 ? -22.517 -6.078  27.839  1.00 30.95  ? 238 TRP A CZ2   1 
ATOM   1297  C CZ3   . TRP A  1 176 ? -24.497 -5.271  26.729  1.00 32.42  ? 238 TRP A CZ3   1 
ATOM   1298  C CH2   . TRP A  1 176 ? -23.511 -5.152  27.708  1.00 31.81  ? 238 TRP A CH2   1 
ATOM   1299  N N     . TRP A  1 177 ? -26.744 -8.954  25.340  1.00 27.35  ? 239 TRP A N     1 
ATOM   1300  C CA    . TRP A  1 177 ? -27.663 -8.416  26.347  1.00 25.55  ? 239 TRP A CA    1 
ATOM   1301  C C     . TRP A  1 177 ? -28.427 -9.469  27.109  1.00 24.65  ? 239 TRP A C     1 
ATOM   1302  O O     . TRP A  1 177 ? -28.993 -9.172  28.145  1.00 23.62  ? 239 TRP A O     1 
ATOM   1303  C CB    . TRP A  1 177 ? -28.680 -7.485  25.696  1.00 25.71  ? 239 TRP A CB    1 
ATOM   1304  C CG    . TRP A  1 177 ? -28.112 -6.220  25.171  1.00 26.18  ? 239 TRP A CG    1 
ATOM   1305  C CD1   . TRP A  1 177 ? -27.802 -5.951  23.883  1.00 27.51  ? 239 TRP A CD1   1 
ATOM   1306  C CD2   . TRP A  1 177 ? -27.801 -5.043  25.913  1.00 26.80  ? 239 TRP A CD2   1 
ATOM   1307  N NE1   . TRP A  1 177 ? -27.308 -4.680  23.762  1.00 28.35  ? 239 TRP A NE1   1 
ATOM   1308  C CE2   . TRP A  1 177 ? -27.299 -4.097  24.999  1.00 27.75  ? 239 TRP A CE2   1 
ATOM   1309  C CE3   . TRP A  1 177 ? -27.893 -4.693  27.263  1.00 27.74  ? 239 TRP A CE3   1 
ATOM   1310  C CZ2   . TRP A  1 177 ? -26.893 -2.816  25.384  1.00 28.24  ? 239 TRP A CZ2   1 
ATOM   1311  C CZ3   . TRP A  1 177 ? -27.487 -3.424  27.647  1.00 28.89  ? 239 TRP A CZ3   1 
ATOM   1312  C CH2   . TRP A  1 177 ? -26.986 -2.499  26.704  1.00 28.64  ? 239 TRP A CH2   1 
ATOM   1313  N N     . GLU A  1 178 ? -28.464 -10.689 26.590  1.00 25.98  ? 240 GLU A N     1 
ATOM   1314  C CA    . GLU A  1 178 ? -29.158 -11.806 27.254  1.00 27.70  ? 240 GLU A CA    1 
ATOM   1315  C C     . GLU A  1 178 ? -28.508 -12.212 28.557  1.00 29.59  ? 240 GLU A C     1 
ATOM   1316  O O     . GLU A  1 178 ? -29.205 -12.733 29.432  1.00 30.64  ? 240 GLU A O     1 
ATOM   1317  C CB    . GLU A  1 178 ? -29.257 -13.041 26.349  1.00 27.49  ? 240 GLU A CB    1 
ATOM   1318  C CG    . GLU A  1 178 ? -30.329 -12.893 25.277  1.00 28.14  ? 240 GLU A CG    1 
ATOM   1319  C CD    . GLU A  1 178 ? -30.137 -13.784 24.063  1.00 28.86  ? 240 GLU A CD    1 
ATOM   1320  O OE1   . GLU A  1 178 ? -30.816 -13.543 23.038  1.00 28.65  ? 240 GLU A OE1   1 
ATOM   1321  O OE2   . GLU A  1 178 ? -29.305 -14.707 24.117  1.00 30.19  ? 240 GLU A OE2   1 
ATOM   1322  N N     . ASN A  1 179 ? -27.194 -11.963 28.683  1.00 30.68  ? 241 ASN A N     1 
ATOM   1323  C CA    . ASN A  1 179 ? -26.454 -12.269 29.899  1.00 30.38  ? 241 ASN A CA    1 
ATOM   1324  C C     . ASN A  1 179 ? -25.304 -11.313 30.230  1.00 31.59  ? 241 ASN A C     1 
ATOM   1325  O O     . ASN A  1 179 ? -24.143 -11.565 29.900  1.00 31.66  ? 241 ASN A O     1 
ATOM   1326  C CB    . ASN A  1 179 ? -25.924 -13.677 29.827  1.00 29.90  ? 241 ASN A CB    1 
ATOM   1327  C CG    . ASN A  1 179 ? -25.257 -14.091 31.103  1.00 31.38  ? 241 ASN A CG    1 
ATOM   1328  O OD1   . ASN A  1 179 ? -25.202 -13.327 32.079  1.00 32.68  ? 241 ASN A OD1   1 
ATOM   1329  N ND2   . ASN A  1 179 ? -24.706 -15.289 31.100  1.00 32.12  ? 241 ASN A ND2   1 
ATOM   1330  N N     . VAL A  1 180 ? -25.643 -10.248 30.952  1.00 32.30  ? 242 VAL A N     1 
ATOM   1331  C CA    . VAL A  1 180 ? -24.694 -9.228  31.377  1.00 32.07  ? 242 VAL A CA    1 
ATOM   1332  C C     . VAL A  1 180 ? -24.197 -9.472  32.815  1.00 33.04  ? 242 VAL A C     1 
ATOM   1333  O O     . VAL A  1 180 ? -24.879 -9.115  33.790  1.00 33.71  ? 242 VAL A O     1 
ATOM   1334  C CB    . VAL A  1 180 ? -25.362 -7.854  31.296  1.00 31.96  ? 242 VAL A CB    1 
ATOM   1335  C CG1   . VAL A  1 180 ? -24.386 -6.750  31.675  1.00 32.45  ? 242 VAL A CG1   1 
ATOM   1336  C CG2   . VAL A  1 180 ? -25.886 -7.637  29.895  1.00 32.94  ? 242 VAL A CG2   1 
ATOM   1337  N N     . TYR A  1 181 ? -22.990 -10.036 32.936  1.00 33.22  ? 243 TYR A N     1 
ATOM   1338  C CA    . TYR A  1 181 ? -22.374 -10.403 34.231  1.00 31.81  ? 243 TYR A CA    1 
ATOM   1339  C C     . TYR A  1 181 ? -23.315 -11.242 35.074  1.00 33.81  ? 243 TYR A C     1 
ATOM   1340  O O     . TYR A  1 181 ? -23.435 -11.023 36.275  1.00 37.32  ? 243 TYR A O     1 
ATOM   1341  C CB    . TYR A  1 181 ? -21.919 -9.159  34.992  1.00 28.50  ? 243 TYR A CB    1 
ATOM   1342  C CG    . TYR A  1 181 ? -20.883 -8.421  34.242  1.00 26.38  ? 243 TYR A CG    1 
ATOM   1343  C CD1   . TYR A  1 181 ? -19.594 -8.892  34.178  1.00 25.75  ? 243 TYR A CD1   1 
ATOM   1344  C CD2   . TYR A  1 181 ? -21.198 -7.256  33.571  1.00 25.98  ? 243 TYR A CD2   1 
ATOM   1345  C CE1   . TYR A  1 181 ? -18.627 -8.204  33.480  1.00 26.84  ? 243 TYR A CE1   1 
ATOM   1346  C CE2   . TYR A  1 181 ? -20.249 -6.558  32.863  1.00 26.54  ? 243 TYR A CE2   1 
ATOM   1347  C CZ    . TYR A  1 181 ? -18.958 -7.028  32.815  1.00 27.10  ? 243 TYR A CZ    1 
ATOM   1348  O OH    . TYR A  1 181 ? -17.996 -6.321  32.101  1.00 26.58  ? 243 TYR A OH    1 
ATOM   1349  N N     . GLY A  1 182 ? -24.001 -12.178 34.427  1.00 33.83  ? 244 GLY A N     1 
ATOM   1350  C CA    . GLY A  1 182 ? -24.928 -13.050 35.110  1.00 34.15  ? 244 GLY A CA    1 
ATOM   1351  C C     . GLY A  1 182 ? -26.378 -12.633 35.030  1.00 35.69  ? 244 GLY A C     1 
ATOM   1352  O O     . GLY A  1 182 ? -27.233 -13.415 35.392  1.00 34.21  ? 244 GLY A O     1 
ATOM   1353  N N     . PHE A  1 183 ? -26.670 -11.418 34.558  1.00 39.67  ? 245 PHE A N     1 
ATOM   1354  C CA    . PHE A  1 183 ? -28.050 -10.874 34.565  1.00 41.03  ? 245 PHE A CA    1 
ATOM   1355  C C     . PHE A  1 183 ? -28.704 -10.727 33.196  1.00 40.87  ? 245 PHE A C     1 
ATOM   1356  O O     . PHE A  1 183 ? -28.056 -10.344 32.223  1.00 43.17  ? 245 PHE A O     1 
ATOM   1357  C CB    . PHE A  1 183 ? -28.066 -9.516  35.242  1.00 41.04  ? 245 PHE A CB    1 
ATOM   1358  C CG    . PHE A  1 183 ? -27.545 -9.555  36.623  1.00 42.35  ? 245 PHE A CG    1 
ATOM   1359  C CD1   . PHE A  1 183 ? -28.351 -9.971  37.667  1.00 41.43  ? 245 PHE A CD1   1 
ATOM   1360  C CD2   . PHE A  1 183 ? -26.230 -9.208  36.881  1.00 44.36  ? 245 PHE A CD2   1 
ATOM   1361  C CE1   . PHE A  1 183 ? -27.860 -10.016 38.962  1.00 42.72  ? 245 PHE A CE1   1 
ATOM   1362  C CE2   . PHE A  1 183 ? -25.733 -9.243  38.174  1.00 46.30  ? 245 PHE A CE2   1 
ATOM   1363  C CZ    . PHE A  1 183 ? -26.548 -9.650  39.220  1.00 44.68  ? 245 PHE A CZ    1 
ATOM   1364  N N     . ASP A  1 184 ? -30.008 -10.992 33.155  1.00 39.62  ? 246 ASP A N     1 
ATOM   1365  C CA    . ASP A  1 184 ? -30.816 -10.853 31.942  1.00 38.67  ? 246 ASP A CA    1 
ATOM   1366  C C     . ASP A  1 184 ? -31.140 -9.383  31.664  1.00 34.79  ? 246 ASP A C     1 
ATOM   1367  O O     . ASP A  1 184 ? -31.648 -8.684  32.525  1.00 32.15  ? 246 ASP A O     1 
ATOM   1368  C CB    . ASP A  1 184 ? -32.118 -11.652 32.105  1.00 40.12  ? 246 ASP A CB    1 
ATOM   1369  C CG    . ASP A  1 184 ? -32.983 -11.641 30.855  1.00 40.67  ? 246 ASP A CG    1 
ATOM   1370  O OD1   . ASP A  1 184 ? -33.535 -10.588 30.499  1.00 41.71  ? 246 ASP A OD1   1 
ATOM   1371  O OD2   . ASP A  1 184 ? -33.118 -12.695 30.230  1.00 41.37  ? 246 ASP A OD2   1 
ATOM   1372  N N     . MET A  1 185 ? -30.833 -8.920  30.465  1.00 33.17  ? 247 MET A N     1 
ATOM   1373  C CA    . MET A  1 185 ? -31.223 -7.586  30.061  1.00 35.04  ? 247 MET A CA    1 
ATOM   1374  C C     . MET A  1 185 ? -31.901 -7.588  28.685  1.00 36.81  ? 247 MET A C     1 
ATOM   1375  O O     . MET A  1 185 ? -31.686 -6.657  27.874  1.00 35.50  ? 247 MET A O     1 
ATOM   1376  C CB    . MET A  1 185 ? -30.005 -6.670  30.042  1.00 35.86  ? 247 MET A CB    1 
ATOM   1377  C CG    . MET A  1 185 ? -29.330 -6.488  31.391  1.00 36.29  ? 247 MET A CG    1 
ATOM   1378  S SD    . MET A  1 185 ? -28.274 -5.025  31.371  1.00 38.37  ? 247 MET A SD    1 
ATOM   1379  C CE    . MET A  1 185 ? -27.662 -4.964  33.052  1.00 37.13  ? 247 MET A CE    1 
ATOM   1380  N N     . THR A  1 186 ? -32.743 -8.607  28.436  1.00 36.28  ? 248 THR A N     1 
ATOM   1381  C CA    . THR A  1 186 ? -33.349 -8.802  27.108  1.00 34.02  ? 248 THR A CA    1 
ATOM   1382  C C     . THR A  1 186 ? -34.330 -7.707  26.791  1.00 32.80  ? 248 THR A C     1 
ATOM   1383  O O     . THR A  1 186 ? -34.573 -7.427  25.632  1.00 32.58  ? 248 THR A O     1 
ATOM   1384  C CB    . THR A  1 186 ? -34.116 -10.119 26.960  1.00 34.39  ? 248 THR A CB    1 
ATOM   1385  O OG1   . THR A  1 186 ? -35.159 -10.152 27.921  1.00 34.97  ? 248 THR A OG1   1 
ATOM   1386  C CG2   . THR A  1 186 ? -33.221 -11.318 27.168  1.00 35.64  ? 248 THR A CG2   1 
ATOM   1387  N N     . CYS A  1 187 ? -34.889 -7.069  27.810  1.00 33.11  ? 249 CYS A N     1 
ATOM   1388  C CA    . CYS A  1 187 ? -35.777 -5.948  27.553  1.00 33.91  ? 249 CYS A CA    1 
ATOM   1389  C C     . CYS A  1 187 ? -35.000 -4.836  26.825  1.00 32.29  ? 249 CYS A C     1 
ATOM   1390  O O     . CYS A  1 187 ? -35.571 -4.148  25.977  1.00 32.18  ? 249 CYS A O     1 
ATOM   1391  C CB    . CYS A  1 187 ? -36.447 -5.454  28.838  1.00 35.27  ? 249 CYS A CB    1 
ATOM   1392  S SG    . CYS A  1 187 ? -35.301 -4.700  29.981  1.00 38.62  ? 249 CYS A SG    1 
ATOM   1393  N N     . ILE A  1 188 ? -33.704 -4.687  27.111  1.00 30.40  ? 250 ILE A N     1 
ATOM   1394  C CA    . ILE A  1 188 ? -32.879 -3.750  26.355  1.00 29.53  ? 250 ILE A CA    1 
ATOM   1395  C C     . ILE A  1 188 ? -32.572 -4.312  24.969  1.00 28.82  ? 250 ILE A C     1 
ATOM   1396  O O     . ILE A  1 188 ? -32.741 -3.645  23.952  1.00 28.38  ? 250 ILE A O     1 
ATOM   1397  C CB    . ILE A  1 188 ? -31.592 -3.364  27.107  1.00 29.14  ? 250 ILE A CB    1 
ATOM   1398  C CG1   . ILE A  1 188 ? -31.945 -2.370  28.215  1.00 28.51  ? 250 ILE A CG1   1 
ATOM   1399  C CG2   . ILE A  1 188 ? -30.579 -2.717  26.158  1.00 29.43  ? 250 ILE A CG2   1 
ATOM   1400  C CD1   . ILE A  1 188 ? -30.765 -1.887  29.029  1.00 28.08  ? 250 ILE A CD1   1 
ATOM   1401  N N     . ARG A  1 189 ? -32.124 -5.545  24.933  1.00 29.07  ? 251 ARG A N     1 
ATOM   1402  C CA    . ARG A  1 189 ? -31.930 -6.248  23.673  1.00 30.46  ? 251 ARG A CA    1 
ATOM   1403  C C     . ARG A  1 189 ? -33.055 -5.956  22.669  1.00 28.82  ? 251 ARG A C     1 
ATOM   1404  O O     . ARG A  1 189 ? -32.817 -5.516  21.549  1.00 26.05  ? 251 ARG A O     1 
ATOM   1405  C CB    . ARG A  1 189 ? -31.832 -7.749  23.978  1.00 32.73  ? 251 ARG A CB    1 
ATOM   1406  C CG    . ARG A  1 189 ? -31.533 -8.641  22.792  1.00 34.23  ? 251 ARG A CG    1 
ATOM   1407  C CD    . ARG A  1 189 ? -32.772 -9.393  22.348  1.00 35.89  ? 251 ARG A CD    1 
ATOM   1408  N NE    . ARG A  1 189 ? -32.801 -10.750 22.884  1.00 36.89  ? 251 ARG A NE    1 
ATOM   1409  C CZ    . ARG A  1 189 ? -33.906 -11.447 23.115  1.00 38.30  ? 251 ARG A CZ    1 
ATOM   1410  N NH1   . ARG A  1 189 ? -35.104 -10.925 22.889  1.00 38.60  ? 251 ARG A NH1   1 
ATOM   1411  N NH2   . ARG A  1 189 ? -33.810 -12.680 23.589  1.00 39.96  ? 251 ARG A NH2   1 
ATOM   1412  N N     . ASP A  1 190 ? -34.289 -6.157  23.112  1.00 29.55  ? 252 ASP A N     1 
ATOM   1413  C CA    . ASP A  1 190 ? -35.465 -5.953  22.261  1.00 29.25  ? 252 ASP A CA    1 
ATOM   1414  C C     . ASP A  1 190 ? -35.552 -4.556  21.676  1.00 29.91  ? 252 ASP A C     1 
ATOM   1415  O O     . ASP A  1 190 ? -36.031 -4.402  20.567  1.00 29.19  ? 252 ASP A O     1 
ATOM   1416  C CB    . ASP A  1 190 ? -36.746 -6.288  23.027  1.00 27.76  ? 252 ASP A CB    1 
ATOM   1417  C CG    . ASP A  1 190 ? -36.895 -7.783  23.262  1.00 27.08  ? 252 ASP A CG    1 
ATOM   1418  O OD1   . ASP A  1 190 ? -36.037 -8.534  22.774  1.00 27.30  ? 252 ASP A OD1   1 
ATOM   1419  O OD2   . ASP A  1 190 ? -37.849 -8.223  23.928  1.00 25.95  ? 252 ASP A OD2   1 
ATOM   1420  N N     . VAL A  1 191 ? -35.092 -3.555  22.419  1.00 32.26  ? 253 VAL A N     1 
ATOM   1421  C CA    . VAL A  1 191 ? -35.005 -2.183  21.916  1.00 35.39  ? 253 VAL A CA    1 
ATOM   1422  C C     . VAL A  1 191 ? -33.818 -2.030  20.947  1.00 36.66  ? 253 VAL A C     1 
ATOM   1423  O O     . VAL A  1 191 ? -33.890 -1.287  19.959  1.00 33.70  ? 253 VAL A O     1 
ATOM   1424  C CB    . VAL A  1 191 ? -34.922 -1.157  23.087  1.00 37.12  ? 253 VAL A CB    1 
ATOM   1425  C CG1   . VAL A  1 191 ? -34.577 0.251   22.603  1.00 38.80  ? 253 VAL A CG1   1 
ATOM   1426  C CG2   . VAL A  1 191 ? -36.235 -1.120  23.844  1.00 36.41  ? 253 VAL A CG2   1 
ATOM   1427  N N     . ALA A  1 192 ? -32.719 -2.720  21.239  1.00 39.99  ? 254 ALA A N     1 
ATOM   1428  C CA    . ALA A  1 192 ? -31.519 -2.593  20.413  1.00 40.82  ? 254 ALA A CA    1 
ATOM   1429  C C     . ALA A  1 192 ? -31.790 -3.115  19.030  1.00 40.62  ? 254 ALA A C     1 
ATOM   1430  O O     . ALA A  1 192 ? -31.428 -2.471  18.058  1.00 47.99  ? 254 ALA A O     1 
ATOM   1431  C CB    . ALA A  1 192 ? -30.334 -3.302  21.040  1.00 40.09  ? 254 ALA A CB    1 
ATOM   1432  N N     . MET A  1 193 ? -32.452 -4.259  18.947  1.00 38.97  ? 255 MET A N     1 
ATOM   1433  C CA    . MET A  1 193 ? -32.915 -4.805  17.676  1.00 38.83  ? 255 MET A CA    1 
ATOM   1434  C C     . MET A  1 193 ? -33.581 -3.790  16.776  1.00 40.30  ? 255 MET A C     1 
ATOM   1435  O O     . MET A  1 193 ? -33.334 -3.753  15.579  1.00 42.34  ? 255 MET A O     1 
ATOM   1436  C CB    . MET A  1 193 ? -33.918 -5.890  17.951  1.00 39.34  ? 255 MET A CB    1 
ATOM   1437  C CG    . MET A  1 193 ? -33.260 -7.175  18.348  1.00 40.92  ? 255 MET A CG    1 
ATOM   1438  S SD    . MET A  1 193 ? -32.555 -7.904  16.877  1.00 45.40  ? 255 MET A SD    1 
ATOM   1439  C CE    . MET A  1 193 ? -32.735 -9.650  17.291  1.00 47.66  ? 255 MET A CE    1 
ATOM   1440  N N     . LYS A  1 194 ? -34.408 -2.948  17.368  1.00 43.41  ? 256 LYS A N     1 
ATOM   1441  C CA    . LYS A  1 194 ? -35.178 -1.956  16.624  1.00 45.40  ? 256 LYS A CA    1 
ATOM   1442  C C     . LYS A  1 194 ? -34.343 -0.773  16.120  1.00 40.50  ? 256 LYS A C     1 
ATOM   1443  O O     . LYS A  1 194 ? -34.858 0.115   15.443  1.00 37.67  ? 256 LYS A O     1 
ATOM   1444  C CB    . LYS A  1 194 ? -36.382 -1.495  17.482  1.00 50.62  ? 256 LYS A CB    1 
ATOM   1445  C CG    . LYS A  1 194 ? -37.346 -2.639  17.863  1.00 57.55  ? 256 LYS A CG    1 
ATOM   1446  C CD    . LYS A  1 194 ? -37.700 -3.555  16.667  1.00 64.48  ? 256 LYS A CD    1 
ATOM   1447  C CE    . LYS A  1 194 ? -38.233 -4.927  17.045  1.00 67.61  ? 256 LYS A CE    1 
ATOM   1448  N NZ    . LYS A  1 194 ? -39.620 -4.783  17.559  1.00 71.48  ? 256 LYS A NZ    1 
ATOM   1449  N N     . GLU A  1 195 ? -33.052 -0.770  16.420  1.00 38.25  ? 257 GLU A N     1 
ATOM   1450  C CA    . GLU A  1 195 ? -32.185 0.292   15.957  1.00 38.91  ? 257 GLU A CA    1 
ATOM   1451  C C     . GLU A  1 195 ? -31.116 -0.210  14.971  1.00 36.05  ? 257 GLU A C     1 
ATOM   1452  O O     . GLU A  1 195 ? -30.277 -1.049  15.313  1.00 35.60  ? 257 GLU A O     1 
ATOM   1453  C CB    . GLU A  1 195 ? -31.547 0.989   17.151  1.00 41.51  ? 257 GLU A CB    1 
ATOM   1454  C CG    . GLU A  1 195 ? -30.974 2.368   16.833  1.00 42.82  ? 257 GLU A CG    1 
ATOM   1455  C CD    . GLU A  1 195 ? -30.398 3.020   18.063  1.00 42.54  ? 257 GLU A CD    1 
ATOM   1456  O OE1   . GLU A  1 195 ? -31.064 2.951   19.133  1.00 41.17  ? 257 GLU A OE1   1 
ATOM   1457  O OE2   . GLU A  1 195 ? -29.293 3.592   17.956  1.00 40.03  ? 257 GLU A OE2   1 
ATOM   1458  N N     . PRO A  1 196 ? -31.146 0.310   13.735  1.00 33.12  ? 258 PRO A N     1 
ATOM   1459  C CA    . PRO A  1 196 ? -30.183 -0.145  12.768  1.00 31.66  ? 258 PRO A CA    1 
ATOM   1460  C C     . PRO A  1 196 ? -28.802 0.285   13.174  1.00 31.44  ? 258 PRO A C     1 
ATOM   1461  O O     . PRO A  1 196 ? -28.656 1.328   13.782  1.00 31.54  ? 258 PRO A O     1 
ATOM   1462  C CB    . PRO A  1 196 ? -30.598 0.571   11.473  1.00 31.82  ? 258 PRO A CB    1 
ATOM   1463  C CG    . PRO A  1 196 ? -31.969 1.082   11.701  1.00 32.93  ? 258 PRO A CG    1 
ATOM   1464  C CD    . PRO A  1 196 ? -32.055 1.324   13.174  1.00 33.80  ? 258 PRO A CD    1 
ATOM   1465  N N     . LEU A  1 197 ? -27.806 -0.513  12.822  1.00 31.63  ? 259 LEU A N     1 
ATOM   1466  C CA    . LEU A  1 197 ? -26.422 -0.194  13.093  1.00 32.38  ? 259 LEU A CA    1 
ATOM   1467  C C     . LEU A  1 197 ? -25.760 0.397   11.884  1.00 30.90  ? 259 LEU A C     1 
ATOM   1468  O O     . LEU A  1 197 ? -25.852 -0.175  10.787  1.00 29.65  ? 259 LEU A O     1 
ATOM   1469  C CB    . LEU A  1 197 ? -25.637 -1.443  13.386  1.00 36.12  ? 259 LEU A CB    1 
ATOM   1470  C CG    . LEU A  1 197 ? -25.376 -1.750  14.837  1.00 40.03  ? 259 LEU A CG    1 
ATOM   1471  C CD1   . LEU A  1 197 ? -26.659 -2.258  15.525  1.00 42.85  ? 259 LEU A CD1   1 
ATOM   1472  C CD2   . LEU A  1 197 ? -24.234 -2.764  14.840  1.00 40.44  ? 259 LEU A CD2   1 
ATOM   1473  N N     . VAL A  1 198 ? -25.062 1.511   12.095  1.00 28.87  ? 260 VAL A N     1 
ATOM   1474  C CA    . VAL A  1 198 ? -24.230 2.094   11.075  1.00 27.19  ? 260 VAL A CA    1 
ATOM   1475  C C     . VAL A  1 198 ? -22.837 1.616   11.318  1.00 26.35  ? 260 VAL A C     1 
ATOM   1476  O O     . VAL A  1 198 ? -22.210 2.042   12.254  1.00 26.81  ? 260 VAL A O     1 
ATOM   1477  C CB    . VAL A  1 198 ? -24.245 3.618   11.133  1.00 27.42  ? 260 VAL A CB    1 
ATOM   1478  C CG1   . VAL A  1 198 ? -23.270 4.188   10.122  1.00 28.27  ? 260 VAL A CG1   1 
ATOM   1479  C CG2   . VAL A  1 198 ? -25.642 4.145   10.849  1.00 27.84  ? 260 VAL A CG2   1 
ATOM   1480  N N     . ASP A  1 199 ? -22.351 0.731   10.466  1.00 26.96  ? 261 ASP A N     1 
ATOM   1481  C CA    . ASP A  1 199 ? -21.028 0.118   10.656  1.00 27.64  ? 261 ASP A CA    1 
ATOM   1482  C C     . ASP A  1 199 ? -20.570 -0.537  9.348   1.00 26.79  ? 261 ASP A C     1 
ATOM   1483  O O     . ASP A  1 199 ? -21.385 -0.736  8.443   1.00 27.01  ? 261 ASP A O     1 
ATOM   1484  C CB    . ASP A  1 199 ? -21.108 -0.923  11.788  1.00 28.00  ? 261 ASP A CB    1 
ATOM   1485  C CG    . ASP A  1 199 ? -19.899 -0.902  12.715  1.00 29.08  ? 261 ASP A CG    1 
ATOM   1486  O OD1   . ASP A  1 199 ? -18.767 -0.585  12.275  1.00 30.78  ? 261 ASP A OD1   1 
ATOM   1487  O OD2   . ASP A  1 199 ? -20.099 -1.233  13.900  1.00 29.41  ? 261 ASP A OD2   1 
ATOM   1488  N N     . ILE A  1 200 ? -19.289 -0.878  9.232   1.00 25.99  ? 262 ILE A N     1 
ATOM   1489  C CA    . ILE A  1 200 ? -18.803 -1.483  7.986   1.00 25.44  ? 262 ILE A CA    1 
ATOM   1490  C C     . ILE A  1 200 ? -19.089 -2.978  7.922   1.00 24.51  ? 262 ILE A C     1 
ATOM   1491  O O     . ILE A  1 200 ? -18.896 -3.698  8.878   1.00 22.74  ? 262 ILE A O     1 
ATOM   1492  C CB    . ILE A  1 200 ? -17.298 -1.253  7.748   1.00 25.73  ? 262 ILE A CB    1 
ATOM   1493  C CG1   . ILE A  1 200 ? -17.006 0.231   7.536   1.00 25.91  ? 262 ILE A CG1   1 
ATOM   1494  C CG2   . ILE A  1 200 ? -16.797 -2.051  6.547   1.00 26.00  ? 262 ILE A CG2   1 
ATOM   1495  C CD1   . ILE A  1 200 ? -16.310 0.831   8.733   1.00 27.67  ? 262 ILE A CD1   1 
ATOM   1496  N N     . VAL A  1 201 ? -19.530 -3.413  6.747   1.00 25.41  ? 263 VAL A N     1 
ATOM   1497  C CA    . VAL A  1 201 ? -19.831 -4.802  6.438   1.00 25.35  ? 263 VAL A CA    1 
ATOM   1498  C C     . VAL A  1 201 ? -18.799 -5.350  5.437   1.00 25.34  ? 263 VAL A C     1 
ATOM   1499  O O     . VAL A  1 201 ? -18.501 -4.721  4.400   1.00 24.74  ? 263 VAL A O     1 
ATOM   1500  C CB    . VAL A  1 201 ? -21.230 -4.895  5.809   1.00 26.08  ? 263 VAL A CB    1 
ATOM   1501  C CG1   . VAL A  1 201 ? -21.619 -6.344  5.612   1.00 26.97  ? 263 VAL A CG1   1 
ATOM   1502  C CG2   . VAL A  1 201 ? -22.264 -4.189  6.678   1.00 26.29  ? 263 VAL A CG2   1 
ATOM   1503  N N     . ASP A  1 202 ? -18.249 -6.516  5.751   1.00 25.07  ? 264 ASP A N     1 
ATOM   1504  C CA    . ASP A  1 202 ? -17.300 -7.187  4.863   1.00 25.80  ? 264 ASP A CA    1 
ATOM   1505  C C     . ASP A  1 202 ? -18.066 -7.719  3.630   1.00 26.64  ? 264 ASP A C     1 
ATOM   1506  O O     . ASP A  1 202 ? -19.073 -8.444  3.786   1.00 26.84  ? 264 ASP A O     1 
ATOM   1507  C CB    . ASP A  1 202 ? -16.653 -8.337  5.635   1.00 26.52  ? 264 ASP A CB    1 
ATOM   1508  C CG    . ASP A  1 202 ? -15.546 -9.046  4.881   1.00 27.75  ? 264 ASP A CG    1 
ATOM   1509  O OD1   . ASP A  1 202 ? -15.614 -9.199  3.640   1.00 28.24  ? 264 ASP A OD1   1 
ATOM   1510  O OD2   . ASP A  1 202 ? -14.591 -9.476  5.560   1.00 29.52  ? 264 ASP A OD2   1 
ATOM   1511  N N     . PRO A  1 203 ? -17.624 -7.349  2.404   1.00 26.22  ? 265 PRO A N     1 
ATOM   1512  C CA    . PRO A  1 203 ? -18.332 -7.797  1.200   1.00 26.31  ? 265 PRO A CA    1 
ATOM   1513  C C     . PRO A  1 203 ? -18.517 -9.303  1.120   1.00 26.99  ? 265 PRO A C     1 
ATOM   1514  O O     . PRO A  1 203 ? -19.448 -9.766  0.461   1.00 27.38  ? 265 PRO A O     1 
ATOM   1515  C CB    . PRO A  1 203 ? -17.447 -7.309  0.044   1.00 26.03  ? 265 PRO A CB    1 
ATOM   1516  C CG    . PRO A  1 203 ? -16.206 -6.761  0.659   1.00 26.40  ? 265 PRO A CG    1 
ATOM   1517  C CD    . PRO A  1 203 ? -16.562 -6.388  2.069   1.00 26.88  ? 265 PRO A CD    1 
ATOM   1518  N N     . LYS A  1 204 ? -17.650 -10.051 1.798   1.00 27.50  ? 266 LYS A N     1 
ATOM   1519  C CA    . LYS A  1 204 ? -17.785 -11.497 1.904   1.00 27.59  ? 266 LYS A CA    1 
ATOM   1520  C C     . LYS A  1 204 ? -19.038 -11.933 2.634   1.00 26.08  ? 266 LYS A C     1 
ATOM   1521  O O     . LYS A  1 204 ? -19.578 -12.994 2.333   1.00 25.16  ? 266 LYS A O     1 
ATOM   1522  C CB    . LYS A  1 204 ? -16.562 -12.099 2.574   1.00 29.72  ? 266 LYS A CB    1 
ATOM   1523  C CG    . LYS A  1 204 ? -15.375 -12.136 1.637   1.00 32.62  ? 266 LYS A CG    1 
ATOM   1524  C CD    . LYS A  1 204 ? -14.064 -12.276 2.381   1.00 35.91  ? 266 LYS A CD    1 
ATOM   1525  C CE    . LYS A  1 204 ? -12.928 -12.386 1.374   1.00 39.59  ? 266 LYS A CE    1 
ATOM   1526  N NZ    . LYS A  1 204 ? -11.595 -12.140 2.002   1.00 40.97  ? 266 LYS A NZ    1 
ATOM   1527  N N     . GLN A  1 205 ? -19.525 -11.114 3.562   1.00 25.47  ? 267 GLN A N     1 
ATOM   1528  C CA    . GLN A  1 205 ? -20.723 -11.476 4.337   1.00 26.43  ? 267 GLN A CA    1 
ATOM   1529  C C     . GLN A  1 205 ? -22.016 -11.499 3.516   1.00 26.77  ? 267 GLN A C     1 
ATOM   1530  O O     . GLN A  1 205 ? -22.983 -12.135 3.929   1.00 26.55  ? 267 GLN A O     1 
ATOM   1531  C CB    . GLN A  1 205 ? -20.907 -10.532 5.526   1.00 26.46  ? 267 GLN A CB    1 
ATOM   1532  C CG    . GLN A  1 205 ? -19.856 -10.702 6.602   1.00 26.48  ? 267 GLN A CG    1 
ATOM   1533  C CD    . GLN A  1 205 ? -20.063 -9.798  7.815   1.00 26.77  ? 267 GLN A CD    1 
ATOM   1534  O OE1   . GLN A  1 205 ? -21.058 -9.913  8.543   1.00 26.09  ? 267 GLN A OE1   1 
ATOM   1535  N NE2   . GLN A  1 205 ? -19.098 -8.903  8.053   1.00 27.58  ? 267 GLN A NE2   1 
ATOM   1536  N N     . VAL A  1 206 ? -22.025 -10.803 2.374   1.00 27.12  ? 268 VAL A N     1 
ATOM   1537  C CA    . VAL A  1 206 ? -23.237 -10.581 1.561   1.00 26.52  ? 268 VAL A CA    1 
ATOM   1538  C C     . VAL A  1 206 ? -23.678 -11.874 0.864   1.00 26.29  ? 268 VAL A C     1 
ATOM   1539  O O     . VAL A  1 206 ? -22.885 -12.518 0.206   1.00 28.63  ? 268 VAL A O     1 
ATOM   1540  C CB    . VAL A  1 206 ? -23.007 -9.463  0.502   1.00 25.88  ? 268 VAL A CB    1 
ATOM   1541  C CG1   . VAL A  1 206 ? -24.223 -9.325  -0.399  1.00 25.70  ? 268 VAL A CG1   1 
ATOM   1542  C CG2   . VAL A  1 206 ? -22.671 -8.126  1.158   1.00 24.95  ? 268 VAL A CG2   1 
ATOM   1543  N N     . VAL A  1 207 ? -24.946 -12.229 0.999   1.00 25.67  ? 269 VAL A N     1 
ATOM   1544  C CA    . VAL A  1 207 ? -25.462 -13.533 0.578   1.00 25.41  ? 269 VAL A CA    1 
ATOM   1545  C C     . VAL A  1 207 ? -26.312 -13.436 -0.690  1.00 25.99  ? 269 VAL A C     1 
ATOM   1546  O O     . VAL A  1 207 ? -26.653 -14.446 -1.308  1.00 26.28  ? 269 VAL A O     1 
ATOM   1547  C CB    . VAL A  1 207 ? -26.312 -14.118 1.725   1.00 25.39  ? 269 VAL A CB    1 
ATOM   1548  C CG1   . VAL A  1 207 ? -27.141 -15.314 1.302   1.00 24.96  ? 269 VAL A CG1   1 
ATOM   1549  C CG2   . VAL A  1 207 ? -25.413 -14.498 2.885   1.00 26.21  ? 269 VAL A CG2   1 
ATOM   1550  N N     . THR A  1 208 ? -26.650 -12.221 -1.095  1.00 26.52  ? 270 THR A N     1 
ATOM   1551  C CA    . THR A  1 208 ? -27.575 -12.032 -2.203  1.00 26.16  ? 270 THR A CA    1 
ATOM   1552  C C     . THR A  1 208 ? -27.060 -11.060 -3.234  1.00 26.18  ? 270 THR A C     1 
ATOM   1553  O O     . THR A  1 208 ? -26.020 -10.416 -3.061  1.00 26.50  ? 270 THR A O     1 
ATOM   1554  C CB    . THR A  1 208 ? -28.909 -11.457 -1.685  1.00 25.70  ? 270 THR A CB    1 
ATOM   1555  O OG1   . THR A  1 208 ? -28.717 -10.110 -1.221  1.00 24.69  ? 270 THR A OG1   1 
ATOM   1556  C CG2   . THR A  1 208 ? -29.425 -12.315 -0.560  1.00 25.59  ? 270 THR A CG2   1 
ATOM   1557  N N     . ASN A  1 209 ? -27.830 -10.935 -4.303  1.00 26.39  ? 271 ASN A N     1 
ATOM   1558  C CA    . ASN A  1 209 ? -27.709 -9.780  -5.196  1.00 25.90  ? 271 ASN A CA    1 
ATOM   1559  C C     . ASN A  1 209 ? -28.283 -8.562  -4.508  1.00 24.99  ? 271 ASN A C     1 
ATOM   1560  O O     . ASN A  1 209 ? -28.715 -8.631  -3.354  1.00 24.51  ? 271 ASN A O     1 
ATOM   1561  C CB    . ASN A  1 209 ? -28.421 -10.014 -6.524  1.00 25.13  ? 271 ASN A CB    1 
ATOM   1562  C CG    . ASN A  1 209 ? -29.878 -10.342 -6.352  1.00 25.08  ? 271 ASN A CG    1 
ATOM   1563  O OD1   . ASN A  1 209 ? -30.355 -10.540 -5.248  1.00 25.78  ? 271 ASN A OD1   1 
ATOM   1564  N ND2   . ASN A  1 209 ? -30.585 -10.442 -7.451  1.00 26.17  ? 271 ASN A ND2   1 
ATOM   1565  N N     . ALA A  1 210 ? -28.257 -7.443  -5.214  1.00 24.63  ? 272 ALA A N     1 
ATOM   1566  C CA    . ALA A  1 210 ? -28.750 -6.195  -4.671  1.00 23.78  ? 272 ALA A CA    1 
ATOM   1567  C C     . ALA A  1 210 ? -30.018 -5.796  -5.368  1.00 22.70  ? 272 ALA A C     1 
ATOM   1568  O O     . ALA A  1 210 ? -30.279 -6.166  -6.504  1.00 20.92  ? 272 ALA A O     1 
ATOM   1569  C CB    . ALA A  1 210 ? -27.707 -5.093  -4.804  1.00 24.17  ? 272 ALA A CB    1 
ATOM   1570  N N     . CYS A  1 211 ? -30.808 -5.033  -4.648  1.00 23.47  ? 273 CYS A N     1 
ATOM   1571  C CA    . CYS A  1 211 ? -32.091 -4.642  -5.111  1.00 24.99  ? 273 CYS A CA    1 
ATOM   1572  C C     . CYS A  1 211 ? -32.231 -3.161  -4.874  1.00 23.77  ? 273 CYS A C     1 
ATOM   1573  O O     . CYS A  1 211 ? -31.913 -2.671  -3.806  1.00 21.64  ? 273 CYS A O     1 
ATOM   1574  C CB    . CYS A  1 211 ? -33.151 -5.444  -4.359  1.00 26.72  ? 273 CYS A CB    1 
ATOM   1575  S SG    . CYS A  1 211 ? -34.831 -4.988  -4.773  1.00 31.08  ? 273 CYS A SG    1 
ATOM   1576  N N     . LEU A  1 212 ? -32.688 -2.466  -5.908  1.00 24.70  ? 274 LEU A N     1 
ATOM   1577  C CA    . LEU A  1 212 ? -32.937 -1.035  -5.864  1.00 25.28  ? 274 LEU A CA    1 
ATOM   1578  C C     . LEU A  1 212 ? -34.233 -0.823  -5.115  1.00 24.77  ? 274 LEU A C     1 
ATOM   1579  O O     . LEU A  1 212 ? -35.208 -1.506  -5.387  1.00 23.87  ? 274 LEU A O     1 
ATOM   1580  C CB    . LEU A  1 212 ? -33.065 -0.490  -7.292  1.00 26.25  ? 274 LEU A CB    1 
ATOM   1581  C CG    . LEU A  1 212 ? -33.393 0.992   -7.469  1.00 27.27  ? 274 LEU A CG    1 
ATOM   1582  C CD1   . LEU A  1 212 ? -32.286 1.870   -6.906  1.00 27.59  ? 274 LEU A CD1   1 
ATOM   1583  C CD2   . LEU A  1 212 ? -33.655 1.313   -8.932  1.00 27.65  ? 274 LEU A CD2   1 
ATOM   1584  N N     . ILE A  1 213 ? -34.241 0.083   -4.147  1.00 25.82  ? 275 ILE A N     1 
ATOM   1585  C CA    . ILE A  1 213 ? -35.471 0.376   -3.406  1.00 26.98  ? 275 ILE A CA    1 
ATOM   1586  C C     . ILE A  1 213 ? -35.877 1.845   -3.400  1.00 26.85  ? 275 ILE A C     1 
ATOM   1587  O O     . ILE A  1 213 ? -36.967 2.178   -2.952  1.00 26.52  ? 275 ILE A O     1 
ATOM   1588  C CB    . ILE A  1 213 ? -35.423 -0.157  -1.953  1.00 27.73  ? 275 ILE A CB    1 
ATOM   1589  C CG1   . ILE A  1 213 ? -34.248 0.415   -1.191  1.00 28.85  ? 275 ILE A CG1   1 
ATOM   1590  C CG2   . ILE A  1 213 ? -35.340 -1.682  -1.940  1.00 27.93  ? 275 ILE A CG2   1 
ATOM   1591  C CD1   . ILE A  1 213 ? -34.423 0.270   0.306   1.00 30.50  ? 275 ILE A CD1   1 
ATOM   1592  N N     . LYS A  1 214 ? -35.016 2.723   -3.884  1.00 27.25  ? 276 LYS A N     1 
ATOM   1593  C CA    . LYS A  1 214 ? -35.415 4.098   -4.055  1.00 28.56  ? 276 LYS A CA    1 
ATOM   1594  C C     . LYS A  1 214 ? -34.450 4.801   -4.980  1.00 30.26  ? 276 LYS A C     1 
ATOM   1595  O O     . LYS A  1 214 ? -33.267 4.859   -4.716  1.00 31.27  ? 276 LYS A O     1 
ATOM   1596  C CB    . LYS A  1 214 ? -35.490 4.820   -2.709  1.00 29.22  ? 276 LYS A CB    1 
ATOM   1597  C CG    . LYS A  1 214 ? -36.093 6.219   -2.757  1.00 29.73  ? 276 LYS A CG    1 
ATOM   1598  C CD    . LYS A  1 214 ? -37.576 6.181   -3.070  1.00 30.74  ? 276 LYS A CD    1 
ATOM   1599  C CE    . LYS A  1 214 ? -38.072 7.543   -3.487  1.00 32.43  ? 276 LYS A CE    1 
ATOM   1600  N NZ    . LYS A  1 214 ? -39.552 7.556   -3.546  1.00 33.58  ? 276 LYS A NZ    1 
ATOM   1601  N N     . GLU A  1 215 ? -34.978 5.336   -6.071  1.00 32.94  ? 277 GLU A N     1 
ATOM   1602  C CA    . GLU A  1 215 ? -34.208 6.119   -7.014  1.00 33.64  ? 277 GLU A CA    1 
ATOM   1603  C C     . GLU A  1 215 ? -34.598 7.570   -6.821  1.00 32.38  ? 277 GLU A C     1 
ATOM   1604  O O     . GLU A  1 215 ? -35.761 7.873   -6.533  1.00 32.74  ? 277 GLU A O     1 
ATOM   1605  C CB    . GLU A  1 215 ? -34.543 5.657   -8.418  1.00 35.34  ? 277 GLU A CB    1 
ATOM   1606  C CG    . GLU A  1 215 ? -33.538 6.112   -9.461  1.00 38.00  ? 277 GLU A CG    1 
ATOM   1607  C CD    . GLU A  1 215 ? -33.444 5.159   -10.621 1.00 37.44  ? 277 GLU A CD    1 
ATOM   1608  O OE1   . GLU A  1 215 ? -32.394 5.169   -11.278 1.00 37.31  ? 277 GLU A OE1   1 
ATOM   1609  O OE2   . GLU A  1 215 ? -34.402 4.391   -10.845 1.00 37.15  ? 277 GLU A OE2   1 
ATOM   1610  N N     . VAL A  1 216 ? -33.643 8.474   -6.952  1.00 31.80  ? 278 VAL A N     1 
ATOM   1611  C CA    . VAL A  1 216 ? -33.944 9.880   -6.689  1.00 33.53  ? 278 VAL A CA    1 
ATOM   1612  C C     . VAL A  1 216 ? -33.447 10.804  -7.801  1.00 33.64  ? 278 VAL A C     1 
ATOM   1613  O O     . VAL A  1 216 ? -32.230 11.033  -7.943  1.00 34.07  ? 278 VAL A O     1 
ATOM   1614  C CB    . VAL A  1 216 ? -33.372 10.329  -5.334  1.00 33.66  ? 278 VAL A CB    1 
ATOM   1615  C CG1   . VAL A  1 216 ? -33.584 11.818  -5.101  1.00 34.53  ? 278 VAL A CG1   1 
ATOM   1616  C CG2   . VAL A  1 216 ? -34.048 9.566   -4.227  1.00 34.85  ? 278 VAL A CG2   1 
ATOM   1617  N N     . ASP A  1 217 ? -34.390 11.350  -8.571  1.00 31.50  ? 279 ASP A N     1 
ATOM   1618  C CA    . ASP A  1 217 ? -34.033 12.369  -9.527  1.00 30.81  ? 279 ASP A CA    1 
ATOM   1619  C C     . ASP A  1 217 ? -34.124 13.688  -8.775  1.00 30.17  ? 279 ASP A C     1 
ATOM   1620  O O     . ASP A  1 217 ? -35.205 14.212  -8.540  1.00 29.52  ? 279 ASP A O     1 
ATOM   1621  C CB    . ASP A  1 217 ? -34.939 12.335  -10.752 1.00 29.83  ? 279 ASP A CB    1 
ATOM   1622  C CG    . ASP A  1 217 ? -34.616 13.423  -11.740 1.00 29.00  ? 279 ASP A CG    1 
ATOM   1623  O OD1   . ASP A  1 217 ? -33.509 14.000  -11.672 1.00 29.33  ? 279 ASP A OD1   1 
ATOM   1624  O OD2   . ASP A  1 217 ? -35.481 13.704  -12.587 1.00 29.13  ? 279 ASP A OD2   1 
ATOM   1625  N N     . ILE A  1 218 ? -32.978 14.225  -8.400  1.00 29.81  ? 280 ILE A N     1 
ATOM   1626  C CA    . ILE A  1 218 ? -32.976 15.385  -7.545  1.00 31.55  ? 280 ILE A CA    1 
ATOM   1627  C C     . ILE A  1 218 ? -33.609 16.621  -8.198  1.00 31.87  ? 280 ILE A C     1 
ATOM   1628  O O     . ILE A  1 218 ? -33.978 17.574  -7.502  1.00 29.51  ? 280 ILE A O     1 
ATOM   1629  C CB    . ILE A  1 218 ? -31.554 15.692  -7.072  1.00 33.43  ? 280 ILE A CB    1 
ATOM   1630  C CG1   . ILE A  1 218 ? -31.030 14.476  -6.274  1.00 34.62  ? 280 ILE A CG1   1 
ATOM   1631  C CG2   . ILE A  1 218 ? -31.541 16.974  -6.228  1.00 33.59  ? 280 ILE A CG2   1 
ATOM   1632  C CD1   . ILE A  1 218 ? -29.659 14.651  -5.639  1.00 35.59  ? 280 ILE A CD1   1 
ATOM   1633  N N     . TYR A  1 219 ? -33.723 16.613  -9.527  1.00 33.27  ? 281 TYR A N     1 
ATOM   1634  C CA    . TYR A  1 219 ? -34.379 17.708  -10.253 1.00 33.42  ? 281 TYR A CA    1 
ATOM   1635  C C     . TYR A  1 219 ? -35.883 17.694  -10.047 1.00 32.23  ? 281 TYR A C     1 
ATOM   1636  O O     . TYR A  1 219 ? -36.494 18.749  -9.982  1.00 29.50  ? 281 TYR A O     1 
ATOM   1637  C CB    . TYR A  1 219 ? -34.057 17.658  -11.754 1.00 34.58  ? 281 TYR A CB    1 
ATOM   1638  C CG    . TYR A  1 219 ? -32.580 17.851  -12.065 1.00 36.07  ? 281 TYR A CG    1 
ATOM   1639  C CD1   . TYR A  1 219 ? -31.944 19.067  -11.813 1.00 36.92  ? 281 TYR A CD1   1 
ATOM   1640  C CD2   . TYR A  1 219 ? -31.817 16.819  -12.610 1.00 37.08  ? 281 TYR A CD2   1 
ATOM   1641  C CE1   . TYR A  1 219 ? -30.589 19.242  -12.088 1.00 38.00  ? 281 TYR A CE1   1 
ATOM   1642  C CE2   . TYR A  1 219 ? -30.466 16.992  -12.898 1.00 37.35  ? 281 TYR A CE2   1 
ATOM   1643  C CZ    . TYR A  1 219 ? -29.851 18.198  -12.627 1.00 37.43  ? 281 TYR A CZ    1 
ATOM   1644  O OH    . TYR A  1 219 ? -28.508 18.366  -12.892 1.00 35.70  ? 281 TYR A OH    1 
ATOM   1645  N N     . THR A  1 220 ? -36.459 16.498  -9.894  1.00 33.40  ? 282 THR A N     1 
ATOM   1646  C CA    . THR A  1 220 ? -37.914 16.314  -9.909  1.00 33.16  ? 282 THR A CA    1 
ATOM   1647  C C     . THR A  1 220 ? -38.574 15.663  -8.687  1.00 34.51  ? 282 THR A C     1 
ATOM   1648  O O     . THR A  1 220 ? -39.804 15.599  -8.645  1.00 34.91  ? 282 THR A O     1 
ATOM   1649  C CB    . THR A  1 220 ? -38.337 15.472  -11.120 1.00 31.87  ? 282 THR A CB    1 
ATOM   1650  O OG1   . THR A  1 220 ? -37.904 14.115  -10.944 1.00 30.43  ? 282 THR A OG1   1 
ATOM   1651  C CG2   . THR A  1 220 ? -37.761 16.059  -12.399 1.00 31.22  ? 282 THR A CG2   1 
ATOM   1652  N N     . VAL A  1 221 ? -37.815 15.182  -7.702  1.00 36.18  ? 283 VAL A N     1 
ATOM   1653  C CA    . VAL A  1 221 ? -38.475 14.605  -6.523  1.00 36.88  ? 283 VAL A CA    1 
ATOM   1654  C C     . VAL A  1 221 ? -39.058 15.696  -5.682  1.00 37.33  ? 283 VAL A C     1 
ATOM   1655  O O     . VAL A  1 221 ? -38.529 16.807  -5.644  1.00 34.09  ? 283 VAL A O     1 
ATOM   1656  C CB    . VAL A  1 221 ? -37.578 13.743  -5.610  1.00 36.76  ? 283 VAL A CB    1 
ATOM   1657  C CG1   . VAL A  1 221 ? -37.252 12.432  -6.312  1.00 38.97  ? 283 VAL A CG1   1 
ATOM   1658  C CG2   . VAL A  1 221 ? -36.331 14.502  -5.182  1.00 35.72  ? 283 VAL A CG2   1 
ATOM   1659  N N     . LYS A  1 222 ? -40.146 15.337  -5.002  1.00 40.63  ? 284 LYS A N     1 
ATOM   1660  C CA    . LYS A  1 222 ? -40.868 16.213  -4.087  1.00 41.64  ? 284 LYS A CA    1 
ATOM   1661  C C     . LYS A  1 222 ? -40.789 15.545  -2.713  1.00 37.21  ? 284 LYS A C     1 
ATOM   1662  O O     . LYS A  1 222 ? -40.641 14.331  -2.616  1.00 34.15  ? 284 LYS A O     1 
ATOM   1663  C CB    . LYS A  1 222 ? -42.343 16.365  -4.527  1.00 47.18  ? 284 LYS A CB    1 
ATOM   1664  C CG    . LYS A  1 222 ? -42.705 15.755  -5.889  1.00 49.07  ? 284 LYS A CG    1 
ATOM   1665  C CD    . LYS A  1 222 ? -43.954 16.384  -6.499  1.00 49.46  ? 284 LYS A CD    1 
ATOM   1666  C CE    . LYS A  1 222 ? -43.590 17.680  -7.195  1.00 49.74  ? 284 LYS A CE    1 
ATOM   1667  N NZ    . LYS A  1 222 ? -44.787 18.522  -7.399  1.00 51.75  ? 284 LYS A NZ    1 
ATOM   1668  N N     . THR A  1 223 ? -40.943 16.318  -1.654  1.00 36.16  ? 285 THR A N     1 
ATOM   1669  C CA    . THR A  1 223 ? -40.782 15.756  -0.326  1.00 37.04  ? 285 THR A CA    1 
ATOM   1670  C C     . THR A  1 223 ? -41.790 14.627  -0.068  1.00 36.66  ? 285 THR A C     1 
ATOM   1671  O O     . THR A  1 223 ? -41.418 13.617  0.511   1.00 35.50  ? 285 THR A O     1 
ATOM   1672  C CB    . THR A  1 223 ? -40.930 16.786  0.808   1.00 38.52  ? 285 THR A CB    1 
ATOM   1673  O OG1   . THR A  1 223 ? -42.313 17.104  0.942   1.00 42.17  ? 285 THR A OG1   1 
ATOM   1674  C CG2   . THR A  1 223 ? -40.093 18.069  0.570   1.00 39.64  ? 285 THR A CG2   1 
ATOM   1675  N N     . GLU A  1 224 ? -43.044 14.743  -0.505  1.00 37.56  ? 286 GLU A N     1 
ATOM   1676  C CA    . GLU A  1 224 ? -43.987 13.644  -0.214  1.00 40.87  ? 286 GLU A CA    1 
ATOM   1677  C C     . GLU A  1 224 ? -43.575 12.278  -0.830  1.00 39.05  ? 286 GLU A C     1 
ATOM   1678  O O     . GLU A  1 224 ? -44.021 11.225  -0.387  1.00 37.57  ? 286 GLU A O     1 
ATOM   1679  C CB    . GLU A  1 224 ? -45.449 14.007  -0.541  1.00 44.01  ? 286 GLU A CB    1 
ATOM   1680  C CG    . GLU A  1 224 ? -45.902 13.828  -1.992  1.00 47.02  ? 286 GLU A CG    1 
ATOM   1681  C CD    . GLU A  1 224 ? -45.983 15.136  -2.749  1.00 50.42  ? 286 GLU A CD    1 
ATOM   1682  O OE1   . GLU A  1 224 ? -45.339 16.125  -2.300  1.00 54.90  ? 286 GLU A OE1   1 
ATOM   1683  O OE2   . GLU A  1 224 ? -46.684 15.166  -3.790  1.00 48.87  ? 286 GLU A OE2   1 
ATOM   1684  N N     . GLU A  1 225 ? -42.710 12.303  -1.830  1.00 39.59  ? 287 GLU A N     1 
ATOM   1685  C CA    . GLU A  1 225 ? -42.158 11.078  -2.380  1.00 40.15  ? 287 GLU A CA    1 
ATOM   1686  C C     . GLU A  1 225 ? -41.102 10.419  -1.465  1.00 37.61  ? 287 GLU A C     1 
ATOM   1687  O O     . GLU A  1 225 ? -40.749 9.259   -1.661  1.00 36.11  ? 287 GLU A O     1 
ATOM   1688  C CB    . GLU A  1 225 ? -41.549 11.356  -3.757  1.00 41.79  ? 287 GLU A CB    1 
ATOM   1689  C CG    . GLU A  1 225 ? -42.551 11.794  -4.827  1.00 42.33  ? 287 GLU A CG    1 
ATOM   1690  C CD    . GLU A  1 225 ? -41.882 12.192  -6.138  1.00 44.22  ? 287 GLU A CD    1 
ATOM   1691  O OE1   . GLU A  1 225 ? -40.634 12.132  -6.215  1.00 44.69  ? 287 GLU A OE1   1 
ATOM   1692  O OE2   . GLU A  1 225 ? -42.594 12.578  -7.092  1.00 43.22  ? 287 GLU A OE2   1 
ATOM   1693  N N     . LEU A  1 226 ? -40.616 11.133  -0.461  1.00 35.69  ? 288 LEU A N     1 
ATOM   1694  C CA    . LEU A  1 226 ? -39.605 10.574  0.448   1.00 36.61  ? 288 LEU A CA    1 
ATOM   1695  C C     . LEU A  1 226 ? -40.174 9.799   1.644   1.00 36.84  ? 288 LEU A C     1 
ATOM   1696  O O     . LEU A  1 226 ? -39.421 9.150   2.379   1.00 36.43  ? 288 LEU A O     1 
ATOM   1697  C CB    . LEU A  1 226 ? -38.697 11.686  0.956   1.00 36.66  ? 288 LEU A CB    1 
ATOM   1698  C CG    . LEU A  1 226 ? -38.026 12.487  -0.160  1.00 36.67  ? 288 LEU A CG    1 
ATOM   1699  C CD1   . LEU A  1 226 ? -37.201 13.617  0.420   1.00 36.70  ? 288 LEU A CD1   1 
ATOM   1700  C CD2   . LEU A  1 226 ? -37.168 11.594  -1.032  1.00 37.01  ? 288 LEU A CD2   1 
ATOM   1701  N N     . SER A  1 227 ? -41.484 9.899   1.857   1.00 36.50  ? 289 SER A N     1 
ATOM   1702  C CA    . SER A  1 227 ? -42.204 8.959   2.691   1.00 36.41  ? 289 SER A CA    1 
ATOM   1703  C C     . SER A  1 227 ? -42.742 7.959   1.712   1.00 36.44  ? 289 SER A C     1 
ATOM   1704  O O     . SER A  1 227 ? -43.587 8.315   0.901   1.00 39.13  ? 289 SER A O     1 
ATOM   1705  C CB    . SER A  1 227 ? -43.367 9.640   3.413   1.00 37.83  ? 289 SER A CB    1 
ATOM   1706  O OG    . SER A  1 227 ? -42.915 10.580  4.387   1.00 37.77  ? 289 SER A OG    1 
ATOM   1707  N N     . PHE A  1 228 ? -42.261 6.722   1.745   1.00 36.32  ? 290 PHE A N     1 
ATOM   1708  C CA    . PHE A  1 228 ? -42.617 5.774   0.686   1.00 36.33  ? 290 PHE A CA    1 
ATOM   1709  C C     . PHE A  1 228 ? -42.673 4.341   1.176   1.00 35.68  ? 290 PHE A C     1 
ATOM   1710  O O     . PHE A  1 228 ? -42.197 4.037   2.268   1.00 36.44  ? 290 PHE A O     1 
ATOM   1711  C CB    . PHE A  1 228 ? -41.623 5.879   -0.466  1.00 36.78  ? 290 PHE A CB    1 
ATOM   1712  C CG    . PHE A  1 228 ? -40.232 5.459   -0.097  1.00 38.95  ? 290 PHE A CG    1 
ATOM   1713  C CD1   . PHE A  1 228 ? -39.831 4.120   -0.218  1.00 39.91  ? 290 PHE A CD1   1 
ATOM   1714  C CD2   . PHE A  1 228 ? -39.323 6.380   0.391   1.00 38.90  ? 290 PHE A CD2   1 
ATOM   1715  C CE1   . PHE A  1 228 ? -38.550 3.721   0.141   1.00 37.36  ? 290 PHE A CE1   1 
ATOM   1716  C CE2   . PHE A  1 228 ? -38.039 5.983   0.746   1.00 38.51  ? 290 PHE A CE2   1 
ATOM   1717  C CZ    . PHE A  1 228 ? -37.653 4.653   0.623   1.00 37.06  ? 290 PHE A CZ    1 
ATOM   1718  N N     . THR A  1 229 ? -43.297 3.480   0.370   1.00 34.85  ? 291 THR A N     1 
ATOM   1719  C CA    . THR A  1 229 ? -43.238 2.026   0.551   1.00 33.08  ? 291 THR A CA    1 
ATOM   1720  C C     . THR A  1 229 ? -42.728 1.467   -0.769  1.00 31.47  ? 291 THR A C     1 
ATOM   1721  O O     . THR A  1 229 ? -42.975 2.027   -1.819  1.00 30.67  ? 291 THR A O     1 
ATOM   1722  C CB    . THR A  1 229 ? -44.597 1.412   1.004   1.00 31.57  ? 291 THR A CB    1 
ATOM   1723  O OG1   . THR A  1 229 ? -44.959 1.943   2.285   1.00 30.55  ? 291 THR A OG1   1 
ATOM   1724  C CG2   . THR A  1 229 ? -44.508 -0.084  1.158   1.00 31.14  ? 291 THR A CG2   1 
ATOM   1725  N N     . SER A  1 230 ? -41.979 0.377   -0.689  1.00 31.68  ? 292 SER A N     1 
ATOM   1726  C CA    . SER A  1 230 ? -41.106 -0.039  -1.776  1.00 30.57  ? 292 SER A CA    1 
ATOM   1727  C C     . SER A  1 230 ? -40.811 -1.520  -1.692  1.00 27.57  ? 292 SER A C     1 
ATOM   1728  O O     . SER A  1 230 ? -40.235 -1.951  -0.731  1.00 27.20  ? 292 SER A O     1 
ATOM   1729  C CB    . SER A  1 230 ? -39.799 0.752   -1.675  1.00 30.36  ? 292 SER A CB    1 
ATOM   1730  O OG    . SER A  1 230 ? -38.935 0.424   -2.732  1.00 31.26  ? 292 SER A OG    1 
ATOM   1731  N N     . ALA A  1 231 ? -41.209 -2.292  -2.695  1.00 26.76  ? 293 ALA A N     1 
ATOM   1732  C CA    . ALA A  1 231 ? -41.060 -3.749  -2.650  1.00 26.78  ? 293 ALA A CA    1 
ATOM   1733  C C     . ALA A  1 231 ? -39.621 -4.088  -2.889  1.00 27.60  ? 293 ALA A C     1 
ATOM   1734  O O     . ALA A  1 231 ? -38.872 -3.270  -3.438  1.00 27.54  ? 293 ALA A O     1 
ATOM   1735  C CB    . ALA A  1 231 ? -41.924 -4.430  -3.699  1.00 26.38  ? 293 ALA A CB    1 
ATOM   1736  N N     . PHE A  1 232 ? -39.234 -5.289  -2.476  1.00 27.64  ? 294 PHE A N     1 
ATOM   1737  C CA    . PHE A  1 232 ? -37.896 -5.765  -2.750  1.00 28.58  ? 294 PHE A CA    1 
ATOM   1738  C C     . PHE A  1 232 ? -37.841 -7.285  -2.899  1.00 29.90  ? 294 PHE A C     1 
ATOM   1739  O O     . PHE A  1 232 ? -38.633 -8.034  -2.304  1.00 29.28  ? 294 PHE A O     1 
ATOM   1740  C CB    . PHE A  1 232 ? -36.913 -5.272  -1.680  1.00 28.48  ? 294 PHE A CB    1 
ATOM   1741  C CG    . PHE A  1 232 ? -37.072 -5.940  -0.326  1.00 28.50  ? 294 PHE A CG    1 
ATOM   1742  C CD1   . PHE A  1 232 ? -37.886 -5.399  0.651   1.00 29.06  ? 294 PHE A CD1   1 
ATOM   1743  C CD2   . PHE A  1 232 ? -36.373 -7.092  -0.019  1.00 28.82  ? 294 PHE A CD2   1 
ATOM   1744  C CE1   . PHE A  1 232 ? -38.010 -5.995  1.906   1.00 28.77  ? 294 PHE A CE1   1 
ATOM   1745  C CE2   . PHE A  1 232 ? -36.502 -7.703  1.224   1.00 28.65  ? 294 PHE A CE2   1 
ATOM   1746  C CZ    . PHE A  1 232 ? -37.322 -7.153  2.192   1.00 28.11  ? 294 PHE A CZ    1 
ATOM   1747  N N     . CYS A  1 233 ? -36.900 -7.732  -3.719  1.00 30.70  ? 295 CYS A N     1 
ATOM   1748  C CA    . CYS A  1 233 ? -36.599 -9.131  -3.802  1.00 31.92  ? 295 CYS A CA    1 
ATOM   1749  C C     . CYS A  1 233 ? -35.112 -9.281  -3.744  1.00 31.39  ? 295 CYS A C     1 
ATOM   1750  O O     . CYS A  1 233 ? -34.394 -8.503  -4.364  1.00 32.13  ? 295 CYS A O     1 
ATOM   1751  C CB    . CYS A  1 233 ? -37.120 -9.732  -5.092  1.00 33.39  ? 295 CYS A CB    1 
ATOM   1752  S SG    . CYS A  1 233 ? -37.041 -11.537 -5.028  1.00 37.01  ? 295 CYS A SG    1 
ATOM   1753  N N     . LEU A  1 234 ? -34.655 -10.292 -3.013  1.00 30.84  ? 296 LEU A N     1 
ATOM   1754  C CA    . LEU A  1 234 ? -33.243 -10.620 -2.949  1.00 30.01  ? 296 LEU A CA    1 
ATOM   1755  C C     . LEU A  1 234 ? -33.009 -12.080 -3.279  1.00 28.71  ? 296 LEU A C     1 
ATOM   1756  O O     . LEU A  1 234 ? -33.612 -12.978 -2.703  1.00 26.50  ? 296 LEU A O     1 
ATOM   1757  C CB    . LEU A  1 234 ? -32.715 -10.301 -1.577  1.00 31.52  ? 296 LEU A CB    1 
ATOM   1758  C CG    . LEU A  1 234 ? -32.771 -8.812  -1.219  1.00 33.38  ? 296 LEU A CG    1 
ATOM   1759  C CD1   . LEU A  1 234 ? -32.403 -8.657  0.240   1.00 35.07  ? 296 LEU A CD1   1 
ATOM   1760  C CD2   . LEU A  1 234 ? -31.827 -7.971  -2.063  1.00 33.55  ? 296 LEU A CD2   1 
ATOM   1761  N N     . GLN A  1 235 ? -32.144 -12.302 -4.251  1.00 29.31  ? 297 GLN A N     1 
ATOM   1762  C CA    . GLN A  1 235 ? -31.823 -13.631 -4.692  1.00 30.68  ? 297 GLN A CA    1 
ATOM   1763  C C     . GLN A  1 235 ? -30.638 -14.149 -3.900  1.00 29.80  ? 297 GLN A C     1 
ATOM   1764  O O     . GLN A  1 235 ? -29.578 -13.527 -3.887  1.00 27.81  ? 297 GLN A O     1 
ATOM   1765  C CB    . GLN A  1 235 ? -31.485 -13.603 -6.172  1.00 32.17  ? 297 GLN A CB    1 
ATOM   1766  C CG    . GLN A  1 235 ? -31.131 -14.957 -6.744  1.00 33.62  ? 297 GLN A CG    1 
ATOM   1767  C CD    . GLN A  1 235 ? -31.408 -14.973 -8.211  1.00 35.18  ? 297 GLN A CD    1 
ATOM   1768  O OE1   . GLN A  1 235 ? -32.577 -14.989 -8.611  1.00 38.29  ? 297 GLN A OE1   1 
ATOM   1769  N NE2   . GLN A  1 235 ? -30.358 -14.931 -9.031  1.00 34.60  ? 297 GLN A NE2   1 
ATOM   1770  N N     . ILE A  1 236 ? -30.821 -15.303 -3.263  1.00 29.54  ? 298 ILE A N     1 
ATOM   1771  C CA    . ILE A  1 236 ? -29.742 -15.952 -2.527  1.00 29.90  ? 298 ILE A CA    1 
ATOM   1772  C C     . ILE A  1 236 ? -28.695 -16.562 -3.471  1.00 28.84  ? 298 ILE A C     1 
ATOM   1773  O O     . ILE A  1 236 ? -28.965 -17.488 -4.203  1.00 26.42  ? 298 ILE A O     1 
ATOM   1774  C CB    . ILE A  1 236 ? -30.290 -17.025 -1.558  1.00 30.54  ? 298 ILE A CB    1 
ATOM   1775  C CG1   . ILE A  1 236 ? -30.773 -16.368 -0.258  1.00 30.26  ? 298 ILE A CG1   1 
ATOM   1776  C CG2   . ILE A  1 236 ? -29.206 -18.022 -1.190  1.00 31.22  ? 298 ILE A CG2   1 
ATOM   1777  C CD1   . ILE A  1 236 ? -32.227 -16.014 -0.243  1.00 30.64  ? 298 ILE A CD1   1 
ATOM   1778  N N     . GLN A  1 237 ? -27.491 -16.028 -3.434  1.00 30.13  ? 299 GLN A N     1 
ATOM   1779  C CA    . GLN A  1 237 ? -26.433 -16.476 -4.322  1.00 31.99  ? 299 GLN A CA    1 
ATOM   1780  C C     . GLN A  1 237 ? -25.769 -17.776 -3.858  1.00 33.30  ? 299 GLN A C     1 
ATOM   1781  O O     . GLN A  1 237 ? -25.155 -18.474 -4.669  1.00 34.36  ? 299 GLN A O     1 
ATOM   1782  C CB    . GLN A  1 237 ? -25.375 -15.377 -4.458  1.00 32.54  ? 299 GLN A CB    1 
ATOM   1783  C CG    . GLN A  1 237 ? -25.927 -14.122 -5.090  1.00 34.12  ? 299 GLN A CG    1 
ATOM   1784  C CD    . GLN A  1 237 ? -26.677 -14.435 -6.371  1.00 34.94  ? 299 GLN A CD    1 
ATOM   1785  O OE1   . GLN A  1 237 ? -26.113 -15.014 -7.284  1.00 35.57  ? 299 GLN A OE1   1 
ATOM   1786  N NE2   . GLN A  1 237 ? -27.946 -14.067 -6.437  1.00 35.57  ? 299 GLN A NE2   1 
ATOM   1787  N N     . ARG A  1 238 ? -25.874 -18.096 -2.570  1.00 31.99  ? 300 ARG A N     1 
ATOM   1788  C CA    . ARG A  1 238 ? -25.133 -19.224 -2.005  1.00 31.71  ? 300 ARG A CA    1 
ATOM   1789  C C     . ARG A  1 238 ? -25.816 -19.773 -0.741  1.00 34.42  ? 300 ARG A C     1 
ATOM   1790  O O     . ARG A  1 238 ? -26.467 -19.013 0.000   1.00 35.04  ? 300 ARG A O     1 
ATOM   1791  C CB    . ARG A  1 238 ? -23.708 -18.775 -1.668  1.00 29.37  ? 300 ARG A CB    1 
ATOM   1792  C CG    . ARG A  1 238 ? -23.586 -18.077 -0.330  1.00 27.77  ? 300 ARG A CG    1 
ATOM   1793  C CD    . ARG A  1 238 ? -22.324 -17.251 -0.204  1.00 27.81  ? 300 ARG A CD    1 
ATOM   1794  N NE    . ARG A  1 238 ? -22.329 -16.536 1.074   1.00 27.62  ? 300 ARG A NE    1 
ATOM   1795  C CZ    . ARG A  1 238 ? -21.496 -15.552 1.408   1.00 27.22  ? 300 ARG A CZ    1 
ATOM   1796  N NH1   . ARG A  1 238 ? -20.555 -15.139 0.568   1.00 28.43  ? 300 ARG A NH1   1 
ATOM   1797  N NH2   . ARG A  1 238 ? -21.611 -14.954 2.579   1.00 26.60  ? 300 ARG A NH2   1 
ATOM   1798  N N     . ASN A  1 239 ? -25.659 -21.077 -0.482  1.00 34.59  ? 301 ASN A N     1 
ATOM   1799  C CA    . ASN A  1 239 ? -26.180 -21.665 0.762   1.00 34.51  ? 301 ASN A CA    1 
ATOM   1800  C C     . ASN A  1 239 ? -25.555 -20.929 1.939   1.00 33.12  ? 301 ASN A C     1 
ATOM   1801  O O     . ASN A  1 239 ? -24.330 -20.826 1.981   1.00 36.63  ? 301 ASN A O     1 
ATOM   1802  C CB    . ASN A  1 239 ? -25.812 -23.145 0.870   1.00 36.41  ? 301 ASN A CB    1 
ATOM   1803  C CG    . ASN A  1 239 ? -26.488 -23.992 -0.179  1.00 37.78  ? 301 ASN A CG    1 
ATOM   1804  O OD1   . ASN A  1 239 ? -25.908 -24.276 -1.221  1.00 44.17  ? 301 ASN A OD1   1 
ATOM   1805  N ND2   . ASN A  1 239 ? -27.721 -24.356 0.063   1.00 36.41  ? 301 ASN A ND2   1 
ATOM   1806  N N     . ASP A  1 240 ? -26.355 -20.412 2.878   1.00 28.91  ? 302 ASP A N     1 
ATOM   1807  C CA    . ASP A  1 240 ? -25.797 -19.659 4.008   1.00 26.07  ? 302 ASP A CA    1 
ATOM   1808  C C     . ASP A  1 240 ? -26.869 -19.434 5.025   1.00 24.19  ? 302 ASP A C     1 
ATOM   1809  O O     . ASP A  1 240 ? -27.931 -20.021 4.910   1.00 23.96  ? 302 ASP A O     1 
ATOM   1810  C CB    . ASP A  1 240 ? -25.233 -18.309 3.537   1.00 27.24  ? 302 ASP A CB    1 
ATOM   1811  C CG    . ASP A  1 240 ? -23.987 -17.863 4.330   1.00 28.15  ? 302 ASP A CG    1 
ATOM   1812  O OD1   . ASP A  1 240 ? -23.964 -18.065 5.566   1.00 28.30  ? 302 ASP A OD1   1 
ATOM   1813  O OD2   . ASP A  1 240 ? -23.036 -17.304 3.716   1.00 28.15  ? 302 ASP A OD2   1 
ATOM   1814  N N     . TYR A  1 241 ? -26.566 -18.621 6.040   1.00 22.97  ? 303 TYR A N     1 
ATOM   1815  C CA    . TYR A  1 241 ? -27.554 -18.095 7.011   1.00 21.84  ? 303 TYR A CA    1 
ATOM   1816  C C     . TYR A  1 241 ? -27.686 -16.570 6.820   1.00 21.42  ? 303 TYR A C     1 
ATOM   1817  O O     . TYR A  1 241 ? -26.680 -15.879 6.582   1.00 21.10  ? 303 TYR A O     1 
ATOM   1818  C CB    . TYR A  1 241 ? -27.128 -18.370 8.471   1.00 21.06  ? 303 TYR A CB    1 
ATOM   1819  C CG    . TYR A  1 241 ? -27.104 -19.832 8.884   1.00 21.15  ? 303 TYR A CG    1 
ATOM   1820  C CD1   . TYR A  1 241 ? -28.272 -20.510 9.279   1.00 20.99  ? 303 TYR A CD1   1 
ATOM   1821  C CD2   . TYR A  1 241 ? -25.906 -20.552 8.887   1.00 21.47  ? 303 TYR A CD2   1 
ATOM   1822  C CE1   . TYR A  1 241 ? -28.241 -21.865 9.623   1.00 20.25  ? 303 TYR A CE1   1 
ATOM   1823  C CE2   . TYR A  1 241 ? -25.867 -21.903 9.245   1.00 20.63  ? 303 TYR A CE2   1 
ATOM   1824  C CZ    . TYR A  1 241 ? -27.041 -22.545 9.614   1.00 20.21  ? 303 TYR A CZ    1 
ATOM   1825  O OH    . TYR A  1 241 ? -27.024 -23.858 9.972   1.00 20.08  ? 303 TYR A OH    1 
ATOM   1826  N N     . VAL A  1 242 ? -28.906 -16.041 6.935   1.00 20.33  ? 304 VAL A N     1 
ATOM   1827  C CA    . VAL A  1 242 ? -29.112 -14.601 6.839   1.00 19.38  ? 304 VAL A CA    1 
ATOM   1828  C C     . VAL A  1 242 ? -29.603 -14.050 8.175   1.00 19.41  ? 304 VAL A C     1 
ATOM   1829  O O     . VAL A  1 242 ? -30.628 -14.461 8.691   1.00 18.86  ? 304 VAL A O     1 
ATOM   1830  C CB    . VAL A  1 242 ? -30.086 -14.243 5.715   1.00 19.54  ? 304 VAL A CB    1 
ATOM   1831  C CG1   . VAL A  1 242 ? -30.598 -12.817 5.866   1.00 19.84  ? 304 VAL A CG1   1 
ATOM   1832  C CG2   . VAL A  1 242 ? -29.422 -14.410 4.359   1.00 19.74  ? 304 VAL A CG2   1 
ATOM   1833  N N     . HIS A  1 243 ? -28.842 -13.111 8.721   1.00 19.95  ? 305 HIS A N     1 
ATOM   1834  C CA    . HIS A  1 243 ? -29.082 -12.534 10.036  1.00 20.12  ? 305 HIS A CA    1 
ATOM   1835  C C     . HIS A  1 243 ? -29.613 -11.104 9.941   1.00 20.10  ? 305 HIS A C     1 
ATOM   1836  O O     . HIS A  1 243 ? -30.186 -10.603 10.893  1.00 19.55  ? 305 HIS A O     1 
ATOM   1837  C CB    . HIS A  1 243 ? -27.758 -12.540 10.845  1.00 20.70  ? 305 HIS A CB    1 
ATOM   1838  C CG    . HIS A  1 243 ? -27.306 -13.910 11.285  1.00 20.93  ? 305 HIS A CG    1 
ATOM   1839  N ND1   . HIS A  1 243 ? -26.514 -14.723 10.502  1.00 21.02  ? 305 HIS A ND1   1 
ATOM   1840  C CD2   . HIS A  1 243 ? -27.547 -14.611 12.424  1.00 20.96  ? 305 HIS A CD2   1 
ATOM   1841  C CE1   . HIS A  1 243 ? -26.294 -15.864 11.133  1.00 21.33  ? 305 HIS A CE1   1 
ATOM   1842  N NE2   . HIS A  1 243 ? -26.917 -15.826 12.300  1.00 20.79  ? 305 HIS A NE2   1 
ATOM   1843  N N     . ALA A  1 244 ? -29.404 -10.450 8.800   1.00 21.21  ? 306 ALA A N     1 
ATOM   1844  C CA    . ALA A  1 244 ? -29.768 -9.042  8.626   1.00 22.61  ? 306 ALA A CA    1 
ATOM   1845  C C     . ALA A  1 244 ? -29.825 -8.548  7.168   1.00 23.85  ? 306 ALA A C     1 
ATOM   1846  O O     . ALA A  1 244 ? -29.221 -9.128  6.257   1.00 23.75  ? 306 ALA A O     1 
ATOM   1847  C CB    . ALA A  1 244 ? -28.778 -8.181  9.364   1.00 22.50  ? 306 ALA A CB    1 
ATOM   1848  N N     . LEU A  1 245 ? -30.541 -7.444  6.982   1.00 24.36  ? 307 LEU A N     1 
ATOM   1849  C CA    . LEU A  1 245 ? -30.530 -6.708  5.729   1.00 25.16  ? 307 LEU A CA    1 
ATOM   1850  C C     . LEU A  1 245 ? -29.598 -5.506  5.855   1.00 24.23  ? 307 LEU A C     1 
ATOM   1851  O O     . LEU A  1 245 ? -29.425 -4.972  6.932   1.00 24.29  ? 307 LEU A O     1 
ATOM   1852  C CB    . LEU A  1 245 ? -31.939 -6.216  5.382   1.00 26.70  ? 307 LEU A CB    1 
ATOM   1853  C CG    . LEU A  1 245 ? -33.056 -7.259  5.326   1.00 26.94  ? 307 LEU A CG    1 
ATOM   1854  C CD1   . LEU A  1 245 ? -34.348 -6.583  4.885   1.00 26.44  ? 307 LEU A CD1   1 
ATOM   1855  C CD2   . LEU A  1 245 ? -32.693 -8.421  4.410   1.00 27.08  ? 307 LEU A CD2   1 
ATOM   1856  N N     . VAL A  1 246 ? -29.013 -5.089  4.740   1.00 23.76  ? 308 VAL A N     1 
ATOM   1857  C CA    . VAL A  1 246 ? -28.043 -4.005  4.715   1.00 23.75  ? 308 VAL A CA    1 
ATOM   1858  C C     . VAL A  1 246 ? -28.314 -3.088  3.540   1.00 23.49  ? 308 VAL A C     1 
ATOM   1859  O O     . VAL A  1 246 ? -28.505 -3.532  2.413   1.00 23.57  ? 308 VAL A O     1 
ATOM   1860  C CB    . VAL A  1 246 ? -26.600 -4.521  4.562   1.00 23.89  ? 308 VAL A CB    1 
ATOM   1861  C CG1   . VAL A  1 246 ? -25.627 -3.361  4.431   1.00 23.74  ? 308 VAL A CG1   1 
ATOM   1862  C CG2   . VAL A  1 246 ? -26.217 -5.386  5.747   1.00 24.07  ? 308 VAL A CG2   1 
ATOM   1863  N N     . THR A  1 247 ? -28.311 -1.799  3.816   1.00 23.31  ? 309 THR A N     1 
ATOM   1864  C CA    . THR A  1 247 ? -28.575 -0.824  2.801   1.00 23.63  ? 309 THR A CA    1 
ATOM   1865  C C     . THR A  1 247 ? -27.349 0.045   2.581   1.00 22.84  ? 309 THR A C     1 
ATOM   1866  O O     . THR A  1 247 ? -26.686 0.486   3.528   1.00 22.54  ? 309 THR A O     1 
ATOM   1867  C CB    . THR A  1 247 ? -29.759 0.108   3.174   1.00 24.44  ? 309 THR A CB    1 
ATOM   1868  O OG1   . THR A  1 247 ? -29.455 0.839   4.373   1.00 25.99  ? 309 THR A OG1   1 
ATOM   1869  C CG2   . THR A  1 247 ? -31.031 -0.655  3.386   1.00 24.22  ? 309 THR A CG2   1 
ATOM   1870  N N     . TYR A  1 248 ? -27.109 0.325   1.307   1.00 21.81  ? 310 TYR A N     1 
ATOM   1871  C CA    . TYR A  1 248 ? -26.094 1.258   0.870   1.00 20.81  ? 310 TYR A CA    1 
ATOM   1872  C C     . TYR A  1 248 ? -26.677 2.131   -0.217  1.00 19.82  ? 310 TYR A C     1 
ATOM   1873  O O     . TYR A  1 248 ? -27.721 1.815   -0.769  1.00 19.88  ? 310 TYR A O     1 
ATOM   1874  C CB    . TYR A  1 248 ? -24.877 0.476   0.355   1.00 21.26  ? 310 TYR A CB    1 
ATOM   1875  C CG    . TYR A  1 248 ? -25.095 -0.379  -0.900  1.00 20.53  ? 310 TYR A CG    1 
ATOM   1876  C CD1   . TYR A  1 248 ? -24.971 0.191   -2.168  1.00 20.01  ? 310 TYR A CD1   1 
ATOM   1877  C CD2   . TYR A  1 248 ? -25.387 -1.746  -0.809  1.00 19.43  ? 310 TYR A CD2   1 
ATOM   1878  C CE1   . TYR A  1 248 ? -25.143 -0.557  -3.303  1.00 19.92  ? 310 TYR A CE1   1 
ATOM   1879  C CE2   . TYR A  1 248 ? -25.572 -2.509  -1.942  1.00 19.47  ? 310 TYR A CE2   1 
ATOM   1880  C CZ    . TYR A  1 248 ? -25.442 -1.911  -3.191  1.00 20.26  ? 310 TYR A CZ    1 
ATOM   1881  O OH    . TYR A  1 248 ? -25.621 -2.637  -4.364  1.00 21.01  ? 310 TYR A OH    1 
ATOM   1882  N N     . PHE A  1 249 ? -26.024 3.232   -0.534  1.00 19.97  ? 311 PHE A N     1 
ATOM   1883  C CA    . PHE A  1 249 ? -26.521 4.076   -1.621  1.00 20.97  ? 311 PHE A CA    1 
ATOM   1884  C C     . PHE A  1 249 ? -25.420 4.502   -2.565  1.00 22.00  ? 311 PHE A C     1 
ATOM   1885  O O     . PHE A  1 249 ? -24.239 4.503   -2.180  1.00 22.32  ? 311 PHE A O     1 
ATOM   1886  C CB    . PHE A  1 249 ? -27.256 5.296   -1.077  1.00 20.82  ? 311 PHE A CB    1 
ATOM   1887  C CG    . PHE A  1 249 ? -26.404 6.222   -0.271  1.00 21.14  ? 311 PHE A CG    1 
ATOM   1888  C CD1   . PHE A  1 249 ? -25.666 7.225   -0.874  1.00 21.15  ? 311 PHE A CD1   1 
ATOM   1889  C CD2   . PHE A  1 249 ? -26.375 6.122   1.106   1.00 22.05  ? 311 PHE A CD2   1 
ATOM   1890  C CE1   . PHE A  1 249 ? -24.902 8.102   -0.117  1.00 21.28  ? 311 PHE A CE1   1 
ATOM   1891  C CE2   . PHE A  1 249 ? -25.617 6.996   1.868   1.00 22.32  ? 311 PHE A CE2   1 
ATOM   1892  C CZ    . PHE A  1 249 ? -24.881 7.990   1.256   1.00 21.73  ? 311 PHE A CZ    1 
ATOM   1893  N N     . ASN A  1 250 ? -25.790 4.832   -3.803  1.00 22.70  ? 312 ASN A N     1 
ATOM   1894  C CA    . ASN A  1 250 ? -24.818 5.387   -4.745  1.00 24.80  ? 312 ASN A CA    1 
ATOM   1895  C C     . ASN A  1 250 ? -25.210 6.787   -5.080  1.00 25.54  ? 312 ASN A C     1 
ATOM   1896  O O     . ASN A  1 250 ? -26.382 7.120   -5.002  1.00 26.10  ? 312 ASN A O     1 
ATOM   1897  C CB    . ASN A  1 250 ? -24.730 4.582   -6.036  1.00 26.04  ? 312 ASN A CB    1 
ATOM   1898  C CG    . ASN A  1 250 ? -24.533 3.091   -5.800  1.00 27.42  ? 312 ASN A CG    1 
ATOM   1899  O OD1   . ASN A  1 250 ? -25.162 2.269   -6.479  1.00 30.06  ? 312 ASN A OD1   1 
ATOM   1900  N ND2   . ASN A  1 250 ? -23.693 2.728   -4.826  1.00 27.21  ? 312 ASN A ND2   1 
ATOM   1901  N N     . ILE A  1 251 ? -24.222 7.595   -5.447  1.00 27.00  ? 313 ILE A N     1 
ATOM   1902  C CA    . ILE A  1 251 ? -24.424 9.010   -5.761  1.00 29.47  ? 313 ILE A CA    1 
ATOM   1903  C C     . ILE A  1 251 ? -23.793 9.292   -7.096  1.00 29.58  ? 313 ILE A C     1 
ATOM   1904  O O     . ILE A  1 251 ? -22.740 8.750   -7.394  1.00 28.87  ? 313 ILE A O     1 
ATOM   1905  C CB    . ILE A  1 251 ? -23.749 9.930   -4.723  1.00 31.06  ? 313 ILE A CB    1 
ATOM   1906  C CG1   . ILE A  1 251 ? -24.412 9.740   -3.357  1.00 32.75  ? 313 ILE A CG1   1 
ATOM   1907  C CG2   . ILE A  1 251 ? -23.782 11.396  -5.152  1.00 29.91  ? 313 ILE A CG2   1 
ATOM   1908  C CD1   . ILE A  1 251 ? -25.837 10.248  -3.263  1.00 34.52  ? 313 ILE A CD1   1 
ATOM   1909  N N     . GLU A  1 252 ? -24.447 10.127  -7.897  1.00 30.58  ? 314 GLU A N     1 
ATOM   1910  C CA    . GLU A  1 252 ? -23.956 10.435  -9.227  1.00 31.66  ? 314 GLU A CA    1 
ATOM   1911  C C     . GLU A  1 252 ? -24.130 11.891  -9.595  1.00 32.03  ? 314 GLU A C     1 
ATOM   1912  O O     . GLU A  1 252 ? -25.147 12.509  -9.266  1.00 31.10  ? 314 GLU A O     1 
ATOM   1913  C CB    . GLU A  1 252 ? -24.665 9.579   -10.266 1.00 32.03  ? 314 GLU A CB    1 
ATOM   1914  C CG    . GLU A  1 252 ? -24.006 9.646   -11.622 1.00 32.85  ? 314 GLU A CG    1 
ATOM   1915  C CD    . GLU A  1 252 ? -24.524 8.596   -12.544 1.00 34.68  ? 314 GLU A CD    1 
ATOM   1916  O OE1   . GLU A  1 252 ? -25.362 7.769   -12.083 1.00 34.43  ? 314 GLU A OE1   1 
ATOM   1917  O OE2   . GLU A  1 252 ? -24.076 8.611   -13.719 1.00 36.34  ? 314 GLU A OE2   1 
ATOM   1918  N N     . PHE A  1 253 ? -23.123 12.418  -10.289 1.00 32.77  ? 315 PHE A N     1 
ATOM   1919  C CA    . PHE A  1 253 ? -23.163 13.756  -10.853 1.00 34.16  ? 315 PHE A CA    1 
ATOM   1920  C C     . PHE A  1 253 ? -23.283 13.494  -12.341 1.00 34.76  ? 315 PHE A C     1 
ATOM   1921  O O     . PHE A  1 253 ? -22.304 13.102  -12.974 1.00 34.20  ? 315 PHE A O     1 
ATOM   1922  C CB    . PHE A  1 253 ? -21.879 14.526  -10.517 1.00 34.43  ? 315 PHE A CB    1 
ATOM   1923  C CG    . PHE A  1 253 ? -21.596 14.640  -9.036  1.00 34.32  ? 315 PHE A CG    1 
ATOM   1924  C CD1   . PHE A  1 253 ? -21.123 13.545  -8.310  1.00 33.72  ? 315 PHE A CD1   1 
ATOM   1925  C CD2   . PHE A  1 253 ? -21.790 15.843  -8.366  1.00 34.27  ? 315 PHE A CD2   1 
ATOM   1926  C CE1   . PHE A  1 253 ? -20.864 13.647  -6.951  1.00 33.32  ? 315 PHE A CE1   1 
ATOM   1927  C CE2   . PHE A  1 253 ? -21.529 15.948  -7.003  1.00 35.06  ? 315 PHE A CE2   1 
ATOM   1928  C CZ    . PHE A  1 253 ? -21.061 14.847  -6.296  1.00 34.18  ? 315 PHE A CZ    1 
ATOM   1929  N N     . THR A  1 254 ? -24.495 13.627  -12.881 1.00 36.10  ? 316 THR A N     1 
ATOM   1930  C CA    . THR A  1 254 ? -24.778 13.217  -14.267 1.00 35.94  ? 316 THR A CA    1 
ATOM   1931  C C     . THR A  1 254 ? -24.290 14.239  -15.291 1.00 38.63  ? 316 THR A C     1 
ATOM   1932  O O     . THR A  1 254 ? -23.951 13.888  -16.423 1.00 37.53  ? 316 THR A O     1 
ATOM   1933  C CB    . THR A  1 254 ? -26.272 13.001  -14.494 1.00 33.09  ? 316 THR A CB    1 
ATOM   1934  O OG1   . THR A  1 254 ? -26.956 14.202  -14.143 1.00 32.37  ? 316 THR A OG1   1 
ATOM   1935  C CG2   . THR A  1 254 ? -26.807 11.838  -13.660 1.00 31.68  ? 316 THR A CG2   1 
ATOM   1936  N N     . LYS A  1 255 ? -24.225 15.498  -14.878 1.00 43.98  ? 317 LYS A N     1 
ATOM   1937  C CA    . LYS A  1 255 ? -23.851 16.586  -15.791 1.00 48.08  ? 317 LYS A CA    1 
ATOM   1938  C C     . LYS A  1 255 ? -22.364 16.680  -16.133 1.00 44.26  ? 317 LYS A C     1 
ATOM   1939  O O     . LYS A  1 255 ? -21.979 17.389  -17.062 1.00 43.77  ? 317 LYS A O     1 
ATOM   1940  C CB    . LYS A  1 255 ? -24.348 17.910  -15.218 1.00 53.23  ? 317 LYS A CB    1 
ATOM   1941  C CG    . LYS A  1 255 ? -25.870 17.957  -15.109 1.00 58.67  ? 317 LYS A CG    1 
ATOM   1942  C CD    . LYS A  1 255 ? -26.591 17.738  -16.457 1.00 60.37  ? 317 LYS A CD    1 
ATOM   1943  C CE    . LYS A  1 255 ? -28.112 17.792  -16.305 1.00 61.60  ? 317 LYS A CE    1 
ATOM   1944  N NZ    . LYS A  1 255 ? -28.835 17.234  -17.473 1.00 59.81  ? 317 LYS A NZ    1 
ATOM   1945  N N     . CYS A  1 256 ? -21.543 15.947  -15.389 1.00 41.21  ? 318 CYS A N     1 
ATOM   1946  C CA    . CYS A  1 256 ? -20.101 15.909  -15.606 1.00 37.26  ? 318 CYS A CA    1 
ATOM   1947  C C     . CYS A  1 256 ? -19.754 15.200  -16.892 1.00 33.02  ? 318 CYS A C     1 
ATOM   1948  O O     . CYS A  1 256 ? -20.447 14.279  -17.311 1.00 30.70  ? 318 CYS A O     1 
ATOM   1949  C CB    . CYS A  1 256 ? -19.404 15.206  -14.436 1.00 37.08  ? 318 CYS A CB    1 
ATOM   1950  S SG    . CYS A  1 256 ? -19.648 16.038  -12.843 1.00 36.54  ? 318 CYS A SG    1 
ATOM   1951  N N     . HIS A  1 257 ? -18.634 15.620  -17.465 1.00 30.90  ? 319 HIS A N     1 
ATOM   1952  C CA    . HIS A  1 257 ? -18.188 15.196  -18.789 1.00 29.89  ? 319 HIS A CA    1 
ATOM   1953  C C     . HIS A  1 257 ? -17.731 13.755  -18.793 1.00 29.47  ? 319 HIS A C     1 
ATOM   1954  O O     . HIS A  1 257 ? -17.810 13.084  -19.834 1.00 27.78  ? 319 HIS A O     1 
ATOM   1955  C CB    . HIS A  1 257 ? -17.064 16.109  -19.281 1.00 29.48  ? 319 HIS A CB    1 
ATOM   1956  C CG    . HIS A  1 257 ? -16.807 16.018  -20.756 1.00 29.32  ? 319 HIS A CG    1 
ATOM   1957  N ND1   . HIS A  1 257 ? -15.541 15.834  -21.269 1.00 29.04  ? 319 HIS A ND1   1 
ATOM   1958  C CD2   . HIS A  1 257 ? -17.639 16.090  -21.823 1.00 28.50  ? 319 HIS A CD2   1 
ATOM   1959  C CE1   . HIS A  1 257 ? -15.604 15.784  -22.585 1.00 28.52  ? 319 HIS A CE1   1 
ATOM   1960  N NE2   . HIS A  1 257 ? -16.863 15.945  -22.947 1.00 28.31  ? 319 HIS A NE2   1 
ATOM   1961  N N     . LYS A  1 258 ? -17.256 13.290  -17.637 1.00 29.58  ? 320 LYS A N     1 
ATOM   1962  C CA    . LYS A  1 258 ? -17.081 11.877  -17.410 1.00 30.78  ? 320 LYS A CA    1 
ATOM   1963  C C     . LYS A  1 258 ? -17.840 11.396  -16.197 1.00 30.99  ? 320 LYS A C     1 
ATOM   1964  O O     . LYS A  1 258 ? -18.273 12.187  -15.369 1.00 29.90  ? 320 LYS A O     1 
ATOM   1965  C CB    . LYS A  1 258 ? -15.620 11.557  -17.267 1.00 32.92  ? 320 LYS A CB    1 
ATOM   1966  C CG    . LYS A  1 258 ? -14.861 11.751  -18.566 1.00 33.90  ? 320 LYS A CG    1 
ATOM   1967  C CD    . LYS A  1 258 ? -13.562 10.969  -18.523 1.00 35.62  ? 320 LYS A CD    1 
ATOM   1968  C CE    . LYS A  1 258 ? -12.964 10.796  -19.896 1.00 35.69  ? 320 LYS A CE    1 
ATOM   1969  N NZ    . LYS A  1 258 ? -11.550 10.387  -19.701 1.00 35.66  ? 320 LYS A NZ    1 
ATOM   1970  N N     . LYS A  1 259 ? -18.020 10.081  -16.131 1.00 32.51  ? 321 LYS A N     1 
ATOM   1971  C CA    . LYS A  1 259 ? -18.795 9.445   -15.078 1.00 35.53  ? 321 LYS A CA    1 
ATOM   1972  C C     . LYS A  1 259 ? -18.203 9.908   -13.738 1.00 34.55  ? 321 LYS A C     1 
ATOM   1973  O O     . LYS A  1 259 ? -17.023 9.693   -13.476 1.00 38.82  ? 321 LYS A O     1 
ATOM   1974  C CB    . LYS A  1 259 ? -18.804 7.901   -15.305 1.00 38.79  ? 321 LYS A CB    1 
ATOM   1975  C CG    . LYS A  1 259 ? -18.905 6.967   -14.091 1.00 45.10  ? 321 LYS A CG    1 
ATOM   1976  C CD    . LYS A  1 259 ? -20.331 6.684   -13.566 1.00 48.56  ? 321 LYS A CD    1 
ATOM   1977  C CE    . LYS A  1 259 ? -20.311 6.174   -12.104 1.00 49.43  ? 321 LYS A CE    1 
ATOM   1978  N NZ    . LYS A  1 259 ? -21.563 6.476   -11.345 1.00 48.23  ? 321 LYS A NZ    1 
ATOM   1979  N N     . MET A  1 260 ? -19.001 10.601  -12.926 1.00 32.30  ? 322 MET A N     1 
ATOM   1980  C CA    . MET A  1 260 ? -18.588 11.027  -11.574 1.00 31.56  ? 322 MET A CA    1 
ATOM   1981  C C     . MET A  1 260 ? -19.576 10.491  -10.582 1.00 32.07  ? 322 MET A C     1 
ATOM   1982  O O     . MET A  1 260 ? -20.792 10.690  -10.731 1.00 31.96  ? 322 MET A O     1 
ATOM   1983  C CB    . MET A  1 260 ? -18.652 12.530  -11.413 1.00 32.05  ? 322 MET A CB    1 
ATOM   1984  C CG    . MET A  1 260 ? -17.455 13.283  -11.903 1.00 32.63  ? 322 MET A CG    1 
ATOM   1985  S SD    . MET A  1 260 ? -16.275 13.557  -10.611 1.00 33.12  ? 322 MET A SD    1 
ATOM   1986  C CE    . MET A  1 260 ? -15.110 12.203  -10.942 1.00 34.26  ? 322 MET A CE    1 
ATOM   1987  N N     . GLY A  1 261 ? -19.068 9.865   -9.534  1.00 32.47  ? 323 GLY A N     1 
ATOM   1988  C CA    . GLY A  1 261 ? -19.935 9.348   -8.498  1.00 32.10  ? 323 GLY A CA    1 
ATOM   1989  C C     . GLY A  1 261 ? -19.172 8.460   -7.566  1.00 31.03  ? 323 GLY A C     1 
ATOM   1990  O O     . GLY A  1 261 ? -17.994 8.202   -7.785  1.00 32.29  ? 323 GLY A O     1 
ATOM   1991  N N     . PHE A  1 262 ? -19.856 7.993   -6.528  1.00 29.57  ? 324 PHE A N     1 
ATOM   1992  C CA    . PHE A  1 262 ? -19.291 7.017   -5.624  1.00 27.49  ? 324 PHE A CA    1 
ATOM   1993  C C     . PHE A  1 262 ? -20.387 6.118   -5.103  1.00 26.84  ? 324 PHE A C     1 
ATOM   1994  O O     . PHE A  1 262 ? -21.580 6.402   -5.247  1.00 25.83  ? 324 PHE A O     1 
ATOM   1995  C CB    . PHE A  1 262 ? -18.518 7.690   -4.484  1.00 26.42  ? 324 PHE A CB    1 
ATOM   1996  C CG    . PHE A  1 262 ? -19.333 8.637   -3.677  1.00 26.85  ? 324 PHE A CG    1 
ATOM   1997  C CD1   . PHE A  1 262 ? -20.065 8.185   -2.575  1.00 26.91  ? 324 PHE A CD1   1 
ATOM   1998  C CD2   . PHE A  1 262 ? -19.384 9.984   -4.010  1.00 26.39  ? 324 PHE A CD2   1 
ATOM   1999  C CE1   . PHE A  1 262 ? -20.823 9.070   -1.822  1.00 26.53  ? 324 PHE A CE1   1 
ATOM   2000  C CE2   . PHE A  1 262 ? -20.144 10.871  -3.262  1.00 26.00  ? 324 PHE A CE2   1 
ATOM   2001  C CZ    . PHE A  1 262 ? -20.857 10.418  -2.169  1.00 26.62  ? 324 PHE A CZ    1 
ATOM   2002  N N     . SER A  1 263 ? -19.949 5.018   -4.518  1.00 26.92  ? 325 SER A N     1 
ATOM   2003  C CA    . SER A  1 263 ? -20.828 4.055   -3.920  1.00 28.13  ? 325 SER A CA    1 
ATOM   2004  C C     . SER A  1 263 ? -20.454 3.956   -2.451  1.00 30.32  ? 325 SER A C     1 
ATOM   2005  O O     . SER A  1 263 ? -19.300 4.180   -2.099  1.00 32.04  ? 325 SER A O     1 
ATOM   2006  C CB    . SER A  1 263 ? -20.660 2.711   -4.620  1.00 27.24  ? 325 SER A CB    1 
ATOM   2007  O OG    . SER A  1 263 ? -21.273 1.655   -3.905  1.00 27.41  ? 325 SER A OG    1 
ATOM   2008  N N     . THR A  1 264 ? -21.438 3.662   -1.597  1.00 31.34  ? 326 THR A N     1 
ATOM   2009  C CA    . THR A  1 264 ? -21.190 3.405   -0.192  1.00 30.53  ? 326 THR A CA    1 
ATOM   2010  C C     . THR A  1 264 ? -21.352 1.923   0.071   1.00 28.71  ? 326 THR A C     1 
ATOM   2011  O O     . THR A  1 264 ? -21.459 1.509   1.209   1.00 30.99  ? 326 THR A O     1 
ATOM   2012  C CB    . THR A  1 264 ? -22.135 4.229   0.723   1.00 32.14  ? 326 THR A CB    1 
ATOM   2013  O OG1   . THR A  1 264 ? -23.488 3.748   0.637   1.00 33.46  ? 326 THR A OG1   1 
ATOM   2014  C CG2   . THR A  1 264 ? -22.097 5.692   0.347   1.00 32.34  ? 326 THR A CG2   1 
ATOM   2015  N N     . ALA A  1 265 ? -21.353 1.116   -0.976  1.00 26.67  ? 327 ALA A N     1 
ATOM   2016  C CA    . ALA A  1 265 ? -21.562 -0.316  -0.823  1.00 25.80  ? 327 ALA A CA    1 
ATOM   2017  C C     . ALA A  1 265 ? -20.428 -0.993  -0.062  1.00 24.17  ? 327 ALA A C     1 
ATOM   2018  O O     . ALA A  1 265 ? -19.330 -0.458  0.038   1.00 22.67  ? 327 ALA A O     1 
ATOM   2019  C CB    . ALA A  1 265 ? -21.707 -0.967  -2.191  1.00 26.59  ? 327 ALA A CB    1 
ATOM   2020  N N     . PRO A  1 266 ? -20.695 -2.190  0.454   1.00 23.29  ? 328 PRO A N     1 
ATOM   2021  C CA    . PRO A  1 266 ? -19.698 -3.018  1.095   1.00 24.34  ? 328 PRO A CA    1 
ATOM   2022  C C     . PRO A  1 266 ? -18.475 -3.334  0.254   1.00 24.82  ? 328 PRO A C     1 
ATOM   2023  O O     . PRO A  1 266 ? -17.381 -3.388  0.790   1.00 24.24  ? 328 PRO A O     1 
ATOM   2024  C CB    . PRO A  1 266 ? -20.452 -4.317  1.370   1.00 24.45  ? 328 PRO A CB    1 
ATOM   2025  C CG    . PRO A  1 266 ? -21.859 -3.893  1.530   1.00 24.00  ? 328 PRO A CG    1 
ATOM   2026  C CD    . PRO A  1 266 ? -22.037 -2.785  0.551   1.00 23.64  ? 328 PRO A CD    1 
ATOM   2027  N N     . ASP A  1 267 ? -18.668 -3.579  -1.036  1.00 26.26  ? 329 ASP A N     1 
ATOM   2028  C CA    . ASP A  1 267 ? -17.538 -3.840  -1.955  1.00 27.05  ? 329 ASP A CA    1 
ATOM   2029  C C     . ASP A  1 267 ? -16.883 -2.548  -2.470  1.00 26.43  ? 329 ASP A C     1 
ATOM   2030  O O     . ASP A  1 267 ? -15.969 -2.616  -3.262  1.00 27.56  ? 329 ASP A O     1 
ATOM   2031  C CB    . ASP A  1 267 ? -17.983 -4.688  -3.163  1.00 27.51  ? 329 ASP A CB    1 
ATOM   2032  C CG    . ASP A  1 267 ? -19.214 -4.131  -3.819  1.00 28.40  ? 329 ASP A CG    1 
ATOM   2033  O OD1   . ASP A  1 267 ? -20.304 -4.369  -3.252  1.00 31.67  ? 329 ASP A OD1   1 
ATOM   2034  O OD2   . ASP A  1 267 ? -19.108 -3.429  -4.847  1.00 28.26  ? 329 ASP A OD2   1 
ATOM   2035  N N     . ALA A  1 268 ? -17.363 -1.378  -2.081  1.00 25.08  ? 330 ALA A N     1 
ATOM   2036  C CA    . ALA A  1 268 ? -16.737 -0.147  -2.531  1.00 24.37  ? 330 ALA A CA    1 
ATOM   2037  C C     . ALA A  1 268 ? -15.734 0.246   -1.475  1.00 23.67  ? 330 ALA A C     1 
ATOM   2038  O O     . ALA A  1 268 ? -15.749 -0.303  -0.396  1.00 24.25  ? 330 ALA A O     1 
ATOM   2039  C CB    . ALA A  1 268 ? -17.786 0.932   -2.705  1.00 24.78  ? 330 ALA A CB    1 
ATOM   2040  N N     . PRO A  1 269 ? -14.861 1.201   -1.765  1.00 23.19  ? 331 PRO A N     1 
ATOM   2041  C CA    . PRO A  1 269 ? -13.991 1.704   -0.687  1.00 24.56  ? 331 PRO A CA    1 
ATOM   2042  C C     . PRO A  1 269 ? -14.730 2.445   0.428   1.00 24.85  ? 331 PRO A C     1 
ATOM   2043  O O     . PRO A  1 269 ? -15.847 2.895   0.219   1.00 25.53  ? 331 PRO A O     1 
ATOM   2044  C CB    . PRO A  1 269 ? -13.015 2.660   -1.406  1.00 24.10  ? 331 PRO A CB    1 
ATOM   2045  C CG    . PRO A  1 269 ? -13.517 2.786   -2.796  1.00 23.49  ? 331 PRO A CG    1 
ATOM   2046  C CD    . PRO A  1 269 ? -14.403 1.612   -3.090  1.00 23.03  ? 331 PRO A CD    1 
ATOM   2047  N N     . TYR A  1 270 ? -14.084 2.570   1.585   1.00 25.28  ? 332 TYR A N     1 
ATOM   2048  C CA    . TYR A  1 270 ? -14.690 3.143   2.775   1.00 26.48  ? 332 TYR A CA    1 
ATOM   2049  C C     . TYR A  1 270 ? -15.158 4.589   2.542   1.00 27.28  ? 332 TYR A C     1 
ATOM   2050  O O     . TYR A  1 270 ? -14.504 5.379   1.835   1.00 26.89  ? 332 TYR A O     1 
ATOM   2051  C CB    . TYR A  1 270 ? -13.716 3.055   3.966   1.00 27.77  ? 332 TYR A CB    1 
ATOM   2052  C CG    . TYR A  1 270 ? -14.092 3.893   5.206   1.00 31.57  ? 332 TYR A CG    1 
ATOM   2053  C CD1   . TYR A  1 270 ? -13.778 5.283   5.283   1.00 31.61  ? 332 TYR A CD1   1 
ATOM   2054  C CD2   . TYR A  1 270 ? -14.743 3.296   6.332   1.00 33.34  ? 332 TYR A CD2   1 
ATOM   2055  C CE1   . TYR A  1 270 ? -14.117 6.046   6.411   1.00 32.54  ? 332 TYR A CE1   1 
ATOM   2056  C CE2   . TYR A  1 270 ? -15.077 4.049   7.475   1.00 33.20  ? 332 TYR A CE2   1 
ATOM   2057  C CZ    . TYR A  1 270 ? -14.772 5.424   7.521   1.00 34.17  ? 332 TYR A CZ    1 
ATOM   2058  O OH    . TYR A  1 270 ? -15.116 6.172   8.651   1.00 32.13  ? 332 TYR A OH    1 
ATOM   2059  N N     . THR A  1 271 ? -16.323 4.890   3.132   1.00 27.95  ? 333 THR A N     1 
ATOM   2060  C CA    . THR A  1 271 ? -16.899 6.243   3.257   1.00 28.30  ? 333 THR A CA    1 
ATOM   2061  C C     . THR A  1 271 ? -17.410 6.431   4.675   1.00 28.11  ? 333 THR A C     1 
ATOM   2062  O O     . THR A  1 271 ? -17.684 5.460   5.375   1.00 30.28  ? 333 THR A O     1 
ATOM   2063  C CB    . THR A  1 271 ? -18.094 6.449   2.308   1.00 28.90  ? 333 THR A CB    1 
ATOM   2064  O OG1   . THR A  1 271 ? -19.243 5.711   2.762   1.00 29.47  ? 333 THR A OG1   1 
ATOM   2065  C CG2   . THR A  1 271 ? -17.731 5.986   0.917   1.00 29.11  ? 333 THR A CG2   1 
ATOM   2066  N N     . HIS A  1 272 ? -17.578 7.663   5.114   1.00 27.45  ? 334 HIS A N     1 
ATOM   2067  C CA    . HIS A  1 272 ? -18.006 7.876   6.496   1.00 26.89  ? 334 HIS A CA    1 
ATOM   2068  C C     . HIS A  1 272 ? -19.431 7.415   6.738   1.00 25.97  ? 334 HIS A C     1 
ATOM   2069  O O     . HIS A  1 272 ? -19.849 7.304   7.888   1.00 26.63  ? 334 HIS A O     1 
ATOM   2070  C CB    . HIS A  1 272 ? -17.832 9.339   6.914   1.00 27.04  ? 334 HIS A CB    1 
ATOM   2071  C CG    . HIS A  1 272 ? -18.877 10.256  6.372   1.00 27.18  ? 334 HIS A CG    1 
ATOM   2072  N ND1   . HIS A  1 272 ? -18.864 10.737  5.079   1.00 28.37  ? 334 HIS A ND1   1 
ATOM   2073  C CD2   . HIS A  1 272 ? -19.968 10.795  6.959   1.00 28.36  ? 334 HIS A CD2   1 
ATOM   2074  C CE1   . HIS A  1 272 ? -19.910 11.526  4.892   1.00 29.28  ? 334 HIS A CE1   1 
ATOM   2075  N NE2   . HIS A  1 272 ? -20.598 11.577  6.019   1.00 29.70  ? 334 HIS A NE2   1 
ATOM   2076  N N     . TRP A  1 273 ? -20.182 7.158   5.673   1.00 25.66  ? 335 TRP A N     1 
ATOM   2077  C CA    . TRP A  1 273 ? -21.563 6.645   5.804   1.00 26.81  ? 335 TRP A CA    1 
ATOM   2078  C C     . TRP A  1 273 ? -21.601 5.147   6.110   1.00 26.43  ? 335 TRP A C     1 
ATOM   2079  O O     . TRP A  1 273 ? -22.580 4.637   6.662   1.00 24.66  ? 335 TRP A O     1 
ATOM   2080  C CB    . TRP A  1 273 ? -22.360 6.882   4.506   1.00 27.50  ? 335 TRP A CB    1 
ATOM   2081  C CG    . TRP A  1 273 ? -22.727 8.323   4.219   1.00 25.94  ? 335 TRP A CG    1 
ATOM   2082  C CD1   . TRP A  1 273 ? -23.715 9.031   4.794   1.00 26.23  ? 335 TRP A CD1   1 
ATOM   2083  C CD2   . TRP A  1 273 ? -22.117 9.185   3.272   1.00 24.85  ? 335 TRP A CD2   1 
ATOM   2084  N NE1   . TRP A  1 273 ? -23.757 10.292  4.282   1.00 25.48  ? 335 TRP A NE1   1 
ATOM   2085  C CE2   . TRP A  1 273 ? -22.785 10.404  3.336   1.00 24.35  ? 335 TRP A CE2   1 
ATOM   2086  C CE3   . TRP A  1 273 ? -21.064 9.041   2.375   1.00 25.11  ? 335 TRP A CE3   1 
ATOM   2087  C CZ2   . TRP A  1 273 ? -22.445 11.463  2.566   1.00 24.44  ? 335 TRP A CZ2   1 
ATOM   2088  C CZ3   . TRP A  1 273 ? -20.734 10.104  1.598   1.00 24.90  ? 335 TRP A CZ3   1 
ATOM   2089  C CH2   . TRP A  1 273 ? -21.418 11.303  1.698   1.00 24.30  ? 335 TRP A CH2   1 
ATOM   2090  N N     . LYS A  1 274 ? -20.552 4.452   5.682   1.00 26.65  ? 336 LYS A N     1 
ATOM   2091  C CA    . LYS A  1 274 ? -20.434 3.036   5.899   1.00 27.15  ? 336 LYS A CA    1 
ATOM   2092  C C     . LYS A  1 274 ? -21.654 2.356   5.304   1.00 28.58  ? 336 LYS A C     1 
ATOM   2093  O O     . LYS A  1 274 ? -22.131 2.760   4.235   1.00 31.63  ? 336 LYS A O     1 
ATOM   2094  C CB    . LYS A  1 274 ? -20.292 2.774   7.401   1.00 26.93  ? 336 LYS A CB    1 
ATOM   2095  C CG    . LYS A  1 274 ? -19.228 3.631   8.064   1.00 26.60  ? 336 LYS A CG    1 
ATOM   2096  C CD    . LYS A  1 274 ? -19.083 3.331   9.554   1.00 27.09  ? 336 LYS A CD    1 
ATOM   2097  C CE    . LYS A  1 274 ? -17.887 4.068   10.167  1.00 26.60  ? 336 LYS A CE    1 
ATOM   2098  N NZ    . LYS A  1 274 ? -17.815 3.925   11.638  1.00 26.29  ? 336 LYS A NZ    1 
ATOM   2099  N N     . GLN A  1 275 ? -22.172 1.344   6.001   1.00 28.96  ? 337 GLN A N     1 
ATOM   2100  C CA    . GLN A  1 275 ? -23.431 0.691   5.647   1.00 28.93  ? 337 GLN A CA    1 
ATOM   2101  C C     . GLN A  1 275 ? -24.390 0.706   6.834   1.00 28.00  ? 337 GLN A C     1 
ATOM   2102  O O     . GLN A  1 275 ? -23.983 0.948   7.958   1.00 27.79  ? 337 GLN A O     1 
ATOM   2103  C CB    . GLN A  1 275 ? -23.192 -0.755  5.220   1.00 29.15  ? 337 GLN A CB    1 
ATOM   2104  C CG    . GLN A  1 275 ? -22.474 -0.902  3.894   1.00 29.70  ? 337 GLN A CG    1 
ATOM   2105  C CD    . GLN A  1 275 ? -20.961 -0.718  3.972   1.00 29.37  ? 337 GLN A CD    1 
ATOM   2106  O OE1   . GLN A  1 275 ? -20.293 -1.287  4.824   1.00 28.84  ? 337 GLN A OE1   1 
ATOM   2107  N NE2   . GLN A  1 275 ? -20.423 0.069   3.062   1.00 29.82  ? 337 GLN A NE2   1 
ATOM   2108  N N     . THR A  1 276 ? -25.661 0.422   6.563   1.00 27.79  ? 338 THR A N     1 
ATOM   2109  C CA    . THR A  1 276 ? -26.723 0.513   7.555   1.00 27.03  ? 338 THR A CA    1 
ATOM   2110  C C     . THR A  1 276 ? -27.266 -0.900  7.710   1.00 25.18  ? 338 THR A C     1 
ATOM   2111  O O     . THR A  1 276 ? -27.685 -1.512  6.744   1.00 24.63  ? 338 THR A O     1 
ATOM   2112  C CB    . THR A  1 276 ? -27.827 1.516   7.102   1.00 27.63  ? 338 THR A CB    1 
ATOM   2113  O OG1   . THR A  1 276 ? -27.231 2.699   6.499   1.00 28.69  ? 338 THR A OG1   1 
ATOM   2114  C CG2   . THR A  1 276 ? -28.720 1.883   8.279   1.00 26.72  ? 338 THR A CG2   1 
ATOM   2115  N N     . VAL A  1 277 ? -27.241 -1.430  8.915   1.00 24.40  ? 339 VAL A N     1 
ATOM   2116  C CA    . VAL A  1 277 ? -27.578 -2.827  9.106   1.00 25.08  ? 339 VAL A CA    1 
ATOM   2117  C C     . VAL A  1 277 ? -28.917 -2.895  9.801   1.00 26.10  ? 339 VAL A C     1 
ATOM   2118  O O     . VAL A  1 277 ? -29.119 -2.169  10.747  1.00 27.01  ? 339 VAL A O     1 
ATOM   2119  C CB    . VAL A  1 277 ? -26.496 -3.536  9.950   1.00 24.46  ? 339 VAL A CB    1 
ATOM   2120  C CG1   . VAL A  1 277 ? -26.813 -5.010  10.139  1.00 23.82  ? 339 VAL A CG1   1 
ATOM   2121  C CG2   . VAL A  1 277 ? -25.136 -3.379  9.285   1.00 24.45  ? 339 VAL A CG2   1 
ATOM   2122  N N     . PHE A  1 278 ? -29.816 -3.763  9.327   1.00 27.37  ? 340 PHE A N     1 
ATOM   2123  C CA    . PHE A  1 278 ? -31.097 -4.032  9.977   1.00 28.50  ? 340 PHE A CA    1 
ATOM   2124  C C     . PHE A  1 278 ? -31.196 -5.495  10.419  1.00 30.29  ? 340 PHE A C     1 
ATOM   2125  O O     . PHE A  1 278 ? -31.403 -6.390  9.586   1.00 28.83  ? 340 PHE A O     1 
ATOM   2126  C CB    . PHE A  1 278 ? -32.239 -3.729  9.027   1.00 29.01  ? 340 PHE A CB    1 
ATOM   2127  C CG    . PHE A  1 278 ? -32.293 -2.300  8.584   1.00 30.10  ? 340 PHE A CG    1 
ATOM   2128  C CD1   . PHE A  1 278 ? -31.398 -1.822  7.638   1.00 30.55  ? 340 PHE A CD1   1 
ATOM   2129  C CD2   . PHE A  1 278 ? -33.250 -1.433  9.102   1.00 30.68  ? 340 PHE A CD2   1 
ATOM   2130  C CE1   . PHE A  1 278 ? -31.449 -0.505  7.220   1.00 31.12  ? 340 PHE A CE1   1 
ATOM   2131  C CE2   . PHE A  1 278 ? -33.314 -0.116  8.685   1.00 31.06  ? 340 PHE A CE2   1 
ATOM   2132  C CZ    . PHE A  1 278 ? -32.414 0.348   7.742   1.00 31.60  ? 340 PHE A CZ    1 
ATOM   2133  N N     . TYR A  1 279 ? -31.087 -5.729  11.733  1.00 32.36  ? 341 TYR A N     1 
ATOM   2134  C CA    . TYR A  1 279 ? -31.078 -7.087  12.273  1.00 33.08  ? 341 TYR A CA    1 
ATOM   2135  C C     . TYR A  1 279 ? -32.453 -7.714  12.156  1.00 33.65  ? 341 TYR A C     1 
ATOM   2136  O O     . TYR A  1 279 ? -33.430 -7.001  12.204  1.00 32.70  ? 341 TYR A O     1 
ATOM   2137  C CB    . TYR A  1 279 ? -30.558 -7.101  13.728  1.00 33.87  ? 341 TYR A CB    1 
ATOM   2138  C CG    . TYR A  1 279 ? -29.039 -7.090  13.780  1.00 34.57  ? 341 TYR A CG    1 
ATOM   2139  C CD1   . TYR A  1 279 ? -28.318 -8.138  13.234  1.00 35.31  ? 341 TYR A CD1   1 
ATOM   2140  C CD2   . TYR A  1 279 ? -28.328 -6.027  14.341  1.00 35.50  ? 341 TYR A CD2   1 
ATOM   2141  C CE1   . TYR A  1 279 ? -26.942 -8.138  13.236  1.00 36.34  ? 341 TYR A CE1   1 
ATOM   2142  C CE2   . TYR A  1 279 ? -26.944 -6.019  14.344  1.00 35.78  ? 341 TYR A CE2   1 
ATOM   2143  C CZ    . TYR A  1 279 ? -26.266 -7.089  13.783  1.00 36.75  ? 341 TYR A CZ    1 
ATOM   2144  O OH    . TYR A  1 279 ? -24.901 -7.156  13.742  1.00 38.72  ? 341 TYR A OH    1 
ATOM   2145  N N     . LEU A  1 280 ? -32.501 -9.034  11.954  1.00 37.63  ? 342 LEU A N     1 
ATOM   2146  C CA    . LEU A  1 280 ? -33.740 -9.847  11.998  1.00 40.50  ? 342 LEU A CA    1 
ATOM   2147  C C     . LEU A  1 280 ? -33.835 -10.624 13.308  1.00 44.86  ? 342 LEU A C     1 
ATOM   2148  O O     . LEU A  1 280 ? -32.797 -10.946 13.887  1.00 49.68  ? 342 LEU A O     1 
ATOM   2149  C CB    . LEU A  1 280 ? -33.733 -10.880 10.879  1.00 39.73  ? 342 LEU A CB    1 
ATOM   2150  C CG    . LEU A  1 280 ? -33.597 -10.374 9.454   1.00 39.56  ? 342 LEU A CG    1 
ATOM   2151  C CD1   . LEU A  1 280 ? -33.563 -11.546 8.485   1.00 39.19  ? 342 LEU A CD1   1 
ATOM   2152  C CD2   . LEU A  1 280 ? -34.758 -9.446  9.153   1.00 39.71  ? 342 LEU A CD2   1 
ATOM   2153  N N     . GLU A  1 281 ? -35.047 -10.978 13.750  1.00 47.73  ? 343 GLU A N     1 
ATOM   2154  C CA    . GLU A  1 281 ? -35.193 -11.622 15.057  1.00 52.85  ? 343 GLU A CA    1 
ATOM   2155  C C     . GLU A  1 281 ? -34.597 -13.008 15.065  1.00 53.29  ? 343 GLU A C     1 
ATOM   2156  O O     . GLU A  1 281 ? -33.765 -13.329 15.923  1.00 62.52  ? 343 GLU A O     1 
ATOM   2157  C CB    . GLU A  1 281 ? -36.634 -11.691 15.505  1.00 58.64  ? 343 GLU A CB    1 
ATOM   2158  C CG    . GLU A  1 281 ? -37.219 -10.335 15.837  1.00 64.71  ? 343 GLU A CG    1 
ATOM   2159  C CD    . GLU A  1 281 ? -38.646 -10.450 16.309  1.00 70.50  ? 343 GLU A CD    1 
ATOM   2160  O OE1   . GLU A  1 281 ? -39.557 -10.328 15.463  1.00 82.47  ? 343 GLU A OE1   1 
ATOM   2161  O OE2   . GLU A  1 281 ? -38.852 -10.704 17.508  1.00 69.87  ? 343 GLU A OE2   1 
ATOM   2162  N N     . ASP A  1 282 ? -35.005 -13.830 14.116  1.00 47.96  ? 344 ASP A N     1 
ATOM   2163  C CA    . ASP A  1 282 ? -34.338 -15.108 13.925  1.00 47.32  ? 344 ASP A CA    1 
ATOM   2164  C C     . ASP A  1 282 ? -33.602 -15.075 12.617  1.00 43.11  ? 344 ASP A C     1 
ATOM   2165  O O     . ASP A  1 282 ? -33.919 -14.273 11.724  1.00 44.51  ? 344 ASP A O     1 
ATOM   2166  C CB    . ASP A  1 282 ? -35.340 -16.252 13.899  1.00 50.43  ? 344 ASP A CB    1 
ATOM   2167  C CG    . ASP A  1 282 ? -36.235 -16.260 15.110  1.00 52.82  ? 344 ASP A CG    1 
ATOM   2168  O OD1   . ASP A  1 282 ? -35.770 -16.644 16.203  1.00 57.17  ? 344 ASP A OD1   1 
ATOM   2169  O OD2   . ASP A  1 282 ? -37.401 -15.864 14.969  1.00 50.97  ? 344 ASP A OD2   1 
ATOM   2170  N N     . TYR A  1 283 ? -32.626 -15.962 12.497  1.00 35.47  ? 345 TYR A N     1 
ATOM   2171  C CA    . TYR A  1 283 ? -31.914 -16.086 11.256  1.00 30.27  ? 345 TYR A CA    1 
ATOM   2172  C C     . TYR A  1 283 ? -32.707 -16.949 10.247  1.00 28.65  ? 345 TYR A C     1 
ATOM   2173  O O     . TYR A  1 283 ? -33.426 -17.865 10.610  1.00 25.04  ? 345 TYR A O     1 
ATOM   2174  C CB    . TYR A  1 283 ? -30.478 -16.569 11.497  1.00 28.12  ? 345 TYR A CB    1 
ATOM   2175  C CG    . TYR A  1 283 ? -30.325 -17.834 12.280  1.00 26.25  ? 345 TYR A CG    1 
ATOM   2176  C CD1   . TYR A  1 283 ? -30.475 -19.055 11.663  1.00 25.87  ? 345 TYR A CD1   1 
ATOM   2177  C CD2   . TYR A  1 283 ? -29.967 -17.814 13.624  1.00 25.21  ? 345 TYR A CD2   1 
ATOM   2178  C CE1   . TYR A  1 283 ? -30.324 -20.238 12.372  1.00 26.19  ? 345 TYR A CE1   1 
ATOM   2179  C CE2   . TYR A  1 283 ? -29.799 -18.992 14.341  1.00 25.72  ? 345 TYR A CE2   1 
ATOM   2180  C CZ    . TYR A  1 283 ? -29.982 -20.214 13.711  1.00 25.93  ? 345 TYR A CZ    1 
ATOM   2181  O OH    . TYR A  1 283 ? -29.826 -21.417 14.387  1.00 26.12  ? 345 TYR A OH    1 
ATOM   2182  N N     . LEU A  1 284 ? -32.580 -16.602 8.970   1.00 28.64  ? 346 LEU A N     1 
ATOM   2183  C CA    . LEU A  1 284 ? -33.162 -17.369 7.879   1.00 27.79  ? 346 LEU A CA    1 
ATOM   2184  C C     . LEU A  1 284 ? -32.161 -18.391 7.470   1.00 27.21  ? 346 LEU A C     1 
ATOM   2185  O O     . LEU A  1 284 ? -30.973 -18.072 7.334   1.00 25.81  ? 346 LEU A O     1 
ATOM   2186  C CB    . LEU A  1 284 ? -33.415 -16.471 6.671   1.00 28.33  ? 346 LEU A CB    1 
ATOM   2187  C CG    . LEU A  1 284 ? -34.728 -15.681 6.619   1.00 28.87  ? 346 LEU A CG    1 
ATOM   2188  C CD1   . LEU A  1 284 ? -35.246 -15.295 7.985   1.00 29.44  ? 346 LEU A CD1   1 
ATOM   2189  C CD2   . LEU A  1 284 ? -34.592 -14.441 5.755   1.00 28.31  ? 346 LEU A CD2   1 
ATOM   2190  N N     . THR A  1 285 ? -32.634 -19.609 7.253   1.00 27.27  ? 347 THR A N     1 
ATOM   2191  C CA    . THR A  1 285 ? -31.801 -20.659 6.674   1.00 28.97  ? 347 THR A CA    1 
ATOM   2192  C C     . THR A  1 285 ? -32.049 -20.848 5.139   1.00 30.36  ? 347 THR A C     1 
ATOM   2193  O O     . THR A  1 285 ? -33.085 -21.391 4.712   1.00 35.23  ? 347 THR A O     1 
ATOM   2194  C CB    . THR A  1 285 ? -31.981 -21.951 7.475   1.00 27.81  ? 347 THR A CB    1 
ATOM   2195  O OG1   . THR A  1 285 ? -31.883 -21.623 8.858   1.00 24.85  ? 347 THR A OG1   1 
ATOM   2196  C CG2   . THR A  1 285 ? -30.890 -22.964 7.114   1.00 28.43  ? 347 THR A CG2   1 
ATOM   2197  N N     . VAL A  1 286 ? -31.081 -20.432 4.316   1.00 28.39  ? 348 VAL A N     1 
ATOM   2198  C CA    . VAL A  1 286 ? -31.346 -20.188 2.906   1.00 26.92  ? 348 VAL A CA    1 
ATOM   2199  C C     . VAL A  1 286 ? -30.502 -21.064 1.985   1.00 27.31  ? 348 VAL A C     1 
ATOM   2200  O O     . VAL A  1 286 ? -29.354 -21.361 2.295   1.00 28.80  ? 348 VAL A O     1 
ATOM   2201  C CB    . VAL A  1 286 ? -31.161 -18.685 2.586   1.00 26.25  ? 348 VAL A CB    1 
ATOM   2202  C CG1   . VAL A  1 286 ? -32.048 -17.840 3.470   1.00 26.26  ? 348 VAL A CG1   1 
ATOM   2203  C CG2   . VAL A  1 286 ? -29.724 -18.216 2.756   1.00 26.31  ? 348 VAL A CG2   1 
ATOM   2204  N N     . ARG A  1 287 ? -31.059 -21.451 0.844   1.00 28.13  ? 349 ARG A N     1 
ATOM   2205  C CA    . ARG A  1 287 ? -30.329 -22.233 -0.158  1.00 30.52  ? 349 ARG A CA    1 
ATOM   2206  C C     . ARG A  1 287 ? -30.107 -21.453 -1.457  1.00 30.93  ? 349 ARG A C     1 
ATOM   2207  O O     . ARG A  1 287 ? -30.914 -20.596 -1.813  1.00 29.62  ? 349 ARG A O     1 
ATOM   2208  C CB    . ARG A  1 287 ? -31.090 -23.521 -0.461  1.00 32.61  ? 349 ARG A CB    1 
ATOM   2209  C CG    . ARG A  1 287 ? -31.212 -24.454 0.736   1.00 33.91  ? 349 ARG A CG    1 
ATOM   2210  C CD    . ARG A  1 287 ? -32.070 -25.701 0.514   1.00 35.41  ? 349 ARG A CD    1 
ATOM   2211  N NE    . ARG A  1 287 ? -31.816 -26.435 -0.740  1.00 38.45  ? 349 ARG A NE    1 
ATOM   2212  C CZ    . ARG A  1 287 ? -32.626 -26.424 -1.814  1.00 40.68  ? 349 ARG A CZ    1 
ATOM   2213  N NH1   . ARG A  1 287 ? -33.752 -25.712 -1.830  1.00 42.03  ? 349 ARG A NH1   1 
ATOM   2214  N NH2   . ARG A  1 287 ? -32.313 -27.112 -2.904  1.00 39.93  ? 349 ARG A NH2   1 
ATOM   2215  N N     . ARG A  1 288 ? -29.003 -21.724 -2.156  1.00 32.47  ? 350 ARG A N     1 
ATOM   2216  C CA    . ARG A  1 288 ? -28.750 -21.063 -3.446  1.00 34.28  ? 350 ARG A CA    1 
ATOM   2217  C C     . ARG A  1 288 ? -30.010 -21.203 -4.296  1.00 33.97  ? 350 ARG A C     1 
ATOM   2218  O O     . ARG A  1 288 ? -30.552 -22.280 -4.413  1.00 33.91  ? 350 ARG A O     1 
ATOM   2219  C CB    . ARG A  1 288 ? -27.554 -21.684 -4.174  1.00 35.66  ? 350 ARG A CB    1 
ATOM   2220  C CG    . ARG A  1 288 ? -26.990 -20.838 -5.303  1.00 37.41  ? 350 ARG A CG    1 
ATOM   2221  C CD    . ARG A  1 288 ? -26.856 -21.624 -6.598  1.00 41.48  ? 350 ARG A CD    1 
ATOM   2222  N NE    . ARG A  1 288 ? -26.546 -20.750 -7.745  1.00 44.21  ? 350 ARG A NE    1 
ATOM   2223  C CZ    . ARG A  1 288 ? -25.334 -20.293 -8.034  1.00 46.23  ? 350 ARG A CZ    1 
ATOM   2224  N NH1   . ARG A  1 288 ? -24.298 -20.606 -7.268  1.00 52.35  ? 350 ARG A NH1   1 
ATOM   2225  N NH2   . ARG A  1 288 ? -25.141 -19.522 -9.083  1.00 46.14  ? 350 ARG A NH2   1 
ATOM   2226  N N     . GLY A  1 289 ? -30.489 -20.098 -4.852  1.00 33.96  ? 351 GLY A N     1 
ATOM   2227  C CA    . GLY A  1 289 ? -31.630 -20.107 -5.750  1.00 33.47  ? 351 GLY A CA    1 
ATOM   2228  C C     . GLY A  1 289 ? -32.929 -19.654 -5.113  1.00 35.40  ? 351 GLY A C     1 
ATOM   2229  O O     . GLY A  1 289 ? -33.806 -19.143 -5.801  1.00 38.34  ? 351 GLY A O     1 
ATOM   2230  N N     . GLU A  1 290 ? -33.062 -19.784 -3.801  1.00 37.40  ? 352 GLU A N     1 
ATOM   2231  C CA    . GLU A  1 290 ? -34.299 -19.356 -3.125  1.00 39.11  ? 352 GLU A CA    1 
ATOM   2232  C C     . GLU A  1 290 ? -34.284 -17.826 -3.055  1.00 40.69  ? 352 GLU A C     1 
ATOM   2233  O O     . GLU A  1 290 ? -33.298 -17.203 -3.468  1.00 44.69  ? 352 GLU A O     1 
ATOM   2234  C CB    . GLU A  1 290 ? -34.417 -19.987 -1.729  1.00 40.44  ? 352 GLU A CB    1 
ATOM   2235  C CG    . GLU A  1 290 ? -34.147 -21.495 -1.691  1.00 41.49  ? 352 GLU A CG    1 
ATOM   2236  C CD    . GLU A  1 290 ? -34.386 -22.150 -0.325  1.00 43.11  ? 352 GLU A CD    1 
ATOM   2237  O OE1   . GLU A  1 290 ? -35.213 -23.076 -0.295  1.00 45.56  ? 352 GLU A OE1   1 
ATOM   2238  O OE2   . GLU A  1 290 ? -33.753 -21.794 0.707   1.00 42.49  ? 352 GLU A OE2   1 
ATOM   2239  N N     . GLU A  1 291 ? -35.355 -17.212 -2.551  1.00 40.14  ? 353 GLU A N     1 
ATOM   2240  C CA    . GLU A  1 291 ? -35.510 -15.747 -2.623  1.00 39.26  ? 353 GLU A CA    1 
ATOM   2241  C C     . GLU A  1 291 ? -36.228 -15.155 -1.431  1.00 38.01  ? 353 GLU A C     1 
ATOM   2242  O O     . GLU A  1 291 ? -37.165 -15.736 -0.913  1.00 40.01  ? 353 GLU A O     1 
ATOM   2243  C CB    . GLU A  1 291 ? -36.306 -15.356 -3.875  1.00 41.69  ? 353 GLU A CB    1 
ATOM   2244  C CG    . GLU A  1 291 ? -35.597 -15.648 -5.188  1.00 44.92  ? 353 GLU A CG    1 
ATOM   2245  C CD    . GLU A  1 291 ? -36.472 -15.392 -6.403  1.00 46.08  ? 353 GLU A CD    1 
ATOM   2246  O OE1   . GLU A  1 291 ? -37.714 -15.573 -6.301  1.00 42.79  ? 353 GLU A OE1   1 
ATOM   2247  O OE2   . GLU A  1 291 ? -35.889 -15.047 -7.464  1.00 47.71  ? 353 GLU A OE2   1 
ATOM   2248  N N     . ILE A  1 292 ? -35.818 -13.955 -1.046  1.00 37.15  ? 354 ILE A N     1 
ATOM   2249  C CA    . ILE A  1 292 ? -36.483 -13.199 0.011   1.00 35.79  ? 354 ILE A CA    1 
ATOM   2250  C C     . ILE A  1 292 ? -37.294 -12.067 -0.603  1.00 34.57  ? 354 ILE A C     1 
ATOM   2251  O O     . ILE A  1 292 ? -36.757 -11.242 -1.331  1.00 36.51  ? 354 ILE A O     1 
ATOM   2252  C CB    . ILE A  1 292 ? -35.465 -12.550 0.959   1.00 36.11  ? 354 ILE A CB    1 
ATOM   2253  C CG1   . ILE A  1 292 ? -34.557 -13.607 1.583   1.00 35.94  ? 354 ILE A CG1   1 
ATOM   2254  C CG2   . ILE A  1 292 ? -36.176 -11.753 2.041   1.00 36.38  ? 354 ILE A CG2   1 
ATOM   2255  C CD1   . ILE A  1 292 ? -33.277 -13.018 2.140   1.00 36.52  ? 354 ILE A CD1   1 
ATOM   2256  N N     . TYR A  1 293 ? -38.581 -12.023 -0.303  1.00 32.95  ? 355 TYR A N     1 
ATOM   2257  C CA    . TYR A  1 293 ? -39.447 -10.958 -0.777  1.00 31.26  ? 355 TYR A CA    1 
ATOM   2258  C C     . TYR A  1 293 ? -39.848 -10.123 0.390   1.00 28.81  ? 355 TYR A C     1 
ATOM   2259  O O     . TYR A  1 293 ? -39.883 -10.609 1.513   1.00 29.79  ? 355 TYR A O     1 
ATOM   2260  C CB    . TYR A  1 293 ? -40.713 -11.541 -1.377  1.00 32.25  ? 355 TYR A CB    1 
ATOM   2261  C CG    . TYR A  1 293 ? -40.493 -12.266 -2.668  1.00 32.84  ? 355 TYR A CG    1 
ATOM   2262  C CD1   . TYR A  1 293 ? -39.973 -13.555 -2.674  1.00 33.41  ? 355 TYR A CD1   1 
ATOM   2263  C CD2   . TYR A  1 293 ? -40.812 -11.666 -3.883  1.00 32.83  ? 355 TYR A CD2   1 
ATOM   2264  C CE1   . TYR A  1 293 ? -39.778 -14.223 -3.857  1.00 36.19  ? 355 TYR A CE1   1 
ATOM   2265  C CE2   . TYR A  1 293 ? -40.624 -12.327 -5.069  1.00 34.03  ? 355 TYR A CE2   1 
ATOM   2266  C CZ    . TYR A  1 293 ? -40.115 -13.601 -5.052  1.00 36.74  ? 355 TYR A CZ    1 
ATOM   2267  O OH    . TYR A  1 293 ? -39.934 -14.266 -6.237  1.00 44.03  ? 355 TYR A OH    1 
ATOM   2268  N N     . GLY A  1 294 ? -40.191 -8.875  0.125   1.00 26.60  ? 356 GLY A N     1 
ATOM   2269  C CA    . GLY A  1 294 ? -40.737 -8.022  1.162   1.00 25.32  ? 356 GLY A CA    1 
ATOM   2270  C C     . GLY A  1 294 ? -41.008 -6.610  0.702   1.00 24.90  ? 356 GLY A C     1 
ATOM   2271  O O     . GLY A  1 294 ? -40.902 -6.272  -0.483  1.00 24.02  ? 356 GLY A O     1 
ATOM   2272  N N     . THR A  1 295 ? -41.371 -5.773  1.653   1.00 24.90  ? 357 THR A N     1 
ATOM   2273  C CA    . THR A  1 295 ? -41.425 -4.353  1.407   1.00 26.01  ? 357 THR A CA    1 
ATOM   2274  C C     . THR A  1 295 ? -40.637 -3.682  2.487   1.00 26.39  ? 357 THR A C     1 
ATOM   2275  O O     . THR A  1 295 ? -40.464 -4.213  3.567   1.00 27.37  ? 357 THR A O     1 
ATOM   2276  C CB    . THR A  1 295 ? -42.849 -3.809  1.473   1.00 26.68  ? 357 THR A CB    1 
ATOM   2277  O OG1   . THR A  1 295 ? -43.346 -3.982  2.803   1.00 27.71  ? 357 THR A OG1   1 
ATOM   2278  C CG2   . THR A  1 295 ? -43.756 -4.538  0.488   1.00 27.66  ? 357 THR A CG2   1 
ATOM   2279  N N     . ILE A  1 296 ? -40.166 -2.499  2.186   1.00 27.73  ? 358 ILE A N     1 
ATOM   2280  C CA    . ILE A  1 296 ? -39.534 -1.673  3.174   1.00 30.21  ? 358 ILE A CA    1 
ATOM   2281  C C     . ILE A  1 296 ? -40.044 -0.257  2.953   1.00 31.54  ? 358 ILE A C     1 
ATOM   2282  O O     . ILE A  1 296 ? -40.007 0.267   1.837   1.00 30.39  ? 358 ILE A O     1 
ATOM   2283  C CB    . ILE A  1 296 ? -37.998 -1.750  3.103   1.00 32.32  ? 358 ILE A CB    1 
ATOM   2284  C CG1   . ILE A  1 296 ? -37.377 -0.403  3.435   1.00 33.14  ? 358 ILE A CG1   1 
ATOM   2285  C CG2   . ILE A  1 296 ? -37.506 -2.135  1.727   1.00 33.06  ? 358 ILE A CG2   1 
ATOM   2286  C CD1   . ILE A  1 296 ? -35.899 -0.515  3.668   1.00 34.70  ? 358 ILE A CD1   1 
ATOM   2287  N N     . SER A  1 297 ? -40.565 0.342   4.014   1.00 32.97  ? 359 SER A N     1 
ATOM   2288  C CA    . SER A  1 297 ? -41.125 1.671   3.924   1.00 34.15  ? 359 SER A CA    1 
ATOM   2289  C C     . SER A  1 297 ? -40.427 2.505   4.937   1.00 36.27  ? 359 SER A C     1 
ATOM   2290  O O     . SER A  1 297 ? -39.981 1.979   5.941   1.00 38.51  ? 359 SER A O     1 
ATOM   2291  C CB    . SER A  1 297 ? -42.620 1.631   4.196   1.00 33.24  ? 359 SER A CB    1 
ATOM   2292  O OG    . SER A  1 297 ? -42.924 0.517   5.000   1.00 34.19  ? 359 SER A OG    1 
ATOM   2293  N N     . MET A  1 298 ? -40.308 3.798   4.663   1.00 40.02  ? 360 MET A N     1 
ATOM   2294  C CA    . MET A  1 298 ? -39.823 4.742   5.657   1.00 42.62  ? 360 MET A CA    1 
ATOM   2295  C C     . MET A  1 298 ? -40.511 6.100   5.560   1.00 40.76  ? 360 MET A C     1 
ATOM   2296  O O     . MET A  1 298 ? -40.891 6.547   4.483   1.00 38.97  ? 360 MET A O     1 
ATOM   2297  C CB    . MET A  1 298 ? -38.293 4.880   5.611   1.00 46.91  ? 360 MET A CB    1 
ATOM   2298  C CG    . MET A  1 298 ? -37.635 4.748   4.234   1.00 52.41  ? 360 MET A CG    1 
ATOM   2299  S SD    . MET A  1 298 ? -35.920 5.391   4.118   1.00 56.29  ? 360 MET A SD    1 
ATOM   2300  C CE    . MET A  1 298 ? -36.335 7.149   4.279   1.00 54.80  ? 360 MET A CE    1 
ATOM   2301  N N     . LYS A  1 299 ? -40.703 6.709   6.723   1.00 40.59  ? 361 LYS A N     1 
ATOM   2302  C CA    . LYS A  1 299 ? -41.208 8.056   6.845   1.00 42.42  ? 361 LYS A CA    1 
ATOM   2303  C C     . LYS A  1 299 ? -40.183 8.794   7.662   1.00 40.13  ? 361 LYS A C     1 
ATOM   2304  O O     . LYS A  1 299 ? -39.387 8.165   8.356   1.00 38.78  ? 361 LYS A O     1 
ATOM   2305  C CB    . LYS A  1 299 ? -42.539 8.088   7.622   1.00 48.01  ? 361 LYS A CB    1 
ATOM   2306  C CG    . LYS A  1 299 ? -43.563 7.017   7.251   1.00 55.81  ? 361 LYS A CG    1 
ATOM   2307  C CD    . LYS A  1 299 ? -44.996 7.435   7.612   1.00 60.60  ? 361 LYS A CD    1 
ATOM   2308  C CE    . LYS A  1 299 ? -45.164 7.759   9.087   1.00 61.25  ? 361 LYS A CE    1 
ATOM   2309  N NZ    . LYS A  1 299 ? -44.719 6.604   9.909   1.00 63.19  ? 361 LYS A NZ    1 
ATOM   2310  N N     . PRO A  1 300 ? -40.204 10.131  7.607   1.00 39.42  ? 362 PRO A N     1 
ATOM   2311  C CA    . PRO A  1 300 ? -39.763 10.873  8.788   1.00 40.41  ? 362 PRO A CA    1 
ATOM   2312  C C     . PRO A  1 300 ? -40.639 10.534  9.976   1.00 41.08  ? 362 PRO A C     1 
ATOM   2313  O O     . PRO A  1 300 ? -41.857 10.353  9.819   1.00 42.51  ? 362 PRO A O     1 
ATOM   2314  C CB    . PRO A  1 300 ? -39.991 12.332  8.395   1.00 40.99  ? 362 PRO A CB    1 
ATOM   2315  C CG    . PRO A  1 300 ? -39.863 12.330  6.904   1.00 41.42  ? 362 PRO A CG    1 
ATOM   2316  C CD    . PRO A  1 300 ? -40.483 11.024  6.473   1.00 40.27  ? 362 PRO A CD    1 
ATOM   2317  N N     . ASN A  1 301 ? -40.036 10.449  11.153  1.00 41.73  ? 363 ASN A N     1 
ATOM   2318  C CA    . ASN A  1 301 ? -40.802 10.231  12.361  1.00 44.20  ? 363 ASN A CA    1 
ATOM   2319  C C     . ASN A  1 301 ? -41.747 11.415  12.575  1.00 46.76  ? 363 ASN A C     1 
ATOM   2320  O O     . ASN A  1 301 ? -41.401 12.588  12.328  1.00 45.33  ? 363 ASN A O     1 
ATOM   2321  C CB    . ASN A  1 301 ? -39.872 10.038  13.558  1.00 43.01  ? 363 ASN A CB    1 
ATOM   2322  C CG    . ASN A  1 301 ? -40.608 10.033  14.863  1.00 42.30  ? 363 ASN A CG    1 
ATOM   2323  O OD1   . ASN A  1 301 ? -40.639 11.038  15.562  1.00 40.98  ? 363 ASN A OD1   1 
ATOM   2324  N ND2   . ASN A  1 301 ? -41.246 8.918   15.184  1.00 43.63  ? 363 ASN A ND2   1 
ATOM   2325  N N     . ALA A  1 302 ? -42.957 11.098  13.016  1.00 48.14  ? 364 ALA A N     1 
ATOM   2326  C CA    . ALA A  1 302 ? -43.928 12.122  13.273  1.00 48.82  ? 364 ALA A CA    1 
ATOM   2327  C C     . ALA A  1 302 ? -43.298 13.214  14.193  1.00 48.26  ? 364 ALA A C     1 
ATOM   2328  O O     . ALA A  1 302 ? -43.233 14.382  13.808  1.00 45.42  ? 364 ALA A O     1 
ATOM   2329  C CB    . ALA A  1 302 ? -45.187 11.493  13.877  1.00 50.51  ? 364 ALA A CB    1 
ATOM   2330  N N     . LYS A  1 303 ? -42.808 12.821  15.373  1.00 49.41  ? 365 LYS A N     1 
ATOM   2331  C CA    . LYS A  1 303 ? -42.470 13.776  16.446  1.00 51.87  ? 365 LYS A CA    1 
ATOM   2332  C C     . LYS A  1 303 ? -41.169 14.502  16.241  1.00 51.88  ? 365 LYS A C     1 
ATOM   2333  O O     . LYS A  1 303 ? -40.986 15.592  16.764  1.00 52.41  ? 365 LYS A O     1 
ATOM   2334  C CB    . LYS A  1 303 ? -42.516 13.117  17.838  1.00 53.54  ? 365 LYS A CB    1 
ATOM   2335  C CG    . LYS A  1 303 ? -43.916 12.620  18.180  1.00 60.51  ? 365 LYS A CG    1 
ATOM   2336  C CD    . LYS A  1 303 ? -44.109 12.228  19.633  1.00 64.26  ? 365 LYS A CD    1 
ATOM   2337  C CE    . LYS A  1 303 ? -45.588 11.932  19.917  1.00 68.56  ? 365 LYS A CE    1 
ATOM   2338  N NZ    . LYS A  1 303 ? -45.796 11.680  21.367  1.00 71.22  ? 365 LYS A NZ    1 
ATOM   2339  N N     . ASN A  1 304 ? -40.263 13.898  15.490  1.00 55.42  ? 366 ASN A N     1 
ATOM   2340  C CA    . ASN A  1 304 ? -39.048 14.588  15.057  1.00 54.48  ? 366 ASN A CA    1 
ATOM   2341  C C     . ASN A  1 304 ? -38.739 14.267  13.587  1.00 57.00  ? 366 ASN A C     1 
ATOM   2342  O O     . ASN A  1 304 ? -38.515 13.106  13.232  1.00 57.38  ? 366 ASN A O     1 
ATOM   2343  C CB    . ASN A  1 304 ? -37.879 14.218  15.962  1.00 49.56  ? 366 ASN A CB    1 
ATOM   2344  C CG    . ASN A  1 304 ? -36.589 14.849  15.519  1.00 49.20  ? 366 ASN A CG    1 
ATOM   2345  O OD1   . ASN A  1 304 ? -36.572 15.791  14.732  1.00 50.43  ? 366 ASN A OD1   1 
ATOM   2346  N ND2   . ASN A  1 304 ? -35.494 14.324  16.009  1.00 51.29  ? 366 ASN A ND2   1 
ATOM   2347  N N     . VAL A  1 305 ? -38.748 15.305  12.744  1.00 57.99  ? 367 VAL A N     1 
ATOM   2348  C CA    . VAL A  1 305 ? -38.610 15.150  11.283  1.00 57.92  ? 367 VAL A CA    1 
ATOM   2349  C C     . VAL A  1 305 ? -37.220 14.632  10.855  1.00 52.49  ? 367 VAL A C     1 
ATOM   2350  O O     . VAL A  1 305 ? -37.076 14.052  9.772   1.00 52.62  ? 367 VAL A O     1 
ATOM   2351  C CB    . VAL A  1 305 ? -39.065 16.442  10.532  1.00 58.51  ? 367 VAL A CB    1 
ATOM   2352  C CG1   . VAL A  1 305 ? -38.896 16.322  9.018   1.00 56.03  ? 367 VAL A CG1   1 
ATOM   2353  C CG2   . VAL A  1 305 ? -40.543 16.720  10.840  1.00 62.24  ? 367 VAL A CG2   1 
ATOM   2354  N N     . ARG A  1 306 ? -36.234 14.760  11.735  1.00 47.09  ? 368 ARG A N     1 
ATOM   2355  C CA    . ARG A  1 306 ? -34.873 14.262  11.463  1.00 46.53  ? 368 ARG A CA    1 
ATOM   2356  C C     . ARG A  1 306 ? -34.637 12.736  11.579  1.00 43.95  ? 368 ARG A C     1 
ATOM   2357  O O     . ARG A  1 306 ? -33.844 12.175  10.839  1.00 40.09  ? 368 ARG A O     1 
ATOM   2358  C CB    . ARG A  1 306 ? -33.896 14.985  12.371  1.00 47.20  ? 368 ARG A CB    1 
ATOM   2359  C CG    . ARG A  1 306 ? -34.007 16.487  12.210  1.00 49.03  ? 368 ARG A CG    1 
ATOM   2360  C CD    . ARG A  1 306 ? -32.656 17.149  12.015  1.00 50.98  ? 368 ARG A CD    1 
ATOM   2361  N NE    . ARG A  1 306 ? -32.670 18.041  10.851  1.00 51.32  ? 368 ARG A NE    1 
ATOM   2362  C CZ    . ARG A  1 306 ? -33.191 19.263  10.845  1.00 52.15  ? 368 ARG A CZ    1 
ATOM   2363  N NH1   . ARG A  1 306 ? -33.762 19.765  11.943  1.00 55.90  ? 368 ARG A NH1   1 
ATOM   2364  N NH2   . ARG A  1 306 ? -33.149 19.995  9.744   1.00 49.16  ? 368 ARG A NH2   1 
ATOM   2365  N N     . ASP A  1 307 ? -35.321 12.082  12.513  1.00 43.25  ? 369 ASP A N     1 
ATOM   2366  C CA    . ASP A  1 307 ? -35.227 10.624  12.707  1.00 40.57  ? 369 ASP A CA    1 
ATOM   2367  C C     . ASP A  1 307 ? -36.067 9.902   11.682  1.00 39.07  ? 369 ASP A C     1 
ATOM   2368  O O     . ASP A  1 307 ? -36.965 10.504  11.091  1.00 39.32  ? 369 ASP A O     1 
ATOM   2369  C CB    . ASP A  1 307 ? -35.707 10.269  14.107  1.00 40.62  ? 369 ASP A CB    1 
ATOM   2370  C CG    . ASP A  1 307 ? -34.814 10.849  15.184  1.00 40.26  ? 369 ASP A CG    1 
ATOM   2371  O OD1   . ASP A  1 307 ? -33.771 11.470  14.880  1.00 39.43  ? 369 ASP A OD1   1 
ATOM   2372  O OD2   . ASP A  1 307 ? -35.180 10.704  16.356  1.00 41.89  ? 369 ASP A OD2   1 
ATOM   2373  N N     . LEU A  1 308 ? -35.800 8.611   11.494  1.00 39.00  ? 370 LEU A N     1 
ATOM   2374  C CA    . LEU A  1 308 ? -36.486 7.804   10.454  1.00 39.71  ? 370 LEU A CA    1 
ATOM   2375  C C     . LEU A  1 308 ? -37.187 6.556   10.958  1.00 37.66  ? 370 LEU A C     1 
ATOM   2376  O O     . LEU A  1 308 ? -36.573 5.707   11.594  1.00 36.20  ? 370 LEU A O     1 
ATOM   2377  C CB    . LEU A  1 308 ? -35.492 7.313   9.412   1.00 41.16  ? 370 LEU A CB    1 
ATOM   2378  C CG    . LEU A  1 308 ? -34.795 8.331   8.517   1.00 43.37  ? 370 LEU A CG    1 
ATOM   2379  C CD1   . LEU A  1 308 ? -33.737 7.637   7.665   1.00 42.32  ? 370 LEU A CD1   1 
ATOM   2380  C CD2   . LEU A  1 308 ? -35.838 9.032   7.649   1.00 44.99  ? 370 LEU A CD2   1 
ATOM   2381  N N     . ASP A  1 309 ? -38.461 6.419   10.635  1.00 35.83  ? 371 ASP A N     1 
ATOM   2382  C CA    . ASP A  1 309 ? -39.157 5.214   10.986  1.00 36.53  ? 371 ASP A CA    1 
ATOM   2383  C C     . ASP A  1 309 ? -39.069 4.313   9.779   1.00 34.57  ? 371 ASP A C     1 
ATOM   2384  O O     . ASP A  1 309 ? -39.224 4.780   8.669   1.00 32.87  ? 371 ASP A O     1 
ATOM   2385  C CB    . ASP A  1 309 ? -40.616 5.500   11.351  1.00 38.65  ? 371 ASP A CB    1 
ATOM   2386  C CG    . ASP A  1 309 ? -40.767 6.275   12.657  1.00 40.65  ? 371 ASP A CG    1 
ATOM   2387  O OD1   . ASP A  1 309 ? -39.757 6.588   13.351  1.00 39.47  ? 371 ASP A OD1   1 
ATOM   2388  O OD2   . ASP A  1 309 ? -41.942 6.565   12.985  1.00 43.08  ? 371 ASP A OD2   1 
ATOM   2389  N N     . PHE A  1 310 ? -38.806 3.029   10.017  1.00 34.84  ? 372 PHE A N     1 
ATOM   2390  C CA    . PHE A  1 310 ? -38.889 1.976   8.997   1.00 34.82  ? 372 PHE A CA    1 
ATOM   2391  C C     . PHE A  1 310 ? -39.900 0.876   9.346   1.00 33.06  ? 372 PHE A C     1 
ATOM   2392  O O     . PHE A  1 310 ? -40.187 0.614   10.515  1.00 33.51  ? 372 PHE A O     1 
ATOM   2393  C CB    . PHE A  1 310 ? -37.550 1.270   8.859   1.00 36.63  ? 372 PHE A CB    1 
ATOM   2394  C CG    . PHE A  1 310 ? -36.446 2.141   8.362   1.00 38.49  ? 372 PHE A CG    1 
ATOM   2395  C CD1   . PHE A  1 310 ? -35.731 2.955   9.237   1.00 38.73  ? 372 PHE A CD1   1 
ATOM   2396  C CD2   . PHE A  1 310 ? -36.100 2.128   7.021   1.00 39.88  ? 372 PHE A CD2   1 
ATOM   2397  C CE1   . PHE A  1 310 ? -34.696 3.750   8.776   1.00 38.74  ? 372 PHE A CE1   1 
ATOM   2398  C CE2   . PHE A  1 310 ? -35.070 2.931   6.552   1.00 40.60  ? 372 PHE A CE2   1 
ATOM   2399  C CZ    . PHE A  1 310 ? -34.364 3.738   7.435   1.00 39.34  ? 372 PHE A CZ    1 
ATOM   2400  N N     . THR A  1 311 ? -40.402 0.205   8.326   1.00 30.78  ? 373 THR A N     1 
ATOM   2401  C CA    . THR A  1 311 ? -41.129 -1.027  8.531   1.00 31.00  ? 373 THR A CA    1 
ATOM   2402  C C     . THR A  1 311 ? -40.714 -1.994  7.435   1.00 30.11  ? 373 THR A C     1 
ATOM   2403  O O     . THR A  1 311 ? -40.950 -1.748  6.247   1.00 31.08  ? 373 THR A O     1 
ATOM   2404  C CB    . THR A  1 311 ? -42.657 -0.817  8.536   1.00 32.18  ? 373 THR A CB    1 
ATOM   2405  O OG1   . THR A  1 311 ? -43.030 -0.103  9.720   1.00 33.09  ? 373 THR A OG1   1 
ATOM   2406  C CG2   . THR A  1 311 ? -43.407 -2.168  8.503   1.00 32.11  ? 373 THR A CG2   1 
ATOM   2407  N N     . VAL A  1 312 ? -40.073 -3.081  7.836   1.00 28.05  ? 374 VAL A N     1 
ATOM   2408  C CA    . VAL A  1 312 ? -39.651 -4.069  6.894   1.00 27.84  ? 374 VAL A CA    1 
ATOM   2409  C C     . VAL A  1 312 ? -40.595 -5.221  7.024   1.00 27.71  ? 374 VAL A C     1 
ATOM   2410  O O     . VAL A  1 312 ? -40.673 -5.821  8.066   1.00 27.34  ? 374 VAL A O     1 
ATOM   2411  C CB    . VAL A  1 312 ? -38.218 -4.533  7.177   1.00 28.15  ? 374 VAL A CB    1 
ATOM   2412  C CG1   . VAL A  1 312 ? -37.820 -5.623  6.200   1.00 29.09  ? 374 VAL A CG1   1 
ATOM   2413  C CG2   . VAL A  1 312 ? -37.253 -3.367  7.040   1.00 28.62  ? 374 VAL A CG2   1 
ATOM   2414  N N     . ASP A  1 313 ? -41.344 -5.510  5.978   1.00 29.45  ? 375 ASP A N     1 
ATOM   2415  C CA    . ASP A  1 313 ? -42.128 -6.730  5.942   1.00 31.65  ? 375 ASP A CA    1 
ATOM   2416  C C     . ASP A  1 313 ? -41.330 -7.733  5.147   1.00 32.01  ? 375 ASP A C     1 
ATOM   2417  O O     . ASP A  1 313 ? -40.821 -7.396  4.072   1.00 34.24  ? 375 ASP A O     1 
ATOM   2418  C CB    . ASP A  1 313 ? -43.485 -6.488  5.283   1.00 32.58  ? 375 ASP A CB    1 
ATOM   2419  C CG    . ASP A  1 313 ? -44.400 -5.573  6.108   1.00 33.50  ? 375 ASP A CG    1 
ATOM   2420  O OD1   . ASP A  1 313 ? -43.995 -5.065  7.179   1.00 33.83  ? 375 ASP A OD1   1 
ATOM   2421  O OD2   . ASP A  1 313 ? -45.549 -5.375  5.670   1.00 34.67  ? 375 ASP A OD2   1 
ATOM   2422  N N     . LEU A  1 314 ? -41.199 -8.952  5.656   1.00 30.53  ? 376 LEU A N     1 
ATOM   2423  C CA    . LEU A  1 314 ? -40.308 -9.897  5.019   1.00 30.60  ? 376 LEU A CA    1 
ATOM   2424  C C     . LEU A  1 314 ? -40.929 -11.259 4.923   1.00 29.25  ? 376 LEU A C     1 
ATOM   2425  O O     . LEU A  1 314 ? -41.310 -11.815 5.934   1.00 28.64  ? 376 LEU A O     1 
ATOM   2426  C CB    . LEU A  1 314 ? -38.993 -9.981  5.798   1.00 31.69  ? 376 LEU A CB    1 
ATOM   2427  C CG    . LEU A  1 314 ? -37.940 -10.932 5.183   1.00 32.95  ? 376 LEU A CG    1 
ATOM   2428  C CD1   . LEU A  1 314 ? -36.522 -10.395 5.383   1.00 32.92  ? 376 LEU A CD1   1 
ATOM   2429  C CD2   . LEU A  1 314 ? -38.053 -12.360 5.712   1.00 32.55  ? 376 LEU A CD2   1 
ATOM   2430  N N     . ASP A  1 315 ? -40.963 -11.809 3.710   1.00 28.93  ? 377 ASP A N     1 
ATOM   2431  C CA    . ASP A  1 315 ? -41.579 -13.112 3.426   1.00 28.91  ? 377 ASP A CA    1 
ATOM   2432  C C     . ASP A  1 315 ? -40.557 -14.031 2.811   1.00 26.92  ? 377 ASP A C     1 
ATOM   2433  O O     . ASP A  1 315 ? -39.921 -13.671 1.843   1.00 27.13  ? 377 ASP A O     1 
ATOM   2434  C CB    . ASP A  1 315 ? -42.729 -12.955 2.418   1.00 29.69  ? 377 ASP A CB    1 
ATOM   2435  C CG    . ASP A  1 315 ? -44.055 -12.647 3.076   1.00 30.79  ? 377 ASP A CG    1 
ATOM   2436  O OD1   . ASP A  1 315 ? -44.147 -11.704 3.866   1.00 32.51  ? 377 ASP A OD1   1 
ATOM   2437  O OD2   . ASP A  1 315 ? -45.029 -13.358 2.810   1.00 33.07  ? 377 ASP A OD2   1 
ATOM   2438  N N     . PHE A  1 316 ? -40.408 -15.226 3.338   1.00 25.67  ? 378 PHE A N     1 
ATOM   2439  C CA    . PHE A  1 316 ? -39.473 -16.164 2.753   1.00 26.25  ? 378 PHE A CA    1 
ATOM   2440  C C     . PHE A  1 316 ? -40.052 -17.546 2.893   1.00 28.86  ? 378 PHE A C     1 
ATOM   2441  O O     . PHE A  1 316 ? -40.401 -17.943 4.004   1.00 30.87  ? 378 PHE A O     1 
ATOM   2442  C CB    . PHE A  1 316 ? -38.139 -16.107 3.492   1.00 24.90  ? 378 PHE A CB    1 
ATOM   2443  C CG    . PHE A  1 316 ? -37.141 -17.109 3.016   1.00 23.97  ? 378 PHE A CG    1 
ATOM   2444  C CD1   . PHE A  1 316 ? -36.476 -16.914 1.815   1.00 24.95  ? 378 PHE A CD1   1 
ATOM   2445  C CD2   . PHE A  1 316 ? -36.839 -18.232 3.763   1.00 23.55  ? 378 PHE A CD2   1 
ATOM   2446  C CE1   . PHE A  1 316 ? -35.535 -17.826 1.352   1.00 24.49  ? 378 PHE A CE1   1 
ATOM   2447  C CE2   . PHE A  1 316 ? -35.899 -19.146 3.315   1.00 23.96  ? 378 PHE A CE2   1 
ATOM   2448  C CZ    . PHE A  1 316 ? -35.251 -18.949 2.105   1.00 24.35  ? 378 PHE A CZ    1 
ATOM   2449  N N     . LYS A  1 317 ? -40.161 -18.269 1.780   1.00 30.71  ? 379 LYS A N     1 
ATOM   2450  C CA    . LYS A  1 317 ? -40.572 -19.664 1.801   1.00 31.99  ? 379 LYS A CA    1 
ATOM   2451  C C     . LYS A  1 317 ? -39.510 -20.491 1.144   1.00 32.39  ? 379 LYS A C     1 
ATOM   2452  O O     . LYS A  1 317 ? -39.569 -20.739 -0.046  1.00 33.37  ? 379 LYS A O     1 
ATOM   2453  C CB    . LYS A  1 317 ? -41.915 -19.865 1.095   1.00 34.47  ? 379 LYS A CB    1 
ATOM   2454  C CG    . LYS A  1 317 ? -42.346 -21.336 0.963   1.00 38.16  ? 379 LYS A CG    1 
ATOM   2455  C CD    . LYS A  1 317 ? -43.733 -21.628 1.567   1.00 41.64  ? 379 LYS A CD    1 
ATOM   2456  C CE    . LYS A  1 317 ? -44.893 -20.864 0.896   1.00 43.12  ? 379 LYS A CE    1 
ATOM   2457  N NZ    . LYS A  1 317 ? -45.486 -21.576 -0.266  1.00 42.69  ? 379 LYS A NZ    1 
ATOM   2458  N N     . GLY A  1 318 ? -38.524 -20.902 1.926   1.00 33.86  ? 380 GLY A N     1 
ATOM   2459  C CA    . GLY A  1 318 ? -37.482 -21.810 1.445   1.00 36.33  ? 380 GLY A CA    1 
ATOM   2460  C C     . GLY A  1 318 ? -37.741 -23.238 1.910   1.00 37.09  ? 380 GLY A C     1 
ATOM   2461  O O     . GLY A  1 318 ? -38.677 -23.505 2.676   1.00 36.68  ? 380 GLY A O     1 
ATOM   2462  N N     . GLN A  1 319 ? -36.899 -24.153 1.443   1.00 35.75  ? 381 GLN A N     1 
ATOM   2463  C CA    . GLN A  1 319 ? -37.071 -25.561 1.712   1.00 36.06  ? 381 GLN A CA    1 
ATOM   2464  C C     . GLN A  1 319 ? -36.713 -25.855 3.153   1.00 34.52  ? 381 GLN A C     1 
ATOM   2465  O O     . GLN A  1 319 ? -37.139 -26.851 3.680   1.00 32.35  ? 381 GLN A O     1 
ATOM   2466  C CB    . GLN A  1 319 ? -36.179 -26.369 0.770   1.00 39.82  ? 381 GLN A CB    1 
ATOM   2467  C CG    . GLN A  1 319 ? -36.538 -27.837 0.622   1.00 43.20  ? 381 GLN A CG    1 
ATOM   2468  C CD    . GLN A  1 319 ? -35.575 -28.548 -0.311  1.00 48.07  ? 381 GLN A CD    1 
ATOM   2469  O OE1   . GLN A  1 319 ? -35.789 -28.611 -1.531  1.00 49.40  ? 381 GLN A OE1   1 
ATOM   2470  N NE2   . GLN A  1 319 ? -34.470 -29.044 0.251   1.00 51.68  ? 381 GLN A NE2   1 
ATOM   2471  N N     . LEU A  1 320 ? -35.910 -24.991 3.771   1.00 35.94  ? 382 LEU A N     1 
ATOM   2472  C CA    . LEU A  1 320 ? -35.405 -25.218 5.122   1.00 37.27  ? 382 LEU A CA    1 
ATOM   2473  C C     . LEU A  1 320 ? -36.027 -24.313 6.188   1.00 38.25  ? 382 LEU A C     1 
ATOM   2474  O O     . LEU A  1 320 ? -35.896 -24.568 7.375   1.00 42.74  ? 382 LEU A O     1 
ATOM   2475  C CB    . LEU A  1 320 ? -33.883 -25.052 5.144   1.00 37.65  ? 382 LEU A CB    1 
ATOM   2476  C CG    . LEU A  1 320 ? -33.107 -25.951 4.185   1.00 38.86  ? 382 LEU A CG    1 
ATOM   2477  C CD1   . LEU A  1 320 ? -31.588 -25.796 4.345   1.00 39.12  ? 382 LEU A CD1   1 
ATOM   2478  C CD2   . LEU A  1 320 ? -33.525 -27.406 4.333   1.00 38.73  ? 382 LEU A CD2   1 
ATOM   2479  N N     . CYS A  1 321 ? -36.668 -23.234 5.799   1.00 37.01  ? 383 CYS A N     1 
ATOM   2480  C CA    . CYS A  1 321 ? -37.461 -22.502 6.766   1.00 38.03  ? 383 CYS A CA    1 
ATOM   2481  C C     . CYS A  1 321 ? -38.463 -21.655 6.018   1.00 38.80  ? 383 CYS A C     1 
ATOM   2482  O O     . CYS A  1 321 ? -38.434 -21.565 4.783   1.00 36.48  ? 383 CYS A O     1 
ATOM   2483  C CB    . CYS A  1 321 ? -36.598 -21.640 7.706   1.00 39.22  ? 383 CYS A CB    1 
ATOM   2484  S SG    . CYS A  1 321 ? -36.265 -19.924 7.189   1.00 41.45  ? 383 CYS A SG    1 
ATOM   2485  N N     . GLU A  1 322 ? -39.351 -21.036 6.780   1.00 39.95  ? 384 GLU A N     1 
ATOM   2486  C CA    . GLU A  1 322 ? -40.442 -20.268 6.216   1.00 40.14  ? 384 GLU A CA    1 
ATOM   2487  C C     . GLU A  1 322 ? -40.890 -19.251 7.230   1.00 37.10  ? 384 GLU A C     1 
ATOM   2488  O O     . GLU A  1 322 ? -41.305 -19.624 8.307   1.00 38.55  ? 384 GLU A O     1 
ATOM   2489  C CB    . GLU A  1 322 ? -41.585 -21.233 5.882   1.00 44.56  ? 384 GLU A CB    1 
ATOM   2490  C CG    . GLU A  1 322 ? -42.984 -20.622 5.828   1.00 49.33  ? 384 GLU A CG    1 
ATOM   2491  C CD    . GLU A  1 322 ? -44.038 -21.603 5.340   1.00 53.16  ? 384 GLU A CD    1 
ATOM   2492  O OE1   . GLU A  1 322 ? -43.808 -22.832 5.451   1.00 56.85  ? 384 GLU A OE1   1 
ATOM   2493  O OE2   . GLU A  1 322 ? -45.087 -21.139 4.830   1.00 55.12  ? 384 GLU A OE2   1 
ATOM   2494  N N     . THR A  1 323 ? -40.774 -17.971 6.939   1.00 35.07  ? 385 THR A N     1 
ATOM   2495  C CA    . THR A  1 323 ? -41.421 -17.006 7.812   1.00 37.06  ? 385 THR A CA    1 
ATOM   2496  C C     . THR A  1 323 ? -42.041 -15.914 6.989   1.00 35.37  ? 385 THR A C     1 
ATOM   2497  O O     . THR A  1 323 ? -41.764 -15.768 5.794   1.00 36.49  ? 385 THR A O     1 
ATOM   2498  C CB    . THR A  1 323 ? -40.481 -16.354 8.866   1.00 39.91  ? 385 THR A CB    1 
ATOM   2499  O OG1   . THR A  1 323 ? -39.357 -15.761 8.199   1.00 43.56  ? 385 THR A OG1   1 
ATOM   2500  C CG2   . THR A  1 323 ? -40.006 -17.374 9.965   1.00 40.35  ? 385 THR A CG2   1 
ATOM   2501  N N     . SER A  1 324 ? -42.907 -15.170 7.655   1.00 32.59  ? 386 SER A N     1 
ATOM   2502  C CA    . SER A  1 324 ? -43.413 -13.931 7.146   1.00 31.10  ? 386 SER A CA    1 
ATOM   2503  C C     . SER A  1 324 ? -43.611 -13.012 8.337   1.00 31.58  ? 386 SER A C     1 
ATOM   2504  O O     . SER A  1 324 ? -44.358 -13.310 9.233   1.00 30.63  ? 386 SER A O     1 
ATOM   2505  C CB    . SER A  1 324 ? -44.709 -14.143 6.392   1.00 30.15  ? 386 SER A CB    1 
ATOM   2506  O OG    . SER A  1 324 ? -45.667 -13.216 6.856   1.00 29.84  ? 386 SER A OG    1 
ATOM   2507  N N     . VAL A  1 325 ? -42.913 -11.886 8.324   1.00 35.01  ? 387 VAL A N     1 
ATOM   2508  C CA    . VAL A  1 325 ? -42.693 -11.055 9.508   1.00 33.81  ? 387 VAL A CA    1 
ATOM   2509  C C     . VAL A  1 325 ? -42.906 -9.582  9.150   1.00 32.77  ? 387 VAL A C     1 
ATOM   2510  O O     . VAL A  1 325 ? -42.838 -9.177  7.978   1.00 31.19  ? 387 VAL A O     1 
ATOM   2511  C CB    . VAL A  1 325 ? -41.242 -11.253 10.046  1.00 33.73  ? 387 VAL A CB    1 
ATOM   2512  C CG1   . VAL A  1 325 ? -41.110 -10.747 11.475  1.00 34.47  ? 387 VAL A CG1   1 
ATOM   2513  C CG2   . VAL A  1 325 ? -40.831 -12.729 9.983   1.00 34.29  ? 387 VAL A CG2   1 
ATOM   2514  N N     . SER A  1 326 ? -43.181 -8.795  10.173  1.00 32.40  ? 388 SER A N     1 
ATOM   2515  C CA    . SER A  1 326 ? -43.220 -7.364  10.039  1.00 32.92  ? 388 SER A CA    1 
ATOM   2516  C C     . SER A  1 326 ? -42.532 -6.741  11.246  1.00 33.95  ? 388 SER A C     1 
ATOM   2517  O O     . SER A  1 326 ? -43.024 -6.826  12.372  1.00 34.99  ? 388 SER A O     1 
ATOM   2518  C CB    . SER A  1 326 ? -44.658 -6.897  9.954   1.00 33.12  ? 388 SER A CB    1 
ATOM   2519  O OG    . SER A  1 326 ? -44.687 -5.501  9.786   1.00 34.30  ? 388 SER A OG    1 
ATOM   2520  N N     . ASN A  1 327 ? -41.379 -6.131  10.999  1.00 35.98  ? 389 ASN A N     1 
ATOM   2521  C CA    . ASN A  1 327 ? -40.528 -5.546  12.044  1.00 36.79  ? 389 ASN A CA    1 
ATOM   2522  C C     . ASN A  1 327 ? -40.534 -4.042  11.904  1.00 34.61  ? 389 ASN A C     1 
ATOM   2523  O O     . ASN A  1 327 ? -40.593 -3.535  10.794  1.00 35.18  ? 389 ASN A O     1 
ATOM   2524  C CB    . ASN A  1 327 ? -39.074 -6.041  11.909  1.00 37.94  ? 389 ASN A CB    1 
ATOM   2525  C CG    . ASN A  1 327 ? -38.929 -7.543  12.119  1.00 39.12  ? 389 ASN A CG    1 
ATOM   2526  O OD1   . ASN A  1 327 ? -39.809 -8.209  12.681  1.00 38.34  ? 389 ASN A OD1   1 
ATOM   2527  N ND2   . ASN A  1 327 ? -37.798 -8.088  11.656  1.00 40.26  ? 389 ASN A ND2   1 
ATOM   2528  N N     . ASP A  1 328 ? -40.454 -3.333  13.021  1.00 34.48  ? 390 ASP A N     1 
ATOM   2529  C CA    . ASP A  1 328 ? -40.287 -1.875  13.006  1.00 34.28  ? 390 ASP A CA    1 
ATOM   2530  C C     . ASP A  1 328 ? -38.845 -1.524  13.416  1.00 32.39  ? 390 ASP A C     1 
ATOM   2531  O O     . ASP A  1 328 ? -38.214 -2.303  14.138  1.00 33.86  ? 390 ASP A O     1 
ATOM   2532  C CB    . ASP A  1 328 ? -41.322 -1.234  13.929  1.00 35.13  ? 390 ASP A CB    1 
ATOM   2533  C CG    . ASP A  1 328 ? -42.758 -1.350  13.383  1.00 36.09  ? 390 ASP A CG    1 
ATOM   2534  O OD1   . ASP A  1 328 ? -43.002 -1.607  12.177  1.00 33.85  ? 390 ASP A OD1   1 
ATOM   2535  O OD2   . ASP A  1 328 ? -43.669 -1.176  14.195  1.00 40.27  ? 390 ASP A OD2   1 
ATOM   2536  N N     . TYR A  1 329 ? -38.310 -0.418  12.890  1.00 28.78  ? 391 TYR A N     1 
ATOM   2537  C CA    . TYR A  1 329 ? -36.990 0.071   13.266  1.00 27.90  ? 391 TYR A CA    1 
ATOM   2538  C C     . TYR A  1 329 ? -37.028 1.570   13.334  1.00 29.45  ? 391 TYR A C     1 
ATOM   2539  O O     . TYR A  1 329 ? -37.807 2.188   12.626  1.00 30.38  ? 391 TYR A O     1 
ATOM   2540  C CB    . TYR A  1 329 ? -35.937 -0.289  12.229  1.00 27.83  ? 391 TYR A CB    1 
ATOM   2541  C CG    . TYR A  1 329 ? -35.769 -1.764  11.937  1.00 27.27  ? 391 TYR A CG    1 
ATOM   2542  C CD1   . TYR A  1 329 ? -36.604 -2.422  11.043  1.00 26.36  ? 391 TYR A CD1   1 
ATOM   2543  C CD2   . TYR A  1 329 ? -34.742 -2.494  12.522  1.00 27.25  ? 391 TYR A CD2   1 
ATOM   2544  C CE1   . TYR A  1 329 ? -36.443 -3.767  10.774  1.00 25.23  ? 391 TYR A CE1   1 
ATOM   2545  C CE2   . TYR A  1 329 ? -34.578 -3.840  12.254  1.00 26.05  ? 391 TYR A CE2   1 
ATOM   2546  C CZ    . TYR A  1 329 ? -35.431 -4.460  11.383  1.00 25.15  ? 391 TYR A CZ    1 
ATOM   2547  O OH    . TYR A  1 329 ? -35.255 -5.783  11.130  1.00 25.39  ? 391 TYR A OH    1 
ATOM   2548  N N     . LYS A  1 330 ? -36.175 2.166   14.159  1.00 31.90  ? 392 LYS A N     1 
ATOM   2549  C CA    . LYS A  1 330 ? -36.101 3.630   14.275  1.00 35.08  ? 392 LYS A CA    1 
ATOM   2550  C C     . LYS A  1 330 ? -34.637 4.056   14.248  1.00 34.76  ? 392 LYS A C     1 
ATOM   2551  O O     . LYS A  1 330 ? -33.802 3.483   14.942  1.00 31.58  ? 392 LYS A O     1 
ATOM   2552  C CB    . LYS A  1 330 ? -36.806 4.156   15.554  1.00 37.43  ? 392 LYS A CB    1 
ATOM   2553  C CG    . LYS A  1 330 ? -38.337 4.108   15.507  1.00 42.66  ? 392 LYS A CG    1 
ATOM   2554  C CD    . LYS A  1 330 ? -38.996 4.138   16.894  1.00 47.31  ? 392 LYS A CD    1 
ATOM   2555  C CE    . LYS A  1 330 ? -38.817 5.468   17.614  1.00 49.00  ? 392 LYS A CE    1 
ATOM   2556  N NZ    . LYS A  1 330 ? -39.586 6.572   16.969  1.00 49.11  ? 392 LYS A NZ    1 
ATOM   2557  N N     . MET A  1 331 ? -34.335 5.079   13.461  1.00 37.17  ? 393 MET A N     1 
ATOM   2558  C CA    . MET A  1 331 ? -32.970 5.547   13.366  1.00 41.35  ? 393 MET A CA    1 
ATOM   2559  C C     . MET A  1 331 ? -32.668 6.687   14.307  1.00 43.74  ? 393 MET A C     1 
ATOM   2560  O O     . MET A  1 331 ? -33.251 7.779   14.206  1.00 37.78  ? 393 MET A O     1 
ATOM   2561  C CB    . MET A  1 331 ? -32.570 5.928   11.935  1.00 43.98  ? 393 MET A CB    1 
ATOM   2562  C CG    . MET A  1 331 ? -31.843 4.794   11.200  1.00 45.12  ? 393 MET A CG    1 
ATOM   2563  S SD    . MET A  1 331 ? -30.620 5.222   9.927   1.00 46.26  ? 393 MET A SD    1 
ATOM   2564  C CE    . MET A  1 331 ? -29.550 6.312   10.846  1.00 47.53  ? 393 MET A CE    1 
ATOM   2565  N N     . ARG A  1 332 ? -31.763 6.347   15.238  1.00 52.89  ? 394 ARG A N     1 
ATOM   2566  C CA    . ARG A  1 332 ? -30.901 7.267   16.020  1.00 55.91  ? 394 ARG A CA    1 
ATOM   2567  C C     . ARG A  1 332 ? -31.730 8.346   16.700  1.00 52.24  ? 394 ARG A C     1 
ATOM   2568  O O     . ARG A  1 332 ? -32.923 8.125   16.940  1.00 49.51  ? 394 ARG A O     1 
ATOM   2569  C CB    . ARG A  1 332 ? -29.739 7.866   15.147  1.00 60.01  ? 394 ARG A CB    1 
ATOM   2570  C CG    . ARG A  1 332 ? -28.479 6.997   14.905  1.00 58.80  ? 394 ARG A CG    1 
ATOM   2571  C CD    . ARG A  1 332 ? -27.394 7.316   15.922  1.00 58.16  ? 394 ARG A CD    1 
ATOM   2572  N NE    . ARG A  1 332 ? -27.915 7.152   17.301  1.00 62.90  ? 394 ARG A NE    1 
ATOM   2573  C CZ    . ARG A  1 332 ? -27.561 7.865   18.382  1.00 59.38  ? 394 ARG A CZ    1 
ATOM   2574  N NH1   . ARG A  1 332 ? -26.658 8.842   18.297  1.00 60.74  ? 394 ARG A NH1   1 
ATOM   2575  N NH2   . ARG A  1 332 ? -28.118 7.602   19.566  1.00 50.42  ? 394 ARG A NH2   1 
ATOM   2576  O OXT   . ARG A  1 332 ? -31.228 9.420   17.030  1.00 51.10  ? 394 ARG A OXT   1 
ATOM   2577  N N     . SER B  1 17  ? -29.916 11.668  27.516  1.00 30.72  ? 79  SER B N     1 
ATOM   2578  C CA    . SER B  1 17  ? -28.748 11.086  26.752  1.00 31.35  ? 79  SER B CA    1 
ATOM   2579  C C     . SER B  1 17  ? -28.077 9.829   27.367  1.00 33.25  ? 79  SER B C     1 
ATOM   2580  O O     . SER B  1 17  ? -27.469 9.032   26.672  1.00 32.46  ? 79  SER B O     1 
ATOM   2581  C CB    . SER B  1 17  ? -27.660 12.121  26.579  1.00 31.18  ? 79  SER B CB    1 
ATOM   2582  O OG    . SER B  1 17  ? -26.654 11.891  27.542  1.00 30.18  ? 79  SER B OG    1 
ATOM   2583  N N     . TYR B  1 18  ? -28.162 9.669   28.676  1.00 35.92  ? 80  TYR B N     1 
ATOM   2584  C CA    . TYR B  1 18  ? -27.938 8.355   29.281  1.00 37.36  ? 80  TYR B CA    1 
ATOM   2585  C C     . TYR B  1 18  ? -29.136 7.401   29.071  1.00 39.39  ? 80  TYR B C     1 
ATOM   2586  O O     . TYR B  1 18  ? -29.123 6.274   29.566  1.00 36.37  ? 80  TYR B O     1 
ATOM   2587  C CB    . TYR B  1 18  ? -27.645 8.503   30.774  1.00 37.99  ? 80  TYR B CB    1 
ATOM   2588  C CG    . TYR B  1 18  ? -26.196 8.829   31.072  1.00 39.10  ? 80  TYR B CG    1 
ATOM   2589  C CD1   . TYR B  1 18  ? -25.227 7.841   31.016  1.00 40.05  ? 80  TYR B CD1   1 
ATOM   2590  C CD2   . TYR B  1 18  ? -25.791 10.124  31.408  1.00 40.28  ? 80  TYR B CD2   1 
ATOM   2591  C CE1   . TYR B  1 18  ? -23.898 8.119   31.278  1.00 39.84  ? 80  TYR B CE1   1 
ATOM   2592  C CE2   . TYR B  1 18  ? -24.458 10.412  31.684  1.00 39.91  ? 80  TYR B CE2   1 
ATOM   2593  C CZ    . TYR B  1 18  ? -23.522 9.400   31.613  1.00 39.69  ? 80  TYR B CZ    1 
ATOM   2594  O OH    . TYR B  1 18  ? -22.211 9.652   31.875  1.00 40.30  ? 80  TYR B OH    1 
ATOM   2595  N N     . ALA B  1 19  ? -30.171 7.862   28.354  1.00 42.12  ? 81  ALA B N     1 
ATOM   2596  C CA    . ALA B  1 19  ? -31.351 7.050   28.063  1.00 43.20  ? 81  ALA B CA    1 
ATOM   2597  C C     . ALA B  1 19  ? -31.057 5.923   27.068  1.00 44.08  ? 81  ALA B C     1 
ATOM   2598  O O     . ALA B  1 19  ? -31.749 4.894   27.043  1.00 48.74  ? 81  ALA B O     1 
ATOM   2599  C CB    . ALA B  1 19  ? -32.490 7.930   27.538  1.00 42.73  ? 81  ALA B CB    1 
ATOM   2600  N N     . HIS B  1 20  ? -30.029 6.109   26.254  1.00 40.52  ? 82  HIS B N     1 
ATOM   2601  C CA    . HIS B  1 20  ? -29.785 5.226   25.140  1.00 36.04  ? 82  HIS B CA    1 
ATOM   2602  C C     . HIS B  1 20  ? -29.088 3.932   25.557  1.00 32.17  ? 82  HIS B C     1 
ATOM   2603  O O     . HIS B  1 20  ? -28.042 3.983   26.192  1.00 31.48  ? 82  HIS B O     1 
ATOM   2604  C CB    . HIS B  1 20  ? -28.920 5.980   24.154  1.00 36.84  ? 82  HIS B CB    1 
ATOM   2605  C CG    . HIS B  1 20  ? -28.736 5.253   22.875  1.00 38.76  ? 82  HIS B CG    1 
ATOM   2606  N ND1   . HIS B  1 20  ? -29.791 4.666   22.216  1.00 40.00  ? 82  HIS B ND1   1 
ATOM   2607  C CD2   . HIS B  1 20  ? -27.630 4.980   22.147  1.00 39.43  ? 82  HIS B CD2   1 
ATOM   2608  C CE1   . HIS B  1 20  ? -29.350 4.083   21.121  1.00 40.08  ? 82  HIS B CE1   1 
ATOM   2609  N NE2   . HIS B  1 20  ? -28.045 4.263   21.051  1.00 41.05  ? 82  HIS B NE2   1 
ATOM   2610  N N     A PHE B  1 21  ? -29.625 2.774   25.187  0.50 28.17  ? 83  PHE B N     1 
ATOM   2611  C CA    A PHE B  1 21  ? -29.034 1.506   25.641  0.50 25.97  ? 83  PHE B CA    1 
ATOM   2612  C C     A PHE B  1 21  ? -27.521 1.417   25.454  0.50 26.93  ? 83  PHE B C     1 
ATOM   2613  O O     A PHE B  1 21  ? -26.838 0.688   26.153  0.50 25.96  ? 83  PHE B O     1 
ATOM   2614  C CB    A PHE B  1 21  ? -29.669 0.350   24.905  0.50 23.67  ? 83  PHE B CB    1 
ATOM   2615  C CG    A PHE B  1 21  ? -29.347 0.320   23.453  0.50 21.51  ? 83  PHE B CG    1 
ATOM   2616  C CD1   A PHE B  1 21  ? -28.134 -0.143  23.017  0.50 20.75  ? 83  PHE B CD1   1 
ATOM   2617  C CD2   A PHE B  1 21  ? -30.267 0.732   22.528  0.50 20.66  ? 83  PHE B CD2   1 
ATOM   2618  C CE1   A PHE B  1 21  ? -27.831 -0.190  21.673  0.50 19.97  ? 83  PHE B CE1   1 
ATOM   2619  C CE2   A PHE B  1 21  ? -29.978 0.687   21.184  0.50 20.15  ? 83  PHE B CE2   1 
ATOM   2620  C CZ    A PHE B  1 21  ? -28.757 0.226   20.754  0.50 19.63  ? 83  PHE B CZ    1 
ATOM   2621  N N     . GLY B  1 22  ? -27.009 2.178   24.506  1.00 28.80  ? 84  GLY B N     1 
ATOM   2622  C CA    . GLY B  1 22  ? -25.648 2.011   24.012  1.00 31.78  ? 84  GLY B CA    1 
ATOM   2623  C C     . GLY B  1 22  ? -24.468 2.634   24.746  1.00 34.49  ? 84  GLY B C     1 
ATOM   2624  O O     . GLY B  1 22  ? -23.332 2.137   24.697  1.00 34.05  ? 84  GLY B O     1 
ATOM   2625  N N     . ILE B  1 23  ? -24.698 3.751   25.406  1.00 37.38  ? 85  ILE B N     1 
ATOM   2626  C CA    . ILE B  1 23  ? -23.651 4.295   26.268  1.00 37.41  ? 85  ILE B CA    1 
ATOM   2627  C C     . ILE B  1 23  ? -23.408 3.311   27.444  1.00 35.30  ? 85  ILE B C     1 
ATOM   2628  O O     . ILE B  1 23  ? -22.276 3.148   27.889  1.00 32.76  ? 85  ILE B O     1 
ATOM   2629  C CB    . ILE B  1 23  ? -24.007 5.739   26.726  1.00 38.79  ? 85  ILE B CB    1 
ATOM   2630  C CG1   . ILE B  1 23  ? -22.752 6.539   27.083  1.00 39.94  ? 85  ILE B CG1   1 
ATOM   2631  C CG2   . ILE B  1 23  ? -25.030 5.750   27.855  1.00 39.32  ? 85  ILE B CG2   1 
ATOM   2632  C CD1   . ILE B  1 23  ? -21.769 5.872   28.038  1.00 39.79  ? 85  ILE B CD1   1 
ATOM   2633  N N     . HIS B  1 24  ? -24.479 2.648   27.911  1.00 34.22  ? 86  HIS B N     1 
ATOM   2634  C CA    . HIS B  1 24  ? -24.404 1.636   28.990  1.00 33.01  ? 86  HIS B CA    1 
ATOM   2635  C C     . HIS B  1 24  ? -23.720 0.371   28.520  1.00 30.63  ? 86  HIS B C     1 
ATOM   2636  O O     . HIS B  1 24  ? -22.948 -0.233  29.252  1.00 28.29  ? 86  HIS B O     1 
ATOM   2637  C CB    . HIS B  1 24  ? -25.805 1.310   29.562  1.00 33.79  ? 86  HIS B CB    1 
ATOM   2638  C CG    . HIS B  1 24  ? -26.376 2.415   30.400  1.00 32.87  ? 86  HIS B CG    1 
ATOM   2639  N ND1   . HIS B  1 24  ? -27.096 3.457   29.859  1.00 31.53  ? 86  HIS B ND1   1 
ATOM   2640  C CD2   . HIS B  1 24  ? -26.285 2.668   31.726  1.00 33.13  ? 86  HIS B CD2   1 
ATOM   2641  C CE1   . HIS B  1 24  ? -27.429 4.302   30.813  1.00 32.07  ? 86  HIS B CE1   1 
ATOM   2642  N NE2   . HIS B  1 24  ? -26.955 3.844   31.957  1.00 33.73  ? 86  HIS B NE2   1 
ATOM   2643  N N     . GLU B  1 25  ? -24.003 -0.011  27.284  1.00 30.59  ? 87  GLU B N     1 
ATOM   2644  C CA    . GLU B  1 25  ? -23.273 -1.099  26.634  1.00 30.85  ? 87  GLU B CA    1 
ATOM   2645  C C     . GLU B  1 25  ? -21.776 -0.894  26.773  1.00 29.76  ? 87  GLU B C     1 
ATOM   2646  O O     . GLU B  1 25  ? -21.060 -1.792  27.200  1.00 27.85  ? 87  GLU B O     1 
ATOM   2647  C CB    . GLU B  1 25  ? -23.641 -1.170  25.148  1.00 31.27  ? 87  GLU B CB    1 
ATOM   2648  C CG    . GLU B  1 25  ? -23.085 -2.363  24.392  1.00 29.78  ? 87  GLU B CG    1 
ATOM   2649  C CD    . GLU B  1 25  ? -23.661 -2.473  22.996  1.00 29.63  ? 87  GLU B CD    1 
ATOM   2650  O OE1   . GLU B  1 25  ? -24.650 -1.771  22.648  1.00 28.43  ? 87  GLU B OE1   1 
ATOM   2651  O OE2   . GLU B  1 25  ? -23.121 -3.294  22.238  1.00 30.90  ? 87  GLU B OE2   1 
ATOM   2652  N N     . GLU B  1 26  ? -21.313 0.302   26.424  1.00 29.80  ? 88  GLU B N     1 
ATOM   2653  C CA    . GLU B  1 26  ? -19.884 0.600   26.522  1.00 31.05  ? 88  GLU B CA    1 
ATOM   2654  C C     . GLU B  1 26  ? -19.394 0.436   27.950  1.00 30.61  ? 88  GLU B C     1 
ATOM   2655  O O     . GLU B  1 26  ? -18.349 -0.171  28.180  1.00 30.58  ? 88  GLU B O     1 
ATOM   2656  C CB    . GLU B  1 26  ? -19.542 2.025   26.034  1.00 31.93  ? 88  GLU B CB    1 
ATOM   2657  C CG    . GLU B  1 26  ? -18.045 2.258   25.777  1.00 32.02  ? 88  GLU B CG    1 
ATOM   2658  C CD    . GLU B  1 26  ? -17.670 3.728   25.573  1.00 32.76  ? 88  GLU B CD    1 
ATOM   2659  O OE1   . GLU B  1 26  ? -16.469 4.064   25.587  1.00 34.36  ? 88  GLU B OE1   1 
ATOM   2660  O OE2   . GLU B  1 26  ? -18.567 4.565   25.392  1.00 32.28  ? 88  GLU B OE2   1 
ATOM   2661  N N     . MET B  1 27  ? -20.141 0.997   28.898  1.00 30.87  ? 89  MET B N     1 
ATOM   2662  C CA    . MET B  1 27  ? -19.746 0.968   30.297  1.00 31.49  ? 89  MET B CA    1 
ATOM   2663  C C     . MET B  1 27  ? -19.731 -0.448  30.806  1.00 30.88  ? 89  MET B C     1 
ATOM   2664  O O     . MET B  1 27  ? -18.824 -0.834  31.537  1.00 31.66  ? 89  MET B O     1 
ATOM   2665  C CB    . MET B  1 27  ? -20.721 1.758   31.151  1.00 33.91  ? 89  MET B CB    1 
ATOM   2666  C CG    . MET B  1 27  ? -20.640 3.266   30.997  1.00 34.97  ? 89  MET B CG    1 
ATOM   2667  S SD    . MET B  1 27  ? -21.888 4.149   31.973  1.00 34.20  ? 89  MET B SD    1 
ATOM   2668  C CE    . MET B  1 27  ? -20.859 5.621   32.227  1.00 37.12  ? 89  MET B CE    1 
ATOM   2669  N N     . LEU B  1 28  ? -20.746 -1.217  30.423  1.00 29.67  ? 90  LEU B N     1 
ATOM   2670  C CA    . LEU B  1 28  ? -20.868 -2.591  30.882  1.00 29.19  ? 90  LEU B CA    1 
ATOM   2671  C C     . LEU B  1 28  ? -19.769 -3.466  30.313  1.00 28.78  ? 90  LEU B C     1 
ATOM   2672  O O     . LEU B  1 28  ? -19.194 -4.257  31.036  1.00 28.63  ? 90  LEU B O     1 
ATOM   2673  C CB    . LEU B  1 28  ? -22.252 -3.146  30.534  1.00 29.36  ? 90  LEU B CB    1 
ATOM   2674  C CG    . LEU B  1 28  ? -23.368 -2.533  31.387  1.00 29.85  ? 90  LEU B CG    1 
ATOM   2675  C CD1   . LEU B  1 28  ? -24.723 -2.677  30.730  1.00 29.61  ? 90  LEU B CD1   1 
ATOM   2676  C CD2   . LEU B  1 28  ? -23.397 -3.130  32.782  1.00 30.41  ? 90  LEU B CD2   1 
ATOM   2677  N N     . LYS B  1 29  ? -19.467 -3.300  29.027  1.00 29.83  ? 91  LYS B N     1 
ATOM   2678  C CA    . LYS B  1 29  ? -18.454 -4.122  28.345  1.00 30.43  ? 91  LYS B CA    1 
ATOM   2679  C C     . LYS B  1 29  ? -17.028 -3.840  28.822  1.00 28.93  ? 91  LYS B C     1 
ATOM   2680  O O     . LYS B  1 29  ? -16.135 -4.662  28.602  1.00 29.38  ? 91  LYS B O     1 
ATOM   2681  C CB    . LYS B  1 29  ? -18.545 -3.956  26.825  1.00 32.00  ? 91  LYS B CB    1 
ATOM   2682  C CG    . LYS B  1 29  ? -19.735 -4.676  26.225  1.00 34.82  ? 91  LYS B CG    1 
ATOM   2683  C CD    . LYS B  1 29  ? -19.820 -4.554  24.708  1.00 36.10  ? 91  LYS B CD    1 
ATOM   2684  C CE    . LYS B  1 29  ? -20.867 -5.509  24.130  1.00 36.32  ? 91  LYS B CE    1 
ATOM   2685  N NZ    . LYS B  1 29  ? -21.222 -5.133  22.737  1.00 36.90  ? 91  LYS B NZ    1 
ATOM   2686  N N     . ASP B  1 30  ? -16.822 -2.695  29.471  1.00 26.19  ? 92  ASP B N     1 
ATOM   2687  C CA    . ASP B  1 30  ? -15.566 -2.411  30.136  1.00 24.74  ? 92  ASP B CA    1 
ATOM   2688  C C     . ASP B  1 30  ? -15.458 -3.348  31.310  1.00 24.03  ? 92  ASP B C     1 
ATOM   2689  O O     . ASP B  1 30  ? -15.982 -3.057  32.386  1.00 23.65  ? 92  ASP B O     1 
ATOM   2690  C CB    . ASP B  1 30  ? -15.539 -0.962  30.619  1.00 25.16  ? 92  ASP B CB    1 
ATOM   2691  C CG    . ASP B  1 30  ? -14.239 -0.587  31.322  1.00 25.36  ? 92  ASP B CG    1 
ATOM   2692  O OD1   . ASP B  1 30  ? -13.444 -1.495  31.691  1.00 27.03  ? 92  ASP B OD1   1 
ATOM   2693  O OD2   . ASP B  1 30  ? -14.038 0.633   31.521  1.00 23.87  ? 92  ASP B OD2   1 
ATOM   2694  N N     . GLU B  1 31  ? -14.780 -4.475  31.102  1.00 23.93  ? 93  GLU B N     1 
ATOM   2695  C CA    . GLU B  1 31  ? -14.662 -5.517  32.145  1.00 23.17  ? 93  GLU B CA    1 
ATOM   2696  C C     . GLU B  1 31  ? -13.851 -5.064  33.365  1.00 21.33  ? 93  GLU B C     1 
ATOM   2697  O O     . GLU B  1 31  ? -14.141 -5.483  34.497  1.00 19.17  ? 93  GLU B O     1 
ATOM   2698  C CB    . GLU B  1 31  ? -14.078 -6.813  31.565  1.00 23.73  ? 93  GLU B CB    1 
ATOM   2699  C CG    . GLU B  1 31  ? -15.001 -7.464  30.555  1.00 24.85  ? 93  GLU B CG    1 
ATOM   2700  C CD    . GLU B  1 31  ? -14.479 -8.790  30.056  1.00 26.19  ? 93  GLU B CD    1 
ATOM   2701  O OE1   . GLU B  1 31  ? -14.633 -9.063  28.829  1.00 26.33  ? 93  GLU B OE1   1 
ATOM   2702  O OE2   . GLU B  1 31  ? -13.925 -9.552  30.888  1.00 25.82  ? 93  GLU B OE2   1 
ATOM   2703  N N     . VAL B  1 32  ? -12.855 -4.206  33.138  1.00 20.29  ? 94  VAL B N     1 
ATOM   2704  C CA    . VAL B  1 32  ? -12.026 -3.730  34.230  1.00 20.88  ? 94  VAL B CA    1 
ATOM   2705  C C     . VAL B  1 32  ? -12.902 -2.984  35.223  1.00 21.46  ? 94  VAL B C     1 
ATOM   2706  O O     . VAL B  1 32  ? -12.852 -3.231  36.439  1.00 20.87  ? 94  VAL B O     1 
ATOM   2707  C CB    . VAL B  1 32  ? -10.887 -2.802  33.761  1.00 21.31  ? 94  VAL B CB    1 
ATOM   2708  C CG1   . VAL B  1 32  ? -10.203 -2.141  34.957  1.00 21.33  ? 94  VAL B CG1   1 
ATOM   2709  C CG2   . VAL B  1 32  ? -9.846  -3.567  32.947  1.00 21.59  ? 94  VAL B CG2   1 
ATOM   2710  N N     . ARG B  1 33  ? -13.702 -2.065  34.692  1.00 21.28  ? 95  ARG B N     1 
ATOM   2711  C CA    . ARG B  1 33  ? -14.572 -1.257  35.522  1.00 21.20  ? 95  ARG B CA    1 
ATOM   2712  C C     . ARG B  1 33  ? -15.596 -2.110  36.236  1.00 20.59  ? 95  ARG B C     1 
ATOM   2713  O O     . ARG B  1 33  ? -15.612 -2.164  37.450  1.00 19.74  ? 95  ARG B O     1 
ATOM   2714  C CB    . ARG B  1 33  ? -15.282 -0.242  34.653  1.00 22.43  ? 95  ARG B CB    1 
ATOM   2715  C CG    . ARG B  1 33  ? -16.204 0.704   35.399  1.00 22.82  ? 95  ARG B CG    1 
ATOM   2716  C CD    . ARG B  1 33  ? -17.172 1.288   34.411  1.00 23.40  ? 95  ARG B CD    1 
ATOM   2717  N NE    . ARG B  1 33  ? -18.244 0.323   34.239  1.00 24.32  ? 95  ARG B NE    1 
ATOM   2718  C CZ    . ARG B  1 33  ? -19.487 0.521   34.650  1.00 25.80  ? 95  ARG B CZ    1 
ATOM   2719  N NH1   . ARG B  1 33  ? -19.807 1.683   35.209  1.00 26.80  ? 95  ARG B NH1   1 
ATOM   2720  N NH2   . ARG B  1 33  ? -20.416 -0.426  34.487  1.00 25.51  ? 95  ARG B NH2   1 
ATOM   2721  N N     . THR B  1 34  ? -16.433 -2.793  35.460  1.00 21.16  ? 96  THR B N     1 
ATOM   2722  C CA    . THR B  1 34  ? -17.575 -3.554  35.989  1.00 21.57  ? 96  THR B CA    1 
ATOM   2723  C C     . THR B  1 34  ? -17.157 -4.720  36.907  1.00 21.69  ? 96  THR B C     1 
ATOM   2724  O O     . THR B  1 34  ? -17.763 -4.936  37.942  1.00 21.97  ? 96  THR B O     1 
ATOM   2725  C CB    . THR B  1 34  ? -18.467 -4.131  34.845  1.00 21.39  ? 96  THR B CB    1 
ATOM   2726  O OG1   . THR B  1 34  ? -18.703 -3.142  33.837  1.00 20.93  ? 96  THR B OG1   1 
ATOM   2727  C CG2   . THR B  1 34  ? -19.793 -4.598  35.395  1.00 21.40  ? 96  THR B CG2   1 
ATOM   2728  N N     . LEU B  1 35  ? -16.140 -5.481  36.519  1.00 22.38  ? 97  LEU B N     1 
ATOM   2729  C CA    . LEU B  1 35  ? -15.700 -6.595  37.344  1.00 22.81  ? 97  LEU B CA    1 
ATOM   2730  C C     . LEU B  1 35  ? -15.101 -6.122  38.651  1.00 22.72  ? 97  LEU B C     1 
ATOM   2731  O O     . LEU B  1 35  ? -15.266 -6.788  39.673  1.00 22.90  ? 97  LEU B O     1 
ATOM   2732  C CB    . LEU B  1 35  ? -14.675 -7.479  36.625  1.00 23.26  ? 97  LEU B CB    1 
ATOM   2733  C CG    . LEU B  1 35  ? -15.201 -8.524  35.650  1.00 23.19  ? 97  LEU B CG    1 
ATOM   2734  C CD1   . LEU B  1 35  ? -14.070 -9.361  35.090  1.00 22.47  ? 97  LEU B CD1   1 
ATOM   2735  C CD2   . LEU B  1 35  ? -16.213 -9.408  36.345  1.00 23.76  ? 97  LEU B CD2   1 
ATOM   2736  N N     . THR B  1 36  ? -14.393 -4.992  38.628  1.00 22.18  ? 98  THR B N     1 
ATOM   2737  C CA    . THR B  1 36  ? -13.817 -4.483  39.863  1.00 22.16  ? 98  THR B CA    1 
ATOM   2738  C C     . THR B  1 36  ? -14.975 -4.164  40.803  1.00 22.90  ? 98  THR B C     1 
ATOM   2739  O O     . THR B  1 36  ? -15.009 -4.659  41.918  1.00 23.08  ? 98  THR B O     1 
ATOM   2740  C CB    . THR B  1 36  ? -12.894 -3.260  39.658  1.00 22.09  ? 98  THR B CB    1 
ATOM   2741  O OG1   . THR B  1 36  ? -11.711 -3.630  38.944  1.00 20.47  ? 98  THR B OG1   1 
ATOM   2742  C CG2   . THR B  1 36  ? -12.451 -2.715  40.993  1.00 22.92  ? 98  THR B CG2   1 
ATOM   2743  N N     . TYR B  1 37  ? -15.946 -3.381  40.340  1.00 23.72  ? 99  TYR B N     1 
ATOM   2744  C CA    . TYR B  1 37  ? -17.144 -3.087  41.150  1.00 24.61  ? 99  TYR B CA    1 
ATOM   2745  C C     . TYR B  1 37  ? -17.809 -4.356  41.638  1.00 25.41  ? 99  TYR B C     1 
ATOM   2746  O O     . TYR B  1 37  ? -18.229 -4.433  42.785  1.00 26.97  ? 99  TYR B O     1 
ATOM   2747  C CB    . TYR B  1 37  ? -18.196 -2.263  40.380  1.00 24.22  ? 99  TYR B CB    1 
ATOM   2748  C CG    . TYR B  1 37  ? -17.996 -0.774  40.480  1.00 22.81  ? 99  TYR B CG    1 
ATOM   2749  C CD1   . TYR B  1 37  ? -17.163 -0.112  39.591  1.00 22.47  ? 99  TYR B CD1   1 
ATOM   2750  C CD2   . TYR B  1 37  ? -18.634 -0.040  41.454  1.00 22.48  ? 99  TYR B CD2   1 
ATOM   2751  C CE1   . TYR B  1 37  ? -16.975 1.252   39.659  1.00 22.59  ? 99  TYR B CE1   1 
ATOM   2752  C CE2   . TYR B  1 37  ? -18.456 1.330   41.540  1.00 22.83  ? 99  TYR B CE2   1 
ATOM   2753  C CZ    . TYR B  1 37  ? -17.619 1.975   40.637  1.00 22.62  ? 99  TYR B CZ    1 
ATOM   2754  O OH    . TYR B  1 37  ? -17.411 3.335   40.694  1.00 21.47  ? 99  TYR B OH    1 
ATOM   2755  N N     . ARG B  1 38  ? -17.925 -5.355  40.782  1.00 26.37  ? 100 ARG B N     1 
ATOM   2756  C CA    . ARG B  1 38  ? -18.582 -6.574  41.227  1.00 29.10  ? 100 ARG B CA    1 
ATOM   2757  C C     . ARG B  1 38  ? -17.810 -7.300  42.324  1.00 28.73  ? 100 ARG B C     1 
ATOM   2758  O O     . ARG B  1 38  ? -18.382 -7.667  43.341  1.00 27.52  ? 100 ARG B O     1 
ATOM   2759  C CB    . ARG B  1 38  ? -18.846 -7.543  40.081  1.00 30.90  ? 100 ARG B CB    1 
ATOM   2760  C CG    . ARG B  1 38  ? -19.882 -8.590  40.484  1.00 31.60  ? 100 ARG B CG    1 
ATOM   2761  C CD    . ARG B  1 38  ? -19.928 -9.730  39.507  1.00 32.06  ? 100 ARG B CD    1 
ATOM   2762  N NE    . ARG B  1 38  ? -18.625 -10.369 39.421  1.00 30.58  ? 100 ARG B NE    1 
ATOM   2763  C CZ    . ARG B  1 38  ? -18.336 -11.296 38.526  1.00 29.62  ? 100 ARG B CZ    1 
ATOM   2764  N NH1   . ARG B  1 38  ? -19.271 -11.700 37.654  1.00 29.47  ? 100 ARG B NH1   1 
ATOM   2765  N NH2   . ARG B  1 38  ? -17.113 -11.813 38.501  1.00 28.99  ? 100 ARG B NH2   1 
ATOM   2766  N N     . ASN B  1 39  ? -16.513 -7.494  42.110  1.00 29.17  ? 101 ASN B N     1 
ATOM   2767  C CA    . ASN B  1 39  ? -15.662 -8.162  43.098  1.00 28.27  ? 101 ASN B CA    1 
ATOM   2768  C C     . ASN B  1 39  ? -15.686 -7.433  44.425  1.00 28.20  ? 101 ASN B C     1 
ATOM   2769  O O     . ASN B  1 39  ? -15.686 -8.059  45.472  1.00 27.23  ? 101 ASN B O     1 
ATOM   2770  C CB    . ASN B  1 39  ? -14.218 -8.223  42.615  1.00 27.48  ? 101 ASN B CB    1 
ATOM   2771  C CG    . ASN B  1 39  ? -14.016 -9.137  41.429  1.00 26.32  ? 101 ASN B CG    1 
ATOM   2772  O OD1   . ASN B  1 39  ? -12.904 -9.226  40.942  1.00 25.40  ? 101 ASN B OD1   1 
ATOM   2773  N ND2   . ASN B  1 39  ? -15.068 -9.803  40.947  1.00 26.27  ? 101 ASN B ND2   1 
ATOM   2774  N N     . SER B  1 40  ? -15.722 -6.104  44.371  1.00 29.05  ? 102 SER B N     1 
ATOM   2775  C CA    . SER B  1 40  ? -15.695 -5.290  45.587  1.00 30.63  ? 102 SER B CA    1 
ATOM   2776  C C     . SER B  1 40  ? -16.834 -5.690  46.528  1.00 30.57  ? 102 SER B C     1 
ATOM   2777  O O     . SER B  1 40  ? -16.685 -5.666  47.756  1.00 29.37  ? 102 SER B O     1 
ATOM   2778  C CB    . SER B  1 40  ? -15.739 -3.782  45.253  1.00 30.98  ? 102 SER B CB    1 
ATOM   2779  O OG    . SER B  1 40  ? -17.035 -3.385  44.849  1.00 32.31  ? 102 SER B OG    1 
ATOM   2780  N N     . MET B  1 41  ? -17.958 -6.079  45.930  1.00 30.65  ? 103 MET B N     1 
ATOM   2781  C CA    . MET B  1 41  ? -19.136 -6.461  46.678  1.00 29.63  ? 103 MET B CA    1 
ATOM   2782  C C     . MET B  1 41  ? -19.180 -7.958  46.910  1.00 29.21  ? 103 MET B C     1 
ATOM   2783  O O     . MET B  1 41  ? -19.283 -8.367  48.039  1.00 30.39  ? 103 MET B O     1 
ATOM   2784  C CB    . MET B  1 41  ? -20.378 -5.967  45.956  1.00 29.73  ? 103 MET B CB    1 
ATOM   2785  C CG    . MET B  1 41  ? -20.276 -4.496  45.553  1.00 29.21  ? 103 MET B CG    1 
ATOM   2786  S SD    . MET B  1 41  ? -21.859 -3.820  45.035  1.00 29.68  ? 103 MET B SD    1 
ATOM   2787  C CE    . MET B  1 41  ? -21.376 -2.601  43.833  1.00 29.33  ? 103 MET B CE    1 
ATOM   2788  N N     . TYR B  1 42  ? -19.040 -8.767  45.865  1.00 30.21  ? 104 TYR B N     1 
ATOM   2789  C CA    . TYR B  1 42  ? -19.112 -10.243 45.986  1.00 31.67  ? 104 TYR B CA    1 
ATOM   2790  C C     . TYR B  1 42  ? -18.024 -10.836 46.884  1.00 32.39  ? 104 TYR B C     1 
ATOM   2791  O O     . TYR B  1 42  ? -18.290 -11.781 47.624  1.00 33.10  ? 104 TYR B O     1 
ATOM   2792  C CB    . TYR B  1 42  ? -19.043 -10.947 44.609  1.00 32.33  ? 104 TYR B CB    1 
ATOM   2793  C CG    . TYR B  1 42  ? -20.313 -10.890 43.745  1.00 32.74  ? 104 TYR B CG    1 
ATOM   2794  C CD1   . TYR B  1 42  ? -21.292 -9.899  43.939  1.00 33.18  ? 104 TYR B CD1   1 
ATOM   2795  C CD2   . TYR B  1 42  ? -20.499 -11.789 42.698  1.00 32.64  ? 104 TYR B CD2   1 
ATOM   2796  C CE1   . TYR B  1 42  ? -22.416 -9.825  43.128  1.00 32.94  ? 104 TYR B CE1   1 
ATOM   2797  C CE2   . TYR B  1 42  ? -21.626 -11.731 41.894  1.00 33.13  ? 104 TYR B CE2   1 
ATOM   2798  C CZ    . TYR B  1 42  ? -22.577 -10.744 42.108  1.00 33.94  ? 104 TYR B CZ    1 
ATOM   2799  O OH    . TYR B  1 42  ? -23.692 -10.668 41.302  1.00 34.75  ? 104 TYR B OH    1 
ATOM   2800  N N     . HIS B  1 43  ? -16.805 -10.295 46.820  1.00 32.58  ? 105 HIS B N     1 
ATOM   2801  C CA    . HIS B  1 43  ? -15.715 -10.738 47.721  1.00 31.94  ? 105 HIS B CA    1 
ATOM   2802  C C     . HIS B  1 43  ? -15.816 -10.158 49.144  1.00 32.30  ? 105 HIS B C     1 
ATOM   2803  O O     . HIS B  1 43  ? -15.011 -10.501 50.009  1.00 31.78  ? 105 HIS B O     1 
ATOM   2804  C CB    . HIS B  1 43  ? -14.353 -10.347 47.163  1.00 30.49  ? 105 HIS B CB    1 
ATOM   2805  C CG    . HIS B  1 43  ? -14.039 -10.962 45.849  1.00 28.95  ? 105 HIS B CG    1 
ATOM   2806  N ND1   . HIS B  1 43  ? -12.821 -10.793 45.235  1.00 29.08  ? 105 HIS B ND1   1 
ATOM   2807  C CD2   . HIS B  1 43  ? -14.774 -11.742 45.029  1.00 28.55  ? 105 HIS B CD2   1 
ATOM   2808  C CE1   . HIS B  1 43  ? -12.823 -11.437 44.084  1.00 29.81  ? 105 HIS B CE1   1 
ATOM   2809  N NE2   . HIS B  1 43  ? -13.995 -12.022 43.935  1.00 28.77  ? 105 HIS B NE2   1 
ATOM   2810  N N     . ASN B  1 44  ? -16.758 -9.253  49.377  1.00 32.34  ? 106 ASN B N     1 
ATOM   2811  C CA    . ASN B  1 44  ? -16.888 -8.642  50.674  1.00 33.78  ? 106 ASN B CA    1 
ATOM   2812  C C     . ASN B  1 44  ? -18.340 -8.620  51.121  1.00 35.61  ? 106 ASN B C     1 
ATOM   2813  O O     . ASN B  1 44  ? -18.892 -7.587  51.523  1.00 32.88  ? 106 ASN B O     1 
ATOM   2814  C CB    . ASN B  1 44  ? -16.265 -7.241  50.663  1.00 34.67  ? 106 ASN B CB    1 
ATOM   2815  C CG    . ASN B  1 44  ? -14.840 -7.236  50.132  1.00 34.05  ? 106 ASN B CG    1 
ATOM   2816  O OD1   . ASN B  1 44  ? -14.537 -6.555  49.172  1.00 34.18  ? 106 ASN B OD1   1 
ATOM   2817  N ND2   . ASN B  1 44  ? -13.969 -8.015  50.752  1.00 34.65  ? 106 ASN B ND2   1 
ATOM   2818  N N     . LYS B  1 45  ? -18.949 -9.798  51.064  1.00 40.87  ? 107 LYS B N     1 
ATOM   2819  C CA    . LYS B  1 45  ? -20.340 -9.972  51.498  1.00 45.35  ? 107 LYS B CA    1 
ATOM   2820  C C     . LYS B  1 45  ? -20.559 -9.616  52.962  1.00 42.94  ? 107 LYS B C     1 
ATOM   2821  O O     . LYS B  1 45  ? -21.653 -9.223  53.341  1.00 46.36  ? 107 LYS B O     1 
ATOM   2822  C CB    . LYS B  1 45  ? -20.817 -11.409 51.244  1.00 50.19  ? 107 LYS B CB    1 
ATOM   2823  C CG    . LYS B  1 45  ? -21.276 -11.669 49.821  1.00 52.41  ? 107 LYS B CG    1 
ATOM   2824  C CD    . LYS B  1 45  ? -21.031 -13.110 49.422  1.00 57.22  ? 107 LYS B CD    1 
ATOM   2825  C CE    . LYS B  1 45  ? -21.424 -13.305 47.970  1.00 62.11  ? 107 LYS B CE    1 
ATOM   2826  N NZ    . LYS B  1 45  ? -20.383 -14.064 47.227  1.00 67.46  ? 107 LYS B NZ    1 
ATOM   2827  N N     . HIS B  1 46  ? -19.523 -9.758  53.776  1.00 40.49  ? 108 HIS B N     1 
ATOM   2828  C CA    . HIS B  1 46  ? -19.600 -9.371  55.177  1.00 39.71  ? 108 HIS B CA    1 
ATOM   2829  C C     . HIS B  1 46  ? -19.881 -7.885  55.344  1.00 39.14  ? 108 HIS B C     1 
ATOM   2830  O O     . HIS B  1 46  ? -20.416 -7.473  56.364  1.00 39.92  ? 108 HIS B O     1 
ATOM   2831  C CB    . HIS B  1 46  ? -18.314 -9.726  55.923  1.00 40.54  ? 108 HIS B CB    1 
ATOM   2832  C CG    . HIS B  1 46  ? -17.113 -8.927  55.495  1.00 43.15  ? 108 HIS B CG    1 
ATOM   2833  N ND1   . HIS B  1 46  ? -16.267 -9.342  54.487  1.00 44.33  ? 108 HIS B ND1   1 
ATOM   2834  C CD2   . HIS B  1 46  ? -16.607 -7.752  55.946  1.00 42.77  ? 108 HIS B CD2   1 
ATOM   2835  C CE1   . HIS B  1 46  ? -15.299 -8.456  54.330  1.00 42.96  ? 108 HIS B CE1   1 
ATOM   2836  N NE2   . HIS B  1 46  ? -15.483 -7.480  55.201  1.00 42.89  ? 108 HIS B NE2   1 
ATOM   2837  N N     . VAL B  1 47  ? -19.518 -7.072  54.361  1.00 37.44  ? 109 VAL B N     1 
ATOM   2838  C CA    . VAL B  1 47  ? -19.785 -5.652  54.453  1.00 36.31  ? 109 VAL B CA    1 
ATOM   2839  C C     . VAL B  1 47  ? -21.247 -5.399  54.146  1.00 35.54  ? 109 VAL B C     1 
ATOM   2840  O O     . VAL B  1 47  ? -21.861 -4.523  54.745  1.00 35.48  ? 109 VAL B O     1 
ATOM   2841  C CB    . VAL B  1 47  ? -18.883 -4.846  53.496  1.00 36.85  ? 109 VAL B CB    1 
ATOM   2842  C CG1   . VAL B  1 47  ? -19.219 -3.363  53.547  1.00 35.96  ? 109 VAL B CG1   1 
ATOM   2843  C CG2   . VAL B  1 47  ? -17.416 -5.058  53.853  1.00 36.97  ? 109 VAL B CG2   1 
ATOM   2844  N N     . PHE B  1 48  ? -21.805 -6.173  53.221  1.00 35.15  ? 110 PHE B N     1 
ATOM   2845  C CA    . PHE B  1 48  ? -23.140 -5.871  52.685  1.00 36.57  ? 110 PHE B CA    1 
ATOM   2846  C C     . PHE B  1 48  ? -24.279 -6.572  53.386  1.00 38.17  ? 110 PHE B C     1 
ATOM   2847  O O     . PHE B  1 48  ? -25.415 -6.095  53.329  1.00 38.09  ? 110 PHE B O     1 
ATOM   2848  C CB    . PHE B  1 48  ? -23.202 -6.166  51.177  1.00 35.09  ? 110 PHE B CB    1 
ATOM   2849  C CG    . PHE B  1 48  ? -22.466 -5.155  50.354  1.00 33.88  ? 110 PHE B CG    1 
ATOM   2850  C CD1   . PHE B  1 48  ? -21.114 -5.297  50.117  1.00 33.42  ? 110 PHE B CD1   1 
ATOM   2851  C CD2   . PHE B  1 48  ? -23.108 -4.024  49.882  1.00 33.35  ? 110 PHE B CD2   1 
ATOM   2852  C CE1   . PHE B  1 48  ? -20.420 -4.346  49.396  1.00 33.07  ? 110 PHE B CE1   1 
ATOM   2853  C CE2   . PHE B  1 48  ? -22.420 -3.073  49.147  1.00 33.27  ? 110 PHE B CE2   1 
ATOM   2854  C CZ    . PHE B  1 48  ? -21.072 -3.235  48.904  1.00 32.46  ? 110 PHE B CZ    1 
ATOM   2855  N N     . LYS B  1 49  ? -23.984 -7.682  54.057  1.00 40.61  ? 111 LYS B N     1 
ATOM   2856  C CA    . LYS B  1 49  ? -25.040 -8.529  54.587  1.00 42.74  ? 111 LYS B CA    1 
ATOM   2857  C C     . LYS B  1 49  ? -25.989 -7.765  55.528  1.00 41.22  ? 111 LYS B C     1 
ATOM   2858  O O     . LYS B  1 49  ? -25.572 -7.108  56.481  1.00 38.23  ? 111 LYS B O     1 
ATOM   2859  C CB    . LYS B  1 49  ? -24.493 -9.787  55.269  1.00 46.60  ? 111 LYS B CB    1 
ATOM   2860  C CG    . LYS B  1 49  ? -25.479 -10.932 55.135  1.00 51.37  ? 111 LYS B CG    1 
ATOM   2861  C CD    . LYS B  1 49  ? -25.454 -11.905 56.291  1.00 53.77  ? 111 LYS B CD    1 
ATOM   2862  C CE    . LYS B  1 49  ? -26.709 -12.769 56.234  1.00 56.92  ? 111 LYS B CE    1 
ATOM   2863  N NZ    . LYS B  1 49  ? -26.670 -13.815 57.294  1.00 59.30  ? 111 LYS B NZ    1 
ATOM   2864  N N     . ASP B  1 50  ? -27.273 -7.845  55.197  1.00 41.59  ? 112 ASP B N     1 
ATOM   2865  C CA    . ASP B  1 50  ? -28.361 -7.218  55.944  1.00 41.89  ? 112 ASP B CA    1 
ATOM   2866  C C     . ASP B  1 50  ? -28.306 -5.707  56.006  1.00 38.10  ? 112 ASP B C     1 
ATOM   2867  O O     . ASP B  1 50  ? -28.955 -5.120  56.848  1.00 35.95  ? 112 ASP B O     1 
ATOM   2868  C CB    . ASP B  1 50  ? -28.468 -7.813  57.359  1.00 45.22  ? 112 ASP B CB    1 
ATOM   2869  C CG    . ASP B  1 50  ? -28.874 -9.285  57.350  1.00 47.50  ? 112 ASP B CG    1 
ATOM   2870  O OD1   . ASP B  1 50  ? -29.836 -9.654  56.632  1.00 51.31  ? 112 ASP B OD1   1 
ATOM   2871  O OD2   . ASP B  1 50  ? -28.231 -10.075 58.070  1.00 48.79  ? 112 ASP B OD2   1 
ATOM   2872  N N     . LYS B  1 51  ? -27.591 -5.076  55.084  1.00 37.79  ? 113 LYS B N     1 
ATOM   2873  C CA    . LYS B  1 51  ? -27.448 -3.632  55.111  1.00 38.88  ? 113 LYS B CA    1 
ATOM   2874  C C     . LYS B  1 51  ? -28.205 -2.937  53.984  1.00 35.68  ? 113 LYS B C     1 
ATOM   2875  O O     . LYS B  1 51  ? -28.615 -3.547  53.002  1.00 33.76  ? 113 LYS B O     1 
ATOM   2876  C CB    . LYS B  1 51  ? -25.970 -3.251  55.104  1.00 44.28  ? 113 LYS B CB    1 
ATOM   2877  C CG    . LYS B  1 51  ? -25.197 -3.857  56.271  1.00 49.95  ? 113 LYS B CG    1 
ATOM   2878  C CD    . LYS B  1 51  ? -23.824 -3.213  56.460  1.00 57.69  ? 113 LYS B CD    1 
ATOM   2879  C CE    . LYS B  1 51  ? -23.737 -2.287  57.670  1.00 59.66  ? 113 LYS B CE    1 
ATOM   2880  N NZ    . LYS B  1 51  ? -23.641 -3.098  58.915  1.00 61.76  ? 113 LYS B NZ    1 
ATOM   2881  N N     . VAL B  1 52  ? -28.386 -1.639  54.159  1.00 35.04  ? 114 VAL B N     1 
ATOM   2882  C CA    . VAL B  1 52  ? -29.198 -0.823  53.275  1.00 36.05  ? 114 VAL B CA    1 
ATOM   2883  C C     . VAL B  1 52  ? -28.275 -0.014  52.378  1.00 35.74  ? 114 VAL B C     1 
ATOM   2884  O O     . VAL B  1 52  ? -27.477 0.764   52.877  1.00 37.45  ? 114 VAL B O     1 
ATOM   2885  C CB    . VAL B  1 52  ? -30.095 0.146   54.085  1.00 37.43  ? 114 VAL B CB    1 
ATOM   2886  C CG1   . VAL B  1 52  ? -30.859 1.119   53.176  1.00 37.24  ? 114 VAL B CG1   1 
ATOM   2887  C CG2   . VAL B  1 52  ? -31.065 -0.646  54.955  1.00 37.89  ? 114 VAL B CG2   1 
ATOM   2888  N N     . VAL B  1 53  ? -28.424 -0.178  51.064  1.00 34.13  ? 115 VAL B N     1 
ATOM   2889  C CA    . VAL B  1 53  ? -27.493 0.364   50.085  1.00 33.01  ? 115 VAL B CA    1 
ATOM   2890  C C     . VAL B  1 53  ? -28.134 1.387   49.134  1.00 32.61  ? 115 VAL B C     1 
ATOM   2891  O O     . VAL B  1 53  ? -29.248 1.190   48.650  1.00 34.56  ? 115 VAL B O     1 
ATOM   2892  C CB    . VAL B  1 53  ? -26.894 -0.774  49.239  1.00 32.54  ? 115 VAL B CB    1 
ATOM   2893  C CG1   . VAL B  1 53  ? -25.824 -0.229  48.299  1.00 32.83  ? 115 VAL B CG1   1 
ATOM   2894  C CG2   . VAL B  1 53  ? -26.324 -1.862  50.139  1.00 31.89  ? 115 VAL B CG2   1 
ATOM   2895  N N     . LEU B  1 54  ? -27.415 2.469   48.855  1.00 31.07  ? 116 LEU B N     1 
ATOM   2896  C CA    . LEU B  1 54  ? -27.861 3.461   47.902  1.00 31.24  ? 116 LEU B CA    1 
ATOM   2897  C C     . LEU B  1 54  ? -26.970 3.436   46.674  1.00 32.69  ? 116 LEU B C     1 
ATOM   2898  O O     . LEU B  1 54  ? -25.785 3.700   46.793  1.00 32.81  ? 116 LEU B O     1 
ATOM   2899  C CB    . LEU B  1 54  ? -27.806 4.857   48.518  1.00 31.09  ? 116 LEU B CB    1 
ATOM   2900  C CG    . LEU B  1 54  ? -28.143 6.022   47.585  1.00 30.84  ? 116 LEU B CG    1 
ATOM   2901  C CD1   . LEU B  1 54  ? -29.595 5.914   47.137  1.00 32.49  ? 116 LEU B CD1   1 
ATOM   2902  C CD2   . LEU B  1 54  ? -27.898 7.349   48.269  1.00 30.27  ? 116 LEU B CD2   1 
ATOM   2903  N N     . ASP B  1 55  ? -27.554 3.135   45.506  1.00 34.85  ? 117 ASP B N     1 
ATOM   2904  C CA    . ASP B  1 55  ? -26.883 3.208   44.192  1.00 33.99  ? 117 ASP B CA    1 
ATOM   2905  C C     . ASP B  1 55  ? -27.178 4.593   43.592  1.00 32.42  ? 117 ASP B C     1 
ATOM   2906  O O     . ASP B  1 55  ? -28.281 4.865   43.155  1.00 30.68  ? 117 ASP B O     1 
ATOM   2907  C CB    . ASP B  1 55  ? -27.367 2.056   43.277  1.00 34.41  ? 117 ASP B CB    1 
ATOM   2908  C CG    . ASP B  1 55  ? -26.600 1.960   41.961  1.00 36.87  ? 117 ASP B CG    1 
ATOM   2909  O OD1   . ASP B  1 55  ? -25.718 2.820   41.700  1.00 40.95  ? 117 ASP B OD1   1 
ATOM   2910  O OD2   . ASP B  1 55  ? -26.889 1.026   41.165  1.00 37.07  ? 117 ASP B OD2   1 
ATOM   2911  N N     . VAL B  1 56  ? -26.186 5.476   43.630  1.00 32.76  ? 118 VAL B N     1 
ATOM   2912  C CA    . VAL B  1 56  ? -26.304 6.813   43.071  1.00 33.00  ? 118 VAL B CA    1 
ATOM   2913  C C     . VAL B  1 56  ? -26.018 6.714   41.566  1.00 34.84  ? 118 VAL B C     1 
ATOM   2914  O O     . VAL B  1 56  ? -24.906 6.315   41.142  1.00 34.86  ? 118 VAL B O     1 
ATOM   2915  C CB    . VAL B  1 56  ? -25.346 7.798   43.773  1.00 32.72  ? 118 VAL B CB    1 
ATOM   2916  C CG1   . VAL B  1 56  ? -25.416 9.190   43.148  1.00 32.21  ? 118 VAL B CG1   1 
ATOM   2917  C CG2   . VAL B  1 56  ? -25.675 7.865   45.261  1.00 32.57  ? 118 VAL B CG2   1 
ATOM   2918  N N     . GLY B  1 57  ? -27.043 7.057   40.775  1.00 35.14  ? 119 GLY B N     1 
ATOM   2919  C CA    . GLY B  1 57  ? -27.028 6.883   39.319  1.00 34.29  ? 119 GLY B CA    1 
ATOM   2920  C C     . GLY B  1 57  ? -27.129 5.410   38.950  1.00 34.27  ? 119 GLY B C     1 
ATOM   2921  O O     . GLY B  1 57  ? -26.200 4.854   38.384  1.00 34.05  ? 119 GLY B O     1 
ATOM   2922  N N     . SER B  1 58  ? -28.265 4.796   39.291  1.00 34.87  ? 120 SER B N     1 
ATOM   2923  C CA    . SER B  1 58  ? -28.508 3.346   39.169  1.00 35.36  ? 120 SER B CA    1 
ATOM   2924  C C     . SER B  1 58  ? -28.231 2.804   37.761  1.00 34.07  ? 120 SER B C     1 
ATOM   2925  O O     . SER B  1 58  ? -27.697 1.685   37.594  1.00 32.64  ? 120 SER B O     1 
ATOM   2926  C CB    . SER B  1 58  ? -29.968 3.006   39.587  1.00 38.45  ? 120 SER B CB    1 
ATOM   2927  O OG    . SER B  1 58  ? -30.926 3.177   38.511  1.00 41.42  ? 120 SER B OG    1 
ATOM   2928  N N     . GLY B  1 59  ? -28.618 3.609   36.768  1.00 32.97  ? 121 GLY B N     1 
ATOM   2929  C CA    . GLY B  1 59  ? -28.474 3.264   35.373  1.00 32.01  ? 121 GLY B CA    1 
ATOM   2930  C C     . GLY B  1 59  ? -29.295 2.038   35.082  1.00 32.33  ? 121 GLY B C     1 
ATOM   2931  O O     . GLY B  1 59  ? -30.451 1.907   35.522  1.00 32.95  ? 121 GLY B O     1 
ATOM   2932  N N     . THR B  1 60  ? -28.673 1.136   34.340  1.00 32.24  ? 122 THR B N     1 
ATOM   2933  C CA    . THR B  1 60  ? -29.209 -0.189  34.061  1.00 31.59  ? 122 THR B CA    1 
ATOM   2934  C C     . THR B  1 60  ? -29.637 -0.962  35.305  1.00 31.90  ? 122 THR B C     1 
ATOM   2935  O O     . THR B  1 60  ? -30.421 -1.909  35.221  1.00 31.13  ? 122 THR B O     1 
ATOM   2936  C CB    . THR B  1 60  ? -28.122 -1.014  33.372  1.00 31.13  ? 122 THR B CB    1 
ATOM   2937  O OG1   . THR B  1 60  ? -26.840 -0.412  33.636  1.00 32.40  ? 122 THR B OG1   1 
ATOM   2938  C CG2   . THR B  1 60  ? -28.346 -1.012  31.904  1.00 31.37  ? 122 THR B CG2   1 
ATOM   2939  N N     . GLY B  1 61  ? -29.078 -0.585  36.448  1.00 32.48  ? 123 GLY B N     1 
ATOM   2940  C CA    . GLY B  1 61  ? -29.338 -1.279  37.700  1.00 33.63  ? 123 GLY B CA    1 
ATOM   2941  C C     . GLY B  1 61  ? -28.273 -2.302  38.043  1.00 34.15  ? 123 GLY B C     1 
ATOM   2942  O O     . GLY B  1 61  ? -28.378 -3.003  39.048  1.00 32.39  ? 123 GLY B O     1 
ATOM   2943  N N     . ILE B  1 62  ? -27.251 -2.392  37.198  1.00 36.41  ? 124 ILE B N     1 
ATOM   2944  C CA    . ILE B  1 62  ? -26.212 -3.409  37.340  1.00 35.99  ? 124 ILE B CA    1 
ATOM   2945  C C     . ILE B  1 62  ? -25.563 -3.380  38.732  1.00 38.21  ? 124 ILE B C     1 
ATOM   2946  O O     . ILE B  1 62  ? -25.334 -4.436  39.326  1.00 38.67  ? 124 ILE B O     1 
ATOM   2947  C CB    . ILE B  1 62  ? -25.153 -3.320  36.196  1.00 34.07  ? 124 ILE B CB    1 
ATOM   2948  C CG1   . ILE B  1 62  ? -24.185 -4.508  36.260  1.00 33.53  ? 124 ILE B CG1   1 
ATOM   2949  C CG2   . ILE B  1 62  ? -24.375 -2.002  36.219  1.00 33.23  ? 124 ILE B CG2   1 
ATOM   2950  C CD1   . ILE B  1 62  ? -24.821 -5.843  35.969  1.00 33.87  ? 124 ILE B CD1   1 
ATOM   2951  N N     . LEU B  1 63  ? -25.283 -2.189  39.264  1.00 40.11  ? 125 LEU B N     1 
ATOM   2952  C CA    . LEU B  1 63  ? -24.556 -2.105  40.535  1.00 38.57  ? 125 LEU B CA    1 
ATOM   2953  C C     . LEU B  1 63  ? -25.450 -2.490  41.686  1.00 36.75  ? 125 LEU B C     1 
ATOM   2954  O O     . LEU B  1 63  ? -25.023 -3.203  42.580  1.00 34.66  ? 125 LEU B O     1 
ATOM   2955  C CB    . LEU B  1 63  ? -23.980 -0.712  40.746  1.00 39.14  ? 125 LEU B CB    1 
ATOM   2956  C CG    . LEU B  1 63  ? -22.870 -0.344  39.771  1.00 40.15  ? 125 LEU B CG    1 
ATOM   2957  C CD1   . LEU B  1 63  ? -22.260 0.966   40.245  1.00 42.28  ? 125 LEU B CD1   1 
ATOM   2958  C CD2   . LEU B  1 63  ? -21.804 -1.419  39.643  1.00 39.05  ? 125 LEU B CD2   1 
ATOM   2959  N N     . SER B  1 64  ? -26.692 -2.022  41.639  1.00 37.35  ? 126 SER B N     1 
ATOM   2960  C CA    . SER B  1 64  ? -27.703 -2.378  42.624  1.00 37.60  ? 126 SER B CA    1 
ATOM   2961  C C     . SER B  1 64  ? -27.948 -3.880  42.645  1.00 36.02  ? 126 SER B C     1 
ATOM   2962  O O     . SER B  1 64  ? -28.167 -4.457  43.709  1.00 37.29  ? 126 SER B O     1 
ATOM   2963  C CB    . SER B  1 64  ? -29.012 -1.638  42.345  1.00 39.04  ? 126 SER B CB    1 
ATOM   2964  O OG    . SER B  1 64  ? -28.831 -0.226  42.432  1.00 40.70  ? 126 SER B OG    1 
ATOM   2965  N N     . MET B  1 65  ? -27.897 -4.525  41.486  1.00 34.03  ? 127 MET B N     1 
ATOM   2966  C CA    . MET B  1 65  ? -28.047 -5.989  41.444  1.00 34.02  ? 127 MET B CA    1 
ATOM   2967  C C     . MET B  1 65  ? -26.827 -6.715  42.022  1.00 32.50  ? 127 MET B C     1 
ATOM   2968  O O     . MET B  1 65  ? -26.970 -7.776  42.638  1.00 32.76  ? 127 MET B O     1 
ATOM   2969  C CB    . MET B  1 65  ? -28.361 -6.484  40.024  1.00 34.84  ? 127 MET B CB    1 
ATOM   2970  C CG    . MET B  1 65  ? -29.757 -6.110  39.529  1.00 35.42  ? 127 MET B CG    1 
ATOM   2971  S SD    . MET B  1 65  ? -30.236 -6.933  37.998  1.00 35.26  ? 127 MET B SD    1 
ATOM   2972  C CE    . MET B  1 65  ? -28.982 -6.368  36.853  1.00 34.85  ? 127 MET B CE    1 
ATOM   2973  N N     . PHE B  1 66  ? -25.636 -6.148  41.837  1.00 31.17  ? 128 PHE B N     1 
ATOM   2974  C CA    . PHE B  1 66  ? -24.447 -6.667  42.507  1.00 29.78  ? 128 PHE B CA    1 
ATOM   2975  C C     . PHE B  1 66  ? -24.637 -6.633  44.027  1.00 30.44  ? 128 PHE B C     1 
ATOM   2976  O O     . PHE B  1 66  ? -24.403 -7.629  44.703  1.00 31.05  ? 128 PHE B O     1 
ATOM   2977  C CB    . PHE B  1 66  ? -23.192 -5.871  42.125  1.00 27.40  ? 128 PHE B CB    1 
ATOM   2978  C CG    . PHE B  1 66  ? -22.714 -6.097  40.717  1.00 25.39  ? 128 PHE B CG    1 
ATOM   2979  C CD1   . PHE B  1 66  ? -23.070 -7.230  39.993  1.00 24.34  ? 128 PHE B CD1   1 
ATOM   2980  C CD2   . PHE B  1 66  ? -21.839 -5.185  40.140  1.00 24.55  ? 128 PHE B CD2   1 
ATOM   2981  C CE1   . PHE B  1 66  ? -22.591 -7.416  38.711  1.00 24.31  ? 128 PHE B CE1   1 
ATOM   2982  C CE2   . PHE B  1 66  ? -21.359 -5.368  38.860  1.00 24.04  ? 128 PHE B CE2   1 
ATOM   2983  C CZ    . PHE B  1 66  ? -21.740 -6.484  38.142  1.00 24.18  ? 128 PHE B CZ    1 
ATOM   2984  N N     . ALA B  1 67  ? -25.078 -5.489  44.548  1.00 30.45  ? 129 ALA B N     1 
ATOM   2985  C CA    . ALA B  1 67  ? -25.281 -5.312  45.991  1.00 30.79  ? 129 ALA B CA    1 
ATOM   2986  C C     . ALA B  1 67  ? -26.294 -6.311  46.548  1.00 31.41  ? 129 ALA B C     1 
ATOM   2987  O O     . ALA B  1 67  ? -26.068 -6.963  47.556  1.00 28.09  ? 129 ALA B O     1 
ATOM   2988  C CB    . ALA B  1 67  ? -25.730 -3.885  46.286  1.00 30.33  ? 129 ALA B CB    1 
ATOM   2989  N N     . ALA B  1 68  ? -27.417 -6.424  45.862  1.00 34.89  ? 130 ALA B N     1 
ATOM   2990  C CA    . ALA B  1 68  ? -28.452 -7.363  46.257  1.00 36.89  ? 130 ALA B CA    1 
ATOM   2991  C C     . ALA B  1 68  ? -27.906 -8.773  46.376  1.00 37.85  ? 130 ALA B C     1 
ATOM   2992  O O     . ALA B  1 68  ? -28.226 -9.474  47.336  1.00 39.24  ? 130 ALA B O     1 
ATOM   2993  C CB    . ALA B  1 68  ? -29.596 -7.329  45.262  1.00 37.03  ? 130 ALA B CB    1 
ATOM   2994  N N     . LYS B  1 69  ? -27.088 -9.177  45.406  1.00 38.17  ? 131 LYS B N     1 
ATOM   2995  C CA    . LYS B  1 69  ? -26.489 -10.503 45.403  1.00 39.02  ? 131 LYS B CA    1 
ATOM   2996  C C     . LYS B  1 69  ? -25.432 -10.673 46.475  1.00 37.22  ? 131 LYS B C     1 
ATOM   2997  O O     . LYS B  1 69  ? -25.126 -11.797 46.848  1.00 35.94  ? 131 LYS B O     1 
ATOM   2998  C CB    . LYS B  1 69  ? -25.894 -10.830 44.034  1.00 42.01  ? 131 LYS B CB    1 
ATOM   2999  C CG    . LYS B  1 69  ? -26.932 -11.277 43.022  1.00 46.30  ? 131 LYS B CG    1 
ATOM   3000  C CD    . LYS B  1 69  ? -27.584 -12.597 43.410  1.00 50.13  ? 131 LYS B CD    1 
ATOM   3001  C CE    . LYS B  1 69  ? -28.245 -13.259 42.206  1.00 53.87  ? 131 LYS B CE    1 
ATOM   3002  N NZ    . LYS B  1 69  ? -29.311 -14.200 42.636  1.00 57.44  ? 131 LYS B NZ    1 
ATOM   3003  N N     . ALA B  1 70  ? -24.863 -9.569  46.953  1.00 37.13  ? 132 ALA B N     1 
ATOM   3004  C CA    . ALA B  1 70  ? -23.905 -9.611  48.071  1.00 39.12  ? 132 ALA B CA    1 
ATOM   3005  C C     . ALA B  1 70  ? -24.586 -9.696  49.458  1.00 39.95  ? 132 ALA B C     1 
ATOM   3006  O O     . ALA B  1 70  ? -23.915 -9.710  50.494  1.00 39.56  ? 132 ALA B O     1 
ATOM   3007  C CB    . ALA B  1 70  ? -22.960 -8.414  48.001  1.00 40.03  ? 132 ALA B CB    1 
ATOM   3008  N N     . GLY B  1 71  ? -25.919 -9.734  49.459  1.00 41.51  ? 133 GLY B N     1 
ATOM   3009  C CA    . GLY B  1 71  ? -26.721 -9.988  50.655  1.00 40.84  ? 133 GLY B CA    1 
ATOM   3010  C C     . GLY B  1 71  ? -27.368 -8.767  51.286  1.00 41.37  ? 133 GLY B C     1 
ATOM   3011  O O     . GLY B  1 71  ? -27.756 -8.810  52.449  1.00 41.76  ? 133 GLY B O     1 
ATOM   3012  N N     . ALA B  1 72  ? -27.493 -7.677  50.534  1.00 41.96  ? 134 ALA B N     1 
ATOM   3013  C CA    . ALA B  1 72  ? -28.060 -6.456  51.083  1.00 43.56  ? 134 ALA B CA    1 
ATOM   3014  C C     . ALA B  1 72  ? -29.516 -6.694  51.443  1.00 44.58  ? 134 ALA B C     1 
ATOM   3015  O O     . ALA B  1 72  ? -30.222 -7.429  50.761  1.00 43.85  ? 134 ALA B O     1 
ATOM   3016  C CB    . ALA B  1 72  ? -27.932 -5.310  50.091  1.00 44.24  ? 134 ALA B CB    1 
ATOM   3017  N N     . LYS B  1 73  ? -29.954 -6.078  52.528  1.00 48.15  ? 135 LYS B N     1 
ATOM   3018  C CA    . LYS B  1 73  ? -31.337 -6.198  52.965  1.00 50.86  ? 135 LYS B CA    1 
ATOM   3019  C C     . LYS B  1 73  ? -32.220 -5.413  52.014  1.00 49.06  ? 135 LYS B C     1 
ATOM   3020  O O     . LYS B  1 73  ? -33.244 -5.904  51.592  1.00 51.12  ? 135 LYS B O     1 
ATOM   3021  C CB    . LYS B  1 73  ? -31.510 -5.655  54.385  1.00 53.91  ? 135 LYS B CB    1 
ATOM   3022  C CG    . LYS B  1 73  ? -32.825 -6.026  55.078  1.00 56.35  ? 135 LYS B CG    1 
ATOM   3023  C CD    . LYS B  1 73  ? -33.535 -4.815  55.715  1.00 59.80  ? 135 LYS B CD    1 
ATOM   3024  C CE    . LYS B  1 73  ? -32.694 -3.994  56.715  1.00 58.88  ? 135 LYS B CE    1 
ATOM   3025  N NZ    . LYS B  1 73  ? -32.399 -4.703  57.990  1.00 58.18  ? 135 LYS B NZ    1 
ATOM   3026  N N     . LYS B  1 74  ? -31.822 -4.187  51.700  1.00 47.71  ? 136 LYS B N     1 
ATOM   3027  C CA    . LYS B  1 74  ? -32.559 -3.337  50.775  1.00 49.07  ? 136 LYS B CA    1 
ATOM   3028  C C     . LYS B  1 74  ? -31.555 -2.545  49.955  1.00 46.83  ? 136 LYS B C     1 
ATOM   3029  O O     . LYS B  1 74  ? -30.474 -2.236  50.444  1.00 47.45  ? 136 LYS B O     1 
ATOM   3030  C CB    . LYS B  1 74  ? -33.465 -2.355  51.531  1.00 55.52  ? 136 LYS B CB    1 
ATOM   3031  C CG    . LYS B  1 74  ? -34.752 -2.941  52.126  1.00 62.61  ? 136 LYS B CG    1 
ATOM   3032  C CD    . LYS B  1 74  ? -36.027 -2.541  51.355  1.00 67.75  ? 136 LYS B CD    1 
ATOM   3033  C CE    . LYS B  1 74  ? -36.000 -2.961  49.880  1.00 66.81  ? 136 LYS B CE    1 
ATOM   3034  N NZ    . LYS B  1 74  ? -37.341 -3.232  49.285  1.00 63.87  ? 136 LYS B NZ    1 
ATOM   3035  N N     . VAL B  1 75  ? -31.907 -2.237  48.707  1.00 44.11  ? 137 VAL B N     1 
ATOM   3036  C CA    . VAL B  1 75  ? -31.077 -1.410  47.834  1.00 39.87  ? 137 VAL B CA    1 
ATOM   3037  C C     . VAL B  1 75  ? -31.942 -0.382  47.149  1.00 37.89  ? 137 VAL B C     1 
ATOM   3038  O O     . VAL B  1 75  ? -32.913 -0.751  46.508  1.00 38.62  ? 137 VAL B O     1 
ATOM   3039  C CB    . VAL B  1 75  ? -30.422 -2.241  46.719  1.00 39.59  ? 137 VAL B CB    1 
ATOM   3040  C CG1   . VAL B  1 75  ? -29.516 -1.353  45.869  1.00 39.26  ? 137 VAL B CG1   1 
ATOM   3041  C CG2   . VAL B  1 75  ? -29.642 -3.414  47.299  1.00 39.88  ? 137 VAL B CG2   1 
ATOM   3042  N N     . PHE B  1 76  ? -31.586 0.890   47.261  1.00 36.32  ? 138 PHE B N     1 
ATOM   3043  C CA    . PHE B  1 76  ? -32.338 1.943   46.609  1.00 38.61  ? 138 PHE B CA    1 
ATOM   3044  C C     . PHE B  1 76  ? -31.491 2.511   45.508  1.00 38.98  ? 138 PHE B C     1 
ATOM   3045  O O     . PHE B  1 76  ? -30.413 2.984   45.785  1.00 41.50  ? 138 PHE B O     1 
ATOM   3046  C CB    . PHE B  1 76  ? -32.690 3.074   47.587  1.00 41.32  ? 138 PHE B CB    1 
ATOM   3047  C CG    . PHE B  1 76  ? -33.430 2.614   48.822  1.00 44.72  ? 138 PHE B CG    1 
ATOM   3048  C CD1   . PHE B  1 76  ? -34.381 1.586   48.755  1.00 47.05  ? 138 PHE B CD1   1 
ATOM   3049  C CD2   . PHE B  1 76  ? -33.195 3.208   50.052  1.00 45.56  ? 138 PHE B CD2   1 
ATOM   3050  C CE1   . PHE B  1 76  ? -35.056 1.141   49.892  1.00 44.71  ? 138 PHE B CE1   1 
ATOM   3051  C CE2   . PHE B  1 76  ? -33.873 2.767   51.187  1.00 46.41  ? 138 PHE B CE2   1 
ATOM   3052  C CZ    . PHE B  1 76  ? -34.806 1.731   51.106  1.00 44.06  ? 138 PHE B CZ    1 
ATOM   3053  N N     . GLY B  1 77  ? -31.980 2.484   44.268  1.00 39.94  ? 139 GLY B N     1 
ATOM   3054  C CA    . GLY B  1 77  ? -31.282 3.085   43.112  1.00 37.77  ? 139 GLY B CA    1 
ATOM   3055  C C     . GLY B  1 77  ? -31.966 4.369   42.681  1.00 36.83  ? 139 GLY B C     1 
ATOM   3056  O O     . GLY B  1 77  ? -33.176 4.407   42.552  1.00 35.40  ? 139 GLY B O     1 
ATOM   3057  N N     . ILE B  1 78  ? -31.201 5.440   42.496  1.00 38.35  ? 140 ILE B N     1 
ATOM   3058  C CA    . ILE B  1 78  ? -31.750 6.706   41.978  1.00 39.67  ? 140 ILE B CA    1 
ATOM   3059  C C     . ILE B  1 78  ? -31.159 6.997   40.591  1.00 39.92  ? 140 ILE B C     1 
ATOM   3060  O O     . ILE B  1 78  ? -29.943 6.959   40.424  1.00 38.37  ? 140 ILE B O     1 
ATOM   3061  C CB    . ILE B  1 78  ? -31.451 7.913   42.899  1.00 38.68  ? 140 ILE B CB    1 
ATOM   3062  C CG1   . ILE B  1 78  ? -31.965 7.654   44.319  1.00 37.73  ? 140 ILE B CG1   1 
ATOM   3063  C CG2   . ILE B  1 78  ? -32.090 9.183   42.339  1.00 38.52  ? 140 ILE B CG2   1 
ATOM   3064  C CD1   . ILE B  1 78  ? -31.431 8.636   45.344  1.00 37.09  ? 140 ILE B CD1   1 
ATOM   3065  N N     . GLU B  1 79  ? -32.030 7.332   39.631  1.00 39.68  ? 141 GLU B N     1 
ATOM   3066  C CA    . GLU B  1 79  ? -31.656 7.508   38.233  1.00 38.70  ? 141 GLU B CA    1 
ATOM   3067  C C     . GLU B  1 79  ? -32.597 8.502   37.555  1.00 40.47  ? 141 GLU B C     1 
ATOM   3068  O O     . GLU B  1 79  ? -33.805 8.247   37.491  1.00 42.71  ? 141 GLU B O     1 
ATOM   3069  C CB    . GLU B  1 79  ? -31.743 6.139   37.546  1.00 39.07  ? 141 GLU B CB    1 
ATOM   3070  C CG    . GLU B  1 79  ? -31.502 6.136   36.047  1.00 38.37  ? 141 GLU B CG    1 
ATOM   3071  C CD    . GLU B  1 79  ? -30.198 6.787   35.690  1.00 38.02  ? 141 GLU B CD    1 
ATOM   3072  O OE1   . GLU B  1 79  ? -29.142 6.180   35.993  1.00 36.19  ? 141 GLU B OE1   1 
ATOM   3073  O OE2   . GLU B  1 79  ? -30.247 7.910   35.133  1.00 37.90  ? 141 GLU B OE2   1 
ATOM   3074  N N     . CYS B  1 80  ? -32.077 9.627   37.049  1.00 40.77  ? 142 CYS B N     1 
ATOM   3075  C CA    . CYS B  1 80  ? -32.959 10.641  36.454  1.00 40.25  ? 142 CYS B CA    1 
ATOM   3076  C C     . CYS B  1 80  ? -33.350 10.233  35.047  1.00 40.84  ? 142 CYS B C     1 
ATOM   3077  O O     . CYS B  1 80  ? -34.438 10.542  34.615  1.00 45.45  ? 142 CYS B O     1 
ATOM   3078  C CB    . CYS B  1 80  ? -32.371 12.056  36.493  1.00 39.43  ? 142 CYS B CB    1 
ATOM   3079  S SG    . CYS B  1 80  ? -30.878 12.349  35.526  1.00 42.67  ? 142 CYS B SG    1 
ATOM   3080  N N     . SER B  1 81  ? -32.502 9.490   34.350  1.00 41.76  ? 143 SER B N     1 
ATOM   3081  C CA    . SER B  1 81  ? -32.777 9.137   32.951  1.00 42.11  ? 143 SER B CA    1 
ATOM   3082  C C     . SER B  1 81  ? -33.880 8.117   32.806  1.00 41.29  ? 143 SER B C     1 
ATOM   3083  O O     . SER B  1 81  ? -34.181 7.373   33.742  1.00 44.30  ? 143 SER B O     1 
ATOM   3084  C CB    . SER B  1 81  ? -31.525 8.586   32.270  1.00 43.16  ? 143 SER B CB    1 
ATOM   3085  O OG    . SER B  1 81  ? -31.679 8.607   30.856  1.00 43.36  ? 143 SER B OG    1 
ATOM   3086  N N     . SER B  1 82  ? -34.450 8.059   31.605  1.00 39.58  ? 144 SER B N     1 
ATOM   3087  C CA    . SER B  1 82  ? -35.522 7.108   31.302  1.00 39.49  ? 144 SER B CA    1 
ATOM   3088  C C     . SER B  1 82  ? -35.016 5.666   31.234  1.00 37.91  ? 144 SER B C     1 
ATOM   3089  O O     . SER B  1 82  ? -35.799 4.726   31.105  1.00 37.26  ? 144 SER B O     1 
ATOM   3090  C CB    . SER B  1 82  ? -36.263 7.504   30.004  1.00 40.04  ? 144 SER B CB    1 
ATOM   3091  O OG    . SER B  1 82  ? -35.377 7.776   28.923  1.00 38.42  ? 144 SER B OG    1 
ATOM   3092  N N     . ILE B  1 83  ? -33.703 5.500   31.334  1.00 37.86  ? 145 ILE B N     1 
ATOM   3093  C CA    . ILE B  1 83  ? -33.098 4.188   31.432  1.00 37.25  ? 145 ILE B CA    1 
ATOM   3094  C C     . ILE B  1 83  ? -33.640 3.462   32.657  1.00 35.64  ? 145 ILE B C     1 
ATOM   3095  O O     . ILE B  1 83  ? -33.747 2.231   32.658  1.00 34.93  ? 145 ILE B O     1 
ATOM   3096  C CB    . ILE B  1 83  ? -31.557 4.293   31.483  1.00 39.18  ? 145 ILE B CB    1 
ATOM   3097  C CG1   . ILE B  1 83  ? -30.888 2.931   31.219  1.00 40.12  ? 145 ILE B CG1   1 
ATOM   3098  C CG2   . ILE B  1 83  ? -31.092 4.869   32.820  1.00 40.14  ? 145 ILE B CG2   1 
ATOM   3099  C CD1   . ILE B  1 83  ? -31.065 2.380   29.820  1.00 39.29  ? 145 ILE B CD1   1 
ATOM   3100  N N     . SER B  1 84  ? -34.006 4.222   33.684  1.00 34.74  ? 146 SER B N     1 
ATOM   3101  C CA    . SER B  1 84  ? -34.649 3.654   34.876  1.00 36.04  ? 146 SER B CA    1 
ATOM   3102  C C     . SER B  1 84  ? -35.792 2.688   34.583  1.00 36.51  ? 146 SER B C     1 
ATOM   3103  O O     . SER B  1 84  ? -35.893 1.631   35.238  1.00 33.87  ? 146 SER B O     1 
ATOM   3104  C CB    . SER B  1 84  ? -35.212 4.775   35.697  1.00 35.88  ? 146 SER B CB    1 
ATOM   3105  O OG    . SER B  1 84  ? -35.898 5.637   34.823  1.00 35.99  ? 146 SER B OG    1 
ATOM   3106  N N     . ASP B  1 85  ? -36.632 3.051   33.603  1.00 37.71  ? 147 ASP B N     1 
ATOM   3107  C CA    . ASP B  1 85  ? -37.758 2.210   33.181  1.00 39.12  ? 147 ASP B CA    1 
ATOM   3108  C C     . ASP B  1 85  ? -37.274 0.793   32.848  1.00 39.38  ? 147 ASP B C     1 
ATOM   3109  O O     . ASP B  1 85  ? -37.904 -0.190  33.245  1.00 38.99  ? 147 ASP B O     1 
ATOM   3110  C CB    . ASP B  1 85  ? -38.506 2.812   31.981  1.00 40.65  ? 147 ASP B CB    1 
ATOM   3111  C CG    . ASP B  1 85  ? -39.057 4.223   32.251  1.00 44.59  ? 147 ASP B CG    1 
ATOM   3112  O OD1   . ASP B  1 85  ? -39.287 4.594   33.433  1.00 47.68  ? 147 ASP B OD1   1 
ATOM   3113  O OD2   . ASP B  1 85  ? -39.289 4.965   31.264  1.00 44.90  ? 147 ASP B OD2   1 
ATOM   3114  N N     . TYR B  1 86  ? -36.150 0.692   32.141  1.00 39.10  ? 148 TYR B N     1 
ATOM   3115  C CA    . TYR B  1 86  ? -35.571 -0.611  31.816  1.00 40.89  ? 148 TYR B CA    1 
ATOM   3116  C C     . TYR B  1 86  ? -35.002 -1.287  33.053  1.00 43.13  ? 148 TYR B C     1 
ATOM   3117  O O     . TYR B  1 86  ? -35.167 -2.509  33.224  1.00 44.54  ? 148 TYR B O     1 
ATOM   3118  C CB    . TYR B  1 86  ? -34.526 -0.486  30.702  1.00 43.45  ? 148 TYR B CB    1 
ATOM   3119  C CG    . TYR B  1 86  ? -35.181 -0.108  29.391  1.00 46.59  ? 148 TYR B CG    1 
ATOM   3120  C CD1   . TYR B  1 86  ? -35.862 -1.063  28.643  1.00 48.31  ? 148 TYR B CD1   1 
ATOM   3121  C CD2   . TYR B  1 86  ? -35.184 1.218   28.935  1.00 45.94  ? 148 TYR B CD2   1 
ATOM   3122  C CE1   . TYR B  1 86  ? -36.510 -0.713  27.478  1.00 50.99  ? 148 TYR B CE1   1 
ATOM   3123  C CE2   . TYR B  1 86  ? -35.826 1.572   27.770  1.00 46.73  ? 148 TYR B CE2   1 
ATOM   3124  C CZ    . TYR B  1 86  ? -36.485 0.608   27.050  1.00 50.13  ? 148 TYR B CZ    1 
ATOM   3125  O OH    . TYR B  1 86  ? -37.124 0.970   25.896  1.00 54.16  ? 148 TYR B OH    1 
ATOM   3126  N N     . SER B  1 87  ? -34.372 -0.503  33.938  1.00 42.40  ? 149 SER B N     1 
ATOM   3127  C CA    . SER B  1 87  ? -33.801 -1.063  35.171  1.00 39.11  ? 149 SER B CA    1 
ATOM   3128  C C     . SER B  1 87  ? -34.875 -1.803  35.972  1.00 38.32  ? 149 SER B C     1 
ATOM   3129  O O     . SER B  1 87  ? -34.631 -2.901  36.480  1.00 38.00  ? 149 SER B O     1 
ATOM   3130  C CB    . SER B  1 87  ? -33.026 -0.007  36.002  1.00 37.40  ? 149 SER B CB    1 
ATOM   3131  O OG    . SER B  1 87  ? -33.848 0.942   36.644  1.00 34.05  ? 149 SER B OG    1 
ATOM   3132  N N     . GLU B  1 88  ? -36.080 -1.248  36.021  1.00 37.70  ? 150 GLU B N     1 
ATOM   3133  C CA    . GLU B  1 88  ? -37.178 -1.917  36.730  1.00 37.08  ? 150 GLU B CA    1 
ATOM   3134  C C     . GLU B  1 88  ? -37.509 -3.269  36.111  1.00 35.24  ? 150 GLU B C     1 
ATOM   3135  O O     . GLU B  1 88  ? -37.590 -4.284  36.822  1.00 32.86  ? 150 GLU B O     1 
ATOM   3136  C CB    . GLU B  1 88  ? -38.426 -1.013  36.814  1.00 37.23  ? 150 GLU B CB    1 
ATOM   3137  C CG    . GLU B  1 88  ? -38.249 0.147   37.803  1.00 38.09  ? 150 GLU B CG    1 
ATOM   3138  C CD    . GLU B  1 88  ? -39.507 0.965   38.052  1.00 38.00  ? 150 GLU B CD    1 
ATOM   3139  O OE1   . GLU B  1 88  ? -40.448 0.859   37.249  1.00 38.88  ? 150 GLU B OE1   1 
ATOM   3140  O OE2   . GLU B  1 88  ? -39.559 1.706   39.059  1.00 37.11  ? 150 GLU B OE2   1 
ATOM   3141  N N     . LYS B  1 89  ? -37.691 -3.269  34.792  1.00 34.84  ? 151 LYS B N     1 
ATOM   3142  C CA    . LYS B  1 89  ? -38.069 -4.479  34.081  1.00 35.55  ? 151 LYS B CA    1 
ATOM   3143  C C     . LYS B  1 89  ? -36.956 -5.479  34.242  1.00 33.34  ? 151 LYS B C     1 
ATOM   3144  O O     . LYS B  1 89  ? -37.222 -6.669  34.437  1.00 30.64  ? 151 LYS B O     1 
ATOM   3145  C CB    . LYS B  1 89  ? -38.380 -4.225  32.587  1.00 38.47  ? 151 LYS B CB    1 
ATOM   3146  C CG    . LYS B  1 89  ? -39.810 -3.749  32.286  1.00 40.95  ? 151 LYS B CG    1 
ATOM   3147  C CD    . LYS B  1 89  ? -40.032 -3.507  30.786  1.00 44.86  ? 151 LYS B CD    1 
ATOM   3148  C CE    . LYS B  1 89  ? -41.078 -2.421  30.481  1.00 45.73  ? 151 LYS B CE    1 
ATOM   3149  N NZ    . LYS B  1 89  ? -40.598 -1.454  29.441  1.00 45.82  ? 151 LYS B NZ    1 
ATOM   3150  N N     . ILE B  1 90  ? -35.717 -4.990  34.174  1.00 32.65  ? 152 ILE B N     1 
ATOM   3151  C CA    . ILE B  1 90  ? -34.538 -5.851  34.306  1.00 33.36  ? 152 ILE B CA    1 
ATOM   3152  C C     . ILE B  1 90  ? -34.453 -6.492  35.686  1.00 34.70  ? 152 ILE B C     1 
ATOM   3153  O O     . ILE B  1 90  ? -34.234 -7.693  35.839  1.00 34.27  ? 152 ILE B O     1 
ATOM   3154  C CB    . ILE B  1 90  ? -33.238 -5.066  34.081  1.00 33.12  ? 152 ILE B CB    1 
ATOM   3155  C CG1   . ILE B  1 90  ? -33.041 -4.763  32.598  1.00 32.66  ? 152 ILE B CG1   1 
ATOM   3156  C CG2   . ILE B  1 90  ? -32.043 -5.872  34.566  1.00 33.95  ? 152 ILE B CG2   1 
ATOM   3157  C CD1   . ILE B  1 90  ? -31.962 -3.737  32.331  1.00 32.18  ? 152 ILE B CD1   1 
ATOM   3158  N N     . ILE B  1 91  ? -34.587 -5.671  36.705  1.00 36.70  ? 153 ILE B N     1 
ATOM   3159  C CA    . ILE B  1 91  ? -34.503 -6.173  38.049  1.00 38.49  ? 153 ILE B CA    1 
ATOM   3160  C C     . ILE B  1 91  ? -35.570 -7.243  38.238  1.00 38.35  ? 153 ILE B C     1 
ATOM   3161  O O     . ILE B  1 91  ? -35.288 -8.351  38.723  1.00 36.38  ? 153 ILE B O     1 
ATOM   3162  C CB    . ILE B  1 91  ? -34.644 -5.015  39.051  1.00 40.88  ? 153 ILE B CB    1 
ATOM   3163  C CG1   . ILE B  1 91  ? -33.340 -4.217  39.061  1.00 41.55  ? 153 ILE B CG1   1 
ATOM   3164  C CG2   . ILE B  1 91  ? -34.966 -5.517  40.459  1.00 41.59  ? 153 ILE B CG2   1 
ATOM   3165  C CD1   . ILE B  1 91  ? -33.511 -2.798  39.550  1.00 42.16  ? 153 ILE B CD1   1 
ATOM   3166  N N     . LYS B  1 92  ? -36.792 -6.913  37.834  1.00 38.82  ? 154 LYS B N     1 
ATOM   3167  C CA    . LYS B  1 92  ? -37.887 -7.850  37.985  1.00 40.16  ? 154 LYS B CA    1 
ATOM   3168  C C     . LYS B  1 92  ? -37.569 -9.182  37.286  1.00 38.77  ? 154 LYS B C     1 
ATOM   3169  O O     . LYS B  1 92  ? -37.737 -10.240 37.867  1.00 38.36  ? 154 LYS B O     1 
ATOM   3170  C CB    . LYS B  1 92  ? -39.209 -7.268  37.471  1.00 42.55  ? 154 LYS B CB    1 
ATOM   3171  C CG    . LYS B  1 92  ? -40.405 -7.895  38.188  1.00 46.55  ? 154 LYS B CG    1 
ATOM   3172  C CD    . LYS B  1 92  ? -41.678 -7.977  37.358  1.00 47.99  ? 154 LYS B CD    1 
ATOM   3173  C CE    . LYS B  1 92  ? -42.574 -9.086  37.890  1.00 47.53  ? 154 LYS B CE    1 
ATOM   3174  N NZ    . LYS B  1 92  ? -43.892 -8.995  37.225  1.00 49.26  ? 154 LYS B NZ    1 
ATOM   3175  N N     . ALA B  1 93  ? -37.078 -9.127  36.054  1.00 37.53  ? 155 ALA B N     1 
ATOM   3176  C CA    . ALA B  1 93  ? -36.765 -10.334 35.305  1.00 35.31  ? 155 ALA B CA    1 
ATOM   3177  C C     . ALA B  1 93  ? -35.771 -11.226 36.030  1.00 34.90  ? 155 ALA B C     1 
ATOM   3178  O O     . ALA B  1 93  ? -35.808 -12.426 35.845  1.00 34.93  ? 155 ALA B O     1 
ATOM   3179  C CB    . ALA B  1 93  ? -36.225 -9.962  33.945  1.00 35.97  ? 155 ALA B CB    1 
ATOM   3180  N N     . ASN B  1 94  ? -34.893 -10.644 36.846  1.00 35.57  ? 156 ASN B N     1 
ATOM   3181  C CA    . ASN B  1 94  ? -33.919 -11.411 37.626  1.00 37.99  ? 156 ASN B CA    1 
ATOM   3182  C C     . ASN B  1 94  ? -34.328 -11.754 39.089  1.00 41.69  ? 156 ASN B C     1 
ATOM   3183  O O     . ASN B  1 94  ? -33.492 -12.168 39.895  1.00 41.82  ? 156 ASN B O     1 
ATOM   3184  C CB    . ASN B  1 94  ? -32.611 -10.642 37.642  1.00 37.68  ? 156 ASN B CB    1 
ATOM   3185  C CG    . ASN B  1 94  ? -32.077 -10.371 36.258  1.00 36.77  ? 156 ASN B CG    1 
ATOM   3186  O OD1   . ASN B  1 94  ? -31.384 -11.210 35.690  1.00 38.96  ? 156 ASN B OD1   1 
ATOM   3187  N ND2   . ASN B  1 94  ? -32.343 -9.183  35.729  1.00 34.99  ? 156 ASN B ND2   1 
ATOM   3188  N N     . HIS B  1 95  ? -35.603 -11.561 39.428  1.00 45.24  ? 157 HIS B N     1 
ATOM   3189  C CA    . HIS B  1 95  ? -36.162 -11.939 40.734  1.00 45.64  ? 157 HIS B CA    1 
ATOM   3190  C C     . HIS B  1 95  ? -35.566 -11.182 41.895  1.00 44.28  ? 157 HIS B C     1 
ATOM   3191  O O     . HIS B  1 95  ? -35.403 -11.750 42.976  1.00 41.86  ? 157 HIS B O     1 
ATOM   3192  C CB    . HIS B  1 95  ? -35.994 -13.433 40.971  1.00 48.62  ? 157 HIS B CB    1 
ATOM   3193  C CG    . HIS B  1 95  ? -36.449 -14.260 39.820  1.00 54.02  ? 157 HIS B CG    1 
ATOM   3194  N ND1   . HIS B  1 95  ? -37.730 -14.184 39.315  1.00 54.79  ? 157 HIS B ND1   1 
ATOM   3195  C CD2   . HIS B  1 95  ? -35.792 -15.163 39.054  1.00 59.12  ? 157 HIS B CD2   1 
ATOM   3196  C CE1   . HIS B  1 95  ? -37.847 -15.018 38.295  1.00 58.76  ? 157 HIS B CE1   1 
ATOM   3197  N NE2   . HIS B  1 95  ? -36.686 -15.627 38.119  1.00 62.27  ? 157 HIS B NE2   1 
ATOM   3198  N N     . LEU B  1 96  ? -35.251 -9.902  41.671  1.00 42.43  ? 158 LEU B N     1 
ATOM   3199  C CA    . LEU B  1 96  ? -34.652 -9.079  42.707  1.00 40.86  ? 158 LEU B CA    1 
ATOM   3200  C C     . LEU B  1 96  ? -35.500 -7.873  43.039  1.00 39.26  ? 158 LEU B C     1 
ATOM   3201  O O     . LEU B  1 96  ? -35.033 -6.988  43.748  1.00 41.87  ? 158 LEU B O     1 
ATOM   3202  C CB    . LEU B  1 96  ? -33.248 -8.623  42.299  1.00 41.26  ? 158 LEU B CB    1 
ATOM   3203  C CG    . LEU B  1 96  ? -32.185 -9.703  42.118  1.00 42.17  ? 158 LEU B CG    1 
ATOM   3204  C CD1   . LEU B  1 96  ? -30.923 -9.091  41.530  1.00 42.50  ? 158 LEU B CD1   1 
ATOM   3205  C CD2   . LEU B  1 96  ? -31.850 -10.392 43.429  1.00 43.27  ? 158 LEU B CD2   1 
ATOM   3206  N N     . ASP B  1 97  ? -36.740 -7.818  42.570  1.00 37.64  ? 159 ASP B N     1 
ATOM   3207  C CA    . ASP B  1 97  ? -37.576 -6.630  42.855  1.00 39.67  ? 159 ASP B CA    1 
ATOM   3208  C C     . ASP B  1 97  ? -38.005 -6.503  44.327  1.00 41.42  ? 159 ASP B C     1 
ATOM   3209  O O     . ASP B  1 97  ? -38.303 -5.406  44.803  1.00 43.91  ? 159 ASP B O     1 
ATOM   3210  C CB    . ASP B  1 97  ? -38.788 -6.534  41.916  1.00 38.35  ? 159 ASP B CB    1 
ATOM   3211  C CG    . ASP B  1 97  ? -39.545 -7.832  41.793  1.00 38.14  ? 159 ASP B CG    1 
ATOM   3212  O OD1   . ASP B  1 97  ? -38.914 -8.916  41.887  1.00 37.77  ? 159 ASP B OD1   1 
ATOM   3213  O OD2   . ASP B  1 97  ? -40.770 -7.757  41.564  1.00 37.32  ? 159 ASP B OD2   1 
ATOM   3214  N N     . ASN B  1 98  ? -38.032 -7.631  45.034  1.00 42.41  ? 160 ASN B N     1 
ATOM   3215  C CA    . ASN B  1 98  ? -38.287 -7.675  46.480  1.00 41.06  ? 160 ASN B CA    1 
ATOM   3216  C C     . ASN B  1 98  ? -37.220 -6.968  47.307  1.00 40.28  ? 160 ASN B C     1 
ATOM   3217  O O     . ASN B  1 98  ? -37.480 -6.576  48.421  1.00 43.32  ? 160 ASN B O     1 
ATOM   3218  C CB    . ASN B  1 98  ? -38.408 -9.137  46.947  1.00 41.25  ? 160 ASN B CB    1 
ATOM   3219  C CG    . ASN B  1 98  ? -37.131 -9.954  46.682  1.00 42.96  ? 160 ASN B CG    1 
ATOM   3220  O OD1   . ASN B  1 98  ? -36.481 -9.820  45.642  1.00 42.46  ? 160 ASN B OD1   1 
ATOM   3221  N ND2   . ASN B  1 98  ? -36.772 -10.801 47.623  1.00 44.81  ? 160 ASN B ND2   1 
ATOM   3222  N N     . ILE B  1 99  ? -36.015 -6.835  46.766  1.00 41.01  ? 161 ILE B N     1 
ATOM   3223  C CA    . ILE B  1 99  ? -34.872 -6.218  47.464  1.00 39.07  ? 161 ILE B CA    1 
ATOM   3224  C C     . ILE B  1 99  ? -34.562 -4.811  46.924  1.00 39.43  ? 161 ILE B C     1 
ATOM   3225  O O     . ILE B  1 99  ? -34.248 -3.901  47.685  1.00 41.19  ? 161 ILE B O     1 
ATOM   3226  C CB    . ILE B  1 99  ? -33.613 -7.115  47.330  1.00 37.21  ? 161 ILE B CB    1 
ATOM   3227  C CG1   . ILE B  1 99  ? -33.832 -8.450  48.072  1.00 36.96  ? 161 ILE B CG1   1 
ATOM   3228  C CG2   . ILE B  1 99  ? -32.368 -6.400  47.837  1.00 36.25  ? 161 ILE B CG2   1 
ATOM   3229  C CD1   . ILE B  1 99  ? -32.869 -9.569  47.702  1.00 36.02  ? 161 ILE B CD1   1 
ATOM   3230  N N     . ILE B  1 100 ? -34.629 -4.637  45.610  1.00 37.88  ? 162 ILE B N     1 
ATOM   3231  C CA    . ILE B  1 100 ? -34.199 -3.391  44.993  1.00 36.42  ? 162 ILE B CA    1 
ATOM   3232  C C     . ILE B  1 100 ? -35.409 -2.558  44.602  1.00 35.70  ? 162 ILE B C     1 
ATOM   3233  O O     . ILE B  1 100 ? -36.340 -3.056  43.965  1.00 39.21  ? 162 ILE B O     1 
ATOM   3234  C CB    . ILE B  1 100 ? -33.362 -3.638  43.717  1.00 35.72  ? 162 ILE B CB    1 
ATOM   3235  C CG1   . ILE B  1 100 ? -32.159 -4.552  43.987  1.00 34.52  ? 162 ILE B CG1   1 
ATOM   3236  C CG2   . ILE B  1 100 ? -32.884 -2.309  43.149  1.00 36.28  ? 162 ILE B CG2   1 
ATOM   3237  C CD1   . ILE B  1 100 ? -31.495 -5.105  42.742  1.00 33.64  ? 162 ILE B CD1   1 
ATOM   3238  N N     . THR B  1 101 ? -35.363 -1.281  44.941  1.00 32.67  ? 163 THR B N     1 
ATOM   3239  C CA    . THR B  1 101 ? -36.395 -0.344  44.578  1.00 33.09  ? 163 THR B CA    1 
ATOM   3240  C C     . THR B  1 101 ? -35.701 0.782   43.838  1.00 33.51  ? 163 THR B C     1 
ATOM   3241  O O     . THR B  1 101 ? -34.674 1.261   44.291  1.00 33.28  ? 163 THR B O     1 
ATOM   3242  C CB    . THR B  1 101 ? -37.087 0.228   45.832  1.00 34.21  ? 163 THR B CB    1 
ATOM   3243  O OG1   . THR B  1 101 ? -37.476 -0.850  46.690  1.00 37.23  ? 163 THR B OG1   1 
ATOM   3244  C CG2   . THR B  1 101 ? -38.312 1.043   45.464  1.00 33.97  ? 163 THR B CG2   1 
ATOM   3245  N N     . ILE B  1 102 ? -36.257 1.204   42.705  1.00 34.53  ? 164 ILE B N     1 
ATOM   3246  C CA    . ILE B  1 102 ? -35.667 2.277   41.915  1.00 35.04  ? 164 ILE B CA    1 
ATOM   3247  C C     . ILE B  1 102 ? -36.507 3.505   42.052  1.00 37.48  ? 164 ILE B C     1 
ATOM   3248  O O     . ILE B  1 102 ? -37.714 3.425   41.957  1.00 41.17  ? 164 ILE B O     1 
ATOM   3249  C CB    . ILE B  1 102 ? -35.621 1.944   40.416  1.00 33.84  ? 164 ILE B CB    1 
ATOM   3250  C CG1   . ILE B  1 102 ? -34.744 0.708   40.165  1.00 33.60  ? 164 ILE B CG1   1 
ATOM   3251  C CG2   . ILE B  1 102 ? -35.114 3.135   39.617  1.00 33.57  ? 164 ILE B CG2   1 
ATOM   3252  C CD1   . ILE B  1 102 ? -33.301 0.817   40.615  1.00 32.54  ? 164 ILE B CD1   1 
ATOM   3253  N N     . PHE B  1 103 ? -35.863 4.643   42.247  1.00 40.86  ? 165 PHE B N     1 
ATOM   3254  C CA    . PHE B  1 103 ? -36.561 5.908   42.311  1.00 44.22  ? 165 PHE B CA    1 
ATOM   3255  C C     . PHE B  1 103 ? -36.214 6.707   41.063  1.00 43.97  ? 165 PHE B C     1 
ATOM   3256  O O     . PHE B  1 103 ? -35.084 7.147   40.879  1.00 42.97  ? 165 PHE B O     1 
ATOM   3257  C CB    . PHE B  1 103 ? -36.233 6.643   43.623  1.00 47.09  ? 165 PHE B CB    1 
ATOM   3258  C CG    . PHE B  1 103 ? -36.681 5.890   44.860  1.00 49.12  ? 165 PHE B CG    1 
ATOM   3259  C CD1   . PHE B  1 103 ? -37.918 6.149   45.441  1.00 50.16  ? 165 PHE B CD1   1 
ATOM   3260  C CD2   . PHE B  1 103 ? -35.879 4.894   45.422  1.00 49.90  ? 165 PHE B CD2   1 
ATOM   3261  C CE1   . PHE B  1 103 ? -38.336 5.446   46.565  1.00 50.51  ? 165 PHE B CE1   1 
ATOM   3262  C CE2   . PHE B  1 103 ? -36.292 4.189   46.545  1.00 50.21  ? 165 PHE B CE2   1 
ATOM   3263  C CZ    . PHE B  1 103 ? -37.522 4.467   47.118  1.00 50.45  ? 165 PHE B CZ    1 
ATOM   3264  N N     . LYS B  1 104 ? -37.216 6.865   40.207  1.00 45.01  ? 166 LYS B N     1 
ATOM   3265  C CA    . LYS B  1 104 ? -37.090 7.568   38.945  1.00 46.10  ? 166 LYS B CA    1 
ATOM   3266  C C     . LYS B  1 104 ? -37.038 9.070   39.228  1.00 43.69  ? 166 LYS B C     1 
ATOM   3267  O O     . LYS B  1 104 ? -38.041 9.700   39.504  1.00 44.89  ? 166 LYS B O     1 
ATOM   3268  C CB    . LYS B  1 104 ? -38.287 7.208   38.048  1.00 50.01  ? 166 LYS B CB    1 
ATOM   3269  C CG    . LYS B  1 104 ? -37.940 6.825   36.610  1.00 56.25  ? 166 LYS B CG    1 
ATOM   3270  C CD    . LYS B  1 104 ? -38.069 7.955   35.562  1.00 58.46  ? 166 LYS B CD    1 
ATOM   3271  C CE    . LYS B  1 104 ? -38.624 7.436   34.219  1.00 55.78  ? 166 LYS B CE    1 
ATOM   3272  N NZ    . LYS B  1 104 ? -38.676 8.438   33.121  1.00 53.68  ? 166 LYS B NZ    1 
ATOM   3273  N N     . GLY B  1 105 ? -35.853 9.648   39.206  1.00 43.18  ? 167 GLY B N     1 
ATOM   3274  C CA    . GLY B  1 105 ? -35.727 11.061  39.510  1.00 42.37  ? 167 GLY B CA    1 
ATOM   3275  C C     . GLY B  1 105 ? -34.292 11.484  39.748  1.00 40.03  ? 167 GLY B C     1 
ATOM   3276  O O     . GLY B  1 105 ? -33.392 10.670  39.826  1.00 37.29  ? 167 GLY B O     1 
ATOM   3277  N N     . LYS B  1 106 ? -34.110 12.783  39.899  1.00 41.60  ? 168 LYS B N     1 
ATOM   3278  C CA    . LYS B  1 106 ? -32.817 13.379  40.155  1.00 43.27  ? 168 LYS B CA    1 
ATOM   3279  C C     . LYS B  1 106 ? -32.509 13.150  41.628  1.00 45.23  ? 168 LYS B C     1 
ATOM   3280  O O     . LYS B  1 106 ? -33.389 13.278  42.478  1.00 53.02  ? 168 LYS B O     1 
ATOM   3281  C CB    . LYS B  1 106 ? -32.900 14.873  39.861  1.00 44.96  ? 168 LYS B CB    1 
ATOM   3282  C CG    . LYS B  1 106 ? -31.639 15.504  39.307  1.00 45.59  ? 168 LYS B CG    1 
ATOM   3283  C CD    . LYS B  1 106 ? -31.900 16.920  38.803  1.00 47.65  ? 168 LYS B CD    1 
ATOM   3284  C CE    . LYS B  1 106 ? -32.981 16.964  37.712  1.00 49.33  ? 168 LYS B CE    1 
ATOM   3285  N NZ    . LYS B  1 106 ? -33.165 18.331  37.146  1.00 50.70  ? 168 LYS B NZ    1 
ATOM   3286  N N     . VAL B  1 107 ? -31.271 12.822  41.947  1.00 45.18  ? 169 VAL B N     1 
ATOM   3287  C CA    . VAL B  1 107 ? -30.881 12.560  43.336  1.00 46.04  ? 169 VAL B CA    1 
ATOM   3288  C C     . VAL B  1 107 ? -31.188 13.742  44.262  1.00 46.65  ? 169 VAL B C     1 
ATOM   3289  O O     . VAL B  1 107 ? -31.751 13.564  45.354  1.00 44.83  ? 169 VAL B O     1 
ATOM   3290  C CB    . VAL B  1 107 ? -29.385 12.193  43.402  1.00 47.76  ? 169 VAL B CB    1 
ATOM   3291  C CG1   . VAL B  1 107 ? -28.808 12.363  44.802  1.00 47.80  ? 169 VAL B CG1   1 
ATOM   3292  C CG2   . VAL B  1 107 ? -29.172 10.772  42.896  1.00 47.92  ? 169 VAL B CG2   1 
ATOM   3293  N N     . GLU B  1 108 ? -30.855 14.948  43.803  1.00 48.24  ? 170 GLU B N     1 
ATOM   3294  C CA    . GLU B  1 108 ? -31.027 16.160  44.621  1.00 48.96  ? 170 GLU B CA    1 
ATOM   3295  C C     . GLU B  1 108 ? -32.513 16.501  44.809  1.00 45.72  ? 170 GLU B C     1 
ATOM   3296  O O     . GLU B  1 108 ? -32.852 17.533  45.399  1.00 44.86  ? 170 GLU B O     1 
ATOM   3297  C CB    . GLU B  1 108 ? -30.197 17.374  44.099  1.00 51.67  ? 170 GLU B CB    1 
ATOM   3298  C CG    . GLU B  1 108 ? -29.810 17.405  42.619  1.00 53.21  ? 170 GLU B CG    1 
ATOM   3299  C CD    . GLU B  1 108 ? -28.633 16.486  42.297  1.00 55.83  ? 170 GLU B CD    1 
ATOM   3300  O OE1   . GLU B  1 108 ? -27.468 16.753  42.712  1.00 54.56  ? 170 GLU B OE1   1 
ATOM   3301  O OE2   . GLU B  1 108 ? -28.887 15.473  41.619  1.00 54.97  ? 170 GLU B OE2   1 
ATOM   3302  N N     . GLU B  1 109 ? -33.383 15.606  44.335  1.00 44.16  ? 171 GLU B N     1 
ATOM   3303  C CA    . GLU B  1 109 ? -34.832 15.791  44.395  1.00 45.13  ? 171 GLU B CA    1 
ATOM   3304  C C     . GLU B  1 109 ? -35.661 14.631  44.930  1.00 45.47  ? 171 GLU B C     1 
ATOM   3305  O O     . GLU B  1 109 ? -36.715 14.853  45.458  1.00 53.46  ? 171 GLU B O     1 
ATOM   3306  C CB    . GLU B  1 109 ? -35.387 16.147  43.022  1.00 41.65  ? 171 GLU B CB    1 
ATOM   3307  C CG    . GLU B  1 109 ? -34.983 17.538  42.551  1.00 39.04  ? 171 GLU B CG    1 
ATOM   3308  C CD    . GLU B  1 109 ? -35.248 17.729  41.081  1.00 35.54  ? 171 GLU B CD    1 
ATOM   3309  O OE1   . GLU B  1 109 ? -35.845 16.811  40.472  1.00 33.93  ? 171 GLU B OE1   1 
ATOM   3310  O OE2   . GLU B  1 109 ? -34.885 18.798  40.553  1.00 32.03  ? 171 GLU B OE2   1 
ATOM   3311  N N     . VAL B  1 110 ? -35.243 13.399  44.826  1.00 44.89  ? 172 VAL B N     1 
ATOM   3312  C CA    . VAL B  1 110 ? -36.088 12.386  45.424  1.00 47.55  ? 172 VAL B CA    1 
ATOM   3313  C C     . VAL B  1 110 ? -35.906 12.297  46.958  1.00 48.37  ? 172 VAL B C     1 
ATOM   3314  O O     . VAL B  1 110 ? -35.019 12.936  47.541  1.00 45.45  ? 172 VAL B O     1 
ATOM   3315  C CB    . VAL B  1 110 ? -35.910 11.015  44.749  1.00 49.56  ? 172 VAL B CB    1 
ATOM   3316  C CG1   . VAL B  1 110 ? -36.094 11.151  43.245  1.00 49.80  ? 172 VAL B CG1   1 
ATOM   3317  C CG2   . VAL B  1 110 ? -34.567 10.399  45.089  1.00 51.04  ? 172 VAL B CG2   1 
ATOM   3318  N N     . GLU B  1 111 ? -36.786 11.518  47.587  1.00 49.41  ? 173 GLU B N     1 
ATOM   3319  C CA    . GLU B  1 111 ? -36.768 11.275  49.018  1.00 50.10  ? 173 GLU B CA    1 
ATOM   3320  C C     . GLU B  1 111 ? -36.877 9.782   49.200  1.00 46.51  ? 173 GLU B C     1 
ATOM   3321  O O     . GLU B  1 111 ? -37.519 9.100   48.410  1.00 41.94  ? 173 GLU B O     1 
ATOM   3322  C CB    . GLU B  1 111 ? -37.950 11.974  49.697  1.00 55.51  ? 173 GLU B CB    1 
ATOM   3323  C CG    . GLU B  1 111 ? -37.581 12.753  50.954  1.00 60.30  ? 173 GLU B CG    1 
ATOM   3324  C CD    . GLU B  1 111 ? -36.642 13.921  50.681  1.00 61.06  ? 173 GLU B CD    1 
ATOM   3325  O OE1   . GLU B  1 111 ? -35.622 14.049  51.384  1.00 60.01  ? 173 GLU B OE1   1 
ATOM   3326  O OE2   . GLU B  1 111 ? -36.919 14.707  49.754  1.00 62.51  ? 173 GLU B OE2   1 
ATOM   3327  N N     . LEU B  1 112 ? -36.226 9.280   50.236  1.00 47.76  ? 174 LEU B N     1 
ATOM   3328  C CA    . LEU B  1 112 ? -36.161 7.846   50.475  1.00 50.03  ? 174 LEU B CA    1 
ATOM   3329  C C     . LEU B  1 112 ? -37.089 7.444   51.636  1.00 49.73  ? 174 LEU B C     1 
ATOM   3330  O O     . LEU B  1 112 ? -37.415 8.256   52.503  1.00 47.23  ? 174 LEU B O     1 
ATOM   3331  C CB    . LEU B  1 112 ? -34.700 7.417   50.752  1.00 52.17  ? 174 LEU B CB    1 
ATOM   3332  C CG    . LEU B  1 112 ? -33.676 7.625   49.620  1.00 55.07  ? 174 LEU B CG    1 
ATOM   3333  C CD1   . LEU B  1 112 ? -32.238 7.437   50.091  1.00 55.72  ? 174 LEU B CD1   1 
ATOM   3334  C CD2   . LEU B  1 112 ? -33.949 6.715   48.434  1.00 55.69  ? 174 LEU B CD2   1 
ATOM   3335  N N     . PRO B  1 113 ? -37.501 6.174   51.664  1.00 49.80  ? 175 PRO B N     1 
ATOM   3336  C CA    . PRO B  1 113 ? -38.224 5.652   52.815  1.00 49.91  ? 175 PRO B CA    1 
ATOM   3337  C C     . PRO B  1 113 ? -37.414 5.435   54.109  1.00 48.88  ? 175 PRO B C     1 
ATOM   3338  O O     . PRO B  1 113 ? -37.951 4.830   55.020  1.00 46.55  ? 175 PRO B O     1 
ATOM   3339  C CB    . PRO B  1 113 ? -38.733 4.297   52.311  1.00 51.38  ? 175 PRO B CB    1 
ATOM   3340  C CG    . PRO B  1 113 ? -37.742 3.888   51.279  1.00 51.03  ? 175 PRO B CG    1 
ATOM   3341  C CD    . PRO B  1 113 ? -37.314 5.157   50.612  1.00 51.23  ? 175 PRO B CD    1 
ATOM   3342  N N     . VAL B  1 114 ? -36.151 5.873   54.183  1.00 50.83  ? 176 VAL B N     1 
ATOM   3343  C CA    . VAL B  1 114 ? -35.381 5.897   55.449  1.00 51.53  ? 176 VAL B CA    1 
ATOM   3344  C C     . VAL B  1 114 ? -34.660 7.235   55.572  1.00 52.13  ? 176 VAL B C     1 
ATOM   3345  O O     . VAL B  1 114 ? -34.599 7.993   54.614  1.00 53.11  ? 176 VAL B O     1 
ATOM   3346  C CB    . VAL B  1 114 ? -34.346 4.753   55.557  1.00 53.91  ? 176 VAL B CB    1 
ATOM   3347  C CG1   . VAL B  1 114 ? -35.028 3.390   55.483  1.00 55.26  ? 176 VAL B CG1   1 
ATOM   3348  C CG2   . VAL B  1 114 ? -33.288 4.859   54.467  1.00 55.19  ? 176 VAL B CG2   1 
ATOM   3349  N N     . GLU B  1 115 ? -34.117 7.529   56.748  1.00 53.12  ? 177 GLU B N     1 
ATOM   3350  C CA    . GLU B  1 115 ? -33.399 8.799   56.975  1.00 52.00  ? 177 GLU B CA    1 
ATOM   3351  C C     . GLU B  1 115 ? -31.916 8.699   56.651  1.00 49.69  ? 177 GLU B C     1 
ATOM   3352  O O     . GLU B  1 115 ? -31.300 9.663   56.186  1.00 45.30  ? 177 GLU B O     1 
ATOM   3353  C CB    . GLU B  1 115 ? -33.528 9.220   58.424  1.00 53.97  ? 177 GLU B CB    1 
ATOM   3354  C CG    . GLU B  1 115 ? -34.849 9.862   58.752  1.00 55.57  ? 177 GLU B CG    1 
ATOM   3355  C CD    . GLU B  1 115 ? -34.887 10.327  60.175  1.00 61.19  ? 177 GLU B CD    1 
ATOM   3356  O OE1   . GLU B  1 115 ? -35.955 10.794  60.601  1.00 67.76  ? 177 GLU B OE1   1 
ATOM   3357  O OE2   . GLU B  1 115 ? -33.850 10.226  60.870  1.00 63.61  ? 177 GLU B OE2   1 
ATOM   3358  N N     . LYS B  1 116 ? -31.361 7.519   56.930  1.00 48.17  ? 178 LYS B N     1 
ATOM   3359  C CA    . LYS B  1 116 ? -29.947 7.240   56.764  1.00 44.78  ? 178 LYS B CA    1 
ATOM   3360  C C     . LYS B  1 116 ? -29.716 5.880   56.134  1.00 44.01  ? 178 LYS B C     1 
ATOM   3361  O O     . LYS B  1 116 ? -30.567 4.989   56.225  1.00 44.85  ? 178 LYS B O     1 
ATOM   3362  C CB    . LYS B  1 116 ? -29.249 7.303   58.117  1.00 43.26  ? 178 LYS B CB    1 
ATOM   3363  C CG    . LYS B  1 116 ? -28.288 8.473   58.264  1.00 41.81  ? 178 LYS B CG    1 
ATOM   3364  C CD    . LYS B  1 116 ? -28.899 9.846   58.015  1.00 39.48  ? 178 LYS B CD    1 
ATOM   3365  C CE    . LYS B  1 116 ? -27.843 10.919  58.233  1.00 37.95  ? 178 LYS B CE    1 
ATOM   3366  N NZ    . LYS B  1 116 ? -28.305 12.300  57.941  1.00 36.27  ? 178 LYS B NZ    1 
ATOM   3367  N N     . VAL B  1 117 ? -28.545 5.739   55.509  1.00 43.22  ? 179 VAL B N     1 
ATOM   3368  C CA    . VAL B  1 117 ? -28.189 4.581   54.687  1.00 41.00  ? 179 VAL B CA    1 
ATOM   3369  C C     . VAL B  1 117 ? -26.818 4.049   55.114  1.00 38.18  ? 179 VAL B C     1 
ATOM   3370  O O     . VAL B  1 117 ? -25.956 4.820   55.523  1.00 35.78  ? 179 VAL B O     1 
ATOM   3371  C CB    . VAL B  1 117 ? -28.180 4.982   53.202  1.00 42.15  ? 179 VAL B CB    1 
ATOM   3372  C CG1   . VAL B  1 117 ? -27.293 4.070   52.390  1.00 44.01  ? 179 VAL B CG1   1 
ATOM   3373  C CG2   . VAL B  1 117 ? -29.590 4.948   52.632  1.00 43.59  ? 179 VAL B CG2   1 
ATOM   3374  N N     . ASP B  1 118 ? -26.636 2.730   55.034  1.00 37.41  ? 180 ASP B N     1 
ATOM   3375  C CA    . ASP B  1 118 ? -25.392 2.085   55.475  1.00 38.24  ? 180 ASP B CA    1 
ATOM   3376  C C     . ASP B  1 118 ? -24.237 2.225   54.478  1.00 37.45  ? 180 ASP B C     1 
ATOM   3377  O O     . ASP B  1 118 ? -23.100 2.418   54.882  1.00 39.72  ? 180 ASP B O     1 
ATOM   3378  C CB    . ASP B  1 118 ? -25.608 0.590   55.761  1.00 38.35  ? 180 ASP B CB    1 
ATOM   3379  C CG    . ASP B  1 118 ? -26.618 0.338   56.866  1.00 38.64  ? 180 ASP B CG    1 
ATOM   3380  O OD1   . ASP B  1 118 ? -26.481 0.877   57.990  1.00 38.44  ? 180 ASP B OD1   1 
ATOM   3381  O OD2   . ASP B  1 118 ? -27.552 -0.432  56.611  1.00 40.38  ? 180 ASP B OD2   1 
ATOM   3382  N N     . ILE B  1 119 ? -24.520 2.092   53.187  1.00 35.46  ? 181 ILE B N     1 
ATOM   3383  C CA    . ILE B  1 119 ? -23.478 2.053   52.165  1.00 33.77  ? 181 ILE B CA    1 
ATOM   3384  C C     . ILE B  1 119 ? -23.907 2.790   50.926  1.00 31.70  ? 181 ILE B C     1 
ATOM   3385  O O     . ILE B  1 119 ? -25.002 2.569   50.442  1.00 31.29  ? 181 ILE B O     1 
ATOM   3386  C CB    . ILE B  1 119 ? -23.207 0.605   51.720  1.00 34.07  ? 181 ILE B CB    1 
ATOM   3387  C CG1   . ILE B  1 119 ? -22.636 -0.224  52.879  1.00 34.85  ? 181 ILE B CG1   1 
ATOM   3388  C CG2   . ILE B  1 119 ? -22.250 0.592   50.543  1.00 34.02  ? 181 ILE B CG2   1 
ATOM   3389  C CD1   . ILE B  1 119 ? -22.631 -1.718  52.629  1.00 34.78  ? 181 ILE B CD1   1 
ATOM   3390  N N     . ILE B  1 120 ? -23.033 3.631   50.387  1.00 30.12  ? 182 ILE B N     1 
ATOM   3391  C CA    . ILE B  1 120 ? -23.268 4.243   49.081  1.00 28.76  ? 182 ILE B CA    1 
ATOM   3392  C C     . ILE B  1 120 ? -22.370 3.608   47.995  1.00 29.20  ? 182 ILE B C     1 
ATOM   3393  O O     . ILE B  1 120 ? -21.179 3.482   48.173  1.00 30.81  ? 182 ILE B O     1 
ATOM   3394  C CB    . ILE B  1 120 ? -23.051 5.755   49.156  1.00 27.33  ? 182 ILE B CB    1 
ATOM   3395  C CG1   . ILE B  1 120 ? -24.273 6.410   49.795  1.00 27.56  ? 182 ILE B CG1   1 
ATOM   3396  C CG2   . ILE B  1 120 ? -22.818 6.327   47.772  1.00 27.92  ? 182 ILE B CG2   1 
ATOM   3397  C CD1   . ILE B  1 120 ? -24.136 7.899   50.043  1.00 27.83  ? 182 ILE B CD1   1 
ATOM   3398  N N     . ILE B  1 121 ? -22.951 3.201   46.873  1.00 30.16  ? 183 ILE B N     1 
ATOM   3399  C CA    . ILE B  1 121 ? -22.186 2.706   45.720  1.00 30.33  ? 183 ILE B CA    1 
ATOM   3400  C C     . ILE B  1 121 ? -22.452 3.628   44.531  1.00 32.31  ? 183 ILE B C     1 
ATOM   3401  O O     . ILE B  1 121 ? -23.578 4.074   44.332  1.00 33.33  ? 183 ILE B O     1 
ATOM   3402  C CB    . ILE B  1 121 ? -22.553 1.239   45.350  1.00 28.68  ? 183 ILE B CB    1 
ATOM   3403  C CG1   . ILE B  1 121 ? -24.002 1.119   44.922  1.00 28.41  ? 183 ILE B CG1   1 
ATOM   3404  C CG2   . ILE B  1 121 ? -22.323 0.293   46.516  1.00 27.95  ? 183 ILE B CG2   1 
ATOM   3405  C CD1   . ILE B  1 121 ? -24.416 -0.311  44.709  1.00 29.46  ? 183 ILE B CD1   1 
ATOM   3406  N N     . SER B  1 122 ? -21.437 3.928   43.732  1.00 34.76  ? 184 SER B N     1 
ATOM   3407  C CA    . SER B  1 122 ? -21.661 4.767   42.549  1.00 37.01  ? 184 SER B CA    1 
ATOM   3408  C C     . SER B  1 122 ? -20.513 4.683   41.555  1.00 36.91  ? 184 SER B C     1 
ATOM   3409  O O     . SER B  1 122 ? -19.365 4.701   41.991  1.00 39.28  ? 184 SER B O     1 
ATOM   3410  C CB    . SER B  1 122 ? -21.825 6.224   42.977  1.00 37.72  ? 184 SER B CB    1 
ATOM   3411  O OG    . SER B  1 122 ? -22.280 7.011   41.890  1.00 39.97  ? 184 SER B OG    1 
ATOM   3412  N N     . GLU B  1 123 ? -20.809 4.576   40.246  1.00 35.75  ? 185 GLU B N     1 
ATOM   3413  C CA    . GLU B  1 123 ? -19.819 4.920   39.197  1.00 34.95  ? 185 GLU B CA    1 
ATOM   3414  C C     . GLU B  1 123 ? -20.192 6.298   38.687  1.00 32.97  ? 185 GLU B C     1 
ATOM   3415  O O     . GLU B  1 123 ? -21.134 6.477   37.929  1.00 32.58  ? 185 GLU B O     1 
ATOM   3416  C CB    . GLU B  1 123 ? -19.704 3.880   38.079  1.00 36.58  ? 185 GLU B CB    1 
ATOM   3417  C CG    . GLU B  1 123 ? -19.833 4.412   36.638  1.00 39.53  ? 185 GLU B CG    1 
ATOM   3418  C CD    . GLU B  1 123 ? -18.635 5.163   36.134  1.00 38.60  ? 185 GLU B CD    1 
ATOM   3419  O OE1   . GLU B  1 123 ? -17.625 5.025   36.840  1.00 38.08  ? 185 GLU B OE1   1 
ATOM   3420  O OE2   . GLU B  1 123 ? -18.728 5.869   35.072  1.00 37.29  ? 185 GLU B OE2   1 
ATOM   3421  N N     . TRP B  1 124 ? -19.451 7.273   39.182  1.00 31.61  ? 186 TRP B N     1 
ATOM   3422  C CA    . TRP B  1 124 ? -19.714 8.666   38.959  1.00 30.58  ? 186 TRP B CA    1 
ATOM   3423  C C     . TRP B  1 124 ? -18.599 9.244   38.131  1.00 29.42  ? 186 TRP B C     1 
ATOM   3424  O O     . TRP B  1 124 ? -18.562 10.442  37.881  1.00 29.65  ? 186 TRP B O     1 
ATOM   3425  C CB    . TRP B  1 124 ? -19.753 9.398   40.302  1.00 31.36  ? 186 TRP B CB    1 
ATOM   3426  C CG    . TRP B  1 124 ? -18.563 9.120   41.169  1.00 31.18  ? 186 TRP B CG    1 
ATOM   3427  C CD1   . TRP B  1 124 ? -18.481 8.190   42.167  1.00 32.11  ? 186 TRP B CD1   1 
ATOM   3428  C CD2   . TRP B  1 124 ? -17.295 9.775   41.125  1.00 30.78  ? 186 TRP B CD2   1 
ATOM   3429  N NE1   . TRP B  1 124 ? -17.238 8.231   42.752  1.00 32.74  ? 186 TRP B NE1   1 
ATOM   3430  C CE2   . TRP B  1 124 ? -16.488 9.194   42.127  1.00 31.58  ? 186 TRP B CE2   1 
ATOM   3431  C CE3   . TRP B  1 124 ? -16.762 10.800  40.347  1.00 31.06  ? 186 TRP B CE3   1 
ATOM   3432  C CZ2   . TRP B  1 124 ? -15.174 9.609   42.365  1.00 30.03  ? 186 TRP B CZ2   1 
ATOM   3433  C CZ3   . TRP B  1 124 ? -15.458 11.203  40.580  1.00 30.71  ? 186 TRP B CZ3   1 
ATOM   3434  C CH2   . TRP B  1 124 ? -14.682 10.607  41.581  1.00 29.94  ? 186 TRP B CH2   1 
ATOM   3435  N N     . MET B  1 125 ? -17.666 8.410   37.715  1.00 27.75  ? 187 MET B N     1 
ATOM   3436  C CA    . MET B  1 125 ? -16.482 8.933   37.093  1.00 26.82  ? 187 MET B CA    1 
ATOM   3437  C C     . MET B  1 125 ? -16.685 9.211   35.620  1.00 26.27  ? 187 MET B C     1 
ATOM   3438  O O     . MET B  1 125 ? -17.386 8.480   34.894  1.00 26.85  ? 187 MET B O     1 
ATOM   3439  C CB    . MET B  1 125 ? -15.331 7.981   37.292  1.00 27.02  ? 187 MET B CB    1 
ATOM   3440  C CG    . MET B  1 125 ? -14.862 7.864   38.745  1.00 26.50  ? 187 MET B CG    1 
ATOM   3441  S SD    . MET B  1 125 ? -15.678 6.614   39.748  1.00 24.92  ? 187 MET B SD    1 
ATOM   3442  C CE    . MET B  1 125 ? -15.098 5.105   38.988  1.00 24.69  ? 187 MET B CE    1 
ATOM   3443  N N     . GLY B  1 126 ? -16.082 10.316  35.215  1.00 26.44  ? 188 GLY B N     1 
ATOM   3444  C CA    . GLY B  1 126 ? -16.151 10.803  33.859  1.00 27.70  ? 188 GLY B CA    1 
ATOM   3445  C C     . GLY B  1 126 ? -14.735 10.943  33.346  1.00 28.10  ? 188 GLY B C     1 
ATOM   3446  O O     . GLY B  1 126 ? -13.773 10.757  34.090  1.00 30.58  ? 188 GLY B O     1 
ATOM   3447  N N     . TYR B  1 127 ? -14.614 11.256  32.065  1.00 27.06  ? 189 TYR B N     1 
ATOM   3448  C CA    . TYR B  1 127 ? -13.325 11.463  31.435  1.00 26.18  ? 189 TYR B CA    1 
ATOM   3449  C C     . TYR B  1 127 ? -12.494 12.496  32.226  1.00 25.64  ? 189 TYR B C     1 
ATOM   3450  O O     . TYR B  1 127 ? -13.033 13.435  32.772  1.00 23.41  ? 189 TYR B O     1 
ATOM   3451  C CB    . TYR B  1 127 ? -13.543 11.928  29.991  1.00 26.10  ? 189 TYR B CB    1 
ATOM   3452  C CG    . TYR B  1 127 ? -14.314 10.953  29.082  1.00 26.35  ? 189 TYR B CG    1 
ATOM   3453  C CD1   . TYR B  1 127 ? -13.947 9.602   28.974  1.00 26.85  ? 189 TYR B CD1   1 
ATOM   3454  C CD2   . TYR B  1 127 ? -15.379 11.391  28.296  1.00 26.06  ? 189 TYR B CD2   1 
ATOM   3455  C CE1   . TYR B  1 127 ? -14.641 8.725   28.135  1.00 25.93  ? 189 TYR B CE1   1 
ATOM   3456  C CE2   . TYR B  1 127 ? -16.076 10.513  27.458  1.00 25.15  ? 189 TYR B CE2   1 
ATOM   3457  C CZ    . TYR B  1 127 ? -15.706 9.185   27.382  1.00 24.46  ? 189 TYR B CZ    1 
ATOM   3458  O OH    . TYR B  1 127 ? -16.363 8.322   26.549  1.00 21.82  ? 189 TYR B OH    1 
ATOM   3459  N N     . CYS B  1 128 ? -11.181 12.300  32.311  1.00 27.19  ? 190 CYS B N     1 
ATOM   3460  C CA    . CYS B  1 128 ? -10.327 13.162  33.136  1.00 27.37  ? 190 CYS B CA    1 
ATOM   3461  C C     . CYS B  1 128 ? -10.847 13.238  34.592  1.00 27.13  ? 190 CYS B C     1 
ATOM   3462  O O     . CYS B  1 128 ? -10.699 14.252  35.281  1.00 26.10  ? 190 CYS B O     1 
ATOM   3463  C CB    . CYS B  1 128 ? -10.242 14.552  32.493  1.00 28.52  ? 190 CYS B CB    1 
ATOM   3464  S SG    . CYS B  1 128 ? -8.811  15.548  32.986  1.00 30.52  ? 190 CYS B SG    1 
ATOM   3465  N N     . LEU B  1 129 ? -11.472 12.141  35.028  1.00 27.80  ? 191 LEU B N     1 
ATOM   3466  C CA    . LEU B  1 129 ? -12.114 11.985  36.357  1.00 27.87  ? 191 LEU B CA    1 
ATOM   3467  C C     . LEU B  1 129 ? -13.410 12.780  36.632  1.00 28.38  ? 191 LEU B C     1 
ATOM   3468  O O     . LEU B  1 129 ? -14.443 12.199  37.000  1.00 27.38  ? 191 LEU B O     1 
ATOM   3469  C CB    . LEU B  1 129 ? -11.114 12.240  37.484  1.00 26.69  ? 191 LEU B CB    1 
ATOM   3470  C CG    . LEU B  1 129 ? -11.563 11.763  38.870  1.00 25.73  ? 191 LEU B CG    1 
ATOM   3471  C CD1   . LEU B  1 129 ? -12.002 10.311  38.855  1.00 25.34  ? 191 LEU B CD1   1 
ATOM   3472  C CD2   . LEU B  1 129 ? -10.450 11.948  39.880  1.00 25.21  ? 191 LEU B CD2   1 
ATOM   3473  N N     . PHE B  1 130 ? -13.342 14.096  36.449  1.00 29.52  ? 192 PHE B N     1 
ATOM   3474  C CA    . PHE B  1 130 ? -14.393 15.007  36.907  1.00 30.31  ? 192 PHE B CA    1 
ATOM   3475  C C     . PHE B  1 130 ? -15.435 15.446  35.872  1.00 32.00  ? 192 PHE B C     1 
ATOM   3476  O O     . PHE B  1 130 ? -16.384 16.140  36.223  1.00 31.77  ? 192 PHE B O     1 
ATOM   3477  C CB    . PHE B  1 130 ? -13.730 16.242  37.512  1.00 29.17  ? 192 PHE B CB    1 
ATOM   3478  C CG    . PHE B  1 130 ? -12.860 15.928  38.692  1.00 28.74  ? 192 PHE B CG    1 
ATOM   3479  C CD1   . PHE B  1 130 ? -13.409 15.323  39.841  1.00 28.72  ? 192 PHE B CD1   1 
ATOM   3480  C CD2   . PHE B  1 130 ? -11.507 16.204  38.672  1.00 28.07  ? 192 PHE B CD2   1 
ATOM   3481  C CE1   . PHE B  1 130 ? -12.622 15.012  40.942  1.00 27.27  ? 192 PHE B CE1   1 
ATOM   3482  C CE2   . PHE B  1 130 ? -10.708 15.892  39.774  1.00 27.61  ? 192 PHE B CE2   1 
ATOM   3483  C CZ    . PHE B  1 130 ? -11.266 15.296  40.909  1.00 27.13  ? 192 PHE B CZ    1 
ATOM   3484  N N     . TYR B  1 131 ? -15.272 15.028  34.615  1.00 36.43  ? 193 TYR B N     1 
ATOM   3485  C CA    . TYR B  1 131 ? -16.191 15.408  33.517  1.00 37.86  ? 193 TYR B CA    1 
ATOM   3486  C C     . TYR B  1 131 ? -17.628 14.961  33.837  1.00 38.51  ? 193 TYR B C     1 
ATOM   3487  O O     . TYR B  1 131 ? -17.847 13.879  34.392  1.00 37.70  ? 193 TYR B O     1 
ATOM   3488  C CB    . TYR B  1 131 ? -15.710 14.873  32.139  1.00 37.05  ? 193 TYR B CB    1 
ATOM   3489  C CG    . TYR B  1 131 ? -16.541 15.340  30.969  1.00 37.35  ? 193 TYR B CG    1 
ATOM   3490  C CD1   . TYR B  1 131 ? -16.634 16.700  30.654  1.00 37.67  ? 193 TYR B CD1   1 
ATOM   3491  C CD2   . TYR B  1 131 ? -17.253 14.430  30.179  1.00 38.83  ? 193 TYR B CD2   1 
ATOM   3492  C CE1   . TYR B  1 131 ? -17.418 17.144  29.589  1.00 38.24  ? 193 TYR B CE1   1 
ATOM   3493  C CE2   . TYR B  1 131 ? -18.043 14.865  29.103  1.00 38.75  ? 193 TYR B CE2   1 
ATOM   3494  C CZ    . TYR B  1 131 ? -18.123 16.223  28.815  1.00 38.32  ? 193 TYR B CZ    1 
ATOM   3495  O OH    . TYR B  1 131 ? -18.891 16.672  27.766  1.00 34.56  ? 193 TYR B OH    1 
ATOM   3496  N N     . GLU B  1 132 ? -18.573 15.849  33.512  1.00 38.90  ? 194 GLU B N     1 
ATOM   3497  C CA    . GLU B  1 132 ? -19.987 15.736  33.872  1.00 38.32  ? 194 GLU B CA    1 
ATOM   3498  C C     . GLU B  1 132 ? -20.289 16.140  35.311  1.00 35.20  ? 194 GLU B C     1 
ATOM   3499  O O     . GLU B  1 132 ? -21.449 16.287  35.664  1.00 33.70  ? 194 GLU B O     1 
ATOM   3500  C CB    . GLU B  1 132 ? -20.539 14.339  33.563  1.00 41.47  ? 194 GLU B CB    1 
ATOM   3501  C CG    . GLU B  1 132 ? -20.478 14.000  32.084  1.00 45.47  ? 194 GLU B CG    1 
ATOM   3502  C CD    . GLU B  1 132 ? -20.843 12.566  31.786  1.00 48.35  ? 194 GLU B CD    1 
ATOM   3503  O OE1   . GLU B  1 132 ? -20.948 11.763  32.736  1.00 52.86  ? 194 GLU B OE1   1 
ATOM   3504  O OE2   . GLU B  1 132 ? -21.017 12.252  30.591  1.00 50.38  ? 194 GLU B OE2   1 
ATOM   3505  N N     . SER B  1 133 ? -19.253 16.334  36.122  1.00 33.08  ? 195 SER B N     1 
ATOM   3506  C CA    . SER B  1 133 ? -19.388 16.836  37.496  1.00 31.63  ? 195 SER B CA    1 
ATOM   3507  C C     . SER B  1 133 ? -20.225 15.964  38.454  1.00 29.09  ? 195 SER B C     1 
ATOM   3508  O O     . SER B  1 133 ? -20.710 16.446  39.476  1.00 27.90  ? 195 SER B O     1 
ATOM   3509  C CB    . SER B  1 133 ? -19.913 18.284  37.461  1.00 31.24  ? 195 SER B CB    1 
ATOM   3510  O OG    . SER B  1 133 ? -18.926 19.148  36.926  1.00 32.66  ? 195 SER B OG    1 
ATOM   3511  N N     . MET B  1 134 ? -20.351 14.674  38.149  1.00 27.64  ? 196 MET B N     1 
ATOM   3512  C CA    . MET B  1 134 ? -21.264 13.808  38.889  1.00 26.73  ? 196 MET B CA    1 
ATOM   3513  C C     . MET B  1 134 ? -20.809 13.519  40.324  1.00 28.15  ? 196 MET B C     1 
ATOM   3514  O O     . MET B  1 134 ? -21.606 13.052  41.142  1.00 28.63  ? 196 MET B O     1 
ATOM   3515  C CB    . MET B  1 134 ? -21.494 12.486  38.164  1.00 25.78  ? 196 MET B CB    1 
ATOM   3516  C CG    . MET B  1 134 ? -22.498 11.603  38.879  1.00 26.15  ? 196 MET B CG    1 
ATOM   3517  S SD    . MET B  1 134 ? -22.885 10.047  38.071  1.00 26.73  ? 196 MET B SD    1 
ATOM   3518  C CE    . MET B  1 134 ? -23.864 9.197   39.304  1.00 27.02  ? 196 MET B CE    1 
ATOM   3519  N N     . LEU B  1 135 ? -19.547 13.792  40.649  1.00 29.48  ? 197 LEU B N     1 
ATOM   3520  C CA    . LEU B  1 135 ? -19.098 13.684  42.042  1.00 29.73  ? 197 LEU B CA    1 
ATOM   3521  C C     . LEU B  1 135 ? -19.918 14.586  42.984  1.00 30.23  ? 197 LEU B C     1 
ATOM   3522  O O     . LEU B  1 135 ? -20.185 14.208  44.135  1.00 28.19  ? 197 LEU B O     1 
ATOM   3523  C CB    . LEU B  1 135 ? -17.616 14.027  42.160  1.00 29.37  ? 197 LEU B CB    1 
ATOM   3524  C CG    . LEU B  1 135 ? -16.981 13.867  43.551  1.00 29.00  ? 197 LEU B CG    1 
ATOM   3525  C CD1   . LEU B  1 135 ? -17.292 12.504  44.171  1.00 28.70  ? 197 LEU B CD1   1 
ATOM   3526  C CD2   . LEU B  1 135 ? -15.476 14.103  43.469  1.00 28.00  ? 197 LEU B CD2   1 
ATOM   3527  N N     . ASN B  1 136 ? -20.328 15.756  42.469  1.00 31.54  ? 198 ASN B N     1 
ATOM   3528  C CA    . ASN B  1 136 ? -21.181 16.706  43.205  1.00 30.98  ? 198 ASN B CA    1 
ATOM   3529  C C     . ASN B  1 136 ? -22.445 16.059  43.677  1.00 30.08  ? 198 ASN B C     1 
ATOM   3530  O O     . ASN B  1 136 ? -22.885 16.301  44.804  1.00 30.08  ? 198 ASN B O     1 
ATOM   3531  C CB    . ASN B  1 136 ? -21.532 17.909  42.348  1.00 30.66  ? 198 ASN B CB    1 
ATOM   3532  C CG    . ASN B  1 136 ? -20.305 18.640  41.863  1.00 31.85  ? 198 ASN B CG    1 
ATOM   3533  O OD1   . ASN B  1 136 ? -19.182 18.237  42.142  1.00 31.69  ? 198 ASN B OD1   1 
ATOM   3534  N ND2   . ASN B  1 136 ? -20.509 19.718  41.131  1.00 33.97  ? 198 ASN B ND2   1 
ATOM   3535  N N     . THR B  1 137 ? -23.021 15.236  42.812  1.00 29.26  ? 199 THR B N     1 
ATOM   3536  C CA    . THR B  1 137 ? -24.197 14.466  43.173  1.00 30.84  ? 199 THR B CA    1 
ATOM   3537  C C     . THR B  1 137 ? -23.884 13.423  44.252  1.00 31.39  ? 199 THR B C     1 
ATOM   3538  O O     . THR B  1 137 ? -24.656 13.227  45.191  1.00 30.91  ? 199 THR B O     1 
ATOM   3539  C CB    . THR B  1 137 ? -24.812 13.780  41.944  1.00 30.73  ? 199 THR B CB    1 
ATOM   3540  O OG1   . THR B  1 137 ? -25.230 14.781  41.017  1.00 31.23  ? 199 THR B OG1   1 
ATOM   3541  C CG2   . THR B  1 137 ? -26.014 12.939  42.338  1.00 30.83  ? 199 THR B CG2   1 
ATOM   3542  N N     . VAL B  1 138 ? -22.759 12.745  44.122  1.00 32.36  ? 200 VAL B N     1 
ATOM   3543  C CA    . VAL B  1 138 ? -22.388 11.765  45.129  1.00 32.97  ? 200 VAL B CA    1 
ATOM   3544  C C     . VAL B  1 138 ? -22.189 12.435  46.484  1.00 34.55  ? 200 VAL B C     1 
ATOM   3545  O O     . VAL B  1 138 ? -22.641 11.902  47.505  1.00 33.67  ? 200 VAL B O     1 
ATOM   3546  C CB    . VAL B  1 138 ? -21.145 10.976  44.709  1.00 33.02  ? 200 VAL B CB    1 
ATOM   3547  C CG1   . VAL B  1 138 ? -20.621 10.137  45.853  1.00 33.16  ? 200 VAL B CG1   1 
ATOM   3548  C CG2   . VAL B  1 138 ? -21.498 10.078  43.536  1.00 33.30  ? 200 VAL B CG2   1 
ATOM   3549  N N     . ILE B  1 139 ? -21.541 13.611  46.474  1.00 37.52  ? 201 ILE B N     1 
ATOM   3550  C CA    . ILE B  1 139 ? -21.340 14.464  47.687  1.00 38.49  ? 201 ILE B CA    1 
ATOM   3551  C C     . ILE B  1 139 ? -22.674 14.791  48.394  1.00 36.77  ? 201 ILE B C     1 
ATOM   3552  O O     . ILE B  1 139 ? -22.841 14.569  49.597  1.00 32.57  ? 201 ILE B O     1 
ATOM   3553  C CB    . ILE B  1 139 ? -20.662 15.816  47.317  1.00 39.67  ? 201 ILE B CB    1 
ATOM   3554  C CG1   . ILE B  1 139 ? -19.320 15.584  46.597  1.00 39.82  ? 201 ILE B CG1   1 
ATOM   3555  C CG2   . ILE B  1 139 ? -20.538 16.721  48.548  1.00 40.25  ? 201 ILE B CG2   1 
ATOM   3556  C CD1   . ILE B  1 139 ? -18.081 16.034  47.334  1.00 40.21  ? 201 ILE B CD1   1 
ATOM   3557  N N     . PHE B  1 140 ? -23.605 15.330  47.612  1.00 36.81  ? 202 PHE B N     1 
ATOM   3558  C CA    . PHE B  1 140 ? -24.928 15.658  48.087  1.00 37.10  ? 202 PHE B CA    1 
ATOM   3559  C C     . PHE B  1 140 ? -25.520 14.433  48.763  1.00 34.62  ? 202 PHE B C     1 
ATOM   3560  O O     . PHE B  1 140 ? -26.013 14.516  49.883  1.00 34.26  ? 202 PHE B O     1 
ATOM   3561  C CB    . PHE B  1 140 ? -25.816 16.096  46.914  1.00 39.05  ? 202 PHE B CB    1 
ATOM   3562  C CG    . PHE B  1 140 ? -27.225 16.436  47.315  1.00 41.83  ? 202 PHE B CG    1 
ATOM   3563  C CD1   . PHE B  1 140 ? -28.168 15.429  47.529  1.00 43.30  ? 202 PHE B CD1   1 
ATOM   3564  C CD2   . PHE B  1 140 ? -27.610 17.757  47.490  1.00 42.47  ? 202 PHE B CD2   1 
ATOM   3565  C CE1   . PHE B  1 140 ? -29.466 15.741  47.909  1.00 44.12  ? 202 PHE B CE1   1 
ATOM   3566  C CE2   . PHE B  1 140 ? -28.905 18.073  47.868  1.00 42.95  ? 202 PHE B CE2   1 
ATOM   3567  C CZ    . PHE B  1 140 ? -29.835 17.065  48.073  1.00 43.46  ? 202 PHE B CZ    1 
ATOM   3568  N N     . ALA B  1 141 ? -25.475 13.304  48.064  1.00 33.41  ? 203 ALA B N     1 
ATOM   3569  C CA    . ALA B  1 141 ? -26.047 12.061  48.570  1.00 34.71  ? 203 ALA B CA    1 
ATOM   3570  C C     . ALA B  1 141 ? -25.399 11.615  49.869  1.00 33.89  ? 203 ALA B C     1 
ATOM   3571  O O     . ALA B  1 141 ? -26.088 11.227  50.800  1.00 33.35  ? 203 ALA B O     1 
ATOM   3572  C CB    . ALA B  1 141 ? -25.950 10.950  47.527  1.00 35.16  ? 203 ALA B CB    1 
ATOM   3573  N N     . ARG B  1 142 ? -24.074 11.660  49.918  1.00 33.92  ? 204 ARG B N     1 
ATOM   3574  C CA    . ARG B  1 142 ? -23.335 11.303  51.133  1.00 33.17  ? 204 ARG B CA    1 
ATOM   3575  C C     . ARG B  1 142 ? -23.824 12.142  52.315  1.00 31.12  ? 204 ARG B C     1 
ATOM   3576  O O     . ARG B  1 142 ? -24.294 11.623  53.332  1.00 28.28  ? 204 ARG B O     1 
ATOM   3577  C CB    . ARG B  1 142 ? -21.832 11.513  50.902  1.00 32.92  ? 204 ARG B CB    1 
ATOM   3578  C CG    . ARG B  1 142 ? -20.938 11.179  52.090  1.00 32.70  ? 204 ARG B CG    1 
ATOM   3579  C CD    . ARG B  1 142 ? -19.588 11.879  51.979  1.00 32.77  ? 204 ARG B CD    1 
ATOM   3580  N NE    . ARG B  1 142 ? -19.741 13.335  51.956  1.00 33.26  ? 204 ARG B NE    1 
ATOM   3581  C CZ    . ARG B  1 142 ? -18.853 14.212  51.475  1.00 34.62  ? 204 ARG B CZ    1 
ATOM   3582  N NH1   . ARG B  1 142 ? -17.681 13.837  50.948  1.00 35.80  ? 204 ARG B NH1   1 
ATOM   3583  N NH2   . ARG B  1 142 ? -19.152 15.499  51.513  1.00 34.75  ? 204 ARG B NH2   1 
ATOM   3584  N N     . ASP B  1 143 ? -23.713 13.448  52.142  1.00 31.54  ? 205 ASP B N     1 
ATOM   3585  C CA    . ASP B  1 143 ? -24.114 14.405  53.153  1.00 32.82  ? 205 ASP B CA    1 
ATOM   3586  C C     . ASP B  1 143 ? -25.541 14.156  53.658  1.00 35.48  ? 205 ASP B C     1 
ATOM   3587  O O     . ASP B  1 143 ? -25.778 14.122  54.866  1.00 35.77  ? 205 ASP B O     1 
ATOM   3588  C CB    . ASP B  1 143 ? -23.983 15.826  52.591  1.00 31.91  ? 205 ASP B CB    1 
ATOM   3589  C CG    . ASP B  1 143 ? -22.534 16.282  52.487  1.00 30.50  ? 205 ASP B CG    1 
ATOM   3590  O OD1   . ASP B  1 143 ? -21.658 15.582  53.043  1.00 28.83  ? 205 ASP B OD1   1 
ATOM   3591  O OD2   . ASP B  1 143 ? -22.279 17.341  51.865  1.00 28.41  ? 205 ASP B OD2   1 
ATOM   3592  N N     . LYS B  1 144 ? -26.482 13.957  52.742  1.00 37.31  ? 206 LYS B N     1 
ATOM   3593  C CA    . LYS B  1 144 ? -27.869 13.703  53.127  1.00 38.59  ? 206 LYS B CA    1 
ATOM   3594  C C     . LYS B  1 144 ? -28.096 12.328  53.809  1.00 39.21  ? 206 LYS B C     1 
ATOM   3595  O O     . LYS B  1 144 ? -28.577 12.257  54.931  1.00 41.80  ? 206 LYS B O     1 
ATOM   3596  C CB    . LYS B  1 144 ? -28.762 13.850  51.904  1.00 39.76  ? 206 LYS B CB    1 
ATOM   3597  C CG    . LYS B  1 144 ? -30.253 13.778  52.187  1.00 42.23  ? 206 LYS B CG    1 
ATOM   3598  C CD    . LYS B  1 144 ? -31.052 14.383  51.027  1.00 45.39  ? 206 LYS B CD    1 
ATOM   3599  C CE    . LYS B  1 144 ? -32.540 14.514  51.322  1.00 45.29  ? 206 LYS B CE    1 
ATOM   3600  N NZ    . LYS B  1 144 ? -33.251 15.334  50.292  1.00 46.12  ? 206 LYS B NZ    1 
ATOM   3601  N N     . TRP B  1 145 ? -27.731 11.237  53.156  1.00 38.78  ? 207 TRP B N     1 
ATOM   3602  C CA    . TRP B  1 145 ? -28.239 9.930   53.560  1.00 37.61  ? 207 TRP B CA    1 
ATOM   3603  C C     . TRP B  1 145 ? -27.254 9.011   54.209  1.00 35.48  ? 207 TRP B C     1 
ATOM   3604  O O     . TRP B  1 145 ? -27.655 8.035   54.798  1.00 34.50  ? 207 TRP B O     1 
ATOM   3605  C CB    . TRP B  1 145 ? -28.823 9.200   52.349  1.00 40.50  ? 207 TRP B CB    1 
ATOM   3606  C CG    . TRP B  1 145 ? -30.091 9.817   51.811  1.00 42.97  ? 207 TRP B CG    1 
ATOM   3607  C CD1   . TRP B  1 145 ? -31.272 9.944   52.469  1.00 43.96  ? 207 TRP B CD1   1 
ATOM   3608  C CD2   . TRP B  1 145 ? -30.301 10.373  50.503  1.00 42.80  ? 207 TRP B CD2   1 
ATOM   3609  N NE1   . TRP B  1 145 ? -32.205 10.553  51.661  1.00 44.37  ? 207 TRP B NE1   1 
ATOM   3610  C CE2   . TRP B  1 145 ? -31.637 10.822  50.448  1.00 43.12  ? 207 TRP B CE2   1 
ATOM   3611  C CE3   . TRP B  1 145 ? -29.491 10.538  49.380  1.00 42.30  ? 207 TRP B CE3   1 
ATOM   3612  C CZ2   . TRP B  1 145 ? -32.181 11.421  49.320  1.00 42.86  ? 207 TRP B CZ2   1 
ATOM   3613  C CZ3   . TRP B  1 145 ? -30.031 11.138  48.260  1.00 43.32  ? 207 TRP B CZ3   1 
ATOM   3614  C CH2   . TRP B  1 145 ? -31.365 11.575  48.238  1.00 42.95  ? 207 TRP B CH2   1 
ATOM   3615  N N     . LEU B  1 146 ? -25.965 9.269   54.080  1.00 37.22  ? 208 LEU B N     1 
ATOM   3616  C CA    . LEU B  1 146 ? -24.985 8.316   54.609  1.00 39.04  ? 208 LEU B CA    1 
ATOM   3617  C C     . LEU B  1 146 ? -24.948 8.435   56.119  1.00 39.77  ? 208 LEU B C     1 
ATOM   3618  O O     . LEU B  1 146 ? -24.856 9.545   56.647  1.00 41.21  ? 208 LEU B O     1 
ATOM   3619  C CB    . LEU B  1 146 ? -23.570 8.525   54.008  1.00 39.08  ? 208 LEU B CB    1 
ATOM   3620  C CG    . LEU B  1 146 ? -22.517 7.430   54.326  1.00 38.44  ? 208 LEU B CG    1 
ATOM   3621  C CD1   . LEU B  1 146 ? -22.947 6.055   53.822  1.00 37.52  ? 208 LEU B CD1   1 
ATOM   3622  C CD2   . LEU B  1 146 ? -21.143 7.797   53.769  1.00 37.98  ? 208 LEU B CD2   1 
ATOM   3623  N N     . LYS B  1 147 ? -25.024 7.297   56.805  1.00 41.78  ? 209 LYS B N     1 
ATOM   3624  C CA    . LYS B  1 147 ? -24.918 7.271   58.268  1.00 44.29  ? 209 LYS B CA    1 
ATOM   3625  C C     . LYS B  1 147 ? -23.479 7.589   58.683  1.00 46.78  ? 209 LYS B C     1 
ATOM   3626  O O     . LYS B  1 147 ? -22.570 7.448   57.870  1.00 49.38  ? 209 LYS B O     1 
ATOM   3627  C CB    . LYS B  1 147 ? -25.315 5.903   58.824  1.00 43.06  ? 209 LYS B CB    1 
ATOM   3628  C CG    . LYS B  1 147 ? -24.230 4.854   58.652  1.00 43.66  ? 209 LYS B CG    1 
ATOM   3629  C CD    . LYS B  1 147 ? -24.615 3.506   59.222  1.00 43.50  ? 209 LYS B CD    1 
ATOM   3630  C CE    . LYS B  1 147 ? -23.422 2.564   59.165  1.00 43.51  ? 209 LYS B CE    1 
ATOM   3631  N NZ    . LYS B  1 147 ? -23.815 1.134   59.207  1.00 43.52  ? 209 LYS B NZ    1 
ATOM   3632  N N     . PRO B  1 148 ? -23.264 8.009   59.948  1.00 48.26  ? 210 PRO B N     1 
ATOM   3633  C CA    . PRO B  1 148 ? -21.875 8.201   60.393  1.00 46.15  ? 210 PRO B CA    1 
ATOM   3634  C C     . PRO B  1 148 ? -21.138 6.858   60.462  1.00 43.68  ? 210 PRO B C     1 
ATOM   3635  O O     . PRO B  1 148 ? -21.692 5.859   60.932  1.00 41.78  ? 210 PRO B O     1 
ATOM   3636  C CB    . PRO B  1 148 ? -22.021 8.836   61.777  1.00 47.53  ? 210 PRO B CB    1 
ATOM   3637  C CG    . PRO B  1 148 ? -23.427 9.365   61.833  1.00 48.20  ? 210 PRO B CG    1 
ATOM   3638  C CD    . PRO B  1 148 ? -24.246 8.480   60.944  1.00 47.81  ? 210 PRO B CD    1 
ATOM   3639  N N     . GLY B  1 149 ? -19.917 6.841   59.936  1.00 41.82  ? 211 GLY B N     1 
ATOM   3640  C CA    . GLY B  1 149 ? -19.153 5.611   59.784  1.00 39.77  ? 211 GLY B CA    1 
ATOM   3641  C C     . GLY B  1 149 ? -19.675 4.689   58.692  1.00 37.97  ? 211 GLY B C     1 
ATOM   3642  O O     . GLY B  1 149 ? -19.256 3.544   58.582  1.00 37.05  ? 211 GLY B O     1 
ATOM   3643  N N     . GLY B  1 150 ? -20.575 5.189   57.858  1.00 36.55  ? 212 GLY B N     1 
ATOM   3644  C CA    . GLY B  1 150 ? -20.970 4.469   56.666  1.00 36.81  ? 212 GLY B CA    1 
ATOM   3645  C C     . GLY B  1 150 ? -19.813 4.318   55.686  1.00 35.85  ? 212 GLY B C     1 
ATOM   3646  O O     . GLY B  1 150 ? -18.768 4.948   55.841  1.00 37.17  ? 212 GLY B O     1 
ATOM   3647  N N     . LEU B  1 151 ? -20.014 3.474   54.679  1.00 34.12  ? 213 LEU B N     1 
ATOM   3648  C CA    . LEU B  1 151 ? -18.996 3.158   53.686  1.00 34.08  ? 213 LEU B CA    1 
ATOM   3649  C C     . LEU B  1 151 ? -19.416 3.574   52.274  1.00 33.94  ? 213 LEU B C     1 
ATOM   3650  O O     . LEU B  1 151 ? -20.606 3.678   51.963  1.00 32.69  ? 213 LEU B O     1 
ATOM   3651  C CB    . LEU B  1 151 ? -18.720 1.647   53.673  1.00 33.84  ? 213 LEU B CB    1 
ATOM   3652  C CG    . LEU B  1 151 ? -18.452 0.940   55.000  1.00 32.26  ? 213 LEU B CG    1 
ATOM   3653  C CD1   . LEU B  1 151 ? -18.249 -0.548  54.791  1.00 30.48  ? 213 LEU B CD1   1 
ATOM   3654  C CD2   . LEU B  1 151 ? -17.240 1.570   55.657  1.00 33.34  ? 213 LEU B CD2   1 
ATOM   3655  N N     . MET B  1 152 ? -18.405 3.786   51.430  1.00 33.85  ? 214 MET B N     1 
ATOM   3656  C CA    . MET B  1 152 ? -18.583 4.166   50.042  1.00 32.40  ? 214 MET B CA    1 
ATOM   3657  C C     . MET B  1 152 ? -17.717 3.304   49.109  1.00 33.36  ? 214 MET B C     1 
ATOM   3658  O O     . MET B  1 152 ? -16.602 2.862   49.440  1.00 32.92  ? 214 MET B O     1 
ATOM   3659  C CB    . MET B  1 152 ? -18.310 5.657   49.854  1.00 31.46  ? 214 MET B CB    1 
ATOM   3660  C CG    . MET B  1 152 ? -19.287 6.515   50.635  1.00 31.35  ? 214 MET B CG    1 
ATOM   3661  S SD    . MET B  1 152 ? -19.080 8.285   50.405  1.00 33.76  ? 214 MET B SD    1 
ATOM   3662  C CE    . MET B  1 152 ? -20.118 8.584   48.982  1.00 34.22  ? 214 MET B CE    1 
ATOM   3663  N N     . PHE B  1 153 ? -18.298 3.039   47.949  1.00 34.44  ? 215 PHE B N     1 
ATOM   3664  C CA    . PHE B  1 153 ? -17.733 2.183   46.935  1.00 34.78  ? 215 PHE B CA    1 
ATOM   3665  C C     . PHE B  1 153 ? -17.800 2.922   45.598  1.00 36.17  ? 215 PHE B C     1 
ATOM   3666  O O     . PHE B  1 153 ? -18.894 3.184   45.084  1.00 39.24  ? 215 PHE B O     1 
ATOM   3667  C CB    . PHE B  1 153 ? -18.551 0.902   46.864  1.00 33.77  ? 215 PHE B CB    1 
ATOM   3668  C CG    . PHE B  1 153 ? -18.219 -0.077  47.933  1.00 34.10  ? 215 PHE B CG    1 
ATOM   3669  C CD1   . PHE B  1 153 ? -18.509 0.184   49.254  1.00 34.41  ? 215 PHE B CD1   1 
ATOM   3670  C CD2   . PHE B  1 153 ? -17.606 -1.272  47.615  1.00 36.18  ? 215 PHE B CD2   1 
ATOM   3671  C CE1   . PHE B  1 153 ? -18.186 -0.734  50.244  1.00 35.63  ? 215 PHE B CE1   1 
ATOM   3672  C CE2   . PHE B  1 153 ? -17.290 -2.203  48.600  1.00 36.74  ? 215 PHE B CE2   1 
ATOM   3673  C CZ    . PHE B  1 153 ? -17.584 -1.935  49.919  1.00 35.74  ? 215 PHE B CZ    1 
ATOM   3674  N N     . PRO B  1 154 ? -16.663 3.334   45.055  1.00 35.10  ? 216 PRO B N     1 
ATOM   3675  C CA    . PRO B  1 154 ? -15.387 3.378   45.733  1.00 34.89  ? 216 PRO B CA    1 
ATOM   3676  C C     . PRO B  1 154 ? -15.293 4.614   46.643  1.00 34.54  ? 216 PRO B C     1 
ATOM   3677  O O     . PRO B  1 154 ? -16.232 5.433   46.653  1.00 34.77  ? 216 PRO B O     1 
ATOM   3678  C CB    . PRO B  1 154 ? -14.410 3.481   44.571  1.00 35.62  ? 216 PRO B CB    1 
ATOM   3679  C CG    . PRO B  1 154 ? -15.180 4.187   43.490  1.00 36.26  ? 216 PRO B CG    1 
ATOM   3680  C CD    . PRO B  1 154 ? -16.644 4.110   43.813  1.00 35.53  ? 216 PRO B CD    1 
ATOM   3681  N N     . ASP B  1 155 ? -14.174 4.733   47.377  1.00 33.02  ? 217 ASP B N     1 
ATOM   3682  C CA    . ASP B  1 155 ? -13.946 5.825   48.342  1.00 32.93  ? 217 ASP B CA    1 
ATOM   3683  C C     . ASP B  1 155 ? -12.646 6.617   48.183  1.00 31.53  ? 217 ASP B C     1 
ATOM   3684  O O     . ASP B  1 155 ? -12.454 7.606   48.869  1.00 28.94  ? 217 ASP B O     1 
ATOM   3685  C CB    . ASP B  1 155 ? -14.039 5.292   49.779  1.00 35.40  ? 217 ASP B CB    1 
ATOM   3686  C CG    . ASP B  1 155 ? -13.261 4.016   49.982  1.00 36.90  ? 217 ASP B CG    1 
ATOM   3687  O OD1   . ASP B  1 155 ? -12.267 3.827   49.253  1.00 37.49  ? 217 ASP B OD1   1 
ATOM   3688  O OD2   . ASP B  1 155 ? -13.651 3.194   50.855  1.00 38.72  ? 217 ASP B OD2   1 
ATOM   3689  N N     . ARG B  1 156 ? -11.758 6.183   47.295  1.00 33.66  ? 218 ARG B N     1 
ATOM   3690  C CA    . ARG B  1 156 ? -10.542 6.937   46.960  1.00 34.69  ? 218 ARG B CA    1 
ATOM   3691  C C     . ARG B  1 156 ? -10.392 7.029   45.444  1.00 31.25  ? 218 ARG B C     1 
ATOM   3692  O O     . ARG B  1 156 ? -10.671 6.056   44.734  1.00 28.08  ? 218 ARG B O     1 
ATOM   3693  C CB    . ARG B  1 156 ? -9.282  6.273   47.526  1.00 39.76  ? 218 ARG B CB    1 
ATOM   3694  C CG    . ARG B  1 156 ? -8.728  6.863   48.825  1.00 46.22  ? 218 ARG B CG    1 
ATOM   3695  C CD    . ARG B  1 156 ? -7.252  6.504   49.048  1.00 51.69  ? 218 ARG B CD    1 
ATOM   3696  N NE    . ARG B  1 156 ? -6.370  7.316   48.194  1.00 58.91  ? 218 ARG B NE    1 
ATOM   3697  C CZ    . ARG B  1 156 ? -5.829  6.936   47.021  1.00 62.51  ? 218 ARG B CZ    1 
ATOM   3698  N NH1   . ARG B  1 156 ? -6.025  5.711   46.510  1.00 58.66  ? 218 ARG B NH1   1 
ATOM   3699  N NH2   . ARG B  1 156 ? -5.061  7.801   46.344  1.00 63.00  ? 218 ARG B NH2   1 
ATOM   3700  N N     . ALA B  1 157 ? -9.960  8.206   44.972  1.00 28.63  ? 219 ALA B N     1 
ATOM   3701  C CA    . ALA B  1 157 ? -9.639  8.453   43.567  1.00 26.05  ? 219 ALA B CA    1 
ATOM   3702  C C     . ALA B  1 157 ? -8.478  9.406   43.491  1.00 24.28  ? 219 ALA B C     1 
ATOM   3703  O O     . ALA B  1 157 ? -8.268  10.205  44.386  1.00 23.30  ? 219 ALA B O     1 
ATOM   3704  C CB    . ALA B  1 157 ? -10.823 9.070   42.850  1.00 26.65  ? 219 ALA B CB    1 
ATOM   3705  N N     . ALA B  1 158 ? -7.750  9.350   42.392  1.00 23.48  ? 220 ALA B N     1 
ATOM   3706  C CA    . ALA B  1 158 ? -6.572  10.174  42.236  1.00 23.33  ? 220 ALA B CA    1 
ATOM   3707  C C     . ALA B  1 158 ? -6.276  10.462  40.775  1.00 22.93  ? 220 ALA B C     1 
ATOM   3708  O O     . ALA B  1 158 ? -6.327  9.576   39.946  1.00 22.40  ? 220 ALA B O     1 
ATOM   3709  C CB    . ALA B  1 158 ? -5.383  9.478   42.874  1.00 24.12  ? 220 ALA B CB    1 
ATOM   3710  N N     . LEU B  1 159 ? -5.917  11.703  40.484  1.00 23.59  ? 221 LEU B N     1 
ATOM   3711  C CA    . LEU B  1 159 ? -5.699  12.154  39.128  1.00 24.23  ? 221 LEU B CA    1 
ATOM   3712  C C     . LEU B  1 159 ? -4.246  12.536  38.931  1.00 23.65  ? 221 LEU B C     1 
ATOM   3713  O O     . LEU B  1 159 ? -3.703  13.322  39.712  1.00 21.69  ? 221 LEU B O     1 
ATOM   3714  C CB    . LEU B  1 159 ? -6.573  13.379  38.874  1.00 25.93  ? 221 LEU B CB    1 
ATOM   3715  C CG    . LEU B  1 159 ? -6.554  13.988  37.466  1.00 27.70  ? 221 LEU B CG    1 
ATOM   3716  C CD1   . LEU B  1 159 ? -7.202  13.025  36.492  1.00 28.24  ? 221 LEU B CD1   1 
ATOM   3717  C CD2   . LEU B  1 159 ? -7.242  15.355  37.404  1.00 28.29  ? 221 LEU B CD2   1 
ATOM   3718  N N     . TYR B  1 160 ? -3.647  12.002  37.859  1.00 24.39  ? 222 TYR B N     1 
ATOM   3719  C CA    . TYR B  1 160 ? -2.217  12.207  37.527  1.00 24.48  ? 222 TYR B CA    1 
ATOM   3720  C C     . TYR B  1 160 ? -2.012  12.916  36.189  1.00 25.16  ? 222 TYR B C     1 
ATOM   3721  O O     . TYR B  1 160 ? -2.909  12.923  35.356  1.00 25.38  ? 222 TYR B O     1 
ATOM   3722  C CB    . TYR B  1 160 ? -1.477  10.872  37.496  1.00 23.44  ? 222 TYR B CB    1 
ATOM   3723  C CG    . TYR B  1 160 ? -1.479  10.197  38.834  1.00 23.91  ? 222 TYR B CG    1 
ATOM   3724  C CD1   . TYR B  1 160 ? -2.548  9.387   39.223  1.00 24.32  ? 222 TYR B CD1   1 
ATOM   3725  C CD2   . TYR B  1 160 ? -0.433  10.387  39.740  1.00 23.93  ? 222 TYR B CD2   1 
ATOM   3726  C CE1   . TYR B  1 160 ? -2.565  8.776   40.466  1.00 24.21  ? 222 TYR B CE1   1 
ATOM   3727  C CE2   . TYR B  1 160 ? -0.443  9.777   40.985  1.00 23.63  ? 222 TYR B CE2   1 
ATOM   3728  C CZ    . TYR B  1 160 ? -1.509  8.987   41.334  1.00 23.90  ? 222 TYR B CZ    1 
ATOM   3729  O OH    . TYR B  1 160 ? -1.527  8.397   42.549  1.00 24.57  ? 222 TYR B OH    1 
ATOM   3730  N N     . VAL B  1 161 ? -0.840  13.538  36.018  1.00 26.27  ? 223 VAL B N     1 
ATOM   3731  C CA    . VAL B  1 161 ? -0.348  13.981  34.700  1.00 27.06  ? 223 VAL B CA    1 
ATOM   3732  C C     . VAL B  1 161 ? 0.922   13.250  34.336  1.00 27.33  ? 223 VAL B C     1 
ATOM   3733  O O     . VAL B  1 161 ? 1.648   12.732  35.183  1.00 26.00  ? 223 VAL B O     1 
ATOM   3734  C CB    . VAL B  1 161 ? 0.023   15.491  34.569  1.00 27.89  ? 223 VAL B CB    1 
ATOM   3735  C CG1   . VAL B  1 161 ? -1.095  16.276  33.905  1.00 29.00  ? 223 VAL B CG1   1 
ATOM   3736  C CG2   . VAL B  1 161 ? 0.442   16.101  35.896  1.00 28.48  ? 223 VAL B CG2   1 
ATOM   3737  N N     . VAL B  1 162 ? 1.204   13.317  33.049  1.00 27.70  ? 224 VAL B N     1 
ATOM   3738  C CA    . VAL B  1 162 ? 2.335   12.695  32.461  1.00 27.65  ? 224 VAL B CA    1 
ATOM   3739  C C     . VAL B  1 162 ? 2.544   13.484  31.173  1.00 28.12  ? 224 VAL B C     1 
ATOM   3740  O O     . VAL B  1 162 ? 1.602   14.111  30.694  1.00 28.16  ? 224 VAL B O     1 
ATOM   3741  C CB    . VAL B  1 162 ? 1.996   11.217  32.255  1.00 27.97  ? 224 VAL B CB    1 
ATOM   3742  C CG1   . VAL B  1 162 ? 2.290   10.776  30.837  1.00 28.69  ? 224 VAL B CG1   1 
ATOM   3743  C CG2   . VAL B  1 162 ? 2.722   10.357  33.286  1.00 27.57  ? 224 VAL B CG2   1 
ATOM   3744  N N     . ALA B  1 163 ? 3.768   13.524  30.640  1.00 29.57  ? 225 ALA B N     1 
ATOM   3745  C CA    . ALA B  1 163 ? 4.008   14.174  29.326  1.00 30.00  ? 225 ALA B CA    1 
ATOM   3746  C C     . ALA B  1 163 ? 4.311   13.130  28.265  1.00 28.92  ? 225 ALA B C     1 
ATOM   3747  O O     . ALA B  1 163 ? 4.818   12.059  28.593  1.00 28.85  ? 225 ALA B O     1 
ATOM   3748  C CB    . ALA B  1 163 ? 5.131   15.197  29.416  1.00 30.10  ? 225 ALA B CB    1 
ATOM   3749  N N     . ILE B  1 164 ? 3.968   13.412  27.009  1.00 28.30  ? 226 ILE B N     1 
ATOM   3750  C CA    . ILE B  1 164 ? 4.186   12.431  25.938  1.00 28.48  ? 226 ILE B CA    1 
ATOM   3751  C C     . ILE B  1 164 ? 4.678   13.028  24.634  1.00 29.06  ? 226 ILE B C     1 
ATOM   3752  O O     . ILE B  1 164 ? 4.541   14.227  24.375  1.00 28.96  ? 226 ILE B O     1 
ATOM   3753  C CB    . ILE B  1 164 ? 2.911   11.616  25.590  1.00 27.84  ? 226 ILE B CB    1 
ATOM   3754  C CG1   . ILE B  1 164 ? 1.825   12.526  25.025  1.00 27.72  ? 226 ILE B CG1   1 
ATOM   3755  C CG2   . ILE B  1 164 ? 2.374   10.874  26.803  1.00 27.91  ? 226 ILE B CG2   1 
ATOM   3756  C CD1   . ILE B  1 164 ? 0.718   11.777  24.316  1.00 27.74  ? 226 ILE B CD1   1 
ATOM   3757  N N     . GLU B  1 165 ? 5.242   12.148  23.814  1.00 29.87  ? 227 GLU B N     1 
ATOM   3758  C CA    . GLU B  1 165 ? 5.547   12.450  22.435  1.00 30.15  ? 227 GLU B CA    1 
ATOM   3759  C C     . GLU B  1 165 ? 4.365   11.942  21.623  1.00 29.70  ? 227 GLU B C     1 
ATOM   3760  O O     . GLU B  1 165 ? 3.845   10.863  21.887  1.00 27.37  ? 227 GLU B O     1 
ATOM   3761  C CB    . GLU B  1 165 ? 6.848   11.765  22.002  1.00 30.69  ? 227 GLU B CB    1 
ATOM   3762  C CG    . GLU B  1 165 ? 7.139   11.867  20.502  1.00 31.90  ? 227 GLU B CG    1 
ATOM   3763  C CD    . GLU B  1 165 ? 6.448   10.782  19.668  1.00 31.48  ? 227 GLU B CD    1 
ATOM   3764  O OE1   . GLU B  1 165 ? 6.074   11.039  18.498  1.00 32.09  ? 227 GLU B OE1   1 
ATOM   3765  O OE2   . GLU B  1 165 ? 6.280   9.667   20.195  1.00 31.06  ? 227 GLU B OE2   1 
ATOM   3766  N N     . ASP B  1 166 ? 3.937   12.729  20.646  1.00 31.38  ? 228 ASP B N     1 
ATOM   3767  C CA    . ASP B  1 166 ? 2.787   12.371  19.843  1.00 34.96  ? 228 ASP B CA    1 
ATOM   3768  C C     . ASP B  1 166 ? 2.778   13.109  18.503  1.00 39.74  ? 228 ASP B C     1 
ATOM   3769  O O     . ASP B  1 166 ? 1.708   13.530  18.050  1.00 41.46  ? 228 ASP B O     1 
ATOM   3770  C CB    . ASP B  1 166 ? 1.500   12.692  20.629  1.00 33.01  ? 228 ASP B CB    1 
ATOM   3771  C CG    . ASP B  1 166 ? 0.321   11.867  20.195  1.00 31.76  ? 228 ASP B CG    1 
ATOM   3772  O OD1   . ASP B  1 166 ? 0.526   10.804  19.593  1.00 33.88  ? 228 ASP B OD1   1 
ATOM   3773  O OD2   . ASP B  1 166 ? -0.818  12.270  20.459  1.00 29.92  ? 228 ASP B OD2   1 
ATOM   3774  N N     . ARG B  1 167 ? 3.935   13.261  17.848  1.00 43.94  ? 229 ARG B N     1 
ATOM   3775  C CA    . ARG B  1 167 ? 3.965   14.117  16.648  1.00 47.43  ? 229 ARG B CA    1 
ATOM   3776  C C     . ARG B  1 167 ? 3.079   13.587  15.524  1.00 43.66  ? 229 ARG B C     1 
ATOM   3777  O O     . ARG B  1 167 ? 2.368   14.358  14.876  1.00 44.58  ? 229 ARG B O     1 
ATOM   3778  C CB    . ARG B  1 167 ? 5.390   14.463  16.157  1.00 51.43  ? 229 ARG B CB    1 
ATOM   3779  C CG    . ARG B  1 167 ? 6.170   13.380  15.457  1.00 56.06  ? 229 ARG B CG    1 
ATOM   3780  C CD    . ARG B  1 167 ? 7.048   13.957  14.348  1.00 60.07  ? 229 ARG B CD    1 
ATOM   3781  N NE    . ARG B  1 167 ? 6.426   13.669  13.069  1.00 61.07  ? 229 ARG B NE    1 
ATOM   3782  C CZ    . ARG B  1 167 ? 6.411   12.459  12.507  1.00 63.36  ? 229 ARG B CZ    1 
ATOM   3783  N NH1   . ARG B  1 167 ? 7.015   11.418  13.091  1.00 58.07  ? 229 ARG B NH1   1 
ATOM   3784  N NH2   . ARG B  1 167 ? 5.778   12.289  11.352  1.00 66.41  ? 229 ARG B NH2   1 
ATOM   3785  N N     . GLN B  1 168 ? 3.075   12.280  15.326  1.00 40.04  ? 230 GLN B N     1 
ATOM   3786  C CA    . GLN B  1 168 ? 2.316   11.730  14.223  1.00 40.18  ? 230 GLN B CA    1 
ATOM   3787  C C     . GLN B  1 168 ? 0.826   11.983  14.405  1.00 39.26  ? 230 GLN B C     1 
ATOM   3788  O O     . GLN B  1 168 ? 0.167   12.518  13.528  1.00 38.58  ? 230 GLN B O     1 
ATOM   3789  C CB    . GLN B  1 168 ? 2.566   10.247  14.102  1.00 41.99  ? 230 GLN B CB    1 
ATOM   3790  C CG    . GLN B  1 168 ? 1.954   9.644   12.863  1.00 44.12  ? 230 GLN B CG    1 
ATOM   3791  C CD    . GLN B  1 168 ? 2.226   8.161   12.774  1.00 48.28  ? 230 GLN B CD    1 
ATOM   3792  O OE1   . GLN B  1 168 ? 2.954   7.710   11.890  1.00 55.32  ? 230 GLN B OE1   1 
ATOM   3793  N NE2   . GLN B  1 168 ? 1.675   7.393   13.707  1.00 47.37  ? 230 GLN B NE2   1 
ATOM   3794  N N     . TYR B  1 169 ? 0.295   11.601  15.554  1.00 39.64  ? 231 TYR B N     1 
ATOM   3795  C CA    . TYR B  1 169 ? -1.128  11.770  15.802  1.00 39.98  ? 231 TYR B CA    1 
ATOM   3796  C C     . TYR B  1 169 ? -1.489  13.258  15.920  1.00 38.39  ? 231 TYR B C     1 
ATOM   3797  O O     . TYR B  1 169 ? -2.602  13.644  15.582  1.00 40.03  ? 231 TYR B O     1 
ATOM   3798  C CB    . TYR B  1 169 ? -1.597  10.965  17.043  1.00 41.70  ? 231 TYR B CB    1 
ATOM   3799  C CG    . TYR B  1 169 ? -3.089  10.635  17.029  1.00 43.16  ? 231 TYR B CG    1 
ATOM   3800  C CD1   . TYR B  1 169 ? -3.587  9.587   16.233  1.00 44.50  ? 231 TYR B CD1   1 
ATOM   3801  C CD2   . TYR B  1 169 ? -4.004  11.372  17.794  1.00 41.92  ? 231 TYR B CD2   1 
ATOM   3802  C CE1   . TYR B  1 169 ? -4.949  9.290   16.202  1.00 44.18  ? 231 TYR B CE1   1 
ATOM   3803  C CE2   . TYR B  1 169 ? -5.363  11.073  17.771  1.00 41.38  ? 231 TYR B CE2   1 
ATOM   3804  C CZ    . TYR B  1 169 ? -5.830  10.037  16.966  1.00 42.69  ? 231 TYR B CZ    1 
ATOM   3805  O OH    . TYR B  1 169 ? -7.168  9.728   16.911  1.00 41.80  ? 231 TYR B OH    1 
ATOM   3806  N N     . LYS B  1 170 ? -0.567  14.096  16.387  1.00 35.64  ? 232 LYS B N     1 
ATOM   3807  C CA    . LYS B  1 170 ? -0.854  15.518  16.476  1.00 34.64  ? 232 LYS B CA    1 
ATOM   3808  C C     . LYS B  1 170 ? -0.953  16.083  15.083  1.00 33.63  ? 232 LYS B C     1 
ATOM   3809  O O     . LYS B  1 170 ? -1.763  16.963  14.813  1.00 33.88  ? 232 LYS B O     1 
ATOM   3810  C CB    . LYS B  1 170 ? 0.218   16.273  17.249  1.00 35.83  ? 232 LYS B CB    1 
ATOM   3811  C CG    . LYS B  1 170 ? -0.073  17.765  17.364  1.00 36.92  ? 232 LYS B CG    1 
ATOM   3812  C CD    . LYS B  1 170 ? 1.050   18.553  18.022  1.00 37.96  ? 232 LYS B CD    1 
ATOM   3813  C CE    . LYS B  1 170 ? 0.740   20.048  18.025  1.00 39.50  ? 232 LYS B CE    1 
ATOM   3814  N NZ    . LYS B  1 170 ? 1.807   20.880  18.639  1.00 41.16  ? 232 LYS B NZ    1 
ATOM   3815  N N     . ASP B  1 171 ? -0.112  15.596  14.193  1.00 33.91  ? 233 ASP B N     1 
ATOM   3816  C CA    . ASP B  1 171 ? -0.276  15.938  12.790  1.00 35.25  ? 233 ASP B CA    1 
ATOM   3817  C C     . ASP B  1 171 ? -1.666  15.620  12.291  1.00 32.94  ? 233 ASP B C     1 
ATOM   3818  O O     . ASP B  1 171 ? -2.336  16.476  11.716  1.00 30.26  ? 233 ASP B O     1 
ATOM   3819  C CB    . ASP B  1 171 ? 0.741   15.214  11.917  1.00 37.74  ? 233 ASP B CB    1 
ATOM   3820  C CG    . ASP B  1 171 ? 1.641   16.174  11.200  1.00 40.87  ? 233 ASP B CG    1 
ATOM   3821  O OD1   . ASP B  1 171 ? 2.511   16.807  11.875  1.00 42.40  ? 233 ASP B OD1   1 
ATOM   3822  O OD2   . ASP B  1 171 ? 1.439   16.309  9.969   1.00 40.76  ? 233 ASP B OD2   1 
ATOM   3823  N N     . PHE B  1 172 ? -2.077  14.375  12.530  1.00 32.20  ? 234 PHE B N     1 
ATOM   3824  C CA    . PHE B  1 172 ? -3.339  13.843  12.036  1.00 31.38  ? 234 PHE B CA    1 
ATOM   3825  C C     . PHE B  1 172 ? -4.548  14.610  12.571  1.00 31.58  ? 234 PHE B C     1 
ATOM   3826  O O     . PHE B  1 172 ? -5.529  14.825  11.846  1.00 32.17  ? 234 PHE B O     1 
ATOM   3827  C CB    . PHE B  1 172 ? -3.456  12.349  12.386  1.00 31.27  ? 234 PHE B CB    1 
ATOM   3828  C CG    . PHE B  1 172 ? -4.760  11.718  11.955  1.00 31.79  ? 234 PHE B CG    1 
ATOM   3829  C CD1   . PHE B  1 172 ? -5.073  11.600  10.613  1.00 31.05  ? 234 PHE B CD1   1 
ATOM   3830  C CD2   . PHE B  1 172 ? -5.678  11.253  12.898  1.00 32.03  ? 234 PHE B CD2   1 
ATOM   3831  C CE1   . PHE B  1 172 ? -6.264  11.032  10.214  1.00 31.70  ? 234 PHE B CE1   1 
ATOM   3832  C CE2   . PHE B  1 172 ? -6.876  10.683  12.504  1.00 31.92  ? 234 PHE B CE2   1 
ATOM   3833  C CZ    . PHE B  1 172 ? -7.163  10.564  11.161  1.00 32.54  ? 234 PHE B CZ    1 
ATOM   3834  N N     . LYS B  1 173 ? -4.471  15.030  13.829  1.00 30.83  ? 235 LYS B N     1 
ATOM   3835  C CA    . LYS B  1 173 ? -5.635  15.558  14.528  1.00 29.56  ? 235 LYS B CA    1 
ATOM   3836  C C     . LYS B  1 173 ? -5.750  17.062  14.522  1.00 28.56  ? 235 LYS B C     1 
ATOM   3837  O O     . LYS B  1 173 ? -6.863  17.589  14.606  1.00 28.51  ? 235 LYS B O     1 
ATOM   3838  C CB    . LYS B  1 173 ? -5.638  15.066  15.971  1.00 30.06  ? 235 LYS B CB    1 
ATOM   3839  C CG    . LYS B  1 173 ? -6.398  13.780  16.147  1.00 30.68  ? 235 LYS B CG    1 
ATOM   3840  C CD    . LYS B  1 173 ? -7.885  14.040  16.068  1.00 31.51  ? 235 LYS B CD    1 
ATOM   3841  C CE    . LYS B  1 173 ? -8.616  12.804  15.599  1.00 32.97  ? 235 LYS B CE    1 
ATOM   3842  N NZ    . LYS B  1 173 ? -10.053 13.123  15.508  1.00 33.41  ? 235 LYS B NZ    1 
ATOM   3843  N N     . ILE B  1 174 ? -4.617  17.753  14.469  1.00 28.13  ? 236 ILE B N     1 
ATOM   3844  C CA    . ILE B  1 174 ? -4.646  19.198  14.583  1.00 28.67  ? 236 ILE B CA    1 
ATOM   3845  C C     . ILE B  1 174 ? -3.824  19.961  13.514  1.00 27.74  ? 236 ILE B C     1 
ATOM   3846  O O     . ILE B  1 174 ? -4.287  20.987  13.045  1.00 29.00  ? 236 ILE B O     1 
ATOM   3847  C CB    . ILE B  1 174 ? -4.473  19.682  16.068  1.00 29.24  ? 236 ILE B CB    1 
ATOM   3848  C CG1   . ILE B  1 174 ? -3.585  20.908  16.172  1.00 30.17  ? 236 ILE B CG1   1 
ATOM   3849  C CG2   . ILE B  1 174 ? -3.921  18.604  16.978  1.00 28.65  ? 236 ILE B CG2   1 
ATOM   3850  C CD1   . ILE B  1 174 ? -2.131  20.627  15.903  1.00 31.02  ? 236 ILE B CD1   1 
ATOM   3851  N N     . HIS B  1 175 ? -2.661  19.487  13.078  1.00 26.44  ? 237 HIS B N     1 
ATOM   3852  C CA    . HIS B  1 175 ? -1.951  20.200  11.983  1.00 24.86  ? 237 HIS B CA    1 
ATOM   3853  C C     . HIS B  1 175 ? -2.628  20.002  10.662  1.00 23.76  ? 237 HIS B C     1 
ATOM   3854  O O     . HIS B  1 175 ? -2.505  20.825  9.794   1.00 23.59  ? 237 HIS B O     1 
ATOM   3855  C CB    . HIS B  1 175 ? -0.487  19.800  11.874  1.00 24.98  ? 237 HIS B CB    1 
ATOM   3856  C CG    . HIS B  1 175 ? 0.353   20.349  12.983  1.00 26.02  ? 237 HIS B CG    1 
ATOM   3857  N ND1   . HIS B  1 175 ? 0.565   21.704  13.152  1.00 26.37  ? 237 HIS B ND1   1 
ATOM   3858  C CD2   . HIS B  1 175 ? 1.009   19.736  13.998  1.00 25.77  ? 237 HIS B CD2   1 
ATOM   3859  C CE1   . HIS B  1 175 ? 1.328   21.902  14.213  1.00 25.70  ? 237 HIS B CE1   1 
ATOM   3860  N NE2   . HIS B  1 175 ? 1.594   20.726  14.756  1.00 25.71  ? 237 HIS B NE2   1 
ATOM   3861  N N     . TRP B  1 176 ? -3.342  18.898  10.526  1.00 23.93  ? 238 TRP B N     1 
ATOM   3862  C CA    . TRP B  1 176 ? -4.167  18.609  9.362   1.00 24.91  ? 238 TRP B CA    1 
ATOM   3863  C C     . TRP B  1 176 ? -5.058  19.776  8.903   1.00 24.70  ? 238 TRP B C     1 
ATOM   3864  O O     . TRP B  1 176 ? -5.238  20.017  7.723   1.00 23.32  ? 238 TRP B O     1 
ATOM   3865  C CB    . TRP B  1 176 ? -5.038  17.403  9.711   1.00 26.57  ? 238 TRP B CB    1 
ATOM   3866  C CG    . TRP B  1 176 ? -6.007  17.010  8.676   1.00 27.24  ? 238 TRP B CG    1 
ATOM   3867  C CD1   . TRP B  1 176 ? -5.788  16.183  7.617   1.00 27.63  ? 238 TRP B CD1   1 
ATOM   3868  C CD2   . TRP B  1 176 ? -7.371  17.411  8.606   1.00 26.65  ? 238 TRP B CD2   1 
ATOM   3869  N NE1   . TRP B  1 176 ? -6.949  16.049  6.884   1.00 28.54  ? 238 TRP B NE1   1 
ATOM   3870  C CE2   . TRP B  1 176 ? -7.933  16.798  7.477   1.00 26.65  ? 238 TRP B CE2   1 
ATOM   3871  C CE3   . TRP B  1 176 ? -8.168  18.235  9.383   1.00 27.16  ? 238 TRP B CE3   1 
ATOM   3872  C CZ2   . TRP B  1 176 ? -9.253  16.980  7.112   1.00 25.91  ? 238 TRP B CZ2   1 
ATOM   3873  C CZ3   . TRP B  1 176 ? -9.488  18.416  9.009   1.00 27.68  ? 238 TRP B CZ3   1 
ATOM   3874  C CH2   . TRP B  1 176 ? -10.014 17.788  7.890   1.00 26.45  ? 238 TRP B CH2   1 
ATOM   3875  N N     . TRP B  1 177 ? -5.626  20.497  9.851   1.00 26.41  ? 239 TRP B N     1 
ATOM   3876  C CA    . TRP B  1 177 ? -6.472  21.651  9.534   1.00 27.56  ? 239 TRP B CA    1 
ATOM   3877  C C     . TRP B  1 177 ? -5.742  22.736  8.726   1.00 28.77  ? 239 TRP B C     1 
ATOM   3878  O O     . TRP B  1 177 ? -6.365  23.623  8.149   1.00 27.62  ? 239 TRP B O     1 
ATOM   3879  C CB    . TRP B  1 177 ? -7.016  22.270  10.832  1.00 27.42  ? 239 TRP B CB    1 
ATOM   3880  C CG    . TRP B  1 177 ? -7.976  21.391  11.567  1.00 27.32  ? 239 TRP B CG    1 
ATOM   3881  C CD1   . TRP B  1 177 ? -7.708  20.622  12.655  1.00 27.38  ? 239 TRP B CD1   1 
ATOM   3882  C CD2   . TRP B  1 177 ? -9.355  21.166  11.249  1.00 26.96  ? 239 TRP B CD2   1 
ATOM   3883  N NE1   . TRP B  1 177 ? -8.829  19.932  13.031  1.00 27.92  ? 239 TRP B NE1   1 
ATOM   3884  C CE2   . TRP B  1 177 ? -9.854  20.251  12.179  1.00 27.02  ? 239 TRP B CE2   1 
ATOM   3885  C CE3   . TRP B  1 177 ? -10.210 21.633  10.251  1.00 26.83  ? 239 TRP B CE3   1 
ATOM   3886  C CZ2   . TRP B  1 177 ? -11.170 19.805  12.148  1.00 26.24  ? 239 TRP B CZ2   1 
ATOM   3887  C CZ3   . TRP B  1 177 ? -11.515 21.185  10.231  1.00 25.73  ? 239 TRP B CZ3   1 
ATOM   3888  C CH2   . TRP B  1 177 ? -11.976 20.283  11.164  1.00 25.39  ? 239 TRP B CH2   1 
ATOM   3889  N N     . GLU B  1 178 ? -4.420  22.677  8.709   1.00 31.27  ? 240 GLU B N     1 
ATOM   3890  C CA    . GLU B  1 178 ? -3.639  23.681  8.018   1.00 35.04  ? 240 GLU B CA    1 
ATOM   3891  C C     . GLU B  1 178 ? -3.795  23.605  6.512   1.00 36.21  ? 240 GLU B C     1 
ATOM   3892  O O     . GLU B  1 178 ? -3.628  24.618  5.831   1.00 36.67  ? 240 GLU B O     1 
ATOM   3893  C CB    . GLU B  1 178 ? -2.152  23.585  8.385   1.00 37.13  ? 240 GLU B CB    1 
ATOM   3894  C CG    . GLU B  1 178 ? -1.830  24.159  9.761   1.00 39.54  ? 240 GLU B CG    1 
ATOM   3895  C CD    . GLU B  1 178 ? -0.488  23.705  10.295  1.00 41.90  ? 240 GLU B CD    1 
ATOM   3896  O OE1   . GLU B  1 178 ? -0.206  23.909  11.501  1.00 45.08  ? 240 GLU B OE1   1 
ATOM   3897  O OE2   . GLU B  1 178 ? 0.279   23.130  9.511   1.00 41.76  ? 240 GLU B OE2   1 
ATOM   3898  N N     . ASN B  1 179 ? -4.116  22.418  5.998   1.00 36.72  ? 241 ASN B N     1 
ATOM   3899  C CA    . ASN B  1 179 ? -4.318  22.241  4.564   1.00 35.53  ? 241 ASN B CA    1 
ATOM   3900  C C     . ASN B  1 179 ? -5.385  21.215  4.204   1.00 34.72  ? 241 ASN B C     1 
ATOM   3901  O O     . ASN B  1 179 ? -5.100  20.024  4.020   1.00 34.88  ? 241 ASN B O     1 
ATOM   3902  C CB    . ASN B  1 179 ? -3.002  21.873  3.901   1.00 36.14  ? 241 ASN B CB    1 
ATOM   3903  C CG    . ASN B  1 179 ? -3.131  21.754  2.397   1.00 36.89  ? 241 ASN B CG    1 
ATOM   3904  O OD1   . ASN B  1 179 ? -4.210  21.921  1.833   1.00 39.22  ? 241 ASN B OD1   1 
ATOM   3905  N ND2   . ASN B  1 179 ? -2.040  21.451  1.748   1.00 36.27  ? 241 ASN B ND2   1 
ATOM   3906  N N     . VAL B  1 180 ? -6.611  21.704  4.068   1.00 34.53  ? 242 VAL B N     1 
ATOM   3907  C CA    . VAL B  1 180 ? -7.763  20.865  3.751   1.00 34.35  ? 242 VAL B CA    1 
ATOM   3908  C C     . VAL B  1 180 ? -8.103  20.947  2.258   1.00 31.40  ? 242 VAL B C     1 
ATOM   3909  O O     . VAL B  1 180 ? -8.668  21.930  1.798   1.00 28.64  ? 242 VAL B O     1 
ATOM   3910  C CB    . VAL B  1 180 ? -8.983  21.254  4.638   1.00 34.94  ? 242 VAL B CB    1 
ATOM   3911  C CG1   . VAL B  1 180 ? -10.168 20.329  4.365   1.00 34.78  ? 242 VAL B CG1   1 
ATOM   3912  C CG2   . VAL B  1 180 ? -8.601  21.183  6.121   1.00 35.71  ? 242 VAL B CG2   1 
ATOM   3913  N N     . TYR B  1 181 ? -7.741  19.909  1.510   1.00 30.29  ? 243 TYR B N     1 
ATOM   3914  C CA    . TYR B  1 181 ? -7.942  19.885  0.050   1.00 29.78  ? 243 TYR B CA    1 
ATOM   3915  C C     . TYR B  1 181 ? -7.530  21.182  -0.631  1.00 30.83  ? 243 TYR B C     1 
ATOM   3916  O O     . TYR B  1 181 ? -8.228  21.700  -1.501  1.00 29.15  ? 243 TYR B O     1 
ATOM   3917  C CB    . TYR B  1 181 ? -9.376  19.558  -0.281  1.00 27.92  ? 243 TYR B CB    1 
ATOM   3918  C CG    . TYR B  1 181 ? -9.770  18.205  0.203   1.00 26.47  ? 243 TYR B CG    1 
ATOM   3919  C CD1   . TYR B  1 181 ? -9.433  17.073  -0.500  1.00 25.28  ? 243 TYR B CD1   1 
ATOM   3920  C CD2   . TYR B  1 181 ? -10.479 18.059  1.373   1.00 26.46  ? 243 TYR B CD2   1 
ATOM   3921  C CE1   . TYR B  1 181 ? -9.809  15.824  -0.054  1.00 25.52  ? 243 TYR B CE1   1 
ATOM   3922  C CE2   . TYR B  1 181 ? -10.861 16.820  1.825   1.00 25.92  ? 243 TYR B CE2   1 
ATOM   3923  C CZ    . TYR B  1 181 ? -10.516 15.705  1.108   1.00 25.82  ? 243 TYR B CZ    1 
ATOM   3924  O OH    . TYR B  1 181 ? -10.881 14.463  1.559   1.00 26.54  ? 243 TYR B OH    1 
ATOM   3925  N N     . GLY B  1 182 ? -6.376  21.687  -0.193  1.00 32.70  ? 244 GLY B N     1 
ATOM   3926  C CA    . GLY B  1 182 ? -5.789  22.915  -0.695  1.00 32.57  ? 244 GLY B CA    1 
ATOM   3927  C C     . GLY B  1 182 ? -6.030  24.151  0.151   1.00 33.51  ? 244 GLY B C     1 
ATOM   3928  O O     . GLY B  1 182 ? -5.362  25.149  -0.060  1.00 33.31  ? 244 GLY B O     1 
ATOM   3929  N N     . PHE B  1 183 ? -6.956  24.100  1.108   1.00 34.83  ? 245 PHE B N     1 
ATOM   3930  C CA    . PHE B  1 183 ? -7.396  25.303  1.801   1.00 35.68  ? 245 PHE B CA    1 
ATOM   3931  C C     . PHE B  1 183 ? -6.909  25.335  3.232   1.00 35.98  ? 245 PHE B C     1 
ATOM   3932  O O     . PHE B  1 183 ? -6.711  24.297  3.857   1.00 35.45  ? 245 PHE B O     1 
ATOM   3933  C CB    . PHE B  1 183 ? -8.918  25.395  1.753   1.00 38.12  ? 245 PHE B CB    1 
ATOM   3934  C CG    . PHE B  1 183 ? -9.463  25.403  0.361   1.00 39.65  ? 245 PHE B CG    1 
ATOM   3935  C CD1   . PHE B  1 183 ? -9.455  26.567  -0.384  1.00 41.28  ? 245 PHE B CD1   1 
ATOM   3936  C CD2   . PHE B  1 183 ? -9.948  24.239  -0.219  1.00 40.20  ? 245 PHE B CD2   1 
ATOM   3937  C CE1   . PHE B  1 183 ? -9.938  26.579  -1.682  1.00 41.86  ? 245 PHE B CE1   1 
ATOM   3938  C CE2   . PHE B  1 183 ? -10.442 24.248  -1.508  1.00 41.49  ? 245 PHE B CE2   1 
ATOM   3939  C CZ    . PHE B  1 183 ? -10.438 25.416  -2.243  1.00 42.10  ? 245 PHE B CZ    1 
ATOM   3940  N N     . ASP B  1 184 ? -6.721  26.555  3.726   1.00 37.68  ? 246 ASP B N     1 
ATOM   3941  C CA    . ASP B  1 184 ? -6.323  26.841  5.109   1.00 38.54  ? 246 ASP B CA    1 
ATOM   3942  C C     . ASP B  1 184 ? -7.502  26.878  6.094   1.00 38.47  ? 246 ASP B C     1 
ATOM   3943  O O     . ASP B  1 184 ? -8.413  27.692  5.950   1.00 39.80  ? 246 ASP B O     1 
ATOM   3944  C CB    . ASP B  1 184 ? -5.628  28.204  5.161   1.00 37.97  ? 246 ASP B CB    1 
ATOM   3945  C CG    . ASP B  1 184 ? -5.163  28.548  6.538   1.00 37.97  ? 246 ASP B CG    1 
ATOM   3946  O OD1   . ASP B  1 184 ? -5.993  28.978  7.356   1.00 37.50  ? 246 ASP B OD1   1 
ATOM   3947  O OD2   . ASP B  1 184 ? -3.971  28.350  6.810   1.00 39.13  ? 246 ASP B OD2   1 
ATOM   3948  N N     . MET B  1 185 ? -7.472  26.029  7.111   1.00 37.47  ? 247 MET B N     1 
ATOM   3949  C CA    . MET B  1 185 ? -8.520  26.050  8.120   1.00 37.11  ? 247 MET B CA    1 
ATOM   3950  C C     . MET B  1 185 ? -7.925  26.189  9.532   1.00 40.14  ? 247 MET B C     1 
ATOM   3951  O O     . MET B  1 185 ? -8.354  25.514  10.482  1.00 41.87  ? 247 MET B O     1 
ATOM   3952  C CB    . MET B  1 185 ? -9.398  24.800  7.984   1.00 33.29  ? 247 MET B CB    1 
ATOM   3953  C CG    . MET B  1 185 ? -10.090 24.694  6.643   1.00 30.33  ? 247 MET B CG    1 
ATOM   3954  S SD    . MET B  1 185 ? -11.382 23.484  6.735   1.00 27.04  ? 247 MET B SD    1 
ATOM   3955  C CE    . MET B  1 185 ? -12.118 23.584  5.117   1.00 28.10  ? 247 MET B CE    1 
ATOM   3956  N N     . THR B  1 186 ? -6.950  27.088  9.680   1.00 41.36  ? 248 THR B N     1 
ATOM   3957  C CA    . THR B  1 186 ? -6.257  27.223  10.969  1.00 40.72  ? 248 THR B CA    1 
ATOM   3958  C C     . THR B  1 186 ? -7.148  27.818  12.055  1.00 39.49  ? 248 THR B C     1 
ATOM   3959  O O     . THR B  1 186 ? -6.973  27.526  13.235  1.00 41.52  ? 248 THR B O     1 
ATOM   3960  C CB    . THR B  1 186 ? -4.956  28.046  10.873  1.00 39.27  ? 248 THR B CB    1 
ATOM   3961  O OG1   . THR B  1 186 ? -5.260  29.343  10.391  1.00 39.13  ? 248 THR B OG1   1 
ATOM   3962  C CG2   . THR B  1 186 ? -3.962  27.404  9.930   1.00 40.68  ? 248 THR B CG2   1 
ATOM   3963  N N     . CYS B  1 187 ? -8.124  28.623  11.670  1.00 37.40  ? 249 CYS B N     1 
ATOM   3964  C CA    . CYS B  1 187 ? -8.997  29.198  12.665  1.00 37.17  ? 249 CYS B CA    1 
ATOM   3965  C C     . CYS B  1 187 ? -9.771  28.085  13.345  1.00 34.38  ? 249 CYS B C     1 
ATOM   3966  O O     . CYS B  1 187 ? -10.145 28.222  14.502  1.00 35.17  ? 249 CYS B O     1 
ATOM   3967  C CB    . CYS B  1 187 ? -9.944  30.216  12.047  1.00 40.54  ? 249 CYS B CB    1 
ATOM   3968  S SG    . CYS B  1 187 ? -11.231 29.502  11.019  1.00 44.83  ? 249 CYS B SG    1 
ATOM   3969  N N     . ILE B  1 188 ? -10.003 26.976  12.638  1.00 32.04  ? 250 ILE B N     1 
ATOM   3970  C CA    . ILE B  1 188 ? -10.573 25.787  13.265  1.00 30.55  ? 250 ILE B CA    1 
ATOM   3971  C C     . ILE B  1 188 ? -9.516  25.084  14.100  1.00 31.04  ? 250 ILE B C     1 
ATOM   3972  O O     . ILE B  1 188 ? -9.759  24.750  15.265  1.00 31.24  ? 250 ILE B O     1 
ATOM   3973  C CB    . ILE B  1 188 ? -11.198 24.816  12.249  1.00 28.57  ? 250 ILE B CB    1 
ATOM   3974  C CG1   . ILE B  1 188 ? -12.538 25.388  11.814  1.00 27.68  ? 250 ILE B CG1   1 
ATOM   3975  C CG2   . ILE B  1 188 ? -11.413 23.433  12.876  1.00 28.97  ? 250 ILE B CG2   1 
ATOM   3976  C CD1   . ILE B  1 188 ? -13.311 24.511  10.869  1.00 27.91  ? 250 ILE B CD1   1 
ATOM   3977  N N     . ARG B  1 189 ? -8.359  24.841  13.498  1.00 31.27  ? 251 ARG B N     1 
ATOM   3978  C CA    . ARG B  1 189 ? -7.212  24.293  14.220  1.00 32.60  ? 251 ARG B CA    1 
ATOM   3979  C C     . ARG B  1 189 ? -7.017  24.899  15.620  1.00 32.41  ? 251 ARG B C     1 
ATOM   3980  O O     . ARG B  1 189 ? -6.842  24.172  16.609  1.00 31.51  ? 251 ARG B O     1 
ATOM   3981  C CB    . ARG B  1 189 ? -5.958  24.489  13.379  1.00 33.71  ? 251 ARG B CB    1 
ATOM   3982  C CG    . ARG B  1 189 ? -4.701  23.867  13.959  1.00 34.68  ? 251 ARG B CG    1 
ATOM   3983  C CD    . ARG B  1 189 ? -3.783  24.923  14.528  1.00 34.73  ? 251 ARG B CD    1 
ATOM   3984  N NE    . ARG B  1 189 ? -2.759  25.330  13.565  1.00 34.54  ? 251 ARG B NE    1 
ATOM   3985  C CZ    . ARG B  1 189 ? -2.186  26.534  13.530  1.00 35.17  ? 251 ARG B CZ    1 
ATOM   3986  N NH1   . ARG B  1 189 ? -2.546  27.481  14.400  1.00 34.18  ? 251 ARG B NH1   1 
ATOM   3987  N NH2   . ARG B  1 189 ? -1.258  26.802  12.606  1.00 34.80  ? 251 ARG B NH2   1 
ATOM   3988  N N     . ASP B  1 190 ? -7.074  26.224  15.698  1.00 32.56  ? 252 ASP B N     1 
ATOM   3989  C CA    . ASP B  1 190 ? -6.888  26.933  16.971  1.00 32.64  ? 252 ASP B CA    1 
ATOM   3990  C C     . ASP B  1 190 ? -7.938  26.587  18.007  1.00 32.83  ? 252 ASP B C     1 
ATOM   3991  O O     . ASP B  1 190 ? -7.640  26.579  19.184  1.00 32.90  ? 252 ASP B O     1 
ATOM   3992  C CB    . ASP B  1 190 ? -6.856  28.441  16.745  1.00 32.37  ? 252 ASP B CB    1 
ATOM   3993  C CG    . ASP B  1 190 ? -5.586  28.892  16.036  1.00 32.59  ? 252 ASP B CG    1 
ATOM   3994  O OD1   . ASP B  1 190 ? -4.699  28.047  15.757  1.00 31.80  ? 252 ASP B OD1   1 
ATOM   3995  O OD2   . ASP B  1 190 ? -5.484  30.089  15.736  1.00 31.58  ? 252 ASP B OD2   1 
ATOM   3996  N N     . VAL B  1 191 ? -9.155  26.290  17.557  1.00 34.71  ? 253 VAL B N     1 
ATOM   3997  C CA    . VAL B  1 191 ? -10.243 25.807  18.418  1.00 34.54  ? 253 VAL B CA    1 
ATOM   3998  C C     . VAL B  1 191 ? -10.019 24.356  18.842  1.00 34.36  ? 253 VAL B C     1 
ATOM   3999  O O     . VAL B  1 191 ? -10.238 24.005  19.999  1.00 33.43  ? 253 VAL B O     1 
ATOM   4000  C CB    . VAL B  1 191 ? -11.623 25.955  17.710  1.00 34.82  ? 253 VAL B CB    1 
ATOM   4001  C CG1   . VAL B  1 191 ? -12.726 25.225  18.466  1.00 35.07  ? 253 VAL B CG1   1 
ATOM   4002  C CG2   . VAL B  1 191 ? -11.961 27.433  17.580  1.00 34.77  ? 253 VAL B CG2   1 
ATOM   4003  N N     . ALA B  1 192 ? -9.581  23.519  17.906  1.00 35.56  ? 254 ALA B N     1 
ATOM   4004  C CA    . ALA B  1 192 ? -9.374  22.095  18.171  1.00 35.96  ? 254 ALA B CA    1 
ATOM   4005  C C     . ALA B  1 192 ? -8.305  21.841  19.212  1.00 36.30  ? 254 ALA B C     1 
ATOM   4006  O O     . ALA B  1 192 ? -8.470  20.999  20.076  1.00 36.20  ? 254 ALA B O     1 
ATOM   4007  C CB    . ALA B  1 192 ? -9.024  21.374  16.892  1.00 36.26  ? 254 ALA B CB    1 
ATOM   4008  N N     . MET B  1 193 ? -7.209  22.573  19.113  1.00 39.67  ? 255 MET B N     1 
ATOM   4009  C CA    . MET B  1 193 ? -6.205  22.648  20.184  1.00 43.24  ? 255 MET B CA    1 
ATOM   4010  C C     . MET B  1 193 ? -6.763  22.775  21.603  1.00 42.53  ? 255 MET B C     1 
ATOM   4011  O O     . MET B  1 193 ? -6.281  22.129  22.541  1.00 39.48  ? 255 MET B O     1 
ATOM   4012  C CB    . MET B  1 193 ? -5.321  23.868  19.943  1.00 44.52  ? 255 MET B CB    1 
ATOM   4013  C CG    . MET B  1 193 ? -4.293  23.632  18.874  1.00 45.97  ? 255 MET B CG    1 
ATOM   4014  S SD    . MET B  1 193 ? -3.074  22.533  19.561  1.00 48.67  ? 255 MET B SD    1 
ATOM   4015  C CE    . MET B  1 193 ? -1.627  23.078  18.647  1.00 56.01  ? 255 MET B CE    1 
ATOM   4016  N N     . LYS B  1 194 ? -7.764  23.638  21.738  1.00 44.88  ? 256 LYS B N     1 
ATOM   4017  C CA    . LYS B  1 194 ? -8.362  23.979  23.026  1.00 45.62  ? 256 LYS B CA    1 
ATOM   4018  C C     . LYS B  1 194 ? -9.274  22.872  23.567  1.00 40.28  ? 256 LYS B C     1 
ATOM   4019  O O     . LYS B  1 194 ? -9.807  22.975  24.661  1.00 37.50  ? 256 LYS B O     1 
ATOM   4020  C CB    . LYS B  1 194 ? -9.096  25.349  22.926  1.00 50.07  ? 256 LYS B CB    1 
ATOM   4021  C CG    . LYS B  1 194 ? -8.212  26.552  22.543  1.00 55.01  ? 256 LYS B CG    1 
ATOM   4022  C CD    . LYS B  1 194 ? -6.900  26.583  23.354  1.00 67.40  ? 256 LYS B CD    1 
ATOM   4023  C CE    . LYS B  1 194 ? -5.751  27.396  22.762  1.00 69.75  ? 256 LYS B CE    1 
ATOM   4024  N NZ    . LYS B  1 194 ? -6.060  28.836  22.957  1.00 72.67  ? 256 LYS B NZ    1 
ATOM   4025  N N     . GLU B  1 195 ? -9.416  21.788  22.827  1.00 36.98  ? 257 GLU B N     1 
ATOM   4026  C CA    . GLU B  1 195 ? -10.239 20.713  23.284  1.00 36.72  ? 257 GLU B CA    1 
ATOM   4027  C C     . GLU B  1 195 ? -9.431  19.434  23.484  1.00 33.09  ? 257 GLU B C     1 
ATOM   4028  O O     . GLU B  1 195 ? -8.886  18.870  22.522  1.00 34.04  ? 257 GLU B O     1 
ATOM   4029  C CB    . GLU B  1 195 ? -11.356 20.494  22.286  1.00 41.38  ? 257 GLU B CB    1 
ATOM   4030  C CG    . GLU B  1 195 ? -12.495 19.636  22.811  1.00 45.55  ? 257 GLU B CG    1 
ATOM   4031  C CD    . GLU B  1 195 ? -13.594 19.511  21.791  1.00 47.50  ? 257 GLU B CD    1 
ATOM   4032  O OE1   . GLU B  1 195 ? -13.987 20.577  21.261  1.00 48.29  ? 257 GLU B OE1   1 
ATOM   4033  O OE2   . GLU B  1 195 ? -14.036 18.367  21.522  1.00 46.96  ? 257 GLU B OE2   1 
ATOM   4034  N N     . PRO B  1 196 ? -9.379  18.942  24.734  1.00 29.42  ? 258 PRO B N     1 
ATOM   4035  C CA    . PRO B  1 196 ? -8.604  17.740  24.995  1.00 27.94  ? 258 PRO B CA    1 
ATOM   4036  C C     . PRO B  1 196 ? -9.143  16.535  24.277  1.00 26.06  ? 258 PRO B C     1 
ATOM   4037  O O     . PRO B  1 196 ? -10.301 16.473  24.033  1.00 24.90  ? 258 PRO B O     1 
ATOM   4038  C CB    . PRO B  1 196 ? -8.748  17.543  26.504  1.00 28.23  ? 258 PRO B CB    1 
ATOM   4039  C CG    . PRO B  1 196 ? -9.305  18.809  27.038  1.00 28.07  ? 258 PRO B CG    1 
ATOM   4040  C CD    . PRO B  1 196 ? -10.102 19.394  25.934  1.00 28.60  ? 258 PRO B CD    1 
ATOM   4041  N N     . LEU B  1 197 ? -8.294  15.587  23.941  1.00 27.73  ? 259 LEU B N     1 
ATOM   4042  C CA    . LEU B  1 197 ? -8.740  14.360  23.275  1.00 30.93  ? 259 LEU B CA    1 
ATOM   4043  C C     . LEU B  1 197 ? -8.884  13.216  24.238  1.00 29.21  ? 259 LEU B C     1 
ATOM   4044  O O     . LEU B  1 197 ? -7.962  12.939  24.982  1.00 31.42  ? 259 LEU B O     1 
ATOM   4045  C CB    . LEU B  1 197 ? -7.731  13.890  22.235  1.00 33.88  ? 259 LEU B CB    1 
ATOM   4046  C CG    . LEU B  1 197 ? -8.055  14.244  20.793  1.00 37.13  ? 259 LEU B CG    1 
ATOM   4047  C CD1   . LEU B  1 197 ? -7.865  15.761  20.524  1.00 38.20  ? 259 LEU B CD1   1 
ATOM   4048  C CD2   . LEU B  1 197 ? -7.156  13.347  19.943  1.00 38.71  ? 259 LEU B CD2   1 
ATOM   4049  N N     . VAL B  1 198 ? -10.006 12.514  24.193  1.00 26.59  ? 260 VAL B N     1 
ATOM   4050  C CA    . VAL B  1 198 ? -10.113 11.283  24.923  1.00 25.17  ? 260 VAL B CA    1 
ATOM   4051  C C     . VAL B  1 198 ? -9.734  10.211  23.950  1.00 25.80  ? 260 VAL B C     1 
ATOM   4052  O O     . VAL B  1 198 ? -10.422 10.012  22.954  1.00 26.37  ? 260 VAL B O     1 
ATOM   4053  C CB    . VAL B  1 198 ? -11.510 11.068  25.454  1.00 24.38  ? 260 VAL B CB    1 
ATOM   4054  C CG1   . VAL B  1 198 ? -11.623 9.715   26.143  1.00 23.91  ? 260 VAL B CG1   1 
ATOM   4055  C CG2   . VAL B  1 198 ? -11.859 12.196  26.417  1.00 24.85  ? 260 VAL B CG2   1 
ATOM   4056  N N     . ASP B  1 199 ? -8.606  9.560   24.210  1.00 26.50  ? 261 ASP B N     1 
ATOM   4057  C CA    . ASP B  1 199 ? -8.112  8.515   23.319  1.00 27.92  ? 261 ASP B CA    1 
ATOM   4058  C C     . ASP B  1 199 ? -7.003  7.694   23.975  1.00 27.65  ? 261 ASP B C     1 
ATOM   4059  O O     . ASP B  1 199 ? -6.440  8.105   24.973  1.00 28.14  ? 261 ASP B O     1 
ATOM   4060  C CB    . ASP B  1 199 ? -7.618  9.136   22.007  1.00 28.45  ? 261 ASP B CB    1 
ATOM   4061  C CG    . ASP B  1 199 ? -7.998  8.317   20.803  1.00 29.78  ? 261 ASP B CG    1 
ATOM   4062  O OD1   . ASP B  1 199 ? -8.244  7.087   20.926  1.00 30.10  ? 261 ASP B OD1   1 
ATOM   4063  O OD2   . ASP B  1 199 ? -8.063  8.926   19.722  1.00 31.73  ? 261 ASP B OD2   1 
ATOM   4064  N N     . ILE B  1 200 ? -6.697  6.527   23.432  1.00 27.89  ? 262 ILE B N     1 
ATOM   4065  C CA    . ILE B  1 200 ? -5.688  5.694   24.053  1.00 28.81  ? 262 ILE B CA    1 
ATOM   4066  C C     . ILE B  1 200 ? -4.319  6.207   23.685  1.00 28.44  ? 262 ILE B C     1 
ATOM   4067  O O     . ILE B  1 200 ? -4.094  6.674   22.561  1.00 25.81  ? 262 ILE B O     1 
ATOM   4068  C CB    . ILE B  1 200 ? -5.802  4.207   23.680  1.00 29.56  ? 262 ILE B CB    1 
ATOM   4069  C CG1   . ILE B  1 200 ? -7.091  3.624   24.275  1.00 32.12  ? 262 ILE B CG1   1 
ATOM   4070  C CG2   . ILE B  1 200 ? -4.608  3.425   24.205  1.00 28.97  ? 262 ILE B CG2   1 
ATOM   4071  C CD1   . ILE B  1 200 ? -8.136  3.328   23.219  1.00 34.41  ? 262 ILE B CD1   1 
ATOM   4072  N N     . VAL B  1 201 ? -3.434  6.124   24.678  1.00 27.89  ? 263 VAL B N     1 
ATOM   4073  C CA    . VAL B  1 201 ? -2.047  6.490   24.548  1.00 27.42  ? 263 VAL B CA    1 
ATOM   4074  C C     . VAL B  1 201 ? -1.211  5.227   24.764  1.00 26.98  ? 263 VAL B C     1 
ATOM   4075  O O     . VAL B  1 201 ? -1.448  4.461   25.691  1.00 27.39  ? 263 VAL B O     1 
ATOM   4076  C CB    . VAL B  1 201 ? -1.679  7.588   25.578  1.00 27.15  ? 263 VAL B CB    1 
ATOM   4077  C CG1   . VAL B  1 201 ? -0.253  8.084   25.366  1.00 27.29  ? 263 VAL B CG1   1 
ATOM   4078  C CG2   . VAL B  1 201 ? -2.647  8.754   25.475  1.00 26.25  ? 263 VAL B CG2   1 
ATOM   4079  N N     . ASP B  1 202 ? -0.251  5.009   23.882  1.00 26.90  ? 264 ASP B N     1 
ATOM   4080  C CA    . ASP B  1 202 ? 0.642   3.890   23.992  1.00 28.74  ? 264 ASP B CA    1 
ATOM   4081  C C     . ASP B  1 202 ? 1.530   4.264   25.154  1.00 29.06  ? 264 ASP B C     1 
ATOM   4082  O O     . ASP B  1 202 ? 2.038   5.393   25.182  1.00 30.68  ? 264 ASP B O     1 
ATOM   4083  C CB    . ASP B  1 202 ? 1.470   3.739   22.697  1.00 31.08  ? 264 ASP B CB    1 
ATOM   4084  C CG    . ASP B  1 202 ? 2.311   2.438   22.637  1.00 34.28  ? 264 ASP B CG    1 
ATOM   4085  O OD1   . ASP B  1 202 ? 2.913   1.992   23.646  1.00 37.81  ? 264 ASP B OD1   1 
ATOM   4086  O OD2   . ASP B  1 202 ? 2.400   1.862   21.535  1.00 36.93  ? 264 ASP B OD2   1 
ATOM   4087  N N     . PRO B  1 203 ? 1.748   3.331   26.102  1.00 27.29  ? 265 PRO B N     1 
ATOM   4088  C CA    . PRO B  1 203 ? 2.711   3.591   27.174  1.00 27.53  ? 265 PRO B CA    1 
ATOM   4089  C C     . PRO B  1 203 ? 4.107   4.011   26.708  1.00 26.64  ? 265 PRO B C     1 
ATOM   4090  O O     . PRO B  1 203 ? 4.761   4.799   27.375  1.00 27.34  ? 265 PRO B O     1 
ATOM   4091  C CB    . PRO B  1 203 ? 2.780   2.254   27.933  1.00 28.10  ? 265 PRO B CB    1 
ATOM   4092  C CG    . PRO B  1 203 ? 2.024   1.260   27.121  1.00 27.03  ? 265 PRO B CG    1 
ATOM   4093  C CD    . PRO B  1 203 ? 1.077   2.035   26.270  1.00 26.69  ? 265 PRO B CD    1 
ATOM   4094  N N     . LYS B  1 204 ? 4.552   3.505   25.571  1.00 26.57  ? 266 LYS B N     1 
ATOM   4095  C CA    . LYS B  1 204 ? 5.854   3.874   25.035  1.00 27.70  ? 266 LYS B CA    1 
ATOM   4096  C C     . LYS B  1 204 ? 5.990   5.376   24.797  1.00 26.44  ? 266 LYS B C     1 
ATOM   4097  O O     . LYS B  1 204 ? 7.089   5.928   24.880  1.00 23.66  ? 266 LYS B O     1 
ATOM   4098  C CB    . LYS B  1 204 ? 6.124   3.083   23.752  1.00 30.57  ? 266 LYS B CB    1 
ATOM   4099  C CG    . LYS B  1 204 ? 6.487   1.634   24.052  1.00 33.55  ? 266 LYS B CG    1 
ATOM   4100  C CD    . LYS B  1 204 ? 6.276   0.669   22.898  1.00 35.90  ? 266 LYS B CD    1 
ATOM   4101  C CE    . LYS B  1 204 ? 6.754   -0.718  23.322  1.00 38.10  ? 266 LYS B CE    1 
ATOM   4102  N NZ    . LYS B  1 204 ? 6.265   -1.763  22.385  1.00 39.95  ? 266 LYS B NZ    1 
ATOM   4103  N N     . GLN B  1 205 ? 4.863   6.036   24.534  1.00 26.97  ? 267 GLN B N     1 
ATOM   4104  C CA    . GLN B  1 205 ? 4.852   7.481   24.262  1.00 26.82  ? 267 GLN B CA    1 
ATOM   4105  C C     . GLN B  1 205 ? 5.117   8.345   25.467  1.00 25.47  ? 267 GLN B C     1 
ATOM   4106  O O     . GLN B  1 205 ? 5.394   9.531   25.309  1.00 24.93  ? 267 GLN B O     1 
ATOM   4107  C CB    . GLN B  1 205 ? 3.521   7.919   23.676  1.00 27.60  ? 267 GLN B CB    1 
ATOM   4108  C CG    . GLN B  1 205 ? 3.231   7.336   22.312  1.00 28.81  ? 267 GLN B CG    1 
ATOM   4109  C CD    . GLN B  1 205 ? 1.911   7.818   21.754  1.00 29.24  ? 267 GLN B CD    1 
ATOM   4110  O OE1   . GLN B  1 205 ? 1.682   9.031   21.620  1.00 29.80  ? 267 GLN B OE1   1 
ATOM   4111  N NE2   . GLN B  1 205 ? 1.048   6.881   21.394  1.00 28.67  ? 267 GLN B NE2   1 
ATOM   4112  N N     . VAL B  1 206 ? 5.040   7.758   26.658  1.00 24.50  ? 268 VAL B N     1 
ATOM   4113  C CA    . VAL B  1 206 ? 5.270   8.497   27.892  1.00 24.14  ? 268 VAL B CA    1 
ATOM   4114  C C     . VAL B  1 206 ? 6.759   8.818   28.101  1.00 24.45  ? 268 VAL B C     1 
ATOM   4115  O O     . VAL B  1 206 ? 7.615   7.919   28.143  1.00 23.88  ? 268 VAL B O     1 
ATOM   4116  C CB    . VAL B  1 206 ? 4.711   7.739   29.109  1.00 23.89  ? 268 VAL B CB    1 
ATOM   4117  C CG1   . VAL B  1 206 ? 4.950   8.535   30.382  1.00 23.59  ? 268 VAL B CG1   1 
ATOM   4118  C CG2   . VAL B  1 206 ? 3.227   7.489   28.912  1.00 24.05  ? 268 VAL B CG2   1 
ATOM   4119  N N     . VAL B  1 207 ? 7.027   10.116  28.242  1.00 24.40  ? 269 VAL B N     1 
ATOM   4120  C CA    . VAL B  1 207 ? 8.361   10.681  28.340  1.00 25.06  ? 269 VAL B CA    1 
ATOM   4121  C C     . VAL B  1 207 ? 8.761   10.950  29.804  1.00 27.46  ? 269 VAL B C     1 
ATOM   4122  O O     . VAL B  1 207 ? 9.947   11.188  30.094  1.00 30.06  ? 269 VAL B O     1 
ATOM   4123  C CB    . VAL B  1 207 ? 8.422   12.003  27.535  1.00 23.88  ? 269 VAL B CB    1 
ATOM   4124  C CG1   . VAL B  1 207 ? 9.700   12.797  27.795  1.00 24.06  ? 269 VAL B CG1   1 
ATOM   4125  C CG2   . VAL B  1 207 ? 8.315   11.693  26.065  1.00 23.81  ? 269 VAL B CG2   1 
ATOM   4126  N N     . THR B  1 208 ? 7.803   10.912  30.732  1.00 27.48  ? 270 THR B N     1 
ATOM   4127  C CA    . THR B  1 208 ? 8.080   11.312  32.103  1.00 28.04  ? 270 THR B CA    1 
ATOM   4128  C C     . THR B  1 208 ? 7.589   10.327  33.153  1.00 27.31  ? 270 THR B C     1 
ATOM   4129  O O     . THR B  1 208 ? 6.989   9.298   32.845  1.00 27.17  ? 270 THR B O     1 
ATOM   4130  C CB    . THR B  1 208 ? 7.435   12.673  32.403  1.00 29.71  ? 270 THR B CB    1 
ATOM   4131  O OG1   . THR B  1 208 ? 6.009   12.533  32.423  1.00 30.85  ? 270 THR B OG1   1 
ATOM   4132  C CG2   . THR B  1 208 ? 7.839   13.700  31.345  1.00 30.89  ? 270 THR B CG2   1 
ATOM   4133  N N     . ASN B  1 209 ? 7.898   10.657  34.402  1.00 27.05  ? 271 ASN B N     1 
ATOM   4134  C CA    . ASN B  1 209 ? 7.245   10.048  35.550  1.00 27.61  ? 271 ASN B CA    1 
ATOM   4135  C C     . ASN B  1 209 ? 5.865   10.663  35.691  1.00 27.55  ? 271 ASN B C     1 
ATOM   4136  O O     . ASN B  1 209 ? 5.492   11.559  34.915  1.00 27.50  ? 271 ASN B O     1 
ATOM   4137  C CB    . ASN B  1 209 ? 8.062   10.261  36.830  1.00 27.34  ? 271 ASN B CB    1 
ATOM   4138  C CG    . ASN B  1 209 ? 8.339   11.738  37.127  1.00 27.86  ? 271 ASN B CG    1 
ATOM   4139  O OD1   . ASN B  1 209 ? 8.138   12.636  36.279  1.00 28.20  ? 271 ASN B OD1   1 
ATOM   4140  N ND2   . ASN B  1 209 ? 8.834   11.995  38.338  1.00 27.32  ? 271 ASN B ND2   1 
ATOM   4141  N N     . ALA B  1 210 ? 5.114   10.202  36.681  1.00 26.46  ? 272 ALA B N     1 
ATOM   4142  C CA    . ALA B  1 210 ? 3.776   10.728  36.889  1.00 26.29  ? 272 ALA B CA    1 
ATOM   4143  C C     . ALA B  1 210 ? 3.706   11.618  38.122  1.00 26.05  ? 272 ALA B C     1 
ATOM   4144  O O     . ALA B  1 210 ? 4.352   11.362  39.110  1.00 25.49  ? 272 ALA B O     1 
ATOM   4145  C CB    . ALA B  1 210 ? 2.782   9.590   36.993  1.00 26.04  ? 272 ALA B CB    1 
ATOM   4146  N N     . CYS B  1 211 ? 2.894   12.658  38.056  1.00 27.56  ? 273 CYS B N     1 
ATOM   4147  C CA    . CYS B  1 211 ? 2.766   13.603  39.145  1.00 29.62  ? 273 CYS B CA    1 
ATOM   4148  C C     . CYS B  1 211 ? 1.320   13.601  39.566  1.00 31.53  ? 273 CYS B C     1 
ATOM   4149  O O     . CYS B  1 211 ? 0.435   13.662  38.718  1.00 33.26  ? 273 CYS B O     1 
ATOM   4150  C CB    . CYS B  1 211 ? 3.183   14.998  38.679  1.00 30.22  ? 273 CYS B CB    1 
ATOM   4151  S SG    . CYS B  1 211 ? 2.883   16.380  39.829  1.00 31.01  ? 273 CYS B SG    1 
ATOM   4152  N N     . LEU B  1 212 ? 1.081   13.511  40.874  1.00 33.66  ? 274 LEU B N     1 
ATOM   4153  C CA    . LEU B  1 212 ? -0.275  13.586  41.453  1.00 33.65  ? 274 LEU B CA    1 
ATOM   4154  C C     . LEU B  1 212 ? -0.783  15.036  41.427  1.00 32.08  ? 274 LEU B C     1 
ATOM   4155  O O     . LEU B  1 212 ? -0.109  15.929  41.920  1.00 32.47  ? 274 LEU B O     1 
ATOM   4156  C CB    . LEU B  1 212 ? -0.247  13.068  42.895  1.00 34.56  ? 274 LEU B CB    1 
ATOM   4157  C CG    . LEU B  1 212 ? -1.525  13.136  43.718  1.00 37.37  ? 274 LEU B CG    1 
ATOM   4158  C CD1   . LEU B  1 212 ? -2.582  12.217  43.114  1.00 39.48  ? 274 LEU B CD1   1 
ATOM   4159  C CD2   . LEU B  1 212 ? -1.242  12.746  45.163  1.00 38.01  ? 274 LEU B CD2   1 
ATOM   4160  N N     . ILE B  1 213 ? -1.952  15.279  40.852  1.00 29.65  ? 275 ILE B N     1 
ATOM   4161  C CA    . ILE B  1 213 ? -2.481  16.631  40.850  1.00 28.48  ? 275 ILE B CA    1 
ATOM   4162  C C     . ILE B  1 213 ? -3.813  16.791  41.584  1.00 28.20  ? 275 ILE B C     1 
ATOM   4163  O O     . ILE B  1 213 ? -4.316  17.900  41.709  1.00 25.38  ? 275 ILE B O     1 
ATOM   4164  C CB    . ILE B  1 213 ? -2.597  17.157  39.425  1.00 28.65  ? 275 ILE B CB    1 
ATOM   4165  C CG1   . ILE B  1 213 ? -3.452  16.221  38.574  1.00 29.82  ? 275 ILE B CG1   1 
ATOM   4166  C CG2   . ILE B  1 213 ? -1.221  17.287  38.817  1.00 27.96  ? 275 ILE B CG2   1 
ATOM   4167  C CD1   . ILE B  1 213 ? -3.967  16.892  37.319  1.00 30.57  ? 275 ILE B CD1   1 
ATOM   4168  N N     . LYS B  1 214 ? -4.397  15.687  42.039  1.00 30.41  ? 276 LYS B N     1 
ATOM   4169  C CA    . LYS B  1 214 ? -5.619  15.748  42.829  1.00 33.01  ? 276 LYS B CA    1 
ATOM   4170  C C     . LYS B  1 214 ? -5.921  14.409  43.463  1.00 33.45  ? 276 LYS B C     1 
ATOM   4171  O O     . LYS B  1 214 ? -6.085  13.401  42.783  1.00 31.86  ? 276 LYS B O     1 
ATOM   4172  C CB    . LYS B  1 214 ? -6.828  16.164  41.979  1.00 35.33  ? 276 LYS B CB    1 
ATOM   4173  C CG    . LYS B  1 214 ? -8.085  16.458  42.789  1.00 37.64  ? 276 LYS B CG    1 
ATOM   4174  C CD    . LYS B  1 214 ? -7.938  17.732  43.625  1.00 40.17  ? 276 LYS B CD    1 
ATOM   4175  C CE    . LYS B  1 214 ? -9.072  17.895  44.635  1.00 40.63  ? 276 LYS B CE    1 
ATOM   4176  N NZ    . LYS B  1 214 ? -9.058  19.251  45.247  1.00 40.47  ? 276 LYS B NZ    1 
ATOM   4177  N N     . GLU B  1 215 ? -6.023  14.423  44.780  1.00 35.27  ? 277 GLU B N     1 
ATOM   4178  C CA    . GLU B  1 215 ? -6.374  13.252  45.541  1.00 36.53  ? 277 GLU B CA    1 
ATOM   4179  C C     . GLU B  1 215 ? -7.765  13.511  46.097  1.00 36.84  ? 277 GLU B C     1 
ATOM   4180  O O     . GLU B  1 215 ? -8.116  14.656  46.378  1.00 38.02  ? 277 GLU B O     1 
ATOM   4181  C CB    . GLU B  1 215 ? -5.365  13.077  46.652  1.00 38.27  ? 277 GLU B CB    1 
ATOM   4182  C CG    . GLU B  1 215 ? -5.351  11.699  47.279  1.00 40.36  ? 277 GLU B CG    1 
ATOM   4183  C CD    . GLU B  1 215 ? -4.009  11.405  47.888  1.00 42.00  ? 277 GLU B CD    1 
ATOM   4184  O OE1   . GLU B  1 215 ? -3.664  10.217  48.004  1.00 46.56  ? 277 GLU B OE1   1 
ATOM   4185  O OE2   . GLU B  1 215 ? -3.296  12.370  48.231  1.00 39.94  ? 277 GLU B OE2   1 
ATOM   4186  N N     . VAL B  1 216 ? -8.579  12.464  46.213  1.00 37.26  ? 278 VAL B N     1 
ATOM   4187  C CA    . VAL B  1 216 ? -9.968  12.618  46.644  1.00 36.58  ? 278 VAL B CA    1 
ATOM   4188  C C     . VAL B  1 216 ? -10.272 11.578  47.714  1.00 35.37  ? 278 VAL B C     1 
ATOM   4189  O O     . VAL B  1 216 ? -10.218 10.382  47.429  1.00 33.15  ? 278 VAL B O     1 
ATOM   4190  C CB    . VAL B  1 216 ? -10.947 12.501  45.446  1.00 35.88  ? 278 VAL B CB    1 
ATOM   4191  C CG1   . VAL B  1 216 ? -12.401 12.552  45.892  1.00 35.74  ? 278 VAL B CG1   1 
ATOM   4192  C CG2   . VAL B  1 216 ? -10.706 13.631  44.458  1.00 35.76  ? 278 VAL B CG2   1 
ATOM   4193  N N     . ASP B  1 217 ? -10.563 12.051  48.933  1.00 33.92  ? 279 ASP B N     1 
ATOM   4194  C CA    . ASP B  1 217 ? -11.145 11.208  49.976  1.00 33.85  ? 279 ASP B CA    1 
ATOM   4195  C C     . ASP B  1 217 ? -12.656 11.403  49.884  1.00 35.05  ? 279 ASP B C     1 
ATOM   4196  O O     . ASP B  1 217 ? -13.197 12.404  50.349  1.00 36.77  ? 279 ASP B O     1 
ATOM   4197  C CB    . ASP B  1 217 ? -10.625 11.593  51.367  1.00 32.00  ? 279 ASP B CB    1 
ATOM   4198  C CG    . ASP B  1 217 ? -11.178 10.694  52.498  1.00 30.38  ? 279 ASP B CG    1 
ATOM   4199  O OD1   . ASP B  1 217 ? -11.663 9.585   52.230  1.00 28.89  ? 279 ASP B OD1   1 
ATOM   4200  O OD2   . ASP B  1 217 ? -11.116 11.099  53.672  1.00 29.21  ? 279 ASP B OD2   1 
ATOM   4201  N N     . ILE B  1 218 ? -13.339 10.439  49.282  1.00 36.21  ? 280 ILE B N     1 
ATOM   4202  C CA    . ILE B  1 218 ? -14.748 10.606  48.946  1.00 37.91  ? 280 ILE B CA    1 
ATOM   4203  C C     . ILE B  1 218 ? -15.615 10.826  50.200  1.00 36.96  ? 280 ILE B C     1 
ATOM   4204  O O     . ILE B  1 218 ? -16.689 11.430  50.112  1.00 39.14  ? 280 ILE B O     1 
ATOM   4205  C CB    . ILE B  1 218 ? -15.268 9.436   48.069  1.00 39.12  ? 280 ILE B CB    1 
ATOM   4206  C CG1   . ILE B  1 218 ? -14.508 9.413   46.732  1.00 40.58  ? 280 ILE B CG1   1 
ATOM   4207  C CG2   . ILE B  1 218 ? -16.763 9.579   47.801  1.00 39.37  ? 280 ILE B CG2   1 
ATOM   4208  C CD1   . ILE B  1 218 ? -14.908 8.322   45.751  1.00 41.49  ? 280 ILE B CD1   1 
ATOM   4209  N N     . TYR B  1 219 ? -15.137 10.370  51.359  1.00 33.87  ? 281 TYR B N     1 
ATOM   4210  C CA    . TYR B  1 219 ? -15.847 10.580  52.631  1.00 29.95  ? 281 TYR B CA    1 
ATOM   4211  C C     . TYR B  1 219 ? -15.817 12.031  53.087  1.00 28.52  ? 281 TYR B C     1 
ATOM   4212  O O     . TYR B  1 219 ? -16.742 12.457  53.755  1.00 26.45  ? 281 TYR B O     1 
ATOM   4213  C CB    . TYR B  1 219 ? -15.237 9.742   53.747  1.00 28.29  ? 281 TYR B CB    1 
ATOM   4214  C CG    . TYR B  1 219 ? -15.309 8.271   53.524  1.00 26.84  ? 281 TYR B CG    1 
ATOM   4215  C CD1   . TYR B  1 219 ? -16.518 7.609   53.529  1.00 26.79  ? 281 TYR B CD1   1 
ATOM   4216  C CD2   . TYR B  1 219 ? -14.162 7.536   53.311  1.00 26.27  ? 281 TYR B CD2   1 
ATOM   4217  C CE1   . TYR B  1 219 ? -16.581 6.240   53.332  1.00 26.62  ? 281 TYR B CE1   1 
ATOM   4218  C CE2   . TYR B  1 219 ? -14.215 6.173   53.105  1.00 26.69  ? 281 TYR B CE2   1 
ATOM   4219  C CZ    . TYR B  1 219 ? -15.422 5.531   53.120  1.00 26.39  ? 281 TYR B CZ    1 
ATOM   4220  O OH    . TYR B  1 219 ? -15.440 4.175   52.919  1.00 26.98  ? 281 TYR B OH    1 
ATOM   4221  N N     . THR B  1 220 ? -14.766 12.777  52.729  1.00 28.03  ? 282 THR B N     1 
ATOM   4222  C CA    . THR B  1 220 ? -14.577 14.126  53.247  1.00 28.11  ? 282 THR B CA    1 
ATOM   4223  C C     . THR B  1 220 ? -14.524 15.263  52.234  1.00 30.04  ? 282 THR B C     1 
ATOM   4224  O O     . THR B  1 220 ? -14.584 16.418  52.639  1.00 31.83  ? 282 THR B O     1 
ATOM   4225  C CB    . THR B  1 220 ? -13.310 14.216  54.107  1.00 27.26  ? 282 THR B CB    1 
ATOM   4226  O OG1   . THR B  1 220 ? -12.146 14.006  53.300  1.00 26.99  ? 282 THR B OG1   1 
ATOM   4227  C CG2   . THR B  1 220 ? -13.351 13.185  55.169  1.00 27.66  ? 282 THR B CG2   1 
ATOM   4228  N N     . VAL B  1 221 ? -14.423 15.000  50.940  1.00 31.95  ? 283 VAL B N     1 
ATOM   4229  C CA    . VAL B  1 221 ? -14.337 16.136  50.014  1.00 34.86  ? 283 VAL B CA    1 
ATOM   4230  C C     . VAL B  1 221 ? -15.646 16.910  49.966  1.00 36.62  ? 283 VAL B C     1 
ATOM   4231  O O     . VAL B  1 221 ? -16.710 16.342  50.253  1.00 35.74  ? 283 VAL B O     1 
ATOM   4232  C CB    . VAL B  1 221 ? -13.938 15.737  48.587  1.00 36.23  ? 283 VAL B CB    1 
ATOM   4233  C CG1   . VAL B  1 221 ? -12.455 15.352  48.560  1.00 40.32  ? 283 VAL B CG1   1 
ATOM   4234  C CG2   . VAL B  1 221 ? -14.832 14.631  48.042  1.00 35.86  ? 283 VAL B CG2   1 
ATOM   4235  N N     . LYS B  1 222 ? -15.548 18.194  49.601  1.00 37.10  ? 284 LYS B N     1 
ATOM   4236  C CA    . LYS B  1 222 ? -16.712 19.088  49.476  1.00 37.21  ? 284 LYS B CA    1 
ATOM   4237  C C     . LYS B  1 222 ? -16.669 19.657  48.084  1.00 34.65  ? 284 LYS B C     1 
ATOM   4238  O O     . LYS B  1 222 ? -15.611 19.685  47.463  1.00 33.08  ? 284 LYS B O     1 
ATOM   4239  C CB    . LYS B  1 222 ? -16.666 20.221  50.505  1.00 39.22  ? 284 LYS B CB    1 
ATOM   4240  C CG    . LYS B  1 222 ? -15.566 20.055  51.559  1.00 41.63  ? 284 LYS B CG    1 
ATOM   4241  C CD    . LYS B  1 222 ? -15.800 20.856  52.824  1.00 41.11  ? 284 LYS B CD    1 
ATOM   4242  C CE    . LYS B  1 222 ? -16.668 20.052  53.762  1.00 42.72  ? 284 LYS B CE    1 
ATOM   4243  N NZ    . LYS B  1 222 ? -17.349 20.968  54.711  1.00 45.69  ? 284 LYS B NZ    1 
ATOM   4244  N N     . THR B  1 223 ? -17.805 20.114  47.582  1.00 33.77  ? 285 THR B N     1 
ATOM   4245  C CA    . THR B  1 223 ? -17.859 20.464  46.168  1.00 34.26  ? 285 THR B CA    1 
ATOM   4246  C C     . THR B  1 223 ? -16.903 21.612  45.796  1.00 34.39  ? 285 THR B C     1 
ATOM   4247  O O     . THR B  1 223 ? -16.322 21.607  44.731  1.00 33.38  ? 285 THR B O     1 
ATOM   4248  C CB    . THR B  1 223 ? -19.288 20.775  45.665  1.00 33.31  ? 285 THR B CB    1 
ATOM   4249  O OG1   . THR B  1 223 ? -19.735 21.974  46.264  1.00 33.74  ? 285 THR B OG1   1 
ATOM   4250  C CG2   . THR B  1 223 ? -20.296 19.656  45.979  1.00 33.13  ? 285 THR B CG2   1 
ATOM   4251  N N     . GLU B  1 224 ? -16.701 22.579  46.676  1.00 36.93  ? 286 GLU B N     1 
ATOM   4252  C CA    . GLU B  1 224 ? -15.826 23.711  46.336  1.00 38.18  ? 286 GLU B CA    1 
ATOM   4253  C C     . GLU B  1 224 ? -14.354 23.297  46.131  1.00 37.01  ? 286 GLU B C     1 
ATOM   4254  O O     . GLU B  1 224 ? -13.613 24.008  45.459  1.00 37.22  ? 286 GLU B O     1 
ATOM   4255  C CB    . GLU B  1 224 ? -15.964 24.867  47.361  1.00 41.29  ? 286 GLU B CB    1 
ATOM   4256  C CG    . GLU B  1 224 ? -15.257 24.705  48.726  1.00 43.12  ? 286 GLU B CG    1 
ATOM   4257  C CD    . GLU B  1 224 ? -16.172 24.291  49.890  1.00 43.77  ? 286 GLU B CD    1 
ATOM   4258  O OE1   . GLU B  1 224 ? -17.316 23.803  49.658  1.00 44.01  ? 286 GLU B OE1   1 
ATOM   4259  O OE2   . GLU B  1 224 ? -15.721 24.455  51.051  1.00 41.00  ? 286 GLU B OE2   1 
ATOM   4260  N N     . GLU B  1 225 ? -13.944 22.159  46.704  1.00 35.28  ? 287 GLU B N     1 
ATOM   4261  C CA    . GLU B  1 225 ? -12.573 21.628  46.543  1.00 34.31  ? 287 GLU B CA    1 
ATOM   4262  C C     . GLU B  1 225 ? -12.321 21.104  45.116  1.00 31.91  ? 287 GLU B C     1 
ATOM   4263  O O     . GLU B  1 225 ? -11.177 20.889  44.706  1.00 29.48  ? 287 GLU B O     1 
ATOM   4264  C CB    . GLU B  1 225 ? -12.295 20.501  47.569  1.00 35.61  ? 287 GLU B CB    1 
ATOM   4265  C CG    . GLU B  1 225 ? -12.250 20.920  49.048  1.00 36.34  ? 287 GLU B CG    1 
ATOM   4266  C CD    . GLU B  1 225 ? -12.155 19.739  50.022  1.00 36.87  ? 287 GLU B CD    1 
ATOM   4267  O OE1   . GLU B  1 225 ? -11.927 18.602  49.583  1.00 38.47  ? 287 GLU B OE1   1 
ATOM   4268  O OE2   . GLU B  1 225 ? -12.321 19.927  51.246  1.00 37.40  ? 287 GLU B OE2   1 
ATOM   4269  N N     . LEU B  1 226 ? -13.404 20.898  44.374  1.00 31.21  ? 288 LEU B N     1 
ATOM   4270  C CA    . LEU B  1 226 ? -13.347 20.394  43.001  1.00 30.83  ? 288 LEU B CA    1 
ATOM   4271  C C     . LEU B  1 226 ? -13.183 21.498  41.938  1.00 30.46  ? 288 LEU B C     1 
ATOM   4272  O O     . LEU B  1 226 ? -13.001 21.212  40.757  1.00 29.93  ? 288 LEU B O     1 
ATOM   4273  C CB    . LEU B  1 226 ? -14.599 19.563  42.710  1.00 30.75  ? 288 LEU B CB    1 
ATOM   4274  C CG    . LEU B  1 226 ? -14.902 18.425  43.697  1.00 30.32  ? 288 LEU B CG    1 
ATOM   4275  C CD1   . LEU B  1 226 ? -16.196 17.728  43.324  1.00 30.23  ? 288 LEU B CD1   1 
ATOM   4276  C CD2   . LEU B  1 226 ? -13.759 17.429  43.717  1.00 30.68  ? 288 LEU B CD2   1 
ATOM   4277  N N     . SER B  1 227 ? -13.268 22.754  42.355  1.00 30.72  ? 289 SER B N     1 
ATOM   4278  C CA    . SER B  1 227 ? -12.650 23.838  41.611  1.00 30.48  ? 289 SER B CA    1 
ATOM   4279  C C     . SER B  1 227 ? -11.299 24.054  42.258  1.00 30.93  ? 289 SER B C     1 
ATOM   4280  O O     . SER B  1 227 ? -11.231 24.415  43.427  1.00 32.16  ? 289 SER B O     1 
ATOM   4281  C CB    . SER B  1 227 ? -13.478 25.108  41.700  1.00 29.79  ? 289 SER B CB    1 
ATOM   4282  O OG    . SER B  1 227 ? -14.643 24.961  40.934  1.00 30.02  ? 289 SER B OG    1 
ATOM   4283  N N     . PHE B  1 228 ? -10.218 23.818  41.532  1.00 31.35  ? 290 PHE B N     1 
ATOM   4284  C CA    . PHE B  1 228 ? -8.916  23.876  42.170  1.00 32.43  ? 290 PHE B CA    1 
ATOM   4285  C C     . PHE B  1 228 ? -7.793  24.230  41.227  1.00 32.01  ? 290 PHE B C     1 
ATOM   4286  O O     . PHE B  1 228 ? -7.900  24.062  40.019  1.00 31.83  ? 290 PHE B O     1 
ATOM   4287  C CB    . PHE B  1 228 ? -8.585  22.523  42.821  1.00 32.89  ? 290 PHE B CB    1 
ATOM   4288  C CG    . PHE B  1 228 ? -8.352  21.421  41.836  1.00 32.47  ? 290 PHE B CG    1 
ATOM   4289  C CD1   . PHE B  1 228 ? -7.083  21.180  41.322  1.00 32.20  ? 290 PHE B CD1   1 
ATOM   4290  C CD2   . PHE B  1 228 ? -9.407  20.630  41.414  1.00 32.65  ? 290 PHE B CD2   1 
ATOM   4291  C CE1   . PHE B  1 228 ? -6.876  20.172  40.395  1.00 31.96  ? 290 PHE B CE1   1 
ATOM   4292  C CE2   . PHE B  1 228 ? -9.206  19.612  40.496  1.00 32.06  ? 290 PHE B CE2   1 
ATOM   4293  C CZ    . PHE B  1 228 ? -7.940  19.381  39.986  1.00 31.96  ? 290 PHE B CZ    1 
ATOM   4294  N N     . THR B  1 229 ? -6.705  24.692  41.832  1.00 31.68  ? 291 THR B N     1 
ATOM   4295  C CA    . THR B  1 229 ? -5.430  24.873  41.175  1.00 30.00  ? 291 THR B CA    1 
ATOM   4296  C C     . THR B  1 229 ? -4.446  23.966  41.911  1.00 29.85  ? 291 THR B C     1 
ATOM   4297  O O     . THR B  1 229 ? -4.558  23.731  43.107  1.00 31.55  ? 291 THR B O     1 
ATOM   4298  C CB    . THR B  1 229 ? -4.980  26.347  41.202  1.00 29.34  ? 291 THR B CB    1 
ATOM   4299  O OG1   . THR B  1 229 ? -5.968  27.152  40.556  1.00 28.40  ? 291 THR B OG1   1 
ATOM   4300  C CG2   . THR B  1 229 ? -3.674  26.529  40.461  1.00 30.12  ? 291 THR B CG2   1 
ATOM   4301  N N     . SER B  1 230 ? -3.487  23.442  41.172  1.00 28.94  ? 292 SER B N     1 
ATOM   4302  C CA    . SER B  1 230 ? -2.705  22.323  41.620  1.00 27.11  ? 292 SER B CA    1 
ATOM   4303  C C     . SER B  1 230 ? -1.397  22.419  40.852  1.00 26.81  ? 292 SER B C     1 
ATOM   4304  O O     . SER B  1 230 ? -1.413  22.565  39.645  1.00 27.21  ? 292 SER B O     1 
ATOM   4305  C CB    . SER B  1 230 ? -3.495  21.061  41.279  1.00 26.84  ? 292 SER B CB    1 
ATOM   4306  O OG    . SER B  1 230 ? -2.850  19.891  41.694  1.00 28.05  ? 292 SER B OG    1 
ATOM   4307  N N     . ALA B  1 231 ? -0.267  22.418  41.546  1.00 26.92  ? 293 ALA B N     1 
ATOM   4308  C CA    . ALA B  1 231 ? 1.043   22.511  40.886  1.00 26.57  ? 293 ALA B CA    1 
ATOM   4309  C C     . ALA B  1 231 ? 1.465   21.137  40.381  1.00 26.83  ? 293 ALA B C     1 
ATOM   4310  O O     . ALA B  1 231 ? 0.994   20.109  40.869  1.00 25.84  ? 293 ALA B O     1 
ATOM   4311  C CB    . ALA B  1 231 ? 2.091   23.063  41.850  1.00 26.35  ? 293 ALA B CB    1 
ATOM   4312  N N     . PHE B  1 232 ? 2.376   21.107  39.419  1.00 27.93  ? 294 PHE B N     1 
ATOM   4313  C CA    . PHE B  1 232 ? 2.926   19.823  38.985  1.00 29.53  ? 294 PHE B CA    1 
ATOM   4314  C C     . PHE B  1 232 ? 4.403   19.923  38.565  1.00 28.29  ? 294 PHE B C     1 
ATOM   4315  O O     . PHE B  1 232 ? 4.905   20.992  38.211  1.00 26.37  ? 294 PHE B O     1 
ATOM   4316  C CB    . PHE B  1 232 ? 2.045   19.195  37.882  1.00 30.72  ? 294 PHE B CB    1 
ATOM   4317  C CG    . PHE B  1 232 ? 2.117   19.906  36.552  1.00 31.49  ? 294 PHE B CG    1 
ATOM   4318  C CD1   . PHE B  1 232 ? 1.319   21.010  36.298  1.00 32.63  ? 294 PHE B CD1   1 
ATOM   4319  C CD2   . PHE B  1 232 ? 2.983   19.468  35.559  1.00 31.69  ? 294 PHE B CD2   1 
ATOM   4320  C CE1   . PHE B  1 232 ? 1.378   21.669  35.077  1.00 33.73  ? 294 PHE B CE1   1 
ATOM   4321  C CE2   . PHE B  1 232 ? 3.059   20.125  34.346  1.00 32.76  ? 294 PHE B CE2   1 
ATOM   4322  C CZ    . PHE B  1 232 ? 2.254   21.231  34.099  1.00 33.78  ? 294 PHE B CZ    1 
ATOM   4323  N N     . CYS B  1 233 ? 5.099   18.803  38.651  1.00 27.79  ? 295 CYS B N     1 
ATOM   4324  C CA    . CYS B  1 233 ? 6.436   18.735  38.123  1.00 29.46  ? 295 CYS B CA    1 
ATOM   4325  C C     . CYS B  1 233 ? 6.625   17.411  37.445  1.00 29.55  ? 295 CYS B C     1 
ATOM   4326  O O     . CYS B  1 233 ? 6.276   16.382  38.014  1.00 31.23  ? 295 CYS B O     1 
ATOM   4327  C CB    . CYS B  1 233 ? 7.462   18.870  39.230  1.00 30.16  ? 295 CYS B CB    1 
ATOM   4328  S SG    . CYS B  1 233 ? 9.079   19.265  38.559  1.00 31.50  ? 295 CYS B SG    1 
ATOM   4329  N N     . LEU B  1 234 ? 7.171   17.431  36.239  1.00 27.98  ? 296 LEU B N     1 
ATOM   4330  C CA    . LEU B  1 234 ? 7.387   16.205  35.521  1.00 28.07  ? 296 LEU B CA    1 
ATOM   4331  C C     . LEU B  1 234 ? 8.855   16.062  35.177  1.00 27.70  ? 296 LEU B C     1 
ATOM   4332  O O     . LEU B  1 234 ? 9.464   16.937  34.525  1.00 27.13  ? 296 LEU B O     1 
ATOM   4333  C CB    . LEU B  1 234 ? 6.542   16.183  34.262  1.00 28.87  ? 296 LEU B CB    1 
ATOM   4334  C CG    . LEU B  1 234 ? 5.036   16.124  34.481  1.00 29.51  ? 296 LEU B CG    1 
ATOM   4335  C CD1   . LEU B  1 234 ? 4.295   16.334  33.163  1.00 30.49  ? 296 LEU B CD1   1 
ATOM   4336  C CD2   . LEU B  1 234 ? 4.618   14.797  35.108  1.00 29.72  ? 296 LEU B CD2   1 
ATOM   4337  N N     . GLN B  1 235 ? 9.417   14.947  35.618  1.00 25.71  ? 297 GLN B N     1 
ATOM   4338  C CA    . GLN B  1 235 ? 10.796  14.679  35.386  1.00 25.69  ? 297 GLN B CA    1 
ATOM   4339  C C     . GLN B  1 235 ? 10.928  13.938  34.086  1.00 26.12  ? 297 GLN B C     1 
ATOM   4340  O O     . GLN B  1 235 ? 10.337  12.878  33.945  1.00 24.82  ? 297 GLN B O     1 
ATOM   4341  C CB    . GLN B  1 235 ? 11.339  13.807  36.492  1.00 26.05  ? 297 GLN B CB    1 
ATOM   4342  C CG    . GLN B  1 235 ? 12.788  13.416  36.285  1.00 26.30  ? 297 GLN B CG    1 
ATOM   4343  C CD    . GLN B  1 235 ? 13.469  13.137  37.577  1.00 25.71  ? 297 GLN B CD    1 
ATOM   4344  O OE1   . GLN B  1 235 ? 13.843  14.071  38.279  1.00 26.38  ? 297 GLN B OE1   1 
ATOM   4345  N NE2   . GLN B  1 235 ? 13.630  11.860  37.914  1.00 25.39  ? 297 GLN B NE2   1 
ATOM   4346  N N     . ILE B  1 236 ? 11.730  14.476  33.159  1.00 26.99  ? 298 ILE B N     1 
ATOM   4347  C CA    . ILE B  1 236 ? 11.978  13.829  31.861  1.00 27.82  ? 298 ILE B CA    1 
ATOM   4348  C C     . ILE B  1 236 ? 12.881  12.599  32.005  1.00 28.17  ? 298 ILE B C     1 
ATOM   4349  O O     . ILE B  1 236 ? 14.028  12.721  32.398  1.00 29.44  ? 298 ILE B O     1 
ATOM   4350  C CB    . ILE B  1 236 ? 12.581  14.821  30.836  1.00 27.88  ? 298 ILE B CB    1 
ATOM   4351  C CG1   . ILE B  1 236 ? 11.468  15.634  30.167  1.00 27.65  ? 298 ILE B CG1   1 
ATOM   4352  C CG2   . ILE B  1 236 ? 13.323  14.093  29.731  1.00 28.51  ? 298 ILE B CG2   1 
ATOM   4353  C CD1   . ILE B  1 236 ? 11.167  16.925  30.861  1.00 28.10  ? 298 ILE B CD1   1 
ATOM   4354  N N     . GLN B  1 237 ? 12.357  11.425  31.677  1.00 28.19  ? 299 GLN B N     1 
ATOM   4355  C CA    . GLN B  1 237 ? 13.080  10.164  31.849  1.00 28.60  ? 299 GLN B CA    1 
ATOM   4356  C C     . GLN B  1 237 ? 14.019  9.855   30.699  1.00 29.22  ? 299 GLN B C     1 
ATOM   4357  O O     . GLN B  1 237 ? 14.862  8.967   30.831  1.00 30.90  ? 299 GLN B O     1 
ATOM   4358  C CB    . GLN B  1 237 ? 12.105  8.990   31.953  1.00 29.93  ? 299 GLN B CB    1 
ATOM   4359  C CG    . GLN B  1 237 ? 11.168  9.045   33.141  1.00 31.98  ? 299 GLN B CG    1 
ATOM   4360  C CD    . GLN B  1 237 ? 11.906  9.287   34.434  1.00 33.42  ? 299 GLN B CD    1 
ATOM   4361  O OE1   . GLN B  1 237 ? 12.684  8.444   34.862  1.00 37.88  ? 299 GLN B OE1   1 
ATOM   4362  N NE2   . GLN B  1 237 ? 11.682  10.441  35.059  1.00 33.12  ? 299 GLN B NE2   1 
ATOM   4363  N N     . ARG B  1 238 ? 13.862  10.535  29.563  1.00 27.99  ? 300 ARG B N     1 
ATOM   4364  C CA    . ARG B  1 238 ? 14.660  10.213  28.372  1.00 26.91  ? 300 ARG B CA    1 
ATOM   4365  C C     . ARG B  1 238 ? 14.680  11.373  27.373  1.00 27.96  ? 300 ARG B C     1 
ATOM   4366  O O     . ARG B  1 238 ? 13.758  12.180  27.338  1.00 27.48  ? 300 ARG B O     1 
ATOM   4367  C CB    . ARG B  1 238 ? 14.106  8.960   27.696  1.00 24.49  ? 300 ARG B CB    1 
ATOM   4368  C CG    . ARG B  1 238 ? 12.937  9.253   26.778  1.00 23.44  ? 300 ARG B CG    1 
ATOM   4369  C CD    . ARG B  1 238 ? 12.059  8.042   26.518  1.00 22.77  ? 300 ARG B CD    1 
ATOM   4370  N NE    . ARG B  1 238 ? 10.898  8.416   25.702  1.00 21.64  ? 300 ARG B NE    1 
ATOM   4371  C CZ    . ARG B  1 238 ? 9.823   7.661   25.517  1.00 20.38  ? 300 ARG B CZ    1 
ATOM   4372  N NH1   . ARG B  1 238 ? 9.738   6.480   26.087  1.00 21.13  ? 300 ARG B NH1   1 
ATOM   4373  N NH2   . ARG B  1 238 ? 8.827   8.086   24.771  1.00 19.42  ? 300 ARG B NH2   1 
ATOM   4374  N N     . ASN B  1 239 ? 15.729  11.457  26.564  1.00 28.81  ? 301 ASN B N     1 
ATOM   4375  C CA    . ASN B  1 239 ? 15.750  12.457  25.505  1.00 30.23  ? 301 ASN B CA    1 
ATOM   4376  C C     . ASN B  1 239 ? 14.619  12.181  24.535  1.00 29.37  ? 301 ASN B C     1 
ATOM   4377  O O     . ASN B  1 239 ? 14.431  11.039  24.099  1.00 30.85  ? 301 ASN B O     1 
ATOM   4378  C CB    . ASN B  1 239 ? 17.074  12.433  24.771  1.00 32.43  ? 301 ASN B CB    1 
ATOM   4379  C CG    . ASN B  1 239 ? 18.218  12.738  25.684  1.00 35.76  ? 301 ASN B CG    1 
ATOM   4380  O OD1   . ASN B  1 239 ? 18.775  11.833  26.321  1.00 43.86  ? 301 ASN B OD1   1 
ATOM   4381  N ND2   . ASN B  1 239 ? 18.545  14.013  25.812  1.00 34.68  ? 301 ASN B ND2   1 
ATOM   4382  N N     . ASP B  1 240 ? 13.841  13.207  24.213  1.00 27.01  ? 302 ASP B N     1 
ATOM   4383  C CA    . ASP B  1 240 ? 12.693  13.015  23.329  1.00 24.80  ? 302 ASP B CA    1 
ATOM   4384  C C     . ASP B  1 240 ? 12.086  14.359  22.999  1.00 24.16  ? 302 ASP B C     1 
ATOM   4385  O O     . ASP B  1 240 ? 12.667  15.397  23.325  1.00 23.93  ? 302 ASP B O     1 
ATOM   4386  C CB    . ASP B  1 240 ? 11.640  12.137  24.015  1.00 24.18  ? 302 ASP B CB    1 
ATOM   4387  C CG    . ASP B  1 240 ? 10.872  11.286  23.041  1.00 23.88  ? 302 ASP B CG    1 
ATOM   4388  O OD1   . ASP B  1 240 ? 10.633  11.786  21.926  1.00 23.34  ? 302 ASP B OD1   1 
ATOM   4389  O OD2   . ASP B  1 240 ? 10.497  10.135  23.380  1.00 23.37  ? 302 ASP B OD2   1 
ATOM   4390  N N     . TYR B  1 241 ? 10.932  14.338  22.341  1.00 23.66  ? 303 TYR B N     1 
ATOM   4391  C CA    . TYR B  1 241 ? 10.136  15.530  22.127  1.00 24.39  ? 303 TYR B CA    1 
ATOM   4392  C C     . TYR B  1 241 ? 8.859   15.403  22.948  1.00 24.81  ? 303 TYR B C     1 
ATOM   4393  O O     . TYR B  1 241 ? 8.341   14.299  23.103  1.00 26.25  ? 303 TYR B O     1 
ATOM   4394  C CB    . TYR B  1 241 ? 9.796   15.677  20.651  1.00 25.12  ? 303 TYR B CB    1 
ATOM   4395  C CG    . TYR B  1 241 ? 10.995  15.893  19.737  1.00 27.23  ? 303 TYR B CG    1 
ATOM   4396  C CD1   . TYR B  1 241 ? 11.539  17.166  19.573  1.00 28.67  ? 303 TYR B CD1   1 
ATOM   4397  C CD2   . TYR B  1 241 ? 11.580  14.840  19.016  1.00 27.01  ? 303 TYR B CD2   1 
ATOM   4398  C CE1   . TYR B  1 241 ? 12.632  17.389  18.744  1.00 28.23  ? 303 TYR B CE1   1 
ATOM   4399  C CE2   . TYR B  1 241 ? 12.670  15.065  18.180  1.00 27.34  ? 303 TYR B CE2   1 
ATOM   4400  C CZ    . TYR B  1 241 ? 13.187  16.345  18.047  1.00 27.88  ? 303 TYR B CZ    1 
ATOM   4401  O OH    . TYR B  1 241 ? 14.277  16.608  17.240  1.00 29.27  ? 303 TYR B OH    1 
ATOM   4402  N N     . VAL B  1 242 ? 8.350   16.517  23.480  1.00 24.18  ? 304 VAL B N     1 
ATOM   4403  C CA    . VAL B  1 242 ? 7.078   16.502  24.182  1.00 24.17  ? 304 VAL B CA    1 
ATOM   4404  C C     . VAL B  1 242 ? 6.049   17.331  23.442  1.00 24.26  ? 304 VAL B C     1 
ATOM   4405  O O     . VAL B  1 242 ? 6.236   18.531  23.234  1.00 24.22  ? 304 VAL B O     1 
ATOM   4406  C CB    . VAL B  1 242 ? 7.230   16.999  25.623  1.00 24.75  ? 304 VAL B CB    1 
ATOM   4407  C CG1   . VAL B  1 242 ? 5.879   17.386  26.218  1.00 24.55  ? 304 VAL B CG1   1 
ATOM   4408  C CG2   . VAL B  1 242 ? 7.892   15.912  26.457  1.00 25.15  ? 304 VAL B CG2   1 
ATOM   4409  N N     . HIS B  1 243 ? 4.961   16.677  23.058  1.00 24.53  ? 305 HIS B N     1 
ATOM   4410  C CA    . HIS B  1 243 ? 3.906   17.323  22.299  1.00 26.39  ? 305 HIS B CA    1 
ATOM   4411  C C     . HIS B  1 243 ? 2.662   17.664  23.117  1.00 27.70  ? 305 HIS B C     1 
ATOM   4412  O O     . HIS B  1 243 ? 1.894   18.530  22.710  1.00 28.25  ? 305 HIS B O     1 
ATOM   4413  C CB    . HIS B  1 243 ? 3.496   16.421  21.129  1.00 26.95  ? 305 HIS B CB    1 
ATOM   4414  C CG    . HIS B  1 243 ? 4.526   16.343  20.051  1.00 25.97  ? 305 HIS B CG    1 
ATOM   4415  N ND1   . HIS B  1 243 ? 5.560   15.442  20.083  1.00 25.76  ? 305 HIS B ND1   1 
ATOM   4416  C CD2   . HIS B  1 243 ? 4.690   17.067  18.922  1.00 25.88  ? 305 HIS B CD2   1 
ATOM   4417  C CE1   . HIS B  1 243 ? 6.323   15.616  19.023  1.00 26.77  ? 305 HIS B CE1   1 
ATOM   4418  N NE2   . HIS B  1 243 ? 5.816   16.599  18.301  1.00 26.60  ? 305 HIS B NE2   1 
ATOM   4419  N N     . ALA B  1 244 ? 2.454   16.974  24.242  1.00 28.89  ? 306 ALA B N     1 
ATOM   4420  C CA    . ALA B  1 244 ? 1.217   17.103  25.035  1.00 28.16  ? 306 ALA B CA    1 
ATOM   4421  C C     . ALA B  1 244 ? 1.363   16.606  26.472  1.00 28.79  ? 306 ALA B C     1 
ATOM   4422  O O     . ALA B  1 244 ? 2.303   15.849  26.802  1.00 29.87  ? 306 ALA B O     1 
ATOM   4423  C CB    . ALA B  1 244 ? 0.103   16.317  24.366  1.00 27.85  ? 306 ALA B CB    1 
ATOM   4424  N N     . LEU B  1 245 ? 0.411   17.013  27.315  1.00 27.85  ? 307 LEU B N     1 
ATOM   4425  C CA    . LEU B  1 245 ? 0.220   16.407  28.639  1.00 26.85  ? 307 LEU B CA    1 
ATOM   4426  C C     . LEU B  1 245 ? -0.915  15.399  28.545  1.00 26.27  ? 307 LEU B C     1 
ATOM   4427  O O     . LEU B  1 245 ? -1.794  15.529  27.695  1.00 26.02  ? 307 LEU B O     1 
ATOM   4428  C CB    . LEU B  1 245 ? -0.106  17.467  29.681  1.00 26.18  ? 307 LEU B CB    1 
ATOM   4429  C CG    . LEU B  1 245 ? 0.941   18.576  29.763  1.00 27.29  ? 307 LEU B CG    1 
ATOM   4430  C CD1   . LEU B  1 245 ? 0.568   19.553  30.877  1.00 27.09  ? 307 LEU B CD1   1 
ATOM   4431  C CD2   . LEU B  1 245 ? 2.368   18.034  29.948  1.00 26.93  ? 307 LEU B CD2   1 
ATOM   4432  N N     . VAL B  1 246 ? -0.873  14.390  29.406  1.00 25.65  ? 308 VAL B N     1 
ATOM   4433  C CA    . VAL B  1 246 ? -1.893  13.341  29.466  1.00 25.21  ? 308 VAL B CA    1 
ATOM   4434  C C     . VAL B  1 246 ? -2.292  13.042  30.914  1.00 25.35  ? 308 VAL B C     1 
ATOM   4435  O O     . VAL B  1 246 ? -1.432  12.801  31.783  1.00 24.95  ? 308 VAL B O     1 
ATOM   4436  C CB    . VAL B  1 246 ? -1.371  12.034  28.832  1.00 25.05  ? 308 VAL B CB    1 
ATOM   4437  C CG1   . VAL B  1 246 ? -2.356  10.894  29.017  1.00 25.00  ? 308 VAL B CG1   1 
ATOM   4438  C CG2   . VAL B  1 246 ? -1.101  12.248  27.358  1.00 25.24  ? 308 VAL B CG2   1 
ATOM   4439  N N     . THR B  1 247 ? -3.596  13.010  31.163  1.00 25.52  ? 309 THR B N     1 
ATOM   4440  C CA    . THR B  1 247 ? -4.100  12.676  32.490  1.00 26.52  ? 309 THR B CA    1 
ATOM   4441  C C     . THR B  1 247 ? -4.768  11.309  32.520  1.00 26.21  ? 309 THR B C     1 
ATOM   4442  O O     . THR B  1 247 ? -5.402  10.887  31.553  1.00 27.54  ? 309 THR B O     1 
ATOM   4443  C CB    . THR B  1 247 ? -5.108  13.717  33.021  1.00 27.31  ? 309 THR B CB    1 
ATOM   4444  O OG1   . THR B  1 247 ? -6.291  13.705  32.211  1.00 28.53  ? 309 THR B OG1   1 
ATOM   4445  C CG2   . THR B  1 247 ? -4.496  15.113  33.017  1.00 27.77  ? 309 THR B CG2   1 
ATOM   4446  N N     . TYR B  1 248 ? -4.590  10.622  33.640  1.00 25.18  ? 310 TYR B N     1 
ATOM   4447  C CA    . TYR B  1 248 ? -5.285  9.386   33.940  1.00 24.41  ? 310 TYR B CA    1 
ATOM   4448  C C     . TYR B  1 248 ? -5.666  9.404   35.403  1.00 23.88  ? 310 TYR B C     1 
ATOM   4449  O O     . TYR B  1 248 ? -5.235  10.274  36.153  1.00 24.67  ? 310 TYR B O     1 
ATOM   4450  C CB    . TYR B  1 248 ? -4.388  8.174   33.632  1.00 24.97  ? 310 TYR B CB    1 
ATOM   4451  C CG    . TYR B  1 248 ? -3.109  8.036   34.457  1.00 24.49  ? 310 TYR B CG    1 
ATOM   4452  C CD1   . TYR B  1 248 ? -3.116  7.342   35.637  1.00 24.56  ? 310 TYR B CD1   1 
ATOM   4453  C CD2   . TYR B  1 248 ? -1.899  8.579   34.023  1.00 24.65  ? 310 TYR B CD2   1 
ATOM   4454  C CE1   . TYR B  1 248 ? -1.973  7.207   36.391  1.00 25.45  ? 310 TYR B CE1   1 
ATOM   4455  C CE2   . TYR B  1 248 ? -0.747  8.447   34.770  1.00 24.95  ? 310 TYR B CE2   1 
ATOM   4456  C CZ    . TYR B  1 248 ? -0.800  7.756   35.955  1.00 25.70  ? 310 TYR B CZ    1 
ATOM   4457  O OH    . TYR B  1 248 ? 0.309   7.597   36.738  1.00 27.14  ? 310 TYR B OH    1 
ATOM   4458  N N     . PHE B  1 249 ? -6.481  8.456   35.826  1.00 23.29  ? 311 PHE B N     1 
ATOM   4459  C CA    . PHE B  1 249 ? -6.843  8.405   37.227  1.00 23.06  ? 311 PHE B CA    1 
ATOM   4460  C C     . PHE B  1 249 ? -6.906  6.987   37.736  1.00 22.73  ? 311 PHE B C     1 
ATOM   4461  O O     . PHE B  1 249 ? -7.083  6.047   36.956  1.00 22.39  ? 311 PHE B O     1 
ATOM   4462  C CB    . PHE B  1 249 ? -8.158  9.173   37.498  1.00 23.58  ? 311 PHE B CB    1 
ATOM   4463  C CG    . PHE B  1 249 ? -9.363  8.619   36.794  1.00 23.57  ? 311 PHE B CG    1 
ATOM   4464  C CD1   . PHE B  1 249 ? -10.050 7.550   37.339  1.00 23.74  ? 311 PHE B CD1   1 
ATOM   4465  C CD2   . PHE B  1 249 ? -9.829  9.190   35.601  1.00 23.66  ? 311 PHE B CD2   1 
ATOM   4466  C CE1   . PHE B  1 249 ? -11.148 7.021   36.695  1.00 24.10  ? 311 PHE B CE1   1 
ATOM   4467  C CE2   . PHE B  1 249 ? -10.938 8.677   34.952  1.00 24.07  ? 311 PHE B CE2   1 
ATOM   4468  C CZ    . PHE B  1 249 ? -11.596 7.588   35.504  1.00 24.75  ? 311 PHE B CZ    1 
ATOM   4469  N N     . ASN B  1 250 ? -6.699  6.847   39.045  1.00 22.90  ? 312 ASN B N     1 
ATOM   4470  C CA    . ASN B  1 250 ? -6.826  5.574   39.734  1.00 22.92  ? 312 ASN B CA    1 
ATOM   4471  C C     . ASN B  1 250 ? -7.971  5.617   40.709  1.00 22.54  ? 312 ASN B C     1 
ATOM   4472  O O     . ASN B  1 250 ? -8.298  6.660   41.255  1.00 23.09  ? 312 ASN B O     1 
ATOM   4473  C CB    . ASN B  1 250 ? -5.558  5.207   40.493  1.00 23.40  ? 312 ASN B CB    1 
ATOM   4474  C CG    . ASN B  1 250 ? -4.296  5.317   39.646  1.00 24.20  ? 312 ASN B CG    1 
ATOM   4475  O OD1   . ASN B  1 250 ? -3.243  5.717   40.156  1.00 24.59  ? 312 ASN B OD1   1 
ATOM   4476  N ND2   . ASN B  1 250 ? -4.382  4.942   38.354  1.00 23.73  ? 312 ASN B ND2   1 
ATOM   4477  N N     . ILE B  1 251 ? -8.589  4.464   40.892  1.00 22.43  ? 313 ILE B N     1 
ATOM   4478  C CA    . ILE B  1 251 ? -9.749  4.312   41.736  1.00 22.51  ? 313 ILE B CA    1 
ATOM   4479  C C     . ILE B  1 251 ? -9.436  3.221   42.722  1.00 23.16  ? 313 ILE B C     1 
ATOM   4480  O O     . ILE B  1 251 ? -8.852  2.206   42.354  1.00 22.08  ? 313 ILE B O     1 
ATOM   4481  C CB    . ILE B  1 251 ? -10.998 3.932   40.905  1.00 21.94  ? 313 ILE B CB    1 
ATOM   4482  C CG1   . ILE B  1 251 ? -11.331 5.074   39.931  1.00 22.35  ? 313 ILE B CG1   1 
ATOM   4483  C CG2   . ILE B  1 251 ? -12.202 3.599   41.799  1.00 20.94  ? 313 ILE B CG2   1 
ATOM   4484  C CD1   . ILE B  1 251 ? -11.845 6.361   40.577  1.00 22.25  ? 313 ILE B CD1   1 
ATOM   4485  N N     . GLU B  1 252 ? -9.831  3.434   43.974  1.00 25.50  ? 314 GLU B N     1 
ATOM   4486  C CA    . GLU B  1 252 ? -9.637  2.428   44.997  1.00 27.63  ? 314 GLU B CA    1 
ATOM   4487  C C     . GLU B  1 252 ? -10.847 2.253   45.889  1.00 28.20  ? 314 GLU B C     1 
ATOM   4488  O O     . GLU B  1 252 ? -11.516 3.231   46.234  1.00 27.07  ? 314 GLU B O     1 
ATOM   4489  C CB    . GLU B  1 252 ? -8.433  2.777   45.831  1.00 29.48  ? 314 GLU B CB    1 
ATOM   4490  C CG    . GLU B  1 252 ? -7.962  1.616   46.685  1.00 32.05  ? 314 GLU B CG    1 
ATOM   4491  C CD    . GLU B  1 252 ? -6.623  1.880   47.335  1.00 33.99  ? 314 GLU B CD    1 
ATOM   4492  O OE1   . GLU B  1 252 ? -6.113  3.039   47.258  1.00 35.39  ? 314 GLU B OE1   1 
ATOM   4493  O OE2   . GLU B  1 252 ? -6.104  0.915   47.930  1.00 33.50  ? 314 GLU B OE2   1 
ATOM   4494  N N     . PHE B  1 253 ? -11.111 0.992   46.239  1.00 29.79  ? 315 PHE B N     1 
ATOM   4495  C CA    . PHE B  1 253 ? -12.127 0.615   47.225  1.00 32.23  ? 315 PHE B CA    1 
ATOM   4496  C C     . PHE B  1 253 ? -11.374 0.204   48.498  1.00 32.87  ? 315 PHE B C     1 
ATOM   4497  O O     . PHE B  1 253 ? -10.931 -0.938  48.609  1.00 32.68  ? 315 PHE B O     1 
ATOM   4498  C CB    . PHE B  1 253 ? -12.957 -0.557  46.702  1.00 32.71  ? 315 PHE B CB    1 
ATOM   4499  C CG    . PHE B  1 253 ? -13.650 -0.286  45.394  1.00 34.49  ? 315 PHE B CG    1 
ATOM   4500  C CD1   . PHE B  1 253 ? -12.948 -0.283  44.201  1.00 35.36  ? 315 PHE B CD1   1 
ATOM   4501  C CD2   . PHE B  1 253 ? -15.019 -0.064  45.347  1.00 35.89  ? 315 PHE B CD2   1 
ATOM   4502  C CE1   . PHE B  1 253 ? -13.592 -0.051  42.992  1.00 34.48  ? 315 PHE B CE1   1 
ATOM   4503  C CE2   . PHE B  1 253 ? -15.665 0.174   44.143  1.00 35.56  ? 315 PHE B CE2   1 
ATOM   4504  C CZ    . PHE B  1 253 ? -14.951 0.171   42.965  1.00 34.94  ? 315 PHE B CZ    1 
ATOM   4505  N N     . THR B  1 254 ? -11.178 1.135   49.433  1.00 33.21  ? 316 THR B N     1 
ATOM   4506  C CA    . THR B  1 254 ? -10.236 0.911   50.552  1.00 33.82  ? 316 THR B CA    1 
ATOM   4507  C C     . THR B  1 254 ? -10.768 -0.120  51.542  1.00 36.14  ? 316 THR B C     1 
ATOM   4508  O O     . THR B  1 254 ? -10.011 -0.885  52.151  1.00 36.79  ? 316 THR B O     1 
ATOM   4509  C CB    . THR B  1 254 ? -9.866  2.218   51.309  1.00 31.56  ? 316 THR B CB    1 
ATOM   4510  O OG1   . THR B  1 254 ? -11.040 2.832   51.838  1.00 31.30  ? 316 THR B OG1   1 
ATOM   4511  C CG2   . THR B  1 254 ? -9.157  3.201   50.395  1.00 31.23  ? 316 THR B CG2   1 
ATOM   4512  N N     . LYS B  1 255 ? -12.082 -0.162  51.669  1.00 39.15  ? 317 LYS B N     1 
ATOM   4513  C CA    . LYS B  1 255 ? -12.705 -0.973  52.684  1.00 41.19  ? 317 LYS B CA    1 
ATOM   4514  C C     . LYS B  1 255 ? -12.672 -2.450  52.395  1.00 40.52  ? 317 LYS B C     1 
ATOM   4515  O O     . LYS B  1 255 ? -12.901 -3.232  53.292  1.00 43.08  ? 317 LYS B O     1 
ATOM   4516  C CB    . LYS B  1 255 ? -14.131 -0.502  52.887  1.00 44.47  ? 317 LYS B CB    1 
ATOM   4517  C CG    . LYS B  1 255 ? -14.203 0.927   53.416  1.00 48.76  ? 317 LYS B CG    1 
ATOM   4518  C CD    . LYS B  1 255 ? -13.490 1.125   54.763  1.00 50.79  ? 317 LYS B CD    1 
ATOM   4519  C CE    . LYS B  1 255 ? -13.603 2.574   55.235  1.00 53.38  ? 317 LYS B CE    1 
ATOM   4520  N NZ    . LYS B  1 255 ? -12.631 2.927   56.298  1.00 54.55  ? 317 LYS B NZ    1 
ATOM   4521  N N     . CYS B  1 256 ? -12.357 -2.842  51.165  1.00 40.02  ? 318 CYS B N     1 
ATOM   4522  C CA    . CYS B  1 256 ? -12.230 -4.260  50.818  1.00 38.14  ? 318 CYS B CA    1 
ATOM   4523  C C     . CYS B  1 256 ? -11.091 -4.977  51.545  1.00 35.85  ? 318 CYS B C     1 
ATOM   4524  O O     . CYS B  1 256 ? -10.068 -4.393  51.904  1.00 34.50  ? 318 CYS B O     1 
ATOM   4525  C CB    . CYS B  1 256 ? -12.041 -4.440  49.319  1.00 37.88  ? 318 CYS B CB    1 
ATOM   4526  S SG    . CYS B  1 256 ? -13.444 -3.833  48.383  1.00 42.30  ? 318 CYS B SG    1 
ATOM   4527  N N     . HIS B  1 257 ? -11.295 -6.273  51.714  1.00 33.88  ? 319 HIS B N     1 
ATOM   4528  C CA    . HIS B  1 257 ? -10.416 -7.114  52.480  1.00 32.43  ? 319 HIS B CA    1 
ATOM   4529  C C     . HIS B  1 257 ? -9.109  -7.352  51.740  1.00 31.86  ? 319 HIS B C     1 
ATOM   4530  O O     . HIS B  1 257 ? -8.113  -7.703  52.362  1.00 33.32  ? 319 HIS B O     1 
ATOM   4531  C CB    . HIS B  1 257 ? -11.113 -8.446  52.812  1.00 31.48  ? 319 HIS B CB    1 
ATOM   4532  C CG    . HIS B  1 257 ? -10.406 -9.240  53.864  1.00 31.44  ? 319 HIS B CG    1 
ATOM   4533  N ND1   . HIS B  1 257 ? -9.976  -10.531 53.656  1.00 30.81  ? 319 HIS B ND1   1 
ATOM   4534  C CD2   . HIS B  1 257 ? -9.997  -8.905  55.108  1.00 31.78  ? 319 HIS B CD2   1 
ATOM   4535  C CE1   . HIS B  1 257 ? -9.362  -10.969 54.734  1.00 30.24  ? 319 HIS B CE1   1 
ATOM   4536  N NE2   . HIS B  1 257 ? -9.361  -10.004 55.630  1.00 31.23  ? 319 HIS B NE2   1 
ATOM   4537  N N     . LYS B  1 258 ? -9.128  -7.216  50.419  1.00 31.78  ? 320 LYS B N     1 
ATOM   4538  C CA    . LYS B  1 258 ? -7.910  -7.159  49.638  1.00 33.14  ? 320 LYS B CA    1 
ATOM   4539  C C     . LYS B  1 258 ? -7.904  -5.935  48.769  1.00 32.48  ? 320 LYS B C     1 
ATOM   4540  O O     . LYS B  1 258 ? -8.929  -5.318  48.563  1.00 31.68  ? 320 LYS B O     1 
ATOM   4541  C CB    . LYS B  1 258 ? -7.757  -8.407  48.799  1.00 35.03  ? 320 LYS B CB    1 
ATOM   4542  C CG    . LYS B  1 258 ? -7.518  -9.620  49.661  1.00 37.89  ? 320 LYS B CG    1 
ATOM   4543  C CD    . LYS B  1 258 ? -6.852  -10.702 48.853  1.00 43.47  ? 320 LYS B CD    1 
ATOM   4544  C CE    . LYS B  1 258 ? -6.171  -11.723 49.751  1.00 48.67  ? 320 LYS B CE    1 
ATOM   4545  N NZ    . LYS B  1 258 ? -5.812  -12.916 48.934  1.00 52.85  ? 320 LYS B NZ    1 
ATOM   4546  N N     . LYS B  1 259 ? -6.728  -5.573  48.287  1.00 33.35  ? 321 LYS B N     1 
ATOM   4547  C CA    . LYS B  1 259 ? -6.586  -4.408  47.438  1.00 36.17  ? 321 LYS B CA    1 
ATOM   4548  C C     . LYS B  1 259 ? -7.611  -4.537  46.278  1.00 32.75  ? 321 LYS B C     1 
ATOM   4549  O O     . LYS B  1 259 ? -7.670  -5.552  45.600  1.00 32.72  ? 321 LYS B O     1 
ATOM   4550  C CB    . LYS B  1 259 ? -5.083  -4.265  47.030  1.00 42.25  ? 321 LYS B CB    1 
ATOM   4551  C CG    . LYS B  1 259 ? -4.700  -3.603  45.689  1.00 49.20  ? 321 LYS B CG    1 
ATOM   4552  C CD    . LYS B  1 259 ? -4.601  -2.062  45.707  1.00 51.94  ? 321 LYS B CD    1 
ATOM   4553  C CE    . LYS B  1 259 ? -4.743  -1.470  44.292  1.00 51.67  ? 321 LYS B CE    1 
ATOM   4554  N NZ    . LYS B  1 259 ? -5.339  -0.104  44.298  1.00 50.60  ? 321 LYS B NZ    1 
ATOM   4555  N N     . MET B  1 260 ? -8.483  -3.540  46.140  1.00 30.45  ? 322 MET B N     1 
ATOM   4556  C CA    . MET B  1 260 ? -9.428  -3.425  45.019  1.00 30.02  ? 322 MET B CA    1 
ATOM   4557  C C     . MET B  1 260 ? -9.260  -2.050  44.412  1.00 30.06  ? 322 MET B C     1 
ATOM   4558  O O     . MET B  1 260 ? -9.342  -1.035  45.108  1.00 31.19  ? 322 MET B O     1 
ATOM   4559  C CB    . MET B  1 260 ? -10.875 -3.508  45.486  1.00 29.53  ? 322 MET B CB    1 
ATOM   4560  C CG    . MET B  1 260 ? -11.370 -4.900  45.740  1.00 30.07  ? 322 MET B CG    1 
ATOM   4561  S SD    . MET B  1 260 ? -12.124 -5.551  44.290  1.00 31.68  ? 322 MET B SD    1 
ATOM   4562  C CE    . MET B  1 260 ? -10.792 -6.555  43.572  1.00 34.32  ? 322 MET B CE    1 
ATOM   4563  N N     . GLY B  1 261 ? -9.068  -2.014  43.109  1.00 28.65  ? 323 GLY B N     1 
ATOM   4564  C CA    . GLY B  1 261 ? -8.994  -0.759  42.413  1.00 27.20  ? 323 GLY B CA    1 
ATOM   4565  C C     . GLY B  1 261 ? -8.617  -0.993  40.983  1.00 26.78  ? 323 GLY B C     1 
ATOM   4566  O O     . GLY B  1 261 ? -8.348  -2.119  40.571  1.00 26.46  ? 323 GLY B O     1 
ATOM   4567  N N     . PHE B  1 262 ? -8.614  0.074   40.214  1.00 26.34  ? 324 PHE B N     1 
ATOM   4568  C CA    . PHE B  1 262 ? -8.097  0.002   38.877  1.00 26.71  ? 324 PHE B CA    1 
ATOM   4569  C C     . PHE B  1 262 ? -7.465  1.329   38.486  1.00 26.59  ? 324 PHE B C     1 
ATOM   4570  O O     . PHE B  1 262 ? -7.571  2.323   39.187  1.00 26.49  ? 324 PHE B O     1 
ATOM   4571  C CB    . PHE B  1 262 ? -9.192  -0.409  37.905  1.00 27.53  ? 324 PHE B CB    1 
ATOM   4572  C CG    . PHE B  1 262 ? -10.397 0.488   37.925  1.00 28.20  ? 324 PHE B CG    1 
ATOM   4573  C CD1   . PHE B  1 262 ? -10.453 1.590   37.094  1.00 29.04  ? 324 PHE B CD1   1 
ATOM   4574  C CD2   . PHE B  1 262 ? -11.489 0.213   38.737  1.00 27.91  ? 324 PHE B CD2   1 
ATOM   4575  C CE1   . PHE B  1 262 ? -11.565 2.417   37.075  1.00 29.45  ? 324 PHE B CE1   1 
ATOM   4576  C CE2   . PHE B  1 262 ? -12.603 1.036   38.725  1.00 28.10  ? 324 PHE B CE2   1 
ATOM   4577  C CZ    . PHE B  1 262 ? -12.639 2.144   37.894  1.00 28.74  ? 324 PHE B CZ    1 
ATOM   4578  N N     . SER B  1 263 ? -6.757  1.314   37.375  1.00 26.31  ? 325 SER B N     1 
ATOM   4579  C CA    . SER B  1 263 ? -6.105  2.490   36.884  1.00 25.49  ? 325 SER B CA    1 
ATOM   4580  C C     . SER B  1 263 ? -6.546  2.673   35.466  1.00 24.90  ? 325 SER B C     1 
ATOM   4581  O O     . SER B  1 263 ? -6.839  1.696   34.779  1.00 25.50  ? 325 SER B O     1 
ATOM   4582  C CB    . SER B  1 263 ? -4.603  2.290   36.938  1.00 25.76  ? 325 SER B CB    1 
ATOM   4583  O OG    . SER B  1 263 ? -3.950  3.306   36.227  1.00 26.33  ? 325 SER B OG    1 
ATOM   4584  N N     . THR B  1 264 ? -6.604  3.925   35.035  1.00 24.77  ? 326 THR B N     1 
ATOM   4585  C CA    . THR B  1 264 ? -6.909  4.249   33.648  1.00 25.02  ? 326 THR B CA    1 
ATOM   4586  C C     . THR B  1 264 ? -5.674  4.730   32.907  1.00 25.27  ? 326 THR B C     1 
ATOM   4587  O O     . THR B  1 264 ? -5.800  5.379   31.847  1.00 25.72  ? 326 THR B O     1 
ATOM   4588  C CB    . THR B  1 264 ? -7.998  5.320   33.548  1.00 24.85  ? 326 THR B CB    1 
ATOM   4589  O OG1   . THR B  1 264 ? -7.473  6.622   33.855  1.00 24.50  ? 326 THR B OG1   1 
ATOM   4590  C CG2   . THR B  1 264 ? -9.137  4.966   34.476  1.00 24.94  ? 326 THR B CG2   1 
ATOM   4591  N N     . ALA B  1 265 ? -4.498  4.400   33.459  1.00 24.17  ? 327 ALA B N     1 
ATOM   4592  C CA    . ALA B  1 265 ? -3.215  4.834   32.912  1.00 23.42  ? 327 ALA B CA    1 
ATOM   4593  C C     . ALA B  1 265 ? -2.943  4.155   31.581  1.00 23.20  ? 327 ALA B C     1 
ATOM   4594  O O     . ALA B  1 265 ? -3.572  3.131   31.261  1.00 22.91  ? 327 ALA B O     1 
ATOM   4595  C CB    . ALA B  1 265 ? -2.080  4.536   33.886  1.00 23.54  ? 327 ALA B CB    1 
ATOM   4596  N N     . PRO B  1 266 ? -2.015  4.731   30.798  1.00 23.36  ? 328 PRO B N     1 
ATOM   4597  C CA    . PRO B  1 266 ? -1.496  4.142   29.569  1.00 24.36  ? 328 PRO B CA    1 
ATOM   4598  C C     . PRO B  1 266 ? -0.896  2.724   29.714  1.00 25.60  ? 328 PRO B C     1 
ATOM   4599  O O     . PRO B  1 266 ? -1.110  1.884   28.849  1.00 26.41  ? 328 PRO B O     1 
ATOM   4600  C CB    . PRO B  1 266 ? -0.406  5.135   29.152  1.00 24.17  ? 328 PRO B CB    1 
ATOM   4601  C CG    . PRO B  1 266 ? -0.837  6.437   29.725  1.00 23.48  ? 328 PRO B CG    1 
ATOM   4602  C CD    . PRO B  1 266 ? -1.475  6.089   31.020  1.00 23.22  ? 328 PRO B CD    1 
ATOM   4603  N N     . ASP B  1 267 ? -0.162  2.467   30.790  1.00 26.55  ? 329 ASP B N     1 
ATOM   4604  C CA    . ASP B  1 267 ? 0.417   1.137   31.042  1.00 27.40  ? 329 ASP B CA    1 
ATOM   4605  C C     . ASP B  1 267 ? -0.569  0.174   31.709  1.00 26.03  ? 329 ASP B C     1 
ATOM   4606  O O     . ASP B  1 267 ? -0.219  -0.954  32.040  1.00 25.61  ? 329 ASP B O     1 
ATOM   4607  C CB    . ASP B  1 267 ? 1.678   1.258   31.906  1.00 29.19  ? 329 ASP B CB    1 
ATOM   4608  C CG    . ASP B  1 267 ? 1.461   2.125   33.131  1.00 31.99  ? 329 ASP B CG    1 
ATOM   4609  O OD1   . ASP B  1 267 ? 1.569   3.379   33.040  1.00 35.34  ? 329 ASP B OD1   1 
ATOM   4610  O OD2   . ASP B  1 267 ? 1.169   1.554   34.194  1.00 36.01  ? 329 ASP B OD2   1 
ATOM   4611  N N     . ALA B  1 268 ? -1.794  0.619   31.936  1.00 25.19  ? 330 ALA B N     1 
ATOM   4612  C CA    . ALA B  1 268 ? -2.818  -0.250  32.504  1.00 24.99  ? 330 ALA B CA    1 
ATOM   4613  C C     . ALA B  1 268 ? -3.648  -0.772  31.361  1.00 24.45  ? 330 ALA B C     1 
ATOM   4614  O O     . ALA B  1 268 ? -3.674  -0.156  30.305  1.00 23.63  ? 330 ALA B O     1 
ATOM   4615  C CB    . ALA B  1 268 ? -3.703  0.510   33.490  1.00 24.78  ? 330 ALA B CB    1 
ATOM   4616  N N     . PRO B  1 269 ? -4.344  -1.903  31.568  1.00 24.29  ? 331 PRO B N     1 
ATOM   4617  C CA    . PRO B  1 269 ? -5.278  -2.355  30.542  1.00 24.54  ? 331 PRO B CA    1 
ATOM   4618  C C     . PRO B  1 269 ? -6.412  -1.363  30.240  1.00 25.57  ? 331 PRO B C     1 
ATOM   4619  O O     . PRO B  1 269 ? -6.767  -0.509  31.065  1.00 26.29  ? 331 PRO B O     1 
ATOM   4620  C CB    . PRO B  1 269 ? -5.832  -3.671  31.101  1.00 24.19  ? 331 PRO B CB    1 
ATOM   4621  C CG    . PRO B  1 269 ? -5.402  -3.733  32.519  1.00 23.97  ? 331 PRO B CG    1 
ATOM   4622  C CD    . PRO B  1 269 ? -4.199  -2.874  32.663  1.00 23.77  ? 331 PRO B CD    1 
ATOM   4623  N N     . TYR B  1 270 ? -6.971  -1.524  29.050  1.00 27.25  ? 332 TYR B N     1 
ATOM   4624  C CA    . TYR B  1 270 ? -7.954  -0.616  28.481  1.00 28.74  ? 332 TYR B CA    1 
ATOM   4625  C C     . TYR B  1 270 ? -9.152  -0.399  29.397  1.00 26.70  ? 332 TYR B C     1 
ATOM   4626  O O     . TYR B  1 270 ? -9.653  -1.323  30.030  1.00 26.96  ? 332 TYR B O     1 
ATOM   4627  C CB    . TYR B  1 270 ? -8.408  -1.165  27.115  1.00 31.99  ? 332 TYR B CB    1 
ATOM   4628  C CG    . TYR B  1 270 ? -9.633  -0.491  26.541  1.00 38.19  ? 332 TYR B CG    1 
ATOM   4629  C CD1   . TYR B  1 270 ? -10.934 -0.963  26.833  1.00 39.77  ? 332 TYR B CD1   1 
ATOM   4630  C CD2   . TYR B  1 270 ? -9.506  0.630   25.689  1.00 42.09  ? 332 TYR B CD2   1 
ATOM   4631  C CE1   . TYR B  1 270 ? -12.067 -0.332  26.314  1.00 41.83  ? 332 TYR B CE1   1 
ATOM   4632  C CE2   . TYR B  1 270 ? -10.632 1.263   25.159  1.00 43.96  ? 332 TYR B CE2   1 
ATOM   4633  C CZ    . TYR B  1 270 ? -11.904 0.787   25.472  1.00 45.36  ? 332 TYR B CZ    1 
ATOM   4634  O OH    . TYR B  1 270 ? -12.996 1.445   24.942  1.00 48.83  ? 332 TYR B OH    1 
ATOM   4635  N N     . THR B  1 271 ? -9.598  0.842   29.469  1.00 25.92  ? 333 THR B N     1 
ATOM   4636  C CA    . THR B  1 271 ? -10.878 1.192   30.096  1.00 26.27  ? 333 THR B CA    1 
ATOM   4637  C C     . THR B  1 271 ? -11.616 2.143   29.158  1.00 26.12  ? 333 THR B C     1 
ATOM   4638  O O     . THR B  1 271 ? -10.979 2.844   28.367  1.00 26.18  ? 333 THR B O     1 
ATOM   4639  C CB    . THR B  1 271 ? -10.685 1.888   31.460  1.00 25.37  ? 333 THR B CB    1 
ATOM   4640  O OG1   . THR B  1 271 ? -10.166 3.206   31.253  1.00 25.07  ? 333 THR B OG1   1 
ATOM   4641  C CG2   . THR B  1 271 ? -9.730  1.088   32.344  1.00 24.91  ? 333 THR B CG2   1 
ATOM   4642  N N     . HIS B  1 272 ? -12.944 2.192   29.251  1.00 25.76  ? 334 HIS B N     1 
ATOM   4643  C CA    . HIS B  1 272 ? -13.714 3.096   28.400  1.00 25.44  ? 334 HIS B CA    1 
ATOM   4644  C C     . HIS B  1 272 ? -13.337 4.577   28.682  1.00 26.48  ? 334 HIS B C     1 
ATOM   4645  O O     . HIS B  1 272 ? -13.602 5.451   27.855  1.00 27.82  ? 334 HIS B O     1 
ATOM   4646  C CB    . HIS B  1 272 ? -15.226 2.852   28.540  1.00 24.73  ? 334 HIS B CB    1 
ATOM   4647  C CG    . HIS B  1 272 ? -15.836 3.504   29.740  1.00 25.29  ? 334 HIS B CG    1 
ATOM   4648  N ND1   . HIS B  1 272 ? -15.788 2.950   31.003  1.00 25.38  ? 334 HIS B ND1   1 
ATOM   4649  C CD2   . HIS B  1 272 ? -16.484 4.687   29.874  1.00 25.85  ? 334 HIS B CD2   1 
ATOM   4650  C CE1   . HIS B  1 272 ? -16.380 3.766   31.861  1.00 25.85  ? 334 HIS B CE1   1 
ATOM   4651  N NE2   . HIS B  1 272 ? -16.818 4.826   31.201  1.00 25.66  ? 334 HIS B NE2   1 
ATOM   4652  N N     . TRP B  1 273 ? -12.707 4.869   29.820  1.00 26.37  ? 335 TRP B N     1 
ATOM   4653  C CA    . TRP B  1 273 ? -12.243 6.226   30.062  1.00 27.43  ? 335 TRP B CA    1 
ATOM   4654  C C     . TRP B  1 273 ? -11.042 6.606   29.236  1.00 26.97  ? 335 TRP B C     1 
ATOM   4655  O O     . TRP B  1 273 ? -10.822 7.800   29.003  1.00 27.97  ? 335 TRP B O     1 
ATOM   4656  C CB    . TRP B  1 273 ? -11.839 6.432   31.514  1.00 28.59  ? 335 TRP B CB    1 
ATOM   4657  C CG    . TRP B  1 273 ? -12.952 6.531   32.401  1.00 29.23  ? 335 TRP B CG    1 
ATOM   4658  C CD1   . TRP B  1 273 ? -13.758 7.622   32.601  1.00 30.09  ? 335 TRP B CD1   1 
ATOM   4659  C CD2   . TRP B  1 273 ? -13.431 5.505   33.246  1.00 29.78  ? 335 TRP B CD2   1 
ATOM   4660  N NE1   . TRP B  1 273 ? -14.720 7.321   33.533  1.00 31.52  ? 335 TRP B NE1   1 
ATOM   4661  C CE2   . TRP B  1 273 ? -14.541 6.023   33.941  1.00 30.37  ? 335 TRP B CE2   1 
ATOM   4662  C CE3   . TRP B  1 273 ? -13.029 4.192   33.491  1.00 30.18  ? 335 TRP B CE3   1 
ATOM   4663  C CZ2   . TRP B  1 273 ? -15.254 5.275   34.846  1.00 29.60  ? 335 TRP B CZ2   1 
ATOM   4664  C CZ3   . TRP B  1 273 ? -13.733 3.453   34.399  1.00 30.20  ? 335 TRP B CZ3   1 
ATOM   4665  C CH2   . TRP B  1 273 ? -14.838 3.997   35.067  1.00 30.12  ? 335 TRP B CH2   1 
ATOM   4666  N N     . LYS B  1 274 ? -10.232 5.608   28.880  1.00 25.88  ? 336 LYS B N     1 
ATOM   4667  C CA    . LYS B  1 274 ? -9.001  5.820   28.144  1.00 25.70  ? 336 LYS B CA    1 
ATOM   4668  C C     . LYS B  1 274 ? -8.121  6.838   28.866  1.00 25.00  ? 336 LYS B C     1 
ATOM   4669  O O     . LYS B  1 274 ? -7.973  6.779   30.102  1.00 26.64  ? 336 LYS B O     1 
ATOM   4670  C CB    . LYS B  1 274 ? -9.323  6.248   26.716  1.00 26.81  ? 336 LYS B CB    1 
ATOM   4671  C CG    . LYS B  1 274 ? -10.419 5.402   26.078  1.00 28.48  ? 336 LYS B CG    1 
ATOM   4672  C CD    . LYS B  1 274 ? -10.818 5.890   24.686  1.00 29.70  ? 336 LYS B CD    1 
ATOM   4673  C CE    . LYS B  1 274 ? -11.768 4.908   24.009  1.00 29.99  ? 336 LYS B CE    1 
ATOM   4674  N NZ    . LYS B  1 274 ? -12.197 5.405   22.681  1.00 31.17  ? 336 LYS B NZ    1 
ATOM   4675  N N     . GLN B  1 275 ? -7.511  7.745   28.111  1.00 23.32  ? 337 GLN B N     1 
ATOM   4676  C CA    . GLN B  1 275 ? -6.726  8.825   28.694  1.00 23.06  ? 337 GLN B CA    1 
ATOM   4677  C C     . GLN B  1 275 ? -7.173  10.118  28.086  1.00 22.46  ? 337 GLN B C     1 
ATOM   4678  O O     . GLN B  1 275 ? -7.932  10.112  27.128  1.00 22.39  ? 337 GLN B O     1 
ATOM   4679  C CB    . GLN B  1 275 ? -5.240  8.631   28.419  1.00 23.67  ? 337 GLN B CB    1 
ATOM   4680  C CG    . GLN B  1 275 ? -4.593  7.486   29.181  1.00 23.96  ? 337 GLN B CG    1 
ATOM   4681  C CD    . GLN B  1 275 ? -4.833  6.125   28.557  1.00 24.05  ? 337 GLN B CD    1 
ATOM   4682  O OE1   . GLN B  1 275 ? -4.652  5.925   27.338  1.00 24.28  ? 337 GLN B OE1   1 
ATOM   4683  N NE2   . GLN B  1 275 ? -5.212  5.168   29.392  1.00 23.97  ? 337 GLN B NE2   1 
ATOM   4684  N N     . THR B  1 276 ? -6.686  11.221  28.637  1.00 22.65  ? 338 THR B N     1 
ATOM   4685  C CA    . THR B  1 276 ? -7.146  12.562  28.261  1.00 22.76  ? 338 THR B CA    1 
ATOM   4686  C C     . THR B  1 276 ? -5.922  13.381  27.895  1.00 22.41  ? 338 THR B C     1 
ATOM   4687  O O     . THR B  1 276 ? -5.047  13.619  28.717  1.00 23.03  ? 338 THR B O     1 
ATOM   4688  C CB    . THR B  1 276 ? -7.914  13.254  29.419  1.00 22.97  ? 338 THR B CB    1 
ATOM   4689  O OG1   . THR B  1 276 ? -8.835  12.330  30.048  1.00 23.37  ? 338 THR B OG1   1 
ATOM   4690  C CG2   . THR B  1 276 ? -8.653  14.455  28.914  1.00 22.66  ? 338 THR B CG2   1 
ATOM   4691  N N     . VAL B  1 277 ? -5.876  13.807  26.648  1.00 22.89  ? 339 VAL B N     1 
ATOM   4692  C CA    . VAL B  1 277 ? -4.690  14.399  26.048  1.00 22.96  ? 339 VAL B CA    1 
ATOM   4693  C C     . VAL B  1 277 ? -4.887  15.909  25.831  1.00 24.04  ? 339 VAL B C     1 
ATOM   4694  O O     . VAL B  1 277 ? -5.863  16.328  25.211  1.00 23.20  ? 339 VAL B O     1 
ATOM   4695  C CB    . VAL B  1 277 ? -4.404  13.748  24.689  1.00 22.25  ? 339 VAL B CB    1 
ATOM   4696  C CG1   . VAL B  1 277 ? -3.147  14.335  24.073  1.00 23.09  ? 339 VAL B CG1   1 
ATOM   4697  C CG2   . VAL B  1 277 ? -4.269  12.244  24.830  1.00 21.87  ? 339 VAL B CG2   1 
ATOM   4698  N N     . PHE B  1 278 ? -3.939  16.711  26.318  1.00 25.11  ? 340 PHE B N     1 
ATOM   4699  C CA    . PHE B  1 278 ? -3.994  18.167  26.196  1.00 25.11  ? 340 PHE B CA    1 
ATOM   4700  C C     . PHE B  1 278 ? -2.873  18.639  25.310  1.00 25.26  ? 340 PHE B C     1 
ATOM   4701  O O     . PHE B  1 278 ? -1.730  18.653  25.740  1.00 26.76  ? 340 PHE B O     1 
ATOM   4702  C CB    . PHE B  1 278 ? -3.820  18.792  27.573  1.00 24.77  ? 340 PHE B CB    1 
ATOM   4703  C CG    . PHE B  1 278 ? -4.912  18.454  28.525  1.00 24.20  ? 340 PHE B CG    1 
ATOM   4704  C CD1   . PHE B  1 278 ? -4.960  17.211  29.136  1.00 23.88  ? 340 PHE B CD1   1 
ATOM   4705  C CD2   . PHE B  1 278 ? -5.884  19.388  28.825  1.00 24.51  ? 340 PHE B CD2   1 
ATOM   4706  C CE1   . PHE B  1 278 ? -5.965  16.915  30.040  1.00 24.77  ? 340 PHE B CE1   1 
ATOM   4707  C CE2   . PHE B  1 278 ? -6.895  19.102  29.733  1.00 24.44  ? 340 PHE B CE2   1 
ATOM   4708  C CZ    . PHE B  1 278 ? -6.936  17.868  30.345  1.00 24.38  ? 340 PHE B CZ    1 
ATOM   4709  N N     . TYR B  1 279 ? -3.172  19.028  24.082  1.00 26.12  ? 341 TYR B N     1 
ATOM   4710  C CA    . TYR B  1 279 ? -2.097  19.358  23.151  1.00 28.30  ? 341 TYR B CA    1 
ATOM   4711  C C     . TYR B  1 279 ? -1.422  20.673  23.518  1.00 29.63  ? 341 TYR B C     1 
ATOM   4712  O O     . TYR B  1 279 ? -2.060  21.521  24.105  1.00 31.09  ? 341 TYR B O     1 
ATOM   4713  C CB    . TYR B  1 279 ? -2.605  19.364  21.713  1.00 28.46  ? 341 TYR B CB    1 
ATOM   4714  C CG    . TYR B  1 279 ? -2.665  17.974  21.127  1.00 29.29  ? 341 TYR B CG    1 
ATOM   4715  C CD1   . TYR B  1 279 ? -1.503  17.214  20.982  1.00 30.77  ? 341 TYR B CD1   1 
ATOM   4716  C CD2   . TYR B  1 279 ? -3.869  17.405  20.731  1.00 29.62  ? 341 TYR B CD2   1 
ATOM   4717  C CE1   . TYR B  1 279 ? -1.540  15.931  20.456  1.00 31.22  ? 341 TYR B CE1   1 
ATOM   4718  C CE2   . TYR B  1 279 ? -3.914  16.115  20.213  1.00 30.79  ? 341 TYR B CE2   1 
ATOM   4719  C CZ    . TYR B  1 279 ? -2.742  15.390  20.075  1.00 31.44  ? 341 TYR B CZ    1 
ATOM   4720  O OH    . TYR B  1 279 ? -2.765  14.124  19.551  1.00 33.28  ? 341 TYR B OH    1 
ATOM   4721  N N     . LEU B  1 280 ? -0.121  20.788  23.231  1.00 31.08  ? 342 LEU B N     1 
ATOM   4722  C CA    . LEU B  1 280 ? 0.644   22.030  23.374  1.00 32.75  ? 342 LEU B CA    1 
ATOM   4723  C C     . LEU B  1 280 ? 0.816   22.647  22.000  1.00 35.52  ? 342 LEU B C     1 
ATOM   4724  O O     . LEU B  1 280 ? 0.844   21.921  20.989  1.00 33.66  ? 342 LEU B O     1 
ATOM   4725  C CB    . LEU B  1 280 ? 2.047   21.765  23.936  1.00 32.86  ? 342 LEU B CB    1 
ATOM   4726  C CG    . LEU B  1 280 ? 2.183   21.044  25.267  1.00 33.05  ? 342 LEU B CG    1 
ATOM   4727  C CD1   . LEU B  1 280 ? 3.645   20.819  25.606  1.00 32.27  ? 342 LEU B CD1   1 
ATOM   4728  C CD2   . LEU B  1 280 ? 1.500   21.858  26.351  1.00 33.86  ? 342 LEU B CD2   1 
ATOM   4729  N N     . GLU B  1 281 ? 1.003   23.969  21.967  1.00 39.49  ? 343 GLU B N     1 
ATOM   4730  C CA    . GLU B  1 281 ? 1.098   24.683  20.691  1.00 43.33  ? 343 GLU B CA    1 
ATOM   4731  C C     . GLU B  1 281 ? 2.323   24.209  19.936  1.00 41.87  ? 343 GLU B C     1 
ATOM   4732  O O     . GLU B  1 281 ? 2.203   23.691  18.826  1.00 40.51  ? 343 GLU B O     1 
ATOM   4733  C CB    . GLU B  1 281 ? 1.085   26.212  20.868  1.00 46.92  ? 343 GLU B CB    1 
ATOM   4734  C CG    . GLU B  1 281 ? -0.268  26.733  21.359  1.00 50.38  ? 343 GLU B CG    1 
ATOM   4735  C CD    . GLU B  1 281 ? -0.314  28.245  21.551  1.00 52.34  ? 343 GLU B CD    1 
ATOM   4736  O OE1   . GLU B  1 281 ? -0.156  28.680  22.716  1.00 58.79  ? 343 GLU B OE1   1 
ATOM   4737  O OE2   . GLU B  1 281 ? -0.500  28.995  20.564  1.00 47.81  ? 343 GLU B OE2   1 
ATOM   4738  N N     . ASP B  1 282 ? 3.484   24.374  20.559  1.00 41.49  ? 344 ASP B N     1 
ATOM   4739  C CA    . ASP B  1 282 ? 4.739   23.890  20.012  1.00 41.79  ? 344 ASP B CA    1 
ATOM   4740  C C     . ASP B  1 282 ? 5.165   22.712  20.817  1.00 39.79  ? 344 ASP B C     1 
ATOM   4741  O O     . ASP B  1 282 ? 4.768   22.583  21.965  1.00 45.05  ? 344 ASP B O     1 
ATOM   4742  C CB    . ASP B  1 282 ? 5.817   24.972  20.106  1.00 42.94  ? 344 ASP B CB    1 
ATOM   4743  C CG    . ASP B  1 282 ? 5.404   26.236  19.424  1.00 43.43  ? 344 ASP B CG    1 
ATOM   4744  O OD1   . ASP B  1 282 ? 5.303   26.222  18.169  1.00 42.28  ? 344 ASP B OD1   1 
ATOM   4745  O OD2   . ASP B  1 282 ? 5.162   27.226  20.152  1.00 43.70  ? 344 ASP B OD2   1 
ATOM   4746  N N     . TYR B  1 283 ? 6.018   21.880  20.244  1.00 36.54  ? 345 TYR B N     1 
ATOM   4747  C CA    . TYR B  1 283 ? 6.577   20.768  20.997  1.00 34.44  ? 345 TYR B CA    1 
ATOM   4748  C C     . TYR B  1 283 ? 7.745   21.246  21.866  1.00 33.29  ? 345 TYR B C     1 
ATOM   4749  O O     . TYR B  1 283 ? 8.434   22.214  21.523  1.00 32.95  ? 345 TYR B O     1 
ATOM   4750  C CB    . TYR B  1 283 ? 6.980   19.614  20.067  1.00 34.62  ? 345 TYR B CB    1 
ATOM   4751  C CG    . TYR B  1 283 ? 7.850   19.955  18.855  1.00 35.08  ? 345 TYR B CG    1 
ATOM   4752  C CD1   . TYR B  1 283 ? 9.221   20.044  18.971  1.00 35.56  ? 345 TYR B CD1   1 
ATOM   4753  C CD2   . TYR B  1 283 ? 7.296   20.126  17.591  1.00 35.01  ? 345 TYR B CD2   1 
ATOM   4754  C CE1   . TYR B  1 283 ? 10.012  20.344  17.883  1.00 36.52  ? 345 TYR B CE1   1 
ATOM   4755  C CE2   . TYR B  1 283 ? 8.085   20.416  16.498  1.00 35.98  ? 345 TYR B CE2   1 
ATOM   4756  C CZ    . TYR B  1 283 ? 9.442   20.527  16.647  1.00 37.08  ? 345 TYR B CZ    1 
ATOM   4757  O OH    . TYR B  1 283 ? 10.246  20.810  15.556  1.00 41.48  ? 345 TYR B OH    1 
ATOM   4758  N N     . LEU B  1 284 ? 7.945   20.594  23.008  1.00 32.02  ? 346 LEU B N     1 
ATOM   4759  C CA    . LEU B  1 284 ? 9.145   20.829  23.823  1.00 32.42  ? 346 LEU B CA    1 
ATOM   4760  C C     . LEU B  1 284 ? 10.265  19.890  23.381  1.00 31.37  ? 346 LEU B C     1 
ATOM   4761  O O     . LEU B  1 284 ? 10.010  18.746  23.058  1.00 31.03  ? 346 LEU B O     1 
ATOM   4762  C CB    . LEU B  1 284 ? 8.848   20.589  25.303  1.00 32.48  ? 346 LEU B CB    1 
ATOM   4763  C CG    . LEU B  1 284 ? 8.246   21.714  26.147  1.00 32.32  ? 346 LEU B CG    1 
ATOM   4764  C CD1   . LEU B  1 284 ? 7.374   22.666  25.348  1.00 31.97  ? 346 LEU B CD1   1 
ATOM   4765  C CD2   . LEU B  1 284 ? 7.479   21.115  27.316  1.00 31.91  ? 346 LEU B CD2   1 
ATOM   4766  N N     . THR B  1 285 ? 11.497  20.378  23.367  1.00 31.91  ? 347 THR B N     1 
ATOM   4767  C CA    . THR B  1 285 ? 12.672  19.536  23.107  1.00 31.86  ? 347 THR B CA    1 
ATOM   4768  C C     . THR B  1 285 ? 13.435  19.300  24.423  1.00 33.61  ? 347 THR B C     1 
ATOM   4769  O O     . THR B  1 285 ? 14.069  20.224  24.987  1.00 38.26  ? 347 THR B O     1 
ATOM   4770  C CB    . THR B  1 285 ? 13.585  20.190  22.062  1.00 29.60  ? 347 THR B CB    1 
ATOM   4771  O OG1   . THR B  1 285 ? 12.780  20.672  20.985  1.00 28.01  ? 347 THR B OG1   1 
ATOM   4772  C CG2   . THR B  1 285 ? 14.614  19.206  21.547  1.00 28.69  ? 347 THR B CG2   1 
ATOM   4773  N N     . VAL B  1 286 ? 13.395  18.056  24.891  1.00 32.71  ? 348 VAL B N     1 
ATOM   4774  C CA    . VAL B  1 286 ? 13.754  17.749  26.267  1.00 33.06  ? 348 VAL B CA    1 
ATOM   4775  C C     . VAL B  1 286 ? 14.839  16.680  26.400  1.00 33.31  ? 348 VAL B C     1 
ATOM   4776  O O     . VAL B  1 286 ? 14.921  15.736  25.608  1.00 31.51  ? 348 VAL B O     1 
ATOM   4777  C CB    . VAL B  1 286 ? 12.508  17.332  27.078  1.00 33.83  ? 348 VAL B CB    1 
ATOM   4778  C CG1   . VAL B  1 286 ? 11.440  18.407  26.987  1.00 34.56  ? 348 VAL B CG1   1 
ATOM   4779  C CG2   . VAL B  1 286 ? 11.938  15.993  26.611  1.00 33.22  ? 348 VAL B CG2   1 
ATOM   4780  N N     . ARG B  1 287 ? 15.658  16.854  27.433  1.00 34.73  ? 349 ARG B N     1 
ATOM   4781  C CA    . ARG B  1 287 ? 16.773  15.970  27.737  1.00 35.91  ? 349 ARG B CA    1 
ATOM   4782  C C     . ARG B  1 287 ? 16.554  15.230  29.060  1.00 34.37  ? 349 ARG B C     1 
ATOM   4783  O O     . ARG B  1 287 ? 16.032  15.802  30.024  1.00 32.37  ? 349 ARG B O     1 
ATOM   4784  C CB    . ARG B  1 287 ? 18.067  16.795  27.815  1.00 39.04  ? 349 ARG B CB    1 
ATOM   4785  C CG    . ARG B  1 287 ? 18.426  17.506  26.511  1.00 41.34  ? 349 ARG B CG    1 
ATOM   4786  C CD    . ARG B  1 287 ? 19.680  18.368  26.597  1.00 43.01  ? 349 ARG B CD    1 
ATOM   4787  N NE    . ARG B  1 287 ? 20.773  17.733  27.336  1.00 43.70  ? 349 ARG B NE    1 
ATOM   4788  C CZ    . ARG B  1 287 ? 21.170  18.084  28.561  1.00 44.20  ? 349 ARG B CZ    1 
ATOM   4789  N NH1   . ARG B  1 287 ? 20.596  19.083  29.234  1.00 44.47  ? 349 ARG B NH1   1 
ATOM   4790  N NH2   . ARG B  1 287 ? 22.169  17.429  29.122  1.00 44.56  ? 349 ARG B NH2   1 
ATOM   4791  N N     . ARG B  1 288 ? 16.969  13.966  29.104  1.00 32.70  ? 350 ARG B N     1 
ATOM   4792  C CA    . ARG B  1 288 ? 16.868  13.174  30.321  1.00 33.72  ? 350 ARG B CA    1 
ATOM   4793  C C     . ARG B  1 288 ? 17.331  14.017  31.511  1.00 33.63  ? 350 ARG B C     1 
ATOM   4794  O O     . ARG B  1 288 ? 18.378  14.633  31.440  1.00 32.98  ? 350 ARG B O     1 
ATOM   4795  C CB    . ARG B  1 288 ? 17.745  11.937  30.212  1.00 35.32  ? 350 ARG B CB    1 
ATOM   4796  C CG    . ARG B  1 288 ? 17.477  10.890  31.269  1.00 36.53  ? 350 ARG B CG    1 
ATOM   4797  C CD    . ARG B  1 288 ? 18.756  10.429  31.971  1.00 40.71  ? 350 ARG B CD    1 
ATOM   4798  N NE    . ARG B  1 288 ? 18.402  9.590   33.124  1.00 43.93  ? 350 ARG B NE    1 
ATOM   4799  C CZ    . ARG B  1 288 ? 18.006  8.322   33.045  1.00 42.55  ? 350 ARG B CZ    1 
ATOM   4800  N NH1   . ARG B  1 288 ? 17.948  7.706   31.876  1.00 45.24  ? 350 ARG B NH1   1 
ATOM   4801  N NH2   . ARG B  1 288 ? 17.674  7.663   34.135  1.00 40.42  ? 350 ARG B NH2   1 
ATOM   4802  N N     . GLY B  1 289 ? 16.548  14.059  32.591  1.00 34.47  ? 351 GLY B N     1 
ATOM   4803  C CA    . GLY B  1 289 ? 16.935  14.772  33.814  1.00 33.96  ? 351 GLY B CA    1 
ATOM   4804  C C     . GLY B  1 289 ? 16.308  16.146  33.973  1.00 35.46  ? 351 GLY B C     1 
ATOM   4805  O O     . GLY B  1 289 ? 16.124  16.608  35.108  1.00 37.28  ? 351 GLY B O     1 
ATOM   4806  N N     . GLU B  1 290 ? 15.985  16.808  32.851  1.00 36.82  ? 352 GLU B N     1 
ATOM   4807  C CA    . GLU B  1 290 ? 15.377  18.169  32.866  1.00 35.45  ? 352 GLU B CA    1 
ATOM   4808  C C     . GLU B  1 290 ? 13.945  18.024  33.380  1.00 33.31  ? 352 GLU B C     1 
ATOM   4809  O O     . GLU B  1 290 ? 13.477  16.899  33.596  1.00 30.61  ? 352 GLU B O     1 
ATOM   4810  C CB    . GLU B  1 290 ? 15.426  18.865  31.469  1.00 35.64  ? 352 GLU B CB    1 
ATOM   4811  C CG    . GLU B  1 290 ? 16.789  18.839  30.751  1.00 35.22  ? 352 GLU B CG    1 
ATOM   4812  C CD    . GLU B  1 290 ? 16.892  19.730  29.497  1.00 36.48  ? 352 GLU B CD    1 
ATOM   4813  O OE1   . GLU B  1 290 ? 17.811  20.570  29.486  1.00 37.45  ? 352 GLU B OE1   1 
ATOM   4814  O OE2   . GLU B  1 290 ? 16.110  19.613  28.512  1.00 36.46  ? 352 GLU B OE2   1 
ATOM   4815  N N     . GLU B  1 291 ? 13.256  19.139  33.591  1.00 33.41  ? 353 GLU B N     1 
ATOM   4816  C CA    . GLU B  1 291 ? 11.959  19.086  34.266  1.00 35.73  ? 353 GLU B CA    1 
ATOM   4817  C C     . GLU B  1 291 ? 10.936  20.096  33.774  1.00 34.82  ? 353 GLU B C     1 
ATOM   4818  O O     . GLU B  1 291 ? 11.264  21.251  33.479  1.00 35.06  ? 353 GLU B O     1 
ATOM   4819  C CB    . GLU B  1 291 ? 12.153  19.299  35.773  1.00 39.90  ? 353 GLU B CB    1 
ATOM   4820  C CG    . GLU B  1 291 ? 12.955  18.210  36.492  1.00 42.55  ? 353 GLU B CG    1 
ATOM   4821  C CD    . GLU B  1 291 ? 13.213  18.550  37.947  1.00 42.30  ? 353 GLU B CD    1 
ATOM   4822  O OE1   . GLU B  1 291 ? 13.311  19.766  38.249  1.00 40.50  ? 353 GLU B OE1   1 
ATOM   4823  O OE2   . GLU B  1 291 ? 13.313  17.598  38.763  1.00 41.67  ? 353 GLU B OE2   1 
ATOM   4824  N N     . ILE B  1 292 ? 9.681   19.661  33.724  1.00 34.31  ? 354 ILE B N     1 
ATOM   4825  C CA    . ILE B  1 292 ? 8.569   20.551  33.383  1.00 33.90  ? 354 ILE B CA    1 
ATOM   4826  C C     . ILE B  1 292 ? 7.803   20.936  34.657  1.00 33.28  ? 354 ILE B C     1 
ATOM   4827  O O     . ILE B  1 292 ? 7.306   20.058  35.388  1.00 32.61  ? 354 ILE B O     1 
ATOM   4828  C CB    . ILE B  1 292 ? 7.567   19.873  32.444  1.00 34.36  ? 354 ILE B CB    1 
ATOM   4829  C CG1   . ILE B  1 292 ? 8.243   19.374  31.188  1.00 34.25  ? 354 ILE B CG1   1 
ATOM   4830  C CG2   . ILE B  1 292 ? 6.481   20.854  32.045  1.00 35.92  ? 354 ILE B CG2   1 
ATOM   4831  C CD1   . ILE B  1 292 ? 7.433   18.335  30.446  1.00 33.64  ? 354 ILE B CD1   1 
ATOM   4832  N N     . TYR B  1 293 ? 7.711   22.240  34.911  1.00 30.99  ? 355 TYR B N     1 
ATOM   4833  C CA    . TYR B  1 293 ? 6.963   22.760  36.038  1.00 29.99  ? 355 TYR B CA    1 
ATOM   4834  C C     . TYR B  1 293 ? 5.698   23.393  35.533  1.00 29.44  ? 355 TYR B C     1 
ATOM   4835  O O     . TYR B  1 293 ? 5.655   23.877  34.438  1.00 31.44  ? 355 TYR B O     1 
ATOM   4836  C CB    . TYR B  1 293 ? 7.775   23.815  36.781  1.00 29.03  ? 355 TYR B CB    1 
ATOM   4837  C CG    . TYR B  1 293 ? 8.952   23.250  37.537  1.00 28.85  ? 355 TYR B CG    1 
ATOM   4838  C CD1   . TYR B  1 293 ? 10.113  22.913  36.878  1.00 28.58  ? 355 TYR B CD1   1 
ATOM   4839  C CD2   . TYR B  1 293 ? 8.901   23.052  38.919  1.00 28.44  ? 355 TYR B CD2   1 
ATOM   4840  C CE1   . TYR B  1 293 ? 11.192  22.395  37.564  1.00 29.37  ? 355 TYR B CE1   1 
ATOM   4841  C CE2   . TYR B  1 293 ? 9.976   22.529  39.615  1.00 28.02  ? 355 TYR B CE2   1 
ATOM   4842  C CZ    . TYR B  1 293 ? 11.116  22.207  38.928  1.00 29.36  ? 355 TYR B CZ    1 
ATOM   4843  O OH    . TYR B  1 293 ? 12.198  21.679  39.577  1.00 31.95  ? 355 TYR B OH    1 
ATOM   4844  N N     . GLY B  1 294 ? 4.660   23.402  36.339  1.00 30.03  ? 356 GLY B N     1 
ATOM   4845  C CA    . GLY B  1 294 ? 3.480   24.162  35.993  1.00 30.66  ? 356 GLY B CA    1 
ATOM   4846  C C     . GLY B  1 294 ? 2.368   24.031  37.010  1.00 30.60  ? 356 GLY B C     1 
ATOM   4847  O O     . GLY B  1 294 ? 2.505   23.330  38.028  1.00 28.55  ? 356 GLY B O     1 
ATOM   4848  N N     . THR B  1 295 ? 1.266   24.712  36.713  1.00 30.73  ? 357 THR B N     1 
ATOM   4849  C CA    . THR B  1 295 ? 0.020   24.511  37.419  1.00 31.75  ? 357 THR B CA    1 
ATOM   4850  C C     . THR B  1 295 ? -1.032  24.097  36.422  1.00 35.03  ? 357 THR B C     1 
ATOM   4851  O O     . THR B  1 295 ? -0.961  24.432  35.234  1.00 36.76  ? 357 THR B O     1 
ATOM   4852  C CB    . THR B  1 295 ? -0.476  25.776  38.115  1.00 30.40  ? 357 THR B CB    1 
ATOM   4853  O OG1   . THR B  1 295 ? -0.808  26.768  37.145  1.00 28.78  ? 357 THR B OG1   1 
ATOM   4854  C CG2   . THR B  1 295 ? 0.588   26.302  39.005  1.00 31.33  ? 357 THR B CG2   1 
ATOM   4855  N N     . ILE B  1 296 ? -2.011  23.359  36.916  1.00 37.15  ? 358 ILE B N     1 
ATOM   4856  C CA    . ILE B  1 296 ? -3.167  23.006  36.129  1.00 37.75  ? 358 ILE B CA    1 
ATOM   4857  C C     . ILE B  1 296 ? -4.364  23.200  37.022  1.00 38.03  ? 358 ILE B C     1 
ATOM   4858  O O     . ILE B  1 296 ? -4.424  22.641  38.104  1.00 38.63  ? 358 ILE B O     1 
ATOM   4859  C CB    . ILE B  1 296 ? -3.084  21.576  35.582  1.00 38.22  ? 358 ILE B CB    1 
ATOM   4860  C CG1   . ILE B  1 296 ? -4.467  20.955  35.501  1.00 40.14  ? 358 ILE B CG1   1 
ATOM   4861  C CG2   . ILE B  1 296 ? -2.237  20.678  36.453  1.00 38.70  ? 358 ILE B CG2   1 
ATOM   4862  C CD1   . ILE B  1 296 ? -4.473  19.696  34.664  1.00 41.65  ? 358 ILE B CD1   1 
ATOM   4863  N N     . SER B  1 297 ? -5.301  24.021  36.581  1.00 39.14  ? 359 SER B N     1 
ATOM   4864  C CA    . SER B  1 297 ? -6.486  24.297  37.375  1.00 40.40  ? 359 SER B CA    1 
ATOM   4865  C C     . SER B  1 297 ? -7.709  23.927  36.572  1.00 41.77  ? 359 SER B C     1 
ATOM   4866  O O     . SER B  1 297 ? -7.673  23.993  35.346  1.00 39.61  ? 359 SER B O     1 
ATOM   4867  C CB    . SER B  1 297 ? -6.526  25.765  37.804  1.00 39.35  ? 359 SER B CB    1 
ATOM   4868  O OG    . SER B  1 297 ? -5.698  26.556  36.997  1.00 39.51  ? 359 SER B OG    1 
ATOM   4869  N N     . MET B  1 298 ? -8.770  23.500  37.260  1.00 45.75  ? 360 MET B N     1 
ATOM   4870  C CA    . MET B  1 298 ? -10.061 23.273  36.601  1.00 50.78  ? 360 MET B CA    1 
ATOM   4871  C C     . MET B  1 298 ? -11.268 23.636  37.453  1.00 50.55  ? 360 MET B C     1 
ATOM   4872  O O     . MET B  1 298 ? -11.275 23.398  38.659  1.00 49.38  ? 360 MET B O     1 
ATOM   4873  C CB    . MET B  1 298 ? -10.201 21.837  36.117  1.00 52.82  ? 360 MET B CB    1 
ATOM   4874  C CG    . MET B  1 298 ? -9.573  20.814  37.032  1.00 55.82  ? 360 MET B CG    1 
ATOM   4875  S SD    . MET B  1 298 ? -10.169 19.158  36.681  1.00 62.86  ? 360 MET B SD    1 
ATOM   4876  C CE    . MET B  1 298 ? -11.845 19.326  37.297  1.00 62.79  ? 360 MET B CE    1 
ATOM   4877  N N     . LYS B  1 299 ? -12.269 24.220  36.782  1.00 51.21  ? 361 LYS B N     1 
ATOM   4878  C CA    . LYS B  1 299 ? -13.562 24.581  37.358  1.00 50.31  ? 361 LYS B CA    1 
ATOM   4879  C C     . LYS B  1 299 ? -14.643 23.932  36.531  1.00 48.36  ? 361 LYS B C     1 
ATOM   4880  O O     . LYS B  1 299 ? -14.423 23.618  35.366  1.00 48.79  ? 361 LYS B O     1 
ATOM   4881  C CB    . LYS B  1 299 ? -13.834 26.085  37.260  1.00 51.74  ? 361 LYS B CB    1 
ATOM   4882  C CG    . LYS B  1 299 ? -12.682 27.018  37.595  1.00 55.53  ? 361 LYS B CG    1 
ATOM   4883  C CD    . LYS B  1 299 ? -13.190 28.402  38.016  1.00 57.55  ? 361 LYS B CD    1 
ATOM   4884  C CE    . LYS B  1 299 ? -14.088 29.059  36.971  1.00 59.31  ? 361 LYS B CE    1 
ATOM   4885  N NZ    . LYS B  1 299 ? -13.399 29.150  35.658  1.00 63.23  ? 361 LYS B NZ    1 
ATOM   4886  N N     . PRO B  1 300 ? -15.830 23.747  37.116  1.00 47.25  ? 362 PRO B N     1 
ATOM   4887  C CA    . PRO B  1 300 ? -16.964 23.699  36.219  1.00 45.37  ? 362 PRO B CA    1 
ATOM   4888  C C     . PRO B  1 300 ? -17.070 25.035  35.491  1.00 42.54  ? 362 PRO B C     1 
ATOM   4889  O O     . PRO B  1 300 ? -16.758 26.080  36.043  1.00 38.22  ? 362 PRO B O     1 
ATOM   4890  C CB    . PRO B  1 300 ? -18.149 23.476  37.160  1.00 46.03  ? 362 PRO B CB    1 
ATOM   4891  C CG    . PRO B  1 300 ? -17.563 22.751  38.329  1.00 46.07  ? 362 PRO B CG    1 
ATOM   4892  C CD    . PRO B  1 300 ? -16.196 23.359  38.489  1.00 47.32  ? 362 PRO B CD    1 
ATOM   4893  N N     . ASN B  1 301 ? -17.473 24.972  34.236  1.00 44.63  ? 363 ASN B N     1 
ATOM   4894  C CA    . ASN B  1 301 ? -17.719 26.157  33.439  1.00 47.57  ? 363 ASN B CA    1 
ATOM   4895  C C     . ASN B  1 301 ? -18.883 26.951  34.033  1.00 50.12  ? 363 ASN B C     1 
ATOM   4896  O O     . ASN B  1 301 ? -19.855 26.365  34.538  1.00 49.89  ? 363 ASN B O     1 
ATOM   4897  C CB    . ASN B  1 301 ? -18.028 25.755  31.993  1.00 48.13  ? 363 ASN B CB    1 
ATOM   4898  C CG    . ASN B  1 301 ? -18.478 26.924  31.152  1.00 47.99  ? 363 ASN B CG    1 
ATOM   4899  O OD1   . ASN B  1 301 ? -19.661 27.067  30.877  1.00 54.04  ? 363 ASN B OD1   1 
ATOM   4900  N ND2   . ASN B  1 301 ? -17.546 27.756  30.733  1.00 46.10  ? 363 ASN B ND2   1 
ATOM   4901  N N     . ALA B  1 302 ? -18.790 28.276  33.970  1.00 52.53  ? 364 ALA B N     1 
ATOM   4902  C CA    . ALA B  1 302 ? -19.805 29.138  34.572  1.00 54.65  ? 364 ALA B CA    1 
ATOM   4903  C C     . ALA B  1 302 ? -21.207 28.835  34.029  1.00 59.64  ? 364 ALA B C     1 
ATOM   4904  O O     . ALA B  1 302 ? -22.153 28.704  34.806  1.00 61.47  ? 364 ALA B O     1 
ATOM   4905  C CB    . ALA B  1 302 ? -19.447 30.597  34.368  1.00 52.57  ? 364 ALA B CB    1 
ATOM   4906  N N     . LYS B  1 303 ? -21.319 28.671  32.709  1.00 63.81  ? 365 LYS B N     1 
ATOM   4907  C CA    . LYS B  1 303 ? -22.618 28.531  32.024  1.00 62.29  ? 365 LYS B CA    1 
ATOM   4908  C C     . LYS B  1 303 ? -23.180 27.109  31.919  1.00 59.00  ? 365 LYS B C     1 
ATOM   4909  O O     . LYS B  1 303 ? -24.380 26.946  31.857  1.00 57.41  ? 365 LYS B O     1 
ATOM   4910  C CB    . LYS B  1 303 ? -22.541 29.178  30.636  1.00 64.87  ? 365 LYS B CB    1 
ATOM   4911  C CG    . LYS B  1 303 ? -22.161 30.651  30.708  1.00 65.95  ? 365 LYS B CG    1 
ATOM   4912  C CD    . LYS B  1 303 ? -22.365 31.370  29.390  1.00 67.54  ? 365 LYS B CD    1 
ATOM   4913  C CE    . LYS B  1 303 ? -22.166 32.871  29.568  1.00 67.95  ? 365 LYS B CE    1 
ATOM   4914  N NZ    . LYS B  1 303 ? -22.503 33.596  28.313  1.00 70.36  ? 365 LYS B NZ    1 
ATOM   4915  N N     . ASN B  1 304 ? -22.336 26.087  31.872  1.00 61.74  ? 366 ASN B N     1 
ATOM   4916  C CA    . ASN B  1 304 ? -22.816 24.701  32.005  1.00 63.91  ? 366 ASN B CA    1 
ATOM   4917  C C     . ASN B  1 304 ? -21.944 23.894  32.965  1.00 65.93  ? 366 ASN B C     1 
ATOM   4918  O O     . ASN B  1 304 ? -20.794 23.584  32.646  1.00 69.44  ? 366 ASN B O     1 
ATOM   4919  C CB    . ASN B  1 304 ? -22.874 23.995  30.653  1.00 61.19  ? 366 ASN B CB    1 
ATOM   4920  C CG    . ASN B  1 304 ? -23.270 22.531  30.775  1.00 61.07  ? 366 ASN B CG    1 
ATOM   4921  O OD1   . ASN B  1 304 ? -23.763 22.068  31.807  1.00 54.91  ? 366 ASN B OD1   1 
ATOM   4922  N ND2   . ASN B  1 304 ? -23.032 21.789  29.720  1.00 65.36  ? 366 ASN B ND2   1 
ATOM   4923  N N     . VAL B  1 305 ? -22.517 23.529  34.112  1.00 66.09  ? 367 VAL B N     1 
ATOM   4924  C CA    . VAL B  1 305 ? -21.783 22.882  35.217  1.00 69.19  ? 367 VAL B CA    1 
ATOM   4925  C C     . VAL B  1 305 ? -21.233 21.466  34.867  1.00 69.77  ? 367 VAL B C     1 
ATOM   4926  O O     . VAL B  1 305 ? -20.379 20.933  35.586  1.00 75.25  ? 367 VAL B O     1 
ATOM   4927  C CB    . VAL B  1 305 ? -22.660 22.866  36.506  1.00 67.50  ? 367 VAL B CB    1 
ATOM   4928  C CG1   . VAL B  1 305 ? -21.975 22.140  37.669  1.00 66.66  ? 367 VAL B CG1   1 
ATOM   4929  C CG2   . VAL B  1 305 ? -23.039 24.294  36.910  1.00 65.62  ? 367 VAL B CG2   1 
ATOM   4930  N N     . ARG B  1 306 ? -21.690 20.877  33.758  1.00 65.79  ? 368 ARG B N     1 
ATOM   4931  C CA    . ARG B  1 306 ? -21.163 19.582  33.275  1.00 61.87  ? 368 ARG B CA    1 
ATOM   4932  C C     . ARG B  1 306 ? -19.839 19.671  32.489  1.00 56.47  ? 368 ARG B C     1 
ATOM   4933  O O     . ARG B  1 306 ? -18.984 18.792  32.610  1.00 52.87  ? 368 ARG B O     1 
ATOM   4934  C CB    . ARG B  1 306 ? -22.213 18.888  32.415  1.00 63.39  ? 368 ARG B CB    1 
ATOM   4935  C CG    . ARG B  1 306 ? -23.546 18.720  33.129  1.00 62.09  ? 368 ARG B CG    1 
ATOM   4936  C CD    . ARG B  1 306 ? -24.152 17.338  32.952  1.00 59.92  ? 368 ARG B CD    1 
ATOM   4937  N NE    . ARG B  1 306 ? -24.548 16.826  34.262  1.00 58.02  ? 368 ARG B NE    1 
ATOM   4938  C CZ    . ARG B  1 306 ? -25.665 17.145  34.917  1.00 53.78  ? 368 ARG B CZ    1 
ATOM   4939  N NH1   . ARG B  1 306 ? -26.565 17.971  34.390  1.00 51.06  ? 368 ARG B NH1   1 
ATOM   4940  N NH2   . ARG B  1 306 ? -25.884 16.616  36.116  1.00 51.65  ? 368 ARG B NH2   1 
ATOM   4941  N N     . ASP B  1 307 ? -19.681 20.742  31.711  1.00 52.59  ? 369 ASP B N     1 
ATOM   4942  C CA    . ASP B  1 307 ? -18.432 21.042  30.979  1.00 50.82  ? 369 ASP B CA    1 
ATOM   4943  C C     . ASP B  1 307 ? -17.312 21.543  31.875  1.00 45.95  ? 369 ASP B C     1 
ATOM   4944  O O     . ASP B  1 307 ? -17.589 22.105  32.922  1.00 46.12  ? 369 ASP B O     1 
ATOM   4945  C CB    . ASP B  1 307 ? -18.710 22.085  29.914  1.00 50.74  ? 369 ASP B CB    1 
ATOM   4946  C CG    . ASP B  1 307 ? -19.755 21.615  28.939  1.00 53.80  ? 369 ASP B CG    1 
ATOM   4947  O OD1   . ASP B  1 307 ? -20.200 20.446  29.085  1.00 54.80  ? 369 ASP B OD1   1 
ATOM   4948  O OD2   . ASP B  1 307 ? -20.125 22.391  28.036  1.00 55.57  ? 369 ASP B OD2   1 
ATOM   4949  N N     . LEU B  1 308 ? -16.057 21.323  31.474  1.00 42.24  ? 370 LEU B N     1 
ATOM   4950  C CA    . LEU B  1 308 ? -14.889 21.639  32.331  1.00 40.61  ? 370 LEU B CA    1 
ATOM   4951  C C     . LEU B  1 308 ? -13.975 22.640  31.673  1.00 37.30  ? 370 LEU B C     1 
ATOM   4952  O O     . LEU B  1 308 ? -13.604 22.474  30.533  1.00 35.85  ? 370 LEU B O     1 
ATOM   4953  C CB    . LEU B  1 308 ? -14.043 20.396  32.638  1.00 40.55  ? 370 LEU B CB    1 
ATOM   4954  C CG    . LEU B  1 308 ? -14.597 19.252  33.469  1.00 40.52  ? 370 LEU B CG    1 
ATOM   4955  C CD1   . LEU B  1 308 ? -13.633 18.082  33.503  1.00 40.41  ? 370 LEU B CD1   1 
ATOM   4956  C CD2   . LEU B  1 308 ? -14.839 19.765  34.873  1.00 43.80  ? 370 LEU B CD2   1 
ATOM   4957  N N     . ASP B  1 309 ? -13.594 23.668  32.410  1.00 36.83  ? 371 ASP B N     1 
ATOM   4958  C CA    . ASP B  1 309 ? -12.606 24.620  31.938  1.00 36.95  ? 371 ASP B CA    1 
ATOM   4959  C C     . ASP B  1 309 ? -11.280 24.295  32.606  1.00 34.60  ? 371 ASP B C     1 
ATOM   4960  O O     . ASP B  1 309 ? -11.230 24.008  33.803  1.00 31.51  ? 371 ASP B O     1 
ATOM   4961  C CB    . ASP B  1 309 ? -13.016 26.053  32.289  1.00 39.02  ? 371 ASP B CB    1 
ATOM   4962  C CG    . ASP B  1 309 ? -14.272 26.517  31.557  1.00 39.13  ? 371 ASP B CG    1 
ATOM   4963  O OD1   . ASP B  1 309 ? -14.761 25.802  30.660  1.00 38.88  ? 371 ASP B OD1   1 
ATOM   4964  O OD2   . ASP B  1 309 ? -14.761 27.625  31.877  1.00 39.60  ? 371 ASP B OD2   1 
ATOM   4965  N N     . PHE B  1 310 ? -10.217 24.313  31.815  1.00 33.21  ? 372 PHE B N     1 
ATOM   4966  C CA    . PHE B  1 310 ? -8.878  24.105  32.322  1.00 32.07  ? 372 PHE B CA    1 
ATOM   4967  C C     . PHE B  1 310 ? -8.067  25.342  32.028  1.00 30.52  ? 372 PHE B C     1 
ATOM   4968  O O     . PHE B  1 310 ? -8.387  26.105  31.132  1.00 30.04  ? 372 PHE B O     1 
ATOM   4969  C CB    . PHE B  1 310 ? -8.192  22.906  31.639  1.00 31.88  ? 372 PHE B CB    1 
ATOM   4970  C CG    . PHE B  1 310 ? -8.810  21.570  31.957  1.00 30.85  ? 372 PHE B CG    1 
ATOM   4971  C CD1   . PHE B  1 310 ? -9.886  21.098  31.239  1.00 30.69  ? 372 PHE B CD1   1 
ATOM   4972  C CD2   . PHE B  1 310 ? -8.296  20.784  32.952  1.00 31.05  ? 372 PHE B CD2   1 
ATOM   4973  C CE1   . PHE B  1 310 ? -10.440 19.868  31.515  1.00 30.78  ? 372 PHE B CE1   1 
ATOM   4974  C CE2   . PHE B  1 310 ? -8.850  19.552  33.246  1.00 31.25  ? 372 PHE B CE2   1 
ATOM   4975  C CZ    . PHE B  1 310 ? -9.924  19.093  32.526  1.00 31.35  ? 372 PHE B CZ    1 
ATOM   4976  N N     . THR B  1 311 ? -7.000  25.509  32.792  1.00 30.28  ? 373 THR B N     1 
ATOM   4977  C CA    . THR B  1 311 ? -5.911  26.409  32.443  1.00 29.01  ? 373 THR B CA    1 
ATOM   4978  C C     . THR B  1 311 ? -4.627  25.698  32.842  1.00 28.98  ? 373 THR B C     1 
ATOM   4979  O O     . THR B  1 311 ? -4.417  25.397  34.023  1.00 30.33  ? 373 THR B O     1 
ATOM   4980  C CB    . THR B  1 311 ? -6.027  27.770  33.155  1.00 27.49  ? 373 THR B CB    1 
ATOM   4981  O OG1   . THR B  1 311 ? -7.103  28.516  32.581  1.00 26.43  ? 373 THR B OG1   1 
ATOM   4982  C CG2   . THR B  1 311 ? -4.756  28.564  32.996  1.00 27.27  ? 373 THR B CG2   1 
ATOM   4983  N N     . VAL B  1 312 ? -3.795  25.376  31.863  1.00 28.02  ? 374 VAL B N     1 
ATOM   4984  C CA    . VAL B  1 312 ? -2.514  24.767  32.165  1.00 28.35  ? 374 VAL B CA    1 
ATOM   4985  C C     . VAL B  1 312 ? -1.494  25.877  31.985  1.00 28.40  ? 374 VAL B C     1 
ATOM   4986  O O     . VAL B  1 312 ? -1.373  26.419  30.896  1.00 27.92  ? 374 VAL B O     1 
ATOM   4987  C CB    . VAL B  1 312 ? -2.213  23.549  31.244  1.00 27.83  ? 374 VAL B CB    1 
ATOM   4988  C CG1   . VAL B  1 312 ? -0.840  22.955  31.530  1.00 28.30  ? 374 VAL B CG1   1 
ATOM   4989  C CG2   . VAL B  1 312 ? -3.248  22.461  31.435  1.00 27.42  ? 374 VAL B CG2   1 
ATOM   4990  N N     . ASP B  1 313 ? -0.788  26.242  33.053  1.00 28.72  ? 375 ASP B N     1 
ATOM   4991  C CA    . ASP B  1 313 ? 0.395   27.089  32.915  1.00 28.46  ? 375 ASP B CA    1 
ATOM   4992  C C     . ASP B  1 313 ? 1.565   26.137  32.895  1.00 29.38  ? 375 ASP B C     1 
ATOM   4993  O O     . ASP B  1 313 ? 1.626   25.190  33.696  1.00 28.01  ? 375 ASP B O     1 
ATOM   4994  C CB    . ASP B  1 313 ? 0.503   28.096  34.047  1.00 27.70  ? 375 ASP B CB    1 
ATOM   4995  C CG    . ASP B  1 313 ? -0.610  29.150  33.996  1.00 28.46  ? 375 ASP B CG    1 
ATOM   4996  O OD1   . ASP B  1 313 ? -1.389  29.215  33.030  1.00 27.01  ? 375 ASP B OD1   1 
ATOM   4997  O OD2   . ASP B  1 313 ? -0.736  29.920  34.952  1.00 30.93  ? 375 ASP B OD2   1 
ATOM   4998  N N     . LEU B  1 314 ? 2.480   26.363  31.961  1.00 30.59  ? 376 LEU B N     1 
ATOM   4999  C CA    . LEU B  1 314 ? 3.604   25.469  31.792  1.00 31.61  ? 376 LEU B CA    1 
ATOM   5000  C C     . LEU B  1 314 ? 4.908   26.249  31.631  1.00 32.06  ? 376 LEU B C     1 
ATOM   5001  O O     . LEU B  1 314 ? 4.985   27.144  30.814  1.00 33.05  ? 376 LEU B O     1 
ATOM   5002  C CB    . LEU B  1 314 ? 3.355   24.566  30.596  1.00 32.20  ? 376 LEU B CB    1 
ATOM   5003  C CG    . LEU B  1 314 ? 4.439   23.503  30.391  1.00 33.65  ? 376 LEU B CG    1 
ATOM   5004  C CD1   . LEU B  1 314 ? 3.832   22.193  29.905  1.00 34.03  ? 376 LEU B CD1   1 
ATOM   5005  C CD2   . LEU B  1 314 ? 5.530   23.997  29.442  1.00 33.83  ? 376 LEU B CD2   1 
ATOM   5006  N N     . ASP B  1 315 ? 5.918   25.886  32.427  1.00 33.01  ? 377 ASP B N     1 
ATOM   5007  C CA    . ASP B  1 315 ? 7.250   26.499  32.418  1.00 32.59  ? 377 ASP B CA    1 
ATOM   5008  C C     . ASP B  1 315 ? 8.307   25.439  32.269  1.00 32.51  ? 377 ASP B C     1 
ATOM   5009  O O     . ASP B  1 315 ? 8.368   24.526  33.087  1.00 33.29  ? 377 ASP B O     1 
ATOM   5010  C CB    . ASP B  1 315 ? 7.509   27.228  33.734  1.00 32.71  ? 377 ASP B CB    1 
ATOM   5011  C CG    . ASP B  1 315 ? 7.006   28.634  33.702  1.00 33.59  ? 377 ASP B CG    1 
ATOM   5012  O OD1   . ASP B  1 315 ? 5.854   28.868  33.294  1.00 34.77  ? 377 ASP B OD1   1 
ATOM   5013  O OD2   . ASP B  1 315 ? 7.780   29.528  34.048  1.00 35.56  ? 377 ASP B OD2   1 
ATOM   5014  N N     . PHE B  1 316 ? 9.166   25.589  31.262  1.00 33.34  ? 378 PHE B N     1 
ATOM   5015  C CA    . PHE B  1 316 ? 10.288  24.676  31.031  1.00 33.44  ? 378 PHE B CA    1 
ATOM   5016  C C     . PHE B  1 316 ? 11.519  25.491  30.644  1.00 35.40  ? 378 PHE B C     1 
ATOM   5017  O O     . PHE B  1 316 ? 11.437  26.356  29.755  1.00 32.81  ? 378 PHE B O     1 
ATOM   5018  C CB    . PHE B  1 316 ? 9.923   23.680  29.934  1.00 32.31  ? 378 PHE B CB    1 
ATOM   5019  C CG    . PHE B  1 316 ? 11.009  22.693  29.619  1.00 31.19  ? 378 PHE B CG    1 
ATOM   5020  C CD1   . PHE B  1 316 ? 11.283  21.639  30.466  1.00 30.09  ? 378 PHE B CD1   1 
ATOM   5021  C CD2   . PHE B  1 316 ? 11.748  22.814  28.461  1.00 31.45  ? 378 PHE B CD2   1 
ATOM   5022  C CE1   . PHE B  1 316 ? 12.290  20.726  30.168  1.00 29.09  ? 378 PHE B CE1   1 
ATOM   5023  C CE2   . PHE B  1 316 ? 12.756  21.908  28.156  1.00 31.12  ? 378 PHE B CE2   1 
ATOM   5024  C CZ    . PHE B  1 316 ? 13.029  20.865  29.014  1.00 29.46  ? 378 PHE B CZ    1 
ATOM   5025  N N     . LYS B  1 317 ? 12.632  25.253  31.351  1.00 38.98  ? 379 LYS B N     1 
ATOM   5026  C CA    . LYS B  1 317 ? 13.929  25.844  31.005  1.00 42.92  ? 379 LYS B CA    1 
ATOM   5027  C C     . LYS B  1 317 ? 14.957  24.752  30.845  1.00 42.17  ? 379 LYS B C     1 
ATOM   5028  O O     . LYS B  1 317 ? 15.709  24.454  31.757  1.00 45.27  ? 379 LYS B O     1 
ATOM   5029  C CB    . LYS B  1 317 ? 14.398  26.861  32.061  1.00 50.38  ? 379 LYS B CB    1 
ATOM   5030  C CG    . LYS B  1 317 ? 15.817  27.409  31.837  1.00 57.70  ? 379 LYS B CG    1 
ATOM   5031  C CD    . LYS B  1 317 ? 15.870  28.934  31.777  1.00 63.81  ? 379 LYS B CD    1 
ATOM   5032  C CE    . LYS B  1 317 ? 15.492  29.616  33.088  1.00 66.40  ? 379 LYS B CE    1 
ATOM   5033  N NZ    . LYS B  1 317 ? 16.679  29.825  33.958  1.00 66.48  ? 379 LYS B NZ    1 
ATOM   5034  N N     . GLY B  1 318 ? 14.982  24.149  29.674  1.00 42.77  ? 380 GLY B N     1 
ATOM   5035  C CA    . GLY B  1 318 ? 15.947  23.112  29.374  1.00 43.38  ? 380 GLY B CA    1 
ATOM   5036  C C     . GLY B  1 318 ? 17.070  23.696  28.563  1.00 43.00  ? 380 GLY B C     1 
ATOM   5037  O O     . GLY B  1 318 ? 17.058  24.882  28.232  1.00 40.15  ? 380 GLY B O     1 
ATOM   5038  N N     . GLN B  1 319 ? 18.037  22.845  28.238  1.00 43.74  ? 381 GLN B N     1 
ATOM   5039  C CA    . GLN B  1 319 ? 19.225  23.263  27.525  1.00 44.46  ? 381 GLN B CA    1 
ATOM   5040  C C     . GLN B  1 319 ? 18.889  23.529  26.082  1.00 43.86  ? 381 GLN B C     1 
ATOM   5041  O O     . GLN B  1 319 ? 19.572  24.296  25.421  1.00 47.42  ? 381 GLN B O     1 
ATOM   5042  C CB    . GLN B  1 319 ? 20.315  22.194  27.632  1.00 46.55  ? 381 GLN B CB    1 
ATOM   5043  C CG    . GLN B  1 319 ? 21.736  22.692  27.390  1.00 50.03  ? 381 GLN B CG    1 
ATOM   5044  C CD    . GLN B  1 319 ? 22.757  21.579  27.559  1.00 50.78  ? 381 GLN B CD    1 
ATOM   5045  O OE1   . GLN B  1 319 ? 23.316  21.374  28.647  1.00 47.85  ? 381 GLN B OE1   1 
ATOM   5046  N NE2   . GLN B  1 319 ? 22.996  20.843  26.481  1.00 50.60  ? 381 GLN B NE2   1 
ATOM   5047  N N     . LEU B  1 320 ? 17.830  22.907  25.589  1.00 44.27  ? 382 LEU B N     1 
ATOM   5048  C CA    . LEU B  1 320 ? 17.523  22.991  24.176  1.00 43.51  ? 382 LEU B CA    1 
ATOM   5049  C C     . LEU B  1 320 ? 16.303  23.842  23.831  1.00 42.24  ? 382 LEU B C     1 
ATOM   5050  O O     . LEU B  1 320 ? 16.104  24.198  22.674  1.00 40.59  ? 382 LEU B O     1 
ATOM   5051  C CB    . LEU B  1 320 ? 17.373  21.588  23.627  1.00 44.95  ? 382 LEU B CB    1 
ATOM   5052  C CG    . LEU B  1 320 ? 18.611  20.698  23.828  1.00 47.05  ? 382 LEU B CG    1 
ATOM   5053  C CD1   . LEU B  1 320 ? 18.377  19.335  23.179  1.00 47.33  ? 382 LEU B CD1   1 
ATOM   5054  C CD2   . LEU B  1 320 ? 19.904  21.344  23.311  1.00 45.16  ? 382 LEU B CD2   1 
ATOM   5055  N N     . CYS B  1 321 ? 15.484  24.176  24.815  1.00 41.92  ? 383 CYS B N     1 
ATOM   5056  C CA    . CYS B  1 321 ? 14.425  25.154  24.587  1.00 40.99  ? 383 CYS B CA    1 
ATOM   5057  C C     . CYS B  1 321 ? 13.944  25.678  25.909  1.00 39.36  ? 383 CYS B C     1 
ATOM   5058  O O     . CYS B  1 321 ? 14.329  25.153  26.948  1.00 39.14  ? 383 CYS B O     1 
ATOM   5059  C CB    . CYS B  1 321 ? 13.259  24.559  23.781  1.00 41.34  ? 383 CYS B CB    1 
ATOM   5060  S SG    . CYS B  1 321 ? 12.189  23.388  24.658  1.00 40.05  ? 383 CYS B SG    1 
ATOM   5061  N N     . GLU B  1 322 ? 13.120  26.714  25.857  1.00 38.47  ? 384 GLU B N     1 
ATOM   5062  C CA    . GLU B  1 322 ? 12.680  27.412  27.038  1.00 42.27  ? 384 GLU B CA    1 
ATOM   5063  C C     . GLU B  1 322 ? 11.387  28.084  26.706  1.00 41.78  ? 384 GLU B C     1 
ATOM   5064  O O     . GLU B  1 322 ? 11.373  28.978  25.877  1.00 43.33  ? 384 GLU B O     1 
ATOM   5065  C CB    . GLU B  1 322 ? 13.742  28.458  27.423  1.00 48.04  ? 384 GLU B CB    1 
ATOM   5066  C CG    . GLU B  1 322 ? 13.303  29.632  28.300  1.00 53.14  ? 384 GLU B CG    1 
ATOM   5067  C CD    . GLU B  1 322 ? 14.500  30.450  28.814  1.00 58.26  ? 384 GLU B CD    1 
ATOM   5068  O OE1   . GLU B  1 322 ? 15.592  30.398  28.201  1.00 57.85  ? 384 GLU B OE1   1 
ATOM   5069  O OE2   . GLU B  1 322 ? 14.359  31.161  29.838  1.00 62.77  ? 384 GLU B OE2   1 
ATOM   5070  N N     . THR B  1 323 ? 10.291  27.669  27.326  1.00 42.18  ? 385 THR B N     1 
ATOM   5071  C CA    . THR B  1 323 ? 9.041   28.450  27.205  1.00 43.84  ? 385 THR B CA    1 
ATOM   5072  C C     . THR B  1 323 ? 8.348   28.552  28.543  1.00 43.07  ? 385 THR B C     1 
ATOM   5073  O O     . THR B  1 323 ? 8.575   27.738  29.442  1.00 43.64  ? 385 THR B O     1 
ATOM   5074  C CB    . THR B  1 323 ? 8.007   27.909  26.167  1.00 42.91  ? 385 THR B CB    1 
ATOM   5075  O OG1   . THR B  1 323 ? 7.694   26.539  26.447  1.00 41.85  ? 385 THR B OG1   1 
ATOM   5076  C CG2   . THR B  1 323 ? 8.509   28.056  24.722  1.00 42.83  ? 385 THR B CG2   1 
ATOM   5077  N N     . SER B  1 324 ? 7.526   29.583  28.670  1.00 41.55  ? 386 SER B N     1 
ATOM   5078  C CA    . SER B  1 324 ? 6.617   29.682  29.783  1.00 42.11  ? 386 SER B CA    1 
ATOM   5079  C C     . SER B  1 324 ? 5.283   30.146  29.192  1.00 42.62  ? 386 SER B C     1 
ATOM   5080  O O     . SER B  1 324 ? 5.214   31.205  28.577  1.00 40.73  ? 386 SER B O     1 
ATOM   5081  C CB    . SER B  1 324 ? 7.157   30.629  30.845  1.00 41.21  ? 386 SER B CB    1 
ATOM   5082  O OG    . SER B  1 324 ? 6.268   31.693  31.070  1.00 42.01  ? 386 SER B OG    1 
ATOM   5083  N N     . VAL B  1 325 ? 4.242   29.326  29.369  1.00 44.24  ? 387 VAL B N     1 
ATOM   5084  C CA    . VAL B  1 325 ? 2.998   29.443  28.614  1.00 42.70  ? 387 VAL B CA    1 
ATOM   5085  C C     . VAL B  1 325 ? 1.776   29.271  29.514  1.00 42.08  ? 387 VAL B C     1 
ATOM   5086  O O     . VAL B  1 325 ? 1.854   28.632  30.582  1.00 40.30  ? 387 VAL B O     1 
ATOM   5087  C CB    . VAL B  1 325 ? 2.933   28.381  27.504  1.00 44.17  ? 387 VAL B CB    1 
ATOM   5088  C CG1   . VAL B  1 325 ? 1.912   28.768  26.437  1.00 46.21  ? 387 VAL B CG1   1 
ATOM   5089  C CG2   . VAL B  1 325 ? 4.299   28.198  26.848  1.00 47.10  ? 387 VAL B CG2   1 
ATOM   5090  N N     . SER B  1 326 ? 0.668   29.880  29.068  1.00 40.40  ? 388 SER B N     1 
ATOM   5091  C CA    . SER B  1 326 ? -0.647  29.759  29.689  1.00 38.43  ? 388 SER B CA    1 
ATOM   5092  C C     . SER B  1 326 ? -1.697  29.421  28.611  1.00 38.40  ? 388 SER B C     1 
ATOM   5093  O O     . SER B  1 326 ? -2.022  30.260  27.779  1.00 38.10  ? 388 SER B O     1 
ATOM   5094  C CB    . SER B  1 326 ? -0.985  31.058  30.435  1.00 37.35  ? 388 SER B CB    1 
ATOM   5095  O OG    . SER B  1 326 ? -2.163  30.966  31.205  1.00 36.18  ? 388 SER B OG    1 
ATOM   5096  N N     . ASN B  1 327 ? -2.182  28.169  28.638  1.00 39.72  ? 389 ASN B N     1 
ATOM   5097  C CA    . ASN B  1 327 ? -3.124  27.603  27.657  1.00 40.18  ? 389 ASN B CA    1 
ATOM   5098  C C     . ASN B  1 327 ? -4.463  27.265  28.314  1.00 39.88  ? 389 ASN B C     1 
ATOM   5099  O O     . ASN B  1 327 ? -4.493  26.633  29.372  1.00 39.64  ? 389 ASN B O     1 
ATOM   5100  C CB    . ASN B  1 327 ? -2.578  26.289  27.038  1.00 40.49  ? 389 ASN B CB    1 
ATOM   5101  C CG    . ASN B  1 327 ? -1.291  26.476  26.215  1.00 41.55  ? 389 ASN B CG    1 
ATOM   5102  O OD1   . ASN B  1 327 ? -0.960  27.595  25.772  1.00 42.22  ? 389 ASN B OD1   1 
ATOM   5103  N ND2   . ASN B  1 327 ? -0.559  25.360  25.993  1.00 39.06  ? 389 ASN B ND2   1 
ATOM   5104  N N     . ASP B  1 328 ? -5.559  27.659  27.663  1.00 41.12  ? 390 ASP B N     1 
ATOM   5105  C CA    . ASP B  1 328 ? -6.924  27.360  28.127  1.00 40.33  ? 390 ASP B CA    1 
ATOM   5106  C C     . ASP B  1 328 ? -7.479  26.153  27.383  1.00 35.48  ? 390 ASP B C     1 
ATOM   5107  O O     . ASP B  1 328 ? -7.162  25.971  26.241  1.00 36.68  ? 390 ASP B O     1 
ATOM   5108  C CB    . ASP B  1 328 ? -7.820  28.576  27.892  1.00 43.55  ? 390 ASP B CB    1 
ATOM   5109  C CG    . ASP B  1 328 ? -7.446  29.781  28.782  1.00 48.84  ? 390 ASP B CG    1 
ATOM   5110  O OD1   . ASP B  1 328 ? -6.708  29.642  29.801  1.00 49.55  ? 390 ASP B OD1   1 
ATOM   5111  O OD2   . ASP B  1 328 ? -7.931  30.884  28.467  1.00 52.95  ? 390 ASP B OD2   1 
ATOM   5112  N N     . TYR B  1 329 ? -8.251  25.299  28.038  1.00 32.06  ? 391 TYR B N     1 
ATOM   5113  C CA    . TYR B  1 329 ? -8.866  24.144  27.378  1.00 31.20  ? 391 TYR B CA    1 
ATOM   5114  C C     . TYR B  1 329 ? -10.292 24.039  27.886  1.00 33.58  ? 391 TYR B C     1 
ATOM   5115  O O     . TYR B  1 329 ? -10.593 24.560  28.961  1.00 36.93  ? 391 TYR B O     1 
ATOM   5116  C CB    . TYR B  1 329 ? -8.140  22.831  27.708  1.00 30.07  ? 391 TYR B CB    1 
ATOM   5117  C CG    . TYR B  1 329 ? -6.670  22.773  27.345  1.00 29.60  ? 391 TYR B CG    1 
ATOM   5118  C CD1   . TYR B  1 329 ? -5.691  23.318  28.182  1.00 29.02  ? 391 TYR B CD1   1 
ATOM   5119  C CD2   . TYR B  1 329 ? -6.251  22.139  26.166  1.00 29.08  ? 391 TYR B CD2   1 
ATOM   5120  C CE1   . TYR B  1 329 ? -4.348  23.264  27.836  1.00 28.49  ? 391 TYR B CE1   1 
ATOM   5121  C CE2   . TYR B  1 329 ? -4.913  22.076  25.812  1.00 27.88  ? 391 TYR B CE2   1 
ATOM   5122  C CZ    . TYR B  1 329 ? -3.971  22.632  26.646  1.00 27.99  ? 391 TYR B CZ    1 
ATOM   5123  O OH    . TYR B  1 329 ? -2.661  22.557  26.275  1.00 26.69  ? 391 TYR B OH    1 
ATOM   5124  N N     . LYS B  1 330 ? -11.174 23.390  27.128  1.00 34.61  ? 392 LYS B N     1 
ATOM   5125  C CA    . LYS B  1 330 ? -12.575 23.205  27.544  1.00 37.14  ? 392 LYS B CA    1 
ATOM   5126  C C     . LYS B  1 330 ? -13.004 21.842  27.118  1.00 37.16  ? 392 LYS B C     1 
ATOM   5127  O O     . LYS B  1 330 ? -12.735 21.452  25.999  1.00 35.70  ? 392 LYS B O     1 
ATOM   5128  C CB    . LYS B  1 330 ? -13.522 24.249  26.919  1.00 41.78  ? 392 LYS B CB    1 
ATOM   5129  C CG    . LYS B  1 330 ? -13.414 25.660  27.525  1.00 45.64  ? 392 LYS B CG    1 
ATOM   5130  C CD    . LYS B  1 330 ? -13.977 26.744  26.607  1.00 47.88  ? 392 LYS B CD    1 
ATOM   5131  C CE    . LYS B  1 330 ? -15.472 26.599  26.382  1.00 48.30  ? 392 LYS B CE    1 
ATOM   5132  N NZ    . LYS B  1 330 ? -16.206 26.924  27.627  1.00 49.56  ? 392 LYS B NZ    1 
ATOM   5133  N N     . MET B  1 331 ? -13.656 21.106  28.012  1.00 41.14  ? 393 MET B N     1 
ATOM   5134  C CA    . MET B  1 331 ? -14.009 19.729  27.720  1.00 44.05  ? 393 MET B CA    1 
ATOM   5135  C C     . MET B  1 331 ? -15.411 19.618  27.198  1.00 48.29  ? 393 MET B C     1 
ATOM   5136  O O     . MET B  1 331 ? -16.376 19.928  27.894  1.00 45.77  ? 393 MET B O     1 
ATOM   5137  C CB    . MET B  1 331 ? -13.790 18.790  28.911  1.00 44.42  ? 393 MET B CB    1 
ATOM   5138  C CG    . MET B  1 331 ? -12.460 18.035  28.814  1.00 46.74  ? 393 MET B CG    1 
ATOM   5139  S SD    . MET B  1 331 ? -12.350 16.398  29.574  1.00 48.37  ? 393 MET B SD    1 
ATOM   5140  C CE    . MET B  1 331 ? -13.694 15.565  28.724  1.00 48.27  ? 393 MET B CE    1 
ATOM   5141  N N     . ARG B  1 332 ? -15.474 19.210  25.926  1.00 57.32  ? 394 ARG B N     1 
ATOM   5142  C CA    . ARG B  1 332 ? -16.668 18.648  25.291  1.00 58.97  ? 394 ARG B CA    1 
ATOM   5143  C C     . ARG B  1 332 ? -17.869 19.568  25.529  1.00 49.97  ? 394 ARG B C     1 
ATOM   5144  O O     . ARG B  1 332 ? -17.713 20.795  25.573  1.00 39.93  ? 394 ARG B O     1 
ATOM   5145  C CB    . ARG B  1 332 ? -16.899 17.187  25.790  1.00 66.90  ? 394 ARG B CB    1 
ATOM   5146  C CG    . ARG B  1 332 ? -16.014 16.081  25.173  1.00 69.38  ? 394 ARG B CG    1 
ATOM   5147  C CD    . ARG B  1 332 ? -16.736 15.411  24.006  1.00 72.46  ? 394 ARG B CD    1 
ATOM   5148  N NE    . ARG B  1 332 ? -17.177 16.404  23.005  1.00 75.60  ? 394 ARG B NE    1 
ATOM   5149  C CZ    . ARG B  1 332 ? -18.312 16.358  22.292  1.00 76.58  ? 394 ARG B CZ    1 
ATOM   5150  N NH1   . ARG B  1 332 ? -19.189 15.364  22.430  1.00 75.42  ? 394 ARG B NH1   1 
ATOM   5151  N NH2   . ARG B  1 332 ? -18.574 17.326  21.419  1.00 73.03  ? 394 ARG B NH2   1 
ATOM   5152  O OXT   . ARG B  1 332 ? -18.994 19.114  25.677  1.00 46.44  ? 394 ARG B OXT   1 
ATOM   5153  N N     . ASP C  1 16  ? -22.336 -47.716 36.154  1.00 42.84  ? 78  ASP C N     1 
ATOM   5154  C CA    . ASP C  1 16  ? -21.325 -48.496 36.970  1.00 46.18  ? 78  ASP C CA    1 
ATOM   5155  C C     . ASP C  1 16  ? -20.139 -47.614 37.271  1.00 43.03  ? 78  ASP C C     1 
ATOM   5156  O O     . ASP C  1 16  ? -19.824 -47.331 38.406  1.00 44.71  ? 78  ASP C O     1 
ATOM   5157  C CB    . ASP C  1 16  ? -20.861 -49.849 36.315  1.00 50.26  ? 78  ASP C CB    1 
ATOM   5158  C CG    . ASP C  1 16  ? -20.168 -49.690 34.892  1.00 53.42  ? 78  ASP C CG    1 
ATOM   5159  O OD1   . ASP C  1 16  ? -20.557 -48.808 34.080  1.00 50.61  ? 78  ASP C OD1   1 
ATOM   5160  O OD2   . ASP C  1 16  ? -19.236 -50.484 34.587  1.00 48.78  ? 78  ASP C OD2   1 
ATOM   5161  N N     . SER C  1 17  ? -19.493 -47.176 36.217  1.00 40.72  ? 79  SER C N     1 
ATOM   5162  C CA    . SER C  1 17  ? -18.314 -46.363 36.303  1.00 37.26  ? 79  SER C CA    1 
ATOM   5163  C C     . SER C  1 17  ? -18.589 -45.034 35.611  1.00 35.89  ? 79  SER C C     1 
ATOM   5164  O O     . SER C  1 17  ? -17.856 -44.067 35.780  1.00 34.54  ? 79  SER C O     1 
ATOM   5165  C CB    . SER C  1 17  ? -17.228 -47.100 35.571  1.00 35.63  ? 79  SER C CB    1 
ATOM   5166  O OG    . SER C  1 17  ? -17.394 -46.901 34.177  1.00 33.04  ? 79  SER C OG    1 
ATOM   5167  N N     . TYR C  1 18  ? -19.647 -45.008 34.807  1.00 33.39  ? 80  TYR C N     1 
ATOM   5168  C CA    . TYR C  1 18  ? -20.183 -43.766 34.303  1.00 31.48  ? 80  TYR C CA    1 
ATOM   5169  C C     . TYR C  1 18  ? -21.107 -43.116 35.327  1.00 31.06  ? 80  TYR C C     1 
ATOM   5170  O O     . TYR C  1 18  ? -21.729 -42.092 35.035  1.00 28.91  ? 80  TYR C O     1 
ATOM   5171  C CB    . TYR C  1 18  ? -20.940 -43.999 32.986  1.00 31.17  ? 80  TYR C CB    1 
ATOM   5172  C CG    . TYR C  1 18  ? -20.072 -44.056 31.737  1.00 29.46  ? 80  TYR C CG    1 
ATOM   5173  C CD1   . TYR C  1 18  ? -19.608 -42.899 31.151  1.00 27.93  ? 80  TYR C CD1   1 
ATOM   5174  C CD2   . TYR C  1 18  ? -19.728 -45.271 31.144  1.00 29.02  ? 80  TYR C CD2   1 
ATOM   5175  C CE1   . TYR C  1 18  ? -18.839 -42.944 30.017  1.00 27.63  ? 80  TYR C CE1   1 
ATOM   5176  C CE2   . TYR C  1 18  ? -18.937 -45.316 30.009  1.00 28.39  ? 80  TYR C CE2   1 
ATOM   5177  C CZ    . TYR C  1 18  ? -18.505 -44.149 29.456  1.00 27.18  ? 80  TYR C CZ    1 
ATOM   5178  O OH    . TYR C  1 18  ? -17.733 -44.198 28.336  1.00 27.82  ? 80  TYR C OH    1 
ATOM   5179  N N     . ALA C  1 19  ? -21.207 -43.700 36.521  1.00 31.59  ? 81  ALA C N     1 
ATOM   5180  C CA    . ALA C  1 19  ? -21.977 -43.074 37.606  1.00 31.86  ? 81  ALA C CA    1 
ATOM   5181  C C     . ALA C  1 19  ? -21.312 -41.829 38.212  1.00 31.49  ? 81  ALA C C     1 
ATOM   5182  O O     . ALA C  1 19  ? -21.987 -40.953 38.765  1.00 33.65  ? 81  ALA C O     1 
ATOM   5183  C CB    . ALA C  1 19  ? -22.249 -44.090 38.694  1.00 31.74  ? 81  ALA C CB    1 
ATOM   5184  N N     . HIS C  1 20  ? -19.995 -41.742 38.092  1.00 29.58  ? 82  HIS C N     1 
ATOM   5185  C CA    . HIS C  1 20  ? -19.245 -40.746 38.811  1.00 28.39  ? 82  HIS C CA    1 
ATOM   5186  C C     . HIS C  1 20  ? -19.296 -39.390 38.121  1.00 24.94  ? 82  HIS C C     1 
ATOM   5187  O O     . HIS C  1 20  ? -18.953 -39.297 36.950  1.00 25.30  ? 82  HIS C O     1 
ATOM   5188  C CB    . HIS C  1 20  ? -17.803 -41.210 38.927  1.00 30.84  ? 82  HIS C CB    1 
ATOM   5189  C CG    . HIS C  1 20  ? -16.969 -40.333 39.809  1.00 35.45  ? 82  HIS C CG    1 
ATOM   5190  N ND1   . HIS C  1 20  ? -17.337 -40.012 41.102  1.00 35.38  ? 82  HIS C ND1   1 
ATOM   5191  C CD2   . HIS C  1 20  ? -15.796 -39.693 39.582  1.00 38.15  ? 82  HIS C CD2   1 
ATOM   5192  C CE1   . HIS C  1 20  ? -16.432 -39.213 41.632  1.00 35.26  ? 82  HIS C CE1   1 
ATOM   5193  N NE2   . HIS C  1 20  ? -15.482 -39.011 40.737  1.00 38.36  ? 82  HIS C NE2   1 
ATOM   5194  N N     A PHE C  1 21  ? -19.663 -38.334 38.846  0.50 21.45  ? 83  PHE C N     1 
ATOM   5195  C CA    A PHE C  1 21  ? -19.813 -37.013 38.245  0.50 19.24  ? 83  PHE C CA    1 
ATOM   5196  C C     A PHE C  1 21  ? -18.624 -36.617 37.389  0.50 19.61  ? 83  PHE C C     1 
ATOM   5197  O O     A PHE C  1 21  ? -18.742 -35.868 36.430  0.50 19.24  ? 83  PHE C O     1 
ATOM   5198  C CB    A PHE C  1 21  ? -20.003 -35.984 39.325  0.50 17.68  ? 83  PHE C CB    1 
ATOM   5199  C CG    A PHE C  1 21  ? -18.806 -35.784 40.169  0.50 16.66  ? 83  PHE C CG    1 
ATOM   5200  C CD1   A PHE C  1 21  ? -17.760 -35.016 39.711  0.50 16.34  ? 83  PHE C CD1   1 
ATOM   5201  C CD2   A PHE C  1 21  ? -18.730 -36.326 41.427  0.50 16.11  ? 83  PHE C CD2   1 
ATOM   5202  C CE1   A PHE C  1 21  ? -16.646 -34.796 40.488  0.50 15.85  ? 83  PHE C CE1   1 
ATOM   5203  C CE2   A PHE C  1 21  ? -17.617 -36.112 42.217  0.50 15.80  ? 83  PHE C CE2   1 
ATOM   5204  C CZ    A PHE C  1 21  ? -16.574 -35.347 41.745  0.50 15.67  ? 83  PHE C CZ    1 
ATOM   5205  N N     . GLY C  1 22  ? -17.474 -37.166 37.723  1.00 20.57  ? 84  GLY C N     1 
ATOM   5206  C CA    . GLY C  1 22  ? -16.217 -36.750 37.137  1.00 21.08  ? 84  GLY C CA    1 
ATOM   5207  C C     . GLY C  1 22  ? -15.906 -37.197 35.721  1.00 21.38  ? 84  GLY C C     1 
ATOM   5208  O O     . GLY C  1 22  ? -15.335 -36.427 34.931  1.00 22.04  ? 84  GLY C O     1 
ATOM   5209  N N     . ILE C  1 23  ? -16.233 -38.423 35.353  1.00 20.92  ? 85  ILE C N     1 
ATOM   5210  C CA    . ILE C  1 23  ? -15.993 -38.780 33.953  1.00 21.06  ? 85  ILE C CA    1 
ATOM   5211  C C     . ILE C  1 23  ? -16.807 -37.796 33.032  1.00 21.18  ? 85  ILE C C     1 
ATOM   5212  O O     . ILE C  1 23  ? -16.343 -37.348 31.976  1.00 20.74  ? 85  ILE C O     1 
ATOM   5213  C CB    . ILE C  1 23  ? -16.244 -40.294 33.709  1.00 20.79  ? 85  ILE C CB    1 
ATOM   5214  C CG1   . ILE C  1 23  ? -15.456 -40.840 32.503  1.00 21.43  ? 85  ILE C CG1   1 
ATOM   5215  C CG2   . ILE C  1 23  ? -17.705 -40.582 33.540  1.00 21.24  ? 85  ILE C CG2   1 
ATOM   5216  C CD1   . ILE C  1 23  ? -15.541 -40.075 31.176  1.00 21.61  ? 85  ILE C CD1   1 
ATOM   5217  N N     . HIS C  1 24  ? -17.995 -37.413 33.477  1.00 21.20  ? 86  HIS C N     1 
ATOM   5218  C CA    . HIS C  1 24  ? -18.845 -36.545 32.700  1.00 20.79  ? 86  HIS C CA    1 
ATOM   5219  C C     . HIS C  1 24  ? -18.335 -35.145 32.687  1.00 20.51  ? 86  HIS C C     1 
ATOM   5220  O O     . HIS C  1 24  ? -18.512 -34.450 31.687  1.00 20.66  ? 86  HIS C O     1 
ATOM   5221  C CB    . HIS C  1 24  ? -20.263 -36.577 33.257  1.00 21.33  ? 86  HIS C CB    1 
ATOM   5222  C CG    . HIS C  1 24  ? -20.979 -37.862 32.969  1.00 20.92  ? 86  HIS C CG    1 
ATOM   5223  N ND1   . HIS C  1 24  ? -20.881 -38.976 33.773  1.00 20.17  ? 86  HIS C ND1   1 
ATOM   5224  C CD2   . HIS C  1 24  ? -21.763 -38.221 31.928  1.00 21.09  ? 86  HIS C CD2   1 
ATOM   5225  C CE1   . HIS C  1 24  ? -21.592 -39.957 33.254  1.00 19.97  ? 86  HIS C CE1   1 
ATOM   5226  N NE2   . HIS C  1 24  ? -22.137 -39.525 32.134  1.00 20.71  ? 86  HIS C NE2   1 
ATOM   5227  N N     . GLU C  1 25  ? -17.716 -34.729 33.791  1.00 20.63  ? 87  GLU C N     1 
ATOM   5228  C CA    . GLU C  1 25  ? -17.024 -33.431 33.852  1.00 21.44  ? 87  GLU C CA    1 
ATOM   5229  C C     . GLU C  1 25  ? -16.006 -33.303 32.721  1.00 21.63  ? 87  GLU C C     1 
ATOM   5230  O O     . GLU C  1 25  ? -15.973 -32.284 32.034  1.00 20.96  ? 87  GLU C O     1 
ATOM   5231  C CB    . GLU C  1 25  ? -16.337 -33.253 35.208  1.00 22.33  ? 87  GLU C CB    1 
ATOM   5232  C CG    . GLU C  1 25  ? -15.681 -31.900 35.443  1.00 22.95  ? 87  GLU C CG    1 
ATOM   5233  C CD    . GLU C  1 25  ? -15.187 -31.735 36.869  1.00 23.86  ? 87  GLU C CD    1 
ATOM   5234  O OE1   . GLU C  1 25  ? -15.588 -32.527 37.761  1.00 24.21  ? 87  GLU C OE1   1 
ATOM   5235  O OE2   . GLU C  1 25  ? -14.394 -30.791 37.100  1.00 25.04  ? 87  GLU C OE2   1 
ATOM   5236  N N     . GLU C  1 26  ? -15.206 -34.350 32.505  1.00 22.19  ? 88  GLU C N     1 
ATOM   5237  C CA    . GLU C  1 26  ? -14.232 -34.343 31.414  1.00 22.89  ? 88  GLU C CA    1 
ATOM   5238  C C     . GLU C  1 26  ? -14.872 -34.219 30.055  1.00 22.08  ? 88  GLU C C     1 
ATOM   5239  O O     . GLU C  1 26  ? -14.427 -33.447 29.236  1.00 20.60  ? 88  GLU C O     1 
ATOM   5240  C CB    . GLU C  1 26  ? -13.370 -35.597 31.411  1.00 24.23  ? 88  GLU C CB    1 
ATOM   5241  C CG    . GLU C  1 26  ? -12.107 -35.415 30.579  1.00 25.07  ? 88  GLU C CG    1 
ATOM   5242  C CD    . GLU C  1 26  ? -11.315 -36.687 30.423  1.00 25.81  ? 88  GLU C CD    1 
ATOM   5243  O OE1   . GLU C  1 26  ? -10.352 -36.680 29.631  1.00 27.13  ? 88  GLU C OE1   1 
ATOM   5244  O OE2   . GLU C  1 26  ? -11.665 -37.695 31.071  1.00 25.61  ? 88  GLU C OE2   1 
ATOM   5245  N N     . MET C  1 27  ? -15.904 -35.007 29.817  1.00 23.87  ? 89  MET C N     1 
ATOM   5246  C CA    . MET C  1 27  ? -16.588 -34.981 28.535  1.00 25.42  ? 89  MET C CA    1 
ATOM   5247  C C     . MET C  1 27  ? -17.194 -33.633 28.267  1.00 23.97  ? 89  MET C C     1 
ATOM   5248  O O     . MET C  1 27  ? -17.157 -33.134 27.126  1.00 22.33  ? 89  MET C O     1 
ATOM   5249  C CB    . MET C  1 27  ? -17.700 -36.002 28.502  1.00 28.19  ? 89  MET C CB    1 
ATOM   5250  C CG    . MET C  1 27  ? -17.200 -37.417 28.376  1.00 31.83  ? 89  MET C CG    1 
ATOM   5251  S SD    . MET C  1 27  ? -18.534 -38.648 28.446  1.00 38.29  ? 89  MET C SD    1 
ATOM   5252  C CE    . MET C  1 27  ? -17.685 -39.893 27.461  1.00 38.86  ? 89  MET C CE    1 
ATOM   5253  N N     . LEU C  1 28  ? -17.773 -33.059 29.316  1.00 22.99  ? 90  LEU C N     1 
ATOM   5254  C CA    . LEU C  1 28  ? -18.443 -31.775 29.197  1.00 23.52  ? 90  LEU C CA    1 
ATOM   5255  C C     . LEU C  1 28  ? -17.459 -30.614 28.990  1.00 22.64  ? 90  LEU C C     1 
ATOM   5256  O O     . LEU C  1 28  ? -17.723 -29.707 28.198  1.00 22.66  ? 90  LEU C O     1 
ATOM   5257  C CB    . LEU C  1 28  ? -19.332 -31.531 30.414  1.00 24.38  ? 90  LEU C CB    1 
ATOM   5258  C CG    . LEU C  1 28  ? -20.586 -32.423 30.486  1.00 24.61  ? 90  LEU C CG    1 
ATOM   5259  C CD1   . LEU C  1 28  ? -21.094 -32.536 31.922  1.00 24.70  ? 90  LEU C CD1   1 
ATOM   5260  C CD2   . LEU C  1 28  ? -21.685 -31.896 29.564  1.00 24.55  ? 90  LEU C CD2   1 
ATOM   5261  N N     . LYS C  1 29  ? -16.323 -30.654 29.674  1.00 21.37  ? 91  LYS C N     1 
ATOM   5262  C CA    . LYS C  1 29  ? -15.341 -29.585 29.548  1.00 21.10  ? 91  LYS C CA    1 
ATOM   5263  C C     . LYS C  1 29  ? -14.606 -29.580 28.221  1.00 21.23  ? 91  LYS C C     1 
ATOM   5264  O O     . LYS C  1 29  ? -13.953 -28.597 27.893  1.00 21.39  ? 91  LYS C O     1 
ATOM   5265  C CB    . LYS C  1 29  ? -14.355 -29.628 30.706  1.00 21.21  ? 91  LYS C CB    1 
ATOM   5266  C CG    . LYS C  1 29  ? -14.964 -29.136 32.002  1.00 21.59  ? 91  LYS C CG    1 
ATOM   5267  C CD    . LYS C  1 29  ? -13.958 -29.164 33.122  1.00 22.47  ? 91  LYS C CD    1 
ATOM   5268  C CE    . LYS C  1 29  ? -14.485 -28.403 34.323  1.00 24.21  ? 91  LYS C CE    1 
ATOM   5269  N NZ    . LYS C  1 29  ? -13.721 -28.725 35.558  1.00 25.36  ? 91  LYS C NZ    1 
ATOM   5270  N N     . ASP C  1 30  ? -14.713 -30.683 27.481  1.00 21.61  ? 92  ASP C N     1 
ATOM   5271  C CA    . ASP C  1 30  ? -14.264 -30.778 26.105  1.00 21.29  ? 92  ASP C CA    1 
ATOM   5272  C C     . ASP C  1 30  ? -15.187 -29.904 25.264  1.00 21.56  ? 92  ASP C C     1 
ATOM   5273  O O     . ASP C  1 30  ? -16.275 -30.318 24.868  1.00 20.55  ? 92  ASP C O     1 
ATOM   5274  C CB    . ASP C  1 30  ? -14.313 -32.252 25.664  1.00 21.51  ? 92  ASP C CB    1 
ATOM   5275  C CG    . ASP C  1 30  ? -13.732 -32.489 24.289  1.00 22.20  ? 92  ASP C CG    1 
ATOM   5276  O OD1   . ASP C  1 30  ? -13.580 -31.518 23.491  1.00 25.78  ? 92  ASP C OD1   1 
ATOM   5277  O OD2   . ASP C  1 30  ? -13.437 -33.663 24.003  1.00 20.22  ? 92  ASP C OD2   1 
ATOM   5278  N N     . GLU C  1 31  ? -14.754 -28.672 25.016  1.00 23.10  ? 93  GLU C N     1 
ATOM   5279  C CA    . GLU C  1 31  ? -15.599 -27.701 24.304  1.00 24.28  ? 93  GLU C CA    1 
ATOM   5280  C C     . GLU C  1 31  ? -15.764 -28.103 22.848  1.00 23.86  ? 93  GLU C C     1 
ATOM   5281  O O     . GLU C  1 31  ? -16.853 -27.927 22.293  1.00 22.73  ? 93  GLU C O     1 
ATOM   5282  C CB    . GLU C  1 31  ? -15.070 -26.252 24.441  1.00 25.24  ? 93  GLU C CB    1 
ATOM   5283  C CG    . GLU C  1 31  ? -15.155 -25.707 25.876  1.00 26.06  ? 93  GLU C CG    1 
ATOM   5284  C CD    . GLU C  1 31  ? -14.737 -24.248 26.046  1.00 26.80  ? 93  GLU C CD    1 
ATOM   5285  O OE1   . GLU C  1 31  ? -14.257 -23.904 27.140  1.00 26.36  ? 93  GLU C OE1   1 
ATOM   5286  O OE2   . GLU C  1 31  ? -14.895 -23.437 25.109  1.00 29.01  ? 93  GLU C OE2   1 
ATOM   5287  N N     . VAL C  1 32  ? -14.712 -28.676 22.251  1.00 23.22  ? 94  VAL C N     1 
ATOM   5288  C CA    . VAL C  1 32  ? -14.799 -29.113 20.860  1.00 23.06  ? 94  VAL C CA    1 
ATOM   5289  C C     . VAL C  1 32  ? -15.921 -30.119 20.729  1.00 22.54  ? 94  VAL C C     1 
ATOM   5290  O O     . VAL C  1 32  ? -16.790 -29.990 19.862  1.00 23.35  ? 94  VAL C O     1 
ATOM   5291  C CB    . VAL C  1 32  ? -13.511 -29.755 20.331  1.00 23.28  ? 94  VAL C CB    1 
ATOM   5292  C CG1   . VAL C  1 32  ? -13.735 -30.325 18.942  1.00 22.57  ? 94  VAL C CG1   1 
ATOM   5293  C CG2   . VAL C  1 32  ? -12.387 -28.731 20.277  1.00 24.26  ? 94  VAL C CG2   1 
ATOM   5294  N N     . ARG C  1 33  ? -15.916 -31.118 21.591  1.00 21.30  ? 95  ARG C N     1 
ATOM   5295  C CA    . ARG C  1 33  ? -16.923 -32.157 21.497  1.00 21.27  ? 95  ARG C CA    1 
ATOM   5296  C C     . ARG C  1 33  ? -18.315 -31.600 21.737  1.00 20.43  ? 95  ARG C C     1 
ATOM   5297  O O     . ARG C  1 33  ? -19.204 -31.707 20.899  1.00 19.73  ? 95  ARG C O     1 
ATOM   5298  C CB    . ARG C  1 33  ? -16.617 -33.226 22.515  1.00 21.97  ? 95  ARG C CB    1 
ATOM   5299  C CG    . ARG C  1 33  ? -17.549 -34.418 22.505  1.00 23.05  ? 95  ARG C CG    1 
ATOM   5300  C CD    . ARG C  1 33  ? -17.431 -35.147 23.834  1.00 24.15  ? 95  ARG C CD    1 
ATOM   5301  N NE    . ARG C  1 33  ? -18.271 -34.445 24.818  1.00 26.31  ? 95  ARG C NE    1 
ATOM   5302  C CZ    . ARG C  1 33  ? -19.424 -34.909 25.313  1.00 27.02  ? 95  ARG C CZ    1 
ATOM   5303  N NH1   . ARG C  1 33  ? -19.843 -36.121 24.984  1.00 26.70  ? 95  ARG C NH1   1 
ATOM   5304  N NH2   . ARG C  1 33  ? -20.148 -34.163 26.155  1.00 26.59  ? 95  ARG C NH2   1 
ATOM   5305  N N     . THR C  1 34  ? -18.485 -30.980 22.886  1.00 20.14  ? 96  THR C N     1 
ATOM   5306  C CA    . THR C  1 34  ? -19.791 -30.551 23.318  1.00 20.36  ? 96  THR C CA    1 
ATOM   5307  C C     . THR C  1 34  ? -20.305 -29.384 22.481  1.00 19.86  ? 96  THR C C     1 
ATOM   5308  O O     . THR C  1 34  ? -21.438 -29.403 22.041  1.00 20.69  ? 96  THR C O     1 
ATOM   5309  C CB    . THR C  1 34  ? -19.777 -30.175 24.816  1.00 21.24  ? 96  THR C CB    1 
ATOM   5310  O OG1   . THR C  1 34  ? -19.139 -31.221 25.584  1.00 21.03  ? 96  THR C OG1   1 
ATOM   5311  C CG2   . THR C  1 34  ? -21.188 -29.975 25.322  1.00 21.45  ? 96  THR C CG2   1 
ATOM   5312  N N     . LEU C  1 35  ? -19.500 -28.369 22.231  1.00 19.56  ? 97  LEU C N     1 
ATOM   5313  C CA    . LEU C  1 35  ? -20.008 -27.270 21.427  1.00 19.63  ? 97  LEU C CA    1 
ATOM   5314  C C     . LEU C  1 35  ? -20.365 -27.729 20.009  1.00 20.53  ? 97  LEU C C     1 
ATOM   5315  O O     . LEU C  1 35  ? -21.322 -27.197 19.414  1.00 20.90  ? 97  LEU C O     1 
ATOM   5316  C CB    . LEU C  1 35  ? -19.025 -26.114 21.350  1.00 19.22  ? 97  LEU C CB    1 
ATOM   5317  C CG    . LEU C  1 35  ? -18.977 -25.192 22.552  1.00 18.84  ? 97  LEU C CG    1 
ATOM   5318  C CD1   . LEU C  1 35  ? -17.942 -24.124 22.278  1.00 19.09  ? 97  LEU C CD1   1 
ATOM   5319  C CD2   . LEU C  1 35  ? -20.345 -24.572 22.793  1.00 18.61  ? 97  LEU C CD2   1 
ATOM   5320  N N     . THR C  1 36  ? -19.624 -28.695 19.456  1.00 20.48  ? 98  THR C N     1 
ATOM   5321  C CA    . THR C  1 36  ? -20.009 -29.222 18.156  1.00 21.13  ? 98  THR C CA    1 
ATOM   5322  C C     . THR C  1 36  ? -21.403 -29.851 18.240  1.00 22.91  ? 98  THR C C     1 
ATOM   5323  O O     . THR C  1 36  ? -22.272 -29.556 17.396  1.00 26.07  ? 98  THR C O     1 
ATOM   5324  C CB    . THR C  1 36  ? -19.025 -30.236 17.563  1.00 20.30  ? 98  THR C CB    1 
ATOM   5325  O OG1   . THR C  1 36  ? -17.749 -29.623 17.400  1.00 19.91  ? 98  THR C OG1   1 
ATOM   5326  C CG2   . THR C  1 36  ? -19.533 -30.709 16.175  1.00 20.19  ? 98  THR C CG2   1 
ATOM   5327  N N     . TYR C  1 37  ? -21.633 -30.707 19.232  1.00 22.43  ? 99  TYR C N     1 
ATOM   5328  C CA    . TYR C  1 37  ? -22.955 -31.298 19.370  1.00 22.26  ? 99  TYR C CA    1 
ATOM   5329  C C     . TYR C  1 37  ? -24.022 -30.247 19.535  1.00 22.13  ? 99  TYR C C     1 
ATOM   5330  O O     . TYR C  1 37  ? -25.101 -30.380 18.976  1.00 22.66  ? 99  TYR C O     1 
ATOM   5331  C CB    . TYR C  1 37  ? -23.018 -32.261 20.532  1.00 22.59  ? 99  TYR C CB    1 
ATOM   5332  C CG    . TYR C  1 37  ? -22.649 -33.676 20.173  1.00 23.10  ? 99  TYR C CG    1 
ATOM   5333  C CD1   . TYR C  1 37  ? -21.328 -34.087 20.190  1.00 23.38  ? 99  TYR C CD1   1 
ATOM   5334  C CD2   . TYR C  1 37  ? -23.632 -34.614 19.836  1.00 23.07  ? 99  TYR C CD2   1 
ATOM   5335  C CE1   . TYR C  1 37  ? -20.990 -35.390 19.887  1.00 24.21  ? 99  TYR C CE1   1 
ATOM   5336  C CE2   . TYR C  1 37  ? -23.304 -35.918 19.522  1.00 22.70  ? 99  TYR C CE2   1 
ATOM   5337  C CZ    . TYR C  1 37  ? -21.983 -36.295 19.546  1.00 23.45  ? 99  TYR C CZ    1 
ATOM   5338  O OH    . TYR C  1 37  ? -21.608 -37.571 19.249  1.00 23.25  ? 99  TYR C OH    1 
ATOM   5339  N N     . ARG C  1 38  ? -23.737 -29.199 20.289  1.00 22.43  ? 100 ARG C N     1 
ATOM   5340  C CA    . ARG C  1 38  ? -24.753 -28.198 20.516  1.00 23.59  ? 100 ARG C CA    1 
ATOM   5341  C C     . ARG C  1 38  ? -25.041 -27.425 19.245  1.00 22.90  ? 100 ARG C C     1 
ATOM   5342  O O     . ARG C  1 38  ? -26.190 -27.193 18.907  1.00 22.68  ? 100 ARG C O     1 
ATOM   5343  C CB    . ARG C  1 38  ? -24.363 -27.238 21.631  1.00 25.54  ? 100 ARG C CB    1 
ATOM   5344  C CG    . ARG C  1 38  ? -25.564 -26.445 22.151  1.00 27.61  ? 100 ARG C CG    1 
ATOM   5345  C CD    . ARG C  1 38  ? -25.153 -25.249 22.981  1.00 28.85  ? 100 ARG C CD    1 
ATOM   5346  N NE    . ARG C  1 38  ? -24.337 -24.326 22.190  1.00 29.43  ? 100 ARG C NE    1 
ATOM   5347  C CZ    . ARG C  1 38  ? -23.723 -23.264 22.692  1.00 29.84  ? 100 ARG C CZ    1 
ATOM   5348  N NH1   . ARG C  1 38  ? -23.853 -22.975 23.989  1.00 29.47  ? 100 ARG C NH1   1 
ATOM   5349  N NH2   . ARG C  1 38  ? -22.984 -22.491 21.894  1.00 29.98  ? 100 ARG C NH2   1 
ATOM   5350  N N     . ASN C  1 39  ? -24.002 -27.026 18.537  1.00 23.13  ? 101 ASN C N     1 
ATOM   5351  C CA    . ASN C  1 39  ? -24.203 -26.292 17.303  1.00 24.28  ? 101 ASN C CA    1 
ATOM   5352  C C     . ASN C  1 39  ? -24.962 -27.097 16.266  1.00 24.25  ? 101 ASN C C     1 
ATOM   5353  O O     . ASN C  1 39  ? -25.807 -26.557 15.554  1.00 25.76  ? 101 ASN C O     1 
ATOM   5354  C CB    . ASN C  1 39  ? -22.872 -25.855 16.714  1.00 24.63  ? 101 ASN C CB    1 
ATOM   5355  C CG    . ASN C  1 39  ? -22.139 -24.838 17.574  1.00 25.01  ? 101 ASN C CG    1 
ATOM   5356  O OD1   . ASN C  1 39  ? -21.017 -24.515 17.254  1.00 27.04  ? 101 ASN C OD1   1 
ATOM   5357  N ND2   . ASN C  1 39  ? -22.763 -24.310 18.637  1.00 25.22  ? 101 ASN C ND2   1 
ATOM   5358  N N     . SER C  1 40  ? -24.682 -28.389 16.193  1.00 23.52  ? 102 SER C N     1 
ATOM   5359  C CA    . SER C  1 40  ? -25.349 -29.229 15.222  1.00 23.42  ? 102 SER C CA    1 
ATOM   5360  C C     . SER C  1 40  ? -26.855 -29.108 15.386  1.00 23.31  ? 102 SER C C     1 
ATOM   5361  O O     . SER C  1 40  ? -27.576 -29.197 14.404  1.00 25.15  ? 102 SER C O     1 
ATOM   5362  C CB    . SER C  1 40  ? -24.890 -30.697 15.321  1.00 23.36  ? 102 SER C CB    1 
ATOM   5363  O OG    . SER C  1 40  ? -25.447 -31.374 16.433  1.00 22.64  ? 102 SER C OG    1 
ATOM   5364  N N     . MET C  1 41  ? -27.332 -28.879 16.607  1.00 22.27  ? 103 MET C N     1 
ATOM   5365  C CA    . MET C  1 41  ? -28.770 -28.799 16.858  1.00 22.42  ? 103 MET C CA    1 
ATOM   5366  C C     . MET C  1 41  ? -29.271 -27.358 16.781  1.00 23.06  ? 103 MET C C     1 
ATOM   5367  O O     . MET C  1 41  ? -30.170 -27.065 16.008  1.00 22.84  ? 103 MET C O     1 
ATOM   5368  C CB    . MET C  1 41  ? -29.114 -29.460 18.211  1.00 21.76  ? 103 MET C CB    1 
ATOM   5369  C CG    . MET C  1 41  ? -28.503 -30.849 18.383  1.00 20.59  ? 103 MET C CG    1 
ATOM   5370  S SD    . MET C  1 41  ? -29.105 -31.738 19.819  1.00 19.95  ? 103 MET C SD    1 
ATOM   5371  C CE    . MET C  1 41  ? -27.733 -32.817 20.201  1.00 19.81  ? 103 MET C CE    1 
ATOM   5372  N N     . TYR C  1 42  ? -28.660 -26.469 17.558  1.00 24.42  ? 104 TYR C N     1 
ATOM   5373  C CA    . TYR C  1 42  ? -29.074 -25.066 17.652  1.00 25.65  ? 104 TYR C CA    1 
ATOM   5374  C C     . TYR C  1 42  ? -28.987 -24.317 16.316  1.00 26.94  ? 104 TYR C C     1 
ATOM   5375  O O     . TYR C  1 42  ? -29.780 -23.401 16.062  1.00 28.60  ? 104 TYR C O     1 
ATOM   5376  C CB    . TYR C  1 42  ? -28.209 -24.312 18.676  1.00 25.93  ? 104 TYR C CB    1 
ATOM   5377  C CG    . TYR C  1 42  ? -28.474 -24.586 20.137  1.00 25.65  ? 104 TYR C CG    1 
ATOM   5378  C CD1   . TYR C  1 42  ? -29.080 -25.771 20.565  1.00 25.98  ? 104 TYR C CD1   1 
ATOM   5379  C CD2   . TYR C  1 42  ? -28.079 -23.664 21.107  1.00 25.70  ? 104 TYR C CD2   1 
ATOM   5380  C CE1   . TYR C  1 42  ? -29.310 -26.005 21.915  1.00 26.32  ? 104 TYR C CE1   1 
ATOM   5381  C CE2   . TYR C  1 42  ? -28.296 -23.898 22.457  1.00 25.90  ? 104 TYR C CE2   1 
ATOM   5382  C CZ    . TYR C  1 42  ? -28.910 -25.073 22.857  1.00 26.06  ? 104 TYR C CZ    1 
ATOM   5383  O OH    . TYR C  1 42  ? -29.135 -25.332 24.190  1.00 26.48  ? 104 TYR C OH    1 
ATOM   5384  N N     . HIS C  1 43  ? -28.003 -24.674 15.488  1.00 27.69  ? 105 HIS C N     1 
ATOM   5385  C CA    . HIS C  1 43  ? -27.886 -24.114 14.134  1.00 28.12  ? 105 HIS C CA    1 
ATOM   5386  C C     . HIS C  1 43  ? -28.764 -24.800 13.105  1.00 27.70  ? 105 HIS C C     1 
ATOM   5387  O O     . HIS C  1 43  ? -28.778 -24.389 11.944  1.00 25.96  ? 105 HIS C O     1 
ATOM   5388  C CB    . HIS C  1 43  ? -26.463 -24.196 13.626  1.00 29.07  ? 105 HIS C CB    1 
ATOM   5389  C CG    . HIS C  1 43  ? -25.483 -23.428 14.452  1.00 31.62  ? 105 HIS C CG    1 
ATOM   5390  N ND1   . HIS C  1 43  ? -24.173 -23.252 14.066  1.00 33.06  ? 105 HIS C ND1   1 
ATOM   5391  C CD2   . HIS C  1 43  ? -25.617 -22.777 15.635  1.00 32.29  ? 105 HIS C CD2   1 
ATOM   5392  C CE1   . HIS C  1 43  ? -23.537 -22.539 14.981  1.00 32.88  ? 105 HIS C CE1   1 
ATOM   5393  N NE2   . HIS C  1 43  ? -24.389 -22.239 15.945  1.00 31.76  ? 105 HIS C NE2   1 
ATOM   5394  N N     . ASN C  1 44  ? -29.487 -25.844 13.512  1.00 28.31  ? 106 ASN C N     1 
ATOM   5395  C CA    . ASN C  1 44  ? -30.404 -26.531 12.612  1.00 28.01  ? 106 ASN C CA    1 
ATOM   5396  C C     . ASN C  1 44  ? -31.728 -26.856 13.279  1.00 27.74  ? 106 ASN C C     1 
ATOM   5397  O O     . ASN C  1 44  ? -32.188 -27.983 13.243  1.00 26.62  ? 106 ASN C O     1 
ATOM   5398  C CB    . ASN C  1 44  ? -29.730 -27.774 12.049  1.00 27.99  ? 106 ASN C CB    1 
ATOM   5399  C CG    . ASN C  1 44  ? -28.385 -27.462 11.418  1.00 28.07  ? 106 ASN C CG    1 
ATOM   5400  O OD1   . ASN C  1 44  ? -27.353 -27.928 11.878  1.00 29.47  ? 106 ASN C OD1   1 
ATOM   5401  N ND2   . ASN C  1 44  ? -28.385 -26.605 10.418  1.00 27.70  ? 106 ASN C ND2   1 
ATOM   5402  N N     . LYS C  1 45  ? -32.350 -25.839 13.871  1.00 28.86  ? 107 LYS C N     1 
ATOM   5403  C CA    . LYS C  1 45  ? -33.642 -26.012 14.516  1.00 29.94  ? 107 LYS C CA    1 
ATOM   5404  C C     . LYS C  1 45  ? -34.700 -26.543 13.569  1.00 28.53  ? 107 LYS C C     1 
ATOM   5405  O O     . LYS C  1 45  ? -35.639 -27.194 14.013  1.00 32.22  ? 107 LYS C O     1 
ATOM   5406  C CB    . LYS C  1 45  ? -34.125 -24.702 15.131  1.00 32.43  ? 107 LYS C CB    1 
ATOM   5407  C CG    . LYS C  1 45  ? -33.538 -24.424 16.495  1.00 35.17  ? 107 LYS C CG    1 
ATOM   5408  C CD    . LYS C  1 45  ? -33.361 -22.934 16.754  1.00 38.72  ? 107 LYS C CD    1 
ATOM   5409  C CE    . LYS C  1 45  ? -32.686 -22.722 18.107  1.00 42.16  ? 107 LYS C CE    1 
ATOM   5410  N NZ    . LYS C  1 45  ? -31.571 -21.747 18.009  1.00 45.68  ? 107 LYS C NZ    1 
ATOM   5411  N N     . HIS C  1 46  ? -34.563 -26.272 12.279  1.00 26.09  ? 108 HIS C N     1 
ATOM   5412  C CA    . HIS C  1 46  ? -35.520 -26.780 11.282  1.00 25.31  ? 108 HIS C CA    1 
ATOM   5413  C C     . HIS C  1 46  ? -35.615 -28.290 11.204  1.00 24.89  ? 108 HIS C C     1 
ATOM   5414  O O     . HIS C  1 46  ? -36.637 -28.826 10.818  1.00 23.55  ? 108 HIS C O     1 
ATOM   5415  C CB    . HIS C  1 46  ? -35.220 -26.227 9.887   1.00 24.78  ? 108 HIS C CB    1 
ATOM   5416  C CG    . HIS C  1 46  ? -33.916 -26.679 9.308   1.00 24.48  ? 108 HIS C CG    1 
ATOM   5417  N ND1   . HIS C  1 46  ? -32.716 -26.060 9.595   1.00 24.57  ? 108 HIS C ND1   1 
ATOM   5418  C CD2   . HIS C  1 46  ? -33.627 -27.657 8.421   1.00 24.69  ? 108 HIS C CD2   1 
ATOM   5419  C CE1   . HIS C  1 46  ? -31.743 -26.643 8.919   1.00 23.87  ? 108 HIS C CE1   1 
ATOM   5420  N NE2   . HIS C  1 46  ? -32.267 -27.615 8.197   1.00 24.44  ? 108 HIS C NE2   1 
ATOM   5421  N N     . VAL C  1 47  ? -34.540 -28.962 11.577  1.00 25.75  ? 109 VAL C N     1 
ATOM   5422  C CA    . VAL C  1 47  ? -34.495 -30.405 11.580  1.00 25.80  ? 109 VAL C CA    1 
ATOM   5423  C C     . VAL C  1 47  ? -35.222 -30.960 12.787  1.00 26.63  ? 109 VAL C C     1 
ATOM   5424  O O     . VAL C  1 47  ? -35.785 -32.039 12.709  1.00 26.79  ? 109 VAL C O     1 
ATOM   5425  C CB    . VAL C  1 47  ? -33.033 -30.893 11.612  1.00 25.94  ? 109 VAL C CB    1 
ATOM   5426  C CG1   . VAL C  1 47  ? -32.948 -32.404 11.699  1.00 26.15  ? 109 VAL C CG1   1 
ATOM   5427  C CG2   . VAL C  1 47  ? -32.318 -30.419 10.378  1.00 26.04  ? 109 VAL C CG2   1 
ATOM   5428  N N     . PHE C  1 48  ? -35.184 -30.232 13.903  1.00 28.53  ? 110 PHE C N     1 
ATOM   5429  C CA    . PHE C  1 48  ? -35.691 -30.729 15.197  1.00 30.18  ? 110 PHE C CA    1 
ATOM   5430  C C     . PHE C  1 48  ? -37.125 -30.298 15.503  1.00 31.78  ? 110 PHE C C     1 
ATOM   5431  O O     . PHE C  1 48  ? -37.827 -30.982 16.259  1.00 32.12  ? 110 PHE C O     1 
ATOM   5432  C CB    . PHE C  1 48  ? -34.748 -30.312 16.356  1.00 29.58  ? 110 PHE C CB    1 
ATOM   5433  C CG    . PHE C  1 48  ? -33.447 -31.081 16.376  1.00 29.52  ? 110 PHE C CG    1 
ATOM   5434  C CD1   . PHE C  1 48  ? -32.350 -30.630 15.669  1.00 30.07  ? 110 PHE C CD1   1 
ATOM   5435  C CD2   . PHE C  1 48  ? -33.336 -32.275 17.063  1.00 29.06  ? 110 PHE C CD2   1 
ATOM   5436  C CE1   . PHE C  1 48  ? -31.172 -31.353 15.648  1.00 28.66  ? 110 PHE C CE1   1 
ATOM   5437  C CE2   . PHE C  1 48  ? -32.157 -32.995 17.056  1.00 28.10  ? 110 PHE C CE2   1 
ATOM   5438  C CZ    . PHE C  1 48  ? -31.077 -32.535 16.345  1.00 27.74  ? 110 PHE C CZ    1 
ATOM   5439  N N     . LYS C  1 49  ? -37.574 -29.188 14.916  1.00 33.42  ? 111 LYS C N     1 
ATOM   5440  C CA    . LYS C  1 49  ? -38.825 -28.591 15.363  1.00 35.60  ? 111 LYS C CA    1 
ATOM   5441  C C     . LYS C  1 49  ? -39.985 -29.582 15.292  1.00 32.12  ? 111 LYS C C     1 
ATOM   5442  O O     . LYS C  1 49  ? -40.220 -30.188 14.262  1.00 30.64  ? 111 LYS C O     1 
ATOM   5443  C CB    . LYS C  1 49  ? -39.176 -27.302 14.617  1.00 39.05  ? 111 LYS C CB    1 
ATOM   5444  C CG    . LYS C  1 49  ? -40.017 -26.403 15.503  1.00 43.89  ? 111 LYS C CG    1 
ATOM   5445  C CD    . LYS C  1 49  ? -40.995 -25.566 14.734  1.00 48.70  ? 111 LYS C CD    1 
ATOM   5446  C CE    . LYS C  1 49  ? -42.004 -24.993 15.709  1.00 54.85  ? 111 LYS C CE    1 
ATOM   5447  N NZ    . LYS C  1 49  ? -42.939 -24.084 14.984  1.00 60.53  ? 111 LYS C NZ    1 
ATOM   5448  N N     . ASP C  1 50  ? -40.665 -29.748 16.421  1.00 29.49  ? 112 ASP C N     1 
ATOM   5449  C CA    . ASP C  1 50  ? -41.793 -30.650 16.571  1.00 28.63  ? 112 ASP C CA    1 
ATOM   5450  C C     . ASP C  1 50  ? -41.472 -32.108 16.257  1.00 28.67  ? 112 ASP C C     1 
ATOM   5451  O O     . ASP C  1 50  ? -42.377 -32.862 15.856  1.00 27.96  ? 112 ASP C O     1 
ATOM   5452  C CB    . ASP C  1 50  ? -42.982 -30.152 15.747  1.00 27.88  ? 112 ASP C CB    1 
ATOM   5453  C CG    . ASP C  1 50  ? -43.396 -28.755 16.139  1.00 27.13  ? 112 ASP C CG    1 
ATOM   5454  O OD1   . ASP C  1 50  ? -43.628 -28.487 17.327  1.00 26.80  ? 112 ASP C OD1   1 
ATOM   5455  O OD2   . ASP C  1 50  ? -43.496 -27.908 15.257  1.00 27.72  ? 112 ASP C OD2   1 
ATOM   5456  N N     . LYS C  1 51  ? -40.215 -32.519 16.472  1.00 28.53  ? 113 LYS C N     1 
ATOM   5457  C CA    . LYS C  1 51  ? -39.817 -33.918 16.238  1.00 29.49  ? 113 LYS C CA    1 
ATOM   5458  C C     . LYS C  1 51  ? -39.494 -34.688 17.524  1.00 27.92  ? 113 LYS C C     1 
ATOM   5459  O O     . LYS C  1 51  ? -39.328 -34.111 18.601  1.00 28.72  ? 113 LYS C O     1 
ATOM   5460  C CB    . LYS C  1 51  ? -38.678 -33.993 15.218  1.00 31.81  ? 113 LYS C CB    1 
ATOM   5461  C CG    . LYS C  1 51  ? -39.070 -33.329 13.900  1.00 35.54  ? 113 LYS C CG    1 
ATOM   5462  C CD    . LYS C  1 51  ? -38.141 -33.656 12.736  1.00 39.38  ? 113 LYS C CD    1 
ATOM   5463  C CE    . LYS C  1 51  ? -38.758 -34.593 11.709  1.00 41.03  ? 113 LYS C CE    1 
ATOM   5464  N NZ    . LYS C  1 51  ? -39.719 -33.862 10.839  1.00 41.47  ? 113 LYS C NZ    1 
ATOM   5465  N N     . VAL C  1 52  ? -39.483 -36.008 17.414  1.00 25.82  ? 114 VAL C N     1 
ATOM   5466  C CA    . VAL C  1 52  ? -39.311 -36.878 18.572  1.00 24.96  ? 114 VAL C CA    1 
ATOM   5467  C C     . VAL C  1 52  ? -37.879 -37.361 18.527  1.00 23.95  ? 114 VAL C C     1 
ATOM   5468  O O     . VAL C  1 52  ? -37.465 -37.910 17.508  1.00 24.63  ? 114 VAL C O     1 
ATOM   5469  C CB    . VAL C  1 52  ? -40.282 -38.086 18.510  1.00 24.92  ? 114 VAL C CB    1 
ATOM   5470  C CG1   . VAL C  1 52  ? -40.008 -39.087 19.622  1.00 24.74  ? 114 VAL C CG1   1 
ATOM   5471  C CG2   . VAL C  1 52  ? -41.722 -37.624 18.581  1.00 24.81  ? 114 VAL C CG2   1 
ATOM   5472  N N     . VAL C  1 53  ? -37.138 -37.185 19.617  1.00 22.58  ? 115 VAL C N     1 
ATOM   5473  C CA    . VAL C  1 53  ? -35.703 -37.452 19.628  1.00 22.64  ? 115 VAL C CA    1 
ATOM   5474  C C     . VAL C  1 53  ? -35.301 -38.472 20.688  1.00 22.98  ? 115 VAL C C     1 
ATOM   5475  O O     . VAL C  1 53  ? -35.752 -38.399 21.839  1.00 23.84  ? 115 VAL C O     1 
ATOM   5476  C CB    . VAL C  1 53  ? -34.902 -36.160 19.882  1.00 23.14  ? 115 VAL C CB    1 
ATOM   5477  C CG1   . VAL C  1 53  ? -33.403 -36.423 19.783  1.00 23.53  ? 115 VAL C CG1   1 
ATOM   5478  C CG2   . VAL C  1 53  ? -35.300 -35.072 18.885  1.00 23.16  ? 115 VAL C CG2   1 
ATOM   5479  N N     . LEU C  1 54  ? -34.431 -39.408 20.295  1.00 22.21  ? 116 LEU C N     1 
ATOM   5480  C CA    . LEU C  1 54  ? -33.891 -40.412 21.194  1.00 21.03  ? 116 LEU C CA    1 
ATOM   5481  C C     . LEU C  1 54  ? -32.443 -40.081 21.446  1.00 21.75  ? 116 LEU C C     1 
ATOM   5482  O O     . LEU C  1 54  ? -31.666 -40.043 20.519  1.00 22.40  ? 116 LEU C O     1 
ATOM   5483  C CB    . LEU C  1 54  ? -33.976 -41.784 20.559  1.00 20.35  ? 116 LEU C CB    1 
ATOM   5484  C CG    . LEU C  1 54  ? -33.350 -42.916 21.359  1.00 20.24  ? 116 LEU C CG    1 
ATOM   5485  C CD1   . LEU C  1 54  ? -34.094 -43.096 22.667  1.00 20.42  ? 116 LEU C CD1   1 
ATOM   5486  C CD2   . LEU C  1 54  ? -33.384 -44.211 20.570  1.00 20.25  ? 116 LEU C CD2   1 
ATOM   5487  N N     . ASP C  1 55  ? -32.086 -39.820 22.698  1.00 23.22  ? 117 ASP C N     1 
ATOM   5488  C CA    . ASP C  1 55  ? -30.688 -39.672 23.126  1.00 23.26  ? 117 ASP C CA    1 
ATOM   5489  C C     . ASP C  1 55  ? -30.200 -41.052 23.607  1.00 22.35  ? 117 ASP C C     1 
ATOM   5490  O O     . ASP C  1 55  ? -30.605 -41.543 24.664  1.00 21.56  ? 117 ASP C O     1 
ATOM   5491  C CB    . ASP C  1 55  ? -30.606 -38.593 24.218  1.00 24.07  ? 117 ASP C CB    1 
ATOM   5492  C CG    . ASP C  1 55  ? -29.174 -38.217 24.609  1.00 26.09  ? 117 ASP C CG    1 
ATOM   5493  O OD1   . ASP C  1 55  ? -28.184 -38.877 24.160  1.00 28.09  ? 117 ASP C OD1   1 
ATOM   5494  O OD2   . ASP C  1 55  ? -29.047 -37.246 25.410  1.00 27.62  ? 117 ASP C OD2   1 
ATOM   5495  N N     . VAL C  1 56  ? -29.353 -41.690 22.812  1.00 21.71  ? 118 VAL C N     1 
ATOM   5496  C CA    . VAL C  1 56  ? -28.763 -42.967 23.219  1.00 21.80  ? 118 VAL C CA    1 
ATOM   5497  C C     . VAL C  1 56  ? -27.567 -42.732 24.158  1.00 22.36  ? 118 VAL C C     1 
ATOM   5498  O O     . VAL C  1 56  ? -26.549 -42.102 23.771  1.00 23.11  ? 118 VAL C O     1 
ATOM   5499  C CB    . VAL C  1 56  ? -28.354 -43.779 21.999  1.00 20.89  ? 118 VAL C CB    1 
ATOM   5500  C CG1   . VAL C  1 56  ? -27.729 -45.106 22.405  1.00 20.39  ? 118 VAL C CG1   1 
ATOM   5501  C CG2   . VAL C  1 56  ? -29.580 -43.986 21.134  1.00 21.07  ? 118 VAL C CG2   1 
ATOM   5502  N N     . GLY C  1 57  ? -27.715 -43.208 25.398  1.00 22.44  ? 119 GLY C N     1 
ATOM   5503  C CA    . GLY C  1 57  ? -26.759 -42.915 26.476  1.00 22.95  ? 119 GLY C CA    1 
ATOM   5504  C C     . GLY C  1 57  ? -26.889 -41.486 26.998  1.00 23.11  ? 119 GLY C C     1 
ATOM   5505  O O     . GLY C  1 57  ? -25.939 -40.690 26.914  1.00 22.59  ? 119 GLY C O     1 
ATOM   5506  N N     . SER C  1 58  ? -28.065 -41.178 27.546  1.00 23.15  ? 120 SER C N     1 
ATOM   5507  C CA    . SER C  1 58  ? -28.442 -39.811 27.902  1.00 23.48  ? 120 SER C CA    1 
ATOM   5508  C C     . SER C  1 58  ? -27.374 -39.141 28.792  1.00 23.84  ? 120 SER C C     1 
ATOM   5509  O O     . SER C  1 58  ? -27.092 -37.946 28.630  1.00 25.86  ? 120 SER C O     1 
ATOM   5510  C CB    . SER C  1 58  ? -29.862 -39.765 28.543  1.00 23.70  ? 120 SER C CB    1 
ATOM   5511  O OG    . SER C  1 58  ? -29.889 -40.044 29.959  1.00 24.96  ? 120 SER C OG    1 
ATOM   5512  N N     . GLY C  1 59  ? -26.775 -39.910 29.703  1.00 23.38  ? 121 GLY C N     1 
ATOM   5513  C CA    . GLY C  1 59  ? -25.769 -39.395 30.631  1.00 23.40  ? 121 GLY C CA    1 
ATOM   5514  C C     . GLY C  1 59  ? -26.326 -38.310 31.532  1.00 23.72  ? 121 GLY C C     1 
ATOM   5515  O O     . GLY C  1 59  ? -27.411 -38.447 32.101  1.00 25.19  ? 121 GLY C O     1 
ATOM   5516  N N     . THR C  1 60  ? -25.566 -37.231 31.657  1.00 23.61  ? 122 THR C N     1 
ATOM   5517  C CA    . THR C  1 60  ? -25.996 -35.998 32.320  1.00 23.05  ? 122 THR C CA    1 
ATOM   5518  C C     . THR C  1 60  ? -27.295 -35.406 31.783  1.00 22.35  ? 122 THR C C     1 
ATOM   5519  O O     . THR C  1 60  ? -27.970 -34.645 32.457  1.00 21.30  ? 122 THR C O     1 
ATOM   5520  C CB    . THR C  1 60  ? -24.901 -34.935 32.153  1.00 23.12  ? 122 THR C CB    1 
ATOM   5521  O OG1   . THR C  1 60  ? -24.089 -35.273 31.004  1.00 23.07  ? 122 THR C OG1   1 
ATOM   5522  C CG2   . THR C  1 60  ? -24.030 -34.880 33.407  1.00 22.78  ? 122 THR C CG2   1 
ATOM   5523  N N     . GLY C  1 61  ? -27.635 -35.761 30.561  1.00 22.83  ? 123 GLY C N     1 
ATOM   5524  C CA    . GLY C  1 61  ? -28.848 -35.285 29.946  1.00 24.62  ? 123 GLY C CA    1 
ATOM   5525  C C     . GLY C  1 61  ? -28.576 -34.140 29.012  1.00 26.37  ? 123 GLY C C     1 
ATOM   5526  O O     . GLY C  1 61  ? -29.495 -33.613 28.406  1.00 28.73  ? 123 GLY C O     1 
ATOM   5527  N N     . ILE C  1 62  ? -27.311 -33.744 28.920  1.00 27.79  ? 124 ILE C N     1 
ATOM   5528  C CA    . ILE C  1 62  ? -26.905 -32.535 28.198  1.00 27.55  ? 124 ILE C CA    1 
ATOM   5529  C C     . ILE C  1 62  ? -27.361 -32.566 26.741  1.00 27.46  ? 124 ILE C C     1 
ATOM   5530  O O     . ILE C  1 62  ? -27.835 -31.546 26.219  1.00 26.18  ? 124 ILE C O     1 
ATOM   5531  C CB    . ILE C  1 62  ? -25.362 -32.286 28.312  1.00 27.60  ? 124 ILE C CB    1 
ATOM   5532  C CG1   . ILE C  1 62  ? -24.973 -30.931 27.718  1.00 26.93  ? 124 ILE C CG1   1 
ATOM   5533  C CG2   . ILE C  1 62  ? -24.544 -33.411 27.671  1.00 27.57  ? 124 ILE C CG2   1 
ATOM   5534  C CD1   . ILE C  1 62  ? -25.507 -29.755 28.500  1.00 27.10  ? 124 ILE C CD1   1 
ATOM   5535  N N     . LEU C  1 63  ? -27.247 -33.727 26.088  1.00 26.97  ? 125 LEU C N     1 
ATOM   5536  C CA    . LEU C  1 63  ? -27.576 -33.770 24.663  1.00 26.31  ? 125 LEU C CA    1 
ATOM   5537  C C     . LEU C  1 63  ? -29.070 -33.662 24.465  1.00 26.02  ? 125 LEU C C     1 
ATOM   5538  O O     . LEU C  1 63  ? -29.522 -32.942 23.580  1.00 26.74  ? 125 LEU C O     1 
ATOM   5539  C CB    . LEU C  1 63  ? -27.038 -35.021 24.014  1.00 26.05  ? 125 LEU C CB    1 
ATOM   5540  C CG    . LEU C  1 63  ? -25.526 -35.064 23.961  1.00 26.75  ? 125 LEU C CG    1 
ATOM   5541  C CD1   . LEU C  1 63  ? -25.098 -36.259 23.130  1.00 27.30  ? 125 LEU C CD1   1 
ATOM   5542  C CD2   . LEU C  1 63  ? -24.954 -33.774 23.383  1.00 26.99  ? 125 LEU C CD2   1 
ATOM   5543  N N     . SER C  1 64  ? -29.829 -34.361 25.309  1.00 25.00  ? 126 SER C N     1 
ATOM   5544  C CA    . SER C  1 64  ? -31.274 -34.221 25.341  1.00 24.02  ? 126 SER C CA    1 
ATOM   5545  C C     . SER C  1 64  ? -31.725 -32.773 25.571  1.00 23.31  ? 126 SER C C     1 
ATOM   5546  O O     . SER C  1 64  ? -32.722 -32.324 24.986  1.00 22.81  ? 126 SER C O     1 
ATOM   5547  C CB    . SER C  1 64  ? -31.850 -35.123 26.411  1.00 23.51  ? 126 SER C CB    1 
ATOM   5548  O OG    . SER C  1 64  ? -31.478 -36.432 26.097  1.00 24.49  ? 126 SER C OG    1 
ATOM   5549  N N     . MET C  1 65  ? -31.007 -32.045 26.417  1.00 22.43  ? 127 MET C N     1 
ATOM   5550  C CA    . MET C  1 65  ? -31.386 -30.656 26.703  1.00 22.96  ? 127 MET C CA    1 
ATOM   5551  C C     . MET C  1 65  ? -31.085 -29.741 25.519  1.00 22.49  ? 127 MET C C     1 
ATOM   5552  O O     . MET C  1 65  ? -31.809 -28.782 25.263  1.00 22.69  ? 127 MET C O     1 
ATOM   5553  C CB    . MET C  1 65  ? -30.754 -30.148 28.013  1.00 22.69  ? 127 MET C CB    1 
ATOM   5554  C CG    . MET C  1 65  ? -31.336 -30.816 29.258  1.00 22.59  ? 127 MET C CG    1 
ATOM   5555  S SD    . MET C  1 65  ? -30.839 -30.082 30.817  1.00 22.52  ? 127 MET C SD    1 
ATOM   5556  C CE    . MET C  1 65  ? -29.051 -30.239 30.764  1.00 22.94  ? 127 MET C CE    1 
ATOM   5557  N N     . PHE C  1 66  ? -30.041 -30.056 24.778  1.00 21.70  ? 128 PHE C N     1 
ATOM   5558  C CA    . PHE C  1 66  ? -29.790 -29.344 23.545  1.00 21.62  ? 128 PHE C CA    1 
ATOM   5559  C C     . PHE C  1 66  ? -30.909 -29.581 22.554  1.00 21.06  ? 128 PHE C C     1 
ATOM   5560  O O     . PHE C  1 66  ? -31.435 -28.656 21.948  1.00 21.40  ? 128 PHE C O     1 
ATOM   5561  C CB    . PHE C  1 66  ? -28.475 -29.804 22.913  1.00 22.47  ? 128 PHE C CB    1 
ATOM   5562  C CG    . PHE C  1 66  ? -27.221 -29.375 23.670  1.00 22.44  ? 128 PHE C CG    1 
ATOM   5563  C CD1   . PHE C  1 66  ? -27.206 -28.267 24.532  1.00 22.04  ? 128 PHE C CD1   1 
ATOM   5564  C CD2   . PHE C  1 66  ? -26.037 -30.066 23.460  1.00 22.07  ? 128 PHE C CD2   1 
ATOM   5565  C CE1   . PHE C  1 66  ? -26.045 -27.899 25.175  1.00 22.02  ? 128 PHE C CE1   1 
ATOM   5566  C CE2   . PHE C  1 66  ? -24.881 -29.700 24.099  1.00 21.87  ? 128 PHE C CE2   1 
ATOM   5567  C CZ    . PHE C  1 66  ? -24.883 -28.618 24.960  1.00 22.12  ? 128 PHE C CZ    1 
ATOM   5568  N N     . ALA C  1 67  ? -31.284 -30.833 22.391  1.00 21.08  ? 129 ALA C N     1 
ATOM   5569  C CA    . ALA C  1 67  ? -32.381 -31.161 21.485  1.00 21.57  ? 129 ALA C CA    1 
ATOM   5570  C C     . ALA C  1 67  ? -33.655 -30.399 21.823  1.00 20.55  ? 129 ALA C C     1 
ATOM   5571  O O     . ALA C  1 67  ? -34.293 -29.836 20.940  1.00 18.45  ? 129 ALA C O     1 
ATOM   5572  C CB    . ALA C  1 67  ? -32.650 -32.664 21.499  1.00 22.45  ? 129 ALA C CB    1 
ATOM   5573  N N     . ALA C  1 68  ? -34.015 -30.414 23.109  1.00 21.11  ? 130 ALA C N     1 
ATOM   5574  C CA    . ALA C  1 68  ? -35.217 -29.740 23.598  1.00 21.14  ? 130 ALA C CA    1 
ATOM   5575  C C     . ALA C  1 68  ? -35.173 -28.253 23.283  1.00 21.08  ? 130 ALA C C     1 
ATOM   5576  O O     . ALA C  1 68  ? -36.160 -27.668 22.832  1.00 21.14  ? 130 ALA C O     1 
ATOM   5577  C CB    . ALA C  1 68  ? -35.391 -29.973 25.087  1.00 21.30  ? 130 ALA C CB    1 
ATOM   5578  N N     . LYS C  1 69  ? -34.017 -27.653 23.484  1.00 21.44  ? 131 LYS C N     1 
ATOM   5579  C CA    . LYS C  1 69  ? -33.862 -26.255 23.181  1.00 22.84  ? 131 LYS C CA    1 
ATOM   5580  C C     . LYS C  1 69  ? -33.878 -25.983 21.699  1.00 23.50  ? 131 LYS C C     1 
ATOM   5581  O O     . LYS C  1 69  ? -34.196 -24.878 21.284  1.00 23.59  ? 131 LYS C O     1 
ATOM   5582  C CB    . LYS C  1 69  ? -32.591 -25.698 23.813  1.00 24.18  ? 131 LYS C CB    1 
ATOM   5583  C CG    . LYS C  1 69  ? -32.754 -25.401 25.302  1.00 25.40  ? 131 LYS C CG    1 
ATOM   5584  C CD    . LYS C  1 69  ? -33.761 -24.294 25.558  1.00 26.47  ? 131 LYS C CD    1 
ATOM   5585  C CE    . LYS C  1 69  ? -33.558 -23.701 26.934  1.00 29.06  ? 131 LYS C CE    1 
ATOM   5586  N NZ    . LYS C  1 69  ? -34.803 -23.042 27.418  1.00 31.08  ? 131 LYS C NZ    1 
ATOM   5587  N N     . ALA C  1 70  ? -33.564 -26.983 20.888  1.00 24.88  ? 132 ALA C N     1 
ATOM   5588  C CA    . ALA C  1 70  ? -33.695 -26.829 19.433  1.00 25.78  ? 132 ALA C CA    1 
ATOM   5589  C C     . ALA C  1 70  ? -35.127 -27.023 18.929  1.00 25.57  ? 132 ALA C C     1 
ATOM   5590  O O     . ALA C  1 70  ? -35.368 -26.955 17.716  1.00 25.06  ? 132 ALA C O     1 
ATOM   5591  C CB    . ALA C  1 70  ? -32.754 -27.783 18.721  1.00 27.12  ? 132 ALA C CB    1 
ATOM   5592  N N     . GLY C  1 71  ? -36.052 -27.294 19.854  1.00 26.20  ? 133 GLY C N     1 
ATOM   5593  C CA    . GLY C  1 71  ? -37.491 -27.313 19.576  1.00 27.70  ? 133 GLY C CA    1 
ATOM   5594  C C     . GLY C  1 71  ? -38.142 -28.672 19.369  1.00 27.44  ? 133 GLY C C     1 
ATOM   5595  O O     . GLY C  1 71  ? -39.204 -28.775 18.762  1.00 26.78  ? 133 GLY C O     1 
ATOM   5596  N N     . ALA C  1 72  ? -37.523 -29.715 19.881  1.00 27.89  ? 134 ALA C N     1 
ATOM   5597  C CA    . ALA C  1 72  ? -38.096 -31.038 19.773  1.00 29.46  ? 134 ALA C CA    1 
ATOM   5598  C C     . ALA C  1 72  ? -39.412 -31.062 20.523  1.00 30.92  ? 134 ALA C C     1 
ATOM   5599  O O     . ALA C  1 72  ? -39.559 -30.375 21.531  1.00 29.75  ? 134 ALA C O     1 
ATOM   5600  C CB    . ALA C  1 72  ? -37.140 -32.077 20.348  1.00 29.81  ? 134 ALA C CB    1 
ATOM   5601  N N     . LYS C  1 73  ? -40.357 -31.848 20.014  1.00 33.56  ? 135 LYS C N     1 
ATOM   5602  C CA    . LYS C  1 73  ? -41.660 -32.005 20.632  1.00 36.10  ? 135 LYS C CA    1 
ATOM   5603  C C     . LYS C  1 73  ? -41.499 -32.853 21.866  1.00 35.01  ? 135 LYS C C     1 
ATOM   5604  O O     . LYS C  1 73  ? -42.064 -32.551 22.898  1.00 34.96  ? 135 LYS C O     1 
ATOM   5605  C CB    . LYS C  1 73  ? -42.630 -32.697 19.675  1.00 40.08  ? 135 LYS C CB    1 
ATOM   5606  C CG    . LYS C  1 73  ? -44.102 -32.654 20.084  1.00 43.52  ? 135 LYS C CG    1 
ATOM   5607  C CD    . LYS C  1 73  ? -44.765 -34.044 20.028  1.00 47.79  ? 135 LYS C CD    1 
ATOM   5608  C CE    . LYS C  1 73  ? -44.675 -34.783 18.680  1.00 47.91  ? 135 LYS C CE    1 
ATOM   5609  N NZ    . LYS C  1 73  ? -45.500 -34.151 17.620  1.00 48.19  ? 135 LYS C NZ    1 
ATOM   5610  N N     . LYS C  1 74  ? -40.752 -33.939 21.745  1.00 35.10  ? 136 LYS C N     1 
ATOM   5611  C CA    . LYS C  1 74  ? -40.486 -34.819 22.884  1.00 36.25  ? 136 LYS C CA    1 
ATOM   5612  C C     . LYS C  1 74  ? -39.068 -35.316 22.728  1.00 33.53  ? 136 LYS C C     1 
ATOM   5613  O O     . LYS C  1 74  ? -38.579 -35.405 21.599  1.00 35.03  ? 136 LYS C O     1 
ATOM   5614  C CB    . LYS C  1 74  ? -41.464 -36.005 22.892  1.00 39.37  ? 136 LYS C CB    1 
ATOM   5615  C CG    . LYS C  1 74  ? -42.897 -35.654 23.321  1.00 42.36  ? 136 LYS C CG    1 
ATOM   5616  C CD    . LYS C  1 74  ? -43.228 -36.098 24.729  1.00 47.20  ? 136 LYS C CD    1 
ATOM   5617  C CE    . LYS C  1 74  ? -42.268 -35.571 25.805  1.00 54.03  ? 136 LYS C CE    1 
ATOM   5618  N NZ    . LYS C  1 74  ? -42.769 -35.503 27.223  1.00 52.23  ? 136 LYS C NZ    1 
ATOM   5619  N N     . VAL C  1 75  ? -38.406 -35.633 23.836  1.00 29.70  ? 137 VAL C N     1 
ATOM   5620  C CA    . VAL C  1 75  ? -37.059 -36.203 23.791  1.00 28.38  ? 137 VAL C CA    1 
ATOM   5621  C C     . VAL C  1 75  ? -37.029 -37.357 24.767  1.00 27.15  ? 137 VAL C C     1 
ATOM   5622  O O     . VAL C  1 75  ? -37.466 -37.216 25.902  1.00 27.81  ? 137 VAL C O     1 
ATOM   5623  C CB    . VAL C  1 75  ? -35.957 -35.174 24.196  1.00 28.82  ? 137 VAL C CB    1 
ATOM   5624  C CG1   . VAL C  1 75  ? -34.573 -35.809 24.144  1.00 29.31  ? 137 VAL C CG1   1 
ATOM   5625  C CG2   . VAL C  1 75  ? -35.985 -33.931 23.319  1.00 28.01  ? 137 VAL C CG2   1 
ATOM   5626  N N     . PHE C  1 76  ? -36.512 -38.497 24.346  1.00 25.93  ? 138 PHE C N     1 
ATOM   5627  C CA    . PHE C  1 76  ? -36.377 -39.620 25.252  1.00 26.29  ? 138 PHE C CA    1 
ATOM   5628  C C     . PHE C  1 76  ? -34.914 -39.935 25.416  1.00 26.55  ? 138 PHE C C     1 
ATOM   5629  O O     . PHE C  1 76  ? -34.211 -40.051 24.431  1.00 28.40  ? 138 PHE C O     1 
ATOM   5630  C CB    . PHE C  1 76  ? -37.090 -40.846 24.689  1.00 26.73  ? 138 PHE C CB    1 
ATOM   5631  C CG    . PHE C  1 76  ? -38.508 -40.588 24.269  1.00 25.91  ? 138 PHE C CG    1 
ATOM   5632  C CD1   . PHE C  1 76  ? -39.308 -39.734 24.996  1.00 26.41  ? 138 PHE C CD1   1 
ATOM   5633  C CD2   . PHE C  1 76  ? -39.042 -41.212 23.156  1.00 25.77  ? 138 PHE C CD2   1 
ATOM   5634  C CE1   . PHE C  1 76  ? -40.615 -39.487 24.617  1.00 26.34  ? 138 PHE C CE1   1 
ATOM   5635  C CE2   . PHE C  1 76  ? -40.352 -40.970 22.766  1.00 26.01  ? 138 PHE C CE2   1 
ATOM   5636  C CZ    . PHE C  1 76  ? -41.144 -40.110 23.505  1.00 25.73  ? 138 PHE C CZ    1 
ATOM   5637  N N     . GLY C  1 77  ? -34.451 -40.066 26.650  1.00 25.88  ? 139 GLY C N     1 
ATOM   5638  C CA    . GLY C  1 77  ? -33.079 -40.487 26.923  1.00 25.50  ? 139 GLY C CA    1 
ATOM   5639  C C     . GLY C  1 77  ? -33.069 -41.882 27.520  1.00 24.64  ? 139 GLY C C     1 
ATOM   5640  O O     . GLY C  1 77  ? -33.947 -42.219 28.306  1.00 24.23  ? 139 GLY C O     1 
ATOM   5641  N N     . ILE C  1 78  ? -32.086 -42.697 27.154  1.00 23.70  ? 140 ILE C N     1 
ATOM   5642  C CA    . ILE C  1 78  ? -31.890 -43.974 27.818  1.00 23.33  ? 140 ILE C CA    1 
ATOM   5643  C C     . ILE C  1 78  ? -30.500 -44.017 28.414  1.00 24.17  ? 140 ILE C C     1 
ATOM   5644  O O     . ILE C  1 78  ? -29.517 -43.712 27.741  1.00 24.42  ? 140 ILE C O     1 
ATOM   5645  C CB    . ILE C  1 78  ? -32.041 -45.152 26.856  1.00 22.86  ? 140 ILE C CB    1 
ATOM   5646  C CG1   . ILE C  1 78  ? -33.409 -45.128 26.186  1.00 23.12  ? 140 ILE C CG1   1 
ATOM   5647  C CG2   . ILE C  1 78  ? -31.893 -46.457 27.603  1.00 22.74  ? 140 ILE C CG2   1 
ATOM   5648  C CD1   . ILE C  1 78  ? -33.554 -46.070 25.003  1.00 22.65  ? 140 ILE C CD1   1 
ATOM   5649  N N     . GLU C  1 79  ? -30.428 -44.433 29.673  1.00 24.79  ? 141 GLU C N     1 
ATOM   5650  C CA    . GLU C  1 79  ? -29.183 -44.431 30.427  1.00 25.39  ? 141 GLU C CA    1 
ATOM   5651  C C     . GLU C  1 79  ? -29.193 -45.558 31.493  1.00 26.72  ? 141 GLU C C     1 
ATOM   5652  O O     . GLU C  1 79  ? -30.066 -45.576 32.356  1.00 25.95  ? 141 GLU C O     1 
ATOM   5653  C CB    . GLU C  1 79  ? -29.004 -43.049 31.064  1.00 24.90  ? 141 GLU C CB    1 
ATOM   5654  C CG    . GLU C  1 79  ? -27.800 -42.911 31.964  1.00 24.75  ? 141 GLU C CG    1 
ATOM   5655  C CD    . GLU C  1 79  ? -26.531 -43.286 31.264  1.00 24.59  ? 141 GLU C CD    1 
ATOM   5656  O OE1   . GLU C  1 79  ? -26.168 -42.536 30.339  1.00 25.49  ? 141 GLU C OE1   1 
ATOM   5657  O OE2   . GLU C  1 79  ? -25.908 -44.309 31.643  1.00 23.69  ? 141 GLU C OE2   1 
ATOM   5658  N N     . CYS C  1 80  ? -28.238 -46.495 31.424  1.00 28.71  ? 142 CYS C N     1 
ATOM   5659  C CA    . CYS C  1 80  ? -28.215 -47.621 32.354  1.00 30.29  ? 142 CYS C CA    1 
ATOM   5660  C C     . CYS C  1 80  ? -27.623 -47.128 33.657  1.00 29.57  ? 142 CYS C C     1 
ATOM   5661  O O     . CYS C  1 80  ? -28.076 -47.532 34.714  1.00 29.21  ? 142 CYS C O     1 
ATOM   5662  C CB    . CYS C  1 80  ? -27.494 -48.868 31.786  1.00 33.10  ? 142 CYS C CB    1 
ATOM   5663  S SG    . CYS C  1 80  ? -25.754 -48.710 31.234  1.00 44.61  ? 142 CYS C SG    1 
ATOM   5664  N N     . SER C  1 81  ? -26.663 -46.200 33.587  1.00 30.06  ? 143 SER C N     1 
ATOM   5665  C CA    . SER C  1 81  ? -25.931 -45.751 34.781  1.00 30.34  ? 143 SER C CA    1 
ATOM   5666  C C     . SER C  1 81  ? -26.806 -44.945 35.711  1.00 30.77  ? 143 SER C C     1 
ATOM   5667  O O     . SER C  1 81  ? -27.825 -44.407 35.296  1.00 31.67  ? 143 SER C O     1 
ATOM   5668  C CB    . SER C  1 81  ? -24.703 -44.928 34.422  1.00 29.96  ? 143 SER C CB    1 
ATOM   5669  O OG    . SER C  1 81  ? -23.788 -44.953 35.507  1.00 32.56  ? 143 SER C OG    1 
ATOM   5670  N N     . SER C  1 82  ? -26.406 -44.883 36.981  1.00 31.62  ? 144 SER C N     1 
ATOM   5671  C CA    . SER C  1 82  ? -27.186 -44.180 38.008  1.00 31.35  ? 144 SER C CA    1 
ATOM   5672  C C     . SER C  1 82  ? -27.010 -42.673 37.847  1.00 31.10  ? 144 SER C C     1 
ATOM   5673  O O     . SER C  1 82  ? -27.631 -41.883 38.553  1.00 32.08  ? 144 SER C O     1 
ATOM   5674  C CB    . SER C  1 82  ? -26.809 -44.649 39.417  1.00 30.32  ? 144 SER C CB    1 
ATOM   5675  O OG    . SER C  1 82  ? -25.418 -44.580 39.611  1.00 30.38  ? 144 SER C OG    1 
ATOM   5676  N N     . ILE C  1 83  ? -26.171 -42.277 36.901  1.00 30.51  ? 145 ILE C N     1 
ATOM   5677  C CA    . ILE C  1 83  ? -26.091 -40.884 36.508  1.00 31.16  ? 145 ILE C CA    1 
ATOM   5678  C C     . ILE C  1 83  ? -27.457 -40.364 36.051  1.00 28.08  ? 145 ILE C C     1 
ATOM   5679  O O     . ILE C  1 83  ? -27.776 -39.187 36.206  1.00 26.51  ? 145 ILE C O     1 
ATOM   5680  C CB    . ILE C  1 83  ? -25.009 -40.685 35.413  1.00 33.71  ? 145 ILE C CB    1 
ATOM   5681  C CG1   . ILE C  1 83  ? -24.610 -39.205 35.274  1.00 35.38  ? 145 ILE C CG1   1 
ATOM   5682  C CG2   . ILE C  1 83  ? -25.476 -41.247 34.082  1.00 33.86  ? 145 ILE C CG2   1 
ATOM   5683  C CD1   . ILE C  1 83  ? -23.865 -38.635 36.472  1.00 35.74  ? 145 ILE C CD1   1 
ATOM   5684  N N     . SER C  1 84  ? -28.265 -41.256 35.506  1.00 26.91  ? 146 SER C N     1 
ATOM   5685  C CA    . SER C  1 84  ? -29.627 -40.924 35.132  1.00 27.59  ? 146 SER C CA    1 
ATOM   5686  C C     . SER C  1 84  ? -30.405 -40.215 36.238  1.00 27.16  ? 146 SER C C     1 
ATOM   5687  O O     . SER C  1 84  ? -31.144 -39.284 35.954  1.00 25.70  ? 146 SER C O     1 
ATOM   5688  C CB    . SER C  1 84  ? -30.366 -42.194 34.764  1.00 28.32  ? 146 SER C CB    1 
ATOM   5689  O OG    . SER C  1 84  ? -30.128 -43.174 35.754  1.00 29.54  ? 146 SER C OG    1 
ATOM   5690  N N     . ASP C  1 85  ? -30.249 -40.656 37.488  1.00 28.03  ? 147 ASP C N     1 
ATOM   5691  C CA    . ASP C  1 85  ? -30.966 -40.043 38.624  1.00 28.39  ? 147 ASP C CA    1 
ATOM   5692  C C     . ASP C  1 85  ? -30.661 -38.548 38.682  1.00 27.66  ? 147 ASP C C     1 
ATOM   5693  O O     . ASP C  1 85  ? -31.558 -37.736 38.921  1.00 27.01  ? 147 ASP C O     1 
ATOM   5694  C CB    . ASP C  1 85  ? -30.614 -40.710 39.975  1.00 29.34  ? 147 ASP C CB    1 
ATOM   5695  C CG    . ASP C  1 85  ? -30.965 -42.217 40.030  1.00 29.86  ? 147 ASP C CG    1 
ATOM   5696  O OD1   . ASP C  1 85  ? -31.825 -42.692 39.283  1.00 30.12  ? 147 ASP C OD1   1 
ATOM   5697  O OD2   . ASP C  1 85  ? -30.351 -42.950 40.825  1.00 32.45  ? 147 ASP C OD2   1 
ATOM   5698  N N     . TYR C  1 86  ? -29.401 -38.191 38.443  1.00 27.67  ? 148 TYR C N     1 
ATOM   5699  C CA    . TYR C  1 86  ? -29.008 -36.775 38.360  1.00 28.39  ? 148 TYR C CA    1 
ATOM   5700  C C     . TYR C  1 86  ? -29.534 -36.085 37.107  1.00 28.58  ? 148 TYR C C     1 
ATOM   5701  O O     . TYR C  1 86  ? -29.955 -34.927 37.171  1.00 29.13  ? 148 TYR C O     1 
ATOM   5702  C CB    . TYR C  1 86  ? -27.485 -36.603 38.500  1.00 28.86  ? 148 TYR C CB    1 
ATOM   5703  C CG    . TYR C  1 86  ? -27.023 -36.983 39.896  1.00 29.52  ? 148 TYR C CG    1 
ATOM   5704  C CD1   . TYR C  1 86  ? -27.121 -36.066 40.956  1.00 29.47  ? 148 TYR C CD1   1 
ATOM   5705  C CD2   . TYR C  1 86  ? -26.564 -38.278 40.178  1.00 28.51  ? 148 TYR C CD2   1 
ATOM   5706  C CE1   . TYR C  1 86  ? -26.754 -36.423 42.235  1.00 29.24  ? 148 TYR C CE1   1 
ATOM   5707  C CE2   . TYR C  1 86  ? -26.187 -38.630 41.453  1.00 28.40  ? 148 TYR C CE2   1 
ATOM   5708  C CZ    . TYR C  1 86  ? -26.290 -37.697 42.468  1.00 28.95  ? 148 TYR C CZ    1 
ATOM   5709  O OH    . TYR C  1 86  ? -25.915 -38.020 43.730  1.00 30.46  ? 148 TYR C OH    1 
ATOM   5710  N N     . SER C  1 87  ? -29.552 -36.786 35.975  1.00 28.64  ? 149 SER C N     1 
ATOM   5711  C CA    . SER C  1 87  ? -30.120 -36.180 34.762  1.00 28.17  ? 149 SER C CA    1 
ATOM   5712  C C     . SER C  1 87  ? -31.570 -35.698 35.022  1.00 26.40  ? 149 SER C C     1 
ATOM   5713  O O     . SER C  1 87  ? -31.935 -34.611 34.613  1.00 24.35  ? 149 SER C O     1 
ATOM   5714  C CB    . SER C  1 87  ? -29.918 -37.064 33.480  1.00 28.48  ? 149 SER C CB    1 
ATOM   5715  O OG    . SER C  1 87  ? -30.680 -38.260 33.377  1.00 28.52  ? 149 SER C OG    1 
ATOM   5716  N N     . GLU C  1 88  ? -32.351 -36.479 35.763  1.00 26.48  ? 150 GLU C N     1 
ATOM   5717  C CA    . GLU C  1 88  ? -33.744 -36.127 36.057  1.00 27.12  ? 150 GLU C CA    1 
ATOM   5718  C C     . GLU C  1 88  ? -33.842 -34.858 36.881  1.00 27.38  ? 150 GLU C C     1 
ATOM   5719  O O     . GLU C  1 88  ? -34.625 -33.960 36.539  1.00 26.84  ? 150 GLU C O     1 
ATOM   5720  C CB    . GLU C  1 88  ? -34.506 -37.287 36.735  1.00 27.58  ? 150 GLU C CB    1 
ATOM   5721  C CG    . GLU C  1 88  ? -34.837 -38.423 35.768  1.00 28.24  ? 150 GLU C CG    1 
ATOM   5722  C CD    . GLU C  1 88  ? -35.685 -39.513 36.367  1.00 29.21  ? 150 GLU C CD    1 
ATOM   5723  O OE1   . GLU C  1 88  ? -35.545 -39.799 37.550  1.00 31.90  ? 150 GLU C OE1   1 
ATOM   5724  O OE2   . GLU C  1 88  ? -36.494 -40.113 35.650  1.00 32.16  ? 150 GLU C OE2   1 
ATOM   5725  N N     . LYS C  1 89  ? -33.064 -34.784 37.962  1.00 28.48  ? 151 LYS C N     1 
ATOM   5726  C CA    . LYS C  1 89  ? -33.081 -33.600 38.841  1.00 28.75  ? 151 LYS C CA    1 
ATOM   5727  C C     . LYS C  1 89  ? -32.602 -32.415 38.072  1.00 26.59  ? 151 LYS C C     1 
ATOM   5728  O O     . LYS C  1 89  ? -33.180 -31.347 38.195  1.00 26.07  ? 151 LYS C O     1 
ATOM   5729  C CB    . LYS C  1 89  ? -32.218 -33.768 40.098  1.00 31.59  ? 151 LYS C CB    1 
ATOM   5730  C CG    . LYS C  1 89  ? -32.894 -34.526 41.242  1.00 36.04  ? 151 LYS C CG    1 
ATOM   5731  C CD    . LYS C  1 89  ? -31.953 -34.718 42.435  1.00 38.27  ? 151 LYS C CD    1 
ATOM   5732  C CE    . LYS C  1 89  ? -32.241 -35.996 43.216  1.00 39.07  ? 151 LYS C CE    1 
ATOM   5733  N NZ    . LYS C  1 89  ? -30.973 -36.722 43.521  1.00 38.71  ? 151 LYS C NZ    1 
ATOM   5734  N N     . ILE C  1 90  ? -31.563 -32.623 37.258  1.00 25.72  ? 152 ILE C N     1 
ATOM   5735  C CA    . ILE C  1 90  ? -30.999 -31.565 36.405  1.00 25.32  ? 152 ILE C CA    1 
ATOM   5736  C C     . ILE C  1 90  ? -32.029 -31.020 35.427  1.00 24.92  ? 152 ILE C C     1 
ATOM   5737  O O     . ILE C  1 90  ? -32.241 -29.825 35.355  1.00 23.87  ? 152 ILE C O     1 
ATOM   5738  C CB    . ILE C  1 90  ? -29.800 -32.068 35.575  1.00 25.47  ? 152 ILE C CB    1 
ATOM   5739  C CG1   . ILE C  1 90  ? -28.585 -32.275 36.465  1.00 26.32  ? 152 ILE C CG1   1 
ATOM   5740  C CG2   . ILE C  1 90  ? -29.428 -31.064 34.491  1.00 25.19  ? 152 ILE C CG2   1 
ATOM   5741  C CD1   . ILE C  1 90  ? -27.465 -33.061 35.809  1.00 26.20  ? 152 ILE C CD1   1 
ATOM   5742  N N     . ILE C  1 91  ? -32.646 -31.911 34.658  1.00 25.59  ? 153 ILE C N     1 
ATOM   5743  C CA    . ILE C  1 91  ? -33.636 -31.529 33.660  1.00 25.72  ? 153 ILE C CA    1 
ATOM   5744  C C     . ILE C  1 91  ? -34.755 -30.739 34.329  1.00 27.51  ? 153 ILE C C     1 
ATOM   5745  O O     . ILE C  1 91  ? -35.169 -29.659 33.846  1.00 26.87  ? 153 ILE C O     1 
ATOM   5746  C CB    . ILE C  1 91  ? -34.188 -32.777 32.942  1.00 25.54  ? 153 ILE C CB    1 
ATOM   5747  C CG1   . ILE C  1 91  ? -33.128 -33.341 31.988  1.00 25.80  ? 153 ILE C CG1   1 
ATOM   5748  C CG2   . ILE C  1 91  ? -35.462 -32.453 32.165  1.00 26.15  ? 153 ILE C CG2   1 
ATOM   5749  C CD1   . ILE C  1 91  ? -33.280 -34.810 31.632  1.00 25.41  ? 153 ILE C CD1   1 
ATOM   5750  N N     . LYS C  1 92  ? -35.242 -31.280 35.448  1.00 29.49  ? 154 LYS C N     1 
ATOM   5751  C CA    . LYS C  1 92  ? -36.309 -30.628 36.177  1.00 30.48  ? 154 LYS C CA    1 
ATOM   5752  C C     . LYS C  1 92  ? -35.873 -29.229 36.559  1.00 26.72  ? 154 LYS C C     1 
ATOM   5753  O O     . LYS C  1 92  ? -36.587 -28.287 36.304  1.00 25.91  ? 154 LYS C O     1 
ATOM   5754  C CB    . LYS C  1 92  ? -36.751 -31.425 37.403  1.00 34.56  ? 154 LYS C CB    1 
ATOM   5755  C CG    . LYS C  1 92  ? -38.208 -31.134 37.734  1.00 41.18  ? 154 LYS C CG    1 
ATOM   5756  C CD    . LYS C  1 92  ? -38.561 -31.262 39.205  1.00 47.88  ? 154 LYS C CD    1 
ATOM   5757  C CE    . LYS C  1 92  ? -39.770 -30.379 39.517  1.00 52.04  ? 154 LYS C CE    1 
ATOM   5758  N NZ    . LYS C  1 92  ? -40.244 -30.639 40.893  1.00 55.24  ? 154 LYS C NZ    1 
ATOM   5759  N N     . ALA C  1 93  ? -34.674 -29.099 37.106  1.00 24.54  ? 155 ALA C N     1 
ATOM   5760  C CA    . ALA C  1 93  ? -34.132 -27.809 37.495  1.00 23.17  ? 155 ALA C CA    1 
ATOM   5761  C C     . ALA C  1 93  ? -34.081 -26.786 36.382  1.00 23.70  ? 155 ALA C C     1 
ATOM   5762  O O     . ALA C  1 93  ? -34.166 -25.605 36.667  1.00 23.59  ? 155 ALA C O     1 
ATOM   5763  C CB    . ALA C  1 93  ? -32.756 -27.985 38.048  1.00 23.04  ? 155 ALA C CB    1 
ATOM   5764  N N     . ASN C  1 94  ? -33.953 -27.235 35.129  1.00 24.67  ? 156 ASN C N     1 
ATOM   5765  C CA    . ASN C  1 94  ? -33.939 -26.355 33.951  1.00 25.31  ? 156 ASN C CA    1 
ATOM   5766  C C     . ASN C  1 94  ? -35.274 -26.213 33.162  1.00 26.89  ? 156 ASN C C     1 
ATOM   5767  O O     . ASN C  1 94  ? -35.312 -25.620 32.071  1.00 25.90  ? 156 ASN C O     1 
ATOM   5768  C CB    . ASN C  1 94  ? -32.855 -26.823 33.008  1.00 25.68  ? 156 ASN C CB    1 
ATOM   5769  C CG    . ASN C  1 94  ? -31.489 -26.842 33.657  1.00 25.71  ? 156 ASN C CG    1 
ATOM   5770  O OD1   . ASN C  1 94  ? -30.817 -25.836 33.707  1.00 26.67  ? 156 ASN C OD1   1 
ATOM   5771  N ND2   . ASN C  1 94  ? -31.065 -27.996 34.124  1.00 26.22  ? 156 ASN C ND2   1 
ATOM   5772  N N     . HIS C  1 95  ? -36.357 -26.729 33.746  1.00 28.69  ? 157 HIS C N     1 
ATOM   5773  C CA    . HIS C  1 95  ? -37.733 -26.548 33.258  1.00 28.09  ? 157 HIS C CA    1 
ATOM   5774  C C     . HIS C  1 95  ? -37.954 -27.309 31.967  1.00 26.59  ? 157 HIS C C     1 
ATOM   5775  O O     . HIS C  1 95  ? -38.722 -26.867 31.115  1.00 28.25  ? 157 HIS C O     1 
ATOM   5776  C CB    . HIS C  1 95  ? -38.115 -25.049 33.122  1.00 28.71  ? 157 HIS C CB    1 
ATOM   5777  C CG    . HIS C  1 95  ? -37.803 -24.227 34.340  1.00 31.41  ? 157 HIS C CG    1 
ATOM   5778  N ND1   . HIS C  1 95  ? -38.377 -24.476 35.573  1.00 33.10  ? 157 HIS C ND1   1 
ATOM   5779  C CD2   . HIS C  1 95  ? -36.972 -23.169 34.520  1.00 31.98  ? 157 HIS C CD2   1 
ATOM   5780  C CE1   . HIS C  1 95  ? -37.908 -23.612 36.458  1.00 33.27  ? 157 HIS C CE1   1 
ATOM   5781  N NE2   . HIS C  1 95  ? -37.053 -22.810 35.845  1.00 32.97  ? 157 HIS C NE2   1 
ATOM   5782  N N     . LEU C  1 96  ? -37.325 -28.468 31.820  1.00 24.55  ? 158 LEU C N     1 
ATOM   5783  C CA    . LEU C  1 96  ? -37.488 -29.202 30.576  1.00 24.51  ? 158 LEU C CA    1 
ATOM   5784  C C     . LEU C  1 96  ? -38.142 -30.552 30.779  1.00 24.12  ? 158 LEU C C     1 
ATOM   5785  O O     . LEU C  1 96  ? -38.225 -31.347 29.850  1.00 24.90  ? 158 LEU C O     1 
ATOM   5786  C CB    . LEU C  1 96  ? -36.148 -29.339 29.855  1.00 24.37  ? 158 LEU C CB    1 
ATOM   5787  C CG    . LEU C  1 96  ? -35.508 -28.033 29.367  1.00 24.52  ? 158 LEU C CG    1 
ATOM   5788  C CD1   . LEU C  1 96  ? -34.086 -28.294 28.896  1.00 24.82  ? 158 LEU C CD1   1 
ATOM   5789  C CD2   . LEU C  1 96  ? -36.294 -27.376 28.251  1.00 24.20  ? 158 LEU C CD2   1 
ATOM   5790  N N     . ASP C  1 97  ? -38.650 -30.810 31.976  1.00 23.69  ? 159 ASP C N     1 
ATOM   5791  C CA    . ASP C  1 97  ? -39.182 -32.157 32.278  1.00 23.53  ? 159 ASP C CA    1 
ATOM   5792  C C     . ASP C  1 97  ? -40.456 -32.490 31.485  1.00 23.46  ? 159 ASP C C     1 
ATOM   5793  O O     . ASP C  1 97  ? -40.731 -33.652 31.196  1.00 21.91  ? 159 ASP C O     1 
ATOM   5794  C CB    . ASP C  1 97  ? -39.344 -32.400 33.804  1.00 22.32  ? 159 ASP C CB    1 
ATOM   5795  C CG    . ASP C  1 97  ? -39.944 -31.218 34.556  1.00 21.53  ? 159 ASP C CG    1 
ATOM   5796  O OD1   . ASP C  1 97  ? -39.557 -30.038 34.324  1.00 20.12  ? 159 ASP C OD1   1 
ATOM   5797  O OD2   . ASP C  1 97  ? -40.793 -31.502 35.421  1.00 21.06  ? 159 ASP C OD2   1 
ATOM   5798  N N     . ASN C  1 98  ? -41.201 -31.447 31.134  1.00 24.88  ? 160 ASN C N     1 
ATOM   5799  C CA    . ASN C  1 98  ? -42.357 -31.539 30.258  1.00 25.98  ? 160 ASN C CA    1 
ATOM   5800  C C     . ASN C  1 98  ? -41.995 -31.973 28.825  1.00 25.35  ? 160 ASN C C     1 
ATOM   5801  O O     . ASN C  1 98  ? -42.878 -32.398 28.076  1.00 26.73  ? 160 ASN C O     1 
ATOM   5802  C CB    . ASN C  1 98  ? -43.068 -30.187 30.205  1.00 28.00  ? 160 ASN C CB    1 
ATOM   5803  C CG    . ASN C  1 98  ? -42.185 -29.100 29.591  1.00 32.20  ? 160 ASN C CG    1 
ATOM   5804  O OD1   . ASN C  1 98  ? -40.972 -29.033 29.871  1.00 34.87  ? 160 ASN C OD1   1 
ATOM   5805  N ND2   . ASN C  1 98  ? -42.764 -28.274 28.714  1.00 33.42  ? 160 ASN C ND2   1 
ATOM   5806  N N     . ILE C  1 99  ? -40.721 -31.863 28.435  1.00 24.18  ? 161 ILE C N     1 
ATOM   5807  C CA    . ILE C  1 99  ? -40.270 -32.284 27.089  1.00 23.49  ? 161 ILE C CA    1 
ATOM   5808  C C     . ILE C  1 99  ? -39.346 -33.511 27.052  1.00 23.70  ? 161 ILE C C     1 
ATOM   5809  O O     . ILE C  1 99  ? -39.401 -34.313 26.118  1.00 23.62  ? 161 ILE C O     1 
ATOM   5810  C CB    . ILE C  1 99  ? -39.555 -31.128 26.391  1.00 23.24  ? 161 ILE C CB    1 
ATOM   5811  C CG1   . ILE C  1 99  ? -40.542 -29.993 26.116  1.00 23.31  ? 161 ILE C CG1   1 
ATOM   5812  C CG2   . ILE C  1 99  ? -38.919 -31.594 25.095  1.00 23.28  ? 161 ILE C CG2   1 
ATOM   5813  C CD1   . ILE C  1 99  ? -39.878 -28.671 25.805  1.00 23.73  ? 161 ILE C CD1   1 
ATOM   5814  N N     . ILE C  1 100 ? -38.495 -33.653 28.059  1.00 24.11  ? 162 ILE C N     1 
ATOM   5815  C CA    . ILE C  1 100 ? -37.543 -34.744 28.110  1.00 24.51  ? 162 ILE C CA    1 
ATOM   5816  C C     . ILE C  1 100 ? -37.978 -35.739 29.155  1.00 26.23  ? 162 ILE C C     1 
ATOM   5817  O O     . ILE C  1 100 ? -38.358 -35.345 30.257  1.00 30.80  ? 162 ILE C O     1 
ATOM   5818  C CB    . ILE C  1 100 ? -36.170 -34.257 28.561  1.00 24.22  ? 162 ILE C CB    1 
ATOM   5819  C CG1   . ILE C  1 100 ? -35.663 -33.193 27.617  1.00 24.47  ? 162 ILE C CG1   1 
ATOM   5820  C CG2   . ILE C  1 100 ? -35.188 -35.409 28.595  1.00 24.81  ? 162 ILE C CG2   1 
ATOM   5821  C CD1   . ILE C  1 100 ? -34.458 -32.455 28.142  1.00 24.48  ? 162 ILE C CD1   1 
ATOM   5822  N N     . THR C  1 101 ? -37.892 -37.019 28.827  1.00 24.98  ? 163 THR C N     1 
ATOM   5823  C CA    . THR C  1 101 ? -38.188 -38.076 29.766  1.00 24.67  ? 163 THR C CA    1 
ATOM   5824  C C     . THR C  1 101 ? -37.000 -38.982 29.692  1.00 24.84  ? 163 THR C C     1 
ATOM   5825  O O     . THR C  1 101 ? -36.531 -39.233 28.596  1.00 27.79  ? 163 THR C O     1 
ATOM   5826  C CB    . THR C  1 101 ? -39.461 -38.797 29.334  1.00 24.74  ? 163 THR C CB    1 
ATOM   5827  O OG1   . THR C  1 101 ? -40.486 -37.815 29.202  1.00 26.04  ? 163 THR C OG1   1 
ATOM   5828  C CG2   . THR C  1 101 ? -39.903 -39.846 30.334  1.00 24.67  ? 163 THR C CG2   1 
ATOM   5829  N N     . ILE C  1 102 ? -36.509 -39.466 30.835  1.00 24.12  ? 164 ILE C N     1 
ATOM   5830  C CA    . ILE C  1 102 ? -35.343 -40.363 30.887  1.00 22.83  ? 164 ILE C CA    1 
ATOM   5831  C C     . ILE C  1 102 ? -35.736 -41.764 31.271  1.00 23.32  ? 164 ILE C C     1 
ATOM   5832  O O     . ILE C  1 102 ? -36.380 -41.964 32.273  1.00 23.56  ? 164 ILE C O     1 
ATOM   5833  C CB    . ILE C  1 102 ? -34.341 -39.907 31.955  1.00 22.09  ? 164 ILE C CB    1 
ATOM   5834  C CG1   . ILE C  1 102 ? -33.856 -38.493 31.679  1.00 21.57  ? 164 ILE C CG1   1 
ATOM   5835  C CG2   . ILE C  1 102 ? -33.175 -40.875 32.046  1.00 22.05  ? 164 ILE C CG2   1 
ATOM   5836  C CD1   . ILE C  1 102 ? -33.175 -38.330 30.354  1.00 21.36  ? 164 ILE C CD1   1 
ATOM   5837  N N     . PHE C  1 103 ? -35.301 -42.749 30.519  1.00 25.11  ? 165 PHE C N     1 
ATOM   5838  C CA    . PHE C  1 103 ? -35.639 -44.125 30.845  1.00 27.82  ? 165 PHE C CA    1 
ATOM   5839  C C     . PHE C  1 103 ? -34.437 -44.857 31.424  1.00 28.81  ? 165 PHE C C     1 
ATOM   5840  O O     . PHE C  1 103 ? -33.484 -45.190 30.712  1.00 28.46  ? 165 PHE C O     1 
ATOM   5841  C CB    . PHE C  1 103 ? -36.194 -44.813 29.615  1.00 29.32  ? 165 PHE C CB    1 
ATOM   5842  C CG    . PHE C  1 103 ? -37.479 -44.190 29.124  1.00 29.72  ? 165 PHE C CG    1 
ATOM   5843  C CD1   . PHE C  1 103 ? -38.684 -44.569 29.668  1.00 30.79  ? 165 PHE C CD1   1 
ATOM   5844  C CD2   . PHE C  1 103 ? -37.478 -43.198 28.159  1.00 29.91  ? 165 PHE C CD2   1 
ATOM   5845  C CE1   . PHE C  1 103 ? -39.875 -43.987 29.248  1.00 29.99  ? 165 PHE C CE1   1 
ATOM   5846  C CE2   . PHE C  1 103 ? -38.668 -42.619 27.722  1.00 29.50  ? 165 PHE C CE2   1 
ATOM   5847  C CZ    . PHE C  1 103 ? -39.869 -43.013 28.275  1.00 29.47  ? 165 PHE C CZ    1 
ATOM   5848  N N     . LYS C  1 104 ? -34.502 -45.074 32.736  1.00 30.18  ? 166 LYS C N     1 
ATOM   5849  C CA    . LYS C  1 104 ? -33.408 -45.632 33.508  1.00 30.75  ? 166 LYS C CA    1 
ATOM   5850  C C     . LYS C  1 104 ? -33.327 -47.089 33.106  1.00 28.37  ? 166 LYS C C     1 
ATOM   5851  O O     . LYS C  1 104 ? -34.152 -47.897 33.507  1.00 29.33  ? 166 LYS C O     1 
ATOM   5852  C CB    . LYS C  1 104 ? -33.676 -45.465 35.021  1.00 33.36  ? 166 LYS C CB    1 
ATOM   5853  C CG    . LYS C  1 104 ? -32.513 -44.926 35.857  1.00 38.93  ? 166 LYS C CG    1 
ATOM   5854  C CD    . LYS C  1 104 ? -31.665 -45.989 36.602  1.00 41.91  ? 166 LYS C CD    1 
ATOM   5855  C CE    . LYS C  1 104 ? -31.220 -45.496 37.989  1.00 43.91  ? 166 LYS C CE    1 
ATOM   5856  N NZ    . LYS C  1 104 ? -30.302 -46.401 38.738  1.00 45.46  ? 166 LYS C NZ    1 
ATOM   5857  N N     . GLY C  1 105 ? -32.348 -47.429 32.285  1.00 26.26  ? 167 GLY C N     1 
ATOM   5858  C CA    . GLY C  1 105 ? -32.161 -48.812 31.927  1.00 26.10  ? 167 GLY C CA    1 
ATOM   5859  C C     . GLY C  1 105 ? -31.257 -48.983 30.747  1.00 26.43  ? 167 GLY C C     1 
ATOM   5860  O O     . GLY C  1 105 ? -30.836 -48.017 30.140  1.00 25.68  ? 167 GLY C O     1 
ATOM   5861  N N     . LYS C  1 106 ? -30.983 -50.238 30.425  1.00 28.21  ? 168 LYS C N     1 
ATOM   5862  C CA    . LYS C  1 106 ? -30.158 -50.592 29.304  1.00 30.22  ? 168 LYS C CA    1 
ATOM   5863  C C     . LYS C  1 106 ? -30.954 -50.369 28.010  1.00 28.28  ? 168 LYS C C     1 
ATOM   5864  O O     . LYS C  1 106 ? -32.154 -50.644 27.970  1.00 27.76  ? 168 LYS C O     1 
ATOM   5865  C CB    . LYS C  1 106 ? -29.749 -52.049 29.454  1.00 35.32  ? 168 LYS C CB    1 
ATOM   5866  C CG    . LYS C  1 106 ? -28.357 -52.346 28.949  1.00 43.39  ? 168 LYS C CG    1 
ATOM   5867  C CD    . LYS C  1 106 ? -27.874 -53.738 29.345  1.00 48.84  ? 168 LYS C CD    1 
ATOM   5868  C CE    . LYS C  1 106 ? -27.761 -53.870 30.861  1.00 51.92  ? 168 LYS C CE    1 
ATOM   5869  N NZ    . LYS C  1 106 ? -27.157 -55.168 31.273  1.00 56.16  ? 168 LYS C NZ    1 
ATOM   5870  N N     . VAL C  1 107 ? -30.298 -49.855 26.965  1.00 26.28  ? 169 VAL C N     1 
ATOM   5871  C CA    . VAL C  1 107 ? -30.944 -49.586 25.673  1.00 25.19  ? 169 VAL C CA    1 
ATOM   5872  C C     . VAL C  1 107 ? -31.521 -50.830 25.011  1.00 25.80  ? 169 VAL C C     1 
ATOM   5873  O O     . VAL C  1 107 ? -32.620 -50.808 24.414  1.00 24.10  ? 169 VAL C O     1 
ATOM   5874  C CB    . VAL C  1 107 ? -29.962 -48.950 24.688  1.00 25.40  ? 169 VAL C CB    1 
ATOM   5875  C CG1   . VAL C  1 107 ? -30.485 -49.046 23.262  1.00 26.16  ? 169 VAL C CG1   1 
ATOM   5876  C CG2   . VAL C  1 107 ? -29.727 -47.488 25.028  1.00 26.36  ? 169 VAL C CG2   1 
ATOM   5877  N N     . GLU C  1 108 ? -30.776 -51.924 25.131  1.00 27.02  ? 170 GLU C N     1 
ATOM   5878  C CA    . GLU C  1 108 ? -31.199 -53.189 24.537  1.00 27.80  ? 170 GLU C CA    1 
ATOM   5879  C C     . GLU C  1 108 ? -32.360 -53.858 25.311  1.00 28.50  ? 170 GLU C C     1 
ATOM   5880  O O     . GLU C  1 108 ? -32.811 -54.942 24.933  1.00 29.59  ? 170 GLU C O     1 
ATOM   5881  C CB    . GLU C  1 108 ? -29.998 -54.145 24.276  1.00 27.58  ? 170 GLU C CB    1 
ATOM   5882  C CG    . GLU C  1 108 ? -28.723 -53.973 25.108  1.00 28.05  ? 170 GLU C CG    1 
ATOM   5883  C CD    . GLU C  1 108 ? -27.787 -52.832 24.640  1.00 27.96  ? 170 GLU C CD    1 
ATOM   5884  O OE1   . GLU C  1 108 ? -27.159 -52.874 23.546  1.00 26.96  ? 170 GLU C OE1   1 
ATOM   5885  O OE2   . GLU C  1 108 ? -27.657 -51.871 25.407  1.00 27.35  ? 170 GLU C OE2   1 
ATOM   5886  N N     . GLU C  1 109 ? -32.848 -53.200 26.369  1.00 29.05  ? 171 GLU C N     1 
ATOM   5887  C CA    . GLU C  1 109 ? -33.920 -53.727 27.231  1.00 28.44  ? 171 GLU C CA    1 
ATOM   5888  C C     . GLU C  1 109 ? -35.129 -52.800 27.384  1.00 27.33  ? 171 GLU C C     1 
ATOM   5889  O O     . GLU C  1 109 ? -36.245 -53.300 27.461  1.00 25.48  ? 171 GLU C O     1 
ATOM   5890  C CB    . GLU C  1 109 ? -33.369 -54.078 28.617  1.00 29.26  ? 171 GLU C CB    1 
ATOM   5891  C CG    . GLU C  1 109 ? -32.551 -55.358 28.626  1.00 31.38  ? 171 GLU C CG    1 
ATOM   5892  C CD    . GLU C  1 109 ? -31.851 -55.612 29.949  1.00 33.00  ? 171 GLU C CD    1 
ATOM   5893  O OE1   . GLU C  1 109 ? -32.169 -54.919 30.950  1.00 33.56  ? 171 GLU C OE1   1 
ATOM   5894  O OE2   . GLU C  1 109 ? -30.958 -56.495 29.970  1.00 35.15  ? 171 GLU C OE2   1 
ATOM   5895  N N     . VAL C  1 110 ? -34.940 -51.477 27.445  1.00 26.56  ? 172 VAL C N     1 
ATOM   5896  C CA    . VAL C  1 110 ? -36.096 -50.608 27.677  1.00 27.25  ? 172 VAL C CA    1 
ATOM   5897  C C     . VAL C  1 110 ? -36.967 -50.458 26.438  1.00 26.01  ? 172 VAL C C     1 
ATOM   5898  O O     . VAL C  1 110 ? -36.569 -50.790 25.306  1.00 25.59  ? 172 VAL C O     1 
ATOM   5899  C CB    . VAL C  1 110 ? -35.772 -49.189 28.204  1.00 28.62  ? 172 VAL C CB    1 
ATOM   5900  C CG1   . VAL C  1 110 ? -34.885 -49.237 29.421  1.00 29.81  ? 172 VAL C CG1   1 
ATOM   5901  C CG2   . VAL C  1 110 ? -35.152 -48.332 27.132  1.00 29.74  ? 172 VAL C CG2   1 
ATOM   5902  N N     . GLU C  1 111 ? -38.171 -49.966 26.701  1.00 24.32  ? 173 GLU C N     1 
ATOM   5903  C CA    . GLU C  1 111 ? -39.213 -49.836 25.713  1.00 23.74  ? 173 GLU C CA    1 
ATOM   5904  C C     . GLU C  1 111 ? -39.640 -48.360 25.726  1.00 22.27  ? 173 GLU C C     1 
ATOM   5905  O O     . GLU C  1 111 ? -39.559 -47.671 26.755  1.00 20.59  ? 173 GLU C O     1 
ATOM   5906  C CB    . GLU C  1 111 ? -40.376 -50.819 26.040  1.00 23.38  ? 173 GLU C CB    1 
ATOM   5907  C CG    . GLU C  1 111 ? -40.809 -51.693 24.879  1.00 23.82  ? 173 GLU C CG    1 
ATOM   5908  C CD    . GLU C  1 111 ? -39.744 -52.697 24.512  1.00 24.51  ? 173 GLU C CD    1 
ATOM   5909  O OE1   . GLU C  1 111 ? -39.249 -52.702 23.354  1.00 24.62  ? 173 GLU C OE1   1 
ATOM   5910  O OE2   . GLU C  1 111 ? -39.370 -53.461 25.411  1.00 25.18  ? 173 GLU C OE2   1 
ATOM   5911  N N     . LEU C  1 112 ? -40.058 -47.879 24.566  1.00 21.79  ? 174 LEU C N     1 
ATOM   5912  C CA    . LEU C  1 112 ? -40.432 -46.490 24.422  1.00 21.80  ? 174 LEU C CA    1 
ATOM   5913  C C     . LEU C  1 112 ? -41.881 -46.337 24.052  1.00 20.54  ? 174 LEU C C     1 
ATOM   5914  O O     . LEU C  1 112 ? -42.477 -47.225 23.485  1.00 17.72  ? 174 LEU C O     1 
ATOM   5915  C CB    . LEU C  1 112 ? -39.644 -45.832 23.315  1.00 23.46  ? 174 LEU C CB    1 
ATOM   5916  C CG    . LEU C  1 112 ? -38.132 -45.723 23.462  1.00 25.16  ? 174 LEU C CG    1 
ATOM   5917  C CD1   . LEU C  1 112 ? -37.503 -45.275 22.144  1.00 26.17  ? 174 LEU C CD1   1 
ATOM   5918  C CD2   . LEU C  1 112 ? -37.747 -44.786 24.593  1.00 25.54  ? 174 LEU C CD2   1 
ATOM   5919  N N     . PRO C  1 113 ? -42.443 -45.165 24.360  1.00 20.79  ? 175 PRO C N     1 
ATOM   5920  C CA    . PRO C  1 113 ? -43.875 -44.967 24.176  1.00 20.95  ? 175 PRO C CA    1 
ATOM   5921  C C     . PRO C  1 113 ? -44.278 -44.759 22.746  1.00 21.45  ? 175 PRO C C     1 
ATOM   5922  O O     . PRO C  1 113 ? -45.424 -44.418 22.485  1.00 21.87  ? 175 PRO C O     1 
ATOM   5923  C CB    . PRO C  1 113 ? -44.173 -43.730 25.030  1.00 20.98  ? 175 PRO C CB    1 
ATOM   5924  C CG    . PRO C  1 113 ? -42.879 -43.016 25.155  1.00 21.03  ? 175 PRO C CG    1 
ATOM   5925  C CD    . PRO C  1 113 ? -41.833 -44.093 25.177  1.00 20.87  ? 175 PRO C CD    1 
ATOM   5926  N N     . VAL C  1 114 ? -43.341 -44.955 21.830  1.00 22.56  ? 176 VAL C N     1 
ATOM   5927  C CA    . VAL C  1 114 ? -43.627 -44.877 20.402  1.00 23.07  ? 176 VAL C CA    1 
ATOM   5928  C C     . VAL C  1 114 ? -42.953 -46.024 19.672  1.00 24.78  ? 176 VAL C C     1 
ATOM   5929  O O     . VAL C  1 114 ? -42.073 -46.700 20.214  1.00 25.12  ? 176 VAL C O     1 
ATOM   5930  C CB    . VAL C  1 114 ? -43.195 -43.529 19.795  1.00 22.22  ? 176 VAL C CB    1 
ATOM   5931  C CG1   . VAL C  1 114 ? -43.900 -42.369 20.495  1.00 22.93  ? 176 VAL C CG1   1 
ATOM   5932  C CG2   . VAL C  1 114 ? -41.708 -43.344 19.903  1.00 21.52  ? 176 VAL C CG2   1 
ATOM   5933  N N     . GLU C  1 115 ? -43.415 -46.290 18.460  1.00 27.84  ? 177 GLU C N     1 
ATOM   5934  C CA    . GLU C  1 115 ? -42.842 -47.382 17.687  1.00 29.89  ? 177 GLU C CA    1 
ATOM   5935  C C     . GLU C  1 115 ? -41.572 -46.913 17.071  1.00 27.58  ? 177 GLU C C     1 
ATOM   5936  O O     . GLU C  1 115 ? -40.580 -47.630 17.081  1.00 27.30  ? 177 GLU C O     1 
ATOM   5937  C CB    . GLU C  1 115 ? -43.791 -47.880 16.610  1.00 33.11  ? 177 GLU C CB    1 
ATOM   5938  C CG    . GLU C  1 115 ? -44.793 -48.854 17.177  1.00 39.18  ? 177 GLU C CG    1 
ATOM   5939  C CD    . GLU C  1 115 ? -45.661 -49.484 16.125  1.00 44.39  ? 177 GLU C CD    1 
ATOM   5940  O OE1   . GLU C  1 115 ? -46.530 -50.301 16.520  1.00 47.59  ? 177 GLU C OE1   1 
ATOM   5941  O OE2   . GLU C  1 115 ? -45.478 -49.157 14.931  1.00 47.35  ? 177 GLU C OE2   1 
ATOM   5942  N N     . LYS C  1 116 ? -41.615 -45.677 16.587  1.00 25.36  ? 178 LYS C N     1 
ATOM   5943  C CA    . LYS C  1 116 ? -40.559 -45.109 15.779  1.00 23.34  ? 178 LYS C CA    1 
ATOM   5944  C C     . LYS C  1 116 ? -40.215 -43.709 16.223  1.00 21.59  ? 178 LYS C C     1 
ATOM   5945  O O     . LYS C  1 116 ? -41.018 -43.033 16.847  1.00 20.44  ? 178 LYS C O     1 
ATOM   5946  C CB    . LYS C  1 116 ? -40.991 -45.113 14.313  1.00 22.89  ? 178 LYS C CB    1 
ATOM   5947  C CG    . LYS C  1 116 ? -40.222 -46.090 13.448  1.00 22.78  ? 178 LYS C CG    1 
ATOM   5948  C CD    . LYS C  1 116 ? -40.227 -47.544 13.915  1.00 22.63  ? 178 LYS C CD    1 
ATOM   5949  C CE    . LYS C  1 116 ? -39.430 -48.390 12.937  1.00 22.61  ? 178 LYS C CE    1 
ATOM   5950  N NZ    . LYS C  1 116 ? -39.266 -49.795 13.356  1.00 23.13  ? 178 LYS C NZ    1 
ATOM   5951  N N     . VAL C  1 117 ? -39.008 -43.287 15.887  1.00 20.81  ? 179 VAL C N     1 
ATOM   5952  C CA    . VAL C  1 117 ? -38.465 -42.022 16.349  1.00 20.50  ? 179 VAL C CA    1 
ATOM   5953  C C     . VAL C  1 117 ? -37.928 -41.245 15.135  1.00 20.54  ? 179 VAL C C     1 
ATOM   5954  O O     . VAL C  1 117 ? -37.452 -41.850 14.163  1.00 19.79  ? 179 VAL C O     1 
ATOM   5955  C CB    . VAL C  1 117 ? -37.365 -42.307 17.373  1.00 20.89  ? 179 VAL C CB    1 
ATOM   5956  C CG1   . VAL C  1 117 ? -36.374 -41.186 17.453  1.00 21.80  ? 179 VAL C CG1   1 
ATOM   5957  C CG2   . VAL C  1 117 ? -37.951 -42.524 18.749  1.00 21.43  ? 179 VAL C CG2   1 
ATOM   5958  N N     . ASP C  1 118 ? -38.026 -39.917 15.179  1.00 19.73  ? 180 ASP C N     1 
ATOM   5959  C CA    . ASP C  1 118 ? -37.583 -39.097 14.066  1.00 19.78  ? 180 ASP C CA    1 
ATOM   5960  C C     . ASP C  1 118 ? -36.068 -38.954 13.974  1.00 20.54  ? 180 ASP C C     1 
ATOM   5961  O O     . ASP C  1 118 ? -35.508 -39.047 12.898  1.00 21.80  ? 180 ASP C O     1 
ATOM   5962  C CB    . ASP C  1 118 ? -38.196 -37.712 14.158  1.00 19.90  ? 180 ASP C CB    1 
ATOM   5963  C CG    . ASP C  1 118 ? -39.711 -37.729 14.020  1.00 19.67  ? 180 ASP C CG    1 
ATOM   5964  O OD1   . ASP C  1 118 ? -40.228 -38.232 13.007  1.00 18.84  ? 180 ASP C OD1   1 
ATOM   5965  O OD2   . ASP C  1 118 ? -40.383 -37.205 14.915  1.00 19.67  ? 180 ASP C OD2   1 
ATOM   5966  N N     . ILE C  1 119 ? -35.401 -38.732 15.101  1.00 20.92  ? 181 ILE C N     1 
ATOM   5967  C CA    . ILE C  1 119 ? -33.958 -38.438 15.144  1.00 20.69  ? 181 ILE C CA    1 
ATOM   5968  C C     . ILE C  1 119 ? -33.281 -39.203 16.298  1.00 21.70  ? 181 ILE C C     1 
ATOM   5969  O O     . ILE C  1 119 ? -33.804 -39.230 17.405  1.00 22.49  ? 181 ILE C O     1 
ATOM   5970  C CB    . ILE C  1 119 ? -33.727 -36.925 15.383  1.00 19.93  ? 181 ILE C CB    1 
ATOM   5971  C CG1   . ILE C  1 119 ? -34.292 -36.085 14.232  1.00 19.34  ? 181 ILE C CG1   1 
ATOM   5972  C CG2   . ILE C  1 119 ? -32.249 -36.628 15.590  1.00 20.02  ? 181 ILE C CG2   1 
ATOM   5973  C CD1   . ILE C  1 119 ? -34.380 -34.601 14.531  1.00 18.85  ? 181 ILE C CD1   1 
ATOM   5974  N N     . ILE C  1 120 ? -32.115 -39.799 16.062  1.00 22.29  ? 182 ILE C N     1 
ATOM   5975  C CA    . ILE C  1 120 ? -31.296 -40.341 17.145  1.00 22.39  ? 182 ILE C CA    1 
ATOM   5976  C C     . ILE C  1 120 ? -30.054 -39.471 17.348  1.00 23.89  ? 182 ILE C C     1 
ATOM   5977  O O     . ILE C  1 120 ? -29.351 -39.180 16.394  1.00 26.38  ? 182 ILE C O     1 
ATOM   5978  C CB    . ILE C  1 120 ? -30.856 -41.767 16.831  1.00 22.10  ? 182 ILE C CB    1 
ATOM   5979  C CG1   . ILE C  1 120 ? -31.980 -42.727 17.164  1.00 22.33  ? 182 ILE C CG1   1 
ATOM   5980  C CG2   . ILE C  1 120 ? -29.609 -42.149 17.620  1.00 22.43  ? 182 ILE C CG2   1 
ATOM   5981  C CD1   . ILE C  1 120 ? -31.691 -44.161 16.752  1.00 22.61  ? 182 ILE C CD1   1 
ATOM   5982  N N     . ILE C  1 121 ? -29.776 -39.073 18.586  1.00 24.33  ? 183 ILE C N     1 
ATOM   5983  C CA    . ILE C  1 121 ? -28.522 -38.390 18.932  1.00 23.96  ? 183 ILE C CA    1 
ATOM   5984  C C     . ILE C  1 121 ? -27.746 -39.289 19.889  1.00 24.69  ? 183 ILE C C     1 
ATOM   5985  O O     . ILE C  1 121 ? -28.347 -40.021 20.697  1.00 23.58  ? 183 ILE C O     1 
ATOM   5986  C CB    . ILE C  1 121 ? -28.759 -36.999 19.556  1.00 23.48  ? 183 ILE C CB    1 
ATOM   5987  C CG1   . ILE C  1 121 ? -29.525 -37.096 20.862  1.00 23.26  ? 183 ILE C CG1   1 
ATOM   5988  C CG2   . ILE C  1 121 ? -29.581 -36.140 18.617  1.00 24.34  ? 183 ILE C CG2   1 
ATOM   5989  C CD1   . ILE C  1 121 ? -29.976 -35.753 21.391  1.00 23.63  ? 183 ILE C CD1   1 
ATOM   5990  N N     . SER C  1 122 ? -26.414 -39.252 19.792  1.00 25.24  ? 184 SER C N     1 
ATOM   5991  C CA    . SER C  1 122 ? -25.584 -40.026 20.706  1.00 25.23  ? 184 SER C CA    1 
ATOM   5992  C C     . SER C  1 122 ? -24.128 -39.648 20.635  1.00 24.56  ? 184 SER C C     1 
ATOM   5993  O O     . SER C  1 122 ? -23.639 -39.453 19.562  1.00 24.20  ? 184 SER C O     1 
ATOM   5994  C CB    . SER C  1 122 ? -25.702 -41.493 20.344  1.00 26.01  ? 184 SER C CB    1 
ATOM   5995  O OG    . SER C  1 122 ? -25.167 -42.286 21.380  1.00 28.03  ? 184 SER C OG    1 
ATOM   5996  N N     . GLU C  1 123 ? -23.443 -39.536 21.771  1.00 25.84  ? 185 GLU C N     1 
ATOM   5997  C CA    . GLU C  1 123 ? -21.968 -39.578 21.802  1.00 27.12  ? 185 GLU C CA    1 
ATOM   5998  C C     . GLU C  1 123 ? -21.556 -40.982 22.277  1.00 26.92  ? 185 GLU C C     1 
ATOM   5999  O O     . GLU C  1 123 ? -21.576 -41.333 23.449  1.00 26.72  ? 185 GLU C O     1 
ATOM   6000  C CB    . GLU C  1 123 ? -21.344 -38.402 22.605  1.00 28.67  ? 185 GLU C CB    1 
ATOM   6001  C CG    . GLU C  1 123 ? -20.321 -38.772 23.694  1.00 31.10  ? 185 GLU C CG    1 
ATOM   6002  C CD    . GLU C  1 123 ? -18.957 -39.157 23.192  1.00 31.12  ? 185 GLU C CD    1 
ATOM   6003  O OE1   . GLU C  1 123 ? -18.700 -38.774 22.046  1.00 32.27  ? 185 GLU C OE1   1 
ATOM   6004  O OE2   . GLU C  1 123 ? -18.174 -39.833 23.934  1.00 31.60  ? 185 GLU C OE2   1 
ATOM   6005  N N     . TRP C  1 124 ? -21.222 -41.805 21.312  1.00 27.92  ? 186 TRP C N     1 
ATOM   6006  C CA    . TRP C  1 124 ? -20.987 -43.203 21.564  1.00 29.30  ? 186 TRP C CA    1 
ATOM   6007  C C     . TRP C  1 124 ? -19.532 -43.475 21.392  1.00 28.74  ? 186 TRP C C     1 
ATOM   6008  O O     . TRP C  1 124 ? -19.106 -44.616 21.511  1.00 30.02  ? 186 TRP C O     1 
ATOM   6009  C CB    . TRP C  1 124 ? -21.759 -44.055 20.551  1.00 30.87  ? 186 TRP C CB    1 
ATOM   6010  C CG    . TRP C  1 124 ? -21.559 -43.598 19.107  1.00 31.95  ? 186 TRP C CG    1 
ATOM   6011  C CD1   . TRP C  1 124 ? -22.370 -42.739 18.394  1.00 33.75  ? 186 TRP C CD1   1 
ATOM   6012  C CD2   . TRP C  1 124 ? -20.491 -43.961 18.223  1.00 31.49  ? 186 TRP C CD2   1 
ATOM   6013  N NE1   . TRP C  1 124 ? -21.862 -42.544 17.126  1.00 34.65  ? 186 TRP C NE1   1 
ATOM   6014  C CE2   . TRP C  1 124 ? -20.710 -43.282 16.998  1.00 32.45  ? 186 TRP C CE2   1 
ATOM   6015  C CE3   . TRP C  1 124 ? -19.376 -44.791 18.342  1.00 30.55  ? 186 TRP C CE3   1 
ATOM   6016  C CZ2   . TRP C  1 124 ? -19.849 -43.409 15.915  1.00 30.48  ? 186 TRP C CZ2   1 
ATOM   6017  C CZ3   . TRP C  1 124 ? -18.526 -44.917 17.260  1.00 30.10  ? 186 TRP C CZ3   1 
ATOM   6018  C CH2   . TRP C  1 124 ? -18.769 -44.230 16.063  1.00 30.46  ? 186 TRP C CH2   1 
ATOM   6019  N N     . MET C  1 125 ? -18.764 -42.444 21.078  1.00 27.13  ? 187 MET C N     1 
ATOM   6020  C CA    . MET C  1 125 ? -17.396 -42.661 20.674  1.00 26.33  ? 187 MET C CA    1 
ATOM   6021  C C     . MET C  1 125 ? -16.511 -42.901 21.884  1.00 27.65  ? 187 MET C C     1 
ATOM   6022  O O     . MET C  1 125 ? -16.713 -42.320 22.989  1.00 30.50  ? 187 MET C O     1 
ATOM   6023  C CB    . MET C  1 125 ? -16.887 -41.475 19.864  1.00 25.19  ? 187 MET C CB    1 
ATOM   6024  C CG    . MET C  1 125 ? -17.562 -41.313 18.515  1.00 23.74  ? 187 MET C CG    1 
ATOM   6025  S SD    . MET C  1 125 ? -19.119 -40.434 18.574  1.00 21.32  ? 187 MET C SD    1 
ATOM   6026  C CE    . MET C  1 125 ? -18.553 -38.748 18.771  1.00 21.76  ? 187 MET C CE    1 
ATOM   6027  N N     . GLY C  1 126 ? -15.541 -43.779 21.663  1.00 28.12  ? 188 GLY C N     1 
ATOM   6028  C CA    . GLY C  1 126 ? -14.543 -44.119 22.663  1.00 30.47  ? 188 GLY C CA    1 
ATOM   6029  C C     . GLY C  1 126 ? -13.166 -43.850 22.094  1.00 31.79  ? 188 GLY C C     1 
ATOM   6030  O O     . GLY C  1 126 ? -13.037 -43.406 20.951  1.00 35.16  ? 188 GLY C O     1 
ATOM   6031  N N     . TYR C  1 127 ? -12.133 -44.085 22.899  1.00 32.12  ? 189 TYR C N     1 
ATOM   6032  C CA    . TYR C  1 127 ? -10.742 -43.952 22.436  1.00 31.21  ? 189 TYR C CA    1 
ATOM   6033  C C     . TYR C  1 127 ? -10.528 -44.839 21.213  1.00 31.22  ? 189 TYR C C     1 
ATOM   6034  O O     . TYR C  1 127 ? -11.114 -45.916 21.135  1.00 29.90  ? 189 TYR C O     1 
ATOM   6035  C CB    . TYR C  1 127 ? -9.777  -44.355 23.551  1.00 29.77  ? 189 TYR C CB    1 
ATOM   6036  C CG    . TYR C  1 127 ? -9.893  -43.510 24.793  1.00 27.63  ? 189 TYR C CG    1 
ATOM   6037  C CD1   . TYR C  1 127 ? -9.832  -42.121 24.710  1.00 27.44  ? 189 TYR C CD1   1 
ATOM   6038  C CD2   . TYR C  1 127 ? -10.061 -44.085 26.050  1.00 26.42  ? 189 TYR C CD2   1 
ATOM   6039  C CE1   . TYR C  1 127 ? -9.938  -41.328 25.836  1.00 27.12  ? 189 TYR C CE1   1 
ATOM   6040  C CE2   . TYR C  1 127 ? -10.170 -43.286 27.191  1.00 26.15  ? 189 TYR C CE2   1 
ATOM   6041  C CZ    . TYR C  1 127 ? -10.104 -41.905 27.061  1.00 26.09  ? 189 TYR C CZ    1 
ATOM   6042  O OH    . TYR C  1 127 ? -10.172 -41.033 28.097  1.00 25.23  ? 189 TYR C OH    1 
ATOM   6043  N N     . CYS C  1 128 ? -9.717  -44.383 20.253  1.00 32.14  ? 190 CYS C N     1 
ATOM   6044  C CA    . CYS C  1 128 ? -9.533  -45.124 18.971  1.00 31.12  ? 190 CYS C CA    1 
ATOM   6045  C C     . CYS C  1 128 ? -10.883 -45.454 18.321  1.00 29.35  ? 190 CYS C C     1 
ATOM   6046  O O     . CYS C  1 128 ? -11.050 -46.489 17.666  1.00 27.66  ? 190 CYS C O     1 
ATOM   6047  C CB    . CYS C  1 128 ? -8.731  -46.425 19.193  1.00 31.63  ? 190 CYS C CB    1 
ATOM   6048  S SG    . CYS C  1 128 ? -8.057  -47.252 17.719  1.00 29.43  ? 190 CYS C SG    1 
ATOM   6049  N N     . LEU C  1 129 ? -11.828 -44.538 18.520  1.00 28.76  ? 191 LEU C N     1 
ATOM   6050  C CA    . LEU C  1 129 ? -13.197 -44.618 17.994  1.00 28.98  ? 191 LEU C CA    1 
ATOM   6051  C C     . LEU C  1 129 ? -14.104 -45.670 18.650  1.00 28.27  ? 191 LEU C C     1 
ATOM   6052  O O     . LEU C  1 129 ? -15.178 -45.332 19.159  1.00 27.62  ? 191 LEU C O     1 
ATOM   6053  C CB    . LEU C  1 129 ? -13.213 -44.777 16.454  1.00 28.12  ? 191 LEU C CB    1 
ATOM   6054  C CG    . LEU C  1 129 ? -14.560 -44.517 15.766  1.00 26.77  ? 191 LEU C CG    1 
ATOM   6055  C CD1   . LEU C  1 129 ? -15.156 -43.180 16.171  1.00 27.04  ? 191 LEU C CD1   1 
ATOM   6056  C CD2   . LEU C  1 129 ? -14.406 -44.531 14.276  1.00 26.16  ? 191 LEU C CD2   1 
ATOM   6057  N N     . PHE C  1 130 ? -13.668 -46.922 18.632  1.00 27.83  ? 192 PHE C N     1 
ATOM   6058  C CA    . PHE C  1 130 ? -14.542 -48.044 18.944  1.00 28.20  ? 192 PHE C CA    1 
ATOM   6059  C C     . PHE C  1 130 ? -14.385 -48.635 20.339  1.00 30.51  ? 192 PHE C C     1 
ATOM   6060  O O     . PHE C  1 130 ? -15.056 -49.594 20.669  1.00 32.43  ? 192 PHE C O     1 
ATOM   6061  C CB    . PHE C  1 130 ? -14.300 -49.146 17.940  1.00 26.48  ? 192 PHE C CB    1 
ATOM   6062  C CG    . PHE C  1 130 ? -14.553 -48.734 16.539  1.00 26.03  ? 192 PHE C CG    1 
ATOM   6063  C CD1   . PHE C  1 130 ? -15.835 -48.410 16.127  1.00 25.07  ? 192 PHE C CD1   1 
ATOM   6064  C CD2   . PHE C  1 130 ? -13.510 -48.665 15.621  1.00 26.14  ? 192 PHE C CD2   1 
ATOM   6065  C CE1   . PHE C  1 130 ? -16.078 -48.039 14.824  1.00 25.09  ? 192 PHE C CE1   1 
ATOM   6066  C CE2   . PHE C  1 130 ? -13.747 -48.293 14.306  1.00 25.69  ? 192 PHE C CE2   1 
ATOM   6067  C CZ    . PHE C  1 130 ? -15.033 -47.985 13.909  1.00 25.37  ? 192 PHE C CZ    1 
ATOM   6068  N N     . TYR C  1 131 ? -13.515 -48.081 21.167  1.00 33.23  ? 193 TYR C N     1 
ATOM   6069  C CA    . TYR C  1 131 ? -13.341 -48.619 22.505  1.00 34.16  ? 193 TYR C CA    1 
ATOM   6070  C C     . TYR C  1 131 ? -14.658 -48.514 23.270  1.00 32.94  ? 193 TYR C C     1 
ATOM   6071  O O     . TYR C  1 131 ? -15.415 -47.565 23.075  1.00 32.35  ? 193 TYR C O     1 
ATOM   6072  C CB    . TYR C  1 131 ? -12.214 -47.895 23.245  1.00 36.53  ? 193 TYR C CB    1 
ATOM   6073  C CG    . TYR C  1 131 ? -11.933 -48.458 24.627  1.00 39.65  ? 193 TYR C CG    1 
ATOM   6074  C CD1   . TYR C  1 131 ? -11.504 -49.787 24.793  1.00 39.84  ? 193 TYR C CD1   1 
ATOM   6075  C CD2   . TYR C  1 131 ? -12.090 -47.663 25.775  1.00 40.03  ? 193 TYR C CD2   1 
ATOM   6076  C CE1   . TYR C  1 131 ? -11.249 -50.306 26.054  1.00 40.37  ? 193 TYR C CE1   1 
ATOM   6077  C CE2   . TYR C  1 131 ? -11.817 -48.171 27.037  1.00 39.41  ? 193 TYR C CE2   1 
ATOM   6078  C CZ    . TYR C  1 131 ? -11.398 -49.491 27.169  1.00 40.29  ? 193 TYR C CZ    1 
ATOM   6079  O OH    . TYR C  1 131 ? -11.125 -50.000 28.415  1.00 41.48  ? 193 TYR C OH    1 
ATOM   6080  N N     . GLU C  1 132 ? -14.907 -49.522 24.113  1.00 32.71  ? 194 GLU C N     1 
ATOM   6081  C CA    . GLU C  1 132 ? -16.153 -49.735 24.849  1.00 31.04  ? 194 GLU C CA    1 
ATOM   6082  C C     . GLU C  1 132 ? -17.300 -50.232 23.978  1.00 30.11  ? 194 GLU C C     1 
ATOM   6083  O O     . GLU C  1 132 ? -18.355 -50.554 24.493  1.00 30.61  ? 194 GLU C O     1 
ATOM   6084  C CB    . GLU C  1 132 ? -16.572 -48.485 25.584  1.00 32.72  ? 194 GLU C CB    1 
ATOM   6085  C CG    . GLU C  1 132 ? -15.570 -48.023 26.596  1.00 33.53  ? 194 GLU C CG    1 
ATOM   6086  C CD    . GLU C  1 132 ? -15.926 -46.672 27.125  1.00 36.72  ? 194 GLU C CD    1 
ATOM   6087  O OE1   . GLU C  1 132 ? -16.635 -45.894 26.426  1.00 38.96  ? 194 GLU C OE1   1 
ATOM   6088  O OE2   . GLU C  1 132 ? -15.495 -46.397 28.258  1.00 40.43  ? 194 GLU C OE2   1 
ATOM   6089  N N     . SER C  1 133 ? -17.102 -50.288 22.666  1.00 28.23  ? 195 SER C N     1 
ATOM   6090  C CA    . SER C  1 133 ? -18.040 -50.928 21.758  1.00 27.00  ? 195 SER C CA    1 
ATOM   6091  C C     . SER C  1 133 ? -19.440 -50.339 21.771  1.00 25.78  ? 195 SER C C     1 
ATOM   6092  O O     . SER C  1 133 ? -20.392 -51.035 21.435  1.00 25.20  ? 195 SER C O     1 
ATOM   6093  C CB    . SER C  1 133 ? -18.093 -52.447 22.035  1.00 27.60  ? 195 SER C CB    1 
ATOM   6094  O OG    . SER C  1 133 ? -16.857 -53.088 21.726  1.00 29.25  ? 195 SER C OG    1 
ATOM   6095  N N     . MET C  1 134 ? -19.581 -49.055 22.100  1.00 25.84  ? 196 MET C N     1 
ATOM   6096  C CA    . MET C  1 134 ? -20.928 -48.468 22.252  1.00 24.52  ? 196 MET C CA    1 
ATOM   6097  C C     . MET C  1 134 ? -21.667 -48.233 20.949  1.00 23.69  ? 196 MET C C     1 
ATOM   6098  O O     . MET C  1 134 ? -22.835 -47.956 20.967  1.00 23.39  ? 196 MET C O     1 
ATOM   6099  C CB    . MET C  1 134 ? -20.886 -47.149 23.012  1.00 25.04  ? 196 MET C CB    1 
ATOM   6100  C CG    . MET C  1 134 ? -22.282 -46.576 23.254  1.00 25.83  ? 196 MET C CG    1 
ATOM   6101  S SD    . MET C  1 134 ? -22.367 -45.187 24.385  1.00 26.08  ? 196 MET C SD    1 
ATOM   6102  C CE    . MET C  1 134 ? -24.019 -44.595 24.080  1.00 26.86  ? 196 MET C CE    1 
ATOM   6103  N N     . LEU C  1 135 ? -20.988 -48.287 19.818  1.00 24.96  ? 197 LEU C N     1 
ATOM   6104  C CA    . LEU C  1 135 ? -21.667 -48.175 18.531  1.00 25.39  ? 197 LEU C CA    1 
ATOM   6105  C C     . LEU C  1 135 ? -22.685 -49.291 18.350  1.00 25.68  ? 197 LEU C C     1 
ATOM   6106  O O     . LEU C  1 135 ? -23.732 -49.095 17.753  1.00 25.43  ? 197 LEU C O     1 
ATOM   6107  C CB    . LEU C  1 135 ? -20.648 -48.209 17.391  1.00 26.40  ? 197 LEU C CB    1 
ATOM   6108  C CG    . LEU C  1 135 ? -21.177 -48.041 15.956  1.00 27.35  ? 197 LEU C CG    1 
ATOM   6109  C CD1   . LEU C  1 135 ? -22.076 -46.807 15.823  1.00 27.63  ? 197 LEU C CD1   1 
ATOM   6110  C CD2   . LEU C  1 135 ? -20.013 -47.947 14.973  1.00 27.63  ? 197 LEU C CD2   1 
ATOM   6111  N N     . ASN C  1 136 ? -22.371 -50.464 18.889  1.00 27.24  ? 198 ASN C N     1 
ATOM   6112  C CA    . ASN C  1 136 ? -23.278 -51.620 18.846  1.00 28.02  ? 198 ASN C CA    1 
ATOM   6113  C C     . ASN C  1 136 ? -24.652 -51.341 19.462  1.00 27.09  ? 198 ASN C C     1 
ATOM   6114  O O     . ASN C  1 136 ? -25.685 -51.804 18.962  1.00 28.15  ? 198 ASN C O     1 
ATOM   6115  C CB    . ASN C  1 136 ? -22.656 -52.813 19.570  1.00 28.67  ? 198 ASN C CB    1 
ATOM   6116  C CG    . ASN C  1 136 ? -21.316 -53.220 18.994  1.00 29.58  ? 198 ASN C CG    1 
ATOM   6117  O OD1   . ASN C  1 136 ? -20.813 -52.617 18.065  1.00 31.10  ? 198 ASN C OD1   1 
ATOM   6118  N ND2   . ASN C  1 136 ? -20.730 -54.244 19.559  1.00 32.25  ? 198 ASN C ND2   1 
ATOM   6119  N N     . THR C  1 137 ? -24.643 -50.585 20.552  1.00 25.15  ? 199 THR C N     1 
ATOM   6120  C CA    . THR C  1 137 ? -25.862 -50.067 21.137  1.00 23.77  ? 199 THR C CA    1 
ATOM   6121  C C     . THR C  1 137 ? -26.541 -49.033 20.202  1.00 24.40  ? 199 THR C C     1 
ATOM   6122  O O     . THR C  1 137 ? -27.757 -49.084 19.973  1.00 25.79  ? 199 THR C O     1 
ATOM   6123  C CB    . THR C  1 137 ? -25.590 -49.453 22.515  1.00 22.20  ? 199 THR C CB    1 
ATOM   6124  O OG1   . THR C  1 137 ? -25.180 -50.483 23.410  1.00 20.82  ? 199 THR C OG1   1 
ATOM   6125  C CG2   . THR C  1 137 ? -26.824 -48.821 23.070  1.00 22.08  ? 199 THR C CG2   1 
ATOM   6126  N N     . VAL C  1 138 ? -25.783 -48.100 19.649  1.00 23.60  ? 200 VAL C N     1 
ATOM   6127  C CA    . VAL C  1 138 ? -26.392 -47.167 18.733  1.00 23.35  ? 200 VAL C CA    1 
ATOM   6128  C C     . VAL C  1 138 ? -27.037 -47.958 17.583  1.00 23.25  ? 200 VAL C C     1 
ATOM   6129  O O     . VAL C  1 138 ? -28.192 -47.715 17.236  1.00 23.81  ? 200 VAL C O     1 
ATOM   6130  C CB    . VAL C  1 138 ? -25.389 -46.114 18.239  1.00 23.48  ? 200 VAL C CB    1 
ATOM   6131  C CG1   . VAL C  1 138 ? -25.990 -45.272 17.133  1.00 24.16  ? 200 VAL C CG1   1 
ATOM   6132  C CG2   . VAL C  1 138 ? -25.013 -45.198 19.377  1.00 23.61  ? 200 VAL C CG2   1 
ATOM   6133  N N     . ILE C  1 139 ? -26.317 -48.927 17.023  1.00 23.12  ? 201 ILE C N     1 
ATOM   6134  C CA    . ILE C  1 139 ? -26.859 -49.773 15.936  1.00 23.64  ? 201 ILE C CA    1 
ATOM   6135  C C     . ILE C  1 139 ? -28.214 -50.414 16.311  1.00 22.89  ? 201 ILE C C     1 
ATOM   6136  O O     . ILE C  1 139 ? -29.206 -50.352 15.562  1.00 20.67  ? 201 ILE C O     1 
ATOM   6137  C CB    . ILE C  1 139 ? -25.886 -50.916 15.604  1.00 24.54  ? 201 ILE C CB    1 
ATOM   6138  C CG1   . ILE C  1 139 ? -24.512 -50.344 15.229  1.00 25.46  ? 201 ILE C CG1   1 
ATOM   6139  C CG2   . ILE C  1 139 ? -26.487 -51.844 14.537  1.00 24.83  ? 201 ILE C CG2   1 
ATOM   6140  C CD1   . ILE C  1 139 ? -24.093 -50.519 13.785  1.00 26.69  ? 201 ILE C CD1   1 
ATOM   6141  N N     . PHE C  1 140 ? -28.227 -51.038 17.488  1.00 22.41  ? 202 PHE C N     1 
ATOM   6142  C CA    . PHE C  1 140 ? -29.429 -51.621 18.026  1.00 21.45  ? 202 PHE C CA    1 
ATOM   6143  C C     . PHE C  1 140 ? -30.552 -50.567 18.047  1.00 20.72  ? 202 PHE C C     1 
ATOM   6144  O O     . PHE C  1 140 ? -31.642 -50.792 17.537  1.00 20.70  ? 202 PHE C O     1 
ATOM   6145  C CB    . PHE C  1 140 ? -29.159 -52.153 19.419  1.00 20.88  ? 202 PHE C CB    1 
ATOM   6146  C CG    . PHE C  1 140 ? -30.347 -52.795 20.045  1.00 21.51  ? 202 PHE C CG    1 
ATOM   6147  C CD1   . PHE C  1 140 ? -31.372 -52.028 20.585  1.00 21.43  ? 202 PHE C CD1   1 
ATOM   6148  C CD2   . PHE C  1 140 ? -30.467 -54.179 20.073  1.00 22.03  ? 202 PHE C CD2   1 
ATOM   6149  C CE1   . PHE C  1 140 ? -32.484 -52.635 21.152  1.00 21.54  ? 202 PHE C CE1   1 
ATOM   6150  C CE2   . PHE C  1 140 ? -31.581 -54.790 20.634  1.00 21.42  ? 202 PHE C CE2   1 
ATOM   6151  C CZ    . PHE C  1 140 ? -32.579 -54.016 21.185  1.00 21.21  ? 202 PHE C CZ    1 
ATOM   6152  N N     . ALA C  1 141 ? -30.271 -49.410 18.622  1.00 20.10  ? 203 ALA C N     1 
ATOM   6153  C CA    . ALA C  1 141 ? -31.278 -48.370 18.749  1.00 19.83  ? 203 ALA C CA    1 
ATOM   6154  C C     . ALA C  1 141 ? -31.817 -47.905 17.412  1.00 20.03  ? 203 ALA C C     1 
ATOM   6155  O O     . ALA C  1 141 ? -33.028 -47.777 17.253  1.00 19.59  ? 203 ALA C O     1 
ATOM   6156  C CB    . ALA C  1 141 ? -30.720 -47.196 19.516  1.00 19.52  ? 203 ALA C CB    1 
ATOM   6157  N N     . ARG C  1 142 ? -30.918 -47.667 16.454  1.00 20.56  ? 204 ARG C N     1 
ATOM   6158  C CA    . ARG C  1 142 ? -31.298 -47.289 15.092  1.00 20.64  ? 204 ARG C CA    1 
ATOM   6159  C C     . ARG C  1 142 ? -32.256 -48.320 14.487  1.00 21.11  ? 204 ARG C C     1 
ATOM   6160  O O     . ARG C  1 142 ? -33.397 -47.998 14.116  1.00 20.08  ? 204 ARG C O     1 
ATOM   6161  C CB    . ARG C  1 142 ? -30.048 -47.202 14.223  1.00 21.05  ? 204 ARG C CB    1 
ATOM   6162  C CG    . ARG C  1 142 ? -30.295 -46.825 12.761  1.00 21.41  ? 204 ARG C CG    1 
ATOM   6163  C CD    . ARG C  1 142 ? -29.116 -47.237 11.878  1.00 21.61  ? 204 ARG C CD    1 
ATOM   6164  N NE    . ARG C  1 142 ? -28.936 -48.686 11.871  1.00 21.63  ? 204 ARG C NE    1 
ATOM   6165  C CZ    . ARG C  1 142 ? -27.835 -49.326 11.503  1.00 22.49  ? 204 ARG C CZ    1 
ATOM   6166  N NH1   . ARG C  1 142 ? -26.751 -48.669 11.087  1.00 23.80  ? 204 ARG C NH1   1 
ATOM   6167  N NH2   . ARG C  1 142 ? -27.811 -50.651 11.567  1.00 22.79  ? 204 ARG C NH2   1 
ATOM   6168  N N     . ASP C  1 143 ? -31.771 -49.562 14.406  1.00 22.15  ? 205 ASP C N     1 
ATOM   6169  C CA    . ASP C  1 143 ? -32.527 -50.682 13.842  1.00 22.40  ? 205 ASP C CA    1 
ATOM   6170  C C     . ASP C  1 143 ? -33.918 -50.742 14.458  1.00 22.77  ? 205 ASP C C     1 
ATOM   6171  O O     . ASP C  1 143 ? -34.907 -50.714 13.729  1.00 22.86  ? 205 ASP C O     1 
ATOM   6172  C CB    . ASP C  1 143 ? -31.767 -52.021 14.013  1.00 21.85  ? 205 ASP C CB    1 
ATOM   6173  C CG    . ASP C  1 143 ? -30.586 -52.173 13.018  1.00 21.49  ? 205 ASP C CG    1 
ATOM   6174  O OD1   . ASP C  1 143 ? -30.484 -51.380 12.047  1.00 20.05  ? 205 ASP C OD1   1 
ATOM   6175  O OD2   . ASP C  1 143 ? -29.755 -53.092 13.203  1.00 21.04  ? 205 ASP C OD2   1 
ATOM   6176  N N     . LYS C  1 144 ? -33.989 -50.748 15.787  1.00 23.30  ? 206 LYS C N     1 
ATOM   6177  C CA    . LYS C  1 144 ? -35.263 -50.866 16.488  1.00 24.28  ? 206 LYS C CA    1 
ATOM   6178  C C     . LYS C  1 144 ? -36.182 -49.649 16.322  1.00 24.04  ? 206 LYS C C     1 
ATOM   6179  O O     . LYS C  1 144 ? -37.325 -49.801 15.912  1.00 24.49  ? 206 LYS C O     1 
ATOM   6180  C CB    . LYS C  1 144 ? -35.025 -51.122 17.964  1.00 26.18  ? 206 LYS C CB    1 
ATOM   6181  C CG    . LYS C  1 144 ? -36.293 -51.329 18.772  1.00 28.02  ? 206 LYS C CG    1 
ATOM   6182  C CD    . LYS C  1 144 ? -35.965 -51.977 20.097  1.00 29.46  ? 206 LYS C CD    1 
ATOM   6183  C CE    . LYS C  1 144 ? -37.233 -52.411 20.804  1.00 31.57  ? 206 LYS C CE    1 
ATOM   6184  N NZ    . LYS C  1 144 ? -36.918 -53.261 21.987  1.00 34.22  ? 206 LYS C NZ    1 
ATOM   6185  N N     . TRP C  1 145 ? -35.693 -48.447 16.602  1.00 22.98  ? 207 TRP C N     1 
ATOM   6186  C CA    . TRP C  1 145 ? -36.585 -47.304 16.708  1.00 22.60  ? 207 TRP C CA    1 
ATOM   6187  C C     . TRP C  1 145 ? -36.528 -46.247 15.596  1.00 22.86  ? 207 TRP C C     1 
ATOM   6188  O O     . TRP C  1 145 ? -37.453 -45.438 15.482  1.00 23.27  ? 207 TRP C O     1 
ATOM   6189  C CB    . TRP C  1 145 ? -36.352 -46.615 18.048  1.00 22.66  ? 207 TRP C CB    1 
ATOM   6190  C CG    . TRP C  1 145 ? -36.754 -47.418 19.220  1.00 22.38  ? 207 TRP C CG    1 
ATOM   6191  C CD1   . TRP C  1 145 ? -38.001 -47.823 19.529  1.00 22.30  ? 207 TRP C CD1   1 
ATOM   6192  C CD2   . TRP C  1 145 ? -35.907 -47.886 20.262  1.00 22.60  ? 207 TRP C CD2   1 
ATOM   6193  N NE1   . TRP C  1 145 ? -37.991 -48.528 20.695  1.00 22.77  ? 207 TRP C NE1   1 
ATOM   6194  C CE2   . TRP C  1 145 ? -36.712 -48.585 21.166  1.00 23.00  ? 207 TRP C CE2   1 
ATOM   6195  C CE3   . TRP C  1 145 ? -34.541 -47.782 20.518  1.00 23.28  ? 207 TRP C CE3   1 
ATOM   6196  C CZ2   . TRP C  1 145 ? -36.203 -49.182 22.317  1.00 24.40  ? 207 TRP C CZ2   1 
ATOM   6197  C CZ3   . TRP C  1 145 ? -34.026 -48.376 21.660  1.00 23.98  ? 207 TRP C CZ3   1 
ATOM   6198  C CH2   . TRP C  1 145 ? -34.855 -49.069 22.546  1.00 24.66  ? 207 TRP C CH2   1 
ATOM   6199  N N     . LEU C  1 146 ? -35.462 -46.194 14.807  1.00 22.88  ? 208 LEU C N     1 
ATOM   6200  C CA    . LEU C  1 146 ? -35.323 -45.069 13.879  1.00 23.28  ? 208 LEU C CA    1 
ATOM   6201  C C     . LEU C  1 146 ? -36.265 -45.244 12.725  1.00 24.56  ? 208 LEU C C     1 
ATOM   6202  O O     . LEU C  1 146 ? -36.276 -46.289 12.121  1.00 25.84  ? 208 LEU C O     1 
ATOM   6203  C CB    . LEU C  1 146 ? -33.896 -44.938 13.339  1.00 22.70  ? 208 LEU C CB    1 
ATOM   6204  C CG    . LEU C  1 146 ? -33.590 -43.664 12.524  1.00 21.98  ? 208 LEU C CG    1 
ATOM   6205  C CD1   . LEU C  1 146 ? -33.826 -42.396 13.335  1.00 21.97  ? 208 LEU C CD1   1 
ATOM   6206  C CD2   . LEU C  1 146 ? -32.178 -43.670 11.968  1.00 21.44  ? 208 LEU C CD2   1 
ATOM   6207  N N     . LYS C  1 147 ? -37.054 -44.223 12.410  1.00 27.20  ? 209 LYS C N     1 
ATOM   6208  C CA    . LYS C  1 147 ? -37.986 -44.301 11.277  1.00 28.94  ? 209 LYS C CA    1 
ATOM   6209  C C     . LYS C  1 147 ? -37.227 -44.366 9.957   1.00 30.27  ? 209 LYS C C     1 
ATOM   6210  O O     . LYS C  1 147 ? -36.073 -43.949 9.890   1.00 29.26  ? 209 LYS C O     1 
ATOM   6211  C CB    . LYS C  1 147 ? -38.953 -43.104 11.270  1.00 29.22  ? 209 LYS C CB    1 
ATOM   6212  C CG    . LYS C  1 147 ? -38.352 -41.819 10.732  1.00 29.93  ? 209 LYS C CG    1 
ATOM   6213  C CD    . LYS C  1 147 ? -39.348 -40.663 10.703  1.00 30.86  ? 209 LYS C CD    1 
ATOM   6214  C CE    . LYS C  1 147 ? -38.741 -39.455 9.994   1.00 31.21  ? 209 LYS C CE    1 
ATOM   6215  N NZ    . LYS C  1 147 ? -39.343 -38.144 10.346  1.00 29.85  ? 209 LYS C NZ    1 
ATOM   6216  N N     . PRO C  1 148 ? -37.876 -44.880 8.897   1.00 33.21  ? 210 PRO C N     1 
ATOM   6217  C CA    . PRO C  1 148 ? -37.205 -44.791 7.604   1.00 33.09  ? 210 PRO C CA    1 
ATOM   6218  C C     . PRO C  1 148 ? -36.962 -43.326 7.212   1.00 32.79  ? 210 PRO C C     1 
ATOM   6219  O O     . PRO C  1 148 ? -37.850 -42.480 7.357   1.00 32.40  ? 210 PRO C O     1 
ATOM   6220  C CB    . PRO C  1 148 ? -38.186 -45.479 6.645   1.00 33.62  ? 210 PRO C CB    1 
ATOM   6221  C CG    . PRO C  1 148 ? -39.086 -46.306 7.503   1.00 33.74  ? 210 PRO C CG    1 
ATOM   6222  C CD    . PRO C  1 148 ? -39.178 -45.572 8.806   1.00 33.55  ? 210 PRO C CD    1 
ATOM   6223  N N     . GLY C  1 149 ? -35.746 -43.037 6.757   1.00 32.67  ? 211 GLY C N     1 
ATOM   6224  C CA    . GLY C  1 149 ? -35.348 -41.680 6.417   1.00 31.80  ? 211 GLY C CA    1 
ATOM   6225  C C     . GLY C  1 149 ? -35.098 -40.802 7.619   1.00 31.42  ? 211 GLY C C     1 
ATOM   6226  O O     . GLY C  1 149 ? -34.898 -39.604 7.476   1.00 32.44  ? 211 GLY C O     1 
ATOM   6227  N N     . GLY C  1 150 ? -35.103 -41.389 8.810   1.00 31.03  ? 212 GLY C N     1 
ATOM   6228  C CA    . GLY C  1 150 ? -34.751 -40.657 10.014  1.00 31.08  ? 212 GLY C CA    1 
ATOM   6229  C C     . GLY C  1 150 ? -33.301 -40.202 9.961   1.00 31.26  ? 212 GLY C C     1 
ATOM   6230  O O     . GLY C  1 150 ? -32.530 -40.699 9.139   1.00 32.00  ? 212 GLY C O     1 
ATOM   6231  N N     . LEU C  1 151 ? -32.935 -39.270 10.844  1.00 30.39  ? 213 LEU C N     1 
ATOM   6232  C CA    . LEU C  1 151 ? -31.596 -38.682 10.868  1.00 29.78  ? 213 LEU C CA    1 
ATOM   6233  C C     . LEU C  1 151 ? -30.816 -39.122 12.083  1.00 29.99  ? 213 LEU C C     1 
ATOM   6234  O O     . LEU C  1 151 ? -31.399 -39.511 13.084  1.00 31.19  ? 213 LEU C O     1 
ATOM   6235  C CB    . LEU C  1 151 ? -31.683 -37.164 10.875  1.00 29.06  ? 213 LEU C CB    1 
ATOM   6236  C CG    . LEU C  1 151 ? -32.543 -36.572 9.764   1.00 29.21  ? 213 LEU C CG    1 
ATOM   6237  C CD1   . LEU C  1 151 ? -32.529 -35.059 9.869   1.00 28.89  ? 213 LEU C CD1   1 
ATOM   6238  C CD2   . LEU C  1 151 ? -32.075 -37.009 8.388   1.00 29.67  ? 213 LEU C CD2   1 
ATOM   6239  N N     . MET C  1 152 ? -29.489 -39.056 11.982  1.00 29.73  ? 214 MET C N     1 
ATOM   6240  C CA    . MET C  1 152 ? -28.596 -39.360 13.103  1.00 28.10  ? 214 MET C CA    1 
ATOM   6241  C C     . MET C  1 152 ? -27.522 -38.273 13.291  1.00 28.25  ? 214 MET C C     1 
ATOM   6242  O O     . MET C  1 152 ? -27.008 -37.666 12.327  1.00 29.67  ? 214 MET C O     1 
ATOM   6243  C CB    . MET C  1 152 ? -27.985 -40.748 12.939  1.00 26.53  ? 214 MET C CB    1 
ATOM   6244  C CG    . MET C  1 152 ? -29.030 -41.856 12.937  1.00 26.37  ? 214 MET C CG    1 
ATOM   6245  S SD    . MET C  1 152 ? -28.348 -43.530 12.811  1.00 26.19  ? 214 MET C SD    1 
ATOM   6246  C CE    . MET C  1 152 ? -28.115 -43.930 14.546  1.00 26.26  ? 214 MET C CE    1 
ATOM   6247  N N     . PHE C  1 153 ? -27.248 -37.997 14.563  1.00 28.27  ? 215 PHE C N     1 
ATOM   6248  C CA    . PHE C  1 153 ? -26.339 -36.935 14.999  1.00 28.51  ? 215 PHE C CA    1 
ATOM   6249  C C     . PHE C  1 153 ? -25.314 -37.531 15.960  1.00 29.71  ? 215 PHE C C     1 
ATOM   6250  O O     . PHE C  1 153 ? -25.647 -37.777 17.124  1.00 30.51  ? 215 PHE C O     1 
ATOM   6251  C CB    . PHE C  1 153 ? -27.120 -35.840 15.722  1.00 27.09  ? 215 PHE C CB    1 
ATOM   6252  C CG    . PHE C  1 153 ? -27.788 -34.869 14.804  1.00 26.71  ? 215 PHE C CG    1 
ATOM   6253  C CD1   . PHE C  1 153 ? -28.881 -35.262 14.042  1.00 27.49  ? 215 PHE C CD1   1 
ATOM   6254  C CD2   . PHE C  1 153 ? -27.333 -33.563 14.700  1.00 26.30  ? 215 PHE C CD2   1 
ATOM   6255  C CE1   . PHE C  1 153 ? -29.500 -34.375 13.177  1.00 27.59  ? 215 PHE C CE1   1 
ATOM   6256  C CE2   . PHE C  1 153 ? -27.947 -32.666 13.846  1.00 26.47  ? 215 PHE C CE2   1 
ATOM   6257  C CZ    . PHE C  1 153 ? -29.035 -33.072 13.082  1.00 27.30  ? 215 PHE C CZ    1 
ATOM   6258  N N     . PRO C  1 154 ? -24.094 -37.817 15.499  1.00 32.01  ? 216 PRO C N     1 
ATOM   6259  C CA    . PRO C  1 154 ? -23.661 -37.667 14.126  1.00 31.77  ? 216 PRO C CA    1 
ATOM   6260  C C     . PRO C  1 154 ? -23.948 -38.938 13.308  1.00 30.90  ? 216 PRO C C     1 
ATOM   6261  O O     . PRO C  1 154 ? -24.370 -39.962 13.884  1.00 28.35  ? 216 PRO C O     1 
ATOM   6262  C CB    . PRO C  1 154 ? -22.152 -37.453 14.290  1.00 32.57  ? 216 PRO C CB    1 
ATOM   6263  C CG    . PRO C  1 154 ? -21.793 -38.232 15.525  1.00 33.50  ? 216 PRO C CG    1 
ATOM   6264  C CD    . PRO C  1 154 ? -23.063 -38.501 16.293  1.00 34.41  ? 216 PRO C CD    1 
ATOM   6265  N N     . ASP C  1 155 ? -23.675 -38.852 11.994  1.00 31.56  ? 217 ASP C N     1 
ATOM   6266  C CA    . ASP C  1 155 ? -23.971 -39.923 11.003  1.00 31.12  ? 217 ASP C CA    1 
ATOM   6267  C C     . ASP C  1 155 ? -22.780 -40.442 10.166  1.00 29.00  ? 217 ASP C C     1 
ATOM   6268  O O     . ASP C  1 155 ? -22.934 -41.376 9.390   1.00 25.98  ? 217 ASP C O     1 
ATOM   6269  C CB    . ASP C  1 155 ? -25.133 -39.495 10.072  1.00 32.67  ? 217 ASP C CB    1 
ATOM   6270  C CG    . ASP C  1 155 ? -25.008 -38.064 9.566   1.00 34.62  ? 217 ASP C CG    1 
ATOM   6271  O OD1   . ASP C  1 155 ? -23.879 -37.636 9.309   1.00 37.70  ? 217 ASP C OD1   1 
ATOM   6272  O OD2   . ASP C  1 155 ? -26.024 -37.347 9.428   1.00 38.36  ? 217 ASP C OD2   1 
ATOM   6273  N N     . ARG C  1 156 ? -21.613 -39.817 10.325  1.00 30.05  ? 218 ARG C N     1 
ATOM   6274  C CA    . ARG C  1 156 ? -20.363 -40.268 9.703   1.00 31.43  ? 218 ARG C CA    1 
ATOM   6275  C C     . ARG C  1 156 ? -19.221 -40.196 10.712  1.00 29.35  ? 218 ARG C C     1 
ATOM   6276  O O     . ARG C  1 156 ? -19.088 -39.223 11.478  1.00 25.81  ? 218 ARG C O     1 
ATOM   6277  C CB    . ARG C  1 156 ? -19.968 -39.397 8.492   1.00 35.21  ? 218 ARG C CB    1 
ATOM   6278  C CG    . ARG C  1 156 ? -20.385 -39.899 7.113   1.00 38.20  ? 218 ARG C CG    1 
ATOM   6279  C CD    . ARG C  1 156 ? -19.571 -39.231 6.009   1.00 40.35  ? 218 ARG C CD    1 
ATOM   6280  N NE    . ARG C  1 156 ? -18.205 -39.772 5.980   1.00 45.61  ? 218 ARG C NE    1 
ATOM   6281  C CZ    . ARG C  1 156 ? -17.105 -39.196 6.492   1.00 46.78  ? 218 ARG C CZ    1 
ATOM   6282  N NH1   . ARG C  1 156 ? -17.139 -37.999 7.087   1.00 43.93  ? 218 ARG C NH1   1 
ATOM   6283  N NH2   . ARG C  1 156 ? -15.934 -39.832 6.384   1.00 47.11  ? 218 ARG C NH2   1 
ATOM   6284  N N     . ALA C  1 157 ? -18.385 -41.229 10.663  1.00 29.18  ? 219 ALA C N     1 
ATOM   6285  C CA    . ALA C  1 157 ? -17.131 -41.292 11.409  1.00 28.71  ? 219 ALA C CA    1 
ATOM   6286  C C     . ALA C  1 157 ? -16.074 -41.996 10.552  1.00 28.94  ? 219 ALA C C     1 
ATOM   6287  O O     . ALA C  1 157 ? -16.398 -42.840 9.699   1.00 29.24  ? 219 ALA C O     1 
ATOM   6288  C CB    . ALA C  1 157 ? -17.319 -42.037 12.707  1.00 28.50  ? 219 ALA C CB    1 
ATOM   6289  N N     . ALA C  1 158 ? -14.812 -41.643 10.784  1.00 28.25  ? 220 ALA C N     1 
ATOM   6290  C CA    . ALA C  1 158 ? -13.701 -42.180 10.006  1.00 27.07  ? 220 ALA C CA    1 
ATOM   6291  C C     . ALA C  1 158 ? -12.456 -42.307 10.870  1.00 26.31  ? 220 ALA C C     1 
ATOM   6292  O O     . ALA C  1 158 ? -12.135 -41.416 11.661  1.00 26.01  ? 220 ALA C O     1 
ATOM   6293  C CB    . ALA C  1 158 ? -13.431 -41.282 8.817   1.00 27.24  ? 220 ALA C CB    1 
ATOM   6294  N N     . LEU C  1 159 ? -11.758 -43.418 10.710  1.00 25.61  ? 221 LEU C N     1 
ATOM   6295  C CA    . LEU C  1 159 ? -10.588 -43.706 11.509  1.00 25.48  ? 221 LEU C CA    1 
ATOM   6296  C C     . LEU C  1 159 ? -9.345  -43.721 10.631  1.00 26.04  ? 221 LEU C C     1 
ATOM   6297  O O     . LEU C  1 159 ? -9.343  -44.351 9.580   1.00 25.12  ? 221 LEU C O     1 
ATOM   6298  C CB    . LEU C  1 159 ? -10.777 -45.057 12.178  1.00 24.60  ? 221 LEU C CB    1 
ATOM   6299  C CG    . LEU C  1 159 ? -9.692  -45.512 13.139  1.00 24.58  ? 221 LEU C CG    1 
ATOM   6300  C CD1   . LEU C  1 159 ? -9.675  -44.622 14.367  1.00 24.75  ? 221 LEU C CD1   1 
ATOM   6301  C CD2   . LEU C  1 159 ? -9.894  -46.961 13.557  1.00 24.60  ? 221 LEU C CD2   1 
ATOM   6302  N N     . TYR C  1 160 ? -8.290  -43.036 11.076  1.00 27.26  ? 222 TYR C N     1 
ATOM   6303  C CA    . TYR C  1 160 ? -7.036  -42.936 10.317  1.00 27.58  ? 222 TYR C CA    1 
ATOM   6304  C C     . TYR C  1 160 ? -5.855  -43.473 11.096  1.00 28.33  ? 222 TYR C C     1 
ATOM   6305  O O     . TYR C  1 160 ? -5.928  -43.583 12.322  1.00 27.93  ? 222 TYR C O     1 
ATOM   6306  C CB    . TYR C  1 160 ? -6.765  -41.476 9.947   1.00 27.88  ? 222 TYR C CB    1 
ATOM   6307  C CG    . TYR C  1 160 ? -7.828  -40.907 9.044   1.00 27.63  ? 222 TYR C CG    1 
ATOM   6308  C CD1   . TYR C  1 160 ? -8.995  -40.392 9.569   1.00 27.13  ? 222 TYR C CD1   1 
ATOM   6309  C CD2   . TYR C  1 160 ? -7.675  -40.906 7.660   1.00 27.31  ? 222 TYR C CD2   1 
ATOM   6310  C CE1   . TYR C  1 160 ? -9.982  -39.879 8.742   1.00 27.31  ? 222 TYR C CE1   1 
ATOM   6311  C CE2   . TYR C  1 160 ? -8.667  -40.406 6.827   1.00 26.87  ? 222 TYR C CE2   1 
ATOM   6312  C CZ    . TYR C  1 160 ? -9.820  -39.896 7.377   1.00 26.35  ? 222 TYR C CZ    1 
ATOM   6313  O OH    . TYR C  1 160 ? -10.815 -39.390 6.585   1.00 24.79  ? 222 TYR C OH    1 
ATOM   6314  N N     . VAL C  1 161 ? -4.781  -43.808 10.368  1.00 29.91  ? 223 VAL C N     1 
ATOM   6315  C CA    . VAL C  1 161 ? -3.431  -44.046 10.945  1.00 29.86  ? 223 VAL C CA    1 
ATOM   6316  C C     . VAL C  1 161 ? -2.441  -43.070 10.364  1.00 30.91  ? 223 VAL C C     1 
ATOM   6317  O O     . VAL C  1 161 ? -2.661  -42.468 9.304   1.00 30.79  ? 223 VAL C O     1 
ATOM   6318  C CB    . VAL C  1 161 ? -2.787  -45.425 10.651  1.00 29.96  ? 223 VAL C CB    1 
ATOM   6319  C CG1   . VAL C  1 161 ? -2.955  -46.364 11.810  1.00 31.34  ? 223 VAL C CG1   1 
ATOM   6320  C CG2   . VAL C  1 161 ? -3.300  -46.025 9.362   1.00 30.34  ? 223 VAL C CG2   1 
ATOM   6321  N N     . VAL C  1 162 ? -1.315  -42.985 11.060  1.00 31.09  ? 224 VAL C N     1 
ATOM   6322  C CA    . VAL C  1 162 ? -0.244  -42.063 10.757  1.00 29.76  ? 224 VAL C CA    1 
ATOM   6323  C C     . VAL C  1 162 ? 0.911   -42.730 11.488  1.00 28.52  ? 224 VAL C C     1 
ATOM   6324  O O     . VAL C  1 162 ? 0.663   -43.554 12.359  1.00 29.62  ? 224 VAL C O     1 
ATOM   6325  C CB    . VAL C  1 162 ? -0.638  -40.658 11.290  1.00 30.32  ? 224 VAL C CB    1 
ATOM   6326  C CG1   . VAL C  1 162 ? 0.427   -40.054 12.190  1.00 31.87  ? 224 VAL C CG1   1 
ATOM   6327  C CG2   . VAL C  1 162 ? -1.020  -39.719 10.148  1.00 29.12  ? 224 VAL C CG2   1 
ATOM   6328  N N     . ALA C  1 163 ? 2.153   -42.448 11.111  1.00 27.90  ? 225 ALA C N     1 
ATOM   6329  C CA    . ALA C  1 163 ? 3.320   -42.927 11.867  1.00 26.68  ? 225 ALA C CA    1 
ATOM   6330  C C     . ALA C  1 163 ? 4.016   -41.731 12.516  1.00 26.08  ? 225 ALA C C     1 
ATOM   6331  O O     . ALA C  1 163 ? 3.989   -40.618 11.959  1.00 27.52  ? 225 ALA C O     1 
ATOM   6332  C CB    . ALA C  1 163 ? 4.272   -43.669 10.945  1.00 26.29  ? 225 ALA C CB    1 
ATOM   6333  N N     . ILE C  1 164 ? 4.648   -41.938 13.673  1.00 24.05  ? 226 ILE C N     1 
ATOM   6334  C CA    . ILE C  1 164 ? 5.354   -40.834 14.336  1.00 23.15  ? 226 ILE C CA    1 
ATOM   6335  C C     . ILE C  1 164 ? 6.728   -41.179 14.864  1.00 23.61  ? 226 ILE C C     1 
ATOM   6336  O O     . ILE C  1 164 ? 7.034   -42.354 15.054  1.00 25.04  ? 226 ILE C O     1 
ATOM   6337  C CB    . ILE C  1 164 ? 4.564   -40.287 15.517  1.00 21.99  ? 226 ILE C CB    1 
ATOM   6338  C CG1   . ILE C  1 164 ? 4.420   -41.352 16.598  1.00 21.13  ? 226 ILE C CG1   1 
ATOM   6339  C CG2   . ILE C  1 164 ? 3.224   -39.759 15.039  1.00 21.95  ? 226 ILE C CG2   1 
ATOM   6340  C CD1   . ILE C  1 164 ? 4.035   -40.774 17.937  1.00 20.85  ? 226 ILE C CD1   1 
ATOM   6341  N N     . GLU C  1 165 ? 7.544   -40.143 15.100  1.00 23.70  ? 227 GLU C N     1 
ATOM   6342  C CA    . GLU C  1 165 ? 8.798   -40.288 15.848  1.00 24.29  ? 227 GLU C CA    1 
ATOM   6343  C C     . GLU C  1 165 ? 8.444   -40.007 17.293  1.00 25.54  ? 227 GLU C C     1 
ATOM   6344  O O     . GLU C  1 165 ? 7.677   -39.066 17.543  1.00 26.18  ? 227 GLU C O     1 
ATOM   6345  C CB    . GLU C  1 165 ? 9.868   -39.298 15.368  1.00 22.98  ? 227 GLU C CB    1 
ATOM   6346  C CG    . GLU C  1 165 ? 11.115  -39.248 16.252  1.00 22.14  ? 227 GLU C CG    1 
ATOM   6347  C CD    . GLU C  1 165 ? 11.002  -38.263 17.415  1.00 21.17  ? 227 GLU C CD    1 
ATOM   6348  O OE1   . GLU C  1 165 ? 11.578  -38.587 18.490  1.00 20.64  ? 227 GLU C OE1   1 
ATOM   6349  O OE2   . GLU C  1 165 ? 10.363  -37.184 17.242  1.00 19.09  ? 227 GLU C OE2   1 
ATOM   6350  N N     . ASP C  1 166 ? 8.982   -40.796 18.228  1.00 25.88  ? 228 ASP C N     1 
ATOM   6351  C CA    . ASP C  1 166 ? 8.651   -40.637 19.643  1.00 28.72  ? 228 ASP C CA    1 
ATOM   6352  C C     . ASP C  1 166 ? 9.695   -41.293 20.542  1.00 31.66  ? 228 ASP C C     1 
ATOM   6353  O O     . ASP C  1 166 ? 9.331   -41.955 21.531  1.00 31.37  ? 228 ASP C O     1 
ATOM   6354  C CB    . ASP C  1 166 ? 7.250   -41.245 19.939  1.00 28.32  ? 228 ASP C CB    1 
ATOM   6355  C CG    . ASP C  1 166 ? 6.570   -40.646 21.172  1.00 27.19  ? 228 ASP C CG    1 
ATOM   6356  O OD1   . ASP C  1 166 ? 6.970   -39.548 21.620  1.00 27.13  ? 228 ASP C OD1   1 
ATOM   6357  O OD2   . ASP C  1 166 ? 5.630   -41.287 21.685  1.00 25.59  ? 228 ASP C OD2   1 
ATOM   6358  N N     . ARG C  1 167 ? 10.986  -41.105 20.241  1.00 35.23  ? 229 ARG C N     1 
ATOM   6359  C CA    . ARG C  1 167 ? 12.018  -41.801 21.044  1.00 37.17  ? 229 ARG C CA    1 
ATOM   6360  C C     . ARG C  1 167 ? 12.022  -41.376 22.525  1.00 34.12  ? 229 ARG C C     1 
ATOM   6361  O O     . ARG C  1 167 ? 12.130  -42.226 23.412  1.00 31.12  ? 229 ARG C O     1 
ATOM   6362  C CB    . ARG C  1 167 ? 13.434  -41.778 20.398  1.00 40.28  ? 229 ARG C CB    1 
ATOM   6363  C CG    . ARG C  1 167 ? 14.235  -40.497 20.465  1.00 42.45  ? 229 ARG C CG    1 
ATOM   6364  C CD    . ARG C  1 167 ? 15.722  -40.791 20.595  1.00 44.70  ? 229 ARG C CD    1 
ATOM   6365  N NE    . ARG C  1 167 ? 16.111  -40.585 21.978  1.00 49.04  ? 229 ARG C NE    1 
ATOM   6366  C CZ    . ARG C  1 167 ? 16.227  -39.388 22.547  1.00 52.80  ? 229 ARG C CZ    1 
ATOM   6367  N NH1   . ARG C  1 167 ? 16.001  -38.282 21.839  1.00 52.08  ? 229 ARG C NH1   1 
ATOM   6368  N NH2   . ARG C  1 167 ? 16.565  -39.293 23.828  1.00 55.05  ? 229 ARG C NH2   1 
ATOM   6369  N N     . GLN C  1 168 ? 11.851  -40.084 22.784  1.00 33.89  ? 230 GLN C N     1 
ATOM   6370  C CA    . GLN C  1 168 ? 11.936  -39.583 24.139  1.00 35.05  ? 230 GLN C CA    1 
ATOM   6371  C C     . GLN C  1 168 ? 10.799  -40.111 24.986  1.00 33.75  ? 230 GLN C C     1 
ATOM   6372  O O     . GLN C  1 168 ? 11.012  -40.667 26.057  1.00 33.18  ? 230 GLN C O     1 
ATOM   6373  C CB    . GLN C  1 168 ? 11.939  -38.067 24.162  1.00 38.11  ? 230 GLN C CB    1 
ATOM   6374  C CG    . GLN C  1 168 ? 12.325  -37.503 25.522  1.00 42.62  ? 230 GLN C CG    1 
ATOM   6375  C CD    . GLN C  1 168 ? 12.338  -35.985 25.555  1.00 47.05  ? 230 GLN C CD    1 
ATOM   6376  O OE1   . GLN C  1 168 ? 13.392  -35.356 25.717  1.00 51.97  ? 230 GLN C OE1   1 
ATOM   6377  N NE2   . GLN C  1 168 ? 11.160  -35.383 25.389  1.00 48.19  ? 230 GLN C NE2   1 
ATOM   6378  N N     . TYR C  1 169 ? 9.584   -39.967 24.503  1.00 34.51  ? 231 TYR C N     1 
ATOM   6379  C CA    . TYR C  1 169 ? 8.455   -40.463 25.268  1.00 36.56  ? 231 TYR C CA    1 
ATOM   6380  C C     . TYR C  1 169 ? 8.445   -41.999 25.358  1.00 34.20  ? 231 TYR C C     1 
ATOM   6381  O O     . TYR C  1 169 ? 8.025   -42.546 26.376  1.00 36.90  ? 231 TYR C O     1 
ATOM   6382  C CB    . TYR C  1 169 ? 7.118   -39.896 24.738  1.00 41.15  ? 231 TYR C CB    1 
ATOM   6383  C CG    . TYR C  1 169 ? 6.018   -39.905 25.779  1.00 45.15  ? 231 TYR C CG    1 
ATOM   6384  C CD1   . TYR C  1 169 ? 5.996   -38.955 26.810  1.00 47.58  ? 231 TYR C CD1   1 
ATOM   6385  C CD2   . TYR C  1 169 ? 5.025   -40.891 25.768  1.00 46.57  ? 231 TYR C CD2   1 
ATOM   6386  C CE1   . TYR C  1 169 ? 5.011   -38.989 27.795  1.00 49.37  ? 231 TYR C CE1   1 
ATOM   6387  C CE2   . TYR C  1 169 ? 4.037   -40.930 26.743  1.00 46.51  ? 231 TYR C CE2   1 
ATOM   6388  C CZ    . TYR C  1 169 ? 4.034   -39.990 27.754  1.00 48.08  ? 231 TYR C CZ    1 
ATOM   6389  O OH    . TYR C  1 169 ? 3.058   -40.058 28.715  1.00 45.41  ? 231 TYR C OH    1 
ATOM   6390  N N     . LYS C  1 170 ? 8.933   -42.699 24.337  1.00 31.08  ? 232 LYS C N     1 
ATOM   6391  C CA    . LYS C  1 170 ? 8.982   -44.163 24.388  1.00 28.60  ? 232 LYS C CA    1 
ATOM   6392  C C     . LYS C  1 170 ? 9.957   -44.600 25.439  1.00 29.11  ? 232 LYS C C     1 
ATOM   6393  O O     . LYS C  1 170 ? 9.730   -45.581 26.125  1.00 30.46  ? 232 LYS C O     1 
ATOM   6394  C CB    . LYS C  1 170 ? 9.412   -44.768 23.059  1.00 27.57  ? 232 LYS C CB    1 
ATOM   6395  C CG    . LYS C  1 170 ? 9.455   -46.290 23.078  1.00 26.32  ? 232 LYS C CG    1 
ATOM   6396  C CD    . LYS C  1 170 ? 9.880   -46.879 21.751  1.00 25.74  ? 232 LYS C CD    1 
ATOM   6397  C CE    . LYS C  1 170 ? 9.935   -48.394 21.812  1.00 25.11  ? 232 LYS C CE    1 
ATOM   6398  N NZ    . LYS C  1 170 ? 10.487  -48.968 20.558  1.00 25.45  ? 232 LYS C NZ    1 
ATOM   6399  N N     . ASP C  1 171 ? 11.071  -43.890 25.540  1.00 30.46  ? 233 ASP C N     1 
ATOM   6400  C CA    . ASP C  1 171 ? 12.012  -44.117 26.640  1.00 31.21  ? 233 ASP C CA    1 
ATOM   6401  C C     . ASP C  1 171 ? 11.389  -44.027 28.000  1.00 28.75  ? 233 ASP C C     1 
ATOM   6402  O O     . ASP C  1 171 ? 11.637  -44.889 28.837  1.00 27.67  ? 233 ASP C O     1 
ATOM   6403  C CB    . ASP C  1 171 ? 13.155  -43.116 26.609  1.00 33.12  ? 233 ASP C CB    1 
ATOM   6404  C CG    . ASP C  1 171 ? 14.449  -43.780 26.456  1.00 35.27  ? 233 ASP C CG    1 
ATOM   6405  O OD1   . ASP C  1 171 ? 14.660  -44.435 25.387  1.00 38.71  ? 233 ASP C OD1   1 
ATOM   6406  O OD2   . ASP C  1 171 ? 15.221  -43.672 27.426  1.00 34.94  ? 233 ASP C OD2   1 
ATOM   6407  N N     . PHE C  1 172 ? 10.616  -42.956 28.201  1.00 27.01  ? 234 PHE C N     1 
ATOM   6408  C CA    . PHE C  1 172 ? 9.946   -42.671 29.465  1.00 26.68  ? 234 PHE C CA    1 
ATOM   6409  C C     . PHE C  1 172 ? 8.882   -43.721 29.830  1.00 26.84  ? 234 PHE C C     1 
ATOM   6410  O O     . PHE C  1 172 ? 8.732   -44.134 30.990  1.00 25.40  ? 234 PHE C O     1 
ATOM   6411  C CB    . PHE C  1 172 ? 9.344   -41.252 29.426  1.00 26.96  ? 234 PHE C CB    1 
ATOM   6412  C CG    . PHE C  1 172 ? 8.594   -40.854 30.697  1.00 28.66  ? 234 PHE C CG    1 
ATOM   6413  C CD1   . PHE C  1 172 ? 9.261   -40.711 31.902  1.00 28.37  ? 234 PHE C CD1   1 
ATOM   6414  C CD2   . PHE C  1 172 ? 7.207   -40.632 30.686  1.00 29.54  ? 234 PHE C CD2   1 
ATOM   6415  C CE1   . PHE C  1 172 ? 8.575   -40.379 33.055  1.00 28.28  ? 234 PHE C CE1   1 
ATOM   6416  C CE2   . PHE C  1 172 ? 6.517   -40.285 31.845  1.00 28.39  ? 234 PHE C CE2   1 
ATOM   6417  C CZ    . PHE C  1 172 ? 7.205   -40.155 33.026  1.00 28.21  ? 234 PHE C CZ    1 
ATOM   6418  N N     . LYS C  1 173 ? 8.173   -44.190 28.827  1.00 27.68  ? 235 LYS C N     1 
ATOM   6419  C CA    . LYS C  1 173 ? 7.021   -45.011 29.076  1.00 29.09  ? 235 LYS C CA    1 
ATOM   6420  C C     . LYS C  1 173 ? 7.281   -46.487 29.015  1.00 29.49  ? 235 LYS C C     1 
ATOM   6421  O O     . LYS C  1 173 ? 6.587   -47.247 29.689  1.00 31.01  ? 235 LYS C O     1 
ATOM   6422  C CB    . LYS C  1 173 ? 5.934   -44.671 28.067  1.00 31.01  ? 235 LYS C CB    1 
ATOM   6423  C CG    . LYS C  1 173 ? 5.008   -43.589 28.557  1.00 31.45  ? 235 LYS C CG    1 
ATOM   6424  C CD    . LYS C  1 173 ? 4.061   -44.172 29.575  1.00 31.21  ? 235 LYS C CD    1 
ATOM   6425  C CE    . LYS C  1 173 ? 3.603   -43.107 30.518  1.00 32.80  ? 235 LYS C CE    1 
ATOM   6426  N NZ    . LYS C  1 173 ? 2.715   -43.732 31.518  1.00 33.41  ? 235 LYS C NZ    1 
ATOM   6427  N N     . ILE C  1 174 ? 8.227   -46.913 28.182  1.00 29.49  ? 236 ILE C N     1 
ATOM   6428  C CA    . ILE C  1 174 ? 8.432   -48.345 27.993  1.00 30.03  ? 236 ILE C CA    1 
ATOM   6429  C C     . ILE C  1 174 ? 9.909   -48.800 28.141  1.00 29.21  ? 236 ILE C C     1 
ATOM   6430  O O     . ILE C  1 174 ? 10.156  -49.850 28.717  1.00 30.50  ? 236 ILE C O     1 
ATOM   6431  C CB    . ILE C  1 174 ? 7.622   -48.907 26.761  1.00 31.18  ? 236 ILE C CB    1 
ATOM   6432  C CG1   . ILE C  1 174 ? 8.392   -49.938 25.939  1.00 32.52  ? 236 ILE C CG1   1 
ATOM   6433  C CG2   . ILE C  1 174 ? 7.155   -47.817 25.827  1.00 31.88  ? 236 ILE C CG2   1 
ATOM   6434  C CD1   . ILE C  1 174 ? 9.539   -49.386 25.132  1.00 34.24  ? 236 ILE C CD1   1 
ATOM   6435  N N     . HIS C  1 175 ? 10.902  -48.039 27.704  1.00 27.91  ? 237 HIS C N     1 
ATOM   6436  C CA    . HIS C  1 175 ? 12.279  -48.492 27.947  1.00 27.26  ? 237 HIS C CA    1 
ATOM   6437  C C     . HIS C  1 175 ? 12.677  -48.368 29.394  1.00 26.34  ? 237 HIS C C     1 
ATOM   6438  O O     . HIS C  1 175 ? 13.565  -49.076 29.841  1.00 25.96  ? 237 HIS C O     1 
ATOM   6439  C CB    . HIS C  1 175 ? 13.278  -47.752 27.074  1.00 28.23  ? 237 HIS C CB    1 
ATOM   6440  C CG    . HIS C  1 175 ? 13.236  -48.189 25.649  1.00 29.63  ? 237 HIS C CG    1 
ATOM   6441  N ND1   . HIS C  1 175 ? 13.496  -49.492 25.276  1.00 29.80  ? 237 HIS C ND1   1 
ATOM   6442  C CD2   . HIS C  1 175 ? 12.935  -47.519 24.512  1.00 29.61  ? 237 HIS C CD2   1 
ATOM   6443  C CE1   . HIS C  1 175 ? 13.358  -49.608 23.970  1.00 30.44  ? 237 HIS C CE1   1 
ATOM   6444  N NE2   . HIS C  1 175 ? 13.025  -48.424 23.481  1.00 30.91  ? 237 HIS C NE2   1 
ATOM   6445  N N     . TRP C  1 176 ? 12.030  -47.440 30.100  1.00 25.90  ? 238 TRP C N     1 
ATOM   6446  C CA    . TRP C  1 176 ? 12.205  -47.201 31.536  1.00 24.66  ? 238 TRP C CA    1 
ATOM   6447  C C     . TRP C  1 176 ? 12.184  -48.479 32.397  1.00 24.06  ? 238 TRP C C     1 
ATOM   6448  O O     . TRP C  1 176 ? 12.992  -48.660 33.294  1.00 22.51  ? 238 TRP C O     1 
ATOM   6449  C CB    . TRP C  1 176 ? 11.104  -46.238 31.973  1.00 25.09  ? 238 TRP C CB    1 
ATOM   6450  C CG    . TRP C  1 176 ? 11.028  -45.994 33.427  1.00 26.59  ? 238 TRP C CG    1 
ATOM   6451  C CD1   . TRP C  1 176 ? 11.710  -45.050 34.128  1.00 28.22  ? 238 TRP C CD1   1 
ATOM   6452  C CD2   . TRP C  1 176 ? 10.216  -46.697 34.381  1.00 26.40  ? 238 TRP C CD2   1 
ATOM   6453  N NE1   . TRP C  1 176 ? 11.378  -45.120 35.469  1.00 28.82  ? 238 TRP C NE1   1 
ATOM   6454  C CE2   . TRP C  1 176 ? 10.465  -46.123 35.648  1.00 26.77  ? 238 TRP C CE2   1 
ATOM   6455  C CE3   . TRP C  1 176 ? 9.309   -47.751 34.287  1.00 26.68  ? 238 TRP C CE3   1 
ATOM   6456  C CZ2   . TRP C  1 176 ? 9.836   -46.562 36.810  1.00 26.31  ? 238 TRP C CZ2   1 
ATOM   6457  C CZ3   . TRP C  1 176 ? 8.688   -48.192 35.452  1.00 26.96  ? 238 TRP C CZ3   1 
ATOM   6458  C CH2   . TRP C  1 176 ? 8.957   -47.596 36.697  1.00 26.23  ? 238 TRP C CH2   1 
ATOM   6459  N N     . TRP C  1 177 ? 11.267  -49.376 32.088  1.00 24.80  ? 239 TRP C N     1 
ATOM   6460  C CA    . TRP C  1 177 ? 11.121  -50.630 32.823  1.00 26.50  ? 239 TRP C CA    1 
ATOM   6461  C C     . TRP C  1 177 ? 12.397  -51.494 32.856  1.00 26.99  ? 239 TRP C C     1 
ATOM   6462  O O     . TRP C  1 177 ? 12.529  -52.386 33.700  1.00 27.15  ? 239 TRP C O     1 
ATOM   6463  C CB    . TRP C  1 177 ? 9.976   -51.449 32.199  1.00 27.36  ? 239 TRP C CB    1 
ATOM   6464  C CG    . TRP C  1 177 ? 8.625   -50.840 32.398  1.00 28.22  ? 239 TRP C CG    1 
ATOM   6465  C CD1   . TRP C  1 177 ? 7.911   -50.102 31.498  1.00 28.86  ? 239 TRP C CD1   1 
ATOM   6466  C CD2   . TRP C  1 177 ? 7.836   -50.915 33.566  1.00 28.07  ? 239 TRP C CD2   1 
ATOM   6467  N NE1   . TRP C  1 177 ? 6.721   -49.712 32.043  1.00 28.66  ? 239 TRP C NE1   1 
ATOM   6468  C CE2   . TRP C  1 177 ? 6.652   -50.201 33.316  1.00 28.57  ? 239 TRP C CE2   1 
ATOM   6469  C CE3   . TRP C  1 177 ? 8.018   -51.513 34.813  1.00 29.66  ? 239 TRP C CE3   1 
ATOM   6470  C CZ2   . TRP C  1 177 ? 5.649   -50.063 34.266  1.00 31.03  ? 239 TRP C CZ2   1 
ATOM   6471  C CZ3   . TRP C  1 177 ? 7.009   -51.392 35.771  1.00 30.94  ? 239 TRP C CZ3   1 
ATOM   6472  C CH2   . TRP C  1 177 ? 5.837   -50.669 35.489  1.00 31.65  ? 239 TRP C CH2   1 
ATOM   6473  N N     . GLU C  1 178 ? 13.300  -51.262 31.904  1.00 27.25  ? 240 GLU C N     1 
ATOM   6474  C CA    . GLU C  1 178 ? 14.517  -52.054 31.757  1.00 27.46  ? 240 GLU C CA    1 
ATOM   6475  C C     . GLU C  1 178 ? 15.439  -51.862 32.952  1.00 28.50  ? 240 GLU C C     1 
ATOM   6476  O O     . GLU C  1 178 ? 16.225  -52.752 33.287  1.00 27.87  ? 240 GLU C O     1 
ATOM   6477  C CB    . GLU C  1 178 ? 15.265  -51.678 30.466  1.00 27.94  ? 240 GLU C CB    1 
ATOM   6478  C CG    . GLU C  1 178 ? 14.654  -52.233 29.176  1.00 27.93  ? 240 GLU C CG    1 
ATOM   6479  C CD    . GLU C  1 178 ? 15.079  -51.477 27.928  1.00 27.35  ? 240 GLU C CD    1 
ATOM   6480  O OE1   . GLU C  1 178 ? 14.404  -51.656 26.889  1.00 26.90  ? 240 GLU C OE1   1 
ATOM   6481  O OE2   . GLU C  1 178 ? 16.078  -50.718 27.984  1.00 26.66  ? 240 GLU C OE2   1 
ATOM   6482  N N     . ASN C  1 179 ? 15.331  -50.697 33.590  1.00 29.90  ? 241 ASN C N     1 
ATOM   6483  C CA    . ASN C  1 179 ? 16.108  -50.394 34.785  1.00 29.94  ? 241 ASN C CA    1 
ATOM   6484  C C     . ASN C  1 179 ? 15.364  -49.546 35.834  1.00 29.53  ? 241 ASN C C     1 
ATOM   6485  O O     . ASN C  1 179 ? 15.414  -48.314 35.826  1.00 29.59  ? 241 ASN C O     1 
ATOM   6486  C CB    . ASN C  1 179 ? 17.402  -49.706 34.391  1.00 30.04  ? 241 ASN C CB    1 
ATOM   6487  C CG    . ASN C  1 179 ? 18.288  -49.429 35.586  1.00 30.61  ? 241 ASN C CG    1 
ATOM   6488  O OD1   . ASN C  1 179 ? 17.992  -49.831 36.714  1.00 30.46  ? 241 ASN C OD1   1 
ATOM   6489  N ND2   . ASN C  1 179 ? 19.403  -48.789 35.336  1.00 31.03  ? 241 ASN C ND2   1 
ATOM   6490  N N     . VAL C  1 180 ? 14.701  -50.238 36.753  1.00 29.06  ? 242 VAL C N     1 
ATOM   6491  C CA    . VAL C  1 180 ? 13.931  -49.608 37.814  1.00 27.87  ? 242 VAL C CA    1 
ATOM   6492  C C     . VAL C  1 180 ? 14.739  -49.694 39.085  1.00 26.32  ? 242 VAL C C     1 
ATOM   6493  O O     . VAL C  1 180 ? 14.846  -50.767 39.674  1.00 25.94  ? 242 VAL C O     1 
ATOM   6494  C CB    . VAL C  1 180 ? 12.594  -50.338 38.009  1.00 28.95  ? 242 VAL C CB    1 
ATOM   6495  C CG1   . VAL C  1 180 ? 11.789  -49.693 39.115  1.00 28.61  ? 242 VAL C CG1   1 
ATOM   6496  C CG2   . VAL C  1 180 ? 11.802  -50.355 36.699  1.00 30.00  ? 242 VAL C CG2   1 
ATOM   6497  N N     . TYR C  1 181 ? 15.348  -48.574 39.464  1.00 24.91  ? 243 TYR C N     1 
ATOM   6498  C CA    . TYR C  1 181 ? 16.206  -48.492 40.642  1.00 24.12  ? 243 TYR C CA    1 
ATOM   6499  C C     . TYR C  1 181 ? 17.221  -49.623 40.735  1.00 25.80  ? 243 TYR C C     1 
ATOM   6500  O O     . TYR C  1 181 ? 17.469  -50.189 41.808  1.00 26.82  ? 243 TYR C O     1 
ATOM   6501  C CB    . TYR C  1 181 ? 15.349  -48.436 41.891  1.00 22.45  ? 243 TYR C CB    1 
ATOM   6502  C CG    . TYR C  1 181 ? 14.465  -47.227 41.913  1.00 20.79  ? 243 TYR C CG    1 
ATOM   6503  C CD1   . TYR C  1 181 ? 14.969  -45.984 42.257  1.00 20.28  ? 243 TYR C CD1   1 
ATOM   6504  C CD2   . TYR C  1 181 ? 13.141  -47.324 41.581  1.00 20.02  ? 243 TYR C CD2   1 
ATOM   6505  C CE1   . TYR C  1 181 ? 14.167  -44.864 42.281  1.00 19.74  ? 243 TYR C CE1   1 
ATOM   6506  C CE2   . TYR C  1 181 ? 12.321  -46.224 41.605  1.00 19.57  ? 243 TYR C CE2   1 
ATOM   6507  C CZ    . TYR C  1 181 ? 12.837  -44.987 41.949  1.00 19.71  ? 243 TYR C CZ    1 
ATOM   6508  O OH    . TYR C  1 181 ? 12.024  -43.875 41.995  1.00 18.97  ? 243 TYR C OH    1 
ATOM   6509  N N     . GLY C  1 182 ? 17.807  -49.946 39.591  1.00 27.79  ? 244 GLY C N     1 
ATOM   6510  C CA    . GLY C  1 182 ? 18.817  -50.981 39.505  1.00 28.90  ? 244 GLY C CA    1 
ATOM   6511  C C     . GLY C  1 182 ? 18.299  -52.321 39.050  1.00 30.18  ? 244 GLY C C     1 
ATOM   6512  O O     . GLY C  1 182 ? 19.101  -53.204 38.789  1.00 30.90  ? 244 GLY C O     1 
ATOM   6513  N N     . PHE C  1 183 ? 16.985  -52.498 38.930  1.00 31.07  ? 245 PHE C N     1 
ATOM   6514  C CA    . PHE C  1 183 ? 16.452  -53.813 38.625  1.00 31.75  ? 245 PHE C CA    1 
ATOM   6515  C C     . PHE C  1 183 ? 15.818  -53.933 37.250  1.00 33.79  ? 245 PHE C C     1 
ATOM   6516  O O     . PHE C  1 183 ? 15.269  -52.970 36.731  1.00 33.71  ? 245 PHE C O     1 
ATOM   6517  C CB    . PHE C  1 183 ? 15.462  -54.176 39.695  1.00 32.46  ? 245 PHE C CB    1 
ATOM   6518  C CG    . PHE C  1 183 ? 16.055  -54.178 41.067  1.00 31.68  ? 245 PHE C CG    1 
ATOM   6519  C CD1   . PHE C  1 183 ? 16.782  -55.258 41.498  1.00 31.35  ? 245 PHE C CD1   1 
ATOM   6520  C CD2   . PHE C  1 183 ? 15.887  -53.103 41.918  1.00 31.63  ? 245 PHE C CD2   1 
ATOM   6521  C CE1   . PHE C  1 183 ? 17.331  -55.276 42.764  1.00 32.58  ? 245 PHE C CE1   1 
ATOM   6522  C CE2   . PHE C  1 183 ? 16.428  -53.115 43.187  1.00 32.12  ? 245 PHE C CE2   1 
ATOM   6523  C CZ    . PHE C  1 183 ? 17.152  -54.205 43.614  1.00 31.92  ? 245 PHE C CZ    1 
ATOM   6524  N N     . ASP C  1 184 ? 15.928  -55.135 36.674  1.00 36.54  ? 246 ASP C N     1 
ATOM   6525  C CA    . ASP C  1 184 ? 15.320  -55.499 35.386  1.00 38.05  ? 246 ASP C CA    1 
ATOM   6526  C C     . ASP C  1 184 ? 13.838  -55.797 35.584  1.00 37.24  ? 246 ASP C C     1 
ATOM   6527  O O     . ASP C  1 184 ? 13.481  -56.655 36.392  1.00 35.60  ? 246 ASP C O     1 
ATOM   6528  C CB    . ASP C  1 184 ? 16.030  -56.745 34.794  1.00 39.05  ? 246 ASP C CB    1 
ATOM   6529  C CG    . ASP C  1 184 ? 15.512  -57.142 33.399  1.00 41.42  ? 246 ASP C CG    1 
ATOM   6530  O OD1   . ASP C  1 184 ? 14.479  -57.841 33.281  1.00 42.55  ? 246 ASP C OD1   1 
ATOM   6531  O OD2   . ASP C  1 184 ? 16.152  -56.754 32.403  1.00 43.74  ? 246 ASP C OD2   1 
ATOM   6532  N N     . MET C  1 185 ? 12.985  -55.069 34.862  1.00 36.44  ? 247 MET C N     1 
ATOM   6533  C CA    . MET C  1 185 ? 11.567  -55.363 34.846  1.00 37.37  ? 247 MET C CA    1 
ATOM   6534  C C     . MET C  1 185 ? 11.078  -55.462 33.406  1.00 39.37  ? 247 MET C C     1 
ATOM   6535  O O     . MET C  1 185 ? 9.988   -54.991 33.077  1.00 42.76  ? 247 MET C O     1 
ATOM   6536  C CB    . MET C  1 185 ? 10.776  -54.293 35.616  1.00 35.92  ? 247 MET C CB    1 
ATOM   6537  C CG    . MET C  1 185 ? 11.101  -54.183 37.105  1.00 33.63  ? 247 MET C CG    1 
ATOM   6538  S SD    . MET C  1 185 ? 9.886   -53.211 38.036  1.00 30.27  ? 247 MET C SD    1 
ATOM   6539  C CE    . MET C  1 185 ? 10.520  -53.363 39.686  1.00 30.54  ? 247 MET C CE    1 
ATOM   6540  N N     . THR C  1 186 ? 11.862  -56.100 32.544  1.00 39.35  ? 248 THR C N     1 
ATOM   6541  C CA    . THR C  1 186 ? 11.494  -56.158 31.138  1.00 39.58  ? 248 THR C CA    1 
ATOM   6542  C C     . THR C  1 186 ? 10.250  -57.000 30.928  1.00 37.46  ? 248 THR C C     1 
ATOM   6543  O O     . THR C  1 186 ? 9.536   -56.783 29.968  1.00 37.92  ? 248 THR C O     1 
ATOM   6544  C CB    . THR C  1 186 ? 12.620  -56.708 30.242  1.00 41.78  ? 248 THR C CB    1 
ATOM   6545  O OG1   . THR C  1 186 ? 13.025  -57.993 30.725  1.00 45.11  ? 248 THR C OG1   1 
ATOM   6546  C CG2   . THR C  1 186 ? 13.828  -55.784 30.228  1.00 41.92  ? 248 THR C CG2   1 
ATOM   6547  N N     . CYS C  1 187 ? 9.968   -57.953 31.810  1.00 37.37  ? 249 CYS C N     1 
ATOM   6548  C CA    . CYS C  1 187 ? 8.775   -58.785 31.618  1.00 38.70  ? 249 CYS C CA    1 
ATOM   6549  C C     . CYS C  1 187 ? 7.501   -57.916 31.696  1.00 35.76  ? 249 CYS C C     1 
ATOM   6550  O O     . CYS C  1 187 ? 6.482   -58.223 31.048  1.00 33.50  ? 249 CYS C O     1 
ATOM   6551  C CB    . CYS C  1 187 ? 8.738   -59.952 32.611  1.00 40.43  ? 249 CYS C CB    1 
ATOM   6552  S SG    . CYS C  1 187 ? 8.458   -59.424 34.309  1.00 44.49  ? 249 CYS C SG    1 
ATOM   6553  N N     . ILE C  1 188 ? 7.575   -56.821 32.451  1.00 32.73  ? 250 ILE C N     1 
ATOM   6554  C CA    . ILE C  1 188 ? 6.504   -55.835 32.444  1.00 31.93  ? 250 ILE C CA    1 
ATOM   6555  C C     . ILE C  1 188 ? 6.536   -54.973 31.185  1.00 30.30  ? 250 ILE C C     1 
ATOM   6556  O O     . ILE C  1 188 ? 5.535   -54.857 30.497  1.00 33.23  ? 250 ILE C O     1 
ATOM   6557  C CB    . ILE C  1 188 ? 6.521   -54.955 33.701  1.00 32.20  ? 250 ILE C CB    1 
ATOM   6558  C CG1   . ILE C  1 188 ? 6.017   -55.779 34.878  1.00 32.43  ? 250 ILE C CG1   1 
ATOM   6559  C CG2   . ILE C  1 188 ? 5.643   -53.713 33.513  1.00 32.00  ? 250 ILE C CG2   1 
ATOM   6560  C CD1   . ILE C  1 188 ? 5.976   -55.022 36.179  1.00 32.99  ? 250 ILE C CD1   1 
ATOM   6561  N N     . ARG C  1 189 ? 7.670   -54.370 30.884  1.00 27.97  ? 251 ARG C N     1 
ATOM   6562  C CA    . ARG C  1 189 ? 7.855   -53.666 29.620  1.00 27.65  ? 251 ARG C CA    1 
ATOM   6563  C C     . ARG C  1 189 ? 7.198   -54.386 28.431  1.00 26.54  ? 251 ARG C C     1 
ATOM   6564  O O     . ARG C  1 189 ? 6.549   -53.758 27.599  1.00 24.43  ? 251 ARG C O     1 
ATOM   6565  C CB    . ARG C  1 189 ? 9.352   -53.548 29.360  1.00 29.71  ? 251 ARG C CB    1 
ATOM   6566  C CG    . ARG C  1 189 ? 9.746   -52.776 28.114  1.00 30.56  ? 251 ARG C CG    1 
ATOM   6567  C CD    . ARG C  1 189 ? 10.215  -53.699 27.008  1.00 31.82  ? 251 ARG C CD    1 
ATOM   6568  N NE    . ARG C  1 189 ? 11.667  -53.859 27.023  1.00 32.50  ? 251 ARG C NE    1 
ATOM   6569  C CZ    . ARG C  1 189 ? 12.322  -54.942 26.602  1.00 32.85  ? 251 ARG C CZ    1 
ATOM   6570  N NH1   . ARG C  1 189 ? 11.684  -56.011 26.128  1.00 31.36  ? 251 ARG C NH1   1 
ATOM   6571  N NH2   . ARG C  1 189 ? 13.642  -54.959 26.683  1.00 35.00  ? 251 ARG C NH2   1 
ATOM   6572  N N     . ASP C  1 190 ? 7.373   -55.703 28.355  1.00 26.52  ? 252 ASP C N     1 
ATOM   6573  C CA    . ASP C  1 190 ? 6.801   -56.492 27.271  1.00 27.62  ? 252 ASP C CA    1 
ATOM   6574  C C     . ASP C  1 190 ? 5.281   -56.442 27.235  1.00 28.79  ? 252 ASP C C     1 
ATOM   6575  O O     . ASP C  1 190 ? 4.688   -56.449 26.163  1.00 30.17  ? 252 ASP C O     1 
ATOM   6576  C CB    . ASP C  1 190 ? 7.289   -57.948 27.327  1.00 27.40  ? 252 ASP C CB    1 
ATOM   6577  C CG    . ASP C  1 190 ? 8.770   -58.088 26.950  1.00 27.32  ? 252 ASP C CG    1 
ATOM   6578  O OD1   . ASP C  1 190 ? 9.397   -57.081 26.527  1.00 25.72  ? 252 ASP C OD1   1 
ATOM   6579  O OD2   . ASP C  1 190 ? 9.303   -59.210 27.081  1.00 26.45  ? 252 ASP C OD2   1 
ATOM   6580  N N     . VAL C  1 191 ? 4.656   -56.407 28.394  1.00 30.18  ? 253 VAL C N     1 
ATOM   6581  C CA    . VAL C  1 191 ? 3.216   -56.263 28.467  1.00 32.45  ? 253 VAL C CA    1 
ATOM   6582  C C     . VAL C  1 191 ? 2.802   -54.833 28.150  1.00 34.25  ? 253 VAL C C     1 
ATOM   6583  O O     . VAL C  1 191 ? 1.771   -54.614 27.526  1.00 36.46  ? 253 VAL C O     1 
ATOM   6584  C CB    . VAL C  1 191 ? 2.700   -56.689 29.855  1.00 33.76  ? 253 VAL C CB    1 
ATOM   6585  C CG1   . VAL C  1 191 ? 1.243   -56.297 30.090  1.00 33.08  ? 253 VAL C CG1   1 
ATOM   6586  C CG2   . VAL C  1 191 ? 2.871   -58.190 30.000  1.00 34.92  ? 253 VAL C CG2   1 
ATOM   6587  N N     . ALA C  1 192 ? 3.586   -53.853 28.579  1.00 36.63  ? 254 ALA C N     1 
ATOM   6588  C CA    . ALA C  1 192 ? 3.215   -52.443 28.374  1.00 38.05  ? 254 ALA C CA    1 
ATOM   6589  C C     . ALA C  1 192 ? 3.157   -52.100 26.900  1.00 38.52  ? 254 ALA C C     1 
ATOM   6590  O O     . ALA C  1 192 ? 2.224   -51.433 26.456  1.00 39.64  ? 254 ALA C O     1 
ATOM   6591  C CB    . ALA C  1 192 ? 4.182   -51.522 29.090  1.00 38.39  ? 254 ALA C CB    1 
ATOM   6592  N N     . MET C  1 193 ? 4.156   -52.567 26.156  1.00 38.72  ? 255 MET C N     1 
ATOM   6593  C CA    . MET C  1 193 ? 4.164   -52.493 24.688  1.00 40.82  ? 255 MET C CA    1 
ATOM   6594  C C     . MET C  1 193 ? 2.841   -52.868 24.026  1.00 40.28  ? 255 MET C C     1 
ATOM   6595  O O     . MET C  1 193 ? 2.414   -52.228 23.048  1.00 38.35  ? 255 MET C O     1 
ATOM   6596  C CB    . MET C  1 193 ? 5.229   -53.440 24.139  1.00 42.19  ? 255 MET C CB    1 
ATOM   6597  C CG    . MET C  1 193 ? 6.627   -52.883 24.231  1.00 42.80  ? 255 MET C CG    1 
ATOM   6598  S SD    . MET C  1 193 ? 6.810   -51.606 23.000  1.00 43.88  ? 255 MET C SD    1 
ATOM   6599  C CE    . MET C  1 193 ? 8.570   -51.827 22.667  1.00 51.41  ? 255 MET C CE    1 
ATOM   6600  N N     . LYS C  1 194 ? 2.222   -53.918 24.570  1.00 41.25  ? 256 LYS C N     1 
ATOM   6601  C CA    . LYS C  1 194 ? 0.989   -54.494 24.042  1.00 40.80  ? 256 LYS C CA    1 
ATOM   6602  C C     . LYS C  1 194 ? -0.233  -53.663 24.386  1.00 37.45  ? 256 LYS C C     1 
ATOM   6603  O O     . LYS C  1 194 ? -1.336  -54.010 24.005  1.00 38.59  ? 256 LYS C O     1 
ATOM   6604  C CB    . LYS C  1 194 ? 0.830   -55.975 24.490  1.00 42.87  ? 256 LYS C CB    1 
ATOM   6605  C CG    . LYS C  1 194 ? 1.943   -56.935 24.014  1.00 47.72  ? 256 LYS C CG    1 
ATOM   6606  C CD    . LYS C  1 194 ? 2.282   -56.748 22.516  1.00 58.47  ? 256 LYS C CD    1 
ATOM   6607  C CE    . LYS C  1 194 ? 3.664   -57.215 22.055  1.00 64.31  ? 256 LYS C CE    1 
ATOM   6608  N NZ    . LYS C  1 194 ? 3.655   -58.700 21.981  1.00 68.73  ? 256 LYS C NZ    1 
ATOM   6609  N N     . GLU C  1 195 ? -0.046  -52.543 25.060  1.00 36.34  ? 257 GLU C N     1 
ATOM   6610  C CA    . GLU C  1 195 ? -1.161  -51.711 25.417  1.00 37.64  ? 257 GLU C CA    1 
ATOM   6611  C C     . GLU C  1 195 ? -0.986  -50.325 24.834  1.00 33.54  ? 257 GLU C C     1 
ATOM   6612  O O     . GLU C  1 195 ? -0.046  -49.621 25.193  1.00 34.11  ? 257 GLU C O     1 
ATOM   6613  C CB    . GLU C  1 195 ? -1.263  -51.649 26.931  1.00 44.50  ? 257 GLU C CB    1 
ATOM   6614  C CG    . GLU C  1 195 ? -2.603  -51.143 27.419  1.00 51.90  ? 257 GLU C CG    1 
ATOM   6615  C CD    . GLU C  1 195 ? -2.765  -51.270 28.920  1.00 55.24  ? 257 GLU C CD    1 
ATOM   6616  O OE1   . GLU C  1 195 ? -2.336  -52.325 29.466  1.00 51.85  ? 257 GLU C OE1   1 
ATOM   6617  O OE2   . GLU C  1 195 ? -3.324  -50.308 29.525  1.00 57.24  ? 257 GLU C OE2   1 
ATOM   6618  N N     . PRO C  1 196 ? -1.889  -49.919 23.926  1.00 30.70  ? 258 PRO C N     1 
ATOM   6619  C CA    . PRO C  1 196 ? -1.734  -48.615 23.303  1.00 29.04  ? 258 PRO C CA    1 
ATOM   6620  C C     . PRO C  1 196 ? -1.843  -47.543 24.334  1.00 27.53  ? 258 PRO C C     1 
ATOM   6621  O O     . PRO C  1 196 ? -2.414  -47.770 25.361  1.00 27.27  ? 258 PRO C O     1 
ATOM   6622  C CB    . PRO C  1 196 ? -2.909  -48.533 22.314  1.00 29.40  ? 258 PRO C CB    1 
ATOM   6623  C CG    . PRO C  1 196 ? -3.405  -49.923 22.156  1.00 29.60  ? 258 PRO C CG    1 
ATOM   6624  C CD    . PRO C  1 196 ? -3.106  -50.601 23.455  1.00 31.08  ? 258 PRO C CD    1 
ATOM   6625  N N     . LEU C  1 197 ? -1.262  -46.396 24.066  1.00 28.49  ? 259 LEU C N     1 
ATOM   6626  C CA    . LEU C  1 197 ? -1.375  -45.259 24.949  1.00 30.79  ? 259 LEU C CA    1 
ATOM   6627  C C     . LEU C  1 197 ? -2.396  -44.305 24.410  1.00 30.16  ? 259 LEU C C     1 
ATOM   6628  O O     . LEU C  1 197 ? -2.378  -43.980 23.226  1.00 32.46  ? 259 LEU C O     1 
ATOM   6629  C CB    . LEU C  1 197 ? -0.056  -44.498 25.017  1.00 34.20  ? 259 LEU C CB    1 
ATOM   6630  C CG    . LEU C  1 197 ? 0.851   -44.781 26.208  1.00 37.34  ? 259 LEU C CG    1 
ATOM   6631  C CD1   . LEU C  1 197 ? 1.496   -46.173 26.133  1.00 37.55  ? 259 LEU C CD1   1 
ATOM   6632  C CD2   . LEU C  1 197 ? 1.882   -43.653 26.289  1.00 39.56  ? 259 LEU C CD2   1 
ATOM   6633  N N     . VAL C  1 198 ? -3.260  -43.804 25.272  1.00 28.30  ? 260 VAL C N     1 
ATOM   6634  C CA    . VAL C  1 198 ? -4.075  -42.679 24.887  1.00 27.01  ? 260 VAL C CA    1 
ATOM   6635  C C     . VAL C  1 198 ? -3.344  -41.465 25.389  1.00 26.87  ? 260 VAL C C     1 
ATOM   6636  O O     . VAL C  1 198 ? -3.259  -41.266 26.586  1.00 26.97  ? 260 VAL C O     1 
ATOM   6637  C CB    . VAL C  1 198 ? -5.466  -42.776 25.506  1.00 26.16  ? 260 VAL C CB    1 
ATOM   6638  C CG1   . VAL C  1 198 ? -6.281  -41.530 25.216  1.00 26.09  ? 260 VAL C CG1   1 
ATOM   6639  C CG2   . VAL C  1 198 ? -6.170  -44.007 24.980  1.00 26.08  ? 260 VAL C CG2   1 
ATOM   6640  N N     . ASP C  1 199 ? -2.799  -40.659 24.490  1.00 27.44  ? 261 ASP C N     1 
ATOM   6641  C CA    . ASP C  1 199 ? -2.116  -39.443 24.924  1.00 29.14  ? 261 ASP C CA    1 
ATOM   6642  C C     . ASP C  1 199 ? -1.925  -38.456 23.783  1.00 29.22  ? 261 ASP C C     1 
ATOM   6643  O O     . ASP C  1 199 ? -2.052  -38.854 22.635  1.00 30.45  ? 261 ASP C O     1 
ATOM   6644  C CB    . ASP C  1 199 ? -0.777  -39.782 25.552  1.00 29.13  ? 261 ASP C CB    1 
ATOM   6645  C CG    . ASP C  1 199 ? -0.484  -38.920 26.769  1.00 30.59  ? 261 ASP C CG    1 
ATOM   6646  O OD1   . ASP C  1 199 ? -0.898  -37.721 26.818  1.00 29.53  ? 261 ASP C OD1   1 
ATOM   6647  O OD2   . ASP C  1 199 ? 0.166   -39.467 27.684  1.00 32.43  ? 261 ASP C OD2   1 
ATOM   6648  N N     . ILE C  1 200 ? -1.639  -37.182 24.083  1.00 28.30  ? 262 ILE C N     1 
ATOM   6649  C CA    . ILE C  1 200 ? -1.530  -36.185 23.012  1.00 28.59  ? 262 ILE C CA    1 
ATOM   6650  C C     . ILE C  1 200 ? -0.228  -36.360 22.259  1.00 27.44  ? 262 ILE C C     1 
ATOM   6651  O O     . ILE C  1 200 ? 0.807   -36.596 22.854  1.00 27.98  ? 262 ILE C O     1 
ATOM   6652  C CB    . ILE C  1 200 ? -1.661  -34.724 23.497  1.00 29.93  ? 262 ILE C CB    1 
ATOM   6653  C CG1   . ILE C  1 200 ? -3.081  -34.456 24.014  1.00 32.66  ? 262 ILE C CG1   1 
ATOM   6654  C CG2   . ILE C  1 200 ? -1.348  -33.727 22.379  1.00 29.80  ? 262 ILE C CG2   1 
ATOM   6655  C CD1   . ILE C  1 200 ? -3.135  -34.303 25.523  1.00 34.92  ? 262 ILE C CD1   1 
ATOM   6656  N N     . VAL C  1 201 ? -0.303  -36.226 20.944  1.00 26.52  ? 263 VAL C N     1 
ATOM   6657  C CA    . VAL C  1 201 ? 0.850   -36.257 20.083  1.00 26.55  ? 263 VAL C CA    1 
ATOM   6658  C C     . VAL C  1 201 ? 1.020   -34.865 19.484  1.00 28.32  ? 263 VAL C C     1 
ATOM   6659  O O     . VAL C  1 201 ? 0.043   -34.258 19.030  1.00 29.87  ? 263 VAL C O     1 
ATOM   6660  C CB    . VAL C  1 201 ? 0.636   -37.286 18.984  1.00 25.96  ? 263 VAL C CB    1 
ATOM   6661  C CG1   . VAL C  1 201 ? 1.879   -37.408 18.132  1.00 26.20  ? 263 VAL C CG1   1 
ATOM   6662  C CG2   . VAL C  1 201 ? 0.281   -38.626 19.613  1.00 25.43  ? 263 VAL C CG2   1 
ATOM   6663  N N     . ASP C  1 202 ? 2.244   -34.338 19.522  1.00 29.07  ? 264 ASP C N     1 
ATOM   6664  C CA    . ASP C  1 202 ? 2.533   -33.045 18.926  1.00 30.13  ? 264 ASP C CA    1 
ATOM   6665  C C     . ASP C  1 202 ? 2.489   -33.273 17.416  1.00 31.42  ? 264 ASP C C     1 
ATOM   6666  O O     . ASP C  1 202 ? 3.102   -34.230 16.916  1.00 33.73  ? 264 ASP C O     1 
ATOM   6667  C CB    . ASP C  1 202 ? 3.909   -32.545 19.358  1.00 30.79  ? 264 ASP C CB    1 
ATOM   6668  C CG    . ASP C  1 202 ? 4.167   -31.071 18.973  1.00 32.27  ? 264 ASP C CG    1 
ATOM   6669  O OD1   . ASP C  1 202 ? 3.814   -30.632 17.851  1.00 31.65  ? 264 ASP C OD1   1 
ATOM   6670  O OD2   . ASP C  1 202 ? 4.798   -30.364 19.786  1.00 32.92  ? 264 ASP C OD2   1 
ATOM   6671  N N     . PRO C  1 203 ? 1.757   -32.421 16.673  1.00 31.03  ? 265 PRO C N     1 
ATOM   6672  C CA    . PRO C  1 203 ? 1.727   -32.600 15.204  1.00 31.41  ? 265 PRO C CA    1 
ATOM   6673  C C     . PRO C  1 203 ? 3.109   -32.719 14.556  1.00 30.57  ? 265 PRO C C     1 
ATOM   6674  O O     . PRO C  1 203 ? 3.259   -33.467 13.600  1.00 30.84  ? 265 PRO C O     1 
ATOM   6675  C CB    . PRO C  1 203 ? 0.991   -31.346 14.695  1.00 31.26  ? 265 PRO C CB    1 
ATOM   6676  C CG    . PRO C  1 203 ? 0.784   -30.459 15.895  1.00 30.41  ? 265 PRO C CG    1 
ATOM   6677  C CD    . PRO C  1 203 ? 0.893   -31.316 17.115  1.00 30.21  ? 265 PRO C CD    1 
ATOM   6678  N N     . LYS C  1 204 ? 4.103   -32.016 15.103  1.00 29.69  ? 266 LYS C N     1 
ATOM   6679  C CA    . LYS C  1 204 ? 5.470   -32.062 14.594  1.00 29.28  ? 266 LYS C CA    1 
ATOM   6680  C C     . LYS C  1 204 ? 6.063   -33.458 14.566  1.00 26.94  ? 266 LYS C C     1 
ATOM   6681  O O     . LYS C  1 204 ? 6.910   -33.752 13.739  1.00 24.75  ? 266 LYS C O     1 
ATOM   6682  C CB    . LYS C  1 204 ? 6.363   -31.128 15.409  1.00 31.47  ? 266 LYS C CB    1 
ATOM   6683  C CG    . LYS C  1 204 ? 6.101   -29.674 15.067  1.00 32.98  ? 266 LYS C CG    1 
ATOM   6684  C CD    . LYS C  1 204 ? 6.586   -28.713 16.122  1.00 34.01  ? 266 LYS C CD    1 
ATOM   6685  C CE    . LYS C  1 204 ? 6.370   -27.301 15.609  1.00 35.25  ? 266 LYS C CE    1 
ATOM   6686  N NZ    . LYS C  1 204 ? 6.482   -26.308 16.712  1.00 37.87  ? 266 LYS C NZ    1 
ATOM   6687  N N     . GLN C  1 205 ? 5.604   -34.320 15.462  1.00 26.87  ? 267 GLN C N     1 
ATOM   6688  C CA    . GLN C  1 205 ? 6.120   -35.679 15.541  1.00 26.97  ? 267 GLN C CA    1 
ATOM   6689  C C     . GLN C  1 205 ? 5.649   -36.550 14.420  1.00 25.70  ? 267 GLN C C     1 
ATOM   6690  O O     . GLN C  1 205 ? 6.188   -37.644 14.270  1.00 27.13  ? 267 GLN C O     1 
ATOM   6691  C CB    . GLN C  1 205 ? 5.718   -36.358 16.842  1.00 28.44  ? 267 GLN C CB    1 
ATOM   6692  C CG    . GLN C  1 205 ? 6.334   -35.742 18.091  1.00 30.01  ? 267 GLN C CG    1 
ATOM   6693  C CD    . GLN C  1 205 ? 5.885   -36.435 19.361  1.00 30.29  ? 267 GLN C CD    1 
ATOM   6694  O OE1   . GLN C  1 205 ? 6.072   -37.640 19.522  1.00 31.07  ? 267 GLN C OE1   1 
ATOM   6695  N NE2   . GLN C  1 205 ? 5.288   -35.683 20.265  1.00 30.64  ? 267 GLN C NE2   1 
ATOM   6696  N N     . VAL C  1 206 ? 4.669   -36.087 13.638  1.00 23.84  ? 268 VAL C N     1 
ATOM   6697  C CA    . VAL C  1 206 ? 4.111   -36.889 12.543  1.00 22.46  ? 268 VAL C CA    1 
ATOM   6698  C C     . VAL C  1 206 ? 5.028   -36.891 11.327  1.00 21.80  ? 268 VAL C C     1 
ATOM   6699  O O     . VAL C  1 206 ? 5.391   -35.837 10.801  1.00 20.24  ? 268 VAL C O     1 
ATOM   6700  C CB    . VAL C  1 206 ? 2.705   -36.413 12.141  1.00 22.10  ? 268 VAL C CB    1 
ATOM   6701  C CG1   . VAL C  1 206 ? 2.139   -37.262 11.016  1.00 21.41  ? 268 VAL C CG1   1 
ATOM   6702  C CG2   . VAL C  1 206 ? 1.783   -36.474 13.338  1.00 22.62  ? 268 VAL C CG2   1 
ATOM   6703  N N     . VAL C  1 207 ? 5.364   -38.107 10.893  1.00 21.83  ? 269 VAL C N     1 
ATOM   6704  C CA    . VAL C  1 207 ? 6.343   -38.364 9.847   1.00 21.74  ? 269 VAL C CA    1 
ATOM   6705  C C     . VAL C  1 207 ? 5.695   -38.600 8.491   1.00 21.95  ? 269 VAL C C     1 
ATOM   6706  O O     . VAL C  1 207 ? 6.361   -38.452 7.472   1.00 22.62  ? 269 VAL C O     1 
ATOM   6707  C CB    . VAL C  1 207 ? 7.203   -39.582 10.233  1.00 21.37  ? 269 VAL C CB    1 
ATOM   6708  C CG1   . VAL C  1 207 ? 8.088   -40.069 9.089   1.00 21.35  ? 269 VAL C CG1   1 
ATOM   6709  C CG2   . VAL C  1 207 ? 8.067   -39.216 11.421  1.00 22.01  ? 269 VAL C CG2   1 
ATOM   6710  N N     . THR C  1 208 ? 4.415   -38.959 8.473   1.00 21.91  ? 270 THR C N     1 
ATOM   6711  C CA    . THR C  1 208 ? 3.764   -39.399 7.252   1.00 22.56  ? 270 THR C CA    1 
ATOM   6712  C C     . THR C  1 208 ? 2.475   -38.659 6.954   1.00 23.83  ? 270 THR C C     1 
ATOM   6713  O O     . THR C  1 208 ? 1.994   -37.839 7.714   1.00 23.01  ? 270 THR C O     1 
ATOM   6714  C CB    . THR C  1 208 ? 3.390   -40.886 7.328   1.00 22.07  ? 270 THR C CB    1 
ATOM   6715  O OG1   . THR C  1 208 ? 2.319   -41.051 8.247   1.00 22.38  ? 270 THR C OG1   1 
ATOM   6716  C CG2   . THR C  1 208 ? 4.562   -41.713 7.783   1.00 22.56  ? 270 THR C CG2   1 
ATOM   6717  N N     . ASN C  1 209 ? 1.914   -38.983 5.807   1.00 26.98  ? 271 ASN C N     1 
ATOM   6718  C CA    . ASN C  1 209 ? 0.542   -38.615 5.485   1.00 28.75  ? 271 ASN C CA    1 
ATOM   6719  C C     . ASN C  1 209 ? -0.379  -39.535 6.269   1.00 30.14  ? 271 ASN C C     1 
ATOM   6720  O O     . ASN C  1 209 ? 0.090   -40.423 7.015   1.00 28.63  ? 271 ASN C O     1 
ATOM   6721  C CB    . ASN C  1 209 ? 0.269   -38.743 3.974   1.00 28.04  ? 271 ASN C CB    1 
ATOM   6722  C CG    . ASN C  1 209 ? 0.500   -40.162 3.440   1.00 28.33  ? 271 ASN C CG    1 
ATOM   6723  O OD1   . ASN C  1 209 ? 1.012   -41.058 4.131   1.00 28.18  ? 271 ASN C OD1   1 
ATOM   6724  N ND2   . ASN C  1 209 ? 0.134   -40.365 2.189   1.00 29.39  ? 271 ASN C ND2   1 
ATOM   6725  N N     . ALA C  1 210 ? -1.683  -39.336 6.072   1.00 31.34  ? 272 ALA C N     1 
ATOM   6726  C CA    . ALA C  1 210 ? -2.689  -40.136 6.754   1.00 31.79  ? 272 ALA C CA    1 
ATOM   6727  C C     . ALA C  1 210 ? -3.412  -41.110 5.836   1.00 29.84  ? 272 ALA C C     1 
ATOM   6728  O O     . ALA C  1 210 ? -3.651  -40.827 4.676   1.00 29.22  ? 272 ALA C O     1 
ATOM   6729  C CB    . ALA C  1 210 ? -3.692  -39.227 7.435   1.00 33.85  ? 272 ALA C CB    1 
ATOM   6730  N N     . CYS C  1 211 ? -3.773  -42.252 6.396   1.00 29.35  ? 273 CYS C N     1 
ATOM   6731  C CA    . CYS C  1 211 ? -4.410  -43.309 5.648   1.00 29.18  ? 273 CYS C CA    1 
ATOM   6732  C C     . CYS C  1 211 ? -5.687  -43.697 6.340   1.00 29.36  ? 273 CYS C C     1 
ATOM   6733  O O     . CYS C  1 211 ? -5.718  -43.928 7.550   1.00 30.38  ? 273 CYS C O     1 
ATOM   6734  C CB    . CYS C  1 211 ? -3.488  -44.516 5.565   1.00 29.89  ? 273 CYS C CB    1 
ATOM   6735  S SG    . CYS C  1 211 ? -4.208  -45.987 4.797   1.00 28.73  ? 273 CYS C SG    1 
ATOM   6736  N N     . LEU C  1 212 ? -6.747  -43.748 5.556   1.00 30.03  ? 274 LEU C N     1 
ATOM   6737  C CA    . LEU C  1 212 ? -8.077  -44.106 6.042   1.00 30.85  ? 274 LEU C CA    1 
ATOM   6738  C C     . LEU C  1 212 ? -8.152  -45.596 6.298   1.00 29.61  ? 274 LEU C C     1 
ATOM   6739  O O     . LEU C  1 212 ? -7.926  -46.394 5.394   1.00 30.72  ? 274 LEU C O     1 
ATOM   6740  C CB    . LEU C  1 212 ? -9.127  -43.696 4.995   1.00 31.75  ? 274 LEU C CB    1 
ATOM   6741  C CG    . LEU C  1 212 ? -10.585 -44.067 5.240   1.00 33.38  ? 274 LEU C CG    1 
ATOM   6742  C CD1   . LEU C  1 212 ? -11.095 -43.380 6.496   1.00 35.56  ? 274 LEU C CD1   1 
ATOM   6743  C CD2   . LEU C  1 212 ? -11.450 -43.703 4.039   1.00 33.19  ? 274 LEU C CD2   1 
ATOM   6744  N N     . ILE C  1 213 ? -8.479  -45.988 7.514   1.00 29.48  ? 275 ILE C N     1 
ATOM   6745  C CA    . ILE C  1 213 ? -8.574  -47.421 7.789   1.00 30.42  ? 275 ILE C CA    1 
ATOM   6746  C C     . ILE C  1 213 ? -9.969  -47.932 8.154   1.00 30.06  ? 275 ILE C C     1 
ATOM   6747  O O     . ILE C  1 213 ? -10.151 -49.140 8.283   1.00 28.42  ? 275 ILE C O     1 
ATOM   6748  C CB    . ILE C  1 213 ? -7.566  -47.858 8.853   1.00 30.44  ? 275 ILE C CB    1 
ATOM   6749  C CG1   . ILE C  1 213 ? -7.755  -47.064 10.131  1.00 31.12  ? 275 ILE C CG1   1 
ATOM   6750  C CG2   . ILE C  1 213 ? -6.166  -47.651 8.330   1.00 30.38  ? 275 ILE C CG2   1 
ATOM   6751  C CD1   . ILE C  1 213 ? -7.099  -47.749 11.294  1.00 32.58  ? 275 ILE C CD1   1 
ATOM   6752  N N     . LYS C  1 214 ? -10.938 -47.029 8.319   1.00 30.85  ? 276 LYS C N     1 
ATOM   6753  C CA    . LYS C  1 214 ? -12.317 -47.435 8.570   1.00 32.01  ? 276 LYS C CA    1 
ATOM   6754  C C     . LYS C  1 214 ? -13.281 -46.276 8.457   1.00 32.31  ? 276 LYS C C     1 
ATOM   6755  O O     . LYS C  1 214 ? -13.171 -45.277 9.179   1.00 32.01  ? 276 LYS C O     1 
ATOM   6756  C CB    . LYS C  1 214 ? -12.469 -48.057 9.964   1.00 33.25  ? 276 LYS C CB    1 
ATOM   6757  C CG    . LYS C  1 214 ? -13.835 -48.661 10.213  1.00 34.15  ? 276 LYS C CG    1 
ATOM   6758  C CD    . LYS C  1 214 ? -14.057 -49.900 9.379   1.00 34.14  ? 276 LYS C CD    1 
ATOM   6759  C CE    . LYS C  1 214 ? -15.509 -50.327 9.418   1.00 34.86  ? 276 LYS C CE    1 
ATOM   6760  N NZ    . LYS C  1 214 ? -15.621 -51.699 8.853   1.00 35.96  ? 276 LYS C NZ    1 
ATOM   6761  N N     . GLU C  1 215 ? -14.242 -46.440 7.560   1.00 33.12  ? 277 GLU C N     1 
ATOM   6762  C CA    . GLU C  1 215 ? -15.264 -45.451 7.331   1.00 33.90  ? 277 GLU C CA    1 
ATOM   6763  C C     . GLU C  1 215 ? -16.522 -46.027 7.922   1.00 33.22  ? 277 GLU C C     1 
ATOM   6764  O O     . GLU C  1 215 ? -16.726 -47.241 7.916   1.00 34.01  ? 277 GLU C O     1 
ATOM   6765  C CB    . GLU C  1 215 ? -15.398 -45.198 5.830   1.00 37.29  ? 277 GLU C CB    1 
ATOM   6766  C CG    . GLU C  1 215 ? -16.092 -43.896 5.455   1.00 42.46  ? 277 GLU C CG    1 
ATOM   6767  C CD    . GLU C  1 215 ? -15.718 -43.410 4.058   1.00 46.51  ? 277 GLU C CD    1 
ATOM   6768  O OE1   . GLU C  1 215 ? -15.907 -42.186 3.803   1.00 52.62  ? 277 GLU C OE1   1 
ATOM   6769  O OE2   . GLU C  1 215 ? -15.207 -44.226 3.244   1.00 42.19  ? 277 GLU C OE2   1 
ATOM   6770  N N     . VAL C  1 216 ? -17.357 -45.165 8.481   1.00 32.79  ? 278 VAL C N     1 
ATOM   6771  C CA    . VAL C  1 216 ? -18.575 -45.624 9.118   1.00 31.40  ? 278 VAL C CA    1 
ATOM   6772  C C     . VAL C  1 216 ? -19.717 -44.754 8.657   1.00 31.08  ? 278 VAL C C     1 
ATOM   6773  O O     . VAL C  1 216 ? -19.734 -43.545 8.949   1.00 31.07  ? 278 VAL C O     1 
ATOM   6774  C CB    . VAL C  1 216 ? -18.445 -45.576 10.646  1.00 31.13  ? 278 VAL C CB    1 
ATOM   6775  C CG1   . VAL C  1 216 ? -19.747 -45.955 11.318  1.00 32.42  ? 278 VAL C CG1   1 
ATOM   6776  C CG2   . VAL C  1 216 ? -17.385 -46.547 11.086  1.00 31.09  ? 278 VAL C CG2   1 
ATOM   6777  N N     . ASP C  1 217 ? -20.636 -45.357 7.895   1.00 29.85  ? 279 ASP C N     1 
ATOM   6778  C CA    . ASP C  1 217 ? -21.913 -44.726 7.615   1.00 29.21  ? 279 ASP C CA    1 
ATOM   6779  C C     . ASP C  1 217 ? -22.862 -45.232 8.685   1.00 30.22  ? 279 ASP C C     1 
ATOM   6780  O O     . ASP C  1 217 ? -23.332 -46.379 8.641   1.00 31.64  ? 279 ASP C O     1 
ATOM   6781  C CB    . ASP C  1 217 ? -22.450 -45.063 6.229   1.00 27.86  ? 279 ASP C CB    1 
ATOM   6782  C CG    . ASP C  1 217 ? -23.785 -44.387 5.944   1.00 27.51  ? 279 ASP C CG    1 
ATOM   6783  O OD1   . ASP C  1 217 ? -24.110 -43.366 6.592   1.00 27.23  ? 279 ASP C OD1   1 
ATOM   6784  O OD2   . ASP C  1 217 ? -24.515 -44.868 5.066   1.00 27.06  ? 279 ASP C OD2   1 
ATOM   6785  N N     . ILE C  1 218 ? -23.168 -44.363 9.637   1.00 29.80  ? 280 ILE C N     1 
ATOM   6786  C CA    . ILE C  1 218 ? -23.895 -44.783 10.817  1.00 29.83  ? 280 ILE C CA    1 
ATOM   6787  C C     . ILE C  1 218 ? -25.297 -45.278 10.469  1.00 27.31  ? 280 ILE C C     1 
ATOM   6788  O O     . ILE C  1 218 ? -25.866 -46.073 11.202  1.00 25.99  ? 280 ILE C O     1 
ATOM   6789  C CB    . ILE C  1 218 ? -23.935 -43.654 11.868  1.00 31.90  ? 280 ILE C CB    1 
ATOM   6790  C CG1   . ILE C  1 218 ? -22.505 -43.331 12.318  1.00 33.35  ? 280 ILE C CG1   1 
ATOM   6791  C CG2   . ILE C  1 218 ? -24.763 -44.081 13.074  1.00 32.76  ? 280 ILE C CG2   1 
ATOM   6792  C CD1   . ILE C  1 218 ? -22.362 -42.257 13.382  1.00 33.96  ? 280 ILE C CD1   1 
ATOM   6793  N N     . TYR C  1 219 ? -25.840 -44.815 9.346   1.00 26.19  ? 281 TYR C N     1 
ATOM   6794  C CA    . TYR C  1 219 ? -27.151 -45.268 8.885   1.00 24.84  ? 281 TYR C CA    1 
ATOM   6795  C C     . TYR C  1 219 ? -27.110 -46.756 8.515   1.00 25.71  ? 281 TYR C C     1 
ATOM   6796  O O     . TYR C  1 219 ? -28.053 -47.478 8.801   1.00 26.36  ? 281 TYR C O     1 
ATOM   6797  C CB    . TYR C  1 219 ? -27.672 -44.421 7.711   1.00 22.61  ? 281 TYR C CB    1 
ATOM   6798  C CG    . TYR C  1 219 ? -27.877 -42.981 8.074   1.00 20.93  ? 281 TYR C CG    1 
ATOM   6799  C CD1   . TYR C  1 219 ? -28.807 -42.602 9.022   1.00 20.48  ? 281 TYR C CD1   1 
ATOM   6800  C CD2   . TYR C  1 219 ? -27.114 -41.990 7.477   1.00 20.98  ? 281 TYR C CD2   1 
ATOM   6801  C CE1   . TYR C  1 219 ? -28.975 -41.259 9.356   1.00 20.73  ? 281 TYR C CE1   1 
ATOM   6802  C CE2   . TYR C  1 219 ? -27.270 -40.649 7.796   1.00 20.84  ? 281 TYR C CE2   1 
ATOM   6803  C CZ    . TYR C  1 219 ? -28.190 -40.287 8.733   1.00 20.48  ? 281 TYR C CZ    1 
ATOM   6804  O OH    . TYR C  1 219 ? -28.303 -38.953 9.010   1.00 19.90  ? 281 TYR C OH    1 
ATOM   6805  N N     . THR C  1 220 ? -26.018 -47.233 7.934   1.00 26.27  ? 282 THR C N     1 
ATOM   6806  C CA    . THR C  1 220 ? -26.039 -48.556 7.327   1.00 26.79  ? 282 THR C CA    1 
ATOM   6807  C C     . THR C  1 220 ? -25.087 -49.577 7.944   1.00 28.28  ? 282 THR C C     1 
ATOM   6808  O O     . THR C  1 220 ? -25.146 -50.749 7.590   1.00 28.23  ? 282 THR C O     1 
ATOM   6809  C CB    . THR C  1 220 ? -25.746 -48.447 5.820   1.00 26.56  ? 282 THR C CB    1 
ATOM   6810  O OG1   . THR C  1 220 ? -24.414 -47.966 5.632   1.00 27.04  ? 282 THR C OG1   1 
ATOM   6811  C CG2   . THR C  1 220 ? -26.715 -47.474 5.152   1.00 26.63  ? 282 THR C CG2   1 
ATOM   6812  N N     . VAL C  1 221 ? -24.190 -49.176 8.837   1.00 30.71  ? 283 VAL C N     1 
ATOM   6813  C CA    . VAL C  1 221 ? -23.241 -50.181 9.353   1.00 33.72  ? 283 VAL C CA    1 
ATOM   6814  C C     . VAL C  1 221 ? -23.957 -51.175 10.230  1.00 32.84  ? 283 VAL C C     1 
ATOM   6815  O O     . VAL C  1 221 ? -24.931 -50.833 10.877  1.00 30.63  ? 283 VAL C O     1 
ATOM   6816  C CB    . VAL C  1 221 ? -22.010 -49.610 10.115  1.00 35.50  ? 283 VAL C CB    1 
ATOM   6817  C CG1   . VAL C  1 221 ? -21.030 -48.977 9.116   1.00 38.19  ? 283 VAL C CG1   1 
ATOM   6818  C CG2   . VAL C  1 221 ? -22.433 -48.641 11.220  1.00 35.15  ? 283 VAL C CG2   1 
ATOM   6819  N N     . LYS C  1 222 ? -23.439 -52.396 10.237  1.00 34.18  ? 284 LYS C N     1 
ATOM   6820  C CA    . LYS C  1 222 ? -23.971 -53.485 11.028  1.00 36.35  ? 284 LYS C CA    1 
ATOM   6821  C C     . LYS C  1 222 ? -22.870 -53.879 11.990  1.00 35.11  ? 284 LYS C C     1 
ATOM   6822  O O     . LYS C  1 222 ? -21.697 -53.574 11.762  1.00 34.13  ? 284 LYS C O     1 
ATOM   6823  C CB    . LYS C  1 222 ? -24.344 -54.669 10.143  1.00 40.91  ? 284 LYS C CB    1 
ATOM   6824  C CG    . LYS C  1 222 ? -24.308 -54.375 8.651   1.00 46.37  ? 284 LYS C CG    1 
ATOM   6825  C CD    . LYS C  1 222 ? -25.172 -55.332 7.858   1.00 51.70  ? 284 LYS C CD    1 
ATOM   6826  C CE    . LYS C  1 222 ? -26.600 -54.830 7.868   1.00 59.35  ? 284 LYS C CE    1 
ATOM   6827  N NZ    . LYS C  1 222 ? -27.559 -55.924 7.565   1.00 68.22  ? 284 LYS C NZ    1 
ATOM   6828  N N     . THR C  1 223 ? -23.219 -54.552 13.073  1.00 33.95  ? 285 THR C N     1 
ATOM   6829  C CA    . THR C  1 223 ? -22.204 -54.789 14.073  1.00 34.77  ? 285 THR C CA    1 
ATOM   6830  C C     . THR C  1 223 ? -21.073 -55.665 13.533  1.00 34.98  ? 285 THR C C     1 
ATOM   6831  O O     . THR C  1 223 ? -19.912 -55.405 13.844  1.00 36.68  ? 285 THR C O     1 
ATOM   6832  C CB    . THR C  1 223 ? -22.743 -55.384 15.381  1.00 34.46  ? 285 THR C CB    1 
ATOM   6833  O OG1   . THR C  1 223 ? -23.126 -56.737 15.155  1.00 35.32  ? 285 THR C OG1   1 
ATOM   6834  C CG2   . THR C  1 223 ? -23.909 -54.560 15.937  1.00 34.52  ? 285 THR C CG2   1 
ATOM   6835  N N     . GLU C  1 224 ? -21.374 -56.663 12.702  1.00 34.67  ? 286 GLU C N     1 
ATOM   6836  C CA    . GLU C  1 224 ? -20.302 -57.582 12.233  1.00 33.74  ? 286 GLU C CA    1 
ATOM   6837  C C     . GLU C  1 224 ? -19.232 -56.886 11.377  1.00 31.17  ? 286 GLU C C     1 
ATOM   6838  O O     . GLU C  1 224 ? -18.119 -57.402 11.261  1.00 28.76  ? 286 GLU C O     1 
ATOM   6839  C CB    . GLU C  1 224 ? -20.850 -58.848 11.527  1.00 34.29  ? 286 GLU C CB    1 
ATOM   6840  C CG    . GLU C  1 224 ? -21.282 -58.679 10.075  1.00 35.60  ? 286 GLU C CG    1 
ATOM   6841  C CD    . GLU C  1 224 ? -22.777 -58.523 9.900   1.00 37.70  ? 286 GLU C CD    1 
ATOM   6842  O OE1   . GLU C  1 224 ? -23.489 -58.293 10.914  1.00 38.18  ? 286 GLU C OE1   1 
ATOM   6843  O OE2   . GLU C  1 224 ? -23.231 -58.619 8.731   1.00 40.10  ? 286 GLU C OE2   1 
ATOM   6844  N N     . GLU C  1 225 ? -19.574 -55.724 10.806  1.00 30.16  ? 287 GLU C N     1 
ATOM   6845  C CA    . GLU C  1 225 ? -18.622 -54.892 10.080  1.00 30.72  ? 287 GLU C CA    1 
ATOM   6846  C C     . GLU C  1 225 ? -17.617 -54.208 11.005  1.00 31.15  ? 287 GLU C C     1 
ATOM   6847  O O     . GLU C  1 225 ? -16.626 -53.665 10.527  1.00 35.36  ? 287 GLU C O     1 
ATOM   6848  C CB    . GLU C  1 225 ? -19.330 -53.813 9.255   1.00 31.62  ? 287 GLU C CB    1 
ATOM   6849  C CG    . GLU C  1 225 ? -20.203 -54.345 8.123   1.00 33.72  ? 287 GLU C CG    1 
ATOM   6850  C CD    . GLU C  1 225 ? -21.025 -53.266 7.425   1.00 35.62  ? 287 GLU C CD    1 
ATOM   6851  O OE1   . GLU C  1 225 ? -20.795 -52.068 7.689   1.00 40.64  ? 287 GLU C OE1   1 
ATOM   6852  O OE2   . GLU C  1 225 ? -21.917 -53.605 6.619   1.00 34.90  ? 287 GLU C OE2   1 
ATOM   6853  N N     . LEU C  1 226 ? -17.858 -54.209 12.311  1.00 29.52  ? 288 LEU C N     1 
ATOM   6854  C CA    . LEU C  1 226 ? -16.924 -53.592 13.246  1.00 28.07  ? 288 LEU C CA    1 
ATOM   6855  C C     . LEU C  1 226 ? -15.779 -54.510 13.663  1.00 27.03  ? 288 LEU C C     1 
ATOM   6856  O O     . LEU C  1 226 ? -14.814 -54.061 14.254  1.00 28.20  ? 288 LEU C O     1 
ATOM   6857  C CB    . LEU C  1 226 ? -17.672 -53.039 14.455  1.00 27.40  ? 288 LEU C CB    1 
ATOM   6858  C CG    . LEU C  1 226 ? -18.740 -52.034 14.043  1.00 28.34  ? 288 LEU C CG    1 
ATOM   6859  C CD1   . LEU C  1 226 ? -19.544 -51.584 15.252  1.00 28.96  ? 288 LEU C CD1   1 
ATOM   6860  C CD2   . LEU C  1 226 ? -18.134 -50.825 13.333  1.00 28.45  ? 288 LEU C CD2   1 
ATOM   6861  N N     . SER C  1 227 ? -15.881 -55.794 13.384  1.00 26.68  ? 289 SER C N     1 
ATOM   6862  C CA    . SER C  1 227 ? -14.717 -56.659 13.447  1.00 26.84  ? 289 SER C CA    1 
ATOM   6863  C C     . SER C  1 227 ? -14.221 -56.721 12.019  1.00 27.66  ? 289 SER C C     1 
ATOM   6864  O O     . SER C  1 227 ? -14.925 -57.186 11.128  1.00 28.18  ? 289 SER C O     1 
ATOM   6865  C CB    . SER C  1 227 ? -15.071 -58.052 13.942  1.00 27.23  ? 289 SER C CB    1 
ATOM   6866  O OG    . SER C  1 227 ? -15.323 -58.055 15.336  1.00 26.69  ? 289 SER C OG    1 
ATOM   6867  N N     . PHE C  1 228 ? -13.017 -56.221 11.789  1.00 28.67  ? 290 PHE C N     1 
ATOM   6868  C CA    . PHE C  1 228 ? -12.531 -56.011 10.425  1.00 28.08  ? 290 PHE C CA    1 
ATOM   6869  C C     . PHE C  1 228 ? -11.025 -56.110 10.310  1.00 26.99  ? 290 PHE C C     1 
ATOM   6870  O O     . PHE C  1 228 ? -10.298 -56.010 11.290  1.00 27.46  ? 290 PHE C O     1 
ATOM   6871  C CB    . PHE C  1 228 ? -12.989 -54.634 9.901   1.00 27.75  ? 290 PHE C CB    1 
ATOM   6872  C CG    . PHE C  1 228 ? -12.363 -53.451 10.613  1.00 26.75  ? 290 PHE C CG    1 
ATOM   6873  C CD1   . PHE C  1 228 ? -11.148 -52.941 10.207  1.00 26.52  ? 290 PHE C CD1   1 
ATOM   6874  C CD2   . PHE C  1 228 ? -13.010 -52.834 11.668  1.00 26.20  ? 290 PHE C CD2   1 
ATOM   6875  C CE1   . PHE C  1 228 ? -10.586 -51.851 10.848  1.00 25.95  ? 290 PHE C CE1   1 
ATOM   6876  C CE2   . PHE C  1 228 ? -12.446 -51.749 12.314  1.00 26.03  ? 290 PHE C CE2   1 
ATOM   6877  C CZ    . PHE C  1 228 ? -11.238 -51.252 11.900  1.00 25.70  ? 290 PHE C CZ    1 
ATOM   6878  N N     . THR C  1 229 ? -10.580 -56.311 9.089   1.00 26.01  ? 291 THR C N     1 
ATOM   6879  C CA    . THR C  1 229 ? -9.187  -56.181 8.756   1.00 26.28  ? 291 THR C CA    1 
ATOM   6880  C C     . THR C  1 229 ? -9.167  -55.103 7.685   1.00 26.14  ? 291 THR C C     1 
ATOM   6881  O O     . THR C  1 229 ? -10.164 -54.862 7.036   1.00 28.15  ? 291 THR C O     1 
ATOM   6882  C CB    . THR C  1 229 ? -8.603  -57.540 8.329   1.00 26.05  ? 291 THR C CB    1 
ATOM   6883  O OG1   . THR C  1 229 ? -8.732  -58.448 9.426   1.00 25.66  ? 291 THR C OG1   1 
ATOM   6884  C CG2   . THR C  1 229 ? -7.148  -57.425 7.979   1.00 26.38  ? 291 THR C CG2   1 
ATOM   6885  N N     . SER C  1 230 ? -8.063  -54.393 7.562   1.00 25.90  ? 292 SER C N     1 
ATOM   6886  C CA    . SER C  1 230 ? -8.048  -53.166 6.798   1.00 25.92  ? 292 SER C CA    1 
ATOM   6887  C C     . SER C  1 230 ? -6.593  -52.828 6.406   1.00 26.79  ? 292 SER C C     1 
ATOM   6888  O O     . SER C  1 230 ? -5.713  -52.662 7.257   1.00 27.07  ? 292 SER C O     1 
ATOM   6889  C CB    . SER C  1 230 ? -8.701  -52.070 7.662   1.00 25.61  ? 292 SER C CB    1 
ATOM   6890  O OG    . SER C  1 230 ? -8.837  -50.838 6.994   1.00 26.25  ? 292 SER C OG    1 
ATOM   6891  N N     . ALA C  1 231 ? -6.330  -52.740 5.111   1.00 27.68  ? 293 ALA C N     1 
ATOM   6892  C CA    . ALA C  1 231 ? -4.980  -52.420 4.646   1.00 27.90  ? 293 ALA C CA    1 
ATOM   6893  C C     . ALA C  1 231 ? -4.642  -50.933 4.841   1.00 27.51  ? 293 ALA C C     1 
ATOM   6894  O O     . ALA C  1 231 ? -5.526  -50.088 4.954   1.00 26.88  ? 293 ALA C O     1 
ATOM   6895  C CB    . ALA C  1 231 ? -4.822  -52.803 3.188   1.00 27.37  ? 293 ALA C CB    1 
ATOM   6896  N N     . PHE C  1 232 ? -3.356  -50.624 4.903   1.00 27.62  ? 294 PHE C N     1 
ATOM   6897  C CA    . PHE C  1 232 ? -2.932  -49.241 4.994   1.00 27.77  ? 294 PHE C CA    1 
ATOM   6898  C C     . PHE C  1 232 ? -1.580  -49.022 4.352   1.00 27.50  ? 294 PHE C C     1 
ATOM   6899  O O     . PHE C  1 232 ? -0.730  -49.908 4.324   1.00 27.17  ? 294 PHE C O     1 
ATOM   6900  C CB    . PHE C  1 232 ? -2.902  -48.777 6.458   1.00 28.32  ? 294 PHE C CB    1 
ATOM   6901  C CG    . PHE C  1 232 ? -1.794  -49.380 7.283   1.00 28.98  ? 294 PHE C CG    1 
ATOM   6902  C CD1   . PHE C  1 232 ? -1.976  -50.594 7.941   1.00 29.16  ? 294 PHE C CD1   1 
ATOM   6903  C CD2   . PHE C  1 232 ? -0.578  -48.723 7.417   1.00 29.58  ? 294 PHE C CD2   1 
ATOM   6904  C CE1   . PHE C  1 232 ? -0.972  -51.142 8.711   1.00 28.91  ? 294 PHE C CE1   1 
ATOM   6905  C CE2   . PHE C  1 232 ? 0.431   -49.263 8.180   1.00 30.57  ? 294 PHE C CE2   1 
ATOM   6906  C CZ    . PHE C  1 232 ? 0.234   -50.476 8.831   1.00 30.58  ? 294 PHE C CZ    1 
ATOM   6907  N N     . CYS C  1 233 ? -1.381  -47.814 3.861   1.00 27.44  ? 295 CYS C N     1 
ATOM   6908  C CA    . CYS C  1 233 ? -0.086  -47.423 3.370   1.00 28.56  ? 295 CYS C CA    1 
ATOM   6909  C C     . CYS C  1 233 ? 0.223   -46.057 3.891   1.00 27.94  ? 295 CYS C C     1 
ATOM   6910  O O     . CYS C  1 233 ? -0.636  -45.188 3.888   1.00 29.81  ? 295 CYS C O     1 
ATOM   6911  C CB    . CYS C  1 233 ? -0.076  -47.385 1.858   1.00 29.00  ? 295 CYS C CB    1 
ATOM   6912  S SG    . CYS C  1 233 ? 1.589   -47.243 1.184   1.00 35.20  ? 295 CYS C SG    1 
ATOM   6913  N N     . LEU C  1 234 ? 1.450   -45.866 4.341   1.00 26.78  ? 296 LEU C N     1 
ATOM   6914  C CA    . LEU C  1 234 ? 1.880   -44.576 4.807   1.00 25.90  ? 296 LEU C CA    1 
ATOM   6915  C C     . LEU C  1 234 ? 3.131   -44.124 4.035   1.00 25.22  ? 296 LEU C C     1 
ATOM   6916  O O     . LEU C  1 234 ? 4.170   -44.796 3.987   1.00 22.51  ? 296 LEU C O     1 
ATOM   6917  C CB    . LEU C  1 234 ? 2.132   -44.632 6.311   1.00 26.53  ? 296 LEU C CB    1 
ATOM   6918  C CG    . LEU C  1 234 ? 0.924   -44.924 7.210   1.00 26.76  ? 296 LEU C CG    1 
ATOM   6919  C CD1   . LEU C  1 234 ? 1.361   -45.165 8.655   1.00 26.88  ? 296 LEU C CD1   1 
ATOM   6920  C CD2   . LEU C  1 234 ? -0.074  -43.778 7.164   1.00 27.38  ? 296 LEU C CD2   1 
ATOM   6921  N N     . GLN C  1 235 ? 3.005   -42.955 3.433   1.00 25.33  ? 297 GLN C N     1 
ATOM   6922  C CA    . GLN C  1 235 ? 4.091   -42.353 2.718   1.00 25.12  ? 297 GLN C CA    1 
ATOM   6923  C C     . GLN C  1 235 ? 4.923   -41.513 3.674   1.00 24.59  ? 297 GLN C C     1 
ATOM   6924  O O     . GLN C  1 235 ? 4.413   -40.596 4.283   1.00 23.52  ? 297 GLN C O     1 
ATOM   6925  C CB    . GLN C  1 235 ? 3.529   -41.467 1.628   1.00 25.37  ? 297 GLN C CB    1 
ATOM   6926  C CG    . GLN C  1 235 ? 4.599   -40.795 0.801   1.00 26.49  ? 297 GLN C CG    1 
ATOM   6927  C CD    . GLN C  1 235 ? 4.119   -40.414 -0.581  1.00 27.07  ? 297 GLN C CD    1 
ATOM   6928  O OE1   . GLN C  1 235 ? 4.044   -41.256 -1.485  1.00 27.21  ? 297 GLN C OE1   1 
ATOM   6929  N NE2   . GLN C  1 235 ? 3.798   -39.147 -0.760  1.00 27.09  ? 297 GLN C NE2   1 
ATOM   6930  N N     . ILE C  1 236 ? 6.208   -41.819 3.787   1.00 24.57  ? 298 ILE C N     1 
ATOM   6931  C CA    . ILE C  1 236 ? 7.100   -41.031 4.609   1.00 24.76  ? 298 ILE C CA    1 
ATOM   6932  C C     . ILE C  1 236 ? 7.328   -39.664 3.964   1.00 24.30  ? 298 ILE C C     1 
ATOM   6933  O O     . ILE C  1 236 ? 7.853   -39.575 2.880   1.00 23.41  ? 298 ILE C O     1 
ATOM   6934  C CB    . ILE C  1 236 ? 8.428   -41.791 4.837   1.00 26.14  ? 298 ILE C CB    1 
ATOM   6935  C CG1   . ILE C  1 236 ? 8.243   -42.796 5.962   1.00 26.76  ? 298 ILE C CG1   1 
ATOM   6936  C CG2   . ILE C  1 236 ? 9.584   -40.866 5.220   1.00 26.62  ? 298 ILE C CG2   1 
ATOM   6937  C CD1   . ILE C  1 236 ? 7.799   -44.155 5.502   1.00 27.26  ? 298 ILE C CD1   1 
ATOM   6938  N N     . GLN C  1 237 ? 6.952   -38.606 4.664   1.00 25.77  ? 299 GLN C N     1 
ATOM   6939  C CA    . GLN C  1 237 ? 7.103   -37.239 4.187   1.00 27.17  ? 299 GLN C CA    1 
ATOM   6940  C C     . GLN C  1 237 ? 8.487   -36.636 4.412   1.00 29.41  ? 299 GLN C C     1 
ATOM   6941  O O     . GLN C  1 237 ? 8.826   -35.635 3.790   1.00 31.76  ? 299 GLN C O     1 
ATOM   6942  C CB    . GLN C  1 237 ? 6.123   -36.336 4.907   1.00 27.38  ? 299 GLN C CB    1 
ATOM   6943  C CG    . GLN C  1 237 ? 4.665   -36.703 4.722   1.00 28.47  ? 299 GLN C CG    1 
ATOM   6944  C CD    . GLN C  1 237 ? 4.285   -36.771 3.274   1.00 29.95  ? 299 GLN C CD    1 
ATOM   6945  O OE1   . GLN C  1 237 ? 4.286   -35.749 2.589   1.00 32.45  ? 299 GLN C OE1   1 
ATOM   6946  N NE2   . GLN C  1 237 ? 4.004   -37.978 2.775   1.00 30.50  ? 299 GLN C NE2   1 
ATOM   6947  N N     . ARG C  1 238 ? 9.289   -37.208 5.299   1.00 29.89  ? 300 ARG C N     1 
ATOM   6948  C CA    . ARG C  1 238 ? 10.592  -36.612 5.600   1.00 29.99  ? 300 ARG C CA    1 
ATOM   6949  C C     . ARG C  1 238 ? 11.539  -37.644 6.225   1.00 30.66  ? 300 ARG C C     1 
ATOM   6950  O O     . ARG C  1 238 ? 11.090  -38.655 6.776   1.00 31.98  ? 300 ARG C O     1 
ATOM   6951  C CB    . ARG C  1 238 ? 10.413  -35.428 6.543   1.00 27.85  ? 300 ARG C CB    1 
ATOM   6952  C CG    . ARG C  1 238 ? 10.250  -35.905 7.971   1.00 27.23  ? 300 ARG C CG    1 
ATOM   6953  C CD    . ARG C  1 238 ? 9.566   -34.925 8.884   1.00 26.09  ? 300 ARG C CD    1 
ATOM   6954  N NE    . ARG C  1 238 ? 9.426   -35.512 10.214  1.00 25.47  ? 300 ARG C NE    1 
ATOM   6955  C CZ    . ARG C  1 238 ? 8.779   -34.945 11.218  1.00 24.70  ? 300 ARG C CZ    1 
ATOM   6956  N NH1   . ARG C  1 238 ? 8.193   -33.779 11.052  1.00 25.49  ? 300 ARG C NH1   1 
ATOM   6957  N NH2   . ARG C  1 238 ? 8.706   -35.545 12.384  1.00 23.86  ? 300 ARG C NH2   1 
ATOM   6958  N N     . ASN C  1 239 ? 12.843  -37.410 6.119   1.00 29.94  ? 301 ASN C N     1 
ATOM   6959  C CA    . ASN C  1 239 ? 13.784  -38.317 6.727   1.00 30.14  ? 301 ASN C CA    1 
ATOM   6960  C C     . ASN C  1 239 ? 13.607  -38.209 8.195   1.00 27.74  ? 301 ASN C C     1 
ATOM   6961  O O     . ASN C  1 239 ? 13.565  -37.110 8.708   1.00 26.59  ? 301 ASN C O     1 
ATOM   6962  C CB    . ASN C  1 239 ? 15.208  -37.989 6.319   1.00 32.20  ? 301 ASN C CB    1 
ATOM   6963  C CG    . ASN C  1 239 ? 15.403  -38.144 4.835   1.00 33.42  ? 301 ASN C CG    1 
ATOM   6964  O OD1   . ASN C  1 239 ? 15.083  -37.230 4.069   1.00 36.56  ? 301 ASN C OD1   1 
ATOM   6965  N ND2   . ASN C  1 239 ? 15.882  -39.317 4.409   1.00 32.71  ? 301 ASN C ND2   1 
ATOM   6966  N N     . ASP C  1 240 ? 13.470  -39.352 8.860   1.00 26.73  ? 302 ASP C N     1 
ATOM   6967  C CA    . ASP C  1 240 ? 13.254  -39.378 10.306  1.00 25.77  ? 302 ASP C CA    1 
ATOM   6968  C C     . ASP C  1 240 ? 13.350  -40.802 10.834  1.00 26.32  ? 302 ASP C C     1 
ATOM   6969  O O     . ASP C  1 240 ? 13.695  -41.737 10.091  1.00 27.07  ? 302 ASP C O     1 
ATOM   6970  C CB    . ASP C  1 240 ? 11.862  -38.821 10.631  1.00 24.78  ? 302 ASP C CB    1 
ATOM   6971  C CG    . ASP C  1 240 ? 11.821  -38.058 11.938  1.00 23.52  ? 302 ASP C CG    1 
ATOM   6972  O OD1   . ASP C  1 240 ? 12.484  -38.507 12.886  1.00 22.68  ? 302 ASP C OD1   1 
ATOM   6973  O OD2   . ASP C  1 240 ? 11.126  -37.025 12.018  1.00 22.54  ? 302 ASP C OD2   1 
ATOM   6974  N N     . TYR C  1 241 ? 13.038  -40.964 12.117  1.00 26.89  ? 303 TYR C N     1 
ATOM   6975  C CA    . TYR C  1 241 ? 12.824  -42.283 12.705  1.00 27.81  ? 303 TYR C CA    1 
ATOM   6976  C C     . TYR C  1 241 ? 11.327  -42.509 13.021  1.00 26.60  ? 303 TYR C C     1 
ATOM   6977  O O     . TYR C  1 241 ? 10.613  -41.575 13.371  1.00 25.83  ? 303 TYR C O     1 
ATOM   6978  C CB    . TYR C  1 241 ? 13.657  -42.398 13.971  1.00 28.80  ? 303 TYR C CB    1 
ATOM   6979  C CG    . TYR C  1 241 ? 15.145  -42.286 13.763  1.00 30.14  ? 303 TYR C CG    1 
ATOM   6980  C CD1   . TYR C  1 241 ? 15.898  -43.413 13.426  1.00 31.53  ? 303 TYR C CD1   1 
ATOM   6981  C CD2   . TYR C  1 241 ? 15.812  -41.066 13.938  1.00 30.74  ? 303 TYR C CD2   1 
ATOM   6982  C CE1   . TYR C  1 241 ? 17.272  -43.327 13.254  1.00 33.32  ? 303 TYR C CE1   1 
ATOM   6983  C CE2   . TYR C  1 241 ? 17.185  -40.963 13.765  1.00 31.73  ? 303 TYR C CE2   1 
ATOM   6984  C CZ    . TYR C  1 241 ? 17.922  -42.087 13.427  1.00 33.35  ? 303 TYR C CZ    1 
ATOM   6985  O OH    . TYR C  1 241 ? 19.310  -41.977 13.269  1.00 34.65  ? 303 TYR C OH    1 
ATOM   6986  N N     . VAL C  1 242 ? 10.853  -43.745 12.910  1.00 25.44  ? 304 VAL C N     1 
ATOM   6987  C CA    . VAL C  1 242 ? 9.485   -44.037 13.291  1.00 25.36  ? 304 VAL C CA    1 
ATOM   6988  C C     . VAL C  1 242 ? 9.419   -45.041 14.430  1.00 25.65  ? 304 VAL C C     1 
ATOM   6989  O O     . VAL C  1 242 ? 9.882   -46.178 14.310  1.00 24.68  ? 304 VAL C O     1 
ATOM   6990  C CB    . VAL C  1 242 ? 8.694   -44.553 12.105  1.00 26.65  ? 304 VAL C CB    1 
ATOM   6991  C CG1   . VAL C  1 242 ? 7.416   -45.250 12.556  1.00 27.09  ? 304 VAL C CG1   1 
ATOM   6992  C CG2   . VAL C  1 242 ? 8.377   -43.398 11.167  1.00 27.15  ? 304 VAL C CG2   1 
ATOM   6993  N N     . HIS C  1 243 ? 8.817   -44.605 15.535  1.00 26.31  ? 305 HIS C N     1 
ATOM   6994  C CA    . HIS C  1 243 ? 8.753   -45.395 16.755  1.00 26.58  ? 305 HIS C CA    1 
ATOM   6995  C C     . HIS C  1 243 ? 7.383   -46.083 16.955  1.00 26.40  ? 305 HIS C C     1 
ATOM   6996  O O     . HIS C  1 243 ? 7.306   -47.138 17.606  1.00 25.32  ? 305 HIS C O     1 
ATOM   6997  C CB    . HIS C  1 243 ? 9.133   -44.492 17.936  1.00 26.95  ? 305 HIS C CB    1 
ATOM   6998  C CG    . HIS C  1 243 ? 10.594  -44.107 17.963  1.00 27.94  ? 305 HIS C CG    1 
ATOM   6999  N ND1   . HIS C  1 243 ? 11.102  -43.015 17.289  1.00 27.73  ? 305 HIS C ND1   1 
ATOM   7000  C CD2   . HIS C  1 243 ? 11.653  -44.671 18.598  1.00 28.23  ? 305 HIS C CD2   1 
ATOM   7001  C CE1   . HIS C  1 243 ? 12.406  -42.930 17.498  1.00 27.71  ? 305 HIS C CE1   1 
ATOM   7002  N NE2   . HIS C  1 243 ? 12.768  -43.929 18.282  1.00 27.96  ? 305 HIS C NE2   1 
ATOM   7003  N N     . ALA C  1 244 ? 6.327   -45.497 16.365  1.00 26.22  ? 306 ALA C N     1 
ATOM   7004  C CA    . ALA C  1 244 ? 4.922   -45.891 16.624  1.00 25.45  ? 306 ALA C CA    1 
ATOM   7005  C C     . ALA C  1 244 ? 3.945   -45.443 15.568  1.00 25.16  ? 306 ALA C C     1 
ATOM   7006  O O     . ALA C  1 244 ? 4.210   -44.519 14.791  1.00 25.64  ? 306 ALA C O     1 
ATOM   7007  C CB    . ALA C  1 244 ? 4.442   -45.313 17.939  1.00 25.52  ? 306 ALA C CB    1 
ATOM   7008  N N     . LEU C  1 245 ? 2.799   -46.109 15.574  1.00 24.76  ? 307 LEU C N     1 
ATOM   7009  C CA    . LEU C  1 245 ? 1.663   -45.703 14.788  1.00 25.40  ? 307 LEU C CA    1 
ATOM   7010  C C     . LEU C  1 245 ? 0.682   -45.010 15.715  1.00 25.72  ? 307 LEU C C     1 
ATOM   7011  O O     . LEU C  1 245 ? 0.608   -45.329 16.892  1.00 25.92  ? 307 LEU C O     1 
ATOM   7012  C CB    . LEU C  1 245 ? 0.999   -46.907 14.134  1.00 25.35  ? 307 LEU C CB    1 
ATOM   7013  C CG    . LEU C  1 245 ? 1.891   -47.787 13.265  1.00 25.39  ? 307 LEU C CG    1 
ATOM   7014  C CD1   . LEU C  1 245 ? 1.049   -48.882 12.631  1.00 25.22  ? 307 LEU C CD1   1 
ATOM   7015  C CD2   . LEU C  1 245 ? 2.600   -46.975 12.184  1.00 25.83  ? 307 LEU C CD2   1 
ATOM   7016  N N     . VAL C  1 246 ? -0.060  -44.056 15.167  1.00 26.14  ? 308 VAL C N     1 
ATOM   7017  C CA    . VAL C  1 246 ? -1.006  -43.259 15.920  1.00 26.36  ? 308 VAL C CA    1 
ATOM   7018  C C     . VAL C  1 246 ? -2.281  -43.209 15.135  1.00 26.54  ? 308 VAL C C     1 
ATOM   7019  O O     . VAL C  1 246 ? -2.232  -42.959 13.930  1.00 26.90  ? 308 VAL C O     1 
ATOM   7020  C CB    . VAL C  1 246 ? -0.509  -41.814 16.106  1.00 26.74  ? 308 VAL C CB    1 
ATOM   7021  C CG1   . VAL C  1 246 ? -1.575  -40.934 16.752  1.00 26.54  ? 308 VAL C CG1   1 
ATOM   7022  C CG2   . VAL C  1 246 ? 0.741   -41.823 16.960  1.00 26.95  ? 308 VAL C CG2   1 
ATOM   7023  N N     . THR C  1 247 ? -3.407  -43.429 15.824  1.00 26.78  ? 309 THR C N     1 
ATOM   7024  C CA    . THR C  1 247 ? -4.748  -43.328 15.225  1.00 27.60  ? 309 THR C CA    1 
ATOM   7025  C C     . THR C  1 247 ? -5.565  -42.148 15.789  1.00 28.35  ? 309 THR C C     1 
ATOM   7026  O O     . THR C  1 247 ? -5.617  -41.921 17.008  1.00 32.57  ? 309 THR C O     1 
ATOM   7027  C CB    . THR C  1 247 ? -5.590  -44.613 15.425  1.00 26.73  ? 309 THR C CB    1 
ATOM   7028  O OG1   . THR C  1 247 ? -5.882  -44.795 16.817  1.00 27.24  ? 309 THR C OG1   1 
ATOM   7029  C CG2   . THR C  1 247 ? -4.870  -45.823 14.909  1.00 26.40  ? 309 THR C CG2   1 
ATOM   7030  N N     . TYR C  1 248 ? -6.225  -41.428 14.898  1.00 26.51  ? 310 TYR C N     1 
ATOM   7031  C CA    . TYR C  1 248 ? -7.175  -40.433 15.302  1.00 26.63  ? 310 TYR C CA    1 
ATOM   7032  C C     . TYR C  1 248 ? -8.440  -40.682 14.508  1.00 26.24  ? 310 TYR C C     1 
ATOM   7033  O O     . TYR C  1 248 ? -8.446  -41.508 13.595  1.00 26.93  ? 310 TYR C O     1 
ATOM   7034  C CB    . TYR C  1 248 ? -6.617  -39.036 15.058  1.00 27.83  ? 310 TYR C CB    1 
ATOM   7035  C CG    . TYR C  1 248 ? -6.369  -38.688 13.604  1.00 29.33  ? 310 TYR C CG    1 
ATOM   7036  C CD1   . TYR C  1 248 ? -7.376  -38.119 12.824  1.00 29.23  ? 310 TYR C CD1   1 
ATOM   7037  C CD2   . TYR C  1 248 ? -5.129  -38.905 13.017  1.00 29.79  ? 310 TYR C CD2   1 
ATOM   7038  C CE1   . TYR C  1 248 ? -7.162  -37.793 11.501  1.00 29.77  ? 310 TYR C CE1   1 
ATOM   7039  C CE2   . TYR C  1 248 ? -4.908  -38.574 11.689  1.00 31.15  ? 310 TYR C CE2   1 
ATOM   7040  C CZ    . TYR C  1 248 ? -5.939  -38.018 10.940  1.00 30.66  ? 310 TYR C CZ    1 
ATOM   7041  O OH    . TYR C  1 248 ? -5.778  -37.698 9.617   1.00 30.66  ? 310 TYR C OH    1 
ATOM   7042  N N     . PHE C  1 249 ? -9.523  -39.997 14.857  1.00 25.41  ? 311 PHE C N     1 
ATOM   7043  C CA    . PHE C  1 249 ? -10.756 -40.126 14.082  1.00 24.64  ? 311 PHE C CA    1 
ATOM   7044  C C     . PHE C  1 249 ? -11.391 -38.765 13.868  1.00 24.76  ? 311 PHE C C     1 
ATOM   7045  O O     . PHE C  1 249 ? -11.131 -37.824 14.627  1.00 24.10  ? 311 PHE C O     1 
ATOM   7046  C CB    . PHE C  1 249 ? -11.746 -41.136 14.712  1.00 23.63  ? 311 PHE C CB    1 
ATOM   7047  C CG    . PHE C  1 249 ? -12.222 -40.774 16.099  1.00 22.98  ? 311 PHE C CG    1 
ATOM   7048  C CD1   . PHE C  1 249 ? -13.285 -39.900 16.268  1.00 22.97  ? 311 PHE C CD1   1 
ATOM   7049  C CD2   . PHE C  1 249 ? -11.639 -41.340 17.237  1.00 22.19  ? 311 PHE C CD2   1 
ATOM   7050  C CE1   . PHE C  1 249 ? -13.737 -39.562 17.541  1.00 22.79  ? 311 PHE C CE1   1 
ATOM   7051  C CE2   . PHE C  1 249 ? -12.093 -41.015 18.510  1.00 22.24  ? 311 PHE C CE2   1 
ATOM   7052  C CZ    . PHE C  1 249 ? -13.141 -40.123 18.664  1.00 22.42  ? 311 PHE C CZ    1 
ATOM   7053  N N     . ASN C  1 250 ? -12.176 -38.667 12.796  1.00 25.01  ? 312 ASN C N     1 
ATOM   7054  C CA    . ASN C  1 250 ? -13.018 -37.516 12.566  1.00 26.16  ? 312 ASN C CA    1 
ATOM   7055  C C     . ASN C  1 250 ? -14.466 -37.910 12.674  1.00 26.93  ? 312 ASN C C     1 
ATOM   7056  O O     . ASN C  1 250 ? -14.809 -39.073 12.459  1.00 28.05  ? 312 ASN C O     1 
ATOM   7057  C CB    . ASN C  1 250 ? -12.772 -36.936 11.191  1.00 26.44  ? 312 ASN C CB    1 
ATOM   7058  C CG    . ASN C  1 250 ? -11.315 -36.753 10.902  1.00 26.98  ? 312 ASN C CG    1 
ATOM   7059  O OD1   . ASN C  1 250 ? -10.874 -37.043 9.795   1.00 28.79  ? 312 ASN C OD1   1 
ATOM   7060  N ND2   . ASN C  1 250 ? -10.548 -36.271 11.886  1.00 26.66  ? 312 ASN C ND2   1 
ATOM   7061  N N     . ILE C  1 251 ? -15.305 -36.921 12.986  1.00 26.77  ? 313 ILE C N     1 
ATOM   7062  C CA    . ILE C  1 251 ? -16.756 -37.096 13.126  1.00 26.16  ? 313 ILE C CA    1 
ATOM   7063  C C     . ILE C  1 251 ? -17.472 -36.056 12.305  1.00 24.77  ? 313 ILE C C     1 
ATOM   7064  O O     . ILE C  1 251 ? -17.061 -34.898 12.299  1.00 24.09  ? 313 ILE C O     1 
ATOM   7065  C CB    . ILE C  1 251 ? -17.153 -36.915 14.602  1.00 26.68  ? 313 ILE C CB    1 
ATOM   7066  C CG1   . ILE C  1 251 ? -16.499 -38.022 15.451  1.00 26.39  ? 313 ILE C CG1   1 
ATOM   7067  C CG2   . ILE C  1 251 ? -18.670 -36.844 14.773  1.00 26.39  ? 313 ILE C CG2   1 
ATOM   7068  C CD1   . ILE C  1 251 ? -17.027 -39.423 15.186  1.00 25.77  ? 313 ILE C CD1   1 
ATOM   7069  N N     . GLU C  1 252 ? -18.542 -36.448 11.632  1.00 25.02  ? 314 GLU C N     1 
ATOM   7070  C CA    . GLU C  1 252 ? -19.298 -35.483 10.853  1.00 27.57  ? 314 GLU C CA    1 
ATOM   7071  C C     . GLU C  1 252 ? -20.804 -35.627 11.073  1.00 28.00  ? 314 GLU C C     1 
ATOM   7072  O O     . GLU C  1 252 ? -21.311 -36.739 11.254  1.00 25.88  ? 314 GLU C O     1 
ATOM   7073  C CB    . GLU C  1 252 ? -18.947 -35.600 9.373   1.00 29.92  ? 314 GLU C CB    1 
ATOM   7074  C CG    . GLU C  1 252 ? -19.488 -34.464 8.490   1.00 33.07  ? 314 GLU C CG    1 
ATOM   7075  C CD    . GLU C  1 252 ? -19.099 -34.600 7.017   1.00 35.25  ? 314 GLU C CD    1 
ATOM   7076  O OE1   . GLU C  1 252 ? -18.410 -35.594 6.658   1.00 36.79  ? 314 GLU C OE1   1 
ATOM   7077  O OE2   . GLU C  1 252 ? -19.472 -33.705 6.221   1.00 35.66  ? 314 GLU C OE2   1 
ATOM   7078  N N     . PHE C  1 253 ? -21.485 -34.475 11.081  1.00 29.86  ? 315 PHE C N     1 
ATOM   7079  C CA    . PHE C  1 253 ? -22.951 -34.362 11.150  1.00 31.59  ? 315 PHE C CA    1 
ATOM   7080  C C     . PHE C  1 253 ? -23.381 -33.877 9.783   1.00 31.56  ? 315 PHE C C     1 
ATOM   7081  O O     . PHE C  1 253 ? -23.449 -32.672 9.571   1.00 32.73  ? 315 PHE C O     1 
ATOM   7082  C CB    . PHE C  1 253 ? -23.383 -33.315 12.210  1.00 32.75  ? 315 PHE C CB    1 
ATOM   7083  C CG    . PHE C  1 253 ? -22.916 -33.620 13.632  1.00 34.48  ? 315 PHE C CG    1 
ATOM   7084  C CD1   . PHE C  1 253 ? -21.600 -33.360 14.034  1.00 35.35  ? 315 PHE C CD1   1 
ATOM   7085  C CD2   . PHE C  1 253 ? -23.791 -34.152 14.575  1.00 35.13  ? 315 PHE C CD2   1 
ATOM   7086  C CE1   . PHE C  1 253 ? -21.168 -33.642 15.330  1.00 34.44  ? 315 PHE C CE1   1 
ATOM   7087  C CE2   . PHE C  1 253 ? -23.358 -34.438 15.875  1.00 35.80  ? 315 PHE C CE2   1 
ATOM   7088  C CZ    . PHE C  1 253 ? -22.045 -34.181 16.254  1.00 34.64  ? 315 PHE C CZ    1 
ATOM   7089  N N     . THR C  1 254 ? -23.635 -34.800 8.854   1.00 31.42  ? 316 THR C N     1 
ATOM   7090  C CA    . THR C  1 254 ? -23.795 -34.471 7.424   1.00 30.62  ? 316 THR C CA    1 
ATOM   7091  C C     . THR C  1 254 ? -25.060 -33.697 7.125   1.00 30.89  ? 316 THR C C     1 
ATOM   7092  O O     . THR C  1 254 ? -25.109 -32.904 6.216   1.00 32.47  ? 316 THR C O     1 
ATOM   7093  C CB    . THR C  1 254 ? -23.842 -35.729 6.543   1.00 29.40  ? 316 THR C CB    1 
ATOM   7094  O OG1   . THR C  1 254 ? -24.932 -36.557 6.963   1.00 29.81  ? 316 THR C OG1   1 
ATOM   7095  C CG2   . THR C  1 254 ? -22.538 -36.489 6.617   1.00 28.14  ? 316 THR C CG2   1 
ATOM   7096  N N     . LYS C  1 255 ? -26.087 -33.916 7.905   1.00 33.66  ? 317 LYS C N     1 
ATOM   7097  C CA    . LYS C  1 255 ? -27.371 -33.275 7.651   1.00 36.34  ? 317 LYS C CA    1 
ATOM   7098  C C     . LYS C  1 255 ? -27.432 -31.801 8.057   1.00 33.54  ? 317 LYS C C     1 
ATOM   7099  O O     . LYS C  1 255 ? -28.411 -31.131 7.774   1.00 35.34  ? 317 LYS C O     1 
ATOM   7100  C CB    . LYS C  1 255 ? -28.468 -34.051 8.388   1.00 40.87  ? 317 LYS C CB    1 
ATOM   7101  C CG    . LYS C  1 255 ? -28.603 -35.504 7.938   1.00 44.66  ? 317 LYS C CG    1 
ATOM   7102  C CD    . LYS C  1 255 ? -28.976 -35.650 6.455   1.00 44.82  ? 317 LYS C CD    1 
ATOM   7103  C CE    . LYS C  1 255 ? -29.069 -37.121 6.066   1.00 45.12  ? 317 LYS C CE    1 
ATOM   7104  N NZ    . LYS C  1 255 ? -29.025 -37.297 4.594   1.00 45.69  ? 317 LYS C NZ    1 
ATOM   7105  N N     . CYS C  1 256 ? -26.413 -31.290 8.731   1.00 31.31  ? 318 CYS C N     1 
ATOM   7106  C CA    . CYS C  1 256 ? -26.388 -29.866 9.090   1.00 30.45  ? 318 CYS C CA    1 
ATOM   7107  C C     . CYS C  1 256 ? -26.215 -28.985 7.878   1.00 29.04  ? 318 CYS C C     1 
ATOM   7108  O O     . CYS C  1 256 ? -25.610 -29.391 6.891   1.00 29.84  ? 318 CYS C O     1 
ATOM   7109  C CB    . CYS C  1 256 ? -25.262 -29.576 10.072  1.00 29.90  ? 318 CYS C CB    1 
ATOM   7110  S SG    . CYS C  1 256 ? -25.431 -30.543 11.584  1.00 30.92  ? 318 CYS C SG    1 
ATOM   7111  N N     . HIS C  1 257 ? -26.735 -27.769 7.972   1.00 27.66  ? 319 HIS C N     1 
ATOM   7112  C CA    . HIS C  1 257 ? -26.795 -26.860 6.824   1.00 26.75  ? 319 HIS C CA    1 
ATOM   7113  C C     . HIS C  1 257 ? -25.453 -26.326 6.411   1.00 25.14  ? 319 HIS C C     1 
ATOM   7114  O O     . HIS C  1 257 ? -25.305 -25.867 5.290   1.00 23.74  ? 319 HIS C O     1 
ATOM   7115  C CB    . HIS C  1 257 ? -27.705 -25.680 7.119   1.00 27.25  ? 319 HIS C CB    1 
ATOM   7116  C CG    . HIS C  1 257 ? -27.997 -24.840 5.920   1.00 27.57  ? 319 HIS C CG    1 
ATOM   7117  N ND1   . HIS C  1 257 ? -27.800 -23.474 5.898   1.00 27.73  ? 319 HIS C ND1   1 
ATOM   7118  C CD2   . HIS C  1 257 ? -28.466 -25.176 4.700   1.00 27.86  ? 319 HIS C CD2   1 
ATOM   7119  C CE1   . HIS C  1 257 ? -28.154 -23.002 4.719   1.00 27.65  ? 319 HIS C CE1   1 
ATOM   7120  N NE2   . HIS C  1 257 ? -28.553 -24.015 3.972   1.00 28.74  ? 319 HIS C NE2   1 
ATOM   7121  N N     . LYS C  1 258 ? -24.517 -26.314 7.353   1.00 25.27  ? 320 LYS C N     1 
ATOM   7122  C CA    . LYS C  1 258 ? -23.122 -26.068 7.072   1.00 25.45  ? 320 LYS C CA    1 
ATOM   7123  C C     . LYS C  1 258 ? -22.310 -27.181 7.654   1.00 25.56  ? 320 LYS C C     1 
ATOM   7124  O O     . LYS C  1 258 ? -22.778 -27.923 8.498   1.00 24.94  ? 320 LYS C O     1 
ATOM   7125  C CB    . LYS C  1 258 ? -22.682 -24.764 7.686   1.00 26.71  ? 320 LYS C CB    1 
ATOM   7126  C CG    . LYS C  1 258 ? -23.318 -23.570 7.024   1.00 28.54  ? 320 LYS C CG    1 
ATOM   7127  C CD    . LYS C  1 258 ? -22.512 -22.315 7.301   1.00 30.47  ? 320 LYS C CD    1 
ATOM   7128  C CE    . LYS C  1 258 ? -22.849 -21.229 6.297   1.00 31.44  ? 320 LYS C CE    1 
ATOM   7129  N NZ    . LYS C  1 258 ? -22.345 -19.918 6.794   1.00 32.13  ? 320 LYS C NZ    1 
ATOM   7130  N N     . LYS C  1 259 ? -21.081 -27.280 7.190   1.00 27.24  ? 321 LYS C N     1 
ATOM   7131  C CA    . LYS C  1 259 ? -20.171 -28.335 7.589   1.00 29.41  ? 321 LYS C CA    1 
ATOM   7132  C C     . LYS C  1 259 ? -20.032 -28.326 9.119   1.00 27.06  ? 321 LYS C C     1 
ATOM   7133  O O     . LYS C  1 259 ? -19.699 -27.319 9.691   1.00 25.23  ? 321 LYS C O     1 
ATOM   7134  C CB    . LYS C  1 259 ? -18.853 -28.147 6.811   1.00 33.34  ? 321 LYS C CB    1 
ATOM   7135  C CG    . LYS C  1 259 ? -17.561 -28.641 7.439   1.00 39.61  ? 321 LYS C CG    1 
ATOM   7136  C CD    . LYS C  1 259 ? -17.226 -30.119 7.171   1.00 43.19  ? 321 LYS C CD    1 
ATOM   7137  C CE    . LYS C  1 259 ? -16.202 -30.620 8.207   1.00 46.90  ? 321 LYS C CE    1 
ATOM   7138  N NZ    . LYS C  1 259 ? -16.307 -32.076 8.502   1.00 46.64  ? 321 LYS C NZ    1 
ATOM   7139  N N     . MET C  1 260 ? -20.402 -29.440 9.756   1.00 27.23  ? 322 MET C N     1 
ATOM   7140  C CA    . MET C  1 260 ? -20.318 -29.654 11.211  1.00 27.32  ? 322 MET C CA    1 
ATOM   7141  C C     . MET C  1 260 ? -19.559 -30.927 11.490  1.00 26.88  ? 322 MET C C     1 
ATOM   7142  O O     . MET C  1 260 ? -19.910 -31.987 10.980  1.00 27.87  ? 322 MET C O     1 
ATOM   7143  C CB    . MET C  1 260 ? -21.690 -29.883 11.834  1.00 28.09  ? 322 MET C CB    1 
ATOM   7144  C CG    . MET C  1 260 ? -22.423 -28.629 12.212  1.00 29.67  ? 322 MET C CG    1 
ATOM   7145  S SD    . MET C  1 260 ? -21.995 -28.076 13.851  1.00 31.26  ? 322 MET C SD    1 
ATOM   7146  C CE    . MET C  1 260 ? -20.921 -26.672 13.496  1.00 31.62  ? 322 MET C CE    1 
ATOM   7147  N N     . GLY C  1 261 ? -18.553 -30.836 12.341  1.00 25.89  ? 323 GLY C N     1 
ATOM   7148  C CA    . GLY C  1 261 ? -17.763 -31.988 12.691  1.00 24.34  ? 323 GLY C CA    1 
ATOM   7149  C C     . GLY C  1 261 ? -16.542 -31.560 13.457  1.00 23.85  ? 323 GLY C C     1 
ATOM   7150  O O     . GLY C  1 261 ? -16.305 -30.355 13.676  1.00 25.04  ? 323 GLY C O     1 
ATOM   7151  N N     . PHE C  1 262 ? -15.765 -32.544 13.870  1.00 22.35  ? 324 PHE C N     1 
ATOM   7152  C CA    . PHE C  1 262 ? -14.489 -32.265 14.487  1.00 22.19  ? 324 PHE C CA    1 
ATOM   7153  C C     . PHE C  1 262 ? -13.521 -33.406 14.252  1.00 22.63  ? 324 PHE C C     1 
ATOM   7154  O O     . PHE C  1 262 ? -13.894 -34.503 13.847  1.00 22.05  ? 324 PHE C O     1 
ATOM   7155  C CB    . PHE C  1 262 ? -14.648 -32.011 15.978  1.00 22.19  ? 324 PHE C CB    1 
ATOM   7156  C CG    . PHE C  1 262 ? -15.277 -33.157 16.732  1.00 22.26  ? 324 PHE C CG    1 
ATOM   7157  C CD1   . PHE C  1 262 ? -14.504 -34.179 17.254  1.00 22.35  ? 324 PHE C CD1   1 
ATOM   7158  C CD2   . PHE C  1 262 ? -16.645 -33.198 16.935  1.00 22.53  ? 324 PHE C CD2   1 
ATOM   7159  C CE1   . PHE C  1 262 ? -15.079 -35.225 17.945  1.00 22.40  ? 324 PHE C CE1   1 
ATOM   7160  C CE2   . PHE C  1 262 ? -17.232 -34.236 17.630  1.00 22.71  ? 324 PHE C CE2   1 
ATOM   7161  C CZ    . PHE C  1 262 ? -16.447 -35.252 18.135  1.00 23.04  ? 324 PHE C CZ    1 
ATOM   7162  N N     . SER C  1 263 ? -12.261 -33.118 14.503  1.00 23.76  ? 325 SER C N     1 
ATOM   7163  C CA    . SER C  1 263 ? -11.212 -34.088 14.336  1.00 24.66  ? 325 SER C CA    1 
ATOM   7164  C C     . SER C  1 263 ? -10.476 -34.266 15.655  1.00 24.65  ? 325 SER C C     1 
ATOM   7165  O O     . SER C  1 263 ? -10.320 -33.316 16.455  1.00 25.68  ? 325 SER C O     1 
ATOM   7166  C CB    . SER C  1 263 ? -10.247 -33.605 13.245  1.00 25.78  ? 325 SER C CB    1 
ATOM   7167  O OG    . SER C  1 263 ? -9.105  -34.446 13.162  1.00 26.37  ? 325 SER C OG    1 
ATOM   7168  N N     . THR C  1 264 ? -10.003 -35.478 15.876  1.00 24.15  ? 326 THR C N     1 
ATOM   7169  C CA    . THR C  1 264 ? -9.219  -35.750 17.050  1.00 24.74  ? 326 THR C CA    1 
ATOM   7170  C C     . THR C  1 264 ? -7.753  -35.876 16.669  1.00 24.33  ? 326 THR C C     1 
ATOM   7171  O O     . THR C  1 264 ? -6.949  -36.387 17.438  1.00 22.92  ? 326 THR C O     1 
ATOM   7172  C CB    . THR C  1 264 ? -9.727  -37.017 17.751  1.00 25.76  ? 326 THR C CB    1 
ATOM   7173  O OG1   . THR C  1 264 ? -9.461  -38.178 16.947  1.00 27.08  ? 326 THR C OG1   1 
ATOM   7174  C CG2   . THR C  1 264 ? -11.213 -36.913 17.984  1.00 25.66  ? 326 THR C CG2   1 
ATOM   7175  N N     . ALA C  1 265 ? -7.410  -35.376 15.482  1.00 25.19  ? 327 ALA C N     1 
ATOM   7176  C CA    . ALA C  1 265 ? -6.048  -35.472 14.964  1.00 25.43  ? 327 ALA C CA    1 
ATOM   7177  C C     . ALA C  1 265 ? -5.090  -34.642 15.799  1.00 25.70  ? 327 ALA C C     1 
ATOM   7178  O O     . ALA C  1 265 ? -5.509  -33.723 16.541  1.00 26.10  ? 327 ALA C O     1 
ATOM   7179  C CB    . ALA C  1 265 ? -5.978  -35.034 13.508  1.00 25.30  ? 327 ALA C CB    1 
ATOM   7180  N N     . PRO C  1 266 ? -3.799  -34.978 15.696  1.00 25.62  ? 328 PRO C N     1 
ATOM   7181  C CA    . PRO C  1 266 ? -2.757  -34.227 16.357  1.00 25.62  ? 328 PRO C CA    1 
ATOM   7182  C C     . PRO C  1 266 ? -2.761  -32.788 15.923  1.00 26.26  ? 328 PRO C C     1 
ATOM   7183  O O     . PRO C  1 266 ? -2.540  -31.942 16.754  1.00 27.19  ? 328 PRO C O     1 
ATOM   7184  C CB    . PRO C  1 266 ? -1.488  -34.919 15.903  1.00 25.95  ? 328 PRO C CB    1 
ATOM   7185  C CG    . PRO C  1 266 ? -1.914  -36.317 15.642  1.00 25.87  ? 328 PRO C CG    1 
ATOM   7186  C CD    . PRO C  1 266 ? -3.279  -36.201 15.063  1.00 25.25  ? 328 PRO C CD    1 
ATOM   7187  N N     . ASP C  1 267 ? -3.018  -32.506 14.643  1.00 28.48  ? 329 ASP C N     1 
ATOM   7188  C CA    . ASP C  1 267 ? -3.039  -31.102 14.138  1.00 29.87  ? 329 ASP C CA    1 
ATOM   7189  C C     . ASP C  1 267 ? -4.354  -30.405 14.414  1.00 29.05  ? 329 ASP C C     1 
ATOM   7190  O O     . ASP C  1 267 ? -4.520  -29.236 14.056  1.00 27.83  ? 329 ASP C O     1 
ATOM   7191  C CB    . ASP C  1 267 ? -2.730  -31.013 12.638  1.00 31.30  ? 329 ASP C CB    1 
ATOM   7192  C CG    . ASP C  1 267 ? -3.546  -31.977 11.834  1.00 33.34  ? 329 ASP C CG    1 
ATOM   7193  O OD1   . ASP C  1 267 ? -3.239  -33.186 11.890  1.00 37.04  ? 329 ASP C OD1   1 
ATOM   7194  O OD2   . ASP C  1 267 ? -4.503  -31.552 11.174  1.00 35.85  ? 329 ASP C OD2   1 
ATOM   7195  N N     . ALA C  1 268 ? -5.273  -31.115 15.064  1.00 29.18  ? 330 ALA C N     1 
ATOM   7196  C CA    . ALA C  1 268 ? -6.533  -30.536 15.499  1.00 28.89  ? 330 ALA C CA    1 
ATOM   7197  C C     . ALA C  1 268 ? -6.467  -30.181 16.974  1.00 28.43  ? 330 ALA C C     1 
ATOM   7198  O O     . ALA C  1 268 ? -5.725  -30.835 17.730  1.00 26.16  ? 330 ALA C O     1 
ATOM   7199  C CB    . ALA C  1 268 ? -7.674  -31.507 15.274  1.00 28.80  ? 330 ALA C CB    1 
ATOM   7200  N N     . PRO C  1 269 ? -7.267  -29.157 17.388  1.00 27.53  ? 331 PRO C N     1 
ATOM   7201  C CA    . PRO C  1 269 ? -7.303  -28.760 18.784  1.00 26.70  ? 331 PRO C CA    1 
ATOM   7202  C C     . PRO C  1 269 ? -7.713  -29.892 19.684  1.00 27.69  ? 331 PRO C C     1 
ATOM   7203  O O     . PRO C  1 269 ? -8.312  -30.874 19.231  1.00 28.49  ? 331 PRO C O     1 
ATOM   7204  C CB    . PRO C  1 269 ? -8.349  -27.652 18.837  1.00 26.34  ? 331 PRO C CB    1 
ATOM   7205  C CG    . PRO C  1 269 ? -9.027  -27.655 17.533  1.00 26.35  ? 331 PRO C CG    1 
ATOM   7206  C CD    . PRO C  1 269 ? -8.091  -28.264 16.550  1.00 26.48  ? 331 PRO C CD    1 
ATOM   7207  N N     . TYR C  1 270 ? -7.372  -29.724 20.956  1.00 28.79  ? 332 TYR C N     1 
ATOM   7208  C CA    . TYR C  1 270 ? -7.447  -30.774 21.946  1.00 29.04  ? 332 TYR C CA    1 
ATOM   7209  C C     . TYR C  1 270 ? -8.873  -31.259 22.116  1.00 28.28  ? 332 TYR C C     1 
ATOM   7210  O O     . TYR C  1 270 ? -9.824  -30.459 22.054  1.00 28.35  ? 332 TYR C O     1 
ATOM   7211  C CB    . TYR C  1 270 ? -6.847  -30.288 23.276  1.00 31.05  ? 332 TYR C CB    1 
ATOM   7212  C CG    . TYR C  1 270 ? -7.149  -31.175 24.459  1.00 34.45  ? 332 TYR C CG    1 
ATOM   7213  C CD1   . TYR C  1 270 ? -8.377  -31.075 25.134  1.00 36.35  ? 332 TYR C CD1   1 
ATOM   7214  C CD2   . TYR C  1 270 ? -6.222  -32.118 24.919  1.00 36.27  ? 332 TYR C CD2   1 
ATOM   7215  C CE1   . TYR C  1 270 ? -8.677  -31.892 26.219  1.00 37.34  ? 332 TYR C CE1   1 
ATOM   7216  C CE2   . TYR C  1 270 ? -6.516  -32.936 26.019  1.00 37.48  ? 332 TYR C CE2   1 
ATOM   7217  C CZ    . TYR C  1 270 ? -7.741  -32.818 26.658  1.00 37.57  ? 332 TYR C CZ    1 
ATOM   7218  O OH    . TYR C  1 270 ? -8.033  -33.617 27.729  1.00 37.00  ? 332 TYR C OH    1 
ATOM   7219  N N     . THR C  1 271 ? -8.996  -32.583 22.279  1.00 27.27  ? 333 THR C N     1 
ATOM   7220  C CA    . THR C  1 271 ? -10.237 -33.264 22.682  1.00 25.86  ? 333 THR C CA    1 
ATOM   7221  C C     . THR C  1 271 ? -9.878  -34.315 23.721  1.00 24.98  ? 333 THR C C     1 
ATOM   7222  O O     . THR C  1 271 ? -8.758  -34.811 23.747  1.00 22.95  ? 333 THR C O     1 
ATOM   7223  C CB    . THR C  1 271 ? -10.882 -34.020 21.515  1.00 25.14  ? 333 THR C CB    1 
ATOM   7224  O OG1   . THR C  1 271 ? -10.055 -35.145 21.196  1.00 25.74  ? 333 THR C OG1   1 
ATOM   7225  C CG2   . THR C  1 271 ? -11.030 -33.130 20.279  1.00 25.03  ? 333 THR C CG2   1 
ATOM   7226  N N     . HIS C  1 272 ? -10.850 -34.699 24.535  1.00 25.35  ? 334 HIS C N     1 
ATOM   7227  C CA    . HIS C  1 272 ? -10.622 -35.701 25.580  1.00 25.47  ? 334 HIS C CA    1 
ATOM   7228  C C     . HIS C  1 272 ? -10.226 -37.096 25.056  1.00 26.07  ? 334 HIS C C     1 
ATOM   7229  O O     . HIS C  1 272 ? -9.767  -37.940 25.840  1.00 28.12  ? 334 HIS C O     1 
ATOM   7230  C CB    . HIS C  1 272 ? -11.836 -35.822 26.516  1.00 24.60  ? 334 HIS C CB    1 
ATOM   7231  C CG    . HIS C  1 272 ? -12.927 -36.720 26.010  1.00 24.73  ? 334 HIS C CG    1 
ATOM   7232  N ND1   . HIS C  1 272 ? -13.890 -36.289 25.124  1.00 25.79  ? 334 HIS C ND1   1 
ATOM   7233  C CD2   . HIS C  1 272 ? -13.230 -38.015 26.288  1.00 24.99  ? 334 HIS C CD2   1 
ATOM   7234  C CE1   . HIS C  1 272 ? -14.728 -37.283 24.865  1.00 25.71  ? 334 HIS C CE1   1 
ATOM   7235  N NE2   . HIS C  1 272 ? -14.353 -38.344 25.561  1.00 24.66  ? 334 HIS C NE2   1 
ATOM   7236  N N     . TRP C  1 273 ? -10.423 -37.350 23.764  1.00 25.37  ? 335 TRP C N     1 
ATOM   7237  C CA    . TRP C  1 273 ? -10.032 -38.635 23.162  1.00 25.40  ? 335 TRP C CA    1 
ATOM   7238  C C     . TRP C  1 273 ? -8.550  -38.690 22.850  1.00 25.97  ? 335 TRP C C     1 
ATOM   7239  O O     . TRP C  1 273 ? -7.977  -39.783 22.650  1.00 23.86  ? 335 TRP C O     1 
ATOM   7240  C CB    . TRP C  1 273 ? -10.763 -38.847 21.842  1.00 25.36  ? 335 TRP C CB    1 
ATOM   7241  C CG    . TRP C  1 273 ? -12.171 -39.214 21.978  1.00 24.70  ? 335 TRP C CG    1 
ATOM   7242  C CD1   . TRP C  1 273 ? -12.675 -40.434 22.292  1.00 24.64  ? 335 TRP C CD1   1 
ATOM   7243  C CD2   . TRP C  1 273 ? -13.275 -38.361 21.786  1.00 23.89  ? 335 TRP C CD2   1 
ATOM   7244  N NE1   . TRP C  1 273 ? -14.034 -40.392 22.319  1.00 23.99  ? 335 TRP C NE1   1 
ATOM   7245  C CE2   . TRP C  1 273 ? -14.428 -39.122 22.015  1.00 23.89  ? 335 TRP C CE2   1 
ATOM   7246  C CE3   . TRP C  1 273 ? -13.406 -37.019 21.453  1.00 23.40  ? 335 TRP C CE3   1 
ATOM   7247  C CZ2   . TRP C  1 273 ? -15.684 -38.595 21.913  1.00 23.87  ? 335 TRP C CZ2   1 
ATOM   7248  C CZ3   . TRP C  1 273 ? -14.657 -36.500 21.352  1.00 23.84  ? 335 TRP C CZ3   1 
ATOM   7249  C CH2   . TRP C  1 273 ? -15.784 -37.282 21.585  1.00 23.81  ? 335 TRP C CH2   1 
ATOM   7250  N N     . LYS C  1 274 ? -7.985  -37.488 22.690  1.00 27.20  ? 336 LYS C N     1 
ATOM   7251  C CA    . LYS C  1 274 ? -6.597  -37.314 22.369  1.00 27.67  ? 336 LYS C CA    1 
ATOM   7252  C C     . LYS C  1 274 ? -6.296  -38.116 21.125  1.00 27.49  ? 336 LYS C C     1 
ATOM   7253  O O     . LYS C  1 274 ? -7.073  -38.076 20.148  1.00 28.08  ? 336 LYS C O     1 
ATOM   7254  C CB    . LYS C  1 274 ? -5.750  -37.735 23.575  1.00 28.88  ? 336 LYS C CB    1 
ATOM   7255  C CG    . LYS C  1 274 ? -6.240  -37.109 24.881  1.00 29.56  ? 336 LYS C CG    1 
ATOM   7256  C CD    . LYS C  1 274 ? -5.423  -37.539 26.097  1.00 30.22  ? 336 LYS C CD    1 
ATOM   7257  C CE    . LYS C  1 274 ? -5.786  -36.702 27.326  1.00 31.07  ? 336 LYS C CE    1 
ATOM   7258  N NZ    . LYS C  1 274 ? -5.106  -37.133 28.576  1.00 30.59  ? 336 LYS C NZ    1 
ATOM   7259  N N     . GLN C  1 275 ? -5.167  -38.821 21.148  1.00 26.29  ? 337 GLN C N     1 
ATOM   7260  C CA    . GLN C  1 275 ? -4.815  -39.767 20.103  1.00 25.23  ? 337 GLN C CA    1 
ATOM   7261  C C     . GLN C  1 275 ? -4.463  -41.064 20.771  1.00 25.40  ? 337 GLN C C     1 
ATOM   7262  O O     . GLN C  1 275 ? -4.343  -41.122 22.000  1.00 25.63  ? 337 GLN C O     1 
ATOM   7263  C CB    . GLN C  1 275 ? -3.610  -39.275 19.305  1.00 24.57  ? 337 GLN C CB    1 
ATOM   7264  C CG    . GLN C  1 275 ? -3.882  -38.079 18.416  1.00 23.73  ? 337 GLN C CG    1 
ATOM   7265  C CD    . GLN C  1 275 ? -3.956  -36.783 19.178  1.00 22.40  ? 337 GLN C CD    1 
ATOM   7266  O OE1   . GLN C  1 275 ? -3.164  -36.532 20.062  1.00 20.94  ? 337 GLN C OE1   1 
ATOM   7267  N NE2   . GLN C  1 275 ? -4.917  -35.952 18.829  1.00 23.11  ? 337 GLN C NE2   1 
ATOM   7268  N N     . THR C  1 276 ? -4.263  -42.088 19.953  1.00 25.21  ? 338 THR C N     1 
ATOM   7269  C CA    . THR C  1 276 ? -4.034  -43.436 20.435  1.00 25.54  ? 338 THR C CA    1 
ATOM   7270  C C     . THR C  1 276 ? -2.746  -43.936 19.788  1.00 24.96  ? 338 THR C C     1 
ATOM   7271  O O     . THR C  1 276 ? -2.637  -43.985 18.568  1.00 24.69  ? 338 THR C O     1 
ATOM   7272  C CB    . THR C  1 276 ? -5.231  -44.349 20.060  1.00 26.38  ? 338 THR C CB    1 
ATOM   7273  O OG1   . THR C  1 276 ? -6.490  -43.638 20.231  1.00 27.09  ? 338 THR C OG1   1 
ATOM   7274  C CG2   . THR C  1 276 ? -5.176  -45.670 20.864  1.00 25.28  ? 338 THR C CG2   1 
ATOM   7275  N N     . VAL C  1 277 ? -1.769  -44.306 20.606  1.00 25.17  ? 339 VAL C N     1 
ATOM   7276  C CA    . VAL C  1 277 ? -0.401  -44.599 20.131  1.00 24.54  ? 339 VAL C CA    1 
ATOM   7277  C C     . VAL C  1 277 ? -0.073  -46.069 20.287  1.00 23.68  ? 339 VAL C C     1 
ATOM   7278  O O     . VAL C  1 277 ? -0.229  -46.619 21.358  1.00 21.80  ? 339 VAL C O     1 
ATOM   7279  C CB    . VAL C  1 277 ? 0.647   -43.811 20.944  1.00 24.50  ? 339 VAL C CB    1 
ATOM   7280  C CG1   . VAL C  1 277 ? 2.060   -44.094 20.457  1.00 24.40  ? 339 VAL C CG1   1 
ATOM   7281  C CG2   . VAL C  1 277 ? 0.348   -42.317 20.903  1.00 24.51  ? 339 VAL C CG2   1 
ATOM   7282  N N     . PHE C  1 278 ? 0.417   -46.678 19.215  1.00 25.16  ? 340 PHE C N     1 
ATOM   7283  C CA    . PHE C  1 278 ? 0.778   -48.095 19.198  1.00 26.73  ? 340 PHE C CA    1 
ATOM   7284  C C     . PHE C  1 278 ? 2.286   -48.221 19.020  1.00 27.13  ? 340 PHE C C     1 
ATOM   7285  O O     . PHE C  1 278 ? 2.788   -47.937 17.942  1.00 27.57  ? 340 PHE C O     1 
ATOM   7286  C CB    . PHE C  1 278 ? 0.070   -48.789 18.031  1.00 27.91  ? 340 PHE C CB    1 
ATOM   7287  C CG    . PHE C  1 278 ? -1.427  -48.783 18.136  1.00 28.34  ? 340 PHE C CG    1 
ATOM   7288  C CD1   . PHE C  1 278 ? -2.153  -47.630 17.861  1.00 28.91  ? 340 PHE C CD1   1 
ATOM   7289  C CD2   . PHE C  1 278 ? -2.102  -49.916 18.506  1.00 28.26  ? 340 PHE C CD2   1 
ATOM   7290  C CE1   . PHE C  1 278 ? -3.526  -47.607 17.962  1.00 28.88  ? 340 PHE C CE1   1 
ATOM   7291  C CE2   . PHE C  1 278 ? -3.475  -49.905 18.600  1.00 29.61  ? 340 PHE C CE2   1 
ATOM   7292  C CZ    . PHE C  1 278 ? -4.191  -48.751 18.325  1.00 29.73  ? 340 PHE C CZ    1 
ATOM   7293  N N     . TYR C  1 279 ? 3.012   -48.626 20.062  1.00 27.97  ? 341 TYR C N     1 
ATOM   7294  C CA    . TYR C  1 279 ? 4.477   -48.658 19.984  1.00 28.07  ? 341 TYR C CA    1 
ATOM   7295  C C     . TYR C  1 279 ? 4.954   -49.818 19.139  1.00 29.27  ? 341 TYR C C     1 
ATOM   7296  O O     . TYR C  1 279 ? 4.276   -50.829 19.049  1.00 28.64  ? 341 TYR C O     1 
ATOM   7297  C CB    . TYR C  1 279 ? 5.110   -48.671 21.375  1.00 27.79  ? 341 TYR C CB    1 
ATOM   7298  C CG    . TYR C  1 279 ? 5.198   -47.274 21.951  1.00 28.62  ? 341 TYR C CG    1 
ATOM   7299  C CD1   . TYR C  1 279 ? 5.954   -46.295 21.328  1.00 29.11  ? 341 TYR C CD1   1 
ATOM   7300  C CD2   . TYR C  1 279 ? 4.499   -46.913 23.093  1.00 29.28  ? 341 TYR C CD2   1 
ATOM   7301  C CE1   . TYR C  1 279 ? 6.012   -45.005 21.828  1.00 29.12  ? 341 TYR C CE1   1 
ATOM   7302  C CE2   . TYR C  1 279 ? 4.562   -45.625 23.595  1.00 29.03  ? 341 TYR C CE2   1 
ATOM   7303  C CZ    . TYR C  1 279 ? 5.323   -44.685 22.952  1.00 28.79  ? 341 TYR C CZ    1 
ATOM   7304  O OH    . TYR C  1 279 ? 5.399   -43.410 23.422  1.00 30.30  ? 341 TYR C OH    1 
ATOM   7305  N N     . LEU C  1 280 ? 6.084   -49.633 18.460  1.00 32.10  ? 342 LEU C N     1 
ATOM   7306  C CA    . LEU C  1 280 ? 6.737   -50.716 17.718  1.00 34.40  ? 342 LEU C CA    1 
ATOM   7307  C C     . LEU C  1 280 ? 7.891   -51.191 18.557  1.00 37.26  ? 342 LEU C C     1 
ATOM   7308  O O     . LEU C  1 280 ? 8.378   -50.426 19.379  1.00 38.05  ? 342 LEU C O     1 
ATOM   7309  C CB    . LEU C  1 280 ? 7.274   -50.225 16.384  1.00 33.29  ? 342 LEU C CB    1 
ATOM   7310  C CG    . LEU C  1 280 ? 6.264   -49.619 15.430  1.00 32.91  ? 342 LEU C CG    1 
ATOM   7311  C CD1   . LEU C  1 280 ? 6.986   -49.086 14.210  1.00 33.08  ? 342 LEU C CD1   1 
ATOM   7312  C CD2   . LEU C  1 280 ? 5.226   -50.654 15.041  1.00 31.70  ? 342 LEU C CD2   1 
ATOM   7313  N N     . GLU C  1 281 ? 8.345   -52.427 18.341  1.00 41.84  ? 343 GLU C N     1 
ATOM   7314  C CA    . GLU C  1 281 ? 9.429   -52.996 19.160  1.00 46.37  ? 343 GLU C CA    1 
ATOM   7315  C C     . GLU C  1 281 ? 10.752  -52.283 18.908  1.00 47.07  ? 343 GLU C C     1 
ATOM   7316  O O     . GLU C  1 281 ? 11.428  -51.840 19.857  1.00 46.56  ? 343 GLU C O     1 
ATOM   7317  C CB    . GLU C  1 281 ? 9.583   -54.495 18.915  1.00 49.57  ? 343 GLU C CB    1 
ATOM   7318  C CG    . GLU C  1 281 ? 8.383   -55.279 19.402  1.00 55.99  ? 343 GLU C CG    1 
ATOM   7319  C CD    . GLU C  1 281 ? 8.507   -56.767 19.172  1.00 59.69  ? 343 GLU C CD    1 
ATOM   7320  O OE1   . GLU C  1 281 ? 8.080   -57.247 18.083  1.00 61.64  ? 343 GLU C OE1   1 
ATOM   7321  O OE2   . GLU C  1 281 ? 9.032   -57.437 20.084  1.00 58.69  ? 343 GLU C OE2   1 
ATOM   7322  N N     . ASP C  1 282 ? 11.104  -52.197 17.625  1.00 46.88  ? 344 ASP C N     1 
ATOM   7323  C CA    . ASP C  1 282 ? 12.254  -51.423 17.159  1.00 45.90  ? 344 ASP C CA    1 
ATOM   7324  C C     . ASP C  1 282 ? 11.755  -50.283 16.322  1.00 42.53  ? 344 ASP C C     1 
ATOM   7325  O O     . ASP C  1 282 ? 10.698  -50.381 15.697  1.00 41.34  ? 344 ASP C O     1 
ATOM   7326  C CB    . ASP C  1 282 ? 13.190  -52.280 16.300  1.00 45.78  ? 344 ASP C CB    1 
ATOM   7327  C CG    . ASP C  1 282 ? 13.591  -53.539 16.991  1.00 45.57  ? 344 ASP C CG    1 
ATOM   7328  O OD1   . ASP C  1 282 ? 14.361  -53.445 17.976  1.00 45.07  ? 344 ASP C OD1   1 
ATOM   7329  O OD2   . ASP C  1 282 ? 13.104  -54.611 16.568  1.00 44.98  ? 344 ASP C OD2   1 
ATOM   7330  N N     . TYR C  1 283 ? 12.548  -49.222 16.278  1.00 39.31  ? 345 TYR C N     1 
ATOM   7331  C CA    . TYR C  1 283 ? 12.203  -48.076 15.471  1.00 37.40  ? 345 TYR C CA    1 
ATOM   7332  C C     . TYR C  1 283 ? 12.551  -48.351 14.011  1.00 35.81  ? 345 TYR C C     1 
ATOM   7333  O O     . TYR C  1 283 ? 13.456  -49.110 13.723  1.00 40.08  ? 345 TYR C O     1 
ATOM   7334  C CB    . TYR C  1 283 ? 12.866  -46.799 16.011  1.00 37.75  ? 345 TYR C CB    1 
ATOM   7335  C CG    . TYR C  1 283 ? 14.373  -46.804 16.248  1.00 37.93  ? 345 TYR C CG    1 
ATOM   7336  C CD1   . TYR C  1 283 ? 15.250  -46.573 15.204  1.00 38.41  ? 345 TYR C CD1   1 
ATOM   7337  C CD2   . TYR C  1 283 ? 14.904  -46.949 17.530  1.00 37.59  ? 345 TYR C CD2   1 
ATOM   7338  C CE1   . TYR C  1 283 ? 16.606  -46.538 15.413  1.00 41.00  ? 345 TYR C CE1   1 
ATOM   7339  C CE2   . TYR C  1 283 ? 16.262  -46.918 17.745  1.00 39.55  ? 345 TYR C CE2   1 
ATOM   7340  C CZ    . TYR C  1 283 ? 17.106  -46.716 16.677  1.00 42.77  ? 345 TYR C CZ    1 
ATOM   7341  O OH    . TYR C  1 283 ? 18.477  -46.698 16.828  1.00 50.73  ? 345 TYR C OH    1 
ATOM   7342  N N     . LEU C  1 284 ? 11.796  -47.775 13.094  1.00 33.54  ? 346 LEU C N     1 
ATOM   7343  C CA    . LEU C  1 284 ? 12.122  -47.827 11.678  1.00 32.62  ? 346 LEU C CA    1 
ATOM   7344  C C     . LEU C  1 284 ? 12.950  -46.603 11.341  1.00 33.72  ? 346 LEU C C     1 
ATOM   7345  O O     . LEU C  1 284 ? 12.681  -45.509 11.824  1.00 33.28  ? 346 LEU C O     1 
ATOM   7346  C CB    . LEU C  1 284 ? 10.855  -47.790 10.835  1.00 32.94  ? 346 LEU C CB    1 
ATOM   7347  C CG    . LEU C  1 284 ? 10.115  -49.099 10.538  1.00 33.77  ? 346 LEU C CG    1 
ATOM   7348  C CD1   . LEU C  1 284 ? 10.252  -50.139 11.631  1.00 34.07  ? 346 LEU C CD1   1 
ATOM   7349  C CD2   . LEU C  1 284 ? 8.651   -48.779 10.300  1.00 34.33  ? 346 LEU C CD2   1 
ATOM   7350  N N     . THR C  1 285 ? 13.952  -46.790 10.495  1.00 35.78  ? 347 THR C N     1 
ATOM   7351  C CA    . THR C  1 285 ? 14.774  -45.685 9.979   1.00 35.83  ? 347 THR C CA    1 
ATOM   7352  C C     . THR C  1 285 ? 14.388  -45.363 8.524   1.00 35.35  ? 347 THR C C     1 
ATOM   7353  O O     . THR C  1 285 ? 14.643  -46.155 7.592   1.00 40.24  ? 347 THR C O     1 
ATOM   7354  C CB    . THR C  1 285 ? 16.245  -46.086 10.080  1.00 36.06  ? 347 THR C CB    1 
ATOM   7355  O OG1   . THR C  1 285 ? 16.476  -46.611 11.394  1.00 36.19  ? 347 THR C OG1   1 
ATOM   7356  C CG2   . THR C  1 285 ? 17.163  -44.909 9.801   1.00 35.61  ? 347 THR C CG2   1 
ATOM   7357  N N     . VAL C  1 286 ? 13.779  -44.206 8.319   1.00 32.72  ? 348 VAL C N     1 
ATOM   7358  C CA    . VAL C  1 286 ? 13.036  -43.982 7.081   1.00 33.26  ? 348 VAL C CA    1 
ATOM   7359  C C     . VAL C  1 286 ? 13.443  -42.721 6.333   1.00 33.79  ? 348 VAL C C     1 
ATOM   7360  O O     . VAL C  1 286 ? 13.767  -41.692 6.935   1.00 31.03  ? 348 VAL C O     1 
ATOM   7361  C CB    . VAL C  1 286 ? 11.510  -43.936 7.330   1.00 32.83  ? 348 VAL C CB    1 
ATOM   7362  C CG1   . VAL C  1 286 ? 11.035  -45.214 8.011   1.00 32.88  ? 348 VAL C CG1   1 
ATOM   7363  C CG2   . VAL C  1 286 ? 11.131  -42.717 8.163   1.00 32.55  ? 348 VAL C CG2   1 
ATOM   7364  N N     . ARG C  1 287 ? 13.386  -42.823 5.007   1.00 34.93  ? 349 ARG C N     1 
ATOM   7365  C CA    . ARG C  1 287 ? 13.749  -41.737 4.112   1.00 35.94  ? 349 ARG C CA    1 
ATOM   7366  C C     . ARG C  1 287 ? 12.529  -41.233 3.382   1.00 35.60  ? 349 ARG C C     1 
ATOM   7367  O O     . ARG C  1 287 ? 11.624  -41.997 3.041   1.00 33.89  ? 349 ARG C O     1 
ATOM   7368  C CB    . ARG C  1 287 ? 14.772  -42.214 3.082   1.00 37.39  ? 349 ARG C CB    1 
ATOM   7369  C CG    . ARG C  1 287 ? 16.063  -42.692 3.706   1.00 38.40  ? 349 ARG C CG    1 
ATOM   7370  C CD    . ARG C  1 287 ? 17.007  -43.293 2.692   1.00 40.44  ? 349 ARG C CD    1 
ATOM   7371  N NE    . ARG C  1 287 ? 17.112  -42.515 1.461   1.00 41.35  ? 349 ARG C NE    1 
ATOM   7372  C CZ    . ARG C  1 287 ? 16.661  -42.920 0.275   1.00 43.84  ? 349 ARG C CZ    1 
ATOM   7373  N NH1   . ARG C  1 287 ? 16.044  -44.094 0.129   1.00 46.82  ? 349 ARG C NH1   1 
ATOM   7374  N NH2   . ARG C  1 287 ? 16.824  -42.150 -0.785  1.00 43.84  ? 349 ARG C NH2   1 
ATOM   7375  N N     . ARG C  1 288 ? 12.533  -39.935 3.122   1.00 36.24  ? 350 ARG C N     1 
ATOM   7376  C CA    . ARG C  1 288 ? 11.457  -39.278 2.378   1.00 35.90  ? 350 ARG C CA    1 
ATOM   7377  C C     . ARG C  1 288 ? 11.124  -40.050 1.106   1.00 32.28  ? 350 ARG C C     1 
ATOM   7378  O O     . ARG C  1 288 ? 12.010  -40.428 0.402   1.00 30.68  ? 350 ARG C O     1 
ATOM   7379  C CB    . ARG C  1 288 ? 11.902  -37.876 2.007   1.00 37.79  ? 350 ARG C CB    1 
ATOM   7380  C CG    . ARG C  1 288 ? 10.772  -36.997 1.578   1.00 40.26  ? 350 ARG C CG    1 
ATOM   7381  C CD    . ARG C  1 288 ? 11.047  -36.369 0.238   1.00 43.96  ? 350 ARG C CD    1 
ATOM   7382  N NE    . ARG C  1 288 ? 9.819   -35.706 -0.205  1.00 47.41  ? 350 ARG C NE    1 
ATOM   7383  C CZ    . ARG C  1 288 ? 9.415   -34.498 0.191   1.00 44.92  ? 350 ARG C CZ    1 
ATOM   7384  N NH1   . ARG C  1 288 ? 10.142  -33.778 1.039   1.00 44.82  ? 350 ARG C NH1   1 
ATOM   7385  N NH2   . ARG C  1 288 ? 8.283   -34.003 -0.280  1.00 43.18  ? 350 ARG C NH2   1 
ATOM   7386  N N     . GLY C  1 289 ? 9.858   -40.322 0.841   1.00 32.73  ? 351 GLY C N     1 
ATOM   7387  C CA    . GLY C  1 289 ? 9.460   -41.039 -0.372  1.00 33.67  ? 351 GLY C CA    1 
ATOM   7388  C C     . GLY C  1 289 ? 9.226   -42.534 -0.198  1.00 35.54  ? 351 GLY C C     1 
ATOM   7389  O O     . GLY C  1 289 ? 8.438   -43.121 -0.948  1.00 37.46  ? 351 GLY C O     1 
ATOM   7390  N N     . GLU C  1 290 ? 9.898   -43.157 0.781   1.00 36.70  ? 352 GLU C N     1 
ATOM   7391  C CA    . GLU C  1 290 ? 9.705   -44.590 1.093   1.00 35.59  ? 352 GLU C CA    1 
ATOM   7392  C C     . GLU C  1 290 ? 8.320   -44.764 1.747   1.00 33.53  ? 352 GLU C C     1 
ATOM   7393  O O     . GLU C  1 290 ? 7.643   -43.777 2.051   1.00 30.67  ? 352 GLU C O     1 
ATOM   7394  C CB    . GLU C  1 290 ? 10.843  -45.145 1.991   1.00 36.35  ? 352 GLU C CB    1 
ATOM   7395  C CG    . GLU C  1 290 ? 12.263  -44.782 1.538   1.00 37.67  ? 352 GLU C CG    1 
ATOM   7396  C CD    . GLU C  1 290 ? 13.383  -45.472 2.324   1.00 40.73  ? 352 GLU C CD    1 
ATOM   7397  O OE1   . GLU C  1 290 ? 14.220  -46.153 1.680   1.00 41.62  ? 352 GLU C OE1   1 
ATOM   7398  O OE2   . GLU C  1 290 ? 13.466  -45.335 3.575   1.00 42.64  ? 352 GLU C OE2   1 
ATOM   7399  N N     . GLU C  1 291 ? 7.900   -46.011 1.953   1.00 33.10  ? 353 GLU C N     1 
ATOM   7400  C CA    . GLU C  1 291 ? 6.532   -46.293 2.387   1.00 34.16  ? 353 GLU C CA    1 
ATOM   7401  C C     . GLU C  1 291 ? 6.365   -47.495 3.324   1.00 32.81  ? 353 GLU C C     1 
ATOM   7402  O O     . GLU C  1 291 ? 7.010   -48.530 3.154   1.00 33.20  ? 353 GLU C O     1 
ATOM   7403  C CB    . GLU C  1 291 ? 5.677   -46.557 1.171   1.00 36.69  ? 353 GLU C CB    1 
ATOM   7404  C CG    . GLU C  1 291 ? 5.571   -45.388 0.229   1.00 40.18  ? 353 GLU C CG    1 
ATOM   7405  C CD    . GLU C  1 291 ? 4.900   -45.789 -1.053  1.00 44.09  ? 353 GLU C CD    1 
ATOM   7406  O OE1   . GLU C  1 291 ? 5.058   -46.971 -1.445  1.00 45.16  ? 353 GLU C OE1   1 
ATOM   7407  O OE2   . GLU C  1 291 ? 4.211   -44.929 -1.649  1.00 47.54  ? 353 GLU C OE2   1 
ATOM   7408  N N     . ILE C  1 292 ? 5.445   -47.360 4.278   1.00 31.26  ? 354 ILE C N     1 
ATOM   7409  C CA    . ILE C  1 292 ? 5.095   -48.432 5.198   1.00 29.28  ? 354 ILE C CA    1 
ATOM   7410  C C     . ILE C  1 292 ? 3.785   -49.043 4.740   1.00 29.49  ? 354 ILE C C     1 
ATOM   7411  O O     . ILE C  1 292 ? 2.780   -48.348 4.582   1.00 29.81  ? 354 ILE C O     1 
ATOM   7412  C CB    . ILE C  1 292 ? 4.922   -47.896 6.626   1.00 28.31  ? 354 ILE C CB    1 
ATOM   7413  C CG1   . ILE C  1 292 ? 6.189   -47.185 7.071   1.00 27.83  ? 354 ILE C CG1   1 
ATOM   7414  C CG2   . ILE C  1 292 ? 4.608   -49.028 7.595   1.00 28.20  ? 354 ILE C CG2   1 
ATOM   7415  C CD1   . ILE C  1 292 ? 5.974   -46.263 8.232   1.00 28.36  ? 354 ILE C CD1   1 
ATOM   7416  N N     . TYR C  1 293 ? 3.796   -50.348 4.532   1.00 29.68  ? 355 TYR C N     1 
ATOM   7417  C CA    . TYR C  1 293 ? 2.577   -51.084 4.229   1.00 30.43  ? 355 TYR C CA    1 
ATOM   7418  C C     . TYR C  1 293 ? 2.192   -51.936 5.419   1.00 30.90  ? 355 TYR C C     1 
ATOM   7419  O O     . TYR C  1 293 ? 3.035   -52.309 6.229   1.00 32.47  ? 355 TYR C O     1 
ATOM   7420  C CB    . TYR C  1 293 ? 2.782   -51.996 3.041   1.00 29.61  ? 355 TYR C CB    1 
ATOM   7421  C CG    . TYR C  1 293 ? 2.976   -51.261 1.768   1.00 29.03  ? 355 TYR C CG    1 
ATOM   7422  C CD1   . TYR C  1 293 ? 4.175   -50.657 1.486   1.00 29.79  ? 355 TYR C CD1   1 
ATOM   7423  C CD2   . TYR C  1 293 ? 1.971   -51.194 0.829   1.00 29.57  ? 355 TYR C CD2   1 
ATOM   7424  C CE1   . TYR C  1 293 ? 4.375   -49.990 0.295   1.00 31.26  ? 355 TYR C CE1   1 
ATOM   7425  C CE2   . TYR C  1 293 ? 2.155   -50.531 -0.368  1.00 30.58  ? 355 TYR C CE2   1 
ATOM   7426  C CZ    . TYR C  1 293 ? 3.362   -49.927 -0.629  1.00 31.80  ? 355 TYR C CZ    1 
ATOM   7427  O OH    . TYR C  1 293 ? 3.562   -49.262 -1.816  1.00 34.79  ? 355 TYR C OH    1 
ATOM   7428  N N     . GLY C  1 294 ? 0.909   -52.243 5.526   1.00 30.87  ? 356 GLY C N     1 
ATOM   7429  C CA    . GLY C  1 294 ? 0.459   -53.189 6.520   1.00 30.57  ? 356 GLY C CA    1 
ATOM   7430  C C     . GLY C  1 294 ? -1.038  -53.339 6.553   1.00 30.04  ? 356 GLY C C     1 
ATOM   7431  O O     . GLY C  1 294 ? -1.766  -52.680 5.826   1.00 28.73  ? 356 GLY C O     1 
ATOM   7432  N N     . THR C  1 295 ? -1.487  -54.217 7.428   1.00 30.47  ? 357 THR C N     1 
ATOM   7433  C CA    . THR C  1 295 ? -2.884  -54.329 7.747   1.00 29.61  ? 357 THR C CA    1 
ATOM   7434  C C     . THR C  1 295 ? -3.035  -54.084 9.240   1.00 29.89  ? 357 THR C C     1 
ATOM   7435  O O     . THR C  1 295 ? -2.149  -54.378 10.044  1.00 29.13  ? 357 THR C O     1 
ATOM   7436  C CB    . THR C  1 295 ? -3.401  -55.728 7.423   1.00 29.24  ? 357 THR C CB    1 
ATOM   7437  O OG1   . THR C  1 295 ? -2.668  -56.689 8.183   1.00 30.33  ? 357 THR C OG1   1 
ATOM   7438  C CG2   . THR C  1 295 ? -3.200  -56.046 5.989   1.00 29.21  ? 357 THR C CG2   1 
ATOM   7439  N N     . ILE C  1 296 ? -4.176  -53.544 9.613   1.00 31.60  ? 358 ILE C N     1 
ATOM   7440  C CA    . ILE C  1 296 ? -4.531  -53.420 11.017  1.00 31.93  ? 358 ILE C CA    1 
ATOM   7441  C C     . ILE C  1 296 ? -5.953  -53.968 11.140  1.00 31.35  ? 358 ILE C C     1 
ATOM   7442  O O     . ILE C  1 296 ? -6.838  -53.610 10.367  1.00 27.56  ? 358 ILE C O     1 
ATOM   7443  C CB    . ILE C  1 296 ? -4.383  -51.981 11.544  1.00 32.36  ? 358 ILE C CB    1 
ATOM   7444  C CG1   . ILE C  1 296 ? -5.433  -51.697 12.597  1.00 34.61  ? 358 ILE C CG1   1 
ATOM   7445  C CG2   . ILE C  1 296 ? -4.569  -50.953 10.444  1.00 32.51  ? 358 ILE C CG2   1 
ATOM   7446  C CD1   . ILE C  1 296 ? -5.173  -50.401 13.311  1.00 37.14  ? 358 ILE C CD1   1 
ATOM   7447  N N     . SER C  1 297 ? -6.138  -54.880 12.087  1.00 33.11  ? 359 SER C N     1 
ATOM   7448  C CA    . SER C  1 297 ? -7.434  -55.499 12.332  1.00 34.66  ? 359 SER C CA    1 
ATOM   7449  C C     . SER C  1 297 ? -7.810  -55.307 13.782  1.00 35.40  ? 359 SER C C     1 
ATOM   7450  O O     . SER C  1 297 ? -6.933  -55.208 14.626  1.00 35.97  ? 359 SER C O     1 
ATOM   7451  C CB    . SER C  1 297 ? -7.399  -56.992 11.978  1.00 34.44  ? 359 SER C CB    1 
ATOM   7452  O OG    . SER C  1 297 ? -6.108  -57.538 12.171  1.00 34.50  ? 359 SER C OG    1 
ATOM   7453  N N     . MET C  1 298 ? -9.107  -55.216 14.065  1.00 37.46  ? 360 MET C N     1 
ATOM   7454  C CA    . MET C  1 298 ? -9.566  -55.212 15.444  1.00 39.56  ? 360 MET C CA    1 
ATOM   7455  C C     . MET C  1 298 ? -10.884 -55.920 15.605  1.00 39.44  ? 360 MET C C     1 
ATOM   7456  O O     . MET C  1 298 ? -11.698 -55.925 14.698  1.00 38.97  ? 360 MET C O     1 
ATOM   7457  C CB    . MET C  1 298 ? -9.654  -53.797 15.994  1.00 42.05  ? 360 MET C CB    1 
ATOM   7458  C CG    . MET C  1 298 ? -10.043 -52.757 14.974  1.00 44.42  ? 360 MET C CG    1 
ATOM   7459  S SD    . MET C  1 298 ? -10.547 -51.245 15.781  1.00 52.24  ? 360 MET C SD    1 
ATOM   7460  C CE    . MET C  1 298 ? -12.125 -51.776 16.465  1.00 49.89  ? 360 MET C CE    1 
ATOM   7461  N N     . LYS C  1 299 ? -11.044 -56.562 16.760  1.00 40.13  ? 361 LYS C N     1 
ATOM   7462  C CA    . LYS C  1 299 ? -12.286 -57.217 17.155  1.00 40.89  ? 361 LYS C CA    1 
ATOM   7463  C C     . LYS C  1 299 ? -12.588 -56.737 18.540  1.00 37.91  ? 361 LYS C C     1 
ATOM   7464  O O     . LYS C  1 299 ? -11.692 -56.233 19.185  1.00 36.45  ? 361 LYS C O     1 
ATOM   7465  C CB    . LYS C  1 299 ? -12.120 -58.732 17.279  1.00 44.39  ? 361 LYS C CB    1 
ATOM   7466  C CG    . LYS C  1 299 ? -11.346 -59.437 16.183  1.00 48.52  ? 361 LYS C CG    1 
ATOM   7467  C CD    . LYS C  1 299 ? -11.714 -60.933 16.140  1.00 52.83  ? 361 LYS C CD    1 
ATOM   7468  C CE    . LYS C  1 299 ? -11.530 -61.687 17.464  1.00 51.19  ? 361 LYS C CE    1 
ATOM   7469  N NZ    . LYS C  1 299 ? -10.129 -61.575 17.920  1.00 53.81  ? 361 LYS C NZ    1 
ATOM   7470  N N     . PRO C  1 300 ? -13.841 -56.910 19.011  1.00 37.60  ? 362 PRO C N     1 
ATOM   7471  C CA    . PRO C  1 300 ? -14.033 -57.000 20.444  1.00 35.58  ? 362 PRO C CA    1 
ATOM   7472  C C     . PRO C  1 300 ? -13.343 -58.260 20.930  1.00 34.42  ? 362 PRO C C     1 
ATOM   7473  O O     . PRO C  1 300 ? -13.301 -59.270 20.223  1.00 32.33  ? 362 PRO C O     1 
ATOM   7474  C CB    . PRO C  1 300 ? -15.550 -57.091 20.597  1.00 35.99  ? 362 PRO C CB    1 
ATOM   7475  C CG    . PRO C  1 300 ? -16.085 -56.350 19.412  1.00 38.79  ? 362 PRO C CG    1 
ATOM   7476  C CD    . PRO C  1 300 ? -15.121 -56.704 18.308  1.00 39.69  ? 362 PRO C CD    1 
ATOM   7477  N N     . ASN C  1 301 ? -12.770 -58.169 22.118  1.00 35.38  ? 363 ASN C N     1 
ATOM   7478  C CA    . ASN C  1 301 ? -12.185 -59.311 22.792  1.00 36.73  ? 363 ASN C CA    1 
ATOM   7479  C C     . ASN C  1 301 ? -13.244 -60.363 23.126  1.00 35.47  ? 363 ASN C C     1 
ATOM   7480  O O     . ASN C  1 301 ? -14.336 -60.026 23.584  1.00 35.68  ? 363 ASN C O     1 
ATOM   7481  C CB    . ASN C  1 301 ? -11.514 -58.849 24.081  1.00 39.23  ? 363 ASN C CB    1 
ATOM   7482  C CG    . ASN C  1 301 ? -11.058 -60.008 24.945  1.00 40.96  ? 363 ASN C CG    1 
ATOM   7483  O OD1   . ASN C  1 301 ? -11.692 -60.347 25.936  1.00 41.03  ? 363 ASN C OD1   1 
ATOM   7484  N ND2   . ASN C  1 301 ? -9.958  -60.625 24.558  1.00 42.46  ? 363 ASN C ND2   1 
ATOM   7485  N N     . ALA C  1 302 ? -12.907 -61.629 22.909  1.00 35.03  ? 364 ALA C N     1 
ATOM   7486  C CA    . ALA C  1 302 ? -13.853 -62.720 23.077  1.00 35.84  ? 364 ALA C CA    1 
ATOM   7487  C C     . ALA C  1 302 ? -14.461 -62.790 24.485  1.00 38.00  ? 364 ALA C C     1 
ATOM   7488  O O     . ALA C  1 302 ? -15.626 -63.113 24.618  1.00 35.73  ? 364 ALA C O     1 
ATOM   7489  C CB    . ALA C  1 302 ? -13.188 -64.030 22.747  1.00 35.61  ? 364 ALA C CB    1 
ATOM   7490  N N     . LYS C  1 303 ? -13.684 -62.472 25.521  1.00 43.10  ? 365 LYS C N     1 
ATOM   7491  C CA    . LYS C  1 303 ? -14.157 -62.528 26.927  1.00 45.53  ? 365 LYS C CA    1 
ATOM   7492  C C     . LYS C  1 303 ? -14.694 -61.229 27.511  1.00 43.86  ? 365 LYS C C     1 
ATOM   7493  O O     . LYS C  1 303 ? -15.435 -61.276 28.475  1.00 44.26  ? 365 LYS C O     1 
ATOM   7494  C CB    . LYS C  1 303 ? -13.054 -63.042 27.836  1.00 49.95  ? 365 LYS C CB    1 
ATOM   7495  C CG    . LYS C  1 303 ? -12.567 -64.402 27.389  1.00 57.33  ? 365 LYS C CG    1 
ATOM   7496  C CD    . LYS C  1 303 ? -11.640 -65.023 28.403  1.00 65.79  ? 365 LYS C CD    1 
ATOM   7497  C CE    . LYS C  1 303 ? -11.310 -66.456 28.016  1.00 72.38  ? 365 LYS C CE    1 
ATOM   7498  N NZ    . LYS C  1 303 ? -10.551 -67.125 29.112  1.00 77.09  ? 365 LYS C NZ    1 
ATOM   7499  N N     . ASN C  1 304 ? -14.315 -60.076 26.964  1.00 43.75  ? 366 ASN C N     1 
ATOM   7500  C CA    . ASN C  1 304 ? -15.034 -58.834 27.255  1.00 44.64  ? 366 ASN C CA    1 
ATOM   7501  C C     . ASN C  1 304 ? -15.253 -57.957 26.025  1.00 44.10  ? 366 ASN C C     1 
ATOM   7502  O O     . ASN C  1 304 ? -14.328 -57.371 25.511  1.00 44.33  ? 366 ASN C O     1 
ATOM   7503  C CB    . ASN C  1 304 ? -14.336 -58.027 28.342  1.00 43.63  ? 366 ASN C CB    1 
ATOM   7504  C CG    . ASN C  1 304 ? -15.035 -56.701 28.624  1.00 44.77  ? 366 ASN C CG    1 
ATOM   7505  O OD1   . ASN C  1 304 ? -16.148 -56.436 28.177  1.00 42.05  ? 366 ASN C OD1   1 
ATOM   7506  N ND2   . ASN C  1 304 ? -14.363 -55.852 29.359  1.00 49.73  ? 366 ASN C ND2   1 
ATOM   7507  N N     . VAL C  1 305 ? -16.508 -57.816 25.628  1.00 44.80  ? 367 VAL C N     1 
ATOM   7508  C CA    . VAL C  1 305 ? -16.886 -57.111 24.411  1.00 48.64  ? 367 VAL C CA    1 
ATOM   7509  C C     . VAL C  1 305 ? -16.519 -55.602 24.439  1.00 51.29  ? 367 VAL C C     1 
ATOM   7510  O O     . VAL C  1 305 ? -16.484 -54.936 23.397  1.00 53.66  ? 367 VAL C O     1 
ATOM   7511  C CB    . VAL C  1 305 ? -18.405 -57.346 24.139  1.00 49.87  ? 367 VAL C CB    1 
ATOM   7512  C CG1   . VAL C  1 305 ? -18.932 -56.570 22.921  1.00 49.64  ? 367 VAL C CG1   1 
ATOM   7513  C CG2   . VAL C  1 305 ? -18.664 -58.843 23.968  1.00 50.32  ? 367 VAL C CG2   1 
ATOM   7514  N N     . ARG C  1 306 ? -16.234 -55.056 25.617  1.00 54.05  ? 368 ARG C N     1 
ATOM   7515  C CA    . ARG C  1 306 ? -15.838 -53.638 25.724  1.00 57.49  ? 368 ARG C CA    1 
ATOM   7516  C C     . ARG C  1 306 ? -14.366 -53.379 25.364  1.00 53.58  ? 368 ARG C C     1 
ATOM   7517  O O     . ARG C  1 306 ? -14.027 -52.326 24.823  1.00 46.57  ? 368 ARG C O     1 
ATOM   7518  C CB    . ARG C  1 306 ? -16.133 -53.105 27.138  1.00 60.80  ? 368 ARG C CB    1 
ATOM   7519  C CG    . ARG C  1 306 ? -17.600 -53.244 27.549  1.00 59.63  ? 368 ARG C CG    1 
ATOM   7520  C CD    . ARG C  1 306 ? -18.175 -52.001 28.218  1.00 59.49  ? 368 ARG C CD    1 
ATOM   7521  N NE    . ARG C  1 306 ? -19.473 -51.670 27.630  1.00 58.73  ? 368 ARG C NE    1 
ATOM   7522  C CZ    . ARG C  1 306 ? -20.616 -52.319 27.862  1.00 58.42  ? 368 ARG C CZ    1 
ATOM   7523  N NH1   . ARG C  1 306 ? -20.658 -53.351 28.691  1.00 60.04  ? 368 ARG C NH1   1 
ATOM   7524  N NH2   . ARG C  1 306 ? -21.735 -51.938 27.250  1.00 56.67  ? 368 ARG C NH2   1 
ATOM   7525  N N     . ASP C  1 307 ? -13.508 -54.347 25.678  1.00 53.76  ? 369 ASP C N     1 
ATOM   7526  C CA    . ASP C  1 307 ? -12.080 -54.290 25.318  1.00 54.99  ? 369 ASP C CA    1 
ATOM   7527  C C     . ASP C  1 307 ? -11.821 -54.602 23.836  1.00 50.76  ? 369 ASP C C     1 
ATOM   7528  O O     . ASP C  1 307 ? -12.620 -55.289 23.195  1.00 48.43  ? 369 ASP C O     1 
ATOM   7529  C CB    . ASP C  1 307 ? -11.284 -55.253 26.202  1.00 55.01  ? 369 ASP C CB    1 
ATOM   7530  C CG    . ASP C  1 307 ? -11.360 -54.882 27.669  1.00 55.63  ? 369 ASP C CG    1 
ATOM   7531  O OD1   . ASP C  1 307 ? -11.900 -53.793 27.984  1.00 59.35  ? 369 ASP C OD1   1 
ATOM   7532  O OD2   . ASP C  1 307 ? -10.883 -55.671 28.507  1.00 51.69  ? 369 ASP C OD2   1 
ATOM   7533  N N     . LEU C  1 308 ? -10.711 -54.082 23.300  1.00 45.41  ? 370 LEU C N     1 
ATOM   7534  C CA    . LEU C  1 308 ? -10.377 -54.257 21.875  1.00 39.81  ? 370 LEU C CA    1 
ATOM   7535  C C     . LEU C  1 308 ? -9.094  -55.034 21.727  1.00 35.12  ? 370 LEU C C     1 
ATOM   7536  O O     . LEU C  1 308 ? -8.116  -54.727 22.364  1.00 35.35  ? 370 LEU C O     1 
ATOM   7537  C CB    . LEU C  1 308 ? -10.206 -52.913 21.154  1.00 39.19  ? 370 LEU C CB    1 
ATOM   7538  C CG    . LEU C  1 308 ? -11.413 -51.987 21.018  1.00 40.68  ? 370 LEU C CG    1 
ATOM   7539  C CD1   . LEU C  1 308 ? -11.004 -50.646 20.427  1.00 39.92  ? 370 LEU C CD1   1 
ATOM   7540  C CD2   . LEU C  1 308 ? -12.507 -52.621 20.181  1.00 42.28  ? 370 LEU C CD2   1 
ATOM   7541  N N     . ASP C  1 309 ? -9.104  -56.035 20.870  1.00 32.25  ? 371 ASP C N     1 
ATOM   7542  C CA    . ASP C  1 309 ? -7.880  -56.677 20.445  1.00 31.32  ? 371 ASP C CA    1 
ATOM   7543  C C     . ASP C  1 309 ? -7.494  -56.114 19.078  1.00 30.64  ? 371 ASP C C     1 
ATOM   7544  O O     . ASP C  1 309 ? -8.345  -55.942 18.202  1.00 29.62  ? 371 ASP C O     1 
ATOM   7545  C CB    . ASP C  1 309 ? -8.072  -58.181 20.315  1.00 31.75  ? 371 ASP C CB    1 
ATOM   7546  C CG    . ASP C  1 309 ? -8.223  -58.879 21.646  1.00 31.90  ? 371 ASP C CG    1 
ATOM   7547  O OD1   . ASP C  1 309 ? -8.024  -58.242 22.711  1.00 31.04  ? 371 ASP C OD1   1 
ATOM   7548  O OD2   . ASP C  1 309 ? -8.564  -60.083 21.599  1.00 30.53  ? 371 ASP C OD2   1 
ATOM   7549  N N     . PHE C  1 310 ? -6.205  -55.825 18.913  1.00 30.27  ? 372 PHE C N     1 
ATOM   7550  C CA    . PHE C  1 310 ? -5.643  -55.389 17.636  1.00 28.35  ? 372 PHE C CA    1 
ATOM   7551  C C     . PHE C  1 310 ? -4.605  -56.382 17.146  1.00 26.22  ? 372 PHE C C     1 
ATOM   7552  O O     . PHE C  1 310 ? -4.069  -57.185 17.903  1.00 24.72  ? 372 PHE C O     1 
ATOM   7553  C CB    . PHE C  1 310 ? -4.963  -54.020 17.762  1.00 27.92  ? 372 PHE C CB    1 
ATOM   7554  C CG    . PHE C  1 310 ? -5.902  -52.882 18.043  1.00 27.19  ? 372 PHE C CG    1 
ATOM   7555  C CD1   . PHE C  1 310 ? -6.248  -52.572 19.324  1.00 27.26  ? 372 PHE C CD1   1 
ATOM   7556  C CD2   . PHE C  1 310 ? -6.403  -52.108 17.021  1.00 27.54  ? 372 PHE C CD2   1 
ATOM   7557  C CE1   . PHE C  1 310 ? -7.084  -51.516 19.595  1.00 28.29  ? 372 PHE C CE1   1 
ATOM   7558  C CE2   . PHE C  1 310 ? -7.238  -51.048 17.277  1.00 27.70  ? 372 PHE C CE2   1 
ATOM   7559  C CZ    . PHE C  1 310 ? -7.576  -50.749 18.569  1.00 28.56  ? 372 PHE C CZ    1 
ATOM   7560  N N     . THR C  1 311 ? -4.350  -56.316 15.854  1.00 25.30  ? 373 THR C N     1 
ATOM   7561  C CA    . THR C  1 311 ? -3.213  -56.974 15.272  1.00 25.62  ? 373 THR C CA    1 
ATOM   7562  C C     . THR C  1 311 ? -2.749  -56.104 14.135  1.00 25.94  ? 373 THR C C     1 
ATOM   7563  O O     . THR C  1 311 ? -3.453  -55.947 13.137  1.00 27.71  ? 373 THR C O     1 
ATOM   7564  C CB    . THR C  1 311 ? -3.552  -58.375 14.767  1.00 25.38  ? 373 THR C CB    1 
ATOM   7565  O OG1   . THR C  1 311 ? -3.736  -59.217 15.898  1.00 25.35  ? 373 THR C OG1   1 
ATOM   7566  C CG2   . THR C  1 311 ? -2.423  -58.931 13.934  1.00 25.99  ? 373 THR C CG2   1 
ATOM   7567  N N     . VAL C  1 312 ? -1.568  -55.522 14.302  1.00 25.39  ? 374 VAL C N     1 
ATOM   7568  C CA    . VAL C  1 312 ? -0.979  -54.698 13.272  1.00 25.07  ? 374 VAL C CA    1 
ATOM   7569  C C     . VAL C  1 312 ? 0.110   -55.537 12.649  1.00 25.06  ? 374 VAL C C     1 
ATOM   7570  O O     . VAL C  1 312 ? 0.981   -56.023 13.358  1.00 23.94  ? 374 VAL C O     1 
ATOM   7571  C CB    . VAL C  1 312 ? -0.392  -53.406 13.848  1.00 24.06  ? 374 VAL C CB    1 
ATOM   7572  C CG1   . VAL C  1 312 ? 0.274   -52.602 12.762  1.00 23.52  ? 374 VAL C CG1   1 
ATOM   7573  C CG2   . VAL C  1 312 ? -1.479  -52.567 14.495  1.00 24.10  ? 374 VAL C CG2   1 
ATOM   7574  N N     . ASP C  1 313 ? -0.006  -55.780 11.346  1.00 25.64  ? 375 ASP C N     1 
ATOM   7575  C CA    . ASP C  1 313 ? 1.076   -56.354 10.563  1.00 25.94  ? 375 ASP C CA    1 
ATOM   7576  C C     . ASP C  1 313 ? 1.691   -55.198 9.839   1.00 26.81  ? 375 ASP C C     1 
ATOM   7577  O O     . ASP C  1 313 ? 0.991   -54.385 9.258   1.00 26.52  ? 375 ASP C O     1 
ATOM   7578  C CB    . ASP C  1 313 ? 0.570   -57.367 9.547   1.00 25.68  ? 375 ASP C CB    1 
ATOM   7579  C CG    . ASP C  1 313 ? 0.017   -58.600 10.184  1.00 26.13  ? 375 ASP C CG    1 
ATOM   7580  O OD1   . ASP C  1 313 ? 0.186   -58.839 11.405  1.00 25.26  ? 375 ASP C OD1   1 
ATOM   7581  O OD2   . ASP C  1 313 ? -0.617  -59.342 9.427   1.00 27.70  ? 375 ASP C OD2   1 
ATOM   7582  N N     . LEU C  1 314 ? 3.008   -55.128 9.847   1.00 28.56  ? 376 LEU C N     1 
ATOM   7583  C CA    . LEU C  1 314 ? 3.680   -54.001 9.257   1.00 28.86  ? 376 LEU C CA    1 
ATOM   7584  C C     . LEU C  1 314 ? 4.850   -54.469 8.415   1.00 28.58  ? 376 LEU C C     1 
ATOM   7585  O O     . LEU C  1 314 ? 5.660   -55.240 8.876   1.00 28.75  ? 376 LEU C O     1 
ATOM   7586  C CB    . LEU C  1 314 ? 4.142   -53.112 10.374  1.00 29.64  ? 376 LEU C CB    1 
ATOM   7587  C CG    . LEU C  1 314 ? 4.840   -51.846 9.901   1.00 31.85  ? 376 LEU C CG    1 
ATOM   7588  C CD1   . LEU C  1 314 ? 4.507   -50.678 10.827  1.00 32.43  ? 376 LEU C CD1   1 
ATOM   7589  C CD2   . LEU C  1 314 ? 6.347   -52.073 9.813   1.00 31.60  ? 376 LEU C CD2   1 
ATOM   7590  N N     . ASP C  1 315 ? 4.917   -54.001 7.177   1.00 29.63  ? 377 ASP C N     1 
ATOM   7591  C CA    . ASP C  1 315 ? 5.984   -54.350 6.232   1.00 31.21  ? 377 ASP C CA    1 
ATOM   7592  C C     . ASP C  1 315 ? 6.672   -53.094 5.711   1.00 29.50  ? 377 ASP C C     1 
ATOM   7593  O O     . ASP C  1 315 ? 6.025   -52.192 5.208   1.00 29.16  ? 377 ASP C O     1 
ATOM   7594  C CB    . ASP C  1 315 ? 5.417   -55.135 5.037   1.00 33.37  ? 377 ASP C CB    1 
ATOM   7595  C CG    . ASP C  1 315 ? 5.363   -56.631 5.297   1.00 35.69  ? 377 ASP C CG    1 
ATOM   7596  O OD1   . ASP C  1 315 ? 4.935   -57.035 6.394   1.00 40.19  ? 377 ASP C OD1   1 
ATOM   7597  O OD2   . ASP C  1 315 ? 5.761   -57.414 4.420   1.00 36.85  ? 377 ASP C OD2   1 
ATOM   7598  N N     . PHE C  1 316 ? 7.987   -53.043 5.813   1.00 29.22  ? 378 PHE C N     1 
ATOM   7599  C CA    . PHE C  1 316 ? 8.732   -51.905 5.310   1.00 29.40  ? 378 PHE C CA    1 
ATOM   7600  C C     . PHE C  1 316 ? 10.034  -52.366 4.711   1.00 31.63  ? 378 PHE C C     1 
ATOM   7601  O O     . PHE C  1 316 ? 10.802  -53.078 5.365   1.00 30.60  ? 378 PHE C O     1 
ATOM   7602  C CB    . PHE C  1 316 ? 9.036   -50.953 6.440   1.00 28.59  ? 378 PHE C CB    1 
ATOM   7603  C CG    . PHE C  1 316 ? 9.846   -49.774 6.032   1.00 27.12  ? 378 PHE C CG    1 
ATOM   7604  C CD1   . PHE C  1 316 ? 9.272   -48.747 5.341   1.00 26.88  ? 378 PHE C CD1   1 
ATOM   7605  C CD2   . PHE C  1 316 ? 11.174  -49.685 6.357   1.00 27.80  ? 378 PHE C CD2   1 
ATOM   7606  C CE1   . PHE C  1 316 ? 10.004  -47.640 4.965   1.00 26.25  ? 378 PHE C CE1   1 
ATOM   7607  C CE2   . PHE C  1 316 ? 11.918  -48.575 5.989   1.00 27.69  ? 378 PHE C CE2   1 
ATOM   7608  C CZ    . PHE C  1 316 ? 11.326  -47.549 5.293   1.00 26.10  ? 378 PHE C CZ    1 
ATOM   7609  N N     . LYS C  1 317 ? 10.252  -51.978 3.457   1.00 35.78  ? 379 LYS C N     1 
ATOM   7610  C CA    . LYS C  1 317 ? 11.508  -52.230 2.758   1.00 39.86  ? 379 LYS C CA    1 
ATOM   7611  C C     . LYS C  1 317 ? 12.036  -50.905 2.241   1.00 39.11  ? 379 LYS C C     1 
ATOM   7612  O O     . LYS C  1 317 ? 11.735  -50.489 1.140   1.00 37.66  ? 379 LYS C O     1 
ATOM   7613  C CB    . LYS C  1 317 ? 11.349  -53.254 1.621   1.00 43.19  ? 379 LYS C CB    1 
ATOM   7614  C CG    . LYS C  1 317 ? 12.638  -53.514 0.833   1.00 47.64  ? 379 LYS C CG    1 
ATOM   7615  C CD    . LYS C  1 317 ? 12.981  -54.997 0.729   1.00 52.21  ? 379 LYS C CD    1 
ATOM   7616  C CE    . LYS C  1 317 ? 11.927  -55.836 -0.014  1.00 53.58  ? 379 LYS C CE    1 
ATOM   7617  N NZ    . LYS C  1 317 ? 12.160  -55.884 -1.486  1.00 54.19  ? 379 LYS C NZ    1 
ATOM   7618  N N     . GLY C  1 318 ? 12.809  -50.242 3.086   1.00 41.03  ? 380 GLY C N     1 
ATOM   7619  C CA    . GLY C  1 318 ? 13.495  -49.020 2.727   1.00 39.81  ? 380 GLY C CA    1 
ATOM   7620  C C     . GLY C  1 318 ? 14.940  -49.336 2.473   1.00 40.67  ? 380 GLY C C     1 
ATOM   7621  O O     . GLY C  1 318 ? 15.364  -50.482 2.574   1.00 41.02  ? 380 GLY C O     1 
ATOM   7622  N N     . GLN C  1 319 ? 15.706  -48.303 2.176   1.00 43.49  ? 381 GLN C N     1 
ATOM   7623  C CA    . GLN C  1 319 ? 17.117  -48.441 1.868   1.00 45.32  ? 381 GLN C CA    1 
ATOM   7624  C C     . GLN C  1 319 ? 17.958  -48.644 3.120   1.00 44.20  ? 381 GLN C C     1 
ATOM   7625  O O     . GLN C  1 319 ? 19.038  -49.207 3.052   1.00 44.79  ? 381 GLN C O     1 
ATOM   7626  C CB    . GLN C  1 319 ? 17.566  -47.183 1.157   1.00 49.98  ? 381 GLN C CB    1 
ATOM   7627  C CG    . GLN C  1 319 ? 18.835  -47.307 0.351   1.00 55.47  ? 381 GLN C CG    1 
ATOM   7628  C CD    . GLN C  1 319 ? 19.139  -45.990 -0.347  1.00 58.72  ? 381 GLN C CD    1 
ATOM   7629  O OE1   . GLN C  1 319 ? 18.586  -45.699 -1.412  1.00 59.66  ? 381 GLN C OE1   1 
ATOM   7630  N NE2   . GLN C  1 319 ? 20.004  -45.175 0.265   1.00 57.45  ? 381 GLN C NE2   1 
ATOM   7631  N N     . LEU C  1 320 ? 17.451  -48.201 4.265   1.00 43.88  ? 382 LEU C N     1 
ATOM   7632  C CA    . LEU C  1 320 ? 18.213  -48.238 5.507   1.00 42.89  ? 382 LEU C CA    1 
ATOM   7633  C C     . LEU C  1 320 ? 17.752  -49.278 6.533   1.00 42.32  ? 382 LEU C C     1 
ATOM   7634  O O     . LEU C  1 320 ? 18.460  -49.555 7.516   1.00 40.55  ? 382 LEU C O     1 
ATOM   7635  C CB    . LEU C  1 320 ? 18.173  -46.851 6.139   1.00 43.50  ? 382 LEU C CB    1 
ATOM   7636  C CG    . LEU C  1 320 ? 18.674  -45.715 5.245   1.00 42.43  ? 382 LEU C CG    1 
ATOM   7637  C CD1   . LEU C  1 320 ? 18.717  -44.434 6.051   1.00 41.53  ? 382 LEU C CD1   1 
ATOM   7638  C CD2   . LEU C  1 320 ? 20.040  -46.022 4.660   1.00 42.65  ? 382 LEU C CD2   1 
ATOM   7639  N N     . CYS C  1 321 ? 16.560  -49.832 6.335   1.00 42.08  ? 383 CYS C N     1 
ATOM   7640  C CA    . CYS C  1 321 ? 16.125  -50.984 7.125   1.00 40.71  ? 383 CYS C CA    1 
ATOM   7641  C C     . CYS C  1 321 ? 14.938  -51.669 6.456   1.00 38.16  ? 383 CYS C C     1 
ATOM   7642  O O     . CYS C  1 321 ? 14.329  -51.136 5.530   1.00 31.69  ? 383 CYS C O     1 
ATOM   7643  C CB    . CYS C  1 321 ? 15.813  -50.597 8.584   1.00 40.24  ? 383 CYS C CB    1 
ATOM   7644  S SG    . CYS C  1 321 ? 14.332  -49.599 8.784   1.00 37.31  ? 383 CYS C SG    1 
ATOM   7645  N N     . GLU C  1 322 ? 14.656  -52.874 6.936   1.00 39.51  ? 384 GLU C N     1 
ATOM   7646  C CA    . GLU C  1 322 ? 13.687  -53.763 6.326   1.00 40.78  ? 384 GLU C CA    1 
ATOM   7647  C C     . GLU C  1 322 ? 13.116  -54.637 7.426   1.00 38.67  ? 384 GLU C C     1 
ATOM   7648  O O     . GLU C  1 322 ? 13.848  -55.408 8.031   1.00 40.46  ? 384 GLU C O     1 
ATOM   7649  C CB    . GLU C  1 322 ? 14.396  -54.605 5.250   1.00 44.09  ? 384 GLU C CB    1 
ATOM   7650  C CG    . GLU C  1 322 ? 13.737  -55.925 4.844   1.00 49.06  ? 384 GLU C CG    1 
ATOM   7651  C CD    . GLU C  1 322 ? 14.355  -56.517 3.569   1.00 52.28  ? 384 GLU C CD    1 
ATOM   7652  O OE1   . GLU C  1 322 ? 15.405  -56.006 3.124   1.00 50.49  ? 384 GLU C OE1   1 
ATOM   7653  O OE2   . GLU C  1 322 ? 13.788  -57.480 2.992   1.00 53.42  ? 384 GLU C OE2   1 
ATOM   7654  N N     . THR C  1 323 ? 11.834  -54.500 7.735   1.00 37.17  ? 385 THR C N     1 
ATOM   7655  C CA    . THR C  1 323 ? 11.191  -55.491 8.610   1.00 38.02  ? 385 THR C CA    1 
ATOM   7656  C C     . THR C  1 323 ? 9.783   -55.785 8.139   1.00 35.40  ? 385 THR C C     1 
ATOM   7657  O O     . THR C  1 323 ? 9.178   -55.019 7.388   1.00 31.75  ? 385 THR C O     1 
ATOM   7658  C CB    . THR C  1 323 ? 11.092  -55.089 10.102  1.00 39.07  ? 385 THR C CB    1 
ATOM   7659  O OG1   . THR C  1 323 ? 10.429  -53.821 10.187  1.00 41.59  ? 385 THR C OG1   1 
ATOM   7660  C CG2   . THR C  1 323 ? 12.482  -55.056 10.817  1.00 38.53  ? 385 THR C CG2   1 
ATOM   7661  N N     . SER C  1 324 ? 9.317   -56.952 8.574   1.00 34.93  ? 386 SER C N     1 
ATOM   7662  C CA    . SER C  1 324 ? 7.954   -57.399 8.387   1.00 34.34  ? 386 SER C CA    1 
ATOM   7663  C C     . SER C  1 324 ? 7.540   -58.100 9.682   1.00 33.17  ? 386 SER C C     1 
ATOM   7664  O O     . SER C  1 324 ? 8.089   -59.120 10.052  1.00 30.14  ? 386 SER C O     1 
ATOM   7665  C CB    . SER C  1 324 ? 7.842   -58.309 7.167   1.00 33.84  ? 386 SER C CB    1 
ATOM   7666  O OG    . SER C  1 324 ? 7.139   -59.474 7.501   1.00 33.77  ? 386 SER C OG    1 
ATOM   7667  N N     . VAL C  1 325 ? 6.569   -57.512 10.365  1.00 35.96  ? 387 VAL C N     1 
ATOM   7668  C CA    . VAL C  1 325 ? 6.275   -57.823 11.760  1.00 36.77  ? 387 VAL C CA    1 
ATOM   7669  C C     . VAL C  1 325 ? 4.773   -57.993 11.946  1.00 36.87  ? 387 VAL C C     1 
ATOM   7670  O O     . VAL C  1 325 ? 3.983   -57.470 11.154  1.00 38.18  ? 387 VAL C O     1 
ATOM   7671  C CB    . VAL C  1 325 ? 6.788   -56.711 12.693  1.00 36.28  ? 387 VAL C CB    1 
ATOM   7672  C CG1   . VAL C  1 325 ? 6.853   -57.206 14.124  1.00 37.96  ? 387 VAL C CG1   1 
ATOM   7673  C CG2   . VAL C  1 325 ? 8.177   -56.262 12.265  1.00 36.13  ? 387 VAL C CG2   1 
ATOM   7674  N N     . SER C  1 326 ? 4.392   -58.766 12.963  1.00 35.61  ? 388 SER C N     1 
ATOM   7675  C CA    . SER C  1 326 ? 3.001   -58.892 13.364  1.00 35.33  ? 388 SER C CA    1 
ATOM   7676  C C     . SER C  1 326 ? 2.914   -58.702 14.874  1.00 34.19  ? 388 SER C C     1 
ATOM   7677  O O     . SER C  1 326 ? 3.473   -59.482 15.635  1.00 35.03  ? 388 SER C O     1 
ATOM   7678  C CB    . SER C  1 326 ? 2.447   -60.242 12.935  1.00 35.91  ? 388 SER C CB    1 
ATOM   7679  O OG    . SER C  1 326 ? 1.055   -60.307 13.168  1.00 38.24  ? 388 SER C OG    1 
ATOM   7680  N N     . ASN C  1 327 ? 2.250   -57.627 15.287  1.00 34.31  ? 389 ASN C N     1 
ATOM   7681  C CA    . ASN C  1 327 ? 2.146   -57.238 16.697  1.00 35.15  ? 389 ASN C CA    1 
ATOM   7682  C C     . ASN C  1 327 ? 0.697   -57.260 17.177  1.00 35.14  ? 389 ASN C C     1 
ATOM   7683  O O     . ASN C  1 327 ? -0.190  -56.778 16.485  1.00 35.72  ? 389 ASN C O     1 
ATOM   7684  C CB    . ASN C  1 327 ? 2.702   -55.824 16.912  1.00 34.79  ? 389 ASN C CB    1 
ATOM   7685  C CG    . ASN C  1 327 ? 4.164   -55.697 16.534  1.00 34.55  ? 389 ASN C CG    1 
ATOM   7686  O OD1   . ASN C  1 327 ? 4.890   -56.699 16.444  1.00 34.33  ? 389 ASN C OD1   1 
ATOM   7687  N ND2   . ASN C  1 327 ? 4.618   -54.451 16.342  1.00 33.82  ? 389 ASN C ND2   1 
ATOM   7688  N N     . ASP C  1 328 ? 0.476   -57.809 18.368  1.00 35.27  ? 390 ASP C N     1 
ATOM   7689  C CA    . ASP C  1 328 ? -0.844  -57.851 18.980  1.00 34.80  ? 390 ASP C CA    1 
ATOM   7690  C C     . ASP C  1 328 ? -0.911  -56.734 20.012  1.00 33.31  ? 390 ASP C C     1 
ATOM   7691  O O     . ASP C  1 328 ? 0.069   -56.486 20.694  1.00 33.79  ? 390 ASP C O     1 
ATOM   7692  C CB    . ASP C  1 328 ? -1.075  -59.208 19.676  1.00 36.20  ? 390 ASP C CB    1 
ATOM   7693  C CG    . ASP C  1 328 ? -1.385  -60.364 18.694  1.00 37.74  ? 390 ASP C CG    1 
ATOM   7694  O OD1   . ASP C  1 328 ? -1.521  -60.159 17.454  1.00 37.43  ? 390 ASP C OD1   1 
ATOM   7695  O OD2   . ASP C  1 328 ? -1.495  -61.501 19.194  1.00 39.08  ? 390 ASP C OD2   1 
ATOM   7696  N N     . TYR C  1 329 ? -2.051  -56.058 20.125  1.00 31.85  ? 391 TYR C N     1 
ATOM   7697  C CA    . TYR C  1 329 ? -2.249  -55.042 21.160  1.00 31.13  ? 391 TYR C CA    1 
ATOM   7698  C C     . TYR C  1 329 ? -3.592  -55.320 21.805  1.00 32.99  ? 391 TYR C C     1 
ATOM   7699  O O     . TYR C  1 329 ? -4.442  -55.952 21.166  1.00 34.26  ? 391 TYR C O     1 
ATOM   7700  C CB    . TYR C  1 329 ? -2.230  -53.628 20.564  1.00 30.03  ? 391 TYR C CB    1 
ATOM   7701  C CG    . TYR C  1 329 ? -0.945  -53.269 19.852  1.00 28.33  ? 391 TYR C CG    1 
ATOM   7702  C CD1   . TYR C  1 329 ? -0.730  -53.625 18.533  1.00 27.92  ? 391 TYR C CD1   1 
ATOM   7703  C CD2   . TYR C  1 329 ? 0.057   -52.581 20.506  1.00 28.50  ? 391 TYR C CD2   1 
ATOM   7704  C CE1   . TYR C  1 329 ? 0.456   -53.313 17.885  1.00 27.35  ? 391 TYR C CE1   1 
ATOM   7705  C CE2   . TYR C  1 329 ? 1.250   -52.264 19.873  1.00 28.70  ? 391 TYR C CE2   1 
ATOM   7706  C CZ    . TYR C  1 329 ? 1.446   -52.628 18.560  1.00 27.38  ? 391 TYR C CZ    1 
ATOM   7707  O OH    . TYR C  1 329 ? 2.630   -52.296 17.955  1.00 24.95  ? 391 TYR C OH    1 
ATOM   7708  N N     . LYS C  1 330 ? -3.786  -54.869 23.052  1.00 34.41  ? 392 LYS C N     1 
ATOM   7709  C CA    . LYS C  1 330 ? -5.095  -54.957 23.732  1.00 36.30  ? 392 LYS C CA    1 
ATOM   7710  C C     . LYS C  1 330 ? -5.386  -53.659 24.412  1.00 34.99  ? 392 LYS C C     1 
ATOM   7711  O O     . LYS C  1 330 ? -4.524  -53.132 25.081  1.00 33.04  ? 392 LYS C O     1 
ATOM   7712  C CB    . LYS C  1 330 ? -5.137  -56.089 24.759  1.00 39.86  ? 392 LYS C CB    1 
ATOM   7713  C CG    . LYS C  1 330 ? -5.219  -57.484 24.128  1.00 45.49  ? 392 LYS C CG    1 
ATOM   7714  C CD    . LYS C  1 330 ? -4.761  -58.607 25.065  1.00 48.47  ? 392 LYS C CD    1 
ATOM   7715  C CE    . LYS C  1 330 ? -5.687  -58.817 26.249  1.00 47.59  ? 392 LYS C CE    1 
ATOM   7716  N NZ    . LYS C  1 330 ? -6.973  -59.407 25.799  1.00 49.36  ? 392 LYS C NZ    1 
ATOM   7717  N N     . MET C  1 331 ? -6.595  -53.141 24.242  1.00 37.41  ? 393 MET C N     1 
ATOM   7718  C CA    . MET C  1 331 ? -6.936  -51.858 24.830  1.00 41.95  ? 393 MET C CA    1 
ATOM   7719  C C     . MET C  1 331 ? -7.581  -51.993 26.201  1.00 45.48  ? 393 MET C C     1 
ATOM   7720  O O     . MET C  1 331 ? -8.677  -52.580 26.353  1.00 42.41  ? 393 MET C O     1 
ATOM   7721  C CB    . MET C  1 331 ? -7.812  -50.983 23.905  1.00 43.85  ? 393 MET C CB    1 
ATOM   7722  C CG    . MET C  1 331 ? -7.019  -49.921 23.132  1.00 43.65  ? 393 MET C CG    1 
ATOM   7723  S SD    . MET C  1 331 ? -7.873  -48.389 22.670  1.00 41.16  ? 393 MET C SD    1 
ATOM   7724  C CE    . MET C  1 331 ? -8.362  -47.781 24.268  1.00 41.39  ? 393 MET C CE    1 
ATOM   7725  N N     . ARG C  1 332 ? -6.827  -51.459 27.177  1.00 50.94  ? 394 ARG C N     1 
ATOM   7726  C CA    . ARG C  1 332 ? -7.295  -51.070 28.518  1.00 51.65  ? 394 ARG C CA    1 
ATOM   7727  C C     . ARG C  1 332 ? -8.142  -52.195 29.113  1.00 44.29  ? 394 ARG C C     1 
ATOM   7728  O O     . ARG C  1 332 ? -7.880  -53.378 28.861  1.00 35.60  ? 394 ARG C O     1 
ATOM   7729  C CB    . ARG C  1 332 ? -8.034  -49.674 28.490  1.00 57.46  ? 394 ARG C CB    1 
ATOM   7730  C CG    . ARG C  1 332 ? -7.166  -48.381 28.373  1.00 56.77  ? 394 ARG C CG    1 
ATOM   7731  C CD    . ARG C  1 332 ? -6.804  -47.797 29.736  1.00 57.64  ? 394 ARG C CD    1 
ATOM   7732  N NE    . ARG C  1 332 ? -6.253  -48.824 30.658  1.00 61.79  ? 394 ARG C NE    1 
ATOM   7733  C CZ    . ARG C  1 332 ? -6.783  -49.225 31.832  1.00 59.73  ? 394 ARG C CZ    1 
ATOM   7734  N NH1   . ARG C  1 332 ? -7.897  -48.691 32.335  1.00 57.46  ? 394 ARG C NH1   1 
ATOM   7735  N NH2   . ARG C  1 332 ? -6.174  -50.168 32.543  1.00 56.55  ? 394 ARG C NH2   1 
ATOM   7736  O OXT   . ARG C  1 332 ? -9.075  -51.935 29.858  1.00 41.20  ? 394 ARG C OXT   1 
ATOM   7737  N N     . SER D  1 17  ? -7.220  -54.780 40.474  1.00 34.26  ? 79  SER D N     1 
ATOM   7738  C CA    . SER D  1 17  ? -6.951  -53.334 40.077  1.00 35.83  ? 79  SER D CA    1 
ATOM   7739  C C     . SER D  1 17  ? -5.522  -52.807 40.384  1.00 37.20  ? 79  SER D C     1 
ATOM   7740  O O     . SER D  1 17  ? -5.037  -51.891 39.716  1.00 36.19  ? 79  SER D O     1 
ATOM   7741  C CB    . SER D  1 17  ? -7.934  -52.365 40.738  1.00 35.65  ? 79  SER D CB    1 
ATOM   7742  O OG    . SER D  1 17  ? -7.356  -51.785 41.903  1.00 35.89  ? 79  SER D OG    1 
ATOM   7743  N N     . TYR D  1 18  ? -4.879  -53.341 41.425  1.00 37.05  ? 80  TYR D N     1 
ATOM   7744  C CA    . TYR D  1 18  ? -3.419  -53.249 41.567  1.00 35.09  ? 80  TYR D CA    1 
ATOM   7745  C C     . TYR D  1 18  ? -2.702  -54.221 40.646  1.00 35.04  ? 80  TYR D C     1 
ATOM   7746  O O     . TYR D  1 18  ? -1.506  -54.339 40.736  1.00 37.03  ? 80  TYR D O     1 
ATOM   7747  C CB    . TYR D  1 18  ? -2.974  -53.554 43.004  1.00 34.54  ? 80  TYR D CB    1 
ATOM   7748  C CG    . TYR D  1 18  ? -3.022  -52.363 43.929  1.00 35.11  ? 80  TYR D CG    1 
ATOM   7749  C CD1   . TYR D  1 18  ? -2.047  -51.376 43.872  1.00 35.55  ? 80  TYR D CD1   1 
ATOM   7750  C CD2   . TYR D  1 18  ? -4.030  -52.219 44.861  1.00 36.06  ? 80  TYR D CD2   1 
ATOM   7751  C CE1   . TYR D  1 18  ? -2.077  -50.290 44.717  1.00 35.25  ? 80  TYR D CE1   1 
ATOM   7752  C CE2   . TYR D  1 18  ? -4.071  -51.127 45.707  1.00 36.12  ? 80  TYR D CE2   1 
ATOM   7753  C CZ    . TYR D  1 18  ? -3.095  -50.175 45.621  1.00 35.83  ? 80  TYR D CZ    1 
ATOM   7754  O OH    . TYR D  1 18  ? -3.147  -49.099 46.450  1.00 39.61  ? 80  TYR D OH    1 
ATOM   7755  N N     . ALA D  1 19  ? -3.425  -54.942 39.789  1.00 36.54  ? 81  ALA D N     1 
ATOM   7756  C CA    . ALA D  1 19  ? -2.819  -55.868 38.818  1.00 37.70  ? 81  ALA D CA    1 
ATOM   7757  C C     . ALA D  1 19  ? -2.123  -55.158 37.648  1.00 37.12  ? 81  ALA D C     1 
ATOM   7758  O O     . ALA D  1 19  ? -1.236  -55.733 37.009  1.00 38.25  ? 81  ALA D O     1 
ATOM   7759  C CB    . ALA D  1 19  ? -3.880  -56.819 38.270  1.00 37.65  ? 81  ALA D CB    1 
ATOM   7760  N N     . HIS D  1 20  ? -2.525  -53.919 37.379  1.00 35.64  ? 82  HIS D N     1 
ATOM   7761  C CA    . HIS D  1 20  ? -2.128  -53.215 36.174  1.00 35.57  ? 82  HIS D CA    1 
ATOM   7762  C C     . HIS D  1 20  ? -0.735  -52.590 36.258  1.00 31.87  ? 82  HIS D C     1 
ATOM   7763  O O     . HIS D  1 20  ? -0.505  -51.758 37.135  1.00 33.41  ? 82  HIS D O     1 
ATOM   7764  C CB    . HIS D  1 20  ? -3.126  -52.102 35.933  1.00 39.07  ? 82  HIS D CB    1 
ATOM   7765  C CG    . HIS D  1 20  ? -2.906  -51.400 34.644  1.00 44.66  ? 82  HIS D CG    1 
ATOM   7766  N ND1   . HIS D  1 20  ? -2.740  -52.083 33.459  1.00 46.15  ? 82  HIS D ND1   1 
ATOM   7767  C CD2   . HIS D  1 20  ? -2.792  -50.087 34.346  1.00 48.16  ? 82  HIS D CD2   1 
ATOM   7768  C CE1   . HIS D  1 20  ? -2.544  -51.221 32.481  1.00 46.41  ? 82  HIS D CE1   1 
ATOM   7769  N NE2   . HIS D  1 20  ? -2.576  -50.003 32.990  1.00 50.11  ? 82  HIS D NE2   1 
ATOM   7770  N N     A PHE D  1 21  ? 0.171   -52.924 35.336  0.50 25.91  ? 83  PHE D N     1 
ATOM   7771  C CA    A PHE D  1 21  ? 1.544   -52.441 35.450  0.50 22.49  ? 83  PHE D CA    1 
ATOM   7772  C C     A PHE D  1 21  ? 1.592   -50.962 35.816  0.50 22.93  ? 83  PHE D C     1 
ATOM   7773  O O     A PHE D  1 21  ? 2.526   -50.506 36.458  0.50 22.60  ? 83  PHE D O     1 
ATOM   7774  C CB    A PHE D  1 21  ? 2.308   -52.668 34.156  0.50 20.00  ? 83  PHE D CB    1 
ATOM   7775  C CG    A PHE D  1 21  ? 1.840   -51.821 33.025  0.50 18.00  ? 83  PHE D CG    1 
ATOM   7776  C CD1   A PHE D  1 21  ? 2.190   -50.491 32.949  0.50 17.06  ? 83  PHE D CD1   1 
ATOM   7777  C CD2   A PHE D  1 21  ? 1.064   -52.354 32.032  0.50 16.99  ? 83  PHE D CD2   1 
ATOM   7778  C CE1   A PHE D  1 21  ? 1.758   -49.703 31.905  0.50 16.42  ? 83  PHE D CE1   1 
ATOM   7779  C CE2   A PHE D  1 21  ? 0.629   -51.571 30.984  0.50 16.44  ? 83  PHE D CE2   1 
ATOM   7780  C CZ    A PHE D  1 21  ? 0.979   -50.245 30.919  0.50 16.12  ? 83  PHE D CZ    1 
ATOM   7781  N N     . GLY D  1 22  ? 0.555   -50.224 35.444  1.00 23.71  ? 84  GLY D N     1 
ATOM   7782  C CA    . GLY D  1 22  ? 0.585   -48.763 35.468  1.00 25.91  ? 84  GLY D CA    1 
ATOM   7783  C C     . GLY D  1 22  ? 0.383   -47.988 36.752  1.00 26.83  ? 84  GLY D C     1 
ATOM   7784  O O     . GLY D  1 22  ? 0.865   -46.862 36.882  1.00 25.18  ? 84  GLY D O     1 
ATOM   7785  N N     . ILE D  1 23  ? -0.366  -48.543 37.685  1.00 30.08  ? 85  ILE D N     1 
ATOM   7786  C CA    . ILE D  1 23  ? -0.443  -47.928 39.009  1.00 33.14  ? 85  ILE D CA    1 
ATOM   7787  C C     . ILE D  1 23  ? 0.918   -48.064 39.739  1.00 32.25  ? 85  ILE D C     1 
ATOM   7788  O O     . ILE D  1 23  ? 1.318   -47.161 40.478  1.00 31.92  ? 85  ILE D O     1 
ATOM   7789  C CB    . ILE D  1 23  ? -1.628  -48.508 39.838  1.00 36.34  ? 85  ILE D CB    1 
ATOM   7790  C CG1   . ILE D  1 23  ? -2.129  -47.515 40.929  1.00 38.03  ? 85  ILE D CG1   1 
ATOM   7791  C CG2   . ILE D  1 23  ? -1.296  -49.880 40.411  1.00 37.36  ? 85  ILE D CG2   1 
ATOM   7792  C CD1   . ILE D  1 23  ? -1.102  -46.898 41.880  1.00 37.06  ? 85  ILE D CD1   1 
ATOM   7793  N N     . HIS D  1 24  ? 1.629   -49.170 39.506  1.00 30.93  ? 86  HIS D N     1 
ATOM   7794  C CA    . HIS D  1 24  ? 2.956   -49.381 40.067  1.00 30.06  ? 86  HIS D CA    1 
ATOM   7795  C C     . HIS D  1 24  ? 4.002   -48.506 39.392  1.00 28.71  ? 86  HIS D C     1 
ATOM   7796  O O     . HIS D  1 24  ? 4.954   -48.042 40.034  1.00 27.24  ? 86  HIS D O     1 
ATOM   7797  C CB    . HIS D  1 24  ? 3.353   -50.833 39.918  1.00 31.86  ? 86  HIS D CB    1 
ATOM   7798  C CG    . HIS D  1 24  ? 2.571   -51.755 40.794  1.00 33.90  ? 86  HIS D CG    1 
ATOM   7799  N ND1   . HIS D  1 24  ? 1.407   -52.373 40.388  1.00 34.05  ? 86  HIS D ND1   1 
ATOM   7800  C CD2   . HIS D  1 24  ? 2.788   -52.160 42.065  1.00 36.33  ? 86  HIS D CD2   1 
ATOM   7801  C CE1   . HIS D  1 24  ? 0.943   -53.122 41.370  1.00 33.83  ? 86  HIS D CE1   1 
ATOM   7802  N NE2   . HIS D  1 24  ? 1.761   -53.009 42.398  1.00 36.28  ? 86  HIS D NE2   1 
ATOM   7803  N N     . GLU D  1 25  ? 3.822   -48.274 38.098  1.00 27.14  ? 87  GLU D N     1 
ATOM   7804  C CA    . GLU D  1 25  ? 4.618   -47.276 37.419  1.00 27.11  ? 87  GLU D CA    1 
ATOM   7805  C C     . GLU D  1 25  ? 4.572   -45.961 38.202  1.00 26.04  ? 87  GLU D C     1 
ATOM   7806  O O     . GLU D  1 25  ? 5.619   -45.416 38.538  1.00 27.03  ? 87  GLU D O     1 
ATOM   7807  C CB    . GLU D  1 25  ? 4.137   -47.071 35.977  1.00 27.87  ? 87  GLU D CB    1 
ATOM   7808  C CG    . GLU D  1 25  ? 5.012   -46.141 35.140  1.00 28.27  ? 87  GLU D CG    1 
ATOM   7809  C CD    . GLU D  1 25  ? 4.596   -46.069 33.692  1.00 28.30  ? 87  GLU D CD    1 
ATOM   7810  O OE1   . GLU D  1 25  ? 3.815   -46.943 33.239  1.00 28.91  ? 87  GLU D OE1   1 
ATOM   7811  O OE2   . GLU D  1 25  ? 5.068   -45.133 33.012  1.00 27.68  ? 87  GLU D OE2   1 
ATOM   7812  N N     . GLU D  1 26  ? 3.380   -45.467 38.529  1.00 24.99  ? 88  GLU D N     1 
ATOM   7813  C CA    . GLU D  1 26  ? 3.275   -44.189 39.251  1.00 24.52  ? 88  GLU D CA    1 
ATOM   7814  C C     . GLU D  1 26  ? 3.992   -44.185 40.594  1.00 25.51  ? 88  GLU D C     1 
ATOM   7815  O O     . GLU D  1 26  ? 4.673   -43.211 40.938  1.00 24.86  ? 88  GLU D O     1 
ATOM   7816  C CB    . GLU D  1 26  ? 1.844   -43.783 39.490  1.00 22.38  ? 88  GLU D CB    1 
ATOM   7817  C CG    . GLU D  1 26  ? 1.754   -42.320 39.837  1.00 21.86  ? 88  GLU D CG    1 
ATOM   7818  C CD    . GLU D  1 26  ? 0.370   -41.929 40.212  1.00 21.94  ? 88  GLU D CD    1 
ATOM   7819  O OE1   . GLU D  1 26  ? 0.164   -40.769 40.607  1.00 21.90  ? 88  GLU D OE1   1 
ATOM   7820  O OE2   . GLU D  1 26  ? -0.503  -42.801 40.148  1.00 22.03  ? 88  GLU D OE2   1 
ATOM   7821  N N     . MET D  1 27  ? 3.825   -45.269 41.341  1.00 27.46  ? 89  MET D N     1 
ATOM   7822  C CA    . MET D  1 27  ? 4.461   -45.421 42.641  1.00 29.62  ? 89  MET D CA    1 
ATOM   7823  C C     . MET D  1 27  ? 5.979   -45.457 42.524  1.00 28.97  ? 89  MET D C     1 
ATOM   7824  O O     . MET D  1 27  ? 6.704   -44.854 43.344  1.00 30.23  ? 89  MET D O     1 
ATOM   7825  C CB    . MET D  1 27  ? 3.997   -46.706 43.322  1.00 31.34  ? 89  MET D CB    1 
ATOM   7826  C CG    . MET D  1 27  ? 2.577   -46.649 43.831  1.00 33.60  ? 89  MET D CG    1 
ATOM   7827  S SD    . MET D  1 27  ? 2.040   -48.222 44.539  1.00 38.00  ? 89  MET D SD    1 
ATOM   7828  C CE    . MET D  1 27  ? 0.825   -47.534 45.681  1.00 41.33  ? 89  MET D CE    1 
ATOM   7829  N N     . LEU D  1 28  ? 6.459   -46.188 41.525  1.00 26.31  ? 90  LEU D N     1 
ATOM   7830  C CA    . LEU D  1 28  ? 7.887   -46.376 41.370  1.00 24.60  ? 90  LEU D CA    1 
ATOM   7831  C C     . LEU D  1 28  ? 8.551   -45.073 40.929  1.00 24.56  ? 90  LEU D C     1 
ATOM   7832  O O     . LEU D  1 28  ? 9.626   -44.721 41.426  1.00 25.44  ? 90  LEU D O     1 
ATOM   7833  C CB    . LEU D  1 28  ? 8.164   -47.508 40.393  1.00 23.46  ? 90  LEU D CB    1 
ATOM   7834  C CG    . LEU D  1 28  ? 7.851   -48.891 40.949  1.00 22.14  ? 90  LEU D CG    1 
ATOM   7835  C CD1   . LEU D  1 28  ? 7.612   -49.875 39.821  1.00 22.01  ? 90  LEU D CD1   1 
ATOM   7836  C CD2   . LEU D  1 28  ? 8.962   -49.365 41.864  1.00 21.49  ? 90  LEU D CD2   1 
ATOM   7837  N N     . LYS D  1 29  ? 7.902   -44.329 40.043  1.00 23.70  ? 91  LYS D N     1 
ATOM   7838  C CA    . LYS D  1 29  ? 8.480   -43.091 39.562  1.00 23.36  ? 91  LYS D CA    1 
ATOM   7839  C C     . LYS D  1 29  ? 8.442   -41.991 40.602  1.00 24.26  ? 91  LYS D C     1 
ATOM   7840  O O     . LYS D  1 29  ? 9.066   -40.960 40.400  1.00 26.30  ? 91  LYS D O     1 
ATOM   7841  C CB    . LYS D  1 29  ? 7.809   -42.649 38.278  1.00 23.55  ? 91  LYS D CB    1 
ATOM   7842  C CG    . LYS D  1 29  ? 8.216   -43.482 37.077  1.00 24.16  ? 91  LYS D CG    1 
ATOM   7843  C CD    . LYS D  1 29  ? 7.564   -42.959 35.809  1.00 25.22  ? 91  LYS D CD    1 
ATOM   7844  C CE    . LYS D  1 29  ? 8.137   -43.613 34.562  1.00 26.40  ? 91  LYS D CE    1 
ATOM   7845  N NZ    . LYS D  1 29  ? 7.216   -43.493 33.397  1.00 27.46  ? 91  LYS D NZ    1 
ATOM   7846  N N     . ASP D  1 30  ? 7.717   -42.194 41.707  1.00 25.38  ? 92  ASP D N     1 
ATOM   7847  C CA    . ASP D  1 30  ? 7.807   -41.310 42.876  1.00 25.45  ? 92  ASP D CA    1 
ATOM   7848  C C     . ASP D  1 30  ? 9.123   -41.553 43.577  1.00 25.69  ? 92  ASP D C     1 
ATOM   7849  O O     . ASP D  1 30  ? 9.236   -42.465 44.421  1.00 24.11  ? 92  ASP D O     1 
ATOM   7850  C CB    . ASP D  1 30  ? 6.650   -41.551 43.846  1.00 26.47  ? 92  ASP D CB    1 
ATOM   7851  C CG    . ASP D  1 30  ? 6.622   -40.540 45.006  1.00 28.34  ? 92  ASP D CG    1 
ATOM   7852  O OD1   . ASP D  1 30  ? 7.629   -39.783 45.187  1.00 31.38  ? 92  ASP D OD1   1 
ATOM   7853  O OD2   . ASP D  1 30  ? 5.590   -40.505 45.734  1.00 25.39  ? 92  ASP D OD2   1 
ATOM   7854  N N     . GLU D  1 31  ? 10.115  -40.733 43.208  1.00 26.47  ? 93  GLU D N     1 
ATOM   7855  C CA    . GLU D  1 31  ? 11.483  -40.906 43.687  1.00 26.13  ? 93  GLU D CA    1 
ATOM   7856  C C     . GLU D  1 31  ? 11.552  -40.587 45.176  1.00 24.68  ? 93  GLU D C     1 
ATOM   7857  O O     . GLU D  1 31  ? 12.199  -41.307 45.925  1.00 25.03  ? 93  GLU D O     1 
ATOM   7858  C CB    . GLU D  1 31  ? 12.477  -40.048 42.893  1.00 28.41  ? 93  GLU D CB    1 
ATOM   7859  C CG    . GLU D  1 31  ? 12.657  -40.464 41.433  1.00 30.19  ? 93  GLU D CG    1 
ATOM   7860  C CD    . GLU D  1 31  ? 13.687  -39.629 40.668  1.00 31.48  ? 93  GLU D CD    1 
ATOM   7861  O OE1   . GLU D  1 31  ? 13.530  -39.480 39.441  1.00 32.85  ? 93  GLU D OE1   1 
ATOM   7862  O OE2   . GLU D  1 31  ? 14.655  -39.118 41.277  1.00 31.69  ? 93  GLU D OE2   1 
ATOM   7863  N N     . VAL D  1 32  ? 10.847  -39.559 45.630  1.00 22.56  ? 94  VAL D N     1 
ATOM   7864  C CA    . VAL D  1 32  ? 10.835  -39.290 47.048  1.00 21.55  ? 94  VAL D CA    1 
ATOM   7865  C C     . VAL D  1 32  ? 10.445  -40.550 47.789  1.00 21.20  ? 94  VAL D C     1 
ATOM   7866  O O     . VAL D  1 32  ? 11.135  -40.963 48.710  1.00 20.66  ? 94  VAL D O     1 
ATOM   7867  C CB    . VAL D  1 32  ? 9.862   -38.177 47.431  1.00 21.80  ? 94  VAL D CB    1 
ATOM   7868  C CG1   . VAL D  1 32  ? 9.747   -38.060 48.947  1.00 21.64  ? 94  VAL D CG1   1 
ATOM   7869  C CG2   . VAL D  1 32  ? 10.333  -36.858 46.850  1.00 22.16  ? 94  VAL D CG2   1 
ATOM   7870  N N     . ARG D  1 33  ? 9.341   -41.161 47.388  1.00 21.25  ? 95  ARG D N     1 
ATOM   7871  C CA    . ARG D  1 33  ? 8.833   -42.318 48.105  1.00 22.34  ? 95  ARG D CA    1 
ATOM   7872  C C     . ARG D  1 33  ? 9.820   -43.442 48.060  1.00 23.25  ? 95  ARG D C     1 
ATOM   7873  O O     . ARG D  1 33  ? 10.296  -43.903 49.095  1.00 25.08  ? 95  ARG D O     1 
ATOM   7874  C CB    . ARG D  1 33  ? 7.512   -42.785 47.508  1.00 22.65  ? 95  ARG D CB    1 
ATOM   7875  C CG    . ARG D  1 33  ? 6.838   -43.960 48.202  1.00 22.67  ? 95  ARG D CG    1 
ATOM   7876  C CD    . ARG D  1 33  ? 5.803   -44.554 47.276  1.00 23.52  ? 95  ARG D CD    1 
ATOM   7877  N NE    . ARG D  1 33  ? 6.474   -45.428 46.310  1.00 25.73  ? 95  ARG D NE    1 
ATOM   7878  C CZ    . ARG D  1 33  ? 6.365   -46.763 46.258  1.00 28.03  ? 95  ARG D CZ    1 
ATOM   7879  N NH1   . ARG D  1 33  ? 5.572   -47.398 47.095  1.00 28.56  ? 95  ARG D NH1   1 
ATOM   7880  N NH2   . ARG D  1 33  ? 7.038   -47.472 45.342  1.00 28.27  ? 95  ARG D NH2   1 
ATOM   7881  N N     . THR D  1 34  ? 10.131  -43.880 46.852  1.00 23.52  ? 96  THR D N     1 
ATOM   7882  C CA    . THR D  1 34  ? 10.905  -45.099 46.659  1.00 23.09  ? 96  THR D CA    1 
ATOM   7883  C C     . THR D  1 34  ? 12.355  -44.969 47.132  1.00 22.67  ? 96  THR D C     1 
ATOM   7884  O O     . THR D  1 34  ? 12.894  -45.892 47.732  1.00 22.95  ? 96  THR D O     1 
ATOM   7885  C CB    . THR D  1 34  ? 10.874  -45.486 45.175  1.00 23.39  ? 96  THR D CB    1 
ATOM   7886  O OG1   . THR D  1 34  ? 9.536   -45.311 44.672  1.00 23.03  ? 96  THR D OG1   1 
ATOM   7887  C CG2   . THR D  1 34  ? 11.397  -46.937 44.962  1.00 23.12  ? 96  THR D CG2   1 
ATOM   7888  N N     . LEU D  1 35  ? 12.993  -43.838 46.851  1.00 22.32  ? 97  LEU D N     1 
ATOM   7889  C CA    . LEU D  1 35  ? 14.381  -43.645 47.284  1.00 22.79  ? 97  LEU D CA    1 
ATOM   7890  C C     . LEU D  1 35  ? 14.498  -43.635 48.800  1.00 23.49  ? 97  LEU D C     1 
ATOM   7891  O O     . LEU D  1 35  ? 15.504  -44.124 49.349  1.00 23.31  ? 97  LEU D O     1 
ATOM   7892  C CB    . LEU D  1 35  ? 15.008  -42.360 46.715  1.00 21.76  ? 97  LEU D CB    1 
ATOM   7893  C CG    . LEU D  1 35  ? 15.504  -42.450 45.283  1.00 21.44  ? 97  LEU D CG    1 
ATOM   7894  C CD1   . LEU D  1 35  ? 16.122  -41.116 44.926  1.00 21.39  ? 97  LEU D CD1   1 
ATOM   7895  C CD2   . LEU D  1 35  ? 16.516  -43.571 45.112  1.00 21.54  ? 97  LEU D CD2   1 
ATOM   7896  N N     . THR D  1 36  ? 13.488  -43.068 49.467  1.00 23.47  ? 98  THR D N     1 
ATOM   7897  C CA    . THR D  1 36  ? 13.489  -43.042 50.916  1.00 24.13  ? 98  THR D CA    1 
ATOM   7898  C C     . THR D  1 36  ? 13.475  -44.484 51.390  1.00 25.47  ? 98  THR D C     1 
ATOM   7899  O O     . THR D  1 36  ? 14.366  -44.877 52.159  1.00 26.95  ? 98  THR D O     1 
ATOM   7900  C CB    . THR D  1 36  ? 12.359  -42.172 51.538  1.00 23.77  ? 98  THR D CB    1 
ATOM   7901  O OG1   . THR D  1 36  ? 12.596  -40.789 51.222  1.00 22.87  ? 98  THR D OG1   1 
ATOM   7902  C CG2   . THR D  1 36  ? 12.342  -42.300 53.062  1.00 23.49  ? 98  THR D CG2   1 
ATOM   7903  N N     . TYR D  1 37  ? 12.524  -45.282 50.901  1.00 26.03  ? 99  TYR D N     1 
ATOM   7904  C CA    . TYR D  1 37  ? 12.485  -46.707 51.256  1.00 27.42  ? 99  TYR D CA    1 
ATOM   7905  C C     . TYR D  1 37  ? 13.796  -47.422 50.966  1.00 28.80  ? 99  TYR D C     1 
ATOM   7906  O O     . TYR D  1 37  ? 14.234  -48.272 51.743  1.00 28.60  ? 99  TYR D O     1 
ATOM   7907  C CB    . TYR D  1 37  ? 11.389  -47.445 50.509  1.00 27.62  ? 99  TYR D CB    1 
ATOM   7908  C CG    . TYR D  1 37  ? 10.068  -47.444 51.214  1.00 28.01  ? 99  TYR D CG    1 
ATOM   7909  C CD1   . TYR D  1 37  ? 9.140   -46.431 50.985  1.00 27.47  ? 99  TYR D CD1   1 
ATOM   7910  C CD2   . TYR D  1 37  ? 9.731   -48.469 52.093  1.00 27.75  ? 99  TYR D CD2   1 
ATOM   7911  C CE1   . TYR D  1 37  ? 7.917   -46.435 51.616  1.00 27.91  ? 99  TYR D CE1   1 
ATOM   7912  C CE2   . TYR D  1 37  ? 8.501   -48.482 52.728  1.00 28.06  ? 99  TYR D CE2   1 
ATOM   7913  C CZ    . TYR D  1 37  ? 7.603   -47.462 52.489  1.00 28.08  ? 99  TYR D CZ    1 
ATOM   7914  O OH    . TYR D  1 37  ? 6.387   -47.460 53.124  1.00 28.07  ? 99  TYR D OH    1 
ATOM   7915  N N     . ARG D  1 38  ? 14.416  -47.098 49.839  1.00 30.18  ? 100 ARG D N     1 
ATOM   7916  C CA    . ARG D  1 38  ? 15.647  -47.761 49.505  1.00 31.71  ? 100 ARG D CA    1 
ATOM   7917  C C     . ARG D  1 38  ? 16.748  -47.341 50.471  1.00 31.22  ? 100 ARG D C     1 
ATOM   7918  O O     . ARG D  1 38  ? 17.435  -48.186 51.042  1.00 31.55  ? 100 ARG D O     1 
ATOM   7919  C CB    . ARG D  1 38  ? 16.059  -47.507 48.059  1.00 33.22  ? 100 ARG D CB    1 
ATOM   7920  C CG    . ARG D  1 38  ? 17.092  -48.535 47.589  1.00 34.66  ? 100 ARG D CG    1 
ATOM   7921  C CD    . ARG D  1 38  ? 17.744  -48.127 46.293  1.00 35.15  ? 100 ARG D CD    1 
ATOM   7922  N NE    . ARG D  1 38  ? 18.382  -46.830 46.476  1.00 36.11  ? 100 ARG D NE    1 
ATOM   7923  C CZ    . ARG D  1 38  ? 18.961  -46.150 45.502  1.00 35.08  ? 100 ARG D CZ    1 
ATOM   7924  N NH1   . ARG D  1 38  ? 18.991  -46.674 44.281  1.00 36.01  ? 100 ARG D NH1   1 
ATOM   7925  N NH2   . ARG D  1 38  ? 19.512  -44.960 45.755  1.00 32.98  ? 100 ARG D NH2   1 
ATOM   7926  N N     . ASN D  1 39  ? 16.899  -46.041 50.673  1.00 30.57  ? 101 ASN D N     1 
ATOM   7927  C CA    . ASN D  1 39  ? 17.932  -45.540 51.566  1.00 29.42  ? 101 ASN D CA    1 
ATOM   7928  C C     . ASN D  1 39  ? 17.751  -46.013 52.993  1.00 27.98  ? 101 ASN D C     1 
ATOM   7929  O O     . ASN D  1 39  ? 18.714  -46.288 53.675  1.00 27.59  ? 101 ASN D O     1 
ATOM   7930  C CB    . ASN D  1 39  ? 17.930  -44.026 51.574  1.00 29.34  ? 101 ASN D CB    1 
ATOM   7931  C CG    . ASN D  1 39  ? 18.409  -43.413 50.270  1.00 27.81  ? 101 ASN D CG    1 
ATOM   7932  O OD1   . ASN D  1 39  ? 18.517  -42.203 50.204  1.00 27.90  ? 101 ASN D OD1   1 
ATOM   7933  N ND2   . ASN D  1 39  ? 18.724  -44.218 49.258  1.00 26.54  ? 101 ASN D ND2   1 
ATOM   7934  N N     . SER D  1 40  ? 16.518  -46.138 53.439  1.00 28.04  ? 102 SER D N     1 
ATOM   7935  C CA    . SER D  1 40  ? 16.275  -46.650 54.780  1.00 29.23  ? 102 SER D CA    1 
ATOM   7936  C C     . SER D  1 40  ? 16.870  -48.053 54.964  1.00 28.63  ? 102 SER D C     1 
ATOM   7937  O O     . SER D  1 40  ? 17.236  -48.422 56.075  1.00 28.87  ? 102 SER D O     1 
ATOM   7938  C CB    . SER D  1 40  ? 14.778  -46.703 55.086  1.00 29.59  ? 102 SER D CB    1 
ATOM   7939  O OG    . SER D  1 40  ? 14.187  -47.815 54.429  1.00 31.18  ? 102 SER D OG    1 
ATOM   7940  N N     . MET D  1 41  ? 16.951  -48.839 53.892  1.00 27.53  ? 103 MET D N     1 
ATOM   7941  C CA    . MET D  1 41  ? 17.526  -50.176 53.983  1.00 27.04  ? 103 MET D CA    1 
ATOM   7942  C C     . MET D  1 41  ? 19.002  -50.137 53.636  1.00 26.24  ? 103 MET D C     1 
ATOM   7943  O O     . MET D  1 41  ? 19.817  -50.577 54.423  1.00 27.28  ? 103 MET D O     1 
ATOM   7944  C CB    . MET D  1 41  ? 16.776  -51.164 53.086  1.00 27.16  ? 103 MET D CB    1 
ATOM   7945  C CG    . MET D  1 41  ? 15.269  -51.107 53.281  1.00 27.40  ? 103 MET D CG    1 
ATOM   7946  S SD    . MET D  1 41  ? 14.373  -52.384 52.385  1.00 27.88  ? 103 MET D SD    1 
ATOM   7947  C CE    . MET D  1 41  ? 12.778  -51.610 52.169  1.00 27.45  ? 103 MET D CE    1 
ATOM   7948  N N     . TYR D  1 42  ? 19.344  -49.601 52.473  1.00 25.34  ? 104 TYR D N     1 
ATOM   7949  C CA    . TYR D  1 42  ? 20.729  -49.581 52.008  1.00 25.05  ? 104 TYR D CA    1 
ATOM   7950  C C     . TYR D  1 42  ? 21.694  -48.863 52.981  1.00 25.77  ? 104 TYR D C     1 
ATOM   7951  O O     . TYR D  1 42  ? 22.828  -49.330 53.214  1.00 26.87  ? 104 TYR D O     1 
ATOM   7952  C CB    . TYR D  1 42  ? 20.811  -48.941 50.610  1.00 24.71  ? 104 TYR D CB    1 
ATOM   7953  C CG    . TYR D  1 42  ? 20.355  -49.795 49.449  1.00 23.45  ? 104 TYR D CG    1 
ATOM   7954  C CD1   . TYR D  1 42  ? 19.527  -50.893 49.636  1.00 23.90  ? 104 TYR D CD1   1 
ATOM   7955  C CD2   . TYR D  1 42  ? 20.758  -49.496 48.151  1.00 22.67  ? 104 TYR D CD2   1 
ATOM   7956  C CE1   . TYR D  1 42  ? 19.120  -51.674 48.562  1.00 24.17  ? 104 TYR D CE1   1 
ATOM   7957  C CE2   . TYR D  1 42  ? 20.362  -50.275 47.078  1.00 23.09  ? 104 TYR D CE2   1 
ATOM   7958  C CZ    . TYR D  1 42  ? 19.534  -51.362 47.288  1.00 23.25  ? 104 TYR D CZ    1 
ATOM   7959  O OH    . TYR D  1 42  ? 19.109  -52.151 46.246  1.00 22.49  ? 104 TYR D OH    1 
ATOM   7960  N N     . HIS D  1 43  ? 21.242  -47.753 53.563  1.00 26.36  ? 105 HIS D N     1 
ATOM   7961  C CA    . HIS D  1 43  ? 22.052  -47.012 54.549  1.00 26.83  ? 105 HIS D CA    1 
ATOM   7962  C C     . HIS D  1 43  ? 22.037  -47.618 55.954  1.00 25.73  ? 105 HIS D C     1 
ATOM   7963  O O     . HIS D  1 43  ? 22.658  -47.075 56.856  1.00 24.80  ? 105 HIS D O     1 
ATOM   7964  C CB    . HIS D  1 43  ? 21.574  -45.571 54.699  1.00 27.73  ? 105 HIS D CB    1 
ATOM   7965  C CG    . HIS D  1 43  ? 21.651  -44.753 53.446  1.00 28.08  ? 105 HIS D CG    1 
ATOM   7966  N ND1   . HIS D  1 43  ? 21.411  -43.393 53.439  1.00 28.11  ? 105 HIS D ND1   1 
ATOM   7967  C CD2   . HIS D  1 43  ? 21.947  -45.091 52.170  1.00 28.12  ? 105 HIS D CD2   1 
ATOM   7968  C CE1   . HIS D  1 43  ? 21.540  -42.932 52.208  1.00 27.95  ? 105 HIS D CE1   1 
ATOM   7969  N NE2   . HIS D  1 43  ? 21.864  -43.941 51.420  1.00 28.29  ? 105 HIS D NE2   1 
ATOM   7970  N N     . ASN D  1 44  ? 21.326  -48.719 56.151  1.00 25.55  ? 106 ASN D N     1 
ATOM   7971  C CA    . ASN D  1 44  ? 21.329  -49.400 57.433  1.00 25.79  ? 106 ASN D CA    1 
ATOM   7972  C C     . ASN D  1 44  ? 21.359  -50.901 57.272  1.00 25.78  ? 106 ASN D C     1 
ATOM   7973  O O     . ASN D  1 44  ? 20.523  -51.608 57.831  1.00 25.97  ? 106 ASN D O     1 
ATOM   7974  C CB    . ASN D  1 44  ? 20.111  -48.966 58.226  1.00 26.33  ? 106 ASN D CB    1 
ATOM   7975  C CG    . ASN D  1 44  ? 19.988  -47.462 58.290  1.00 26.98  ? 106 ASN D CG    1 
ATOM   7976  O OD1   . ASN D  1 44  ? 19.056  -46.891 57.763  1.00 28.30  ? 106 ASN D OD1   1 
ATOM   7977  N ND2   . ASN D  1 44  ? 20.971  -46.818 58.867  1.00 27.70  ? 106 ASN D ND2   1 
ATOM   7978  N N     . LYS D  1 45  ? 22.329  -51.382 56.499  1.00 26.10  ? 107 LYS D N     1 
ATOM   7979  C CA    . LYS D  1 45  ? 22.511  -52.816 56.284  1.00 27.08  ? 107 LYS D CA    1 
ATOM   7980  C C     . LYS D  1 45  ? 22.683  -53.618 57.578  1.00 27.46  ? 107 LYS D C     1 
ATOM   7981  O O     . LYS D  1 45  ? 22.315  -54.812 57.643  1.00 27.52  ? 107 LYS D O     1 
ATOM   7982  C CB    . LYS D  1 45  ? 23.706  -53.038 55.380  1.00 27.73  ? 107 LYS D CB    1 
ATOM   7983  C CG    . LYS D  1 45  ? 23.360  -52.841 53.932  1.00 28.83  ? 107 LYS D CG    1 
ATOM   7984  C CD    . LYS D  1 45  ? 24.543  -52.363 53.146  1.00 30.57  ? 107 LYS D CD    1 
ATOM   7985  C CE    . LYS D  1 45  ? 24.148  -52.269 51.694  1.00 32.46  ? 107 LYS D CE    1 
ATOM   7986  N NZ    . LYS D  1 45  ? 24.667  -50.998 51.150  1.00 34.89  ? 107 LYS D NZ    1 
ATOM   7987  N N     . HIS D  1 46  ? 23.232  -52.955 58.597  1.00 26.93  ? 108 HIS D N     1 
ATOM   7988  C CA    . HIS D  1 46  ? 23.441  -53.567 59.900  1.00 27.71  ? 108 HIS D CA    1 
ATOM   7989  C C     . HIS D  1 46  ? 22.139  -54.067 60.490  1.00 27.84  ? 108 HIS D C     1 
ATOM   7990  O O     . HIS D  1 46  ? 22.136  -55.020 61.259  1.00 28.67  ? 108 HIS D O     1 
ATOM   7991  C CB    . HIS D  1 46  ? 24.154  -52.606 60.877  1.00 28.03  ? 108 HIS D CB    1 
ATOM   7992  C CG    . HIS D  1 46  ? 23.365  -51.368 61.226  1.00 29.03  ? 108 HIS D CG    1 
ATOM   7993  N ND1   . HIS D  1 46  ? 23.362  -50.228 60.445  1.00 28.44  ? 108 HIS D ND1   1 
ATOM   7994  C CD2   . HIS D  1 46  ? 22.579  -51.086 62.295  1.00 29.48  ? 108 HIS D CD2   1 
ATOM   7995  C CE1   . HIS D  1 46  ? 22.596  -49.309 61.010  1.00 28.11  ? 108 HIS D CE1   1 
ATOM   7996  N NE2   . HIS D  1 46  ? 22.103  -49.804 62.130  1.00 28.37  ? 108 HIS D NE2   1 
ATOM   7997  N N     . VAL D  1 47  ? 21.037  -53.430 60.125  1.00 27.98  ? 109 VAL D N     1 
ATOM   7998  C CA    . VAL D  1 47  ? 19.735  -53.828 60.618  1.00 28.72  ? 109 VAL D CA    1 
ATOM   7999  C C     . VAL D  1 47  ? 19.236  -55.081 59.904  1.00 28.92  ? 109 VAL D C     1 
ATOM   8000  O O     . VAL D  1 47  ? 18.560  -55.915 60.513  1.00 28.37  ? 109 VAL D O     1 
ATOM   8001  C CB    . VAL D  1 47  ? 18.723  -52.680 60.463  1.00 28.73  ? 109 VAL D CB    1 
ATOM   8002  C CG1   . VAL D  1 47  ? 17.336  -53.106 60.916  1.00 29.14  ? 109 VAL D CG1   1 
ATOM   8003  C CG2   . VAL D  1 47  ? 19.183  -51.486 61.274  1.00 28.52  ? 109 VAL D CG2   1 
ATOM   8004  N N     . PHE D  1 48  ? 19.594  -55.212 58.633  1.00 30.32  ? 110 PHE D N     1 
ATOM   8005  C CA    . PHE D  1 48  ? 19.053  -56.258 57.782  1.00 33.03  ? 110 PHE D CA    1 
ATOM   8006  C C     . PHE D  1 48  ? 19.924  -57.491 57.664  1.00 34.74  ? 110 PHE D C     1 
ATOM   8007  O O     . PHE D  1 48  ? 19.410  -58.563 57.327  1.00 34.32  ? 110 PHE D O     1 
ATOM   8008  C CB    . PHE D  1 48  ? 18.755  -55.691 56.391  1.00 34.81  ? 110 PHE D CB    1 
ATOM   8009  C CG    . PHE D  1 48  ? 17.574  -54.736 56.379  1.00 36.47  ? 110 PHE D CG    1 
ATOM   8010  C CD1   . PHE D  1 48  ? 17.732  -53.378 56.673  1.00 35.35  ? 110 PHE D CD1   1 
ATOM   8011  C CD2   . PHE D  1 48  ? 16.285  -55.218 56.129  1.00 36.65  ? 110 PHE D CD2   1 
ATOM   8012  C CE1   . PHE D  1 48  ? 16.632  -52.535 56.697  1.00 34.16  ? 110 PHE D CE1   1 
ATOM   8013  C CE2   . PHE D  1 48  ? 15.188  -54.377 56.152  1.00 35.14  ? 110 PHE D CE2   1 
ATOM   8014  C CZ    . PHE D  1 48  ? 15.363  -53.037 56.438  1.00 34.60  ? 110 PHE D CZ    1 
ATOM   8015  N N     . LYS D  1 49  ? 21.215  -57.373 57.978  1.00 36.63  ? 111 LYS D N     1 
ATOM   8016  C CA    . LYS D  1 49  ? 22.109  -58.487 57.726  1.00 39.53  ? 111 LYS D CA    1 
ATOM   8017  C C     . LYS D  1 49  ? 21.687  -59.757 58.417  1.00 39.41  ? 111 LYS D C     1 
ATOM   8018  O O     . LYS D  1 49  ? 21.483  -59.775 59.611  1.00 39.70  ? 111 LYS D O     1 
ATOM   8019  C CB    . LYS D  1 49  ? 23.552  -58.199 58.080  1.00 43.09  ? 111 LYS D CB    1 
ATOM   8020  C CG    . LYS D  1 49  ? 24.439  -59.034 57.178  1.00 49.72  ? 111 LYS D CG    1 
ATOM   8021  C CD    . LYS D  1 49  ? 25.766  -59.405 57.780  1.00 56.76  ? 111 LYS D CD    1 
ATOM   8022  C CE    . LYS D  1 49  ? 26.449  -60.449 56.903  1.00 60.60  ? 111 LYS D CE    1 
ATOM   8023  N NZ    . LYS D  1 49  ? 27.829  -60.692 57.408  1.00 64.46  ? 111 LYS D NZ    1 
ATOM   8024  N N     . ASP D  1 50  ? 21.557  -60.817 57.628  1.00 41.73  ? 112 ASP D N     1 
ATOM   8025  C CA    . ASP D  1 50  ? 21.172  -62.157 58.090  1.00 42.91  ? 112 ASP D CA    1 
ATOM   8026  C C     . ASP D  1 50  ? 19.830  -62.213 58.818  1.00 41.42  ? 112 ASP D C     1 
ATOM   8027  O O     . ASP D  1 50  ? 19.600  -63.129 59.606  1.00 40.83  ? 112 ASP D O     1 
ATOM   8028  C CB    . ASP D  1 50  ? 22.289  -62.780 58.936  1.00 44.52  ? 112 ASP D CB    1 
ATOM   8029  C CG    . ASP D  1 50  ? 23.574  -62.967 58.145  1.00 44.99  ? 112 ASP D CG    1 
ATOM   8030  O OD1   . ASP D  1 50  ? 23.489  -63.401 56.977  1.00 42.43  ? 112 ASP D OD1   1 
ATOM   8031  O OD2   . ASP D  1 50  ? 24.661  -62.673 58.693  1.00 46.71  ? 112 ASP D OD2   1 
ATOM   8032  N N     . LYS D  1 51  ? 18.930  -61.276 58.505  1.00 40.54  ? 113 LYS D N     1 
ATOM   8033  C CA    . LYS D  1 51  ? 17.600  -61.256 59.125  1.00 40.20  ? 113 LYS D CA    1 
ATOM   8034  C C     . LYS D  1 51  ? 16.463  -61.673 58.174  1.00 36.22  ? 113 LYS D C     1 
ATOM   8035  O O     . LYS D  1 51  ? 16.647  -61.748 56.960  1.00 36.34  ? 113 LYS D O     1 
ATOM   8036  C CB    . LYS D  1 51  ? 17.346  -59.904 59.783  1.00 41.28  ? 113 LYS D CB    1 
ATOM   8037  C CG    . LYS D  1 51  ? 18.400  -59.599 60.845  1.00 44.19  ? 113 LYS D CG    1 
ATOM   8038  C CD    . LYS D  1 51  ? 18.005  -58.453 61.767  1.00 46.93  ? 113 LYS D CD    1 
ATOM   8039  C CE    . LYS D  1 51  ? 17.617  -58.918 63.161  1.00 48.45  ? 113 LYS D CE    1 
ATOM   8040  N NZ    . LYS D  1 51  ? 18.840  -59.243 63.936  1.00 49.81  ? 113 LYS D NZ    1 
ATOM   8041  N N     . VAL D  1 52  ? 15.314  -62.016 58.754  1.00 32.12  ? 114 VAL D N     1 
ATOM   8042  C CA    . VAL D  1 52  ? 14.179  -62.538 57.999  1.00 30.54  ? 114 VAL D CA    1 
ATOM   8043  C C     . VAL D  1 52  ? 13.182  -61.401 57.877  1.00 28.78  ? 114 VAL D C     1 
ATOM   8044  O O     . VAL D  1 52  ? 12.765  -60.855 58.892  1.00 27.20  ? 114 VAL D O     1 
ATOM   8045  C CB    . VAL D  1 52  ? 13.527  -63.768 58.701  1.00 30.23  ? 114 VAL D CB    1 
ATOM   8046  C CG1   . VAL D  1 52  ? 12.257  -64.204 57.978  1.00 31.27  ? 114 VAL D CG1   1 
ATOM   8047  C CG2   . VAL D  1 52  ? 14.486  -64.946 58.774  1.00 28.52  ? 114 VAL D CG2   1 
ATOM   8048  N N     . VAL D  1 53  ? 12.801  -61.054 56.642  1.00 28.82  ? 115 VAL D N     1 
ATOM   8049  C CA    . VAL D  1 53  ? 11.981  -59.853 56.367  1.00 28.24  ? 115 VAL D CA    1 
ATOM   8050  C C     . VAL D  1 53  ? 10.642  -60.193 55.719  1.00 28.08  ? 115 VAL D C     1 
ATOM   8051  O O     . VAL D  1 53  ? 10.585  -61.019 54.806  1.00 31.40  ? 115 VAL D O     1 
ATOM   8052  C CB    . VAL D  1 53  ? 12.740  -58.864 55.453  1.00 27.43  ? 115 VAL D CB    1 
ATOM   8053  C CG1   . VAL D  1 53  ? 11.961  -57.569 55.276  1.00 27.02  ? 115 VAL D CG1   1 
ATOM   8054  C CG2   . VAL D  1 53  ? 14.116  -58.561 56.033  1.00 27.38  ? 115 VAL D CG2   1 
ATOM   8055  N N     . LEU D  1 54  ? 9.574   -59.544 56.180  1.00 26.59  ? 116 LEU D N     1 
ATOM   8056  C CA    . LEU D  1 54  ? 8.265   -59.671 55.561  1.00 25.81  ? 116 LEU D CA    1 
ATOM   8057  C C     . LEU D  1 54  ? 7.920   -58.375 54.824  1.00 25.64  ? 116 LEU D C     1 
ATOM   8058  O O     . LEU D  1 54  ? 7.861   -57.329 55.429  1.00 24.92  ? 116 LEU D O     1 
ATOM   8059  C CB    . LEU D  1 54  ? 7.215   -59.975 56.624  1.00 25.37  ? 116 LEU D CB    1 
ATOM   8060  C CG    . LEU D  1 54  ? 5.761   -60.091 56.153  1.00 25.41  ? 116 LEU D CG    1 
ATOM   8061  C CD1   . LEU D  1 54  ? 5.596   -61.243 55.199  1.00 26.00  ? 116 LEU D CD1   1 
ATOM   8062  C CD2   . LEU D  1 54  ? 4.797   -60.281 57.303  1.00 25.26  ? 116 LEU D CD2   1 
ATOM   8063  N N     . ASP D  1 55  ? 7.712   -58.456 53.513  1.00 28.02  ? 117 ASP D N     1 
ATOM   8064  C CA    . ASP D  1 55  ? 7.174   -57.338 52.698  1.00 29.34  ? 117 ASP D CA    1 
ATOM   8065  C C     . ASP D  1 55  ? 5.649   -57.488 52.565  1.00 27.24  ? 117 ASP D C     1 
ATOM   8066  O O     . ASP D  1 55  ? 5.155   -58.328 51.822  1.00 25.38  ? 117 ASP D O     1 
ATOM   8067  C CB    . ASP D  1 55  ? 7.850   -57.290 51.304  1.00 31.04  ? 117 ASP D CB    1 
ATOM   8068  C CG    . ASP D  1 55  ? 7.488   -56.021 50.485  1.00 33.86  ? 117 ASP D CG    1 
ATOM   8069  O OD1   . ASP D  1 55  ? 6.645   -55.186 50.927  1.00 36.49  ? 117 ASP D OD1   1 
ATOM   8070  O OD2   . ASP D  1 55  ? 8.040   -55.870 49.362  1.00 35.72  ? 117 ASP D OD2   1 
ATOM   8071  N N     . VAL D  1 56  ? 4.918   -56.663 53.302  1.00 27.18  ? 118 VAL D N     1 
ATOM   8072  C CA    . VAL D  1 56  ? 3.456   -56.693 53.293  1.00 27.65  ? 118 VAL D CA    1 
ATOM   8073  C C     . VAL D  1 56  ? 2.963   -55.880 52.111  1.00 27.94  ? 118 VAL D C     1 
ATOM   8074  O O     . VAL D  1 56  ? 3.116   -54.650 52.069  1.00 29.07  ? 118 VAL D O     1 
ATOM   8075  C CB    . VAL D  1 56  ? 2.877   -56.131 54.602  1.00 27.91  ? 118 VAL D CB    1 
ATOM   8076  C CG1   . VAL D  1 56  ? 1.363   -56.091 54.576  1.00 27.71  ? 118 VAL D CG1   1 
ATOM   8077  C CG2   . VAL D  1 56  ? 3.349   -56.974 55.771  1.00 28.86  ? 118 VAL D CG2   1 
ATOM   8078  N N     . GLY D  1 57  ? 2.378   -56.583 51.148  1.00 28.32  ? 119 GLY D N     1 
ATOM   8079  C CA    . GLY D  1 57  ? 1.968   -55.980 49.888  1.00 28.25  ? 119 GLY D CA    1 
ATOM   8080  C C     . GLY D  1 57  ? 3.173   -55.829 49.014  1.00 27.74  ? 119 GLY D C     1 
ATOM   8081  O O     . GLY D  1 57  ? 3.559   -54.716 48.692  1.00 24.98  ? 119 GLY D O     1 
ATOM   8082  N N     . SER D  1 58  ? 3.754   -56.978 48.653  1.00 30.96  ? 120 SER D N     1 
ATOM   8083  C CA    . SER D  1 58  ? 5.041   -57.059 47.906  1.00 34.72  ? 120 SER D CA    1 
ATOM   8084  C C     . SER D  1 58  ? 5.061   -56.194 46.613  1.00 36.44  ? 120 SER D C     1 
ATOM   8085  O O     . SER D  1 58  ? 6.044   -55.473 46.316  1.00 35.29  ? 120 SER D O     1 
ATOM   8086  C CB    . SER D  1 58  ? 5.421   -58.546 47.603  1.00 33.86  ? 120 SER D CB    1 
ATOM   8087  O OG    . SER D  1 58  ? 4.777   -59.086 46.439  1.00 34.64  ? 120 SER D OG    1 
ATOM   8088  N N     . GLY D  1 59  ? 3.941   -56.273 45.891  1.00 37.25  ? 121 GLY D N     1 
ATOM   8089  C CA    . GLY D  1 59  ? 3.728   -55.585 44.637  1.00 37.62  ? 121 GLY D CA    1 
ATOM   8090  C C     . GLY D  1 59  ? 4.613   -56.132 43.544  1.00 37.80  ? 121 GLY D C     1 
ATOM   8091  O O     . GLY D  1 59  ? 4.728   -57.347 43.348  1.00 38.99  ? 121 GLY D O     1 
ATOM   8092  N N     . THR D  1 60  ? 5.216   -55.199 42.827  1.00 36.82  ? 122 THR D N     1 
ATOM   8093  C CA    . THR D  1 60  ? 6.285   -55.473 41.902  1.00 36.04  ? 122 THR D CA    1 
ATOM   8094  C C     . THR D  1 60  ? 7.411   -56.290 42.515  1.00 34.98  ? 122 THR D C     1 
ATOM   8095  O O     . THR D  1 60  ? 8.090   -57.012 41.803  1.00 35.80  ? 122 THR D O     1 
ATOM   8096  C CB    . THR D  1 60  ? 6.872   -54.143 41.431  1.00 37.04  ? 122 THR D CB    1 
ATOM   8097  O OG1   . THR D  1 60  ? 6.556   -53.128 42.403  1.00 38.81  ? 122 THR D OG1   1 
ATOM   8098  C CG2   . THR D  1 60  ? 6.264   -53.767 40.084  1.00 37.07  ? 122 THR D CG2   1 
ATOM   8099  N N     . GLY D  1 61  ? 7.604   -56.180 43.826  1.00 32.82  ? 123 GLY D N     1 
ATOM   8100  C CA    . GLY D  1 61  ? 8.686   -56.873 44.510  1.00 32.87  ? 123 GLY D CA    1 
ATOM   8101  C C     . GLY D  1 61  ? 9.834   -55.955 44.875  1.00 32.35  ? 123 GLY D C     1 
ATOM   8102  O O     . GLY D  1 61  ? 10.779  -56.369 45.535  1.00 32.18  ? 123 GLY D O     1 
ATOM   8103  N N     . ILE D  1 62  ? 9.734   -54.700 44.451  1.00 32.29  ? 124 ILE D N     1 
ATOM   8104  C CA    . ILE D  1 62  ? 10.792  -53.701 44.626  1.00 31.25  ? 124 ILE D CA    1 
ATOM   8105  C C     . ILE D  1 62  ? 11.302  -53.600 46.071  1.00 30.55  ? 124 ILE D C     1 
ATOM   8106  O O     . ILE D  1 62  ? 12.519  -53.488 46.302  1.00 28.74  ? 124 ILE D O     1 
ATOM   8107  C CB    . ILE D  1 62  ? 10.328  -52.298 44.095  1.00 31.19  ? 124 ILE D CB    1 
ATOM   8108  C CG1   . ILE D  1 62  ? 11.479  -51.299 44.044  1.00 30.39  ? 124 ILE D CG1   1 
ATOM   8109  C CG2   . ILE D  1 62  ? 9.178   -51.711 44.914  1.00 31.27  ? 124 ILE D CG2   1 
ATOM   8110  C CD1   . ILE D  1 62  ? 12.535  -51.673 43.032  1.00 31.19  ? 124 ILE D CD1   1 
ATOM   8111  N N     . LEU D  1 63  ? 10.391  -53.631 47.044  1.00 30.16  ? 125 LEU D N     1 
ATOM   8112  C CA    . LEU D  1 63  ? 10.819  -53.427 48.426  1.00 30.33  ? 125 LEU D CA    1 
ATOM   8113  C C     . LEU D  1 63  ? 11.540  -54.663 48.944  1.00 31.79  ? 125 LEU D C     1 
ATOM   8114  O O     . LEU D  1 63  ? 12.563  -54.567 49.626  1.00 34.06  ? 125 LEU D O     1 
ATOM   8115  C CB    . LEU D  1 63  ? 9.646   -53.063 49.322  1.00 29.38  ? 125 LEU D CB    1 
ATOM   8116  C CG    . LEU D  1 63  ? 9.010   -51.705 49.042  1.00 29.21  ? 125 LEU D CG    1 
ATOM   8117  C CD1   . LEU D  1 63  ? 8.003   -51.414 50.141  1.00 29.82  ? 125 LEU D CD1   1 
ATOM   8118  C CD2   . LEU D  1 63  ? 10.033  -50.586 48.957  1.00 28.59  ? 125 LEU D CD2   1 
ATOM   8119  N N     . SER D  1 64  ? 11.019  -55.829 48.590  1.00 30.83  ? 126 SER D N     1 
ATOM   8120  C CA    . SER D  1 64  ? 11.691  -57.067 48.891  1.00 29.53  ? 126 SER D CA    1 
ATOM   8121  C C     . SER D  1 64  ? 13.089  -57.127 48.262  1.00 28.20  ? 126 SER D C     1 
ATOM   8122  O O     . SER D  1 64  ? 14.033  -57.607 48.877  1.00 27.41  ? 126 SER D O     1 
ATOM   8123  C CB    . SER D  1 64  ? 10.827  -58.230 48.423  1.00 29.76  ? 126 SER D CB    1 
ATOM   8124  O OG    . SER D  1 64  ? 9.609   -58.209 49.145  1.00 30.26  ? 126 SER D OG    1 
ATOM   8125  N N     . MET D  1 65  ? 13.226  -56.638 47.040  1.00 27.82  ? 127 MET D N     1 
ATOM   8126  C CA    . MET D  1 65  ? 14.537  -56.640 46.372  1.00 28.39  ? 127 MET D CA    1 
ATOM   8127  C C     . MET D  1 65  ? 15.527  -55.669 47.031  1.00 28.75  ? 127 MET D C     1 
ATOM   8128  O O     . MET D  1 65  ? 16.734  -55.939 47.083  1.00 28.36  ? 127 MET D O     1 
ATOM   8129  C CB    . MET D  1 65  ? 14.396  -56.350 44.868  1.00 27.48  ? 127 MET D CB    1 
ATOM   8130  C CG    . MET D  1 65  ? 13.748  -57.496 44.111  1.00 27.16  ? 127 MET D CG    1 
ATOM   8131  S SD    . MET D  1 65  ? 13.824  -57.405 42.323  1.00 27.17  ? 127 MET D SD    1 
ATOM   8132  C CE    . MET D  1 65  ? 13.048  -55.820 42.022  1.00 27.16  ? 127 MET D CE    1 
ATOM   8133  N N     . PHE D  1 66  ? 15.017  -54.550 47.537  1.00 28.00  ? 128 PHE D N     1 
ATOM   8134  C CA    . PHE D  1 66  ? 15.829  -53.684 48.352  1.00 27.62  ? 128 PHE D CA    1 
ATOM   8135  C C     . PHE D  1 66  ? 16.310  -54.441 49.601  1.00 26.63  ? 128 PHE D C     1 
ATOM   8136  O O     . PHE D  1 66  ? 17.503  -54.497 49.884  1.00 26.51  ? 128 PHE D O     1 
ATOM   8137  C CB    . PHE D  1 66  ? 15.044  -52.438 48.772  1.00 28.47  ? 128 PHE D CB    1 
ATOM   8138  C CG    . PHE D  1 66  ? 14.743  -51.465 47.653  1.00 28.00  ? 128 PHE D CG    1 
ATOM   8139  C CD1   . PHE D  1 66  ? 15.459  -51.459 46.462  1.00 27.68  ? 128 PHE D CD1   1 
ATOM   8140  C CD2   . PHE D  1 66  ? 13.772  -50.487 47.848  1.00 27.49  ? 128 PHE D CD2   1 
ATOM   8141  C CE1   . PHE D  1 66  ? 15.170  -50.522 45.482  1.00 27.17  ? 128 PHE D CE1   1 
ATOM   8142  C CE2   . PHE D  1 66  ? 13.486  -49.552 46.877  1.00 26.34  ? 128 PHE D CE2   1 
ATOM   8143  C CZ    . PHE D  1 66  ? 14.187  -49.569 45.697  1.00 26.73  ? 128 PHE D CZ    1 
ATOM   8144  N N     . ALA D  1 67  ? 15.393  -55.034 50.344  1.00 25.69  ? 129 ALA D N     1 
ATOM   8145  C CA    . ALA D  1 67  ? 15.789  -55.752 51.549  1.00 27.17  ? 129 ALA D CA    1 
ATOM   8146  C C     . ALA D  1 67  ? 16.872  -56.804 51.266  1.00 28.25  ? 129 ALA D C     1 
ATOM   8147  O O     . ALA D  1 67  ? 17.869  -56.884 51.976  1.00 27.80  ? 129 ALA D O     1 
ATOM   8148  C CB    . ALA D  1 67  ? 14.580  -56.409 52.187  1.00 27.74  ? 129 ALA D CB    1 
ATOM   8149  N N     . ALA D  1 68  ? 16.663  -57.612 50.224  1.00 30.48  ? 130 ALA D N     1 
ATOM   8150  C CA    . ALA D  1 68  ? 17.616  -58.661 49.828  1.00 29.95  ? 130 ALA D CA    1 
ATOM   8151  C C     . ALA D  1 68  ? 18.983  -58.058 49.570  1.00 28.72  ? 130 ALA D C     1 
ATOM   8152  O O     . ALA D  1 68  ? 19.980  -58.581 50.039  1.00 27.95  ? 130 ALA D O     1 
ATOM   8153  C CB    . ALA D  1 68  ? 17.115  -59.426 48.604  1.00 29.68  ? 130 ALA D CB    1 
ATOM   8154  N N     . LYS D  1 69  ? 19.006  -56.928 48.874  1.00 29.30  ? 131 LYS D N     1 
ATOM   8155  C CA    . LYS D  1 69  ? 20.244  -56.218 48.606  1.00 30.86  ? 131 LYS D CA    1 
ATOM   8156  C C     . LYS D  1 69  ? 20.861  -55.573 49.837  1.00 30.25  ? 131 LYS D C     1 
ATOM   8157  O O     . LYS D  1 69  ? 22.041  -55.320 49.851  1.00 31.15  ? 131 LYS D O     1 
ATOM   8158  C CB    . LYS D  1 69  ? 20.052  -55.160 47.519  1.00 32.67  ? 131 LYS D CB    1 
ATOM   8159  C CG    . LYS D  1 69  ? 20.000  -55.731 46.103  1.00 35.35  ? 131 LYS D CG    1 
ATOM   8160  C CD    . LYS D  1 69  ? 21.311  -56.377 45.688  1.00 38.08  ? 131 LYS D CD    1 
ATOM   8161  C CE    . LYS D  1 69  ? 21.433  -56.496 44.174  1.00 41.95  ? 131 LYS D CE    1 
ATOM   8162  N NZ    . LYS D  1 69  ? 22.414  -57.574 43.822  1.00 46.08  ? 131 LYS D NZ    1 
ATOM   8163  N N     . ALA D  1 70  ? 20.086  -55.310 50.874  1.00 30.79  ? 132 ALA D N     1 
ATOM   8164  C CA    . ALA D  1 70  ? 20.657  -54.838 52.143  1.00 30.16  ? 132 ALA D CA    1 
ATOM   8165  C C     . ALA D  1 70  ? 21.221  -55.994 52.997  1.00 29.41  ? 132 ALA D C     1 
ATOM   8166  O O     . ALA D  1 70  ? 21.764  -55.764 54.092  1.00 28.00  ? 132 ALA D O     1 
ATOM   8167  C CB    . ALA D  1 70  ? 19.610  -54.052 52.921  1.00 30.35  ? 132 ALA D CB    1 
ATOM   8168  N N     . GLY D  1 71  ? 21.062  -57.228 52.504  1.00 29.53  ? 133 GLY D N     1 
ATOM   8169  C CA    . GLY D  1 71  ? 21.665  -58.417 53.112  1.00 29.74  ? 133 GLY D CA    1 
ATOM   8170  C C     . GLY D  1 71  ? 20.764  -59.270 53.976  1.00 28.80  ? 133 GLY D C     1 
ATOM   8171  O O     . GLY D  1 71  ? 21.243  -59.945 54.864  1.00 28.39  ? 133 GLY D O     1 
ATOM   8172  N N     . ALA D  1 72  ? 19.469  -59.260 53.721  1.00 29.09  ? 134 ALA D N     1 
ATOM   8173  C CA    . ALA D  1 72  ? 18.554  -60.118 54.461  1.00 29.70  ? 134 ALA D CA    1 
ATOM   8174  C C     . ALA D  1 72  ? 18.790  -61.590 54.133  1.00 31.53  ? 134 ALA D C     1 
ATOM   8175  O O     . ALA D  1 72  ? 19.053  -61.939 53.007  1.00 30.35  ? 134 ALA D O     1 
ATOM   8176  C CB    . ALA D  1 72  ? 17.132  -59.744 54.122  1.00 29.50  ? 134 ALA D CB    1 
ATOM   8177  N N     . LYS D  1 73  ? 18.674  -62.456 55.120  1.00 37.16  ? 135 LYS D N     1 
ATOM   8178  C CA    . LYS D  1 73  ? 18.882  -63.883 54.908  1.00 43.71  ? 135 LYS D CA    1 
ATOM   8179  C C     . LYS D  1 73  ? 17.767  -64.422 54.022  1.00 43.56  ? 135 LYS D C     1 
ATOM   8180  O O     . LYS D  1 73  ? 18.027  -65.151 53.082  1.00 44.14  ? 135 LYS D O     1 
ATOM   8181  C CB    . LYS D  1 73  ? 18.883  -64.623 56.256  1.00 49.70  ? 135 LYS D CB    1 
ATOM   8182  C CG    . LYS D  1 73  ? 19.376  -66.070 56.207  1.00 56.26  ? 135 LYS D CG    1 
ATOM   8183  C CD    . LYS D  1 73  ? 18.427  -67.062 56.912  1.00 62.52  ? 135 LYS D CD    1 
ATOM   8184  C CE    . LYS D  1 73  ? 18.098  -66.720 58.376  1.00 63.04  ? 135 LYS D CE    1 
ATOM   8185  N NZ    . LYS D  1 73  ? 19.259  -66.856 59.295  1.00 64.04  ? 135 LYS D NZ    1 
ATOM   8186  N N     . LYS D  1 74  ? 16.529  -64.078 54.368  1.00 44.87  ? 136 LYS D N     1 
ATOM   8187  C CA    . LYS D  1 74  ? 15.331  -64.486 53.632  1.00 46.89  ? 136 LYS D CA    1 
ATOM   8188  C C     . LYS D  1 74  ? 14.350  -63.305 53.598  1.00 44.91  ? 136 LYS D C     1 
ATOM   8189  O O     . LYS D  1 74  ? 14.291  -62.499 54.528  1.00 43.03  ? 136 LYS D O     1 
ATOM   8190  C CB    . LYS D  1 74  ? 14.638  -65.693 54.308  1.00 51.45  ? 136 LYS D CB    1 
ATOM   8191  C CG    . LYS D  1 74  ? 15.289  -67.068 54.123  1.00 54.66  ? 136 LYS D CG    1 
ATOM   8192  C CD    . LYS D  1 74  ? 14.505  -68.001 53.184  1.00 57.92  ? 136 LYS D CD    1 
ATOM   8193  C CE    . LYS D  1 74  ? 14.340  -67.409 51.787  1.00 58.65  ? 136 LYS D CE    1 
ATOM   8194  N NZ    . LYS D  1 74  ? 14.319  -68.422 50.695  1.00 57.62  ? 136 LYS D NZ    1 
ATOM   8195  N N     . VAL D  1 75  ? 13.578  -63.210 52.525  1.00 43.33  ? 137 VAL D N     1 
ATOM   8196  C CA    . VAL D  1 75  ? 12.537  -62.201 52.409  1.00 42.74  ? 137 VAL D CA    1 
ATOM   8197  C C     . VAL D  1 75  ? 11.274  -62.893 51.936  1.00 41.30  ? 137 VAL D C     1 
ATOM   8198  O O     . VAL D  1 75  ? 11.287  -63.671 50.978  1.00 40.32  ? 137 VAL D O     1 
ATOM   8199  C CB    . VAL D  1 75  ? 12.910  -61.078 51.407  1.00 43.34  ? 137 VAL D CB    1 
ATOM   8200  C CG1   . VAL D  1 75  ? 11.824  -60.017 51.340  1.00 43.41  ? 137 VAL D CG1   1 
ATOM   8201  C CG2   . VAL D  1 75  ? 14.227  -60.428 51.793  1.00 43.45  ? 137 VAL D CG2   1 
ATOM   8202  N N     . PHE D  1 76  ? 10.178  -62.610 52.615  1.00 41.08  ? 138 PHE D N     1 
ATOM   8203  C CA    . PHE D  1 76  ? 8.893   -63.101 52.173  1.00 42.29  ? 138 PHE D CA    1 
ATOM   8204  C C     . PHE D  1 76  ? 8.032   -61.924 51.752  1.00 39.63  ? 138 PHE D C     1 
ATOM   8205  O O     . PHE D  1 76  ? 7.888   -60.969 52.495  1.00 37.14  ? 138 PHE D O     1 
ATOM   8206  C CB    . PHE D  1 76  ? 8.211   -63.889 53.290  1.00 42.85  ? 138 PHE D CB    1 
ATOM   8207  C CG    . PHE D  1 76  ? 9.052   -64.995 53.858  1.00 41.71  ? 138 PHE D CG    1 
ATOM   8208  C CD1   . PHE D  1 76  ? 9.794   -65.820 53.035  1.00 41.88  ? 138 PHE D CD1   1 
ATOM   8209  C CD2   . PHE D  1 76  ? 9.070   -65.222 55.217  1.00 41.86  ? 138 PHE D CD2   1 
ATOM   8210  C CE1   . PHE D  1 76  ? 10.549  -66.841 53.562  1.00 42.11  ? 138 PHE D CE1   1 
ATOM   8211  C CE2   . PHE D  1 76  ? 9.814   -66.244 55.750  1.00 42.13  ? 138 PHE D CE2   1 
ATOM   8212  C CZ    . PHE D  1 76  ? 10.554  -67.055 54.922  1.00 42.07  ? 138 PHE D CZ    1 
ATOM   8213  N N     . GLY D  1 77  ? 7.466   -62.007 50.555  1.00 38.54  ? 139 GLY D N     1 
ATOM   8214  C CA    . GLY D  1 77  ? 6.514   -61.012 50.084  1.00 38.90  ? 139 GLY D CA    1 
ATOM   8215  C C     . GLY D  1 77  ? 5.125   -61.596 49.927  1.00 38.26  ? 139 GLY D C     1 
ATOM   8216  O O     . GLY D  1 77  ? 4.953   -62.644 49.305  1.00 38.25  ? 139 GLY D O     1 
ATOM   8217  N N     . ILE D  1 78  ? 4.131   -60.920 50.489  1.00 37.91  ? 140 ILE D N     1 
ATOM   8218  C CA    . ILE D  1 78  ? 2.753   -61.338 50.314  1.00 39.39  ? 140 ILE D CA    1 
ATOM   8219  C C     . ILE D  1 78  ? 2.041   -60.314 49.432  1.00 40.88  ? 140 ILE D C     1 
ATOM   8220  O O     . ILE D  1 78  ? 2.207   -59.097 49.614  1.00 38.11  ? 140 ILE D O     1 
ATOM   8221  C CB    . ILE D  1 78  ? 2.007   -61.511 51.650  1.00 38.82  ? 140 ILE D CB    1 
ATOM   8222  C CG1   . ILE D  1 78  ? 2.758   -62.480 52.567  1.00 38.05  ? 140 ILE D CG1   1 
ATOM   8223  C CG2   . ILE D  1 78  ? 0.597   -62.044 51.399  1.00 38.71  ? 140 ILE D CG2   1 
ATOM   8224  C CD1   . ILE D  1 78  ? 2.286   -62.451 54.006  1.00 36.94  ? 140 ILE D CD1   1 
ATOM   8225  N N     . GLU D  1 79  ? 1.259   -60.836 48.479  1.00 42.57  ? 141 GLU D N     1 
ATOM   8226  C CA    . GLU D  1 79  ? 0.566   -60.037 47.475  1.00 43.28  ? 141 GLU D CA    1 
ATOM   8227  C C     . GLU D  1 79  ? -0.647  -60.814 46.919  1.00 43.29  ? 141 GLU D C     1 
ATOM   8228  O O     . GLU D  1 79  ? -0.500  -61.905 46.355  1.00 41.32  ? 141 GLU D O     1 
ATOM   8229  C CB    . GLU D  1 79  ? 1.551   -59.666 46.349  1.00 42.82  ? 141 GLU D CB    1 
ATOM   8230  C CG    . GLU D  1 79  ? 0.957   -58.876 45.192  1.00 42.11  ? 141 GLU D CG    1 
ATOM   8231  C CD    . GLU D  1 79  ? 0.273   -57.607 45.637  1.00 40.88  ? 141 GLU D CD    1 
ATOM   8232  O OE1   . GLU D  1 79  ? 0.977   -56.706 46.111  1.00 42.99  ? 141 GLU D OE1   1 
ATOM   8233  O OE2   . GLU D  1 79  ? -0.958  -57.503 45.508  1.00 40.01  ? 141 GLU D OE2   1 
ATOM   8234  N N     . CYS D  1 80  ? -1.838  -60.233 47.062  1.00 44.96  ? 142 CYS D N     1 
ATOM   8235  C CA    . CYS D  1 80  ? -3.078  -60.879 46.619  1.00 46.39  ? 142 CYS D CA    1 
ATOM   8236  C C     . CYS D  1 80  ? -3.252  -60.692 45.102  1.00 42.91  ? 142 CYS D C     1 
ATOM   8237  O O     . CYS D  1 80  ? -3.741  -61.588 44.430  1.00 40.54  ? 142 CYS D O     1 
ATOM   8238  C CB    . CYS D  1 80  ? -4.291  -60.352 47.418  1.00 48.45  ? 142 CYS D CB    1 
ATOM   8239  S SG    . CYS D  1 80  ? -4.497  -58.545 47.418  1.00 55.13  ? 142 CYS D SG    1 
ATOM   8240  N N     . SER D  1 81  ? -2.807  -59.544 44.577  1.00 40.41  ? 143 SER D N     1 
ATOM   8241  C CA    . SER D  1 81  ? -2.977  -59.189 43.166  1.00 39.64  ? 143 SER D CA    1 
ATOM   8242  C C     . SER D  1 81  ? -2.193  -60.129 42.274  1.00 38.28  ? 143 SER D C     1 
ATOM   8243  O O     . SER D  1 81  ? -1.255  -60.769 42.714  1.00 36.77  ? 143 SER D O     1 
ATOM   8244  C CB    . SER D  1 81  ? -2.544  -57.724 42.912  1.00 40.90  ? 143 SER D CB    1 
ATOM   8245  O OG    . SER D  1 81  ? -2.925  -57.253 41.623  1.00 42.51  ? 143 SER D OG    1 
ATOM   8246  N N     . SER D  1 82  ? -2.581  -60.192 41.007  1.00 39.74  ? 144 SER D N     1 
ATOM   8247  C CA    . SER D  1 82  ? -1.868  -61.007 40.024  1.00 40.01  ? 144 SER D CA    1 
ATOM   8248  C C     . SER D  1 82  ? -0.555  -60.363 39.613  1.00 39.38  ? 144 SER D C     1 
ATOM   8249  O O     . SER D  1 82  ? 0.213   -60.961 38.861  1.00 39.68  ? 144 SER D O     1 
ATOM   8250  C CB    . SER D  1 82  ? -2.727  -61.229 38.787  1.00 40.09  ? 144 SER D CB    1 
ATOM   8251  O OG    . SER D  1 82  ? -3.145  -59.981 38.267  1.00 42.51  ? 144 SER D OG    1 
ATOM   8252  N N     . ILE D  1 83  ? -0.303  -59.141 40.086  1.00 38.26  ? 145 ILE D N     1 
ATOM   8253  C CA    . ILE D  1 83  ? 0.989   -58.502 39.890  1.00 37.68  ? 145 ILE D CA    1 
ATOM   8254  C C     . ILE D  1 83  ? 2.103   -59.390 40.414  1.00 35.09  ? 145 ILE D C     1 
ATOM   8255  O O     . ILE D  1 83  ? 3.205   -59.356 39.913  1.00 34.74  ? 145 ILE D O     1 
ATOM   8256  C CB    . ILE D  1 83  ? 1.027   -57.109 40.552  1.00 40.36  ? 145 ILE D CB    1 
ATOM   8257  C CG1   . ILE D  1 83  ? 2.237   -56.296 40.076  1.00 42.89  ? 145 ILE D CG1   1 
ATOM   8258  C CG2   . ILE D  1 83  ? 1.036   -57.211 42.069  1.00 40.93  ? 145 ILE D CG2   1 
ATOM   8259  C CD1   . ILE D  1 83  ? 2.195   -55.875 38.620  1.00 44.40  ? 145 ILE D CD1   1 
ATOM   8260  N N     . SER D  1 84  ? 1.793   -60.194 41.421  1.00 36.04  ? 146 SER D N     1 
ATOM   8261  C CA    . SER D  1 84  ? 2.721   -61.192 41.980  1.00 36.36  ? 146 SER D CA    1 
ATOM   8262  C C     . SER D  1 84  ? 3.375   -62.105 40.951  1.00 34.82  ? 146 SER D C     1 
ATOM   8263  O O     . SER D  1 84  ? 4.551   -62.415 41.065  1.00 33.77  ? 146 SER D O     1 
ATOM   8264  C CB    . SER D  1 84  ? 1.991   -62.071 42.994  1.00 36.64  ? 146 SER D CB    1 
ATOM   8265  O OG    . SER D  1 84  ? 0.826   -62.597 42.407  1.00 38.18  ? 146 SER D OG    1 
ATOM   8266  N N     . ASP D  1 85  ? 2.610   -62.536 39.955  1.00 35.51  ? 147 ASP D N     1 
ATOM   8267  C CA    . ASP D  1 85  ? 3.164   -63.354 38.873  1.00 35.04  ? 147 ASP D CA    1 
ATOM   8268  C C     . ASP D  1 85  ? 4.357   -62.620 38.246  1.00 33.45  ? 147 ASP D C     1 
ATOM   8269  O O     . ASP D  1 85  ? 5.376   -63.239 37.968  1.00 31.94  ? 147 ASP D O     1 
ATOM   8270  C CB    . ASP D  1 85  ? 2.106   -63.669 37.798  1.00 36.35  ? 147 ASP D CB    1 
ATOM   8271  C CG    . ASP D  1 85  ? 0.883   -64.383 38.355  1.00 37.82  ? 147 ASP D CG    1 
ATOM   8272  O OD1   . ASP D  1 85  ? 1.020   -65.092 39.364  1.00 40.71  ? 147 ASP D OD1   1 
ATOM   8273  O OD2   . ASP D  1 85  ? -0.227  -64.219 37.801  1.00 39.46  ? 147 ASP D OD2   1 
ATOM   8274  N N     . TYR D  1 86  ? 4.232   -61.304 38.045  1.00 32.82  ? 148 TYR D N     1 
ATOM   8275  C CA    . TYR D  1 86  ? 5.345   -60.486 37.543  1.00 33.46  ? 148 TYR D CA    1 
ATOM   8276  C C     . TYR D  1 86  ? 6.463   -60.288 38.570  1.00 33.45  ? 148 TYR D C     1 
ATOM   8277  O O     . TYR D  1 86  ? 7.650   -60.306 38.201  1.00 34.34  ? 148 TYR D O     1 
ATOM   8278  C CB    . TYR D  1 86  ? 4.860   -59.138 36.982  1.00 34.28  ? 148 TYR D CB    1 
ATOM   8279  C CG    . TYR D  1 86  ? 4.014   -59.329 35.745  1.00 36.14  ? 148 TYR D CG    1 
ATOM   8280  C CD1   . TYR D  1 86  ? 4.602   -59.631 34.518  1.00 36.51  ? 148 TYR D CD1   1 
ATOM   8281  C CD2   . TYR D  1 86  ? 2.631   -59.266 35.805  1.00 37.01  ? 148 TYR D CD2   1 
ATOM   8282  C CE1   . TYR D  1 86  ? 3.838   -59.854 33.394  1.00 35.80  ? 148 TYR D CE1   1 
ATOM   8283  C CE2   . TYR D  1 86  ? 1.870   -59.475 34.675  1.00 36.98  ? 148 TYR D CE2   1 
ATOM   8284  C CZ    . TYR D  1 86  ? 2.492   -59.770 33.480  1.00 35.07  ? 148 TYR D CZ    1 
ATOM   8285  O OH    . TYR D  1 86  ? 1.765   -59.988 32.358  1.00 35.31  ? 148 TYR D OH    1 
ATOM   8286  N N     . SER D  1 87  ? 6.116   -60.126 39.848  1.00 31.96  ? 149 SER D N     1 
ATOM   8287  C CA    . SER D  1 87  ? 7.163   -60.041 40.879  1.00 31.63  ? 149 SER D CA    1 
ATOM   8288  C C     . SER D  1 87  ? 8.082   -61.269 40.860  1.00 30.62  ? 149 SER D C     1 
ATOM   8289  O O     . SER D  1 87  ? 9.289   -61.111 40.942  1.00 29.66  ? 149 SER D O     1 
ATOM   8290  C CB    . SER D  1 87  ? 6.617   -59.693 42.297  1.00 32.17  ? 149 SER D CB    1 
ATOM   8291  O OG    . SER D  1 87  ? 5.955   -60.737 43.014  1.00 30.63  ? 149 SER D OG    1 
ATOM   8292  N N     . GLU D  1 88  ? 7.525   -62.465 40.670  1.00 31.31  ? 150 GLU D N     1 
ATOM   8293  C CA    . GLU D  1 88  ? 8.330   -63.696 40.599  1.00 32.60  ? 150 GLU D CA    1 
ATOM   8294  C C     . GLU D  1 88  ? 9.282   -63.708 39.416  1.00 34.06  ? 150 GLU D C     1 
ATOM   8295  O O     . GLU D  1 88  ? 10.475  -63.992 39.599  1.00 33.94  ? 150 GLU D O     1 
ATOM   8296  C CB    . GLU D  1 88  ? 7.456   -64.949 40.551  1.00 33.85  ? 150 GLU D CB    1 
ATOM   8297  C CG    . GLU D  1 88  ? 6.792   -65.291 41.877  1.00 35.50  ? 150 GLU D CG    1 
ATOM   8298  C CD    . GLU D  1 88  ? 6.104   -66.652 41.876  1.00 36.48  ? 150 GLU D CD    1 
ATOM   8299  O OE1   . GLU D  1 88  ? 5.883   -67.210 40.783  1.00 37.12  ? 150 GLU D OE1   1 
ATOM   8300  O OE2   . GLU D  1 88  ? 5.779   -67.164 42.973  1.00 36.61  ? 150 GLU D OE2   1 
ATOM   8301  N N     . LYS D  1 89  ? 8.772   -63.398 38.218  1.00 35.94  ? 151 LYS D N     1 
ATOM   8302  C CA    . LYS D  1 89  ? 9.626   -63.337 37.013  1.00 38.48  ? 151 LYS D CA    1 
ATOM   8303  C C     . LYS D  1 89  ? 10.711  -62.270 37.173  1.00 36.60  ? 151 LYS D C     1 
ATOM   8304  O O     . LYS D  1 89  ? 11.868  -62.499 36.814  1.00 32.62  ? 151 LYS D O     1 
ATOM   8305  C CB    . LYS D  1 89  ? 8.818   -63.077 35.722  1.00 41.38  ? 151 LYS D CB    1 
ATOM   8306  C CG    . LYS D  1 89  ? 8.168   -64.318 35.094  1.00 45.24  ? 151 LYS D CG    1 
ATOM   8307  C CD    . LYS D  1 89  ? 7.328   -63.970 33.855  1.00 47.87  ? 151 LYS D CD    1 
ATOM   8308  C CE    . LYS D  1 89  ? 6.111   -64.879 33.651  1.00 46.59  ? 151 LYS D CE    1 
ATOM   8309  N NZ    . LYS D  1 89  ? 4.890   -64.071 33.327  1.00 45.73  ? 151 LYS D NZ    1 
ATOM   8310  N N     . ILE D  1 90  ? 10.318  -61.118 37.723  1.00 37.53  ? 152 ILE D N     1 
ATOM   8311  C CA    . ILE D  1 90  ? 11.235  -59.995 37.951  1.00 38.60  ? 152 ILE D CA    1 
ATOM   8312  C C     . ILE D  1 90  ? 12.347  -60.391 38.907  1.00 39.80  ? 152 ILE D C     1 
ATOM   8313  O O     . ILE D  1 90  ? 13.532  -60.195 38.627  1.00 37.87  ? 152 ILE D O     1 
ATOM   8314  C CB    . ILE D  1 90  ? 10.514  -58.765 38.551  1.00 37.79  ? 152 ILE D CB    1 
ATOM   8315  C CG1   . ILE D  1 90  ? 9.667   -58.062 37.493  1.00 37.18  ? 152 ILE D CG1   1 
ATOM   8316  C CG2   . ILE D  1 90  ? 11.526  -57.768 39.099  1.00 37.21  ? 152 ILE D CG2   1 
ATOM   8317  C CD1   . ILE D  1 90  ? 8.703   -57.056 38.067  1.00 36.91  ? 152 ILE D CD1   1 
ATOM   8318  N N     . ILE D  1 91  ? 11.950  -60.935 40.051  1.00 42.02  ? 153 ILE D N     1 
ATOM   8319  C CA    . ILE D  1 91  ? 12.907  -61.384 41.047  1.00 42.38  ? 153 ILE D CA    1 
ATOM   8320  C C     . ILE D  1 91  ? 13.868  -62.358 40.392  1.00 42.38  ? 153 ILE D C     1 
ATOM   8321  O O     . ILE D  1 91  ? 15.088  -62.147 40.438  1.00 45.35  ? 153 ILE D O     1 
ATOM   8322  C CB    . ILE D  1 91  ? 12.204  -62.001 42.274  1.00 41.21  ? 153 ILE D CB    1 
ATOM   8323  C CG1   . ILE D  1 91  ? 11.624  -60.860 43.120  1.00 41.15  ? 153 ILE D CG1   1 
ATOM   8324  C CG2   . ILE D  1 91  ? 13.171  -62.819 43.109  1.00 40.75  ? 153 ILE D CG2   1 
ATOM   8325  C CD1   . ILE D  1 91  ? 10.504  -61.267 44.041  1.00 41.47  ? 153 ILE D CD1   1 
ATOM   8326  N N     . LYS D  1 92  ? 13.323  -63.379 39.739  1.00 39.43  ? 154 LYS D N     1 
ATOM   8327  C CA    . LYS D  1 92  ? 14.164  -64.361 39.097  1.00 38.10  ? 154 LYS D CA    1 
ATOM   8328  C C     . LYS D  1 92  ? 15.120  -63.742 38.089  1.00 34.90  ? 154 LYS D C     1 
ATOM   8329  O O     . LYS D  1 92  ? 16.274  -64.105 38.039  1.00 35.79  ? 154 LYS D O     1 
ATOM   8330  C CB    . LYS D  1 92  ? 13.352  -65.432 38.398  1.00 40.61  ? 154 LYS D CB    1 
ATOM   8331  C CG    . LYS D  1 92  ? 14.157  -66.717 38.291  1.00 43.36  ? 154 LYS D CG    1 
ATOM   8332  C CD    . LYS D  1 92  ? 13.891  -67.513 37.026  1.00 43.90  ? 154 LYS D CD    1 
ATOM   8333  C CE    . LYS D  1 92  ? 15.064  -68.441 36.735  1.00 42.58  ? 154 LYS D CE    1 
ATOM   8334  N NZ    . LYS D  1 92  ? 14.634  -69.468 35.757  1.00 42.90  ? 154 LYS D NZ    1 
ATOM   8335  N N     . ALA D  1 93  ? 14.654  -62.797 37.298  1.00 33.33  ? 155 ALA D N     1 
ATOM   8336  C CA    . ALA D  1 93  ? 15.544  -62.066 36.400  1.00 32.69  ? 155 ALA D CA    1 
ATOM   8337  C C     . ALA D  1 93  ? 16.762  -61.394 37.084  1.00 33.27  ? 155 ALA D C     1 
ATOM   8338  O O     . ALA D  1 93  ? 17.847  -61.339 36.511  1.00 31.46  ? 155 ALA D O     1 
ATOM   8339  C CB    . ALA D  1 93  ? 14.749  -61.039 35.626  1.00 32.41  ? 155 ALA D CB    1 
ATOM   8340  N N     . ASN D  1 94  ? 16.583  -60.899 38.305  1.00 34.75  ? 156 ASN D N     1 
ATOM   8341  C CA    . ASN D  1 94  ? 17.655  -60.213 39.019  1.00 34.91  ? 156 ASN D CA    1 
ATOM   8342  C C     . ASN D  1 94  ? 18.427  -61.079 39.988  1.00 34.08  ? 156 ASN D C     1 
ATOM   8343  O O     . ASN D  1 94  ? 19.131  -60.575 40.820  1.00 32.86  ? 156 ASN D O     1 
ATOM   8344  C CB    . ASN D  1 94  ? 17.068  -59.039 39.752  1.00 36.43  ? 156 ASN D CB    1 
ATOM   8345  C CG    . ASN D  1 94  ? 16.383  -58.083 38.811  1.00 38.80  ? 156 ASN D CG    1 
ATOM   8346  O OD1   . ASN D  1 94  ? 17.032  -57.277 38.159  1.00 38.50  ? 156 ASN D OD1   1 
ATOM   8347  N ND2   . ASN D  1 94  ? 15.061  -58.177 38.722  1.00 42.27  ? 156 ASN D ND2   1 
ATOM   8348  N N     . HIS D  1 95  ? 18.295  -62.388 39.861  1.00 36.04  ? 157 HIS D N     1 
ATOM   8349  C CA    . HIS D  1 95  ? 19.116  -63.352 40.596  1.00 37.46  ? 157 HIS D CA    1 
ATOM   8350  C C     . HIS D  1 95  ? 18.898  -63.284 42.099  1.00 36.91  ? 157 HIS D C     1 
ATOM   8351  O O     . HIS D  1 95  ? 19.837  -63.442 42.877  1.00 37.33  ? 157 HIS D O     1 
ATOM   8352  C CB    . HIS D  1 95  ? 20.613  -63.178 40.257  1.00 38.07  ? 157 HIS D CB    1 
ATOM   8353  C CG    . HIS D  1 95  ? 20.893  -63.104 38.788  1.00 39.27  ? 157 HIS D CG    1 
ATOM   8354  N ND1   . HIS D  1 95  ? 20.593  -64.136 37.919  1.00 39.52  ? 157 HIS D ND1   1 
ATOM   8355  C CD2   . HIS D  1 95  ? 21.433  -62.119 38.033  1.00 39.56  ? 157 HIS D CD2   1 
ATOM   8356  C CE1   . HIS D  1 95  ? 20.929  -63.785 36.691  1.00 39.91  ? 157 HIS D CE1   1 
ATOM   8357  N NE2   . HIS D  1 95  ? 21.444  -62.568 36.733  1.00 40.41  ? 157 HIS D NE2   1 
ATOM   8358  N N     . LEU D  1 96  ? 17.658  -63.068 42.511  1.00 36.10  ? 158 LEU D N     1 
ATOM   8359  C CA    . LEU D  1 96  ? 17.360  -62.965 43.934  1.00 36.61  ? 158 LEU D CA    1 
ATOM   8360  C C     . LEU D  1 96  ? 16.362  -64.016 44.421  1.00 37.95  ? 158 LEU D C     1 
ATOM   8361  O O     . LEU D  1 96  ? 15.928  -63.971 45.572  1.00 36.74  ? 158 LEU D O     1 
ATOM   8362  C CB    . LEU D  1 96  ? 16.866  -61.548 44.257  1.00 35.44  ? 158 LEU D CB    1 
ATOM   8363  C CG    . LEU D  1 96  ? 17.875  -60.408 44.057  1.00 34.45  ? 158 LEU D CG    1 
ATOM   8364  C CD1   . LEU D  1 96  ? 17.215  -59.046 44.210  1.00 33.46  ? 158 LEU D CD1   1 
ATOM   8365  C CD2   . LEU D  1 96  ? 19.030  -60.539 45.038  1.00 34.70  ? 158 LEU D CD2   1 
ATOM   8366  N N     . ASP D  1 97  ? 16.024  -64.976 43.562  1.00 40.58  ? 159 ASP D N     1 
ATOM   8367  C CA    . ASP D  1 97  ? 14.966  -65.968 43.873  1.00 42.37  ? 159 ASP D CA    1 
ATOM   8368  C C     . ASP D  1 97  ? 15.358  -66.943 44.990  1.00 39.94  ? 159 ASP D C     1 
ATOM   8369  O O     . ASP D  1 97  ? 14.506  -67.486 45.682  1.00 38.16  ? 159 ASP D O     1 
ATOM   8370  C CB    . ASP D  1 97  ? 14.492  -66.717 42.598  1.00 43.93  ? 159 ASP D CB    1 
ATOM   8371  C CG    . ASP D  1 97  ? 15.653  -67.156 41.672  1.00 44.40  ? 159 ASP D CG    1 
ATOM   8372  O OD1   . ASP D  1 97  ? 16.566  -66.327 41.380  1.00 43.96  ? 159 ASP D OD1   1 
ATOM   8373  O OD2   . ASP D  1 97  ? 15.626  -68.325 41.217  1.00 42.29  ? 159 ASP D OD2   1 
ATOM   8374  N N     . ASN D  1 98  ? 16.660  -67.146 45.140  1.00 41.33  ? 160 ASN D N     1 
ATOM   8375  C CA    . ASN D  1 98  ? 17.244  -67.899 46.251  1.00 42.21  ? 160 ASN D CA    1 
ATOM   8376  C C     . ASN D  1 98  ? 17.007  -67.257 47.632  1.00 40.85  ? 160 ASN D C     1 
ATOM   8377  O O     . ASN D  1 98  ? 17.040  -67.954 48.654  1.00 39.70  ? 160 ASN D O     1 
ATOM   8378  C CB    . ASN D  1 98  ? 18.752  -68.046 46.018  1.00 44.16  ? 160 ASN D CB    1 
ATOM   8379  C CG    . ASN D  1 98  ? 19.475  -66.687 45.962  1.00 47.79  ? 160 ASN D CG    1 
ATOM   8380  O OD1   . ASN D  1 98  ? 18.980  -65.721 45.360  1.00 48.20  ? 160 ASN D OD1   1 
ATOM   8381  N ND2   . ASN D  1 98  ? 20.647  -66.608 46.594  1.00 49.18  ? 160 ASN D ND2   1 
ATOM   8382  N N     . ILE D  1 99  ? 16.785  -65.936 47.645  1.00 39.53  ? 161 ILE D N     1 
ATOM   8383  C CA    . ILE D  1 99  ? 16.555  -65.152 48.865  1.00 36.48  ? 161 ILE D CA    1 
ATOM   8384  C C     . ILE D  1 99  ? 15.090  -64.769 49.049  1.00 36.61  ? 161 ILE D C     1 
ATOM   8385  O O     . ILE D  1 99  ? 14.571  -64.869 50.148  1.00 37.63  ? 161 ILE D O     1 
ATOM   8386  C CB    . ILE D  1 99  ? 17.400  -63.867 48.846  1.00 36.82  ? 161 ILE D CB    1 
ATOM   8387  C CG1   . ILE D  1 99  ? 18.893  -64.218 48.930  1.00 39.01  ? 161 ILE D CG1   1 
ATOM   8388  C CG2   . ILE D  1 99  ? 17.032  -62.947 49.996  1.00 36.20  ? 161 ILE D CG2   1 
ATOM   8389  C CD1   . ILE D  1 99  ? 19.847  -63.084 48.562  1.00 38.70  ? 161 ILE D CD1   1 
ATOM   8390  N N     . ILE D  1 100 ? 14.418  -64.331 47.987  1.00 37.63  ? 162 ILE D N     1 
ATOM   8391  C CA    . ILE D  1 100 ? 13.032  -63.839 48.090  1.00 37.56  ? 162 ILE D CA    1 
ATOM   8392  C C     . ILE D  1 100 ? 12.021  -64.887 47.648  1.00 35.98  ? 162 ILE D C     1 
ATOM   8393  O O     . ILE D  1 100 ? 12.156  -65.468 46.582  1.00 35.33  ? 162 ILE D O     1 
ATOM   8394  C CB    . ILE D  1 100 ? 12.797  -62.592 47.210  1.00 39.70  ? 162 ILE D CB    1 
ATOM   8395  C CG1   . ILE D  1 100 ? 13.820  -61.493 47.544  1.00 39.64  ? 162 ILE D CG1   1 
ATOM   8396  C CG2   . ILE D  1 100 ? 11.366  -62.074 47.376  1.00 40.11  ? 162 ILE D CG2   1 
ATOM   8397  C CD1   . ILE D  1 100 ? 13.867  -60.369 46.530  1.00 38.21  ? 162 ILE D CD1   1 
ATOM   8398  N N     . THR D  1 101 ? 10.991  -65.089 48.458  1.00 35.54  ? 163 THR D N     1 
ATOM   8399  C CA    . THR D  1 101 ? 9.917   -65.998 48.115  1.00 37.48  ? 163 THR D CA    1 
ATOM   8400  C C     . THR D  1 101 ? 8.610   -65.226 48.195  1.00 39.29  ? 163 THR D C     1 
ATOM   8401  O O     . THR D  1 101 ? 8.367   -64.521 49.185  1.00 39.23  ? 163 THR D O     1 
ATOM   8402  C CB    . THR D  1 101 ? 9.870   -67.181 49.082  1.00 38.01  ? 163 THR D CB    1 
ATOM   8403  O OG1   . THR D  1 101 ? 11.181  -67.726 49.210  1.00 40.12  ? 163 THR D OG1   1 
ATOM   8404  C CG2   . THR D  1 101 ? 8.909   -68.252 48.587  1.00 37.62  ? 163 THR D CG2   1 
ATOM   8405  N N     . ILE D  1 102 ? 7.782   -65.343 47.152  1.00 40.01  ? 164 ILE D N     1 
ATOM   8406  C CA    . ILE D  1 102 ? 6.527   -64.603 47.079  1.00 40.74  ? 164 ILE D CA    1 
ATOM   8407  C C     . ILE D  1 102 ? 5.370   -65.544 47.328  1.00 41.44  ? 164 ILE D C     1 
ATOM   8408  O O     . ILE D  1 102 ? 5.303   -66.618 46.737  1.00 43.01  ? 164 ILE D O     1 
ATOM   8409  C CB    . ILE D  1 102 ? 6.311   -63.939 45.705  1.00 40.80  ? 164 ILE D CB    1 
ATOM   8410  C CG1   . ILE D  1 102 ? 7.452   -62.965 45.382  1.00 40.28  ? 164 ILE D CG1   1 
ATOM   8411  C CG2   . ILE D  1 102 ? 4.976   -63.196 45.675  1.00 41.83  ? 164 ILE D CG2   1 
ATOM   8412  C CD1   . ILE D  1 102 ? 7.602   -61.796 46.335  1.00 38.20  ? 164 ILE D CD1   1 
ATOM   8413  N N     . PHE D  1 103 ? 4.459   -65.124 48.198  1.00 40.33  ? 165 PHE D N     1 
ATOM   8414  C CA    . PHE D  1 103 ? 3.270   -65.886 48.480  1.00 39.98  ? 165 PHE D CA    1 
ATOM   8415  C C     . PHE D  1 103 ? 2.106   -65.159 47.822  1.00 42.49  ? 165 PHE D C     1 
ATOM   8416  O O     . PHE D  1 103 ? 1.779   -64.022 48.166  1.00 43.23  ? 165 PHE D O     1 
ATOM   8417  C CB    . PHE D  1 103 ? 3.091   -66.046 49.993  1.00 40.07  ? 165 PHE D CB    1 
ATOM   8418  C CG    . PHE D  1 103 ? 4.184   -66.851 50.635  1.00 38.62  ? 165 PHE D CG    1 
ATOM   8419  C CD1   . PHE D  1 103 ? 4.076   -68.228 50.744  1.00 37.59  ? 165 PHE D CD1   1 
ATOM   8420  C CD2   . PHE D  1 103 ? 5.337   -66.232 51.099  1.00 37.46  ? 165 PHE D CD2   1 
ATOM   8421  C CE1   . PHE D  1 103 ? 5.090   -68.966 51.312  1.00 37.36  ? 165 PHE D CE1   1 
ATOM   8422  C CE2   . PHE D  1 103 ? 6.355   -66.967 51.664  1.00 36.50  ? 165 PHE D CE2   1 
ATOM   8423  C CZ    . PHE D  1 103 ? 6.234   -68.337 51.765  1.00 36.50  ? 165 PHE D CZ    1 
ATOM   8424  N N     . LYS D  1 104 ? 1.514   -65.822 46.838  1.00 44.44  ? 166 LYS D N     1 
ATOM   8425  C CA    . LYS D  1 104 ? 0.388   -65.288 46.092  1.00 45.33  ? 166 LYS D CA    1 
ATOM   8426  C C     . LYS D  1 104 ? -0.849  -65.525 46.950  1.00 39.93  ? 166 LYS D C     1 
ATOM   8427  O O     . LYS D  1 104 ? -1.265  -66.642 47.129  1.00 41.78  ? 166 LYS D O     1 
ATOM   8428  C CB    . LYS D  1 104 ? 0.298   -66.007 44.728  1.00 49.28  ? 166 LYS D CB    1 
ATOM   8429  C CG    . LYS D  1 104 ? 0.128   -65.108 43.502  1.00 55.05  ? 166 LYS D CG    1 
ATOM   8430  C CD    . LYS D  1 104 ? -1.324  -64.958 43.000  1.00 57.01  ? 166 LYS D CD    1 
ATOM   8431  C CE    . LYS D  1 104 ? -1.392  -64.958 41.467  1.00 56.19  ? 166 LYS D CE    1 
ATOM   8432  N NZ    . LYS D  1 104 ? -2.742  -64.683 40.912  1.00 54.93  ? 166 LYS D NZ    1 
ATOM   8433  N N     . GLY D  1 105 ? -1.396  -64.479 47.538  1.00 37.37  ? 167 GLY D N     1 
ATOM   8434  C CA    . GLY D  1 105 ? -2.564  -64.631 48.399  1.00 35.89  ? 167 GLY D CA    1 
ATOM   8435  C C     . GLY D  1 105 ? -2.800  -63.441 49.303  1.00 34.25  ? 167 GLY D C     1 
ATOM   8436  O O     . GLY D  1 105 ? -2.048  -62.478 49.311  1.00 33.48  ? 167 GLY D O     1 
ATOM   8437  N N     . LYS D  1 106 ? -3.877  -63.495 50.053  1.00 34.20  ? 168 LYS D N     1 
ATOM   8438  C CA    . LYS D  1 106 ? -4.207  -62.413 50.953  1.00 35.77  ? 168 LYS D CA    1 
ATOM   8439  C C     . LYS D  1 106 ? -3.342  -62.575 52.209  1.00 35.70  ? 168 LYS D C     1 
ATOM   8440  O O     . LYS D  1 106 ? -3.081  -63.694 52.653  1.00 35.38  ? 168 LYS D O     1 
ATOM   8441  C CB    . LYS D  1 106 ? -5.708  -62.458 51.259  1.00 36.86  ? 168 LYS D CB    1 
ATOM   8442  C CG    . LYS D  1 106 ? -6.377  -61.109 51.477  1.00 39.29  ? 168 LYS D CG    1 
ATOM   8443  C CD    . LYS D  1 106 ? -7.900  -61.210 51.499  1.00 40.43  ? 168 LYS D CD    1 
ATOM   8444  C CE    . LYS D  1 106 ? -8.428  -61.687 50.157  1.00 41.27  ? 168 LYS D CE    1 
ATOM   8445  N NZ    . LYS D  1 106 ? -9.912  -61.682 50.112  1.00 43.01  ? 168 LYS D NZ    1 
ATOM   8446  N N     . VAL D  1 107 ? -2.873  -61.462 52.761  1.00 35.58  ? 169 VAL D N     1 
ATOM   8447  C CA    . VAL D  1 107 ? -2.071  -61.484 53.994  1.00 36.15  ? 169 VAL D CA    1 
ATOM   8448  C C     . VAL D  1 107 ? -2.829  -62.196 55.124  1.00 37.52  ? 169 VAL D C     1 
ATOM   8449  O O     . VAL D  1 107 ? -2.281  -63.082 55.826  1.00 36.57  ? 169 VAL D O     1 
ATOM   8450  C CB    . VAL D  1 107 ? -1.671  -60.044 54.435  1.00 34.82  ? 169 VAL D CB    1 
ATOM   8451  C CG1   . VAL D  1 107 ? -1.233  -60.005 55.888  1.00 34.47  ? 169 VAL D CG1   1 
ATOM   8452  C CG2   . VAL D  1 107 ? -0.560  -59.505 53.556  1.00 34.13  ? 169 VAL D CG2   1 
ATOM   8453  N N     . GLU D  1 108 ? -4.100  -61.820 55.277  1.00 37.28  ? 170 GLU D N     1 
ATOM   8454  C CA    . GLU D  1 108 ? -4.914  -62.359 56.359  1.00 37.92  ? 170 GLU D CA    1 
ATOM   8455  C C     . GLU D  1 108 ? -5.260  -63.842 56.133  1.00 37.50  ? 170 GLU D C     1 
ATOM   8456  O O     . GLU D  1 108 ? -5.971  -64.432 56.938  1.00 36.91  ? 170 GLU D O     1 
ATOM   8457  C CB    . GLU D  1 108 ? -6.157  -61.483 56.685  1.00 38.14  ? 170 GLU D CB    1 
ATOM   8458  C CG    . GLU D  1 108 ? -6.713  -60.573 55.592  1.00 39.52  ? 170 GLU D CG    1 
ATOM   8459  C CD    . GLU D  1 108 ? -5.944  -59.253 55.427  1.00 39.02  ? 170 GLU D CD    1 
ATOM   8460  O OE1   . GLU D  1 108 ? -6.054  -58.332 56.272  1.00 36.83  ? 170 GLU D OE1   1 
ATOM   8461  O OE2   . GLU D  1 108 ? -5.243  -59.127 54.409  1.00 37.97  ? 170 GLU D OE2   1 
ATOM   8462  N N     . GLU D  1 109 ? -4.712  -64.444 55.073  1.00 37.58  ? 171 GLU D N     1 
ATOM   8463  C CA    . GLU D  1 109 ? -4.963  -65.850 54.740  1.00 38.69  ? 171 GLU D CA    1 
ATOM   8464  C C     . GLU D  1 109 ? -3.725  -66.732 54.550  1.00 40.64  ? 171 GLU D C     1 
ATOM   8465  O O     . GLU D  1 109 ? -3.790  -67.919 54.877  1.00 44.16  ? 171 GLU D O     1 
ATOM   8466  C CB    . GLU D  1 109 ? -5.835  -65.957 53.495  1.00 37.71  ? 171 GLU D CB    1 
ATOM   8467  C CG    . GLU D  1 109 ? -7.278  -65.582 53.762  1.00 39.44  ? 171 GLU D CG    1 
ATOM   8468  C CD    . GLU D  1 109 ? -8.071  -65.439 52.494  1.00 41.73  ? 171 GLU D CD    1 
ATOM   8469  O OE1   . GLU D  1 109 ? -7.540  -65.766 51.405  1.00 42.33  ? 171 GLU D OE1   1 
ATOM   8470  O OE2   . GLU D  1 109 ? -9.220  -64.978 52.597  1.00 43.85  ? 171 GLU D OE2   1 
ATOM   8471  N N     . VAL D  1 110 ? -2.612  -66.205 54.033  1.00 39.17  ? 172 VAL D N     1 
ATOM   8472  C CA    . VAL D  1 110 ? -1.452  -67.076 53.815  1.00 38.19  ? 172 VAL D CA    1 
ATOM   8473  C C     . VAL D  1 110 ? -0.704  -67.437 55.111  1.00 38.56  ? 172 VAL D C     1 
ATOM   8474  O O     . VAL D  1 110 ? -0.896  -66.830 56.186  1.00 36.32  ? 172 VAL D O     1 
ATOM   8475  C CB    . VAL D  1 110 ? -0.454  -66.535 52.768  1.00 38.24  ? 172 VAL D CB    1 
ATOM   8476  C CG1   . VAL D  1 110 ? -1.162  -66.171 51.467  1.00 38.36  ? 172 VAL D CG1   1 
ATOM   8477  C CG2   . VAL D  1 110 ? 0.323   -65.359 53.315  1.00 39.34  ? 172 VAL D CG2   1 
ATOM   8478  N N     . GLU D  1 111 ? 0.136   -68.458 54.976  1.00 40.06  ? 173 GLU D N     1 
ATOM   8479  C CA    . GLU D  1 111 ? 0.900   -69.001 56.080  1.00 41.08  ? 173 GLU D CA    1 
ATOM   8480  C C     . GLU D  1 111 ? 2.360   -69.090 55.667  1.00 38.06  ? 173 GLU D C     1 
ATOM   8481  O O     . GLU D  1 111 ? 2.673   -69.470 54.559  1.00 35.83  ? 173 GLU D O     1 
ATOM   8482  C CB    . GLU D  1 111 ? 0.364   -70.382 56.467  1.00 43.46  ? 173 GLU D CB    1 
ATOM   8483  C CG    . GLU D  1 111 ? 0.086   -70.534 57.957  1.00 47.55  ? 173 GLU D CG    1 
ATOM   8484  C CD    . GLU D  1 111 ? -1.058  -69.642 58.445  1.00 51.67  ? 173 GLU D CD    1 
ATOM   8485  O OE1   . GLU D  1 111 ? -0.898  -69.005 59.519  1.00 58.72  ? 173 GLU D OE1   1 
ATOM   8486  O OE2   . GLU D  1 111 ? -2.110  -69.567 57.763  1.00 49.11  ? 173 GLU D OE2   1 
ATOM   8487  N N     . LEU D  1 112 ? 3.244   -68.716 56.578  1.00 38.98  ? 174 LEU D N     1 
ATOM   8488  C CA    . LEU D  1 112 ? 4.666   -68.582 56.290  1.00 39.64  ? 174 LEU D CA    1 
ATOM   8489  C C     . LEU D  1 112 ? 5.463   -69.765 56.798  1.00 39.11  ? 174 LEU D C     1 
ATOM   8490  O O     . LEU D  1 112 ? 5.135   -70.348 57.805  1.00 43.41  ? 174 LEU D O     1 
ATOM   8491  C CB    . LEU D  1 112 ? 5.210   -67.305 56.943  1.00 40.54  ? 174 LEU D CB    1 
ATOM   8492  C CG    . LEU D  1 112 ? 4.607   -65.990 56.438  1.00 43.03  ? 174 LEU D CG    1 
ATOM   8493  C CD1   . LEU D  1 112 ? 5.039   -64.811 57.297  1.00 43.86  ? 174 LEU D CD1   1 
ATOM   8494  C CD2   . LEU D  1 112 ? 4.989   -65.739 54.980  1.00 43.51  ? 174 LEU D CD2   1 
ATOM   8495  N N     . PRO D  1 113 ? 6.561   -70.096 56.137  1.00 38.28  ? 175 PRO D N     1 
ATOM   8496  C CA    . PRO D  1 113 ? 7.381   -71.159 56.661  1.00 37.52  ? 175 PRO D CA    1 
ATOM   8497  C C     . PRO D  1 113 ? 8.064   -70.859 57.998  1.00 38.31  ? 175 PRO D C     1 
ATOM   8498  O O     . PRO D  1 113 ? 8.900   -71.646 58.387  1.00 41.40  ? 175 PRO D O     1 
ATOM   8499  C CB    . PRO D  1 113 ? 8.448   -71.329 55.580  1.00 36.77  ? 175 PRO D CB    1 
ATOM   8500  C CG    . PRO D  1 113 ? 8.557   -69.995 54.952  1.00 36.59  ? 175 PRO D CG    1 
ATOM   8501  C CD    . PRO D  1 113 ? 7.165   -69.454 54.964  1.00 38.00  ? 175 PRO D CD    1 
ATOM   8502  N N     . VAL D  1 114 ? 7.771   -69.743 58.671  1.00 37.51  ? 176 VAL D N     1 
ATOM   8503  C CA    . VAL D  1 114 ? 8.332   -69.472 60.010  1.00 38.19  ? 176 VAL D CA    1 
ATOM   8504  C C     . VAL D  1 114 ? 7.241   -68.949 60.934  1.00 41.70  ? 176 VAL D C     1 
ATOM   8505  O O     . VAL D  1 114 ? 6.201   -68.492 60.458  1.00 46.90  ? 176 VAL D O     1 
ATOM   8506  C CB    . VAL D  1 114 ? 9.530   -68.467 59.996  1.00 36.52  ? 176 VAL D CB    1 
ATOM   8507  C CG1   . VAL D  1 114 ? 10.679  -68.980 59.142  1.00 36.61  ? 176 VAL D CG1   1 
ATOM   8508  C CG2   . VAL D  1 114 ? 9.120   -67.096 59.521  1.00 35.50  ? 176 VAL D CG2   1 
ATOM   8509  N N     . GLU D  1 115 ? 7.465   -69.016 62.249  1.00 43.42  ? 177 GLU D N     1 
ATOM   8510  C CA    . GLU D  1 115 ? 6.470   -68.529 63.212  1.00 43.35  ? 177 GLU D CA    1 
ATOM   8511  C C     . GLU D  1 115 ? 6.582   -67.037 63.386  1.00 43.12  ? 177 GLU D C     1 
ATOM   8512  O O     . GLU D  1 115 ? 5.575   -66.342 63.510  1.00 46.72  ? 177 GLU D O     1 
ATOM   8513  C CB    . GLU D  1 115 ? 6.628   -69.184 64.565  1.00 43.24  ? 177 GLU D CB    1 
ATOM   8514  C CG    . GLU D  1 115 ? 6.026   -70.559 64.627  1.00 45.07  ? 177 GLU D CG    1 
ATOM   8515  C CD    . GLU D  1 115 ? 6.117   -71.133 66.013  1.00 48.88  ? 177 GLU D CD    1 
ATOM   8516  O OE1   . GLU D  1 115 ? 5.728   -72.303 66.179  1.00 51.18  ? 177 GLU D OE1   1 
ATOM   8517  O OE2   . GLU D  1 115 ? 6.583   -70.421 66.932  1.00 51.60  ? 177 GLU D OE2   1 
ATOM   8518  N N     . LYS D  1 116 ? 7.812   -66.553 63.383  1.00 41.49  ? 178 LYS D N     1 
ATOM   8519  C CA    . LYS D  1 116 ? 8.080   -65.159 63.626  1.00 40.05  ? 178 LYS D CA    1 
ATOM   8520  C C     . LYS D  1 116 ? 9.125   -64.615 62.658  1.00 37.39  ? 178 LYS D C     1 
ATOM   8521  O O     . LYS D  1 116 ? 9.924   -65.360 62.090  1.00 35.58  ? 178 LYS D O     1 
ATOM   8522  C CB    . LYS D  1 116 ? 8.548   -64.998 65.066  1.00 41.52  ? 178 LYS D CB    1 
ATOM   8523  C CG    . LYS D  1 116 ? 7.593   -64.247 65.978  1.00 42.28  ? 178 LYS D CG    1 
ATOM   8524  C CD    . LYS D  1 116 ? 6.204   -64.837 66.080  1.00 41.89  ? 178 LYS D CD    1 
ATOM   8525  C CE    . LYS D  1 116 ? 5.404   -64.009 67.065  1.00 43.82  ? 178 LYS D CE    1 
ATOM   8526  N NZ    . LYS D  1 116 ? 3.988   -64.441 67.136  1.00 47.12  ? 178 LYS D NZ    1 
ATOM   8527  N N     . VAL D  1 117 ? 9.110   -63.298 62.503  1.00 35.35  ? 179 VAL D N     1 
ATOM   8528  C CA    . VAL D  1 117 ? 9.896   -62.600 61.496  1.00 33.18  ? 179 VAL D CA    1 
ATOM   8529  C C     . VAL D  1 117 ? 10.629  -61.457 62.163  1.00 32.47  ? 179 VAL D C     1 
ATOM   8530  O O     . VAL D  1 117 ? 10.085  -60.840 63.064  1.00 34.09  ? 179 VAL D O     1 
ATOM   8531  C CB    . VAL D  1 117 ? 8.930   -62.045 60.444  1.00 33.50  ? 179 VAL D CB    1 
ATOM   8532  C CG1   . VAL D  1 117 ? 9.460   -60.810 59.776  1.00 34.63  ? 179 VAL D CG1   1 
ATOM   8533  C CG2   . VAL D  1 117 ? 8.641   -63.099 59.398  1.00 34.53  ? 179 VAL D CG2   1 
ATOM   8534  N N     . ASP D  1 118 ? 11.841  -61.147 61.718  1.00 31.70  ? 180 ASP D N     1 
ATOM   8535  C CA    . ASP D  1 118 ? 12.638  -60.052 62.336  1.00 32.15  ? 180 ASP D CA    1 
ATOM   8536  C C     . ASP D  1 118 ? 12.182  -58.603 62.007  1.00 30.49  ? 180 ASP D C     1 
ATOM   8537  O O     . ASP D  1 118 ? 12.197  -57.730 62.868  1.00 28.25  ? 180 ASP D O     1 
ATOM   8538  C CB    . ASP D  1 118 ? 14.127  -60.198 61.970  1.00 33.85  ? 180 ASP D CB    1 
ATOM   8539  C CG    . ASP D  1 118 ? 14.766  -61.488 62.522  1.00 35.61  ? 180 ASP D CG    1 
ATOM   8540  O OD1   . ASP D  1 118 ? 14.705  -61.688 63.751  1.00 38.29  ? 180 ASP D OD1   1 
ATOM   8541  O OD2   . ASP D  1 118 ? 15.342  -62.289 61.744  1.00 34.84  ? 180 ASP D OD2   1 
ATOM   8542  N N     . ILE D  1 119 ? 11.804  -58.354 60.757  1.00 30.36  ? 181 ILE D N     1 
ATOM   8543  C CA    . ILE D  1 119 ? 11.490  -57.016 60.265  1.00 29.82  ? 181 ILE D CA    1 
ATOM   8544  C C     . ILE D  1 119 ? 10.330  -57.055 59.275  1.00 30.23  ? 181 ILE D C     1 
ATOM   8545  O O     . ILE D  1 119 ? 10.329  -57.860 58.351  1.00 30.64  ? 181 ILE D O     1 
ATOM   8546  C CB    . ILE D  1 119 ? 12.675  -56.449 59.482  1.00 30.36  ? 181 ILE D CB    1 
ATOM   8547  C CG1   . ILE D  1 119 ? 13.891  -56.295 60.380  1.00 30.92  ? 181 ILE D CG1   1 
ATOM   8548  C CG2   . ILE D  1 119 ? 12.323  -55.116 58.839  1.00 30.72  ? 181 ILE D CG2   1 
ATOM   8549  C CD1   . ILE D  1 119 ? 15.171  -56.081 59.606  1.00 31.32  ? 181 ILE D CD1   1 
ATOM   8550  N N     . ILE D  1 120 ? 9.373   -56.147 59.431  1.00 30.18  ? 182 ILE D N     1 
ATOM   8551  C CA    . ILE D  1 120 ? 8.310   -55.958 58.451  1.00 29.53  ? 182 ILE D CA    1 
ATOM   8552  C C     . ILE D  1 120 ? 8.560   -54.669 57.670  1.00 29.58  ? 182 ILE D C     1 
ATOM   8553  O O     . ILE D  1 120 ? 8.862   -53.641 58.257  1.00 29.72  ? 182 ILE D O     1 
ATOM   8554  C CB    . ILE D  1 120 ? 6.949   -55.866 59.137  1.00 29.84  ? 182 ILE D CB    1 
ATOM   8555  C CG1   . ILE D  1 120 ? 6.454   -57.259 59.465  1.00 31.17  ? 182 ILE D CG1   1 
ATOM   8556  C CG2   . ILE D  1 120 ? 5.935   -55.170 58.251  1.00 30.01  ? 182 ILE D CG2   1 
ATOM   8557  C CD1   . ILE D  1 120 ? 5.200   -57.273 60.323  1.00 32.37  ? 182 ILE D CD1   1 
ATOM   8558  N N     . ILE D  1 121 ? 8.436   -54.734 56.347  1.00 29.51  ? 183 ILE D N     1 
ATOM   8559  C CA    . ILE D  1 121 ? 8.504   -53.545 55.490  1.00 29.36  ? 183 ILE D CA    1 
ATOM   8560  C C     . ILE D  1 121 ? 7.186   -53.431 54.723  1.00 29.68  ? 183 ILE D C     1 
ATOM   8561  O O     . ILE D  1 121 ? 6.625   -54.460 54.316  1.00 28.75  ? 183 ILE D O     1 
ATOM   8562  C CB    . ILE D  1 121 ? 9.697   -53.601 54.503  1.00 29.00  ? 183 ILE D CB    1 
ATOM   8563  C CG1   . ILE D  1 121 ? 9.573   -54.782 53.541  1.00 28.80  ? 183 ILE D CG1   1 
ATOM   8564  C CG2   . ILE D  1 121 ? 11.014  -53.700 55.250  1.00 29.56  ? 183 ILE D CG2   1 
ATOM   8565  C CD1   . ILE D  1 121 ? 10.774  -54.957 52.643  1.00 28.92  ? 183 ILE D CD1   1 
ATOM   8566  N N     . SER D  1 122 ? 6.684   -52.205 54.527  1.00 29.29  ? 184 SER D N     1 
ATOM   8567  C CA    . SER D  1 122 ? 5.438   -52.022 53.777  1.00 30.16  ? 184 SER D CA    1 
ATOM   8568  C C     . SER D  1 122 ? 5.281   -50.589 53.326  1.00 30.61  ? 184 SER D C     1 
ATOM   8569  O O     . SER D  1 122 ? 5.664   -49.701 54.060  1.00 29.09  ? 184 SER D O     1 
ATOM   8570  C CB    . SER D  1 122 ? 4.236   -52.425 54.651  1.00 30.11  ? 184 SER D CB    1 
ATOM   8571  O OG    . SER D  1 122 ? 3.018   -52.462 53.916  1.00 29.44  ? 184 SER D OG    1 
ATOM   8572  N N     . GLU D  1 123 ? 4.765   -50.373 52.110  1.00 32.96  ? 185 GLU D N     1 
ATOM   8573  C CA    . GLU D  1 123 ? 4.163   -49.069 51.737  1.00 35.01  ? 185 GLU D CA    1 
ATOM   8574  C C     . GLU D  1 123 ? 2.650   -49.270 51.702  1.00 34.39  ? 185 GLU D C     1 
ATOM   8575  O O     . GLU D  1 123 ? 2.065   -49.720 50.724  1.00 34.10  ? 185 GLU D O     1 
ATOM   8576  C CB    . GLU D  1 123 ? 4.745   -48.474 50.432  1.00 35.82  ? 185 GLU D CB    1 
ATOM   8577  C CG    . GLU D  1 123 ? 3.724   -48.094 49.352  1.00 39.91  ? 185 GLU D CG    1 
ATOM   8578  C CD    . GLU D  1 123 ? 2.898   -46.866 49.646  1.00 42.13  ? 185 GLU D CD    1 
ATOM   8579  O OE1   . GLU D  1 123 ? 3.282   -46.196 50.620  1.00 43.02  ? 185 GLU D OE1   1 
ATOM   8580  O OE2   . GLU D  1 123 ? 1.883   -46.599 48.910  1.00 42.66  ? 185 GLU D OE2   1 
ATOM   8581  N N     . TRP D  1 124 ? 2.024   -48.955 52.818  1.00 35.25  ? 186 TRP D N     1 
ATOM   8582  C CA    . TRP D  1 124 ? 0.606   -49.265 53.022  1.00 34.56  ? 186 TRP D CA    1 
ATOM   8583  C C     . TRP D  1 124 ? -0.189  -48.005 52.865  1.00 32.80  ? 186 TRP D C     1 
ATOM   8584  O O     . TRP D  1 124 ? -1.399  -48.026 52.965  1.00 31.95  ? 186 TRP D O     1 
ATOM   8585  C CB    . TRP D  1 124 ? 0.372   -49.850 54.414  1.00 33.95  ? 186 TRP D CB    1 
ATOM   8586  C CG    . TRP D  1 124 ? 1.034   -49.064 55.465  1.00 33.99  ? 186 TRP D CG    1 
ATOM   8587  C CD1   . TRP D  1 124 ? 2.272   -49.290 55.995  1.00 35.09  ? 186 TRP D CD1   1 
ATOM   8588  C CD2   . TRP D  1 124 ? 0.538   -47.885 56.089  1.00 33.37  ? 186 TRP D CD2   1 
ATOM   8589  N NE1   . TRP D  1 124 ? 2.567   -48.330 56.925  1.00 36.33  ? 186 TRP D NE1   1 
ATOM   8590  C CE2   . TRP D  1 124 ? 1.516   -47.452 56.998  1.00 33.86  ? 186 TRP D CE2   1 
ATOM   8591  C CE3   . TRP D  1 124 ? -0.643  -47.159 55.980  1.00 32.96  ? 186 TRP D CE3   1 
ATOM   8592  C CZ2   . TRP D  1 124 ? 1.349   -46.325 57.786  1.00 32.22  ? 186 TRP D CZ2   1 
ATOM   8593  C CZ3   . TRP D  1 124 ? -0.807  -46.045 56.769  1.00 32.36  ? 186 TRP D CZ3   1 
ATOM   8594  C CH2   . TRP D  1 124 ? 0.183   -45.641 57.660  1.00 31.97  ? 186 TRP D CH2   1 
ATOM   8595  N N     . MET D  1 125 ? 0.494   -46.902 52.599  1.00 31.83  ? 187 MET D N     1 
ATOM   8596  C CA    . MET D  1 125 ? -0.152  -45.623 52.683  1.00 31.20  ? 187 MET D CA    1 
ATOM   8597  C C     . MET D  1 125 ? -1.028  -45.385 51.461  1.00 29.67  ? 187 MET D C     1 
ATOM   8598  O O     . MET D  1 125 ? -0.731  -45.815 50.321  1.00 29.08  ? 187 MET D O     1 
ATOM   8599  C CB    . MET D  1 125 ? 0.881   -44.503 52.870  1.00 31.79  ? 187 MET D CB    1 
ATOM   8600  C CG    . MET D  1 125 ? 1.598   -44.534 54.210  1.00 31.23  ? 187 MET D CG    1 
ATOM   8601  S SD    . MET D  1 125 ? 3.004   -45.633 54.274  1.00 30.18  ? 187 MET D SD    1 
ATOM   8602  C CE    . MET D  1 125 ? 4.227   -44.671 53.396  1.00 30.66  ? 187 MET D CE    1 
ATOM   8603  N N     . GLY D  1 126 ? -2.122  -44.701 51.737  1.00 28.44  ? 188 GLY D N     1 
ATOM   8604  C CA    . GLY D  1 126 ? -3.070  -44.315 50.725  1.00 29.97  ? 188 GLY D CA    1 
ATOM   8605  C C     . GLY D  1 126 ? -3.241  -42.836 50.867  1.00 30.03  ? 188 GLY D C     1 
ATOM   8606  O O     . GLY D  1 126 ? -2.611  -42.244 51.739  1.00 30.68  ? 188 GLY D O     1 
ATOM   8607  N N     . TYR D  1 127 ? -4.053  -42.238 49.992  1.00 31.11  ? 189 TYR D N     1 
ATOM   8608  C CA    . TYR D  1 127 ? -4.338  -40.788 50.044  1.00 31.43  ? 189 TYR D CA    1 
ATOM   8609  C C     . TYR D  1 127 ? -4.922  -40.394 51.410  1.00 30.35  ? 189 TYR D C     1 
ATOM   8610  O O     . TYR D  1 127 ? -5.597  -41.184 52.073  1.00 28.62  ? 189 TYR D O     1 
ATOM   8611  C CB    . TYR D  1 127 ? -5.312  -40.389 48.940  1.00 32.00  ? 189 TYR D CB    1 
ATOM   8612  C CG    . TYR D  1 127 ? -4.858  -40.689 47.545  1.00 32.54  ? 189 TYR D CG    1 
ATOM   8613  C CD1   . TYR D  1 127 ? -3.693  -40.143 47.029  1.00 33.42  ? 189 TYR D CD1   1 
ATOM   8614  C CD2   . TYR D  1 127 ? -5.608  -41.507 46.719  1.00 33.80  ? 189 TYR D CD2   1 
ATOM   8615  C CE1   . TYR D  1 127 ? -3.290  -40.426 45.728  1.00 33.52  ? 189 TYR D CE1   1 
ATOM   8616  C CE2   . TYR D  1 127 ? -5.206  -41.788 45.418  1.00 33.72  ? 189 TYR D CE2   1 
ATOM   8617  C CZ    . TYR D  1 127 ? -4.060  -41.247 44.937  1.00 32.25  ? 189 TYR D CZ    1 
ATOM   8618  O OH    . TYR D  1 127 ? -3.724  -41.537 43.663  1.00 31.49  ? 189 TYR D OH    1 
ATOM   8619  N N     . CYS D  1 128 ? -4.635  -39.178 51.849  1.00 30.87  ? 190 CYS D N     1 
ATOM   8620  C CA    . CYS D  1 128 ? -5.023  -38.770 53.202  1.00 30.18  ? 190 CYS D CA    1 
ATOM   8621  C C     . CYS D  1 128 ? -4.605  -39.819 54.234  1.00 27.50  ? 190 CYS D C     1 
ATOM   8622  O O     . CYS D  1 128 ? -5.309  -40.073 55.198  1.00 25.40  ? 190 CYS D O     1 
ATOM   8623  C CB    . CYS D  1 128 ? -6.527  -38.554 53.267  1.00 30.62  ? 190 CYS D CB    1 
ATOM   8624  S SG    . CYS D  1 128 ? -7.053  -37.652 54.738  1.00 31.74  ? 190 CYS D SG    1 
ATOM   8625  N N     . LEU D  1 129 ? -3.446  -40.417 53.989  1.00 26.69  ? 191 LEU D N     1 
ATOM   8626  C CA    . LEU D  1 129 ? -2.861  -41.481 54.806  1.00 26.73  ? 191 LEU D CA    1 
ATOM   8627  C C     . LEU D  1 129 ? -3.612  -42.831 54.821  1.00 27.35  ? 191 LEU D C     1 
ATOM   8628  O O     . LEU D  1 129 ? -3.010  -43.876 54.538  1.00 29.27  ? 191 LEU D O     1 
ATOM   8629  C CB    . LEU D  1 129 ? -2.593  -41.003 56.239  1.00 25.52  ? 191 LEU D CB    1 
ATOM   8630  C CG    . LEU D  1 129 ? -1.720  -41.925 57.092  1.00 24.39  ? 191 LEU D CG    1 
ATOM   8631  C CD1   . LEU D  1 129 ? -0.411  -42.228 56.390  1.00 24.41  ? 191 LEU D CD1   1 
ATOM   8632  C CD2   . LEU D  1 129 ? -1.446  -41.268 58.429  1.00 24.35  ? 191 LEU D CD2   1 
ATOM   8633  N N     . PHE D  1 130 ? -4.899  -42.822 55.146  1.00 26.46  ? 192 PHE D N     1 
ATOM   8634  C CA    . PHE D  1 130 ? -5.586  -44.055 55.511  1.00 26.31  ? 192 PHE D CA    1 
ATOM   8635  C C     . PHE D  1 130 ? -6.489  -44.597 54.440  1.00 27.49  ? 192 PHE D C     1 
ATOM   8636  O O     . PHE D  1 130 ? -7.122  -45.626 54.632  1.00 27.46  ? 192 PHE D O     1 
ATOM   8637  C CB    . PHE D  1 130 ? -6.414  -43.823 56.765  1.00 25.73  ? 192 PHE D CB    1 
ATOM   8638  C CG    . PHE D  1 130 ? -5.601  -43.437 57.957  1.00 25.36  ? 192 PHE D CG    1 
ATOM   8639  C CD1   . PHE D  1 130 ? -4.671  -44.314 58.494  1.00 24.51  ? 192 PHE D CD1   1 
ATOM   8640  C CD2   . PHE D  1 130 ? -5.755  -42.184 58.536  1.00 26.58  ? 192 PHE D CD2   1 
ATOM   8641  C CE1   . PHE D  1 130 ? -3.918  -43.964 59.589  1.00 24.72  ? 192 PHE D CE1   1 
ATOM   8642  C CE2   . PHE D  1 130 ? -5.001  -41.816 59.644  1.00 27.19  ? 192 PHE D CE2   1 
ATOM   8643  C CZ    . PHE D  1 130 ? -4.084  -42.715 60.174  1.00 26.60  ? 192 PHE D CZ    1 
ATOM   8644  N N     . TYR D  1 131 ? -6.562  -43.928 53.305  1.00 30.00  ? 193 TYR D N     1 
ATOM   8645  C CA    . TYR D  1 131 ? -7.396  -44.439 52.233  1.00 33.09  ? 193 TYR D CA    1 
ATOM   8646  C C     . TYR D  1 131 ? -6.974  -45.865 51.847  1.00 32.52  ? 193 TYR D C     1 
ATOM   8647  O O     . TYR D  1 131 ? -5.803  -46.214 51.929  1.00 33.15  ? 193 TYR D O     1 
ATOM   8648  C CB    . TYR D  1 131 ? -7.370  -43.502 51.027  1.00 35.01  ? 193 TYR D CB    1 
ATOM   8649  C CG    . TYR D  1 131 ? -8.324  -43.904 49.932  1.00 36.65  ? 193 TYR D CG    1 
ATOM   8650  C CD1   . TYR D  1 131 ? -9.700  -43.951 50.158  1.00 37.09  ? 193 TYR D CD1   1 
ATOM   8651  C CD2   . TYR D  1 131 ? -7.856  -44.234 48.675  1.00 38.56  ? 193 TYR D CD2   1 
ATOM   8652  C CE1   . TYR D  1 131 ? -10.576 -44.317 49.157  1.00 38.80  ? 193 TYR D CE1   1 
ATOM   8653  C CE2   . TYR D  1 131 ? -8.728  -44.590 47.665  1.00 39.90  ? 193 TYR D CE2   1 
ATOM   8654  C CZ    . TYR D  1 131 ? -10.085 -44.629 47.913  1.00 39.92  ? 193 TYR D CZ    1 
ATOM   8655  O OH    . TYR D  1 131 ? -10.956 -44.986 46.911  1.00 41.73  ? 193 TYR D OH    1 
ATOM   8656  N N     . GLU D  1 132 ? -7.965  -46.673 51.479  1.00 32.98  ? 194 GLU D N     1 
ATOM   8657  C CA    . GLU D  1 132 ? -7.835  -48.113 51.180  1.00 33.99  ? 194 GLU D CA    1 
ATOM   8658  C C     . GLU D  1 132 ? -7.676  -48.990 52.422  1.00 33.85  ? 194 GLU D C     1 
ATOM   8659  O O     . GLU D  1 132 ? -7.715  -50.219 52.335  1.00 30.78  ? 194 GLU D O     1 
ATOM   8660  C CB    . GLU D  1 132 ? -6.735  -48.389 50.154  1.00 35.37  ? 194 GLU D CB    1 
ATOM   8661  C CG    . GLU D  1 132 ? -7.007  -47.754 48.803  1.00 36.45  ? 194 GLU D CG    1 
ATOM   8662  C CD    . GLU D  1 132 ? -5.835  -47.850 47.871  1.00 37.56  ? 194 GLU D CD    1 
ATOM   8663  O OE1   . GLU D  1 132 ? -4.708  -48.129 48.344  1.00 40.21  ? 194 GLU D OE1   1 
ATOM   8664  O OE2   . GLU D  1 132 ? -6.048  -47.630 46.670  1.00 36.92  ? 194 GLU D OE2   1 
ATOM   8665  N N     . SER D  1 133 ? -7.525  -48.343 53.575  1.00 35.42  ? 195 SER D N     1 
ATOM   8666  C CA    . SER D  1 133 ? -7.461  -49.017 54.859  1.00 35.35  ? 195 SER D CA    1 
ATOM   8667  C C     . SER D  1 133 ? -6.384  -50.104 54.942  1.00 36.08  ? 195 SER D C     1 
ATOM   8668  O O     . SER D  1 133 ? -6.577  -51.090 55.663  1.00 39.13  ? 195 SER D O     1 
ATOM   8669  C CB    . SER D  1 133 ? -8.837  -49.586 55.195  1.00 34.27  ? 195 SER D CB    1 
ATOM   8670  O OG    . SER D  1 133 ? -9.746  -48.525 55.415  1.00 34.83  ? 195 SER D OG    1 
ATOM   8671  N N     . MET D  1 134 ? -5.249  -49.928 54.249  1.00 33.78  ? 196 MET D N     1 
ATOM   8672  C CA    . MET D  1 134 ? -4.229  -50.985 54.224  1.00 31.45  ? 196 MET D CA    1 
ATOM   8673  C C     . MET D  1 134 ? -3.435  -51.106 55.518  1.00 31.49  ? 196 MET D C     1 
ATOM   8674  O O     . MET D  1 134 ? -2.852  -52.152 55.789  1.00 31.71  ? 196 MET D O     1 
ATOM   8675  C CB    . MET D  1 134 ? -3.261  -50.825 53.067  1.00 30.09  ? 196 MET D CB    1 
ATOM   8676  C CG    . MET D  1 134 ? -2.278  -51.969 53.010  1.00 29.88  ? 196 MET D CG    1 
ATOM   8677  S SD    . MET D  1 134 ? -1.356  -52.012 51.494  1.00 31.66  ? 196 MET D SD    1 
ATOM   8678  C CE    . MET D  1 134 ? -0.112  -53.220 51.947  1.00 33.32  ? 196 MET D CE    1 
ATOM   8679  N N     . LEU D  1 135 ? -3.407  -50.060 56.327  1.00 31.71  ? 197 LEU D N     1 
ATOM   8680  C CA    . LEU D  1 135 ? -2.751  -50.173 57.615  1.00 33.28  ? 197 LEU D CA    1 
ATOM   8681  C C     . LEU D  1 135 ? -3.312  -51.357 58.434  1.00 33.77  ? 197 LEU D C     1 
ATOM   8682  O O     . LEU D  1 135 ? -2.569  -51.998 59.173  1.00 37.40  ? 197 LEU D O     1 
ATOM   8683  C CB    . LEU D  1 135 ? -2.903  -48.875 58.400  1.00 34.33  ? 197 LEU D CB    1 
ATOM   8684  C CG    . LEU D  1 135 ? -2.202  -48.815 59.759  1.00 34.40  ? 197 LEU D CG    1 
ATOM   8685  C CD1   . LEU D  1 135 ? -0.742  -49.228 59.643  1.00 34.43  ? 197 LEU D CD1   1 
ATOM   8686  C CD2   . LEU D  1 135 ? -2.342  -47.413 60.338  1.00 34.35  ? 197 LEU D CD2   1 
ATOM   8687  N N     . ASN D  1 136 ? -4.608  -51.644 58.294  1.00 32.53  ? 198 ASN D N     1 
ATOM   8688  C CA    . ASN D  1 136 ? -5.248  -52.779 58.971  1.00 32.02  ? 198 ASN D CA    1 
ATOM   8689  C C     . ASN D  1 136 ? -4.583  -54.109 58.647  1.00 29.70  ? 198 ASN D C     1 
ATOM   8690  O O     . ASN D  1 136 ? -4.442  -54.968 59.515  1.00 29.64  ? 198 ASN D O     1 
ATOM   8691  C CB    . ASN D  1 136 ? -6.736  -52.887 58.601  1.00 33.94  ? 198 ASN D CB    1 
ATOM   8692  C CG    . ASN D  1 136 ? -7.535  -51.631 58.929  1.00 36.19  ? 198 ASN D CG    1 
ATOM   8693  O OD1   . ASN D  1 136 ? -7.011  -50.645 59.447  1.00 38.87  ? 198 ASN D OD1   1 
ATOM   8694  N ND2   . ASN D  1 136 ? -8.822  -51.671 58.632  1.00 38.37  ? 198 ASN D ND2   1 
ATOM   8695  N N     . THR D  1 137 ? -4.198  -54.281 57.391  1.00 27.32  ? 199 THR D N     1 
ATOM   8696  C CA    . THR D  1 137 ? -3.445  -55.449 56.997  1.00 27.87  ? 199 THR D CA    1 
ATOM   8697  C C     . THR D  1 137 ? -2.045  -55.501 57.654  1.00 29.31  ? 199 THR D C     1 
ATOM   8698  O O     . THR D  1 137 ? -1.595  -56.571 58.100  1.00 29.32  ? 199 THR D O     1 
ATOM   8699  C CB    . THR D  1 137 ? -3.307  -55.511 55.473  1.00 27.84  ? 199 THR D CB    1 
ATOM   8700  O OG1   . THR D  1 137 ? -4.603  -55.654 54.903  1.00 28.00  ? 199 THR D OG1   1 
ATOM   8701  C CG2   . THR D  1 137 ? -2.452  -56.694 55.043  1.00 27.57  ? 199 THR D CG2   1 
ATOM   8702  N N     . VAL D  1 138 ? -1.363  -54.355 57.716  1.00 29.46  ? 200 VAL D N     1 
ATOM   8703  C CA    . VAL D  1 138 ? -0.057  -54.276 58.382  1.00 28.62  ? 200 VAL D CA    1 
ATOM   8704  C C     . VAL D  1 138 ? -0.203  -54.671 59.871  1.00 28.78  ? 200 VAL D C     1 
ATOM   8705  O O     . VAL D  1 138 ? 0.551   -55.497 60.410  1.00 27.54  ? 200 VAL D O     1 
ATOM   8706  C CB    . VAL D  1 138 ? 0.556   -52.869 58.210  1.00 28.23  ? 200 VAL D CB    1 
ATOM   8707  C CG1   . VAL D  1 138 ? 1.817   -52.713 59.040  1.00 28.37  ? 200 VAL D CG1   1 
ATOM   8708  C CG2   . VAL D  1 138 ? 0.908   -52.643 56.752  1.00 29.13  ? 200 VAL D CG2   1 
ATOM   8709  N N     . ILE D  1 139 ? -1.205  -54.090 60.519  1.00 28.72  ? 201 ILE D N     1 
ATOM   8710  C CA    . ILE D  1 139 ? -1.495  -54.386 61.912  1.00 29.21  ? 201 ILE D CA    1 
ATOM   8711  C C     . ILE D  1 139 ? -1.595  -55.885 62.087  1.00 28.67  ? 201 ILE D C     1 
ATOM   8712  O O     . ILE D  1 139 ? -0.976  -56.437 62.983  1.00 28.16  ? 201 ILE D O     1 
ATOM   8713  C CB    . ILE D  1 139 ? -2.841  -53.769 62.359  1.00 30.36  ? 201 ILE D CB    1 
ATOM   8714  C CG1   . ILE D  1 139 ? -2.849  -52.231 62.138  1.00 30.56  ? 201 ILE D CG1   1 
ATOM   8715  C CG2   . ILE D  1 139 ? -3.172  -54.217 63.787  1.00 30.22  ? 201 ILE D CG2   1 
ATOM   8716  C CD1   . ILE D  1 139 ? -2.870  -51.372 63.377  1.00 31.46  ? 201 ILE D CD1   1 
ATOM   8717  N N     . PHE D  1 140 ? -2.404  -56.518 61.234  1.00 28.49  ? 202 PHE D N     1 
ATOM   8718  C CA    . PHE D  1 140 ? -2.612  -57.966 61.268  1.00 28.62  ? 202 PHE D CA    1 
ATOM   8719  C C     . PHE D  1 140 ? -1.290  -58.734 61.161  1.00 28.32  ? 202 PHE D C     1 
ATOM   8720  O O     . PHE D  1 140 ? -1.016  -59.644 61.932  1.00 26.39  ? 202 PHE D O     1 
ATOM   8721  C CB    . PHE D  1 140 ? -3.551  -58.400 60.147  1.00 27.68  ? 202 PHE D CB    1 
ATOM   8722  C CG    . PHE D  1 140 ? -3.805  -59.880 60.118  1.00 28.06  ? 202 PHE D CG    1 
ATOM   8723  C CD1   . PHE D  1 140 ? -2.865  -60.756 59.602  1.00 28.76  ? 202 PHE D CD1   1 
ATOM   8724  C CD2   . PHE D  1 140 ? -4.990  -60.403 60.609  1.00 28.92  ? 202 PHE D CD2   1 
ATOM   8725  C CE1   . PHE D  1 140 ? -3.101  -62.131 59.576  1.00 29.27  ? 202 PHE D CE1   1 
ATOM   8726  C CE2   . PHE D  1 140 ? -5.240  -61.773 60.586  1.00 29.31  ? 202 PHE D CE2   1 
ATOM   8727  C CZ    . PHE D  1 140 ? -4.292  -62.641 60.066  1.00 29.09  ? 202 PHE D CZ    1 
ATOM   8728  N N     . ALA D  1 141 ? -0.485  -58.353 60.187  1.00 29.38  ? 203 ALA D N     1 
ATOM   8729  C CA    . ALA D  1 141 ? 0.818   -58.977 59.971  1.00 30.92  ? 203 ALA D CA    1 
ATOM   8730  C C     . ALA D  1 141 ? 1.772   -58.803 61.158  1.00 31.34  ? 203 ALA D C     1 
ATOM   8731  O O     . ALA D  1 141 ? 2.458   -59.753 61.572  1.00 29.30  ? 203 ALA D O     1 
ATOM   8732  C CB    . ALA D  1 141 ? 1.452   -58.395 58.714  1.00 31.35  ? 203 ALA D CB    1 
ATOM   8733  N N     . ARG D  1 142 ? 1.824   -57.571 61.673  1.00 32.59  ? 204 ARG D N     1 
ATOM   8734  C CA    . ARG D  1 142 ? 2.648   -57.252 62.825  1.00 32.77  ? 204 ARG D CA    1 
ATOM   8735  C C     . ARG D  1 142 ? 2.276   -58.224 63.923  1.00 33.84  ? 204 ARG D C     1 
ATOM   8736  O O     . ARG D  1 142 ? 3.110   -59.023 64.348  1.00 35.20  ? 204 ARG D O     1 
ATOM   8737  C CB    . ARG D  1 142 ? 2.414   -55.812 63.278  1.00 32.12  ? 204 ARG D CB    1 
ATOM   8738  C CG    . ARG D  1 142 ? 3.215   -55.406 64.505  1.00 32.14  ? 204 ARG D CG    1 
ATOM   8739  C CD    . ARG D  1 142 ? 2.626   -54.159 65.146  1.00 32.61  ? 204 ARG D CD    1 
ATOM   8740  N NE    . ARG D  1 142 ? 1.275   -54.409 65.634  1.00 33.76  ? 204 ARG D NE    1 
ATOM   8741  C CZ    . ARG D  1 142 ? 0.383   -53.474 65.969  1.00 35.55  ? 204 ARG D CZ    1 
ATOM   8742  N NH1   . ARG D  1 142 ? 0.648   -52.171 65.883  1.00 37.33  ? 204 ARG D NH1   1 
ATOM   8743  N NH2   . ARG D  1 142 ? -0.808  -53.854 66.391  1.00 35.33  ? 204 ARG D NH2   1 
ATOM   8744  N N     . ASP D  1 143 ? 1.003   -58.165 64.332  1.00 34.49  ? 205 ASP D N     1 
ATOM   8745  C CA    . ASP D  1 143 ? 0.450   -58.964 65.434  1.00 33.33  ? 205 ASP D CA    1 
ATOM   8746  C C     . ASP D  1 143 ? 0.803   -60.438 65.261  1.00 33.86  ? 205 ASP D C     1 
ATOM   8747  O O     . ASP D  1 143 ? 1.328   -61.062 66.173  1.00 34.68  ? 205 ASP D O     1 
ATOM   8748  C CB    . ASP D  1 143 ? -1.089  -58.766 65.551  1.00 32.67  ? 205 ASP D CB    1 
ATOM   8749  C CG    . ASP D  1 143 ? -1.491  -57.380 66.129  1.00 31.59  ? 205 ASP D CG    1 
ATOM   8750  O OD1   . ASP D  1 143 ? -0.593  -56.615 66.537  1.00 30.25  ? 205 ASP D OD1   1 
ATOM   8751  O OD2   . ASP D  1 143 ? -2.704  -57.059 66.186  1.00 29.50  ? 205 ASP D OD2   1 
ATOM   8752  N N     . LYS D  1 144 ? 0.558   -60.977 64.077  1.00 35.35  ? 206 LYS D N     1 
ATOM   8753  C CA    . LYS D  1 144 ? 0.783   -62.399 63.821  1.00 36.09  ? 206 LYS D CA    1 
ATOM   8754  C C     . LYS D  1 144 ? 2.263   -62.790 63.748  1.00 36.67  ? 206 LYS D C     1 
ATOM   8755  O O     . LYS D  1 144 ? 2.678   -63.731 64.428  1.00 38.26  ? 206 LYS D O     1 
ATOM   8756  C CB    . LYS D  1 144 ? 0.072   -62.806 62.536  1.00 36.46  ? 206 LYS D CB    1 
ATOM   8757  C CG    . LYS D  1 144 ? 0.153   -64.276 62.215  1.00 37.33  ? 206 LYS D CG    1 
ATOM   8758  C CD    . LYS D  1 144 ? -0.854  -64.634 61.146  1.00 40.02  ? 206 LYS D CD    1 
ATOM   8759  C CE    . LYS D  1 144 ? -0.910  -66.137 60.914  1.00 42.97  ? 206 LYS D CE    1 
ATOM   8760  N NZ    . LYS D  1 144 ? -2.092  -66.502 60.084  1.00 46.38  ? 206 LYS D NZ    1 
ATOM   8761  N N     . TRP D  1 145 ? 3.054   -62.083 62.940  1.00 36.18  ? 207 TRP D N     1 
ATOM   8762  C CA    . TRP D  1 145 ? 4.400   -62.576 62.590  1.00 37.93  ? 207 TRP D CA    1 
ATOM   8763  C C     . TRP D  1 145 ? 5.600   -61.820 63.180  1.00 38.37  ? 207 TRP D C     1 
ATOM   8764  O O     . TRP D  1 145 ? 6.713   -62.376 63.231  1.00 35.41  ? 207 TRP D O     1 
ATOM   8765  C CB    . TRP D  1 145 ? 4.583   -62.639 61.067  1.00 37.81  ? 207 TRP D CB    1 
ATOM   8766  C CG    . TRP D  1 145 ? 3.773   -63.687 60.396  1.00 38.43  ? 207 TRP D CG    1 
ATOM   8767  C CD1   . TRP D  1 145 ? 3.874   -65.039 60.549  1.00 37.94  ? 207 TRP D CD1   1 
ATOM   8768  C CD2   . TRP D  1 145 ? 2.736   -63.469 59.441  1.00 40.58  ? 207 TRP D CD2   1 
ATOM   8769  N NE1   . TRP D  1 145 ? 2.959   -65.678 59.746  1.00 38.43  ? 207 TRP D NE1   1 
ATOM   8770  C CE2   . TRP D  1 145 ? 2.239   -64.738 59.061  1.00 39.88  ? 207 TRP D CE2   1 
ATOM   8771  C CE3   . TRP D  1 145 ? 2.171   -62.321 58.873  1.00 41.26  ? 207 TRP D CE3   1 
ATOM   8772  C CZ2   . TRP D  1 145 ? 1.198   -64.890 58.141  1.00 41.54  ? 207 TRP D CZ2   1 
ATOM   8773  C CZ3   . TRP D  1 145 ? 1.143   -62.468 57.962  1.00 41.89  ? 207 TRP D CZ3   1 
ATOM   8774  C CH2   . TRP D  1 145 ? 0.663   -63.744 57.603  1.00 42.82  ? 207 TRP D CH2   1 
ATOM   8775  N N     . LEU D  1 146 ? 5.406   -60.571 63.598  1.00 38.13  ? 208 LEU D N     1 
ATOM   8776  C CA    . LEU D  1 146 ? 6.539   -59.795 64.097  1.00 39.53  ? 208 LEU D CA    1 
ATOM   8777  C C     . LEU D  1 146 ? 7.006   -60.301 65.475  1.00 40.67  ? 208 LEU D C     1 
ATOM   8778  O O     . LEU D  1 146 ? 6.201   -60.407 66.410  1.00 44.11  ? 208 LEU D O     1 
ATOM   8779  C CB    . LEU D  1 146 ? 6.203   -58.302 64.184  1.00 38.99  ? 208 LEU D CB    1 
ATOM   8780  C CG    . LEU D  1 146 ? 7.407   -57.386 64.456  1.00 37.29  ? 208 LEU D CG    1 
ATOM   8781  C CD1   . LEU D  1 146 ? 8.431   -57.494 63.332  1.00 36.46  ? 208 LEU D CD1   1 
ATOM   8782  C CD2   . LEU D  1 146 ? 6.953   -55.946 64.637  1.00 37.41  ? 208 LEU D CD2   1 
ATOM   8783  N N     . LYS D  1 147 ? 8.298   -60.606 65.600  1.00 39.88  ? 209 LYS D N     1 
ATOM   8784  C CA    . LYS D  1 147 ? 8.848   -61.084 66.868  1.00 39.83  ? 209 LYS D CA    1 
ATOM   8785  C C     . LYS D  1 147 ? 8.800   -59.929 67.842  1.00 37.65  ? 209 LYS D C     1 
ATOM   8786  O O     . LYS D  1 147 ? 8.705   -58.782 67.428  1.00 38.62  ? 209 LYS D O     1 
ATOM   8787  C CB    . LYS D  1 147 ? 10.294  -61.551 66.707  1.00 42.53  ? 209 LYS D CB    1 
ATOM   8788  C CG    . LYS D  1 147 ? 11.310  -60.409 66.607  1.00 46.09  ? 209 LYS D CG    1 
ATOM   8789  C CD    . LYS D  1 147 ? 12.756  -60.883 66.448  1.00 48.29  ? 209 LYS D CD    1 
ATOM   8790  C CE    . LYS D  1 147 ? 13.724  -59.702 66.489  1.00 50.07  ? 209 LYS D CE    1 
ATOM   8791  N NZ    . LYS D  1 147 ? 15.031  -59.960 65.817  1.00 50.28  ? 209 LYS D NZ    1 
ATOM   8792  N N     . PRO D  1 148 ? 8.874   -60.220 69.140  1.00 35.61  ? 210 PRO D N     1 
ATOM   8793  C CA    . PRO D  1 148 ? 8.997   -59.112 70.093  1.00 34.57  ? 210 PRO D CA    1 
ATOM   8794  C C     . PRO D  1 148 ? 10.297  -58.336 69.867  1.00 33.32  ? 210 PRO D C     1 
ATOM   8795  O O     . PRO D  1 148 ? 11.348  -58.934 69.642  1.00 32.09  ? 210 PRO D O     1 
ATOM   8796  C CB    . PRO D  1 148 ? 8.986   -59.803 71.461  1.00 35.21  ? 210 PRO D CB    1 
ATOM   8797  C CG    . PRO D  1 148 ? 8.420   -61.165 71.204  1.00 35.64  ? 210 PRO D CG    1 
ATOM   8798  C CD    . PRO D  1 148 ? 8.786   -61.532 69.797  1.00 35.14  ? 210 PRO D CD    1 
ATOM   8799  N N     . GLY D  1 149 ? 10.203  -57.009 69.889  1.00 33.11  ? 211 GLY D N     1 
ATOM   8800  C CA    . GLY D  1 149 ? 11.350  -56.139 69.619  1.00 32.54  ? 211 GLY D CA    1 
ATOM   8801  C C     . GLY D  1 149 ? 11.720  -56.024 68.152  1.00 32.23  ? 211 GLY D C     1 
ATOM   8802  O O     . GLY D  1 149 ? 12.657  -55.310 67.791  1.00 31.51  ? 211 GLY D O     1 
ATOM   8803  N N     . GLY D  1 150 ? 10.966  -56.697 67.291  1.00 32.18  ? 212 GLY D N     1 
ATOM   8804  C CA    . GLY D  1 150 ? 11.190  -56.604 65.866  1.00 32.56  ? 212 GLY D CA    1 
ATOM   8805  C C     . GLY D  1 150 ? 10.992  -55.168 65.426  1.00 33.67  ? 212 GLY D C     1 
ATOM   8806  O O     . GLY D  1 150 ? 10.464  -54.355 66.196  1.00 34.89  ? 212 GLY D O     1 
ATOM   8807  N N     . LEU D  1 151 ? 11.398  -54.870 64.189  1.00 33.48  ? 213 LEU D N     1 
ATOM   8808  C CA    . LEU D  1 151 ? 11.382  -53.512 63.646  1.00 33.13  ? 213 LEU D CA    1 
ATOM   8809  C C     . LEU D  1 151 ? 10.416  -53.370 62.492  1.00 32.67  ? 213 LEU D C     1 
ATOM   8810  O O     . LEU D  1 151 ? 10.145  -54.342 61.801  1.00 31.59  ? 213 LEU D O     1 
ATOM   8811  C CB    . LEU D  1 151 ? 12.781  -53.122 63.151  1.00 33.86  ? 213 LEU D CB    1 
ATOM   8812  C CG    . LEU D  1 151 ? 13.949  -53.282 64.135  1.00 34.09  ? 213 LEU D CG    1 
ATOM   8813  C CD1   . LEU D  1 151 ? 15.236  -52.854 63.460  1.00 33.04  ? 213 LEU D CD1   1 
ATOM   8814  C CD2   . LEU D  1 151 ? 13.744  -52.503 65.428  1.00 35.23  ? 213 LEU D CD2   1 
ATOM   8815  N N     . MET D  1 152 ? 9.946   -52.135 62.268  1.00 32.86  ? 214 MET D N     1 
ATOM   8816  C CA    . MET D  1 152 ? 9.061   -51.810 61.152  1.00 31.86  ? 214 MET D CA    1 
ATOM   8817  C C     . MET D  1 152 ? 9.549   -50.619 60.311  1.00 32.54  ? 214 MET D C     1 
ATOM   8818  O O     . MET D  1 152 ? 10.123  -49.660 60.820  1.00 34.32  ? 214 MET D O     1 
ATOM   8819  C CB    . MET D  1 152 ? 7.644   -51.604 61.653  1.00 31.38  ? 214 MET D CB    1 
ATOM   8820  C CG    . MET D  1 152 ? 7.092   -52.871 62.292  1.00 32.61  ? 214 MET D CG    1 
ATOM   8821  S SD    . MET D  1 152 ? 5.377   -52.793 62.835  1.00 33.36  ? 214 MET D SD    1 
ATOM   8822  C CE    . MET D  1 152 ? 4.497   -53.229 61.330  1.00 33.81  ? 214 MET D CE    1 
ATOM   8823  N N     . PHE D  1 153 ? 9.349   -50.740 58.998  1.00 32.94  ? 215 PHE D N     1 
ATOM   8824  C CA    . PHE D  1 153 ? 9.827   -49.790 58.001  1.00 32.19  ? 215 PHE D CA    1 
ATOM   8825  C C     . PHE D  1 153 ? 8.667   -49.412 57.094  1.00 32.15  ? 215 PHE D C     1 
ATOM   8826  O O     . PHE D  1 153 ? 8.232   -50.232 56.279  1.00 31.99  ? 215 PHE D O     1 
ATOM   8827  C CB    . PHE D  1 153 ? 10.945  -50.419 57.157  1.00 31.75  ? 215 PHE D CB    1 
ATOM   8828  C CG    . PHE D  1 153 ? 12.307  -50.388 57.820  1.00 31.72  ? 215 PHE D CG    1 
ATOM   8829  C CD1   . PHE D  1 153 ? 12.581  -51.185 58.915  1.00 32.23  ? 215 PHE D CD1   1 
ATOM   8830  C CD2   . PHE D  1 153 ? 13.309  -49.571 57.344  1.00 31.26  ? 215 PHE D CD2   1 
ATOM   8831  C CE1   . PHE D  1 153 ? 13.823  -51.168 59.520  1.00 31.31  ? 215 PHE D CE1   1 
ATOM   8832  C CE2   . PHE D  1 153 ? 14.548  -49.543 57.948  1.00 30.63  ? 215 PHE D CE2   1 
ATOM   8833  C CZ    . PHE D  1 153 ? 14.806  -50.347 59.032  1.00 30.91  ? 215 PHE D CZ    1 
ATOM   8834  N N     . PRO D  1 154 ? 8.126   -48.205 57.251  1.00 33.20  ? 216 PRO D N     1 
ATOM   8835  C CA    . PRO D  1 154 ? 8.447   -47.268 58.324  1.00 34.16  ? 216 PRO D CA    1 
ATOM   8836  C C     . PRO D  1 154 ? 7.706   -47.613 59.619  1.00 34.51  ? 216 PRO D C     1 
ATOM   8837  O O     . PRO D  1 154 ? 6.935   -48.567 59.632  1.00 37.29  ? 216 PRO D O     1 
ATOM   8838  C CB    . PRO D  1 154 ? 7.936   -45.944 57.764  1.00 34.46  ? 216 PRO D CB    1 
ATOM   8839  C CG    . PRO D  1 154 ? 6.805   -46.320 56.846  1.00 35.02  ? 216 PRO D CG    1 
ATOM   8840  C CD    . PRO D  1 154 ? 6.916   -47.793 56.533  1.00 35.10  ? 216 PRO D CD    1 
ATOM   8841  N N     . ASP D  1 155 ? 7.921   -46.834 60.681  1.00 33.95  ? 217 ASP D N     1 
ATOM   8842  C CA    . ASP D  1 155 ? 7.288   -47.097 61.981  1.00 33.92  ? 217 ASP D CA    1 
ATOM   8843  C C     . ASP D  1 155 ? 6.566   -45.888 62.621  1.00 33.67  ? 217 ASP D C     1 
ATOM   8844  O O     . ASP D  1 155 ? 5.941   -46.019 63.680  1.00 32.26  ? 217 ASP D O     1 
ATOM   8845  C CB    . ASP D  1 155 ? 8.310   -47.717 62.961  1.00 35.34  ? 217 ASP D CB    1 
ATOM   8846  C CG    . ASP D  1 155 ? 9.637   -46.969 62.987  1.00 36.67  ? 217 ASP D CG    1 
ATOM   8847  O OD1   . ASP D  1 155 ? 9.638   -45.764 62.670  1.00 38.27  ? 217 ASP D OD1   1 
ATOM   8848  O OD2   . ASP D  1 155 ? 10.681  -47.572 63.318  1.00 37.40  ? 217 ASP D OD2   1 
ATOM   8849  N N     . ARG D  1 156 ? 6.646   -44.717 62.002  1.00 33.71  ? 218 ARG D N     1 
ATOM   8850  C CA    . ARG D  1 156 ? 5.875   -43.571 62.479  1.00 34.26  ? 218 ARG D CA    1 
ATOM   8851  C C     . ARG D  1 156 ? 5.166   -42.972 61.293  1.00 31.15  ? 218 ARG D C     1 
ATOM   8852  O O     . ARG D  1 156 ? 5.684   -43.007 60.183  1.00 31.39  ? 218 ARG D O     1 
ATOM   8853  C CB    . ARG D  1 156 ? 6.771   -42.516 63.160  1.00 37.80  ? 218 ARG D CB    1 
ATOM   8854  C CG    . ARG D  1 156 ? 6.796   -42.544 64.698  1.00 41.93  ? 218 ARG D CG    1 
ATOM   8855  C CD    . ARG D  1 156 ? 7.285   -41.219 65.290  1.00 44.95  ? 218 ARG D CD    1 
ATOM   8856  N NE    . ARG D  1 156 ? 6.271   -40.146 65.182  1.00 48.56  ? 218 ARG D NE    1 
ATOM   8857  C CZ    . ARG D  1 156 ? 6.223   -39.186 64.236  1.00 49.42  ? 218 ARG D CZ    1 
ATOM   8858  N NH1   . ARG D  1 156 ? 7.143   -39.101 63.277  1.00 48.60  ? 218 ARG D NH1   1 
ATOM   8859  N NH2   . ARG D  1 156 ? 5.239   -38.286 64.248  1.00 49.29  ? 218 ARG D NH2   1 
ATOM   8860  N N     . ALA D  1 157 ? 3.973   -42.448 61.539  1.00 28.87  ? 219 ALA D N     1 
ATOM   8861  C CA    . ALA D  1 157 ? 3.243   -41.621 60.580  1.00 28.01  ? 219 ALA D CA    1 
ATOM   8862  C C     . ALA D  1 157 ? 2.418   -40.562 61.324  1.00 27.23  ? 219 ALA D C     1 
ATOM   8863  O O     . ALA D  1 157 ? 2.017   -40.758 62.464  1.00 27.90  ? 219 ALA D O     1 
ATOM   8864  C CB    . ALA D  1 157 ? 2.345   -42.481 59.719  1.00 28.29  ? 219 ALA D CB    1 
ATOM   8865  N N     . ALA D  1 158 ? 2.161   -39.436 60.682  1.00 26.23  ? 220 ALA D N     1 
ATOM   8866  C CA    . ALA D  1 158 ? 1.478   -38.332 61.348  1.00 25.00  ? 220 ALA D CA    1 
ATOM   8867  C C     . ALA D  1 158 ? 0.656   -37.589 60.318  1.00 24.67  ? 220 ALA D C     1 
ATOM   8868  O O     . ALA D  1 158 ? 1.145   -37.323 59.240  1.00 26.48  ? 220 ALA D O     1 
ATOM   8869  C CB    . ALA D  1 158 ? 2.502   -37.410 61.998  1.00 24.57  ? 220 ALA D CB    1 
ATOM   8870  N N     . LEU D  1 159 ? -0.592  -37.270 60.625  1.00 24.53  ? 221 LEU D N     1 
ATOM   8871  C CA    . LEU D  1 159 ? -1.485  -36.609 59.671  1.00 24.63  ? 221 LEU D CA    1 
ATOM   8872  C C     . LEU D  1 159 ? -1.793  -35.195 60.131  1.00 24.70  ? 221 LEU D C     1 
ATOM   8873  O O     . LEU D  1 159 ? -2.091  -34.983 61.290  1.00 23.28  ? 221 LEU D O     1 
ATOM   8874  C CB    . LEU D  1 159 ? -2.781  -37.400 59.567  1.00 24.99  ? 221 LEU D CB    1 
ATOM   8875  C CG    . LEU D  1 159 ? -3.849  -36.893 58.590  1.00 25.33  ? 221 LEU D CG    1 
ATOM   8876  C CD1   . LEU D  1 159 ? -3.384  -37.069 57.155  1.00 25.42  ? 221 LEU D CD1   1 
ATOM   8877  C CD2   . LEU D  1 159 ? -5.173  -37.614 58.803  1.00 25.29  ? 221 LEU D CD2   1 
ATOM   8878  N N     . TYR D  1 160 ? -1.736  -34.231 59.219  1.00 26.42  ? 222 TYR D N     1 
ATOM   8879  C CA    . TYR D  1 160 ? -1.949  -32.830 59.581  1.00 28.19  ? 222 TYR D CA    1 
ATOM   8880  C C     . TYR D  1 160 ? -3.093  -32.189 58.812  1.00 28.34  ? 222 TYR D C     1 
ATOM   8881  O O     . TYR D  1 160 ? -3.513  -32.711 57.784  1.00 28.70  ? 222 TYR D O     1 
ATOM   8882  C CB    . TYR D  1 160 ? -0.655  -32.028 59.349  1.00 29.90  ? 222 TYR D CB    1 
ATOM   8883  C CG    . TYR D  1 160 ? 0.488   -32.468 60.246  1.00 30.43  ? 222 TYR D CG    1 
ATOM   8884  C CD1   . TYR D  1 160 ? 1.270   -33.546 59.898  1.00 30.96  ? 222 TYR D CD1   1 
ATOM   8885  C CD2   . TYR D  1 160 ? 0.774   -31.809 61.452  1.00 30.98  ? 222 TYR D CD2   1 
ATOM   8886  C CE1   . TYR D  1 160 ? 2.303   -33.972 60.714  1.00 31.80  ? 222 TYR D CE1   1 
ATOM   8887  C CE2   . TYR D  1 160 ? 1.815   -32.228 62.274  1.00 30.86  ? 222 TYR D CE2   1 
ATOM   8888  C CZ    . TYR D  1 160 ? 2.569   -33.318 61.894  1.00 30.73  ? 222 TYR D CZ    1 
ATOM   8889  O OH    . TYR D  1 160 ? 3.598   -33.796 62.656  1.00 30.22  ? 222 TYR D OH    1 
ATOM   8890  N N     . VAL D  1 161 ? -3.595  -31.066 59.330  1.00 28.42  ? 223 VAL D N     1 
ATOM   8891  C CA    . VAL D  1 161 ? -4.471  -30.168 58.560  1.00 28.45  ? 223 VAL D CA    1 
ATOM   8892  C C     . VAL D  1 161 ? -3.869  -28.801 58.440  1.00 27.81  ? 223 VAL D C     1 
ATOM   8893  O O     . VAL D  1 161 ? -3.006  -28.428 59.207  1.00 28.41  ? 223 VAL D O     1 
ATOM   8894  C CB    . VAL D  1 161 ? -5.864  -29.907 59.183  1.00 28.83  ? 223 VAL D CB    1 
ATOM   8895  C CG1   . VAL D  1 161 ? -6.900  -30.796 58.548  1.00 30.11  ? 223 VAL D CG1   1 
ATOM   8896  C CG2   . VAL D  1 161 ? -5.856  -30.031 60.687  1.00 28.59  ? 223 VAL D CG2   1 
ATOM   8897  N N     . VAL D  1 162 ? -4.426  -28.039 57.517  1.00 27.28  ? 224 VAL D N     1 
ATOM   8898  C CA    . VAL D  1 162 ? -4.000  -26.701 57.222  1.00 27.39  ? 224 VAL D CA    1 
ATOM   8899  C C     . VAL D  1 162 ? -5.222  -26.078 56.523  1.00 27.07  ? 224 VAL D C     1 
ATOM   8900  O O     . VAL D  1 162 ? -6.050  -26.821 55.994  1.00 25.75  ? 224 VAL D O     1 
ATOM   8901  C CB    . VAL D  1 162 ? -2.728  -26.796 56.350  1.00 28.42  ? 224 VAL D CB    1 
ATOM   8902  C CG1   . VAL D  1 162 ? -2.826  -25.973 55.078  1.00 30.49  ? 224 VAL D CG1   1 
ATOM   8903  C CG2   . VAL D  1 162 ? -1.483  -26.432 57.141  1.00 28.06  ? 224 VAL D CG2   1 
ATOM   8904  N N     . ALA D  1 163 ? -5.369  -24.746 56.544  1.00 26.84  ? 225 ALA D N     1 
ATOM   8905  C CA    . ALA D  1 163 ? -6.429  -24.082 55.755  1.00 26.41  ? 225 ALA D CA    1 
ATOM   8906  C C     . ALA D  1 163 ? -5.823  -23.306 54.585  1.00 26.91  ? 225 ALA D C     1 
ATOM   8907  O O     . ALA D  1 163 ? -4.731  -22.754 54.714  1.00 27.92  ? 225 ALA D O     1 
ATOM   8908  C CB    . ALA D  1 163 ? -7.264  -23.166 56.623  1.00 25.03  ? 225 ALA D CB    1 
ATOM   8909  N N     . ILE D  1 164 ? -6.515  -23.267 53.445  1.00 26.06  ? 226 ILE D N     1 
ATOM   8910  C CA    . ILE D  1 164 ? -5.973  -22.590 52.258  1.00 25.39  ? 226 ILE D CA    1 
ATOM   8911  C C     . ILE D  1 164 ? -6.955  -21.651 51.576  1.00 23.84  ? 226 ILE D C     1 
ATOM   8912  O O     . ILE D  1 164 ? -8.141  -21.720 51.838  1.00 24.18  ? 226 ILE D O     1 
ATOM   8913  C CB    . ILE D  1 164 ? -5.479  -23.602 51.201  1.00 25.76  ? 226 ILE D CB    1 
ATOM   8914  C CG1   . ILE D  1 164 ? -6.638  -24.426 50.643  1.00 25.37  ? 226 ILE D CG1   1 
ATOM   8915  C CG2   . ILE D  1 164 ? -4.395  -24.509 51.780  1.00 25.84  ? 226 ILE D CG2   1 
ATOM   8916  C CD1   . ILE D  1 164 ? -6.309  -25.064 49.316  1.00 25.35  ? 226 ILE D CD1   1 
ATOM   8917  N N     . GLU D  1 165 ? -6.434  -20.781 50.708  1.00 22.82  ? 227 GLU D N     1 
ATOM   8918  C CA    . GLU D  1 165 ? -7.246  -20.005 49.765  1.00 22.85  ? 227 GLU D CA    1 
ATOM   8919  C C     . GLU D  1 165 ? -7.193  -20.729 48.435  1.00 24.60  ? 227 GLU D C     1 
ATOM   8920  O O     . GLU D  1 165 ? -6.137  -21.215 48.057  1.00 25.60  ? 227 GLU D O     1 
ATOM   8921  C CB    . GLU D  1 165 ? -6.716  -18.574 49.604  1.00 21.47  ? 227 GLU D CB    1 
ATOM   8922  C CG    . GLU D  1 165 ? -7.434  -17.735 48.546  1.00 20.56  ? 227 GLU D CG    1 
ATOM   8923  C CD    . GLU D  1 165 ? -6.907  -17.932 47.143  1.00 19.57  ? 227 GLU D CD    1 
ATOM   8924  O OE1   . GLU D  1 165 ? -7.648  -17.684 46.175  1.00 18.88  ? 227 GLU D OE1   1 
ATOM   8925  O OE2   . GLU D  1 165 ? -5.746  -18.337 47.017  1.00 19.00  ? 227 GLU D OE2   1 
ATOM   8926  N N     . ASP D  1 166 ? -8.320  -20.821 47.733  1.00 26.27  ? 228 ASP D N     1 
ATOM   8927  C CA    . ASP D  1 166 ? -8.372  -21.580 46.492  1.00 28.57  ? 228 ASP D CA    1 
ATOM   8928  C C     . ASP D  1 166 ? -9.560  -21.166 45.643  1.00 31.41  ? 228 ASP D C     1 
ATOM   8929  O O     . ASP D  1 166 ? -10.223 -22.032 45.058  1.00 30.49  ? 228 ASP D O     1 
ATOM   8930  C CB    . ASP D  1 166 ? -8.465  -23.091 46.817  1.00 27.78  ? 228 ASP D CB    1 
ATOM   8931  C CG    . ASP D  1 166 ? -8.003  -23.974 45.683  1.00 27.06  ? 228 ASP D CG    1 
ATOM   8932  O OD1   . ASP D  1 166 ? -7.260  -23.499 44.800  1.00 26.57  ? 228 ASP D OD1   1 
ATOM   8933  O OD2   . ASP D  1 166 ? -8.389  -25.154 45.679  1.00 25.88  ? 228 ASP D OD2   1 
ATOM   8934  N N     . ARG D  1 167 ? -9.854  -19.864 45.569  1.00 35.62  ? 229 ARG D N     1 
ATOM   8935  C CA    . ARG D  1 167 ? -11.097 -19.457 44.890  1.00 39.79  ? 229 ARG D CA    1 
ATOM   8936  C C     . ARG D  1 167 ? -11.076 -19.837 43.412  1.00 39.64  ? 229 ARG D C     1 
ATOM   8937  O O     . ARG D  1 167 ? -12.083 -20.307 42.875  1.00 40.87  ? 229 ARG D O     1 
ATOM   8938  C CB    . ARG D  1 167 ? -11.498 -17.982 45.124  1.00 41.94  ? 229 ARG D CB    1 
ATOM   8939  C CG    . ARG D  1 167 ? -10.707 -16.923 44.412  1.00 46.06  ? 229 ARG D CG    1 
ATOM   8940  C CD    . ARG D  1 167 ? -11.579 -15.748 44.008  1.00 50.04  ? 229 ARG D CD    1 
ATOM   8941  N NE    . ARG D  1 167 ? -11.851 -15.847 42.580  1.00 57.12  ? 229 ARG D NE    1 
ATOM   8942  C CZ    . ARG D  1 167 ? -10.965 -15.582 41.616  1.00 62.56  ? 229 ARG D CZ    1 
ATOM   8943  N NH1   . ARG D  1 167 ? -9.735  -15.176 41.923  1.00 63.72  ? 229 ARG D NH1   1 
ATOM   8944  N NH2   . ARG D  1 167 ? -11.310 -15.728 40.339  1.00 63.06  ? 229 ARG D NH2   1 
ATOM   8945  N N     . GLN D  1 168 ? -9.925  -19.685 42.773  1.00 39.47  ? 230 GLN D N     1 
ATOM   8946  C CA    . GLN D  1 168 ? -9.862  -19.911 41.348  1.00 39.91  ? 230 GLN D CA    1 
ATOM   8947  C C     . GLN D  1 168 ? -10.110 -21.368 41.038  1.00 37.61  ? 230 GLN D C     1 
ATOM   8948  O O     . GLN D  1 168 ? -10.975 -21.698 40.246  1.00 39.62  ? 230 GLN D O     1 
ATOM   8949  C CB    . GLN D  1 168 ? -8.534  -19.472 40.771  1.00 42.16  ? 230 GLN D CB    1 
ATOM   8950  C CG    . GLN D  1 168 ? -8.523  -19.523 39.256  1.00 45.71  ? 230 GLN D CG    1 
ATOM   8951  C CD    . GLN D  1 168 ? -7.183  -19.157 38.654  1.00 50.02  ? 230 GLN D CD    1 
ATOM   8952  O OE1   . GLN D  1 168 ? -7.047  -18.129 38.008  1.00 53.08  ? 230 GLN D OE1   1 
ATOM   8953  N NE2   . GLN D  1 168 ? -6.179  -19.982 38.892  1.00 53.06  ? 230 GLN D NE2   1 
ATOM   8954  N N     . TYR D  1 169 ? -9.383  -22.256 41.672  1.00 37.02  ? 231 TYR D N     1 
ATOM   8955  C CA    . TYR D  1 169 ? -9.594  -23.674 41.391  1.00 38.14  ? 231 TYR D CA    1 
ATOM   8956  C C     . TYR D  1 169 ? -10.974 -24.200 41.892  1.00 37.82  ? 231 TYR D C     1 
ATOM   8957  O O     . TYR D  1 169 ? -11.516 -25.149 41.322  1.00 39.03  ? 231 TYR D O     1 
ATOM   8958  C CB    . TYR D  1 169 ? -8.443  -24.510 41.957  1.00 39.11  ? 231 TYR D CB    1 
ATOM   8959  C CG    . TYR D  1 169 ? -8.274  -25.851 41.284  1.00 40.78  ? 231 TYR D CG    1 
ATOM   8960  C CD1   . TYR D  1 169 ? -7.645  -25.952 40.025  1.00 41.50  ? 231 TYR D CD1   1 
ATOM   8961  C CD2   . TYR D  1 169 ? -8.731  -27.029 41.902  1.00 40.71  ? 231 TYR D CD2   1 
ATOM   8962  C CE1   . TYR D  1 169 ? -7.476  -27.185 39.399  1.00 41.36  ? 231 TYR D CE1   1 
ATOM   8963  C CE2   . TYR D  1 169 ? -8.563  -28.269 41.291  1.00 41.36  ? 231 TYR D CE2   1 
ATOM   8964  C CZ    . TYR D  1 169 ? -7.940  -28.346 40.040  1.00 42.16  ? 231 TYR D CZ    1 
ATOM   8965  O OH    . TYR D  1 169 ? -7.809  -29.574 39.435  1.00 39.17  ? 231 TYR D OH    1 
ATOM   8966  N N     . LYS D  1 170 ? -11.543 -23.599 42.938  1.00 35.23  ? 232 LYS D N     1 
ATOM   8967  C CA    . LYS D  1 170 ? -12.832 -24.064 43.433  1.00 34.17  ? 232 LYS D CA    1 
ATOM   8968  C C     . LYS D  1 170 ? -13.887 -23.694 42.413  1.00 33.89  ? 232 LYS D C     1 
ATOM   8969  O O     . LYS D  1 170 ? -14.856 -24.433 42.193  1.00 34.05  ? 232 LYS D O     1 
ATOM   8970  C CB    . LYS D  1 170 ? -13.178 -23.454 44.796  1.00 34.94  ? 232 LYS D CB    1 
ATOM   8971  C CG    . LYS D  1 170 ? -14.511 -23.928 45.369  1.00 34.13  ? 232 LYS D CG    1 
ATOM   8972  C CD    . LYS D  1 170 ? -14.883 -23.195 46.642  1.00 35.72  ? 232 LYS D CD    1 
ATOM   8973  C CE    . LYS D  1 170 ? -16.293 -23.551 47.088  1.00 36.44  ? 232 LYS D CE    1 
ATOM   8974  N NZ    . LYS D  1 170 ? -16.729 -22.758 48.267  1.00 37.63  ? 232 LYS D NZ    1 
ATOM   8975  N N     . ASP D  1 171 ? -13.725 -22.521 41.822  1.00 33.27  ? 233 ASP D N     1 
ATOM   8976  C CA    . ASP D  1 171 ? -14.560 -22.143 40.696  1.00 32.48  ? 233 ASP D CA    1 
ATOM   8977  C C     . ASP D  1 171 ? -14.495 -23.136 39.563  1.00 28.74  ? 233 ASP D C     1 
ATOM   8978  O O     . ASP D  1 171 ? -15.509 -23.481 39.016  1.00 28.76  ? 233 ASP D O     1 
ATOM   8979  C CB    . ASP D  1 171 ? -14.179 -20.782 40.148  1.00 35.17  ? 233 ASP D CB    1 
ATOM   8980  C CG    . ASP D  1 171 ? -15.285 -19.823 40.279  1.00 38.01  ? 233 ASP D CG    1 
ATOM   8981  O OD1   . ASP D  1 171 ? -15.596 -19.459 41.443  1.00 40.18  ? 233 ASP D OD1   1 
ATOM   8982  O OD2   . ASP D  1 171 ? -15.859 -19.477 39.217  1.00 39.08  ? 233 ASP D OD2   1 
ATOM   8983  N N     . PHE D  1 172 ? -13.299 -23.563 39.198  1.00 25.97  ? 234 PHE D N     1 
ATOM   8984  C CA    . PHE D  1 172 ? -13.131 -24.505 38.116  1.00 24.64  ? 234 PHE D CA    1 
ATOM   8985  C C     . PHE D  1 172 ? -13.692 -25.872 38.444  1.00 24.59  ? 234 PHE D C     1 
ATOM   8986  O O     . PHE D  1 172 ? -14.272 -26.517 37.579  1.00 25.05  ? 234 PHE D O     1 
ATOM   8987  C CB    . PHE D  1 172 ? -11.661 -24.624 37.768  1.00 24.87  ? 234 PHE D CB    1 
ATOM   8988  C CG    . PHE D  1 172 ? -11.359 -25.606 36.657  1.00 25.19  ? 234 PHE D CG    1 
ATOM   8989  C CD1   . PHE D  1 172 ? -11.777 -25.374 35.361  1.00 24.11  ? 234 PHE D CD1   1 
ATOM   8990  C CD2   . PHE D  1 172 ? -10.613 -26.770 36.921  1.00 26.10  ? 234 PHE D CD2   1 
ATOM   8991  C CE1   . PHE D  1 172 ? -11.478 -26.288 34.362  1.00 24.63  ? 234 PHE D CE1   1 
ATOM   8992  C CE2   . PHE D  1 172 ? -10.311 -27.690 35.913  1.00 25.00  ? 234 PHE D CE2   1 
ATOM   8993  C CZ    . PHE D  1 172 ? -10.741 -27.445 34.634  1.00 24.30  ? 234 PHE D CZ    1 
ATOM   8994  N N     . LYS D  1 173 ? -13.562 -26.307 39.691  1.00 25.04  ? 235 LYS D N     1 
ATOM   8995  C CA    . LYS D  1 173 ? -13.914 -27.688 40.060  1.00 25.54  ? 235 LYS D CA    1 
ATOM   8996  C C     . LYS D  1 173 ? -15.325 -27.923 40.570  1.00 26.84  ? 235 LYS D C     1 
ATOM   8997  O O     . LYS D  1 173 ? -15.866 -29.028 40.397  1.00 25.72  ? 235 LYS D O     1 
ATOM   8998  C CB    . LYS D  1 173 ? -12.955 -28.201 41.123  1.00 25.11  ? 235 LYS D CB    1 
ATOM   8999  C CG    . LYS D  1 173 ? -11.772 -28.884 40.516  1.00 25.10  ? 235 LYS D CG    1 
ATOM   9000  C CD    . LYS D  1 173 ? -12.168 -30.252 39.997  1.00 24.61  ? 235 LYS D CD    1 
ATOM   9001  C CE    . LYS D  1 173 ? -11.272 -30.659 38.860  1.00 24.68  ? 235 LYS D CE    1 
ATOM   9002  N NZ    . LYS D  1 173 ? -11.695 -31.988 38.398  1.00 24.79  ? 235 LYS D NZ    1 
ATOM   9003  N N     . ILE D  1 174 ? -15.890 -26.918 41.245  1.00 28.83  ? 236 ILE D N     1 
ATOM   9004  C CA    . ILE D  1 174 ? -17.189 -27.081 41.878  1.00 30.29  ? 236 ILE D CA    1 
ATOM   9005  C C     . ILE D  1 174 ? -18.223 -25.975 41.542  1.00 30.02  ? 236 ILE D C     1 
ATOM   9006  O O     . ILE D  1 174 ? -19.387 -26.301 41.335  1.00 32.97  ? 236 ILE D O     1 
ATOM   9007  C CB    . ILE D  1 174 ? -17.077 -27.522 43.386  1.00 31.61  ? 236 ILE D CB    1 
ATOM   9008  C CG1   . ILE D  1 174 ? -18.103 -26.832 44.276  1.00 33.81  ? 236 ILE D CG1   1 
ATOM   9009  C CG2   . ILE D  1 174 ? -15.687 -27.323 43.953  1.00 31.55  ? 236 ILE D CG2   1 
ATOM   9010  C CD1   . ILE D  1 174 ? -17.877 -25.349 44.486  1.00 35.83  ? 236 ILE D CD1   1 
ATOM   9011  N N     . HIS D  1 175 ? -17.855 -24.703 41.424  1.00 28.29  ? 237 HIS D N     1 
ATOM   9012  C CA    . HIS D  1 175 ? -18.869 -23.708 40.985  1.00 27.65  ? 237 HIS D CA    1 
ATOM   9013  C C     . HIS D  1 175 ? -19.214 -23.815 39.507  1.00 26.22  ? 237 HIS D C     1 
ATOM   9014  O O     . HIS D  1 175 ? -20.257 -23.333 39.082  1.00 26.61  ? 237 HIS D O     1 
ATOM   9015  C CB    . HIS D  1 175 ? -18.453 -22.275 41.296  1.00 28.57  ? 237 HIS D CB    1 
ATOM   9016  C CG    . HIS D  1 175 ? -18.496 -21.963 42.750  1.00 30.43  ? 237 HIS D CG    1 
ATOM   9017  N ND1   . HIS D  1 175 ? -19.667 -21.986 43.475  1.00 30.71  ? 237 HIS D ND1   1 
ATOM   9018  C CD2   . HIS D  1 175 ? -17.510 -21.674 43.632  1.00 32.15  ? 237 HIS D CD2   1 
ATOM   9019  C CE1   . HIS D  1 175 ? -19.402 -21.721 44.741  1.00 31.86  ? 237 HIS D CE1   1 
ATOM   9020  N NE2   . HIS D  1 175 ? -18.102 -21.524 44.863  1.00 32.19  ? 237 HIS D NE2   1 
ATOM   9021  N N     . TRP D  1 176 ? -18.314 -24.409 38.733  1.00 24.21  ? 238 TRP D N     1 
ATOM   9022  C CA    . TRP D  1 176 ? -18.498 -24.644 37.319  1.00 22.98  ? 238 TRP D CA    1 
ATOM   9023  C C     . TRP D  1 176 ? -19.776 -25.387 37.035  1.00 23.07  ? 238 TRP D C     1 
ATOM   9024  O O     . TRP D  1 176 ? -20.436 -25.149 36.032  1.00 23.75  ? 238 TRP D O     1 
ATOM   9025  C CB    . TRP D  1 176 ? -17.346 -25.494 36.842  1.00 23.25  ? 238 TRP D CB    1 
ATOM   9026  C CG    . TRP D  1 176 ? -17.470 -26.003 35.450  1.00 23.36  ? 238 TRP D CG    1 
ATOM   9027  C CD1   . TRP D  1 176 ? -17.127 -25.348 34.312  1.00 23.56  ? 238 TRP D CD1   1 
ATOM   9028  C CD2   . TRP D  1 176 ? -17.949 -27.295 35.046  1.00 23.07  ? 238 TRP D CD2   1 
ATOM   9029  N NE1   . TRP D  1 176 ? -17.359 -26.151 33.212  1.00 23.88  ? 238 TRP D NE1   1 
ATOM   9030  C CE2   . TRP D  1 176 ? -17.867 -27.352 33.637  1.00 23.37  ? 238 TRP D CE2   1 
ATOM   9031  C CE3   . TRP D  1 176 ? -18.436 -28.410 35.737  1.00 22.45  ? 238 TRP D CE3   1 
ATOM   9032  C CZ2   . TRP D  1 176 ? -18.261 -28.486 32.902  1.00 22.80  ? 238 TRP D CZ2   1 
ATOM   9033  C CZ3   . TRP D  1 176 ? -18.824 -29.536 35.004  1.00 22.34  ? 238 TRP D CZ3   1 
ATOM   9034  C CH2   . TRP D  1 176 ? -18.734 -29.563 33.604  1.00 22.15  ? 238 TRP D CH2   1 
ATOM   9035  N N     . TRP D  1 177 ? -20.126 -26.309 37.916  1.00 22.59  ? 239 TRP D N     1 
ATOM   9036  C CA    . TRP D  1 177 ? -21.350 -27.062 37.748  1.00 22.47  ? 239 TRP D CA    1 
ATOM   9037  C C     . TRP D  1 177 ? -22.636 -26.207 37.732  1.00 24.17  ? 239 TRP D C     1 
ATOM   9038  O O     . TRP D  1 177 ? -23.695 -26.679 37.300  1.00 25.50  ? 239 TRP D O     1 
ATOM   9039  C CB    . TRP D  1 177 ? -21.443 -28.069 38.863  1.00 21.52  ? 239 TRP D CB    1 
ATOM   9040  C CG    . TRP D  1 177 ? -20.451 -29.132 38.785  1.00 20.78  ? 239 TRP D CG    1 
ATOM   9041  C CD1   . TRP D  1 177 ? -19.343 -29.263 39.540  1.00 20.36  ? 239 TRP D CD1   1 
ATOM   9042  C CD2   . TRP D  1 177 ? -20.495 -30.268 37.920  1.00 20.58  ? 239 TRP D CD2   1 
ATOM   9043  N NE1   . TRP D  1 177 ? -18.679 -30.416 39.208  1.00 20.26  ? 239 TRP D NE1   1 
ATOM   9044  C CE2   . TRP D  1 177 ? -19.364 -31.047 38.205  1.00 20.02  ? 239 TRP D CE2   1 
ATOM   9045  C CE3   . TRP D  1 177 ? -21.384 -30.698 36.919  1.00 20.62  ? 239 TRP D CE3   1 
ATOM   9046  C CZ2   . TRP D  1 177 ? -19.085 -32.232 37.530  1.00 20.05  ? 239 TRP D CZ2   1 
ATOM   9047  C CZ3   . TRP D  1 177 ? -21.101 -31.878 36.244  1.00 20.49  ? 239 TRP D CZ3   1 
ATOM   9048  C CH2   . TRP D  1 177 ? -19.964 -32.635 36.563  1.00 20.06  ? 239 TRP D CH2   1 
ATOM   9049  N N     . GLU D  1 178 ? -22.557 -24.977 38.238  1.00 25.12  ? 240 GLU D N     1 
ATOM   9050  C CA    . GLU D  1 178 ? -23.720 -24.110 38.365  1.00 26.14  ? 240 GLU D CA    1 
ATOM   9051  C C     . GLU D  1 178 ? -24.233 -23.667 37.016  1.00 26.67  ? 240 GLU D C     1 
ATOM   9052  O O     . GLU D  1 178 ? -25.410 -23.317 36.901  1.00 27.62  ? 240 GLU D O     1 
ATOM   9053  C CB    . GLU D  1 178 ? -23.403 -22.872 39.215  1.00 27.05  ? 240 GLU D CB    1 
ATOM   9054  C CG    . GLU D  1 178 ? -23.320 -23.160 40.719  1.00 27.39  ? 240 GLU D CG    1 
ATOM   9055  C CD    . GLU D  1 178 ? -22.496 -22.140 41.503  1.00 26.94  ? 240 GLU D CD    1 
ATOM   9056  O OE1   . GLU D  1 178 ? -22.262 -22.365 42.702  1.00 26.56  ? 240 GLU D OE1   1 
ATOM   9057  O OE2   . GLU D  1 178 ? -22.096 -21.108 40.939  1.00 26.83  ? 240 GLU D OE2   1 
ATOM   9058  N N     . ASN D  1 179 ? -23.357 -23.682 36.010  1.00 26.22  ? 241 ASN D N     1 
ATOM   9059  C CA    . ASN D  1 179 ? -23.736 -23.309 34.654  1.00 25.94  ? 241 ASN D CA    1 
ATOM   9060  C C     . ASN D  1 179 ? -22.972 -24.036 33.558  1.00 25.88  ? 241 ASN D C     1 
ATOM   9061  O O     . ASN D  1 179 ? -21.994 -23.523 33.049  1.00 26.29  ? 241 ASN D O     1 
ATOM   9062  C CB    . ASN D  1 179 ? -23.546 -21.821 34.454  1.00 25.72  ? 241 ASN D CB    1 
ATOM   9063  C CG    . ASN D  1 179 ? -23.933 -21.370 33.066  1.00 25.87  ? 241 ASN D CG    1 
ATOM   9064  O OD1   . ASN D  1 179 ? -24.401 -22.153 32.217  1.00 26.65  ? 241 ASN D OD1   1 
ATOM   9065  N ND2   . ASN D  1 179 ? -23.762 -20.097 32.830  1.00 25.34  ? 241 ASN D ND2   1 
ATOM   9066  N N     . VAL D  1 180 ? -23.486 -25.195 33.161  1.00 25.99  ? 242 VAL D N     1 
ATOM   9067  C CA    . VAL D  1 180 ? -22.902 -26.042 32.124  1.00 25.36  ? 242 VAL D CA    1 
ATOM   9068  C C     . VAL D  1 180 ? -23.617 -25.802 30.768  1.00 25.67  ? 242 VAL D C     1 
ATOM   9069  O O     . VAL D  1 180 ? -24.714 -26.321 30.533  1.00 27.07  ? 242 VAL D O     1 
ATOM   9070  C CB    . VAL D  1 180 ? -23.001 -27.521 32.555  1.00 24.32  ? 242 VAL D CB    1 
ATOM   9071  C CG1   . VAL D  1 180 ? -22.361 -28.440 31.540  1.00 24.25  ? 242 VAL D CG1   1 
ATOM   9072  C CG2   . VAL D  1 180 ? -22.363 -27.710 33.913  1.00 23.96  ? 242 VAL D CG2   1 
ATOM   9073  N N     . TYR D  1 181 ? -22.994 -25.012 29.890  1.00 25.01  ? 243 TYR D N     1 
ATOM   9074  C CA    . TYR D  1 181 ? -23.558 -24.662 28.581  1.00 24.19  ? 243 TYR D CA    1 
ATOM   9075  C C     . TYR D  1 181 ? -24.973 -24.103 28.694  1.00 25.30  ? 243 TYR D C     1 
ATOM   9076  O O     . TYR D  1 181 ? -25.847 -24.397 27.877  1.00 26.47  ? 243 TYR D O     1 
ATOM   9077  C CB    . TYR D  1 181 ? -23.512 -25.877 27.658  1.00 23.24  ? 243 TYR D CB    1 
ATOM   9078  C CG    . TYR D  1 181 ? -22.114 -26.359 27.436  1.00 22.57  ? 243 TYR D CG    1 
ATOM   9079  C CD1   . TYR D  1 181 ? -21.260 -25.683 26.585  1.00 22.15  ? 243 TYR D CD1   1 
ATOM   9080  C CD2   . TYR D  1 181 ? -21.625 -27.478 28.095  1.00 22.39  ? 243 TYR D CD2   1 
ATOM   9081  C CE1   . TYR D  1 181 ? -19.965 -26.111 26.385  1.00 21.49  ? 243 TYR D CE1   1 
ATOM   9082  C CE2   . TYR D  1 181 ? -20.326 -27.913 27.890  1.00 21.94  ? 243 TYR D CE2   1 
ATOM   9083  C CZ    . TYR D  1 181 ? -19.512 -27.219 27.033  1.00 21.15  ? 243 TYR D CZ    1 
ATOM   9084  O OH    . TYR D  1 181 ? -18.241 -27.635 26.824  1.00 20.84  ? 243 TYR D OH    1 
ATOM   9085  N N     . GLY D  1 182 ? -25.198 -23.313 29.735  1.00 25.95  ? 244 GLY D N     1 
ATOM   9086  C CA    . GLY D  1 182 ? -26.488 -22.705 29.948  1.00 26.18  ? 244 GLY D CA    1 
ATOM   9087  C C     . GLY D  1 182 ? -27.345 -23.391 30.982  1.00 26.97  ? 244 GLY D C     1 
ATOM   9088  O O     . GLY D  1 182 ? -28.345 -22.823 31.402  1.00 28.13  ? 244 GLY D O     1 
ATOM   9089  N N     . PHE D  1 183 ? -26.976 -24.588 31.425  1.00 26.36  ? 245 PHE D N     1 
ATOM   9090  C CA    . PHE D  1 183 ? -27.855 -25.352 32.308  1.00 26.44  ? 245 PHE D CA    1 
ATOM   9091  C C     . PHE D  1 183 ? -27.373 -25.512 33.743  1.00 26.52  ? 245 PHE D C     1 
ATOM   9092  O O     . PHE D  1 183 ? -26.205 -25.745 33.975  1.00 27.61  ? 245 PHE D O     1 
ATOM   9093  C CB    . PHE D  1 183 ? -28.048 -26.717 31.698  1.00 26.59  ? 245 PHE D CB    1 
ATOM   9094  C CG    . PHE D  1 183 ? -28.570 -26.662 30.315  1.00 25.86  ? 245 PHE D CG    1 
ATOM   9095  C CD1   . PHE D  1 183 ? -29.907 -26.475 30.119  1.00 25.49  ? 245 PHE D CD1   1 
ATOM   9096  C CD2   . PHE D  1 183 ? -27.721 -26.790 29.216  1.00 25.60  ? 245 PHE D CD2   1 
ATOM   9097  C CE1   . PHE D  1 183 ? -30.419 -26.428 28.847  1.00 26.53  ? 245 PHE D CE1   1 
ATOM   9098  C CE2   . PHE D  1 183 ? -28.223 -26.746 27.935  1.00 25.88  ? 245 PHE D CE2   1 
ATOM   9099  C CZ    . PHE D  1 183 ? -29.579 -26.564 27.749  1.00 26.46  ? 245 PHE D CZ    1 
ATOM   9100  N N     . ASP D  1 184 ? -28.293 -25.451 34.697  1.00 26.65  ? 246 ASP D N     1 
ATOM   9101  C CA    . ASP D  1 184 ? -27.970 -25.653 36.094  1.00 27.51  ? 246 ASP D CA    1 
ATOM   9102  C C     . ASP D  1 184 ? -27.695 -27.133 36.357  1.00 28.05  ? 246 ASP D C     1 
ATOM   9103  O O     . ASP D  1 184 ? -28.545 -27.980 36.054  1.00 28.85  ? 246 ASP D O     1 
ATOM   9104  C CB    . ASP D  1 184 ? -29.149 -25.209 36.936  1.00 29.07  ? 246 ASP D CB    1 
ATOM   9105  C CG    . ASP D  1 184 ? -28.870 -25.296 38.413  1.00 32.26  ? 246 ASP D CG    1 
ATOM   9106  O OD1   . ASP D  1 184 ? -29.106 -26.364 39.022  1.00 35.56  ? 246 ASP D OD1   1 
ATOM   9107  O OD2   . ASP D  1 184 ? -28.415 -24.291 38.980  1.00 35.03  ? 246 ASP D OD2   1 
ATOM   9108  N N     . MET D  1 185 ? -26.526 -27.451 36.918  1.00 27.19  ? 247 MET D N     1 
ATOM   9109  C CA    . MET D  1 185 ? -26.254 -28.806 37.419  1.00 27.50  ? 247 MET D CA    1 
ATOM   9110  C C     . MET D  1 185 ? -25.762 -28.775 38.867  1.00 28.52  ? 247 MET D C     1 
ATOM   9111  O O     . MET D  1 185 ? -24.816 -29.492 39.223  1.00 28.24  ? 247 MET D O     1 
ATOM   9112  C CB    . MET D  1 185 ? -25.222 -29.517 36.564  1.00 27.18  ? 247 MET D CB    1 
ATOM   9113  C CG    . MET D  1 185 ? -25.629 -29.697 35.116  1.00 27.41  ? 247 MET D CG    1 
ATOM   9114  S SD    . MET D  1 185 ? -24.503 -30.792 34.204  1.00 26.77  ? 247 MET D SD    1 
ATOM   9115  C CE    . MET D  1 185 ? -25.350 -30.912 32.638  1.00 25.88  ? 247 MET D CE    1 
ATOM   9116  N N     . THR D  1 186 ? -26.425 -27.984 39.714  1.00 28.90  ? 248 THR D N     1 
ATOM   9117  C CA    . THR D  1 186 ? -25.975 -27.838 41.095  1.00 29.03  ? 248 THR D CA    1 
ATOM   9118  C C     . THR D  1 186 ? -26.174 -29.139 41.854  1.00 28.07  ? 248 THR D C     1 
ATOM   9119  O O     . THR D  1 186 ? -25.387 -29.456 42.731  1.00 28.53  ? 248 THR D O     1 
ATOM   9120  C CB    . THR D  1 186 ? -26.676 -26.695 41.854  1.00 29.24  ? 248 THR D CB    1 
ATOM   9121  O OG1   . THR D  1 186 ? -28.070 -26.937 41.842  1.00 33.48  ? 248 THR D OG1   1 
ATOM   9122  C CG2   . THR D  1 186 ? -26.426 -25.347 41.210  1.00 29.01  ? 248 THR D CG2   1 
ATOM   9123  N N     . CYS D  1 187 ? -27.189 -29.925 41.509  1.00 27.97  ? 249 CYS D N     1 
ATOM   9124  C CA    . CYS D  1 187 ? -27.410 -31.180 42.247  1.00 28.69  ? 249 CYS D CA    1 
ATOM   9125  C C     . CYS D  1 187 ? -26.175 -32.098 42.179  1.00 27.58  ? 249 CYS D C     1 
ATOM   9126  O O     . CYS D  1 187 ? -25.983 -32.961 43.050  1.00 26.87  ? 249 CYS D O     1 
ATOM   9127  C CB    . CYS D  1 187 ? -28.655 -31.911 41.748  1.00 29.38  ? 249 CYS D CB    1 
ATOM   9128  S SG    . CYS D  1 187 ? -28.469 -32.572 40.090  1.00 32.63  ? 249 CYS D SG    1 
ATOM   9129  N N     . ILE D  1 188 ? -25.359 -31.905 41.139  1.00 26.00  ? 250 ILE D N     1 
ATOM   9130  C CA    . ILE D  1 188 ? -24.079 -32.580 41.022  1.00 25.13  ? 250 ILE D CA    1 
ATOM   9131  C C     . ILE D  1 188 ? -23.014 -31.842 41.822  1.00 24.40  ? 250 ILE D C     1 
ATOM   9132  O O     . ILE D  1 188 ? -22.234 -32.460 42.559  1.00 24.05  ? 250 ILE D O     1 
ATOM   9133  C CB    . ILE D  1 188 ? -23.640 -32.756 39.549  1.00 24.50  ? 250 ILE D CB    1 
ATOM   9134  C CG1   . ILE D  1 188 ? -24.437 -33.898 38.918  1.00 24.64  ? 250 ILE D CG1   1 
ATOM   9135  C CG2   . ILE D  1 188 ? -22.155 -33.092 39.462  1.00 24.21  ? 250 ILE D CG2   1 
ATOM   9136  C CD1   . ILE D  1 188 ? -24.095 -34.188 37.471  1.00 24.32  ? 250 ILE D CD1   1 
ATOM   9137  N N     . ARG D  1 189 ? -22.975 -30.538 41.663  1.00 23.30  ? 251 ARG D N     1 
ATOM   9138  C CA    . ARG D  1 189 ? -22.102 -29.709 42.468  1.00 25.14  ? 251 ARG D CA    1 
ATOM   9139  C C     . ARG D  1 189 ? -22.133 -30.069 43.971  1.00 24.94  ? 251 ARG D C     1 
ATOM   9140  O O     . ARG D  1 189 ? -21.092 -30.158 44.643  1.00 23.86  ? 251 ARG D O     1 
ATOM   9141  C CB    . ARG D  1 189 ? -22.535 -28.261 42.274  1.00 27.59  ? 251 ARG D CB    1 
ATOM   9142  C CG    . ARG D  1 189 ? -21.685 -27.234 42.986  1.00 28.86  ? 251 ARG D CG    1 
ATOM   9143  C CD    . ARG D  1 189 ? -22.379 -26.748 44.237  1.00 30.14  ? 251 ARG D CD    1 
ATOM   9144  N NE    . ARG D  1 189 ? -23.032 -25.483 44.009  1.00 30.43  ? 251 ARG D NE    1 
ATOM   9145  C CZ    . ARG D  1 189 ? -24.091 -25.074 44.677  1.00 32.27  ? 251 ARG D CZ    1 
ATOM   9146  N NH1   . ARG D  1 189 ? -24.662 -25.834 45.597  1.00 32.80  ? 251 ARG D NH1   1 
ATOM   9147  N NH2   . ARG D  1 189 ? -24.610 -23.895 44.399  1.00 35.65  ? 251 ARG D NH2   1 
ATOM   9148  N N     . ASP D  1 190 ? -23.338 -30.280 44.485  1.00 24.16  ? 252 ASP D N     1 
ATOM   9149  C CA    . ASP D  1 190 ? -23.527 -30.670 45.872  1.00 23.81  ? 252 ASP D CA    1 
ATOM   9150  C C     . ASP D  1 190 ? -22.938 -32.034 46.220  1.00 23.90  ? 252 ASP D C     1 
ATOM   9151  O O     . ASP D  1 190 ? -22.537 -32.249 47.344  1.00 24.44  ? 252 ASP D O     1 
ATOM   9152  C CB    . ASP D  1 190 ? -25.014 -30.622 46.216  1.00 23.42  ? 252 ASP D CB    1 
ATOM   9153  C CG    . ASP D  1 190 ? -25.567 -29.208 46.140  1.00 22.88  ? 252 ASP D CG    1 
ATOM   9154  O OD1   . ASP D  1 190 ? -24.780 -28.285 45.824  1.00 21.79  ? 252 ASP D OD1   1 
ATOM   9155  O OD2   . ASP D  1 190 ? -26.771 -29.021 46.389  1.00 22.01  ? 252 ASP D OD2   1 
ATOM   9156  N N     . VAL D  1 191 ? -22.904 -32.958 45.280  1.00 24.94  ? 253 VAL D N     1 
ATOM   9157  C CA    . VAL D  1 191 ? -22.245 -34.233 45.506  1.00 26.94  ? 253 VAL D CA    1 
ATOM   9158  C C     . VAL D  1 191 ? -20.745 -34.086 45.366  1.00 28.81  ? 253 VAL D C     1 
ATOM   9159  O O     . VAL D  1 191 ? -19.991 -34.789 46.035  1.00 29.61  ? 253 VAL D O     1 
ATOM   9160  C CB    . VAL D  1 191 ? -22.746 -35.329 44.541  1.00 27.87  ? 253 VAL D CB    1 
ATOM   9161  C CG1   . VAL D  1 191 ? -21.869 -36.575 44.590  1.00 27.66  ? 253 VAL D CG1   1 
ATOM   9162  C CG2   . VAL D  1 191 ? -24.178 -35.702 44.886  1.00 28.43  ? 253 VAL D CG2   1 
ATOM   9163  N N     . ALA D  1 192 ? -20.303 -33.196 44.488  1.00 31.12  ? 254 ALA D N     1 
ATOM   9164  C CA    . ALA D  1 192 ? -18.862 -33.008 44.277  1.00 32.18  ? 254 ALA D CA    1 
ATOM   9165  C C     . ALA D  1 192 ? -18.201 -32.449 45.523  1.00 32.78  ? 254 ALA D C     1 
ATOM   9166  O O     . ALA D  1 192 ? -17.188 -32.989 45.992  1.00 32.49  ? 254 ALA D O     1 
ATOM   9167  C CB    . ALA D  1 192 ? -18.594 -32.122 43.071  1.00 32.27  ? 254 ALA D CB    1 
ATOM   9168  N N     . MET D  1 193 ? -18.788 -31.391 46.077  1.00 33.89  ? 255 MET D N     1 
ATOM   9169  C CA    . MET D  1 193 ? -18.332 -30.844 47.372  1.00 35.28  ? 255 MET D CA    1 
ATOM   9170  C C     . MET D  1 193 ? -17.942 -31.915 48.370  1.00 36.81  ? 255 MET D C     1 
ATOM   9171  O O     . MET D  1 193 ? -16.877 -31.817 48.987  1.00 35.70  ? 255 MET D O     1 
ATOM   9172  C CB    . MET D  1 193 ? -19.430 -30.014 47.991  1.00 33.86  ? 255 MET D CB    1 
ATOM   9173  C CG    . MET D  1 193 ? -19.510 -28.657 47.355  1.00 33.68  ? 255 MET D CG    1 
ATOM   9174  S SD    . MET D  1 193 ? -18.175 -27.644 47.961  1.00 31.57  ? 255 MET D SD    1 
ATOM   9175  C CE    . MET D  1 193 ? -19.013 -26.051 47.915  1.00 32.84  ? 255 MET D CE    1 
ATOM   9176  N N     . LYS D  1 194 ? -18.804 -32.939 48.467  1.00 39.61  ? 256 LYS D N     1 
ATOM   9177  C CA    . LYS D  1 194 ? -18.693 -34.052 49.421  1.00 41.77  ? 256 LYS D CA    1 
ATOM   9178  C C     . LYS D  1 194 ? -17.573 -35.053 49.088  1.00 39.07  ? 256 LYS D C     1 
ATOM   9179  O O     . LYS D  1 194 ? -17.352 -36.031 49.799  1.00 36.25  ? 256 LYS D O     1 
ATOM   9180  C CB    . LYS D  1 194 ? -20.060 -34.772 49.569  1.00 45.46  ? 256 LYS D CB    1 
ATOM   9181  C CG    . LYS D  1 194 ? -21.226 -33.886 50.055  1.00 52.63  ? 256 LYS D CG    1 
ATOM   9182  C CD    . LYS D  1 194 ? -20.841 -33.005 51.268  1.00 64.80  ? 256 LYS D CD    1 
ATOM   9183  C CE    . LYS D  1 194 ? -21.710 -31.771 51.499  1.00 69.83  ? 256 LYS D CE    1 
ATOM   9184  N NZ    . LYS D  1 194 ? -23.002 -32.209 52.082  1.00 73.43  ? 256 LYS D NZ    1 
ATOM   9185  N N     . GLU D  1 195 ? -16.830 -34.790 48.031  1.00 38.38  ? 257 GLU D N     1 
ATOM   9186  C CA    . GLU D  1 195 ? -15.726 -35.641 47.712  1.00 39.84  ? 257 GLU D CA    1 
ATOM   9187  C C     . GLU D  1 195 ? -14.412 -34.844 47.703  1.00 37.37  ? 257 GLU D C     1 
ATOM   9188  O O     . GLU D  1 195 ? -14.238 -33.936 46.879  1.00 35.85  ? 257 GLU D O     1 
ATOM   9189  C CB    . GLU D  1 195 ? -16.002 -36.291 46.383  1.00 44.45  ? 257 GLU D CB    1 
ATOM   9190  C CG    . GLU D  1 195 ? -15.127 -37.485 46.108  1.00 50.10  ? 257 GLU D CG    1 
ATOM   9191  C CD    . GLU D  1 195 ? -15.507 -38.130 44.806  1.00 54.73  ? 257 GLU D CD    1 
ATOM   9192  O OE1   . GLU D  1 195 ? -16.741 -38.313 44.600  1.00 54.34  ? 257 GLU D OE1   1 
ATOM   9193  O OE2   . GLU D  1 195 ? -14.572 -38.424 44.010  1.00 53.89  ? 257 GLU D OE2   1 
ATOM   9194  N N     . PRO D  1 196 ? -13.485 -35.173 48.635  1.00 34.42  ? 258 PRO D N     1 
ATOM   9195  C CA    . PRO D  1 196 ? -12.249 -34.430 48.698  1.00 31.94  ? 258 PRO D CA    1 
ATOM   9196  C C     . PRO D  1 196 ? -11.459 -34.646 47.421  1.00 31.10  ? 258 PRO D C     1 
ATOM   9197  O O     . PRO D  1 196 ? -11.586 -35.702 46.805  1.00 30.72  ? 258 PRO D O     1 
ATOM   9198  C CB    . PRO D  1 196 ? -11.503 -35.055 49.888  1.00 32.20  ? 258 PRO D CB    1 
ATOM   9199  C CG    . PRO D  1 196 ? -12.474 -35.910 50.603  1.00 32.50  ? 258 PRO D CG    1 
ATOM   9200  C CD    . PRO D  1 196 ? -13.480 -36.312 49.576  1.00 34.54  ? 258 PRO D CD    1 
ATOM   9201  N N     . LEU D  1 197 ? -10.649 -33.657 47.053  1.00 30.35  ? 259 LEU D N     1 
ATOM   9202  C CA    . LEU D  1 197 ? -9.803  -33.707 45.868  1.00 30.58  ? 259 LEU D CA    1 
ATOM   9203  C C     . LEU D  1 197 ? -8.406  -34.101 46.230  1.00 30.06  ? 259 LEU D C     1 
ATOM   9204  O O     . LEU D  1 197 ? -7.822  -33.494 47.123  1.00 32.52  ? 259 LEU D O     1 
ATOM   9205  C CB    . LEU D  1 197 ? -9.683  -32.324 45.248  1.00 31.82  ? 259 LEU D CB    1 
ATOM   9206  C CG    . LEU D  1 197 ? -10.574 -32.048 44.063  1.00 33.51  ? 259 LEU D CG    1 
ATOM   9207  C CD1   . LEU D  1 197 ? -12.042 -31.856 44.482  1.00 32.81  ? 259 LEU D CD1   1 
ATOM   9208  C CD2   . LEU D  1 197 ? -9.982  -30.833 43.355  1.00 35.29  ? 259 LEU D CD2   1 
ATOM   9209  N N     . VAL D  1 198 ? -7.842  -35.072 45.518  1.00 28.32  ? 260 VAL D N     1 
ATOM   9210  C CA    . VAL D  1 198 ? -6.422  -35.372 45.638  1.00 26.33  ? 260 VAL D CA    1 
ATOM   9211  C C     . VAL D  1 198 ? -5.709  -34.553 44.569  1.00 26.34  ? 260 VAL D C     1 
ATOM   9212  O O     . VAL D  1 198 ? -5.825  -34.834 43.382  1.00 26.06  ? 260 VAL D O     1 
ATOM   9213  C CB    . VAL D  1 198 ? -6.144  -36.876 45.470  1.00 25.39  ? 260 VAL D CB    1 
ATOM   9214  C CG1   . VAL D  1 198 ? -4.654  -37.148 45.469  1.00 25.30  ? 260 VAL D CG1   1 
ATOM   9215  C CG2   . VAL D  1 198 ? -6.820  -37.661 46.579  1.00 24.81  ? 260 VAL D CG2   1 
ATOM   9216  N N     . ASP D  1 199 ? -4.994  -33.519 44.978  1.00 27.10  ? 261 ASP D N     1 
ATOM   9217  C CA    . ASP D  1 199 ? -4.326  -32.681 44.008  1.00 29.49  ? 261 ASP D CA    1 
ATOM   9218  C C     . ASP D  1 199 ? -3.240  -31.857 44.649  1.00 29.18  ? 261 ASP D C     1 
ATOM   9219  O O     . ASP D  1 199 ? -3.188  -31.779 45.867  1.00 29.55  ? 261 ASP D O     1 
ATOM   9220  C CB    . ASP D  1 199 ? -5.340  -31.779 43.329  1.00 30.80  ? 261 ASP D CB    1 
ATOM   9221  C CG    . ASP D  1 199 ? -5.108  -31.683 41.859  1.00 34.14  ? 261 ASP D CG    1 
ATOM   9222  O OD1   . ASP D  1 199 ? -3.925  -31.791 41.392  1.00 33.54  ? 261 ASP D OD1   1 
ATOM   9223  O OD2   . ASP D  1 199 ? -6.142  -31.508 41.176  1.00 38.32  ? 261 ASP D OD2   1 
ATOM   9224  N N     . ILE D  1 200 ? -2.356  -31.265 43.846  1.00 28.94  ? 262 ILE D N     1 
ATOM   9225  C CA    . ILE D  1 200 ? -1.268  -30.485 44.419  1.00 28.98  ? 262 ILE D CA    1 
ATOM   9226  C C     . ILE D  1 200 ? -1.727  -29.088 44.772  1.00 28.12  ? 262 ILE D C     1 
ATOM   9227  O O     . ILE D  1 200 ? -2.425  -28.448 44.003  1.00 25.90  ? 262 ILE D O     1 
ATOM   9228  C CB    . ILE D  1 200 ? -0.033  -30.384 43.510  1.00 29.39  ? 262 ILE D CB    1 
ATOM   9229  C CG1   . ILE D  1 200 ? 0.637   -31.750 43.371  1.00 30.07  ? 262 ILE D CG1   1 
ATOM   9230  C CG2   . ILE D  1 200 ? 0.978   -29.379 44.057  1.00 29.70  ? 262 ILE D CG2   1 
ATOM   9231  C CD1   . ILE D  1 200 ? 0.437   -32.286 41.976  1.00 32.38  ? 262 ILE D CD1   1 
ATOM   9232  N N     . VAL D  1 201 ? -1.271  -28.631 45.937  1.00 28.58  ? 263 VAL D N     1 
ATOM   9233  C CA    . VAL D  1 201 ? -1.556  -27.310 46.458  1.00 29.15  ? 263 VAL D CA    1 
ATOM   9234  C C     . VAL D  1 201 ? -0.267  -26.503 46.526  1.00 27.14  ? 263 VAL D C     1 
ATOM   9235  O O     . VAL D  1 201 ? 0.730   -26.971 47.041  1.00 25.53  ? 263 VAL D O     1 
ATOM   9236  C CB    . VAL D  1 201 ? -2.160  -27.430 47.874  1.00 31.52  ? 263 VAL D CB    1 
ATOM   9237  C CG1   . VAL D  1 201 ? -2.583  -26.065 48.407  1.00 32.55  ? 263 VAL D CG1   1 
ATOM   9238  C CG2   . VAL D  1 201 ? -3.352  -28.395 47.880  1.00 31.02  ? 263 VAL D CG2   1 
ATOM   9239  N N     . ASP D  1 202 ? -0.294  -25.292 45.993  1.00 27.63  ? 264 ASP D N     1 
ATOM   9240  C CA    . ASP D  1 202 ? 0.860   -24.405 46.048  1.00 29.47  ? 264 ASP D CA    1 
ATOM   9241  C C     . ASP D  1 202 ? 1.025   -24.008 47.510  1.00 30.97  ? 264 ASP D C     1 
ATOM   9242  O O     . ASP D  1 202 ? 0.060   -23.593 48.146  1.00 35.07  ? 264 ASP D O     1 
ATOM   9243  C CB    . ASP D  1 202 ? 0.623   -23.166 45.171  1.00 30.47  ? 264 ASP D CB    1 
ATOM   9244  C CG    . ASP D  1 202 ? 1.861   -22.247 45.034  1.00 32.34  ? 264 ASP D CG    1 
ATOM   9245  O OD1   . ASP D  1 202 ? 2.653   -22.057 45.992  1.00 33.83  ? 264 ASP D OD1   1 
ATOM   9246  O OD2   . ASP D  1 202 ? 2.014   -21.654 43.946  1.00 33.07  ? 264 ASP D OD2   1 
ATOM   9247  N N     . PRO D  1 203 ? 2.236   -24.140 48.065  1.00 30.83  ? 265 PRO D N     1 
ATOM   9248  C CA    . PRO D  1 203 ? 2.452   -23.700 49.442  1.00 31.09  ? 265 PRO D CA    1 
ATOM   9249  C C     . PRO D  1 203 ? 2.042   -22.242 49.712  1.00 30.71  ? 265 PRO D C     1 
ATOM   9250  O O     . PRO D  1 203 ? 1.667   -21.907 50.842  1.00 31.93  ? 265 PRO D O     1 
ATOM   9251  C CB    . PRO D  1 203 ? 3.963   -23.888 49.645  1.00 31.10  ? 265 PRO D CB    1 
ATOM   9252  C CG    . PRO D  1 203 ? 4.529   -24.222 48.310  1.00 30.83  ? 265 PRO D CG    1 
ATOM   9253  C CD    . PRO D  1 203 ? 3.423   -24.801 47.508  1.00 30.88  ? 265 PRO D CD    1 
ATOM   9254  N N     . LYS D  1 204 ? 2.101   -21.393 48.690  1.00 29.63  ? 266 LYS D N     1 
ATOM   9255  C CA    . LYS D  1 204 ? 1.663   -20.005 48.825  1.00 30.79  ? 266 LYS D CA    1 
ATOM   9256  C C     . LYS D  1 204 ? 0.204   -19.846 49.198  1.00 27.40  ? 266 LYS D C     1 
ATOM   9257  O O     . LYS D  1 204 ? -0.185  -18.858 49.810  1.00 23.72  ? 266 LYS D O     1 
ATOM   9258  C CB    . LYS D  1 204 ? 1.946   -19.233 47.538  1.00 34.70  ? 266 LYS D CB    1 
ATOM   9259  C CG    . LYS D  1 204 ? 3.409   -18.874 47.409  1.00 37.84  ? 266 LYS D CG    1 
ATOM   9260  C CD    . LYS D  1 204 ? 3.793   -18.548 45.992  1.00 42.30  ? 266 LYS D CD    1 
ATOM   9261  C CE    . LYS D  1 204 ? 5.247   -18.107 45.966  1.00 47.48  ? 266 LYS D CE    1 
ATOM   9262  N NZ    . LYS D  1 204 ? 5.803   -18.112 44.582  1.00 50.21  ? 266 LYS D NZ    1 
ATOM   9263  N N     . GLN D  1 205 ? -0.592  -20.833 48.832  1.00 27.49  ? 267 GLN D N     1 
ATOM   9264  C CA    . GLN D  1 205 ? -2.008  -20.820 49.142  1.00 28.65  ? 267 GLN D CA    1 
ATOM   9265  C C     . GLN D  1 205 ? -2.328  -21.060 50.593  1.00 26.85  ? 267 GLN D C     1 
ATOM   9266  O O     . GLN D  1 205 ? -3.451  -20.800 51.003  1.00 26.63  ? 267 GLN D O     1 
ATOM   9267  C CB    . GLN D  1 205 ? -2.738  -21.887 48.338  1.00 30.89  ? 267 GLN D CB    1 
ATOM   9268  C CG    . GLN D  1 205 ? -2.762  -21.633 46.844  1.00 31.91  ? 267 GLN D CG    1 
ATOM   9269  C CD    . GLN D  1 205 ? -3.522  -22.715 46.125  1.00 32.09  ? 267 GLN D CD    1 
ATOM   9270  O OE1   . GLN D  1 205 ? -4.713  -22.937 46.385  1.00 32.88  ? 267 GLN D OE1   1 
ATOM   9271  N NE2   . GLN D  1 205 ? -2.852  -23.391 45.210  1.00 32.52  ? 267 GLN D NE2   1 
ATOM   9272  N N     . VAL D  1 206 ? -1.367  -21.565 51.361  1.00 25.75  ? 268 VAL D N     1 
ATOM   9273  C CA    . VAL D  1 206 ? -1.614  -21.903 52.764  1.00 25.27  ? 268 VAL D CA    1 
ATOM   9274  C C     . VAL D  1 206 ? -1.701  -20.655 53.619  1.00 24.79  ? 268 VAL D C     1 
ATOM   9275  O O     . VAL D  1 206 ? -0.829  -19.806 53.565  1.00 25.01  ? 268 VAL D O     1 
ATOM   9276  C CB    . VAL D  1 206 ? -0.537  -22.850 53.324  1.00 24.94  ? 268 VAL D CB    1 
ATOM   9277  C CG1   . VAL D  1 206 ? -0.775  -23.137 54.799  1.00 23.59  ? 268 VAL D CG1   1 
ATOM   9278  C CG2   . VAL D  1 206 ? -0.524  -24.148 52.518  1.00 25.35  ? 268 VAL D CG2   1 
ATOM   9279  N N     . VAL D  1 207 ? -2.770  -20.577 54.402  1.00 24.75  ? 269 VAL D N     1 
ATOM   9280  C CA    . VAL D  1 207 ? -3.136  -19.403 55.179  1.00 25.07  ? 269 VAL D CA    1 
ATOM   9281  C C     . VAL D  1 207 ? -2.854  -19.551 56.679  1.00 24.68  ? 269 VAL D C     1 
ATOM   9282  O O     . VAL D  1 207 ? -2.815  -18.557 57.419  1.00 24.47  ? 269 VAL D O     1 
ATOM   9283  C CB    . VAL D  1 207 ? -4.643  -19.141 54.997  1.00 25.62  ? 269 VAL D CB    1 
ATOM   9284  C CG1   . VAL D  1 207 ? -5.176  -18.110 56.008  1.00 26.20  ? 269 VAL D CG1   1 
ATOM   9285  C CG2   . VAL D  1 207 ? -4.911  -18.696 53.572  1.00 25.46  ? 269 VAL D CG2   1 
ATOM   9286  N N     . THR D  1 208 ? -2.657  -20.781 57.124  1.00 24.49  ? 270 THR D N     1 
ATOM   9287  C CA    . THR D  1 208 ? -2.528  -21.068 58.538  1.00 24.98  ? 270 THR D CA    1 
ATOM   9288  C C     . THR D  1 208 ? -1.263  -21.846 58.818  1.00 25.49  ? 270 THR D C     1 
ATOM   9289  O O     . THR D  1 208 ? -0.508  -22.228 57.916  1.00 24.26  ? 270 THR D O     1 
ATOM   9290  C CB    . THR D  1 208 ? -3.715  -21.906 59.050  1.00 24.76  ? 270 THR D CB    1 
ATOM   9291  O OG1   . THR D  1 208 ? -3.689  -23.210 58.456  1.00 25.40  ? 270 THR D OG1   1 
ATOM   9292  C CG2   . THR D  1 208 ? -4.986  -21.254 58.679  1.00 24.87  ? 270 THR D CG2   1 
ATOM   9293  N N     . ASN D  1 209 ? -1.034  -22.050 60.102  1.00 26.70  ? 271 ASN D N     1 
ATOM   9294  C CA    . ASN D  1 209 ? -0.050  -23.018 60.556  1.00 27.89  ? 271 ASN D CA    1 
ATOM   9295  C C     . ASN D  1 209 ? -0.628  -24.408 60.370  1.00 26.86  ? 271 ASN D C     1 
ATOM   9296  O O     . ASN D  1 209 ? -1.720  -24.553 59.804  1.00 24.92  ? 271 ASN D O     1 
ATOM   9297  C CB    . ASN D  1 209 ? 0.339   -22.757 62.018  1.00 28.62  ? 271 ASN D CB    1 
ATOM   9298  C CG    . ASN D  1 209 ? -0.852  -22.716 62.950  1.00 29.24  ? 271 ASN D CG    1 
ATOM   9299  O OD1   . ASN D  1 209 ? -2.015  -22.689 62.531  1.00 29.32  ? 271 ASN D OD1   1 
ATOM   9300  N ND2   . ASN D  1 209 ? -0.563  -22.719 64.237  1.00 31.30  ? 271 ASN D ND2   1 
ATOM   9301  N N     . ALA D  1 210 ? 0.106   -25.421 60.828  1.00 26.24  ? 272 ALA D N     1 
ATOM   9302  C CA    . ALA D  1 210 ? -0.370  -26.786 60.732  1.00 26.42  ? 272 ALA D CA    1 
ATOM   9303  C C     . ALA D  1 210 ? -0.766  -27.325 62.082  1.00 25.88  ? 272 ALA D C     1 
ATOM   9304  O O     . ALA D  1 210 ? -0.183  -26.969 63.084  1.00 26.10  ? 272 ALA D O     1 
ATOM   9305  C CB    . ALA D  1 210 ? 0.693   -27.676 60.091  1.00 27.12  ? 272 ALA D CB    1 
ATOM   9306  N N     . CYS D  1 211 ? -1.740  -28.217 62.092  1.00 26.14  ? 273 CYS D N     1 
ATOM   9307  C CA    . CYS D  1 211 ? -2.152  -28.858 63.310  1.00 26.97  ? 273 CYS D CA    1 
ATOM   9308  C C     . CYS D  1 211 ? -2.125  -30.352 63.104  1.00 27.04  ? 273 CYS D C     1 
ATOM   9309  O O     . CYS D  1 211 ? -2.598  -30.859 62.085  1.00 25.85  ? 273 CYS D O     1 
ATOM   9310  C CB    . CYS D  1 211 ? -3.556  -28.414 63.698  1.00 27.96  ? 273 CYS D CB    1 
ATOM   9311  S SG    . CYS D  1 211 ? -4.217  -29.269 65.169  1.00 26.12  ? 273 CYS D SG    1 
ATOM   9312  N N     . LEU D  1 212 ? -1.575  -31.045 64.093  1.00 28.60  ? 274 LEU D N     1 
ATOM   9313  C CA    . LEU D  1 212 ? -1.512  -32.504 64.095  1.00 30.05  ? 274 LEU D CA    1 
ATOM   9314  C C     . LEU D  1 212 ? -2.896  -33.020 64.355  1.00 28.53  ? 274 LEU D C     1 
ATOM   9315  O O     . LEU D  1 212 ? -3.555  -32.510 65.225  1.00 29.44  ? 274 LEU D O     1 
ATOM   9316  C CB    . LEU D  1 212 ? -0.547  -32.988 65.190  1.00 31.16  ? 274 LEU D CB    1 
ATOM   9317  C CG    . LEU D  1 212 ? -0.391  -34.486 65.459  1.00 32.23  ? 274 LEU D CG    1 
ATOM   9318  C CD1   . LEU D  1 212 ? 0.166   -35.160 64.217  1.00 32.90  ? 274 LEU D CD1   1 
ATOM   9319  C CD2   . LEU D  1 212 ? 0.541   -34.725 66.650  1.00 32.99  ? 274 LEU D CD2   1 
ATOM   9320  N N     . ILE D  1 213 ? -3.357  -33.996 63.594  1.00 27.80  ? 275 ILE D N     1 
ATOM   9321  C CA    . ILE D  1 213 ? -4.635  -34.604 63.903  1.00 28.31  ? 275 ILE D CA    1 
ATOM   9322  C C     . ILE D  1 213 ? -4.595  -36.112 64.058  1.00 29.00  ? 275 ILE D C     1 
ATOM   9323  O O     . ILE D  1 213 ? -5.628  -36.699 64.349  1.00 29.79  ? 275 ILE D O     1 
ATOM   9324  C CB    . ILE D  1 213 ? -5.714  -34.233 62.873  1.00 29.17  ? 275 ILE D CB    1 
ATOM   9325  C CG1   . ILE D  1 213 ? -5.299  -34.613 61.462  1.00 30.77  ? 275 ILE D CG1   1 
ATOM   9326  C CG2   . ILE D  1 213 ? -5.981  -32.748 62.922  1.00 29.72  ? 275 ILE D CG2   1 
ATOM   9327  C CD1   . ILE D  1 213 ? -6.454  -34.640 60.485  1.00 31.18  ? 275 ILE D CD1   1 
ATOM   9328  N N     . LYS D  1 214 ? -3.444  -36.751 63.852  1.00 29.46  ? 276 LYS D N     1 
ATOM   9329  C CA    . LYS D  1 214 ? -3.327  -38.191 64.109  1.00 31.12  ? 276 LYS D CA    1 
ATOM   9330  C C     . LYS D  1 214 ? -1.890  -38.667 64.040  1.00 32.33  ? 276 LYS D C     1 
ATOM   9331  O O     . LYS D  1 214 ? -1.253  -38.598 62.993  1.00 34.04  ? 276 LYS D O     1 
ATOM   9332  C CB    . LYS D  1 214 ? -4.153  -39.019 63.108  1.00 31.91  ? 276 LYS D CB    1 
ATOM   9333  C CG    . LYS D  1 214 ? -4.215  -40.509 63.416  1.00 32.18  ? 276 LYS D CG    1 
ATOM   9334  C CD    . LYS D  1 214 ? -5.084  -40.784 64.625  1.00 33.11  ? 276 LYS D CD    1 
ATOM   9335  C CE    . LYS D  1 214 ? -4.937  -42.219 65.100  1.00 35.16  ? 276 LYS D CE    1