data_5DTI
# 
_entry.id   5DTI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5DTI         
WWPDB D_1000213788 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5DTG PDB . 
unspecified 5DTJ PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5DTI 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tran, T.H.' 1 
'Tong, L.'   2 
# 
_citation.id                        primary 
_citation.title                     
'Discovery of New Classes of Compounds that Reactivate Acetylcholinesterase Inhibited by Organophosphates.' 
_citation.journal_abbrev            Chembiochem 
_citation.journal_volume            16 
_citation.page_first                2205 
_citation.page_last                 2215 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1439-7633 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26350723 
_citation.pdbx_database_id_DOI      10.1002/cbic.201500348 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Katz, F.S.'       1  
primary 'Pecic, S.'        2  
primary 'Tran, T.H.'       3  
primary 'Trakht, I.'       4  
primary 'Schneider, L.'    5  
primary 'Zhu, Z.'          6  
primary 'Ton-That, L.'     7  
primary 'Luzac, M.'        8  
primary 'Zlatanic, V.'     9  
primary 'Damera, S.'       10 
primary 'Macdonald, J.'    11 
primary 'Landry, D.W.'     12 
primary 'Tong, L.'         13 
primary 'Stojanovic, M.N.' 14 
# 
_cell.entry_id           5DTI 
_cell.length_a           78.411 
_cell.length_b           113.135 
_cell.length_c           227.199 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5DTI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Acetylcholinesterase 60006.785 2   3.1.1.7 ? 'UNP residues 32-573' ? 
2 water   nat water                18.015    518 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DPMEGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFG
FLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWA
TVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALIN
TGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDA
MSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLM
KYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DPMEGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLY
PGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFG
FLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWA
TVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALIN
TGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDA
MSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLM
KYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   MET n 
1 4   GLU n 
1 5   GLY n 
1 6   ARG n 
1 7   GLU n 
1 8   ASP n 
1 9   PRO n 
1 10  GLN n 
1 11  LEU n 
1 12  LEU n 
1 13  VAL n 
1 14  ARG n 
1 15  VAL n 
1 16  ARG n 
1 17  GLY n 
1 18  GLY n 
1 19  GLN n 
1 20  LEU n 
1 21  ARG n 
1 22  GLY n 
1 23  ILE n 
1 24  ARG n 
1 25  LEU n 
1 26  LYS n 
1 27  ALA n 
1 28  PRO n 
1 29  GLY n 
1 30  GLY n 
1 31  PRO n 
1 32  VAL n 
1 33  SER n 
1 34  ALA n 
1 35  PHE n 
1 36  LEU n 
1 37  GLY n 
1 38  ILE n 
1 39  PRO n 
1 40  PHE n 
1 41  ALA n 
1 42  GLU n 
1 43  PRO n 
1 44  PRO n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  ARG n 
1 49  ARG n 
1 50  PHE n 
1 51  MET n 
1 52  PRO n 
1 53  PRO n 
1 54  GLU n 
1 55  PRO n 
1 56  LYS n 
1 57  ARG n 
1 58  PRO n 
1 59  TRP n 
1 60  SER n 
1 61  GLY n 
1 62  VAL n 
1 63  LEU n 
1 64  ASP n 
1 65  ALA n 
1 66  THR n 
1 67  THR n 
1 68  PHE n 
1 69  GLN n 
1 70  ASN n 
1 71  VAL n 
1 72  CYS n 
1 73  TYR n 
1 74  GLN n 
1 75  TYR n 
1 76  VAL n 
1 77  ASP n 
1 78  THR n 
1 79  LEU n 
1 80  TYR n 
1 81  PRO n 
1 82  GLY n 
1 83  PHE n 
1 84  GLU n 
1 85  GLY n 
1 86  THR n 
1 87  GLU n 
1 88  MET n 
1 89  TRP n 
1 90  ASN n 
1 91  PRO n 
1 92  ASN n 
1 93  ARG n 
1 94  GLU n 
1 95  LEU n 
1 96  SER n 
1 97  GLU n 
1 98  ASP n 
1 99  CYS n 
1 100 LEU n 
1 101 TYR n 
1 102 LEU n 
1 103 ASN n 
1 104 VAL n 
1 105 TRP n 
1 106 THR n 
1 107 PRO n 
1 108 TYR n 
1 109 PRO n 
1 110 ARG n 
1 111 PRO n 
1 112 ALA n 
1 113 SER n 
1 114 PRO n 
1 115 THR n 
1 116 PRO n 
1 117 VAL n 
1 118 LEU n 
1 119 ILE n 
1 120 TRP n 
1 121 ILE n 
1 122 TYR n 
1 123 GLY n 
1 124 GLY n 
1 125 GLY n 
1 126 PHE n 
1 127 TYR n 
1 128 SER n 
1 129 GLY n 
1 130 ALA n 
1 131 ALA n 
1 132 SER n 
1 133 LEU n 
1 134 ASP n 
1 135 VAL n 
1 136 TYR n 
1 137 ASP n 
1 138 GLY n 
1 139 ARG n 
1 140 PHE n 
1 141 LEU n 
1 142 ALA n 
1 143 GLN n 
1 144 VAL n 
1 145 GLU n 
1 146 GLY n 
1 147 ALA n 
1 148 VAL n 
1 149 LEU n 
1 150 VAL n 
1 151 SER n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ARG n 
1 156 VAL n 
1 157 GLY n 
1 158 THR n 
1 159 PHE n 
1 160 GLY n 
1 161 PHE n 
1 162 LEU n 
1 163 ALA n 
1 164 LEU n 
1 165 PRO n 
1 166 GLY n 
1 167 SER n 
1 168 ARG n 
1 169 GLU n 
1 170 ALA n 
1 171 PRO n 
1 172 GLY n 
1 173 ASN n 
1 174 VAL n 
1 175 GLY n 
1 176 LEU n 
1 177 LEU n 
1 178 ASP n 
1 179 GLN n 
1 180 ARG n 
1 181 LEU n 
1 182 ALA n 
1 183 LEU n 
1 184 GLN n 
1 185 TRP n 
1 186 VAL n 
1 187 GLN n 
1 188 GLU n 
1 189 ASN n 
1 190 ILE n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 GLY n 
1 195 GLY n 
1 196 ASP n 
1 197 PRO n 
1 198 MET n 
1 199 SER n 
1 200 VAL n 
1 201 THR n 
1 202 LEU n 
1 203 PHE n 
1 204 GLY n 
1 205 GLU n 
1 206 SER n 
1 207 ALA n 
1 208 GLY n 
1 209 ALA n 
1 210 ALA n 
1 211 SER n 
1 212 VAL n 
1 213 GLY n 
1 214 MET n 
1 215 HIS n 
1 216 ILE n 
1 217 LEU n 
1 218 SER n 
1 219 LEU n 
1 220 PRO n 
1 221 SER n 
1 222 ARG n 
1 223 SER n 
1 224 LEU n 
1 225 PHE n 
1 226 HIS n 
1 227 ARG n 
1 228 ALA n 
1 229 VAL n 
1 230 LEU n 
1 231 GLN n 
1 232 SER n 
1 233 GLY n 
1 234 THR n 
1 235 PRO n 
1 236 ASN n 
1 237 GLY n 
1 238 PRO n 
1 239 TRP n 
1 240 ALA n 
1 241 THR n 
1 242 VAL n 
1 243 SER n 
1 244 ALA n 
1 245 GLY n 
1 246 GLU n 
1 247 ALA n 
1 248 ARG n 
1 249 ARG n 
1 250 ARG n 
1 251 ALA n 
1 252 THR n 
1 253 LEU n 
1 254 LEU n 
1 255 ALA n 
1 256 ARG n 
1 257 LEU n 
1 258 VAL n 
1 259 GLY n 
1 260 CYS n 
1 261 PRO n 
1 262 PRO n 
1 263 GLY n 
1 264 GLY n 
1 265 ALA n 
1 266 GLY n 
1 267 GLY n 
1 268 ASN n 
1 269 ASP n 
1 270 THR n 
1 271 GLU n 
1 272 LEU n 
1 273 ILE n 
1 274 ALA n 
1 275 CYS n 
1 276 LEU n 
1 277 ARG n 
1 278 THR n 
1 279 ARG n 
1 280 PRO n 
1 281 ALA n 
1 282 GLN n 
1 283 ASP n 
1 284 LEU n 
1 285 VAL n 
1 286 ASP n 
1 287 HIS n 
1 288 GLU n 
1 289 TRP n 
1 290 HIS n 
1 291 VAL n 
1 292 LEU n 
1 293 PRO n 
1 294 GLN n 
1 295 GLU n 
1 296 SER n 
1 297 ILE n 
1 298 PHE n 
1 299 ARG n 
1 300 PHE n 
1 301 SER n 
1 302 PHE n 
1 303 VAL n 
1 304 PRO n 
1 305 VAL n 
1 306 VAL n 
1 307 ASP n 
1 308 GLY n 
1 309 ASP n 
1 310 PHE n 
1 311 LEU n 
1 312 SER n 
1 313 ASP n 
1 314 THR n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 LEU n 
1 319 ILE n 
1 320 ASN n 
1 321 THR n 
1 322 GLY n 
1 323 ASP n 
1 324 PHE n 
1 325 GLN n 
1 326 ASP n 
1 327 LEU n 
1 328 GLN n 
1 329 VAL n 
1 330 LEU n 
1 331 VAL n 
1 332 GLY n 
1 333 VAL n 
1 334 VAL n 
1 335 LYS n 
1 336 ASP n 
1 337 GLU n 
1 338 GLY n 
1 339 SER n 
1 340 TYR n 
1 341 PHE n 
1 342 LEU n 
1 343 VAL n 
1 344 TYR n 
1 345 GLY n 
1 346 VAL n 
1 347 PRO n 
1 348 GLY n 
1 349 PHE n 
1 350 SER n 
1 351 LYS n 
1 352 ASP n 
1 353 ASN n 
1 354 GLU n 
1 355 SER n 
1 356 LEU n 
1 357 ILE n 
1 358 SER n 
1 359 ARG n 
1 360 ALA n 
1 361 GLN n 
1 362 PHE n 
1 363 LEU n 
1 364 ALA n 
1 365 GLY n 
1 366 VAL n 
1 367 ARG n 
1 368 ILE n 
1 369 GLY n 
1 370 VAL n 
1 371 PRO n 
1 372 GLN n 
1 373 ALA n 
1 374 SER n 
1 375 ASP n 
1 376 LEU n 
1 377 ALA n 
1 378 ALA n 
1 379 GLU n 
1 380 ALA n 
1 381 VAL n 
1 382 VAL n 
1 383 LEU n 
1 384 HIS n 
1 385 TYR n 
1 386 THR n 
1 387 ASP n 
1 388 TRP n 
1 389 LEU n 
1 390 HIS n 
1 391 PRO n 
1 392 GLU n 
1 393 ASP n 
1 394 PRO n 
1 395 THR n 
1 396 HIS n 
1 397 LEU n 
1 398 ARG n 
1 399 ASP n 
1 400 ALA n 
1 401 MET n 
1 402 SER n 
1 403 ALA n 
1 404 VAL n 
1 405 VAL n 
1 406 GLY n 
1 407 ASP n 
1 408 HIS n 
1 409 ASN n 
1 410 VAL n 
1 411 VAL n 
1 412 CYS n 
1 413 PRO n 
1 414 VAL n 
1 415 ALA n 
1 416 GLN n 
1 417 LEU n 
1 418 ALA n 
1 419 GLY n 
1 420 ARG n 
1 421 LEU n 
1 422 ALA n 
1 423 ALA n 
1 424 GLN n 
1 425 GLY n 
1 426 ALA n 
1 427 ARG n 
1 428 VAL n 
1 429 TYR n 
1 430 ALA n 
1 431 TYR n 
1 432 ILE n 
1 433 PHE n 
1 434 GLU n 
1 435 HIS n 
1 436 ARG n 
1 437 ALA n 
1 438 SER n 
1 439 THR n 
1 440 LEU n 
1 441 THR n 
1 442 TRP n 
1 443 PRO n 
1 444 LEU n 
1 445 TRP n 
1 446 MET n 
1 447 GLY n 
1 448 VAL n 
1 449 PRO n 
1 450 HIS n 
1 451 GLY n 
1 452 TYR n 
1 453 GLU n 
1 454 ILE n 
1 455 GLU n 
1 456 PHE n 
1 457 ILE n 
1 458 PHE n 
1 459 GLY n 
1 460 LEU n 
1 461 PRO n 
1 462 LEU n 
1 463 ASP n 
1 464 PRO n 
1 465 SER n 
1 466 LEU n 
1 467 ASN n 
1 468 TYR n 
1 469 THR n 
1 470 THR n 
1 471 GLU n 
1 472 GLU n 
1 473 ARG n 
1 474 ILE n 
1 475 PHE n 
1 476 ALA n 
1 477 GLN n 
1 478 ARG n 
1 479 LEU n 
1 480 MET n 
1 481 LYS n 
1 482 TYR n 
1 483 TRP n 
1 484 THR n 
1 485 ASN n 
1 486 PHE n 
1 487 ALA n 
1 488 ARG n 
1 489 THR n 
1 490 GLY n 
1 491 ASP n 
1 492 PRO n 
1 493 ASN n 
1 494 ASP n 
1 495 PRO n 
1 496 ARG n 
1 497 ASP n 
1 498 SER n 
1 499 LYS n 
1 500 SER n 
1 501 PRO n 
1 502 GLN n 
1 503 TRP n 
1 504 PRO n 
1 505 PRO n 
1 506 TYR n 
1 507 THR n 
1 508 THR n 
1 509 ALA n 
1 510 ALA n 
1 511 GLN n 
1 512 GLN n 
1 513 TYR n 
1 514 VAL n 
1 515 SER n 
1 516 LEU n 
1 517 ASN n 
1 518 LEU n 
1 519 LYS n 
1 520 PRO n 
1 521 LEU n 
1 522 GLU n 
1 523 VAL n 
1 524 ARG n 
1 525 ARG n 
1 526 GLY n 
1 527 LEU n 
1 528 ARG n 
1 529 ALA n 
1 530 GLN n 
1 531 THR n 
1 532 CYS n 
1 533 ALA n 
1 534 PHE n 
1 535 TRP n 
1 536 ASN n 
1 537 ARG n 
1 538 PHE n 
1 539 LEU n 
1 540 PRO n 
1 541 LYS n 
1 542 LEU n 
1 543 LEU n 
1 544 SER n 
1 545 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   545 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Ache 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'Hi-5 insect cells by C-PERL' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSA
;
_struct_ref.pdbx_align_begin           32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5DTI A 4 ? 545 ? P21836 32 ? 573 ? 1 542 
2 1 5DTI B 4 ? 545 ? P21836 32 ? 573 ? 1 542 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5DTI ASP A 1 ? UNP P21836 ? ? 'expression tag' -2 1 
1 5DTI PRO A 2 ? UNP P21836 ? ? 'expression tag' -1 2 
1 5DTI MET A 3 ? UNP P21836 ? ? 'expression tag' 0  3 
2 5DTI ASP B 1 ? UNP P21836 ? ? 'expression tag' -2 4 
2 5DTI PRO B 2 ? UNP P21836 ? ? 'expression tag' -1 5 
2 5DTI MET B 3 ? UNP P21836 ? ? 'expression tag' 0  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5DTI 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.20 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.70 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            274 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% v/v PEG 600, 0.1 M sodium citrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-10-30 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5DTI 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.0 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       126503 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            27.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5DTI 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     126222 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.999 
_refine.ls_d_res_high                            2.003 
_refine.ls_percent_reflns_obs                    92.54 
_refine.ls_R_factor_obs                          0.1974 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1970 
_refine.ls_R_factor_R_free                       0.2238 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.58 
_refine.ls_number_reflns_R_free                  1998 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 2HA2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.24 
_refine.pdbx_overall_phase_error                 27.84 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8349 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             518 
_refine_hist.number_atoms_total               8867 
_refine_hist.d_res_high                       2.003 
_refine_hist.d_res_low                        45.999 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 8603  'X-RAY DIFFRACTION' ? 
f_angle_d          0.981  ? ? 11747 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.567 ? ? 3097  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.038  ? ? 1263  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1549  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.0    2.0531  5552 0.2952 59.00  0.3611 . . 90  . . . . 
'X-RAY DIFFRACTION' . 2.0531 2.1086  6614 0.2785 70.00  0.2788 . . 106 . . . . 
'X-RAY DIFFRACTION' . 2.1086 2.1706  7497 0.2701 79.00  0.3092 . . 120 . . . . 
'X-RAY DIFFRACTION' . 2.1706 2.2407  8663 0.2515 91.00  0.3059 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.2407 2.3208  9393 0.2351 99.00  0.2835 . . 150 . . . . 
'X-RAY DIFFRACTION' . 2.3208 2.4137  9490 0.2279 100.00 0.2433 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.4137 2.5235  9504 0.2167 100.00 0.2702 . . 154 . . . . 
'X-RAY DIFFRACTION' . 2.5235 2.6565  9499 0.2152 100.00 0.2399 . . 151 . . . . 
'X-RAY DIFFRACTION' . 2.6565 2.8230  9563 0.2169 100.00 0.2466 . . 155 . . . . 
'X-RAY DIFFRACTION' . 2.8230 3.0409  9557 0.2181 100.00 0.2554 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.0409 3.3468  9591 0.2222 100.00 0.2471 . . 154 . . . . 
'X-RAY DIFFRACTION' . 3.3468 3.8309  9641 0.1909 100.00 0.2096 . . 155 . . . . 
'X-RAY DIFFRACTION' . 3.8309 4.8257  9699 0.1528 100.00 0.1673 . . 156 . . . . 
'X-RAY DIFFRACTION' . 4.8257 46.0112 9961 0.1663 99.00  0.1949 . . 160 . . . . 
# 
_struct.entry_id                     5DTI 
_struct.title                        'Crystal structure of mouse acetylcholinesterase' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5DTI 
_struct_keywords.text            hydrolase 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MET A 3   ? GLU A 7   ? MET A 0   GLU A 4   5 ? 5  
HELX_P HELX_P2  AA2 ASP A 8   ? GLN A 10  ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P3  AA3 VAL A 45  ? ARG A 49  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P4  AA4 PHE A 83  ? MET A 88  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P5  AA5 LEU A 133 ? ASP A 137 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P6  AA6 GLY A 138 ? GLY A 146 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P7  AA7 VAL A 156 ? LEU A 162 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P8  AA8 ASN A 173 ? ILE A 190 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P9  AA9 ALA A 191 ? PHE A 193 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P10 AB1 SER A 206 ? LEU A 217 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P11 AB2 SER A 218 ? SER A 223 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P12 AB3 ALA A 244 ? VAL A 258 ? ALA A 241 VAL A 255 1 ? 15 
HELX_P HELX_P13 AB4 ASP A 269 ? ARG A 279 ? ASP A 266 ARG A 276 1 ? 11 
HELX_P HELX_P14 AB5 PRO A 280 ? GLU A 288 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P15 AB6 TRP A 289 ? VAL A 291 ? TRP A 286 VAL A 288 5 ? 3  
HELX_P HELX_P16 AB7 THR A 314 ? GLY A 322 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P17 AB8 GLY A 338 ? VAL A 343 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P18 AB9 SER A 358 ? VAL A 370 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P19 AC1 SER A 374 ? THR A 386 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P20 AC2 ASP A 393 ? VAL A 410 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P21 AC3 VAL A 410 ? GLN A 424 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P22 AC4 PRO A 443 ? GLY A 447 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P23 AC5 GLU A 453 ? PHE A 458 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P24 AC6 GLY A 459 ? ASN A 467 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P25 AC7 THR A 469 ? GLY A 490 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 AC8 ARG A 528 ? ARG A 537 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 AC9 PHE A 538 ? LEU A 543 ? PHE A 535 LEU A 540 5 ? 6  
HELX_P HELX_P28 AD1 ASP B 8   ? GLN B 10  ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 AD2 VAL B 45  ? ARG B 49  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 AD3 PHE B 83  ? MET B 88  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 AD4 LEU B 133 ? ASP B 137 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 AD5 GLY B 138 ? GLY B 146 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 AD6 VAL B 156 ? LEU B 162 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 AD7 ASN B 173 ? ILE B 190 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 AD8 ALA B 191 ? PHE B 193 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 AD9 SER B 206 ? LEU B 217 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P37 AE1 SER B 218 ? SER B 223 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 AE2 SER B 243 ? VAL B 258 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P39 AE3 ASP B 269 ? ARG B 279 ? ASP B 266 ARG B 276 1 ? 11 
HELX_P HELX_P40 AE4 PRO B 280 ? GLU B 288 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P41 AE5 TRP B 289 ? VAL B 291 ? TRP B 286 VAL B 288 5 ? 3  
HELX_P HELX_P42 AE6 THR B 314 ? GLY B 322 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 AE7 GLY B 338 ? VAL B 343 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P44 AE8 SER B 358 ? VAL B 370 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 AE9 SER B 374 ? THR B 386 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 AF1 ASP B 393 ? VAL B 410 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 AF2 VAL B 410 ? GLN B 424 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 AF3 PRO B 443 ? GLY B 447 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 AF4 GLU B 453 ? PHE B 458 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P50 AF5 GLY B 459 ? ASN B 467 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P51 AF6 THR B 469 ? GLY B 490 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 AF7 ARG B 528 ? ARG B 537 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P53 AF8 PHE B 538 ? LEU B 543 ? PHE B 535 LEU B 540 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 72  SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf2 disulf ? ? A CYS 260 SG ? ? ? 1_555 A CYS 275 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf3 disulf ? ? A CYS 412 SG ? ? ? 1_555 A CYS 532 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf4 disulf ? ? B CYS 72  SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf5 disulf ? ? B CYS 260 SG ? ? ? 1_555 B CYS 275 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf6 disulf ? ? B CYS 412 SG ? ? ? 1_555 B CYS 532 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.039 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 108 A . ? TYR 105 A PRO 109 A ? PRO 106 A 1 -3.26 
2 TYR 108 B . ? TYR 105 B PRO 109 B ? PRO 106 B 1 3.08  
3 CYS 260 B . ? CYS 257 B PRO 261 B ? PRO 258 B 1 0.89  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 3  ? 
AA6 ? 11 ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? parallel      
AA6 7  8  ? parallel      
AA6 8  9  ? parallel      
AA6 9  10 ? parallel      
AA6 10 11 ? anti-parallel 
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 12  ? VAL A 15  ? LEU A 9   VAL A 12  
AA1 2  GLY A 18  ? ARG A 21  ? GLY A 15  ARG A 18  
AA1 3  VAL A 62  ? ASP A 64  ? VAL A 59  ASP A 61  
AA2 1  ILE A 23  ? ALA A 27  ? ILE A 20  ALA A 24  
AA2 2  GLY A 30  ? PRO A 39  ? GLY A 27  PRO A 36  
AA2 3  TYR A 101 ? PRO A 107 ? TYR A 98  PRO A 104 
AA2 4  VAL A 148 ? MET A 152 ? VAL A 145 MET A 149 
AA2 5  THR A 115 ? ILE A 121 ? THR A 112 ILE A 118 
AA2 6  GLY A 195 ? GLU A 205 ? GLY A 192 GLU A 202 
AA2 7  ARG A 227 ? GLN A 231 ? ARG A 224 GLN A 228 
AA2 8  GLN A 328 ? VAL A 334 ? GLN A 325 VAL A 331 
AA2 9  ARG A 427 ? PHE A 433 ? ARG A 424 PHE A 430 
AA2 10 GLN A 512 ? LEU A 516 ? GLN A 509 LEU A 513 
AA2 11 GLU A 522 ? ARG A 525 ? GLU A 519 ARG A 522 
AA3 1  VAL A 71  ? CYS A 72  ? VAL A 68  CYS A 69  
AA3 2  LEU A 95  ? SER A 96  ? LEU A 92  SER A 93  
AA4 1  VAL A 242 ? SER A 243 ? VAL A 239 SER A 240 
AA4 2  VAL A 305 ? VAL A 306 ? VAL A 302 VAL A 303 
AA5 1  LEU B 12  ? VAL B 15  ? LEU B 9   VAL B 12  
AA5 2  GLY B 18  ? ARG B 21  ? GLY B 15  ARG B 18  
AA5 3  VAL B 62  ? ASP B 64  ? VAL B 59  ASP B 61  
AA6 1  ILE B 23  ? ALA B 27  ? ILE B 20  ALA B 24  
AA6 2  GLY B 30  ? PRO B 39  ? GLY B 27  PRO B 36  
AA6 3  TYR B 101 ? PRO B 107 ? TYR B 98  PRO B 104 
AA6 4  VAL B 148 ? MET B 152 ? VAL B 145 MET B 149 
AA6 5  THR B 115 ? ILE B 121 ? THR B 112 ILE B 118 
AA6 6  GLY B 195 ? GLU B 205 ? GLY B 192 GLU B 202 
AA6 7  ARG B 227 ? GLN B 231 ? ARG B 224 GLN B 228 
AA6 8  GLN B 328 ? VAL B 334 ? GLN B 325 VAL B 331 
AA6 9  ARG B 427 ? PHE B 433 ? ARG B 424 PHE B 430 
AA6 10 GLN B 512 ? LEU B 516 ? GLN B 509 LEU B 513 
AA6 11 GLU B 522 ? ARG B 525 ? GLU B 519 ARG B 522 
AA7 1  VAL B 71  ? CYS B 72  ? VAL B 68  CYS B 69  
AA7 2  LEU B 95  ? SER B 96  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 13  ? N VAL A 10  O LEU A 20  ? O LEU A 17  
AA1 2  3  N GLN A 19  ? N GLN A 16  O LEU A 63  ? O LEU A 60  
AA2 1  2  N ILE A 23  ? N ILE A 20  O ALA A 34  ? O ALA A 31  
AA2 2  3  N ILE A 38  ? N ILE A 35  O LEU A 102 ? O LEU A 99  
AA2 3  4  N TRP A 105 ? N TRP A 102 O LEU A 149 ? O LEU A 146 
AA2 4  5  O VAL A 150 ? O VAL A 147 N LEU A 118 ? N LEU A 115 
AA2 5  6  N VAL A 117 ? N VAL A 114 O SER A 199 ? O SER A 196 
AA2 6  7  N LEU A 202 ? N LEU A 199 O ARG A 227 ? O ARG A 224 
AA2 7  8  N LEU A 230 ? N LEU A 227 O LEU A 330 ? O LEU A 327 
AA2 8  9  N VAL A 333 ? N VAL A 330 O PHE A 433 ? O PHE A 430 
AA2 9  10 N ILE A 432 ? N ILE A 429 O LEU A 516 ? O LEU A 513 
AA2 10 11 N TYR A 513 ? N TYR A 510 O ARG A 524 ? O ARG A 521 
AA3 1  2  N VAL A 71  ? N VAL A 68  O SER A 96  ? O SER A 93  
AA4 1  2  N VAL A 242 ? N VAL A 239 O VAL A 306 ? O VAL A 303 
AA5 1  2  N VAL B 15  ? N VAL B 12  O GLY B 18  ? O GLY B 15  
AA5 2  3  N GLN B 19  ? N GLN B 16  O LEU B 63  ? O LEU B 60  
AA6 1  2  N LEU B 25  ? N LEU B 22  O VAL B 32  ? O VAL B 29  
AA6 2  3  N ILE B 38  ? N ILE B 35  O LEU B 102 ? O LEU B 99  
AA6 3  4  N TRP B 105 ? N TRP B 102 O LEU B 149 ? O LEU B 146 
AA6 4  5  O VAL B 150 ? O VAL B 147 N LEU B 118 ? N LEU B 115 
AA6 5  6  N THR B 115 ? N THR B 112 O ASP B 196 ? O ASP B 193 
AA6 6  7  N GLY B 204 ? N GLY B 201 O GLN B 231 ? O GLN B 228 
AA6 7  8  N LEU B 230 ? N LEU B 227 O LEU B 330 ? O LEU B 327 
AA6 8  9  N VAL B 329 ? N VAL B 326 O ARG B 427 ? O ARG B 424 
AA6 9  10 N ILE B 432 ? N ILE B 429 O LEU B 516 ? O LEU B 513 
AA6 10 11 N TYR B 513 ? N TYR B 510 O ARG B 524 ? O ARG B 521 
AA7 1  2  N VAL B 71  ? N VAL B 68  O SER B 96  ? O SER B 93  
# 
_atom_sites.entry_id                    5DTI 
_atom_sites.fract_transf_matrix[1][1]   0.012753 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008839 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004401 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 3.396   -13.986 54.634  1.00 54.84  ? -2  ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 3.827   -15.375 54.571  1.00 47.13  ? -2  ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 4.344   -15.854 55.922  1.00 43.85  ? -2  ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 5.337   -15.327 56.419  1.00 40.31  ? -2  ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 4.922   -15.546 53.525  1.00 45.26  ? -2  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 5.058   -16.967 53.062  1.00 47.36  ? -2  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 4.834   -17.870 53.885  1.00 59.41  ? -2  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 5.390   -17.188 51.879  1.00 55.55  ? -2  ASP A OD2 1 
ATOM   9    N N   . PRO A 1 2   ? 3.689   -16.869 56.506  1.00 47.01  ? -1  PRO A N   1 
ATOM   10   C CA  . PRO A 1 2   ? 4.126   -17.386 57.810  1.00 46.08  ? -1  PRO A CA  1 
ATOM   11   C C   . PRO A 1 2   ? 5.546   -17.953 57.787  1.00 47.22  ? -1  PRO A C   1 
ATOM   12   O O   . PRO A 1 2   ? 6.223   -17.928 58.812  1.00 40.47  ? -1  PRO A O   1 
ATOM   13   C CB  . PRO A 1 2   ? 3.105   -18.489 58.113  1.00 45.42  ? -1  PRO A CB  1 
ATOM   14   C CG  . PRO A 1 2   ? 1.898   -18.111 57.322  1.00 50.23  ? -1  PRO A CG  1 
ATOM   15   C CD  . PRO A 1 2   ? 2.437   -17.502 56.055  1.00 44.90  ? -1  PRO A CD  1 
ATOM   16   N N   . MET A 1 3   ? 6.002   -18.441 56.636  1.00 45.74  ? 0   MET A N   1 
ATOM   17   C CA  . MET A 1 3   ? 7.321   -19.064 56.570  1.00 43.58  ? 0   MET A CA  1 
ATOM   18   C C   . MET A 1 3   ? 8.427   -18.133 56.056  1.00 41.15  ? 0   MET A C   1 
ATOM   19   O O   . MET A 1 3   ? 9.554   -18.582 55.854  1.00 40.84  ? 0   MET A O   1 
ATOM   20   C CB  . MET A 1 3   ? 7.265   -20.340 55.709  1.00 49.90  ? 0   MET A CB  1 
ATOM   21   C CG  . MET A 1 3   ? 6.145   -20.356 54.680  1.00 57.05  ? 0   MET A CG  1 
ATOM   22   S SD  . MET A 1 3   ? 5.994   -21.815 53.627  1.00 82.48  ? 0   MET A SD  1 
ATOM   23   C CE  . MET A 1 3   ? 7.662   -21.991 52.985  1.00 62.38  ? 0   MET A CE  1 
ATOM   24   N N   . GLU A 1 4   ? 8.125   -16.845 55.875  1.00 38.31  ? 1   GLU A N   1 
ATOM   25   C CA  . GLU A 1 4   ? 9.117   -15.895 55.344  1.00 38.82  ? 1   GLU A CA  1 
ATOM   26   C C   . GLU A 1 4   ? 10.437  -15.910 56.115  1.00 41.80  ? 1   GLU A C   1 
ATOM   27   O O   . GLU A 1 4   ? 11.516  -15.884 55.521  1.00 42.33  ? 1   GLU A O   1 
ATOM   28   C CB  . GLU A 1 4   ? 8.574   -14.457 55.340  1.00 36.91  ? 1   GLU A CB  1 
ATOM   29   C CG  . GLU A 1 4   ? 9.633   -13.438 54.893  1.00 35.90  ? 1   GLU A CG  1 
ATOM   30   C CD  . GLU A 1 4   ? 9.188   -11.984 54.976  1.00 35.63  ? 1   GLU A CD  1 
ATOM   31   O OE1 . GLU A 1 4   ? 10.051  -11.122 55.254  1.00 34.54  ? 1   GLU A OE1 1 
ATOM   32   O OE2 . GLU A 1 4   ? 7.994   -11.695 54.753  1.00 34.70  ? 1   GLU A OE2 1 
ATOM   33   N N   . GLY A 1 5   ? 10.341  -15.959 57.444  1.00 37.58  ? 2   GLY A N   1 
ATOM   34   C CA  . GLY A 1 5   ? 11.510  -15.883 58.301  1.00 35.87  ? 2   GLY A CA  1 
ATOM   35   C C   . GLY A 1 5   ? 12.464  -17.055 58.185  1.00 37.68  ? 2   GLY A C   1 
ATOM   36   O O   . GLY A 1 5   ? 13.607  -16.970 58.629  1.00 39.88  ? 2   GLY A O   1 
ATOM   37   N N   . ARG A 1 6   ? 11.998  -18.149 57.591  1.00 37.21  ? 3   ARG A N   1 
ATOM   38   C CA  . ARG A 1 6   ? 12.814  -19.349 57.429  1.00 39.76  ? 3   ARG A CA  1 
ATOM   39   C C   . ARG A 1 6   ? 13.362  -19.474 56.011  1.00 40.78  ? 3   ARG A C   1 
ATOM   40   O O   . ARG A 1 6   ? 14.067  -20.430 55.693  1.00 38.07  ? 3   ARG A O   1 
ATOM   41   C CB  . ARG A 1 6   ? 11.999  -20.600 57.763  1.00 42.61  ? 3   ARG A CB  1 
ATOM   42   C CG  . ARG A 1 6   ? 11.283  -20.555 59.093  1.00 46.14  ? 3   ARG A CG  1 
ATOM   43   C CD  . ARG A 1 6   ? 12.263  -20.625 60.233  1.00 49.16  ? 3   ARG A CD  1 
ATOM   44   N NE  . ARG A 1 6   ? 11.574  -20.765 61.511  1.00 60.29  ? 3   ARG A NE  1 
ATOM   45   C CZ  . ARG A 1 6   ? 12.191  -20.991 62.663  1.00 54.79  ? 3   ARG A CZ  1 
ATOM   46   N NH1 . ARG A 1 6   ? 13.512  -21.099 62.692  1.00 54.99  ? 3   ARG A NH1 1 
ATOM   47   N NH2 . ARG A 1 6   ? 11.488  -21.104 63.782  1.00 60.89  ? 3   ARG A NH2 1 
ATOM   48   N N   . GLU A 1 7   ? 13.032  -18.509 55.162  1.00 40.15  ? 4   GLU A N   1 
ATOM   49   C CA  . GLU A 1 7   ? 13.340  -18.614 53.740  1.00 38.45  ? 4   GLU A CA  1 
ATOM   50   C C   . GLU A 1 7   ? 14.431  -17.649 53.305  1.00 40.11  ? 4   GLU A C   1 
ATOM   51   O O   . GLU A 1 7   ? 14.834  -16.770 54.070  1.00 38.85  ? 4   GLU A O   1 
ATOM   52   C CB  . GLU A 1 7   ? 12.076  -18.374 52.924  1.00 38.22  ? 4   GLU A CB  1 
ATOM   53   C CG  . GLU A 1 7   ? 11.050  -19.477 53.053  1.00 39.87  ? 4   GLU A CG  1 
ATOM   54   C CD  . GLU A 1 7   ? 9.785   -19.169 52.286  1.00 47.93  ? 4   GLU A CD  1 
ATOM   55   O OE1 . GLU A 1 7   ? 9.434   -19.958 51.383  1.00 51.15  ? 4   GLU A OE1 1 
ATOM   56   O OE2 . GLU A 1 7   ? 9.143   -18.139 52.584  1.00 46.63  ? 4   GLU A OE2 1 
ATOM   57   N N   . ASP A 1 8   ? 14.902  -17.824 52.072  1.00 36.46  ? 5   ASP A N   1 
ATOM   58   C CA  . ASP A 1 8   ? 15.940  -16.978 51.493  1.00 37.56  ? 5   ASP A CA  1 
ATOM   59   C C   . ASP A 1 8   ? 15.464  -15.532 51.423  1.00 38.31  ? 5   ASP A C   1 
ATOM   60   O O   . ASP A 1 8   ? 14.591  -15.201 50.622  1.00 40.79  ? 5   ASP A O   1 
ATOM   61   C CB  . ASP A 1 8   ? 16.324  -17.480 50.092  1.00 34.62  ? 5   ASP A CB  1 
ATOM   62   C CG  . ASP A 1 8   ? 17.616  -16.864 49.577  1.00 36.17  ? 5   ASP A CG  1 
ATOM   63   O OD1 . ASP A 1 8   ? 18.075  -15.851 50.146  1.00 37.19  ? 5   ASP A OD1 1 
ATOM   64   O OD2 . ASP A 1 8   ? 18.176  -17.389 48.590  1.00 38.91  ? 5   ASP A OD2 1 
ATOM   65   N N   . PRO A 1 9   ? 16.043  -14.658 52.262  1.00 42.89  ? 6   PRO A N   1 
ATOM   66   C CA  . PRO A 1 9   ? 15.625  -13.252 52.273  1.00 38.58  ? 6   PRO A CA  1 
ATOM   67   C C   . PRO A 1 9   ? 16.001  -12.529 50.985  1.00 35.37  ? 6   PRO A C   1 
ATOM   68   O O   . PRO A 1 9   ? 15.515  -11.428 50.731  1.00 34.82  ? 6   PRO A O   1 
ATOM   69   C CB  . PRO A 1 9   ? 16.386  -12.670 53.467  1.00 36.09  ? 6   PRO A CB  1 
ATOM   70   C CG  . PRO A 1 9   ? 17.599  -13.521 53.580  1.00 38.29  ? 6   PRO A CG  1 
ATOM   71   C CD  . PRO A 1 9   ? 17.170  -14.908 53.178  1.00 37.75  ? 6   PRO A CD  1 
ATOM   72   N N   . GLN A 1 10  ? 16.860  -13.141 50.179  1.00 37.69  ? 7   GLN A N   1 
ATOM   73   C CA  . GLN A 1 10  ? 17.316  -12.494 48.952  1.00 38.57  ? 7   GLN A CA  1 
ATOM   74   C C   . GLN A 1 10  ? 16.443  -12.829 47.742  1.00 35.98  ? 7   GLN A C   1 
ATOM   75   O O   . GLN A 1 10  ? 16.755  -12.420 46.626  1.00 34.96  ? 7   GLN A O   1 
ATOM   76   C CB  . GLN A 1 10  ? 18.775  -12.867 48.680  1.00 38.41  ? 7   GLN A CB  1 
ATOM   77   C CG  . GLN A 1 10  ? 19.687  -12.537 49.860  1.00 42.12  ? 7   GLN A CG  1 
ATOM   78   C CD  . GLN A 1 10  ? 21.163  -12.661 49.539  1.00 44.40  ? 7   GLN A CD  1 
ATOM   79   O OE1 . GLN A 1 10  ? 21.635  -13.717 49.114  1.00 46.42  ? 7   GLN A OE1 1 
ATOM   80   N NE2 . GLN A 1 10  ? 21.904  -11.576 49.746  1.00 43.26  ? 7   GLN A NE2 1 
ATOM   81   N N   . LEU A 1 11  ? 15.341  -13.543 47.964  1.00 35.06  ? 8   LEU A N   1 
ATOM   82   C CA  . LEU A 1 11  ? 14.450  -13.934 46.868  1.00 36.03  ? 8   LEU A CA  1 
ATOM   83   C C   . LEU A 1 11  ? 13.025  -13.387 47.015  1.00 36.15  ? 8   LEU A C   1 
ATOM   84   O O   . LEU A 1 11  ? 12.133  -13.739 46.237  1.00 32.75  ? 8   LEU A O   1 
ATOM   85   C CB  . LEU A 1 11  ? 14.408  -15.461 46.744  1.00 35.71  ? 8   LEU A CB  1 
ATOM   86   C CG  . LEU A 1 11  ? 15.687  -16.084 46.176  1.00 34.15  ? 8   LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 11  ? 15.638  -17.601 46.244  1.00 33.09  ? 8   LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 11  ? 15.909  -15.613 44.738  1.00 33.16  ? 8   LEU A CD2 1 
ATOM   89   N N   . LEU A 1 12  ? 12.825  -12.517 48.002  1.00 33.38  ? 9   LEU A N   1 
ATOM   90   C CA  . LEU A 1 12  ? 11.527  -11.889 48.254  1.00 31.48  ? 9   LEU A CA  1 
ATOM   91   C C   . LEU A 1 12  ? 11.484  -10.495 47.641  1.00 33.01  ? 9   LEU A C   1 
ATOM   92   O O   . LEU A 1 12  ? 12.367  -9.677  47.893  1.00 32.44  ? 9   LEU A O   1 
ATOM   93   C CB  . LEU A 1 12  ? 11.250  -11.807 49.764  1.00 36.36  ? 9   LEU A CB  1 
ATOM   94   C CG  . LEU A 1 12  ? 9.963   -11.094 50.191  1.00 34.00  ? 9   LEU A CG  1 
ATOM   95   C CD1 . LEU A 1 12  ? 8.736   -11.897 49.786  1.00 30.61  ? 9   LEU A CD1 1 
ATOM   96   C CD2 . LEU A 1 12  ? 9.963   -10.808 51.701  1.00 36.92  ? 9   LEU A CD2 1 
ATOM   97   N N   . VAL A 1 13  ? 10.467  -10.227 46.824  1.00 32.58  ? 10  VAL A N   1 
ATOM   98   C CA  . VAL A 1 13  ? 10.356  -8.934  46.147  1.00 31.63  ? 10  VAL A CA  1 
ATOM   99   C C   . VAL A 1 13  ? 8.910   -8.464  46.170  1.00 32.97  ? 10  VAL A C   1 
ATOM   100  O O   . VAL A 1 13  ? 8.011   -9.270  45.988  1.00 36.48  ? 10  VAL A O   1 
ATOM   101  C CB  . VAL A 1 13  ? 10.844  -9.016  44.668  1.00 32.67  ? 10  VAL A CB  1 
ATOM   102  C CG1 . VAL A 1 13  ? 10.649  -7.687  43.948  1.00 32.09  ? 10  VAL A CG1 1 
ATOM   103  C CG2 . VAL A 1 13  ? 12.304  -9.441  44.603  1.00 35.34  ? 10  VAL A CG2 1 
ATOM   104  N N   . ARG A 1 14  ? 8.672   -7.175  46.388  1.00 30.36  ? 11  ARG A N   1 
ATOM   105  C CA  . ARG A 1 14  ? 7.318   -6.649  46.237  1.00 30.00  ? 11  ARG A CA  1 
ATOM   106  C C   . ARG A 1 14  ? 7.176   -5.852  44.943  1.00 31.37  ? 11  ARG A C   1 
ATOM   107  O O   . ARG A 1 14  ? 8.041   -5.046  44.599  1.00 32.13  ? 11  ARG A O   1 
ATOM   108  C CB  . ARG A 1 14  ? 6.916   -5.770  47.433  1.00 31.25  ? 11  ARG A CB  1 
ATOM   109  C CG  . ARG A 1 14  ? 5.520   -5.163  47.273  1.00 31.76  ? 11  ARG A CG  1 
ATOM   110  C CD  . ARG A 1 14  ? 5.066   -4.371  48.491  1.00 30.04  ? 11  ARG A CD  1 
ATOM   111  N NE  . ARG A 1 14  ? 4.771   -5.252  49.615  1.00 38.56  ? 11  ARG A NE  1 
ATOM   112  C CZ  . ARG A 1 14  ? 3.559   -5.716  49.905  1.00 37.82  ? 11  ARG A CZ  1 
ATOM   113  N NH1 . ARG A 1 14  ? 3.388   -6.513  50.953  1.00 39.24  ? 11  ARG A NH1 1 
ATOM   114  N NH2 . ARG A 1 14  ? 2.518   -5.374  49.158  1.00 30.46  ? 11  ARG A NH2 1 
ATOM   115  N N   . VAL A 1 15  ? 6.084   -6.097  44.224  1.00 28.81  ? 12  VAL A N   1 
ATOM   116  C CA  . VAL A 1 15  ? 5.732   -5.300  43.059  1.00 26.60  ? 12  VAL A CA  1 
ATOM   117  C C   . VAL A 1 15  ? 4.333   -4.738  43.267  1.00 31.24  ? 12  VAL A C   1 
ATOM   118  O O   . VAL A 1 15  ? 3.709   -5.017  44.287  1.00 33.17  ? 12  VAL A O   1 
ATOM   119  C CB  . VAL A 1 15  ? 5.796   -6.126  41.749  1.00 28.07  ? 12  VAL A CB  1 
ATOM   120  C CG1 . VAL A 1 15  ? 7.227   -6.546  41.473  1.00 27.35  ? 12  VAL A CG1 1 
ATOM   121  C CG2 . VAL A 1 15  ? 4.885   -7.343  41.832  1.00 26.12  ? 12  VAL A CG2 1 
ATOM   122  N N   . ARG A 1 16  ? 3.844   -3.958  42.305  1.00 32.26  ? 13  ARG A N   1 
ATOM   123  C CA  . ARG A 1 16  ? 2.562   -3.265  42.438  1.00 33.72  ? 13  ARG A CA  1 
ATOM   124  C C   . ARG A 1 16  ? 1.412   -4.195  42.834  1.00 35.79  ? 13  ARG A C   1 
ATOM   125  O O   . ARG A 1 16  ? 0.539   -3.815  43.614  1.00 33.38  ? 13  ARG A O   1 
ATOM   126  C CB  . ARG A 1 16  ? 2.214   -2.540  41.132  1.00 33.67  ? 13  ARG A CB  1 
ATOM   127  C CG  . ARG A 1 16  ? 0.890   -1.784  41.165  1.00 32.29  ? 13  ARG A CG  1 
ATOM   128  C CD  . ARG A 1 16  ? 0.883   -0.704  42.246  1.00 37.25  ? 13  ARG A CD  1 
ATOM   129  N NE  . ARG A 1 16  ? -0.377  0.038   42.284  1.00 36.01  ? 13  ARG A NE  1 
ATOM   130  C CZ  . ARG A 1 16  ? -1.459  -0.361  42.947  1.00 37.50  ? 13  ARG A CZ  1 
ATOM   131  N NH1 . ARG A 1 16  ? -1.439  -1.500  43.624  1.00 32.06  ? 13  ARG A NH1 1 
ATOM   132  N NH2 . ARG A 1 16  ? -2.563  0.375   42.928  1.00 38.60  ? 13  ARG A NH2 1 
ATOM   133  N N   . GLY A 1 17  ? 1.421   -5.414  42.304  1.00 33.16  ? 14  GLY A N   1 
ATOM   134  C CA  . GLY A 1 17  ? 0.368   -6.374  42.588  1.00 32.69  ? 14  GLY A CA  1 
ATOM   135  C C   . GLY A 1 17  ? 0.497   -7.082  43.930  1.00 36.43  ? 14  GLY A C   1 
ATOM   136  O O   . GLY A 1 17  ? -0.470  -7.661  44.426  1.00 34.47  ? 14  GLY A O   1 
ATOM   137  N N   . GLY A 1 18  ? 1.687   -7.050  44.521  1.00 32.72  ? 15  GLY A N   1 
ATOM   138  C CA  . GLY A 1 18  ? 1.911   -7.735  45.784  1.00 34.35  ? 15  GLY A CA  1 
ATOM   139  C C   . GLY A 1 18  ? 3.280   -8.378  45.902  1.00 35.00  ? 15  GLY A C   1 
ATOM   140  O O   . GLY A 1 18  ? 4.178   -8.079  45.119  1.00 31.61  ? 15  GLY A O   1 
ATOM   141  N N   . GLN A 1 19  ? 3.437   -9.257  46.892  1.00 34.85  ? 16  GLN A N   1 
ATOM   142  C CA  . GLN A 1 19  ? 4.701   -9.947  47.136  1.00 33.28  ? 16  GLN A CA  1 
ATOM   143  C C   . GLN A 1 19  ? 4.900   -11.155 46.216  1.00 32.97  ? 16  GLN A C   1 
ATOM   144  O O   . GLN A 1 19  ? 3.952   -11.868 45.900  1.00 33.10  ? 16  GLN A O   1 
ATOM   145  C CB  . GLN A 1 19  ? 4.786   -10.405 48.603  1.00 33.83  ? 16  GLN A CB  1 
ATOM   146  C CG  . GLN A 1 19  ? 5.031   -9.276  49.598  1.00 34.31  ? 16  GLN A CG  1 
ATOM   147  C CD  . GLN A 1 19  ? 5.280   -9.771  51.014  1.00 35.82  ? 16  GLN A CD  1 
ATOM   148  O OE1 . GLN A 1 19  ? 5.035   -10.933 51.338  1.00 35.19  ? 16  GLN A OE1 1 
ATOM   149  N NE2 . GLN A 1 19  ? 5.777   -8.884  51.864  1.00 39.36  ? 16  GLN A NE2 1 
ATOM   150  N N   . LEU A 1 20  ? 6.149   -11.373 45.814  1.00 32.27  ? 17  LEU A N   1 
ATOM   151  C CA  . LEU A 1 20  ? 6.566   -12.496 44.976  1.00 35.05  ? 17  LEU A CA  1 
ATOM   152  C C   . LEU A 1 20  ? 7.783   -13.149 45.591  1.00 30.91  ? 17  LEU A C   1 
ATOM   153  O O   . LEU A 1 20  ? 8.633   -12.460 46.175  1.00 34.70  ? 17  LEU A O   1 
ATOM   154  C CB  . LEU A 1 20  ? 6.947   -12.055 43.550  1.00 29.46  ? 17  LEU A CB  1 
ATOM   155  C CG  . LEU A 1 20  ? 6.149   -11.112 42.662  1.00 42.46  ? 17  LEU A CG  1 
ATOM   156  C CD1 . LEU A 1 20  ? 7.055   -10.566 41.576  1.00 36.53  ? 17  LEU A CD1 1 
ATOM   157  C CD2 . LEU A 1 20  ? 5.012   -11.857 42.018  1.00 45.64  ? 17  LEU A CD2 1 
ATOM   158  N N   . ARG A 1 21  ? 7.896   -14.464 45.421  1.00 34.46  ? 18  ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 9.118   -15.162 45.808  1.00 34.88  ? 18  ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 9.692   -15.921 44.622  1.00 32.30  ? 18  ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 9.027   -16.779 44.044  1.00 33.59  ? 18  ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 8.871   -16.126 46.972  1.00 30.67  ? 18  ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 10.091  -16.993 47.301  1.00 32.85  ? 18  ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 9.940   -17.699 48.652  1.00 39.98  ? 18  ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 9.779   -16.731 49.731  1.00 38.22  ? 18  ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 10.784  -16.095 50.325  1.00 37.04  ? 18  ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 12.038  -16.328 49.959  1.00 34.92  ? 18  ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 10.533  -15.221 51.289  1.00 38.38  ? 18  ARG A NH2 1 
ATOM   169  N N   . GLY A 1 22  ? 10.930  -15.600 44.264  1.00 33.94  ? 19  GLY A N   1 
ATOM   170  C CA  . GLY A 1 22  ? 11.585  -16.244 43.140  1.00 34.53  ? 19  GLY A CA  1 
ATOM   171  C C   . GLY A 1 22  ? 12.419  -17.432 43.573  1.00 37.48  ? 19  GLY A C   1 
ATOM   172  O O   . GLY A 1 22  ? 12.251  -17.960 44.676  1.00 33.57  ? 19  GLY A O   1 
ATOM   173  N N   . ILE A 1 23  ? 13.340  -17.836 42.708  1.00 31.80  ? 20  ILE A N   1 
ATOM   174  C CA  . ILE A 1 23  ? 14.152  -19.018 42.934  1.00 32.72  ? 20  ILE A CA  1 
ATOM   175  C C   . ILE A 1 23  ? 15.610  -18.754 42.564  1.00 33.32  ? 20  ILE A C   1 
ATOM   176  O O   . ILE A 1 23  ? 15.915  -17.995 41.634  1.00 33.57  ? 20  ILE A O   1 
ATOM   177  C CB  . ILE A 1 23  ? 13.607  -20.223 42.125  1.00 37.38  ? 20  ILE A CB  1 
ATOM   178  C CG1 . ILE A 1 23  ? 14.292  -21.525 42.547  1.00 37.08  ? 20  ILE A CG1 1 
ATOM   179  C CG2 . ILE A 1 23  ? 13.746  -19.973 40.623  1.00 38.09  ? 20  ILE A CG2 1 
ATOM   180  C CD1 . ILE A 1 23  ? 13.570  -22.773 42.094  1.00 42.01  ? 20  ILE A CD1 1 
ATOM   181  N N   . ARG A 1 24  ? 16.510  -19.367 43.322  1.00 33.74  ? 21  ARG A N   1 
ATOM   182  C CA  . ARG A 1 24  ? 17.933  -19.287 43.046  1.00 37.08  ? 21  ARG A CA  1 
ATOM   183  C C   . ARG A 1 24  ? 18.280  -20.385 42.052  1.00 36.21  ? 21  ARG A C   1 
ATOM   184  O O   . ARG A 1 24  ? 18.128  -21.565 42.352  1.00 36.89  ? 21  ARG A O   1 
ATOM   185  C CB  . ARG A 1 24  ? 18.747  -19.433 44.337  1.00 35.23  ? 21  ARG A CB  1 
ATOM   186  C CG  . ARG A 1 24  ? 20.258  -19.431 44.145  1.00 39.66  ? 21  ARG A CG  1 
ATOM   187  C CD  . ARG A 1 24  ? 20.997  -19.760 45.457  1.00 33.62  ? 21  ARG A CD  1 
ATOM   188  N NE  . ARG A 1 24  ? 22.273  -20.427 45.191  1.00 51.63  ? 21  ARG A NE  1 
ATOM   189  C CZ  . ARG A 1 24  ? 23.466  -19.972 45.567  1.00 52.85  ? 21  ARG A CZ  1 
ATOM   190  N NH1 . ARG A 1 24  ? 23.572  -18.843 46.257  1.00 53.28  ? 21  ARG A NH1 1 
ATOM   191  N NH2 . ARG A 1 24  ? 24.561  -20.659 45.260  1.00 50.00  ? 21  ARG A NH2 1 
ATOM   192  N N   . LEU A 1 25  ? 18.711  -19.997 40.857  1.00 35.20  ? 22  LEU A N   1 
ATOM   193  C CA  . LEU A 1 25  ? 19.063  -20.981 39.837  1.00 35.45  ? 22  LEU A CA  1 
ATOM   194  C C   . LEU A 1 25  ? 20.569  -21.013 39.630  1.00 33.82  ? 22  LEU A C   1 
ATOM   195  O O   . LEU A 1 25  ? 21.254  -20.026 39.887  1.00 37.98  ? 22  LEU A O   1 
ATOM   196  C CB  . LEU A 1 25  ? 18.352  -20.673 38.514  1.00 37.05  ? 22  LEU A CB  1 
ATOM   197  C CG  . LEU A 1 25  ? 16.827  -20.811 38.513  1.00 35.83  ? 22  LEU A CG  1 
ATOM   198  C CD1 . LEU A 1 25  ? 16.272  -20.628 37.115  1.00 41.61  ? 22  LEU A CD1 1 
ATOM   199  C CD2 . LEU A 1 25  ? 16.407  -22.154 39.088  1.00 41.34  ? 22  LEU A CD2 1 
ATOM   200  N N   . LYS A 1 26  ? 21.083  -22.146 39.166  1.00 38.67  ? 23  LYS A N   1 
ATOM   201  C CA  . LYS A 1 26  ? 22.510  -22.275 38.893  1.00 36.70  ? 23  LYS A CA  1 
ATOM   202  C C   . LYS A 1 26  ? 22.847  -21.993 37.430  1.00 42.30  ? 23  LYS A C   1 
ATOM   203  O O   . LYS A 1 26  ? 22.308  -22.618 36.519  1.00 38.47  ? 23  LYS A O   1 
ATOM   204  C CB  . LYS A 1 26  ? 23.004  -23.672 39.275  1.00 43.66  ? 23  LYS A CB  1 
ATOM   205  C CG  . LYS A 1 26  ? 22.793  -24.015 40.742  1.00 55.48  ? 23  LYS A CG  1 
ATOM   206  C CD  . LYS A 1 26  ? 23.455  -25.330 41.117  1.00 60.67  ? 23  LYS A CD  1 
ATOM   207  C CE  . LYS A 1 26  ? 23.396  -25.557 42.618  1.00 61.60  ? 23  LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 26  ? 24.199  -26.740 43.032  1.00 69.26  ? 23  LYS A NZ  1 
ATOM   209  N N   . ALA A 1 27  ? 23.734  -21.028 37.228  1.00 40.81  ? 24  ALA A N   1 
ATOM   210  C CA  . ALA A 1 27  ? 24.372  -20.796 35.945  1.00 41.18  ? 24  ALA A CA  1 
ATOM   211  C C   . ALA A 1 27  ? 25.811  -21.280 36.090  1.00 45.91  ? 24  ALA A C   1 
ATOM   212  O O   . ALA A 1 27  ? 26.315  -21.352 37.213  1.00 45.11  ? 24  ALA A O   1 
ATOM   213  C CB  . ALA A 1 27  ? 24.309  -19.320 35.563  1.00 41.72  ? 24  ALA A CB  1 
ATOM   214  N N   . PRO A 1 28  ? 26.474  -21.627 34.972  1.00 45.79  ? 25  PRO A N   1 
ATOM   215  C CA  . PRO A 1 28  ? 27.824  -22.204 35.048  1.00 44.65  ? 25  PRO A CA  1 
ATOM   216  C C   . PRO A 1 28  ? 28.806  -21.384 35.887  1.00 47.41  ? 25  PRO A C   1 
ATOM   217  O O   . PRO A 1 28  ? 29.614  -21.959 36.617  1.00 47.03  ? 25  PRO A O   1 
ATOM   218  C CB  . PRO A 1 28  ? 28.265  -22.241 33.584  1.00 44.58  ? 25  PRO A CB  1 
ATOM   219  C CG  . PRO A 1 28  ? 26.995  -22.408 32.833  1.00 44.63  ? 25  PRO A CG  1 
ATOM   220  C CD  . PRO A 1 28  ? 25.979  -21.585 33.583  1.00 43.12  ? 25  PRO A CD  1 
ATOM   221  N N   . GLY A 1 29  ? 28.718  -20.062 35.801  1.00 45.43  ? 26  GLY A N   1 
ATOM   222  C CA  . GLY A 1 29  ? 29.627  -19.193 36.527  1.00 43.54  ? 26  GLY A CA  1 
ATOM   223  C C   . GLY A 1 29  ? 29.188  -18.840 37.939  1.00 46.77  ? 26  GLY A C   1 
ATOM   224  O O   . GLY A 1 29  ? 29.959  -18.256 38.700  1.00 45.92  ? 26  GLY A O   1 
ATOM   225  N N   . GLY A 1 30  ? 27.956  -19.192 38.297  1.00 45.71  ? 27  GLY A N   1 
ATOM   226  C CA  . GLY A 1 30  ? 27.432  -18.858 39.612  1.00 41.49  ? 27  GLY A CA  1 
ATOM   227  C C   . GLY A 1 30  ? 25.919  -18.754 39.630  1.00 41.84  ? 27  GLY A C   1 
ATOM   228  O O   . GLY A 1 30  ? 25.266  -19.003 38.620  1.00 41.18  ? 27  GLY A O   1 
ATOM   229  N N   . PRO A 1 31  ? 25.348  -18.385 40.786  1.00 40.03  ? 28  PRO A N   1 
ATOM   230  C CA  . PRO A 1 31  ? 23.888  -18.321 40.916  1.00 38.62  ? 28  PRO A CA  1 
ATOM   231  C C   . PRO A 1 31  ? 23.254  -17.119 40.205  1.00 35.67  ? 28  PRO A C   1 
ATOM   232  O O   . PRO A 1 31  ? 23.928  -16.130 39.923  1.00 34.78  ? 28  PRO A O   1 
ATOM   233  C CB  . PRO A 1 31  ? 23.684  -18.218 42.429  1.00 38.95  ? 28  PRO A CB  1 
ATOM   234  C CG  . PRO A 1 31  ? 24.923  -17.544 42.919  1.00 38.90  ? 28  PRO A CG  1 
ATOM   235  C CD  . PRO A 1 31  ? 26.034  -18.062 42.050  1.00 40.43  ? 28  PRO A CD  1 
ATOM   236  N N   . VAL A 1 32  ? 21.960  -17.232 39.912  1.00 33.02  ? 29  VAL A N   1 
ATOM   237  C CA  . VAL A 1 32  ? 21.153  -16.121 39.423  1.00 30.91  ? 29  VAL A CA  1 
ATOM   238  C C   . VAL A 1 32  ? 19.797  -16.152 40.103  1.00 31.53  ? 29  VAL A C   1 
ATOM   239  O O   . VAL A 1 32  ? 19.388  -17.180 40.649  1.00 35.82  ? 29  VAL A O   1 
ATOM   240  C CB  . VAL A 1 32  ? 20.931  -16.166 37.884  1.00 34.12  ? 29  VAL A CB  1 
ATOM   241  C CG1 . VAL A 1 32  ? 22.246  -16.210 37.157  1.00 34.01  ? 29  VAL A CG1 1 
ATOM   242  C CG2 . VAL A 1 32  ? 20.071  -17.359 37.506  1.00 31.77  ? 29  VAL A CG2 1 
ATOM   243  N N   . SER A 1 33  ? 19.106  -15.018 40.078  1.00 30.93  ? 30  SER A N   1 
ATOM   244  C CA  . SER A 1 33  ? 17.739  -14.940 40.570  1.00 32.90  ? 30  SER A CA  1 
ATOM   245  C C   . SER A 1 33  ? 16.771  -15.071 39.401  1.00 32.94  ? 30  SER A C   1 
ATOM   246  O O   . SER A 1 33  ? 16.922  -14.395 38.381  1.00 33.45  ? 30  SER A O   1 
ATOM   247  C CB  . SER A 1 33  ? 17.492  -13.622 41.313  1.00 31.86  ? 30  SER A CB  1 
ATOM   248  O OG  . SER A 1 33  ? 18.548  -13.331 42.210  1.00 32.85  ? 30  SER A OG  1 
ATOM   249  N N   . ALA A 1 34  ? 15.787  -15.950 39.549  1.00 31.90  ? 31  ALA A N   1 
ATOM   250  C CA  . ALA A 1 34  ? 14.734  -16.071 38.555  1.00 32.93  ? 31  ALA A CA  1 
ATOM   251  C C   . ALA A 1 34  ? 13.373  -15.854 39.199  1.00 32.49  ? 31  ALA A C   1 
ATOM   252  O O   . ALA A 1 34  ? 13.059  -16.433 40.233  1.00 31.85  ? 31  ALA A O   1 
ATOM   253  C CB  . ALA A 1 34  ? 14.793  -17.429 37.873  1.00 31.10  ? 31  ALA A CB  1 
ATOM   254  N N   . PHE A 1 35  ? 12.575  -14.998 38.581  1.00 32.68  ? 32  PHE A N   1 
ATOM   255  C CA  . PHE A 1 35  ? 11.204  -14.757 38.996  1.00 31.38  ? 32  PHE A CA  1 
ATOM   256  C C   . PHE A 1 35  ? 10.309  -15.104 37.813  1.00 31.33  ? 32  PHE A C   1 
ATOM   257  O O   . PHE A 1 35  ? 10.117  -14.290 36.910  1.00 30.53  ? 32  PHE A O   1 
ATOM   258  C CB  . PHE A 1 35  ? 11.026  -13.306 39.444  1.00 29.02  ? 32  PHE A CB  1 
ATOM   259  C CG  . PHE A 1 35  ? 11.968  -12.904 40.544  1.00 33.06  ? 32  PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 35  ? 13.231  -12.410 40.252  1.00 32.71  ? 32  PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 35  ? 11.596  -13.043 41.870  1.00 33.97  ? 32  PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 35  ? 14.101  -12.050 41.273  1.00 35.98  ? 32  PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 35  ? 12.457  -12.684 42.892  1.00 32.49  ? 32  PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 35  ? 13.713  -12.191 42.593  1.00 31.92  ? 32  PHE A CZ  1 
ATOM   265  N N   . LEU A 1 36  ? 9.776   -16.321 37.825  1.00 32.16  ? 33  LEU A N   1 
ATOM   266  C CA  . LEU A 1 36  ? 9.105   -16.886 36.655  1.00 33.19  ? 33  LEU A CA  1 
ATOM   267  C C   . LEU A 1 36  ? 7.601   -17.005 36.859  1.00 35.81  ? 33  LEU A C   1 
ATOM   268  O O   . LEU A 1 36  ? 7.136   -17.321 37.956  1.00 31.32  ? 33  LEU A O   1 
ATOM   269  C CB  . LEU A 1 36  ? 9.690   -18.266 36.331  1.00 28.80  ? 33  LEU A CB  1 
ATOM   270  C CG  . LEU A 1 36  ? 11.216  -18.386 36.320  1.00 29.82  ? 33  LEU A CG  1 
ATOM   271  C CD1 . LEU A 1 36  ? 11.636  -19.826 36.083  1.00 33.00  ? 33  LEU A CD1 1 
ATOM   272  C CD2 . LEU A 1 36  ? 11.829  -17.458 35.270  1.00 29.90  ? 33  LEU A CD2 1 
ATOM   273  N N   . GLY A 1 37  ? 6.844   -16.773 35.791  1.00 29.01  ? 34  GLY A N   1 
ATOM   274  C CA  . GLY A 1 37  ? 5.400   -16.908 35.835  1.00 29.36  ? 34  GLY A CA  1 
ATOM   275  C C   . GLY A 1 37  ? 4.710   -15.796 36.613  1.00 31.64  ? 34  GLY A C   1 
ATOM   276  O O   . GLY A 1 37  ? 3.743   -16.041 37.332  1.00 28.85  ? 34  GLY A O   1 
ATOM   277  N N   . ILE A 1 38  ? 5.204   -14.572 36.461  1.00 32.04  ? 35  ILE A N   1 
ATOM   278  C CA  . ILE A 1 38  ? 4.551   -13.398 37.042  1.00 31.08  ? 35  ILE A CA  1 
ATOM   279  C C   . ILE A 1 38  ? 3.394   -12.914 36.166  1.00 31.45  ? 35  ILE A C   1 
ATOM   280  O O   . ILE A 1 38  ? 3.603   -12.519 35.019  1.00 32.05  ? 35  ILE A O   1 
ATOM   281  C CB  . ILE A 1 38  ? 5.541   -12.236 37.230  1.00 32.48  ? 35  ILE A CB  1 
ATOM   282  C CG1 . ILE A 1 38  ? 6.733   -12.684 38.078  1.00 31.18  ? 35  ILE A CG1 1 
ATOM   283  C CG2 . ILE A 1 38  ? 4.845   -11.038 37.872  1.00 32.79  ? 35  ILE A CG2 1 
ATOM   284  C CD1 . ILE A 1 38  ? 7.862   -11.676 38.109  1.00 31.05  ? 35  ILE A CD1 1 
ATOM   285  N N   . PRO A 1 39  ? 2.164   -12.941 36.702  1.00 33.96  ? 36  PRO A N   1 
ATOM   286  C CA  . PRO A 1 39  ? 1.010   -12.458 35.935  1.00 28.23  ? 36  PRO A CA  1 
ATOM   287  C C   . PRO A 1 39  ? 1.058   -10.952 35.713  1.00 33.03  ? 36  PRO A C   1 
ATOM   288  O O   . PRO A 1 39  ? 1.252   -10.208 36.673  1.00 29.52  ? 36  PRO A O   1 
ATOM   289  C CB  . PRO A 1 39  ? -0.182  -12.838 36.815  1.00 33.96  ? 36  PRO A CB  1 
ATOM   290  C CG  . PRO A 1 39  ? 0.381   -12.861 38.216  1.00 32.02  ? 36  PRO A CG  1 
ATOM   291  C CD  . PRO A 1 39  ? 1.790   -13.376 38.062  1.00 33.09  ? 36  PRO A CD  1 
ATOM   292  N N   . PHE A 1 40  ? 0.894   -10.505 34.470  1.00 26.77  ? 37  PHE A N   1 
ATOM   293  C CA  . PHE A 1 40  ? 0.853   -9.073  34.210  1.00 28.98  ? 37  PHE A CA  1 
ATOM   294  C C   . PHE A 1 40  ? -0.507  -8.650  33.684  1.00 27.32  ? 37  PHE A C   1 
ATOM   295  O O   . PHE A 1 40  ? -0.754  -7.468  33.463  1.00 31.72  ? 37  PHE A O   1 
ATOM   296  C CB  . PHE A 1 40  ? 1.964   -8.649  33.241  1.00 27.98  ? 37  PHE A CB  1 
ATOM   297  C CG  . PHE A 1 40  ? 1.859   -9.260  31.857  1.00 30.68  ? 37  PHE A CG  1 
ATOM   298  C CD1 . PHE A 1 40  ? 1.177   -8.603  30.842  1.00 28.49  ? 37  PHE A CD1 1 
ATOM   299  C CD2 . PHE A 1 40  ? 2.473   -10.470 31.569  1.00 28.33  ? 37  PHE A CD2 1 
ATOM   300  C CE1 . PHE A 1 40  ? 1.095   -9.154  29.558  1.00 31.48  ? 37  PHE A CE1 1 
ATOM   301  C CE2 . PHE A 1 40  ? 2.395   -11.027 30.287  1.00 29.66  ? 37  PHE A CE2 1 
ATOM   302  C CZ  . PHE A 1 40  ? 1.707   -10.362 29.285  1.00 30.66  ? 37  PHE A CZ  1 
ATOM   303  N N   . ALA A 1 41  ? -1.399  -9.615  33.512  1.00 29.79  ? 38  ALA A N   1 
ATOM   304  C CA  . ALA A 1 41  ? -2.743  -9.320  33.045  1.00 31.95  ? 38  ALA A CA  1 
ATOM   305  C C   . ALA A 1 41  ? -3.751  -10.258 33.681  1.00 34.36  ? 38  ALA A C   1 
ATOM   306  O O   . ALA A 1 41  ? -3.393  -11.343 34.144  1.00 33.05  ? 38  ALA A O   1 
ATOM   307  C CB  . ALA A 1 41  ? -2.816  -9.425  31.516  1.00 33.29  ? 38  ALA A CB  1 
ATOM   308  N N   . GLU A 1 42  ? -5.012  -9.842  33.707  1.00 32.64  ? 39  GLU A N   1 
ATOM   309  C CA  . GLU A 1 42  ? -6.083  -10.765 34.054  1.00 35.69  ? 39  GLU A CA  1 
ATOM   310  C C   . GLU A 1 42  ? -6.160  -11.788 32.927  1.00 35.41  ? 39  GLU A C   1 
ATOM   311  O O   . GLU A 1 42  ? -5.976  -11.429 31.764  1.00 36.50  ? 39  GLU A O   1 
ATOM   312  C CB  . GLU A 1 42  ? -7.419  -10.036 34.230  1.00 40.80  ? 39  GLU A CB  1 
ATOM   313  C CG  . GLU A 1 42  ? -7.514  -9.178  35.487  1.00 40.53  ? 39  GLU A CG  1 
ATOM   314  C CD  . GLU A 1 42  ? -7.369  -9.989  36.761  1.00 40.22  ? 39  GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 42  ? -8.127  -10.962 36.939  1.00 41.27  ? 39  GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 42  ? -6.497  -9.649  37.584  1.00 41.82  ? 39  GLU A OE2 1 
ATOM   317  N N   . PRO A 1 43  ? -6.410  -13.061 33.267  1.00 32.93  ? 40  PRO A N   1 
ATOM   318  C CA  . PRO A 1 43  ? -6.480  -14.120 32.256  1.00 31.78  ? 40  PRO A CA  1 
ATOM   319  C C   . PRO A 1 43  ? -7.461  -13.764 31.139  1.00 37.22  ? 40  PRO A C   1 
ATOM   320  O O   . PRO A 1 43  ? -8.632  -13.497 31.404  1.00 36.10  ? 40  PRO A O   1 
ATOM   321  C CB  . PRO A 1 43  ? -6.957  -15.337 33.051  1.00 31.26  ? 40  PRO A CB  1 
ATOM   322  C CG  . PRO A 1 43  ? -6.508  -15.055 34.470  1.00 34.25  ? 40  PRO A CG  1 
ATOM   323  C CD  . PRO A 1 43  ? -6.621  -13.574 34.636  1.00 33.09  ? 40  PRO A CD  1 
ATOM   324  N N   . PRO A 1 44  ? -6.977  -13.733 29.889  1.00 35.17  ? 41  PRO A N   1 
ATOM   325  C CA  . PRO A 1 44  ? -7.835  -13.304 28.785  1.00 31.64  ? 41  PRO A CA  1 
ATOM   326  C C   . PRO A 1 44  ? -8.767  -14.420 28.329  1.00 37.46  ? 41  PRO A C   1 
ATOM   327  O O   . PRO A 1 44  ? -8.744  -14.814 27.162  1.00 32.62  ? 41  PRO A O   1 
ATOM   328  C CB  . PRO A 1 44  ? -6.829  -12.939 27.691  1.00 35.01  ? 41  PRO A CB  1 
ATOM   329  C CG  . PRO A 1 44  ? -5.680  -13.851 27.939  1.00 34.85  ? 41  PRO A CG  1 
ATOM   330  C CD  . PRO A 1 44  ? -5.597  -14.005 29.448  1.00 33.19  ? 41  PRO A CD  1 
ATOM   331  N N   . VAL A 1 45  ? -9.580  -14.924 29.250  1.00 35.85  ? 42  VAL A N   1 
ATOM   332  C CA  . VAL A 1 45  ? -10.425 -16.078 28.972  1.00 35.68  ? 42  VAL A CA  1 
ATOM   333  C C   . VAL A 1 45  ? -11.906 -15.724 28.947  1.00 37.71  ? 42  VAL A C   1 
ATOM   334  O O   . VAL A 1 45  ? -12.299 -14.632 29.354  1.00 35.29  ? 42  VAL A O   1 
ATOM   335  C CB  . VAL A 1 45  ? -10.185 -17.192 30.000  1.00 35.75  ? 42  VAL A CB  1 
ATOM   336  C CG1 . VAL A 1 45  ? -8.720  -17.599 29.986  1.00 34.39  ? 42  VAL A CG1 1 
ATOM   337  C CG2 . VAL A 1 45  ? -10.614 -16.741 31.406  1.00 36.32  ? 42  VAL A CG2 1 
ATOM   338  N N   . GLY A 1 46  ? -12.718 -16.650 28.441  1.00 39.40  ? 43  GLY A N   1 
ATOM   339  C CA  . GLY A 1 46  ? -14.154 -16.457 28.362  1.00 35.82  ? 43  GLY A CA  1 
ATOM   340  C C   . GLY A 1 46  ? -14.547 -15.223 27.570  1.00 39.55  ? 43  GLY A C   1 
ATOM   341  O O   . GLY A 1 46  ? -14.292 -15.132 26.370  1.00 35.82  ? 43  GLY A O   1 
ATOM   342  N N   . SER A 1 47  ? -15.162 -14.263 28.249  1.00 34.54  ? 44  SER A N   1 
ATOM   343  C CA  . SER A 1 47  ? -15.629 -13.043 27.603  1.00 36.53  ? 44  SER A CA  1 
ATOM   344  C C   . SER A 1 47  ? -14.484 -12.112 27.213  1.00 36.14  ? 44  SER A C   1 
ATOM   345  O O   . SER A 1 47  ? -14.680 -11.161 26.455  1.00 39.75  ? 44  SER A O   1 
ATOM   346  C CB  . SER A 1 47  ? -16.599 -12.305 28.522  1.00 41.27  ? 44  SER A CB  1 
ATOM   347  O OG  . SER A 1 47  ? -15.957 -11.971 29.738  1.00 40.21  ? 44  SER A OG  1 
ATOM   348  N N   . ARG A 1 48  ? -13.289 -12.383 27.731  1.00 32.54  ? 45  ARG A N   1 
ATOM   349  C CA  . ARG A 1 48  ? -12.121 -11.558 27.423  1.00 33.50  ? 45  ARG A CA  1 
ATOM   350  C C   . ARG A 1 48  ? -11.349 -12.040 26.186  1.00 34.58  ? 45  ARG A C   1 
ATOM   351  O O   . ARG A 1 48  ? -10.400 -11.385 25.749  1.00 34.65  ? 45  ARG A O   1 
ATOM   352  C CB  . ARG A 1 48  ? -11.171 -11.511 28.621  1.00 33.02  ? 45  ARG A CB  1 
ATOM   353  C CG  . ARG A 1 48  ? -11.759 -10.875 29.876  1.00 39.17  ? 45  ARG A CG  1 
ATOM   354  C CD  . ARG A 1 48  ? -10.668 -10.723 30.931  1.00 45.27  ? 45  ARG A CD  1 
ATOM   355  N NE  . ARG A 1 48  ? -11.175 -10.339 32.247  1.00 50.84  ? 45  ARG A NE  1 
ATOM   356  C CZ  . ARG A 1 48  ? -11.146 -11.127 33.319  1.00 58.21  ? 45  ARG A CZ  1 
ATOM   357  N NH1 . ARG A 1 48  ? -10.635 -12.353 33.236  1.00 44.75  ? 45  ARG A NH1 1 
ATOM   358  N NH2 . ARG A 1 48  ? -11.623 -10.687 34.477  1.00 59.14  ? 45  ARG A NH2 1 
ATOM   359  N N   . ARG A 1 49  ? -11.739 -13.181 25.627  1.00 35.82  ? 46  ARG A N   1 
ATOM   360  C CA  . ARG A 1 49  ? -11.080 -13.676 24.416  1.00 31.93  ? 46  ARG A CA  1 
ATOM   361  C C   . ARG A 1 49  ? -11.252 -12.658 23.284  1.00 33.97  ? 46  ARG A C   1 
ATOM   362  O O   . ARG A 1 49  ? -12.334 -12.091 23.117  1.00 34.72  ? 46  ARG A O   1 
ATOM   363  C CB  . ARG A 1 49  ? -11.630 -15.045 24.009  1.00 31.73  ? 46  ARG A CB  1 
ATOM   364  C CG  . ARG A 1 49  ? -10.989 -15.613 22.738  1.00 30.73  ? 46  ARG A CG  1 
ATOM   365  C CD  . ARG A 1 49  ? -11.752 -16.816 22.212  1.00 30.17  ? 46  ARG A CD  1 
ATOM   366  N NE  . ARG A 1 49  ? -11.459 -18.040 22.948  1.00 32.51  ? 46  ARG A NE  1 
ATOM   367  C CZ  . ARG A 1 49  ? -12.062 -19.204 22.727  1.00 37.01  ? 46  ARG A CZ  1 
ATOM   368  N NH1 . ARG A 1 49  ? -12.996 -19.302 21.791  1.00 37.24  ? 46  ARG A NH1 1 
ATOM   369  N NH2 . ARG A 1 49  ? -11.734 -20.269 23.442  1.00 34.43  ? 46  ARG A NH2 1 
ATOM   370  N N   . PHE A 1 50  ? -10.162 -12.422 22.551  1.00 34.05  ? 47  PHE A N   1 
ATOM   371  C CA  . PHE A 1 50  ? -10.059 -11.439 21.462  1.00 32.50  ? 47  PHE A CA  1 
ATOM   372  C C   . PHE A 1 50  ? -9.984  -9.993  21.963  1.00 35.20  ? 47  PHE A C   1 
ATOM   373  O O   . PHE A 1 50  ? -9.774  -9.074  21.174  1.00 34.78  ? 47  PHE A O   1 
ATOM   374  C CB  . PHE A 1 50  ? -11.226 -11.564 20.466  1.00 32.66  ? 47  PHE A CB  1 
ATOM   375  C CG  . PHE A 1 50  ? -11.465 -12.965 19.966  1.00 35.11  ? 47  PHE A CG  1 
ATOM   376  C CD1 . PHE A 1 50  ? -10.462 -13.670 19.323  1.00 33.15  ? 47  PHE A CD1 1 
ATOM   377  C CD2 . PHE A 1 50  ? -12.708 -13.561 20.111  1.00 33.95  ? 47  PHE A CD2 1 
ATOM   378  C CE1 . PHE A 1 50  ? -10.685 -14.958 18.853  1.00 29.67  ? 47  PHE A CE1 1 
ATOM   379  C CE2 . PHE A 1 50  ? -12.940 -14.846 19.642  1.00 33.31  ? 47  PHE A CE2 1 
ATOM   380  C CZ  . PHE A 1 50  ? -11.925 -15.545 19.014  1.00 30.69  ? 47  PHE A CZ  1 
ATOM   381  N N   . MET A 1 51  ? -10.148 -9.782  23.265  1.00 36.99  ? 48  MET A N   1 
ATOM   382  C CA  . MET A 1 51  ? -10.152 -8.422  23.804  1.00 36.65  ? 48  MET A CA  1 
ATOM   383  C C   . MET A 1 51  ? -8.771  -7.969  24.280  1.00 34.48  ? 48  MET A C   1 
ATOM   384  O O   . MET A 1 51  ? -7.912  -8.799  24.588  1.00 33.18  ? 48  MET A O   1 
ATOM   385  C CB  . MET A 1 51  ? -11.157 -8.311  24.953  1.00 39.53  ? 48  MET A CB  1 
ATOM   386  C CG  . MET A 1 51  ? -12.579 -8.699  24.578  1.00 43.82  ? 48  MET A CG  1 
ATOM   387  S SD  . MET A 1 51  ? -13.787 -7.743  25.511  1.00 59.06  ? 48  MET A SD  1 
ATOM   388  C CE  . MET A 1 51  ? -13.730 -6.203  24.597  1.00 52.71  ? 48  MET A CE  1 
ATOM   389  N N   . PRO A 1 52  ? -8.553  -6.643  24.333  1.00 33.78  ? 49  PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? -7.316  -6.088  24.891  1.00 36.62  ? 49  PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? -7.082  -6.590  26.312  1.00 33.51  ? 49  PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? -8.053  -6.862  27.016  1.00 34.05  ? 49  PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? -7.575  -4.579  24.878  1.00 37.67  ? 49  PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? -8.518  -4.386  23.749  1.00 38.13  ? 49  PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? -9.425  -5.585  23.792  1.00 37.95  ? 49  PRO A CD  1 
ATOM   396  N N   . PRO A 1 53  ? -5.814  -6.734  26.722  1.00 32.01  ? 50  PRO A N   1 
ATOM   397  C CA  . PRO A 1 53  ? -5.555  -7.245  28.070  1.00 32.93  ? 50  PRO A CA  1 
ATOM   398  C C   . PRO A 1 53  ? -5.947  -6.236  29.140  1.00 34.55  ? 50  PRO A C   1 
ATOM   399  O O   . PRO A 1 53  ? -5.852  -5.029  28.913  1.00 35.13  ? 50  PRO A O   1 
ATOM   400  C CB  . PRO A 1 53  ? -4.042  -7.472  28.074  1.00 30.00  ? 50  PRO A CB  1 
ATOM   401  C CG  . PRO A 1 53  ? -3.530  -6.442  27.126  1.00 30.89  ? 50  PRO A CG  1 
ATOM   402  C CD  . PRO A 1 53  ? -4.567  -6.375  26.027  1.00 30.40  ? 50  PRO A CD  1 
ATOM   403  N N   . GLU A 1 54  ? -6.384  -6.736  30.287  1.00 36.93  ? 51  GLU A N   1 
ATOM   404  C CA  . GLU A 1 54  ? -6.624  -5.893  31.453  1.00 39.87  ? 51  GLU A CA  1 
ATOM   405  C C   . GLU A 1 54  ? -5.527  -6.142  32.472  1.00 33.86  ? 51  GLU A C   1 
ATOM   406  O O   . GLU A 1 54  ? -5.179  -7.295  32.730  1.00 32.76  ? 51  GLU A O   1 
ATOM   407  C CB  . GLU A 1 54  ? -7.995  -6.181  32.060  1.00 42.12  ? 51  GLU A CB  1 
ATOM   408  C CG  . GLU A 1 54  ? -9.151  -5.962  31.101  1.00 49.83  ? 51  GLU A CG  1 
ATOM   409  C CD  . GLU A 1 54  ? -10.461 -6.509  31.633  1.00 61.22  ? 51  GLU A CD  1 
ATOM   410  O OE1 . GLU A 1 54  ? -10.514 -7.714  31.963  1.00 57.41  ? 51  GLU A OE1 1 
ATOM   411  O OE2 . GLU A 1 54  ? -11.435 -5.731  31.726  1.00 70.36  ? 51  GLU A OE2 1 
ATOM   412  N N   . PRO A 1 55  ? -4.961  -5.063  33.036  1.00 37.84  ? 52  PRO A N   1 
ATOM   413  C CA  . PRO A 1 55  ? -3.906  -5.179  34.046  1.00 35.31  ? 52  PRO A CA  1 
ATOM   414  C C   . PRO A 1 55  ? -4.306  -6.144  35.152  1.00 33.12  ? 52  PRO A C   1 
ATOM   415  O O   . PRO A 1 55  ? -5.460  -6.148  35.570  1.00 36.87  ? 52  PRO A O   1 
ATOM   416  C CB  . PRO A 1 55  ? -3.773  -3.752  34.577  1.00 37.34  ? 52  PRO A CB  1 
ATOM   417  C CG  . PRO A 1 55  ? -4.176  -2.900  33.424  1.00 38.73  ? 52  PRO A CG  1 
ATOM   418  C CD  . PRO A 1 55  ? -5.269  -3.656  32.721  1.00 40.48  ? 52  PRO A CD  1 
ATOM   419  N N   . LYS A 1 56  ? -3.367  -6.980  35.577  1.00 32.36  ? 53  LYS A N   1 
ATOM   420  C CA  . LYS A 1 56  ? -3.609  -7.934  36.645  1.00 35.41  ? 53  LYS A CA  1 
ATOM   421  C C   . LYS A 1 56  ? -3.974  -7.207  37.945  1.00 36.50  ? 53  LYS A C   1 
ATOM   422  O O   . LYS A 1 56  ? -3.295  -6.265  38.347  1.00 35.62  ? 53  LYS A O   1 
ATOM   423  C CB  . LYS A 1 56  ? -2.376  -8.816  36.855  1.00 34.80  ? 53  LYS A CB  1 
ATOM   424  C CG  . LYS A 1 56  ? -2.469  -9.753  38.055  1.00 33.78  ? 53  LYS A CG  1 
ATOM   425  C CD  . LYS A 1 56  ? -3.486  -10.856 37.810  1.00 36.83  ? 53  LYS A CD  1 
ATOM   426  C CE  . LYS A 1 56  ? -3.489  -11.874 38.936  1.00 40.69  ? 53  LYS A CE  1 
ATOM   427  N NZ  . LYS A 1 56  ? -4.368  -13.034 38.609  1.00 44.42  ? 53  LYS A NZ  1 
ATOM   428  N N   . ARG A 1 57  ? -5.052  -7.638  38.587  1.00 39.17  ? 54  ARG A N   1 
ATOM   429  C CA  . ARG A 1 57  ? -5.454  -7.054  39.867  1.00 38.64  ? 54  ARG A CA  1 
ATOM   430  C C   . ARG A 1 57  ? -4.553  -7.562  40.988  1.00 36.28  ? 54  ARG A C   1 
ATOM   431  O O   . ARG A 1 57  ? -4.087  -8.701  40.939  1.00 35.26  ? 54  ARG A O   1 
ATOM   432  C CB  . ARG A 1 57  ? -6.921  -7.369  40.166  1.00 39.04  ? 54  ARG A CB  1 
ATOM   433  C CG  . ARG A 1 57  ? -7.895  -6.746  39.174  1.00 43.97  ? 54  ARG A CG  1 
ATOM   434  C CD  . ARG A 1 57  ? -9.344  -6.943  39.598  1.00 51.46  ? 54  ARG A CD  1 
ATOM   435  N NE  . ARG A 1 57  ? -9.716  -8.354  39.674  1.00 56.67  ? 54  ARG A NE  1 
ATOM   436  C CZ  . ARG A 1 57  ? -10.299 -9.029  38.687  1.00 60.77  ? 54  ARG A CZ  1 
ATOM   437  N NH1 . ARG A 1 57  ? -10.578 -8.422  37.540  1.00 56.68  ? 54  ARG A NH1 1 
ATOM   438  N NH2 . ARG A 1 57  ? -10.602 -10.312 38.846  1.00 60.29  ? 54  ARG A NH2 1 
ATOM   439  N N   . PRO A 1 58  ? -4.292  -6.713  41.997  1.00 39.41  ? 55  PRO A N   1 
ATOM   440  C CA  . PRO A 1 58  ? -3.404  -7.098  43.099  1.00 39.12  ? 55  PRO A CA  1 
ATOM   441  C C   . PRO A 1 58  ? -3.842  -8.388  43.781  1.00 37.35  ? 55  PRO A C   1 
ATOM   442  O O   . PRO A 1 58  ? -5.032  -8.699  43.811  1.00 37.69  ? 55  PRO A O   1 
ATOM   443  C CB  . PRO A 1 58  ? -3.504  -5.908  44.059  1.00 41.58  ? 55  PRO A CB  1 
ATOM   444  C CG  . PRO A 1 58  ? -3.830  -4.754  43.171  1.00 40.12  ? 55  PRO A CG  1 
ATOM   445  C CD  . PRO A 1 58  ? -4.765  -5.324  42.139  1.00 36.73  ? 55  PRO A CD  1 
ATOM   446  N N   . TRP A 1 59  ? -2.876  -9.139  44.297  1.00 38.05  ? 56  TRP A N   1 
ATOM   447  C CA  . TRP A 1 59  ? -3.157  -10.375 45.016  1.00 41.63  ? 56  TRP A CA  1 
ATOM   448  C C   . TRP A 1 59  ? -2.747  -10.242 46.480  1.00 42.25  ? 56  TRP A C   1 
ATOM   449  O O   . TRP A 1 59  ? -1.992  -9.336  46.852  1.00 40.56  ? 56  TRP A O   1 
ATOM   450  C CB  . TRP A 1 59  ? -2.423  -11.552 44.371  1.00 40.10  ? 56  TRP A CB  1 
ATOM   451  C CG  . TRP A 1 59  ? -0.946  -11.332 44.306  1.00 40.19  ? 56  TRP A CG  1 
ATOM   452  C CD1 . TRP A 1 59  ? -0.028  -11.617 45.278  1.00 38.48  ? 56  TRP A CD1 1 
ATOM   453  C CD2 . TRP A 1 59  ? -0.214  -10.754 43.219  1.00 38.08  ? 56  TRP A CD2 1 
ATOM   454  N NE1 . TRP A 1 59  ? 1.231   -11.260 44.857  1.00 38.05  ? 56  TRP A NE1 1 
ATOM   455  C CE2 . TRP A 1 59  ? 1.143   -10.730 43.596  1.00 35.83  ? 56  TRP A CE2 1 
ATOM   456  C CE3 . TRP A 1 59  ? -0.575  -10.263 41.960  1.00 39.04  ? 56  TRP A CE3 1 
ATOM   457  C CZ2 . TRP A 1 59  ? 2.137   -10.223 42.767  1.00 34.51  ? 56  TRP A CZ2 1 
ATOM   458  C CZ3 . TRP A 1 59  ? 0.420   -9.766  41.132  1.00 40.43  ? 56  TRP A CZ3 1 
ATOM   459  C CH2 . TRP A 1 59  ? 1.760   -9.754  41.539  1.00 37.74  ? 56  TRP A CH2 1 
ATOM   460  N N   . SER A 1 60  ? -3.252  -11.147 47.311  1.00 44.29  ? 57  SER A N   1 
ATOM   461  C CA  . SER A 1 60  ? -2.829  -11.213 48.700  1.00 45.25  ? 57  SER A CA  1 
ATOM   462  C C   . SER A 1 60  ? -1.826  -12.346 48.863  1.00 45.04  ? 57  SER A C   1 
ATOM   463  O O   . SER A 1 60  ? -1.823  -13.300 48.084  1.00 42.18  ? 57  SER A O   1 
ATOM   464  C CB  . SER A 1 60  ? -4.028  -11.415 49.633  1.00 51.45  ? 57  SER A CB  1 
ATOM   465  O OG  . SER A 1 60  ? -4.747  -12.587 49.290  1.00 56.09  ? 57  SER A OG  1 
ATOM   466  N N   . GLY A 1 61  ? -0.969  -12.231 49.872  1.00 41.80  ? 58  GLY A N   1 
ATOM   467  C CA  . GLY A 1 61  ? 0.018   -13.255 50.144  1.00 40.52  ? 58  GLY A CA  1 
ATOM   468  C C   . GLY A 1 61  ? 1.195   -13.232 49.187  1.00 42.75  ? 58  GLY A C   1 
ATOM   469  O O   . GLY A 1 61  ? 1.436   -12.244 48.487  1.00 39.84  ? 58  GLY A O   1 
ATOM   470  N N   . VAL A 1 62  ? 1.930   -14.338 49.157  1.00 34.26  ? 59  VAL A N   1 
ATOM   471  C CA  . VAL A 1 62  ? 3.162   -14.418 48.391  1.00 33.87  ? 59  VAL A CA  1 
ATOM   472  C C   . VAL A 1 62  ? 2.978   -15.253 47.126  1.00 33.32  ? 59  VAL A C   1 
ATOM   473  O O   . VAL A 1 62  ? 2.758   -16.463 47.181  1.00 31.91  ? 59  VAL A O   1 
ATOM   474  C CB  . VAL A 1 62  ? 4.304   -15.006 49.235  1.00 34.12  ? 59  VAL A CB  1 
ATOM   475  C CG1 . VAL A 1 62  ? 5.559   -15.132 48.407  1.00 34.23  ? 59  VAL A CG1 1 
ATOM   476  C CG2 . VAL A 1 62  ? 4.565   -14.112 50.444  1.00 36.84  ? 59  VAL A CG2 1 
ATOM   477  N N   . LEU A 1 63  ? 3.064   -14.590 45.985  1.00 32.25  ? 60  LEU A N   1 
ATOM   478  C CA  . LEU A 1 63  ? 2.956   -15.278 44.710  1.00 32.44  ? 60  LEU A CA  1 
ATOM   479  C C   . LEU A 1 63  ? 4.199   -16.133 44.470  1.00 32.85  ? 60  LEU A C   1 
ATOM   480  O O   . LEU A 1 63  ? 5.338   -15.651 44.548  1.00 34.93  ? 60  LEU A O   1 
ATOM   481  C CB  . LEU A 1 63  ? 2.748   -14.273 43.580  1.00 33.11  ? 60  LEU A CB  1 
ATOM   482  C CG  . LEU A 1 63  ? 2.334   -14.851 42.220  1.00 41.22  ? 60  LEU A CG  1 
ATOM   483  C CD1 . LEU A 1 63  ? 1.295   -13.961 41.560  1.00 38.85  ? 60  LEU A CD1 1 
ATOM   484  C CD2 . LEU A 1 63  ? 3.536   -15.006 41.318  1.00 40.39  ? 60  LEU A CD2 1 
ATOM   485  N N   . ASP A 1 64  ? 3.964   -17.414 44.210  1.00 32.40  ? 61  ASP A N   1 
ATOM   486  C CA  . ASP A 1 64  ? 5.021   -18.346 43.851  1.00 36.52  ? 61  ASP A CA  1 
ATOM   487  C C   . ASP A 1 64  ? 5.525   -18.041 42.440  1.00 37.53  ? 61  ASP A C   1 
ATOM   488  O O   . ASP A 1 64  ? 4.857   -18.350 41.456  1.00 37.87  ? 61  ASP A O   1 
ATOM   489  C CB  . ASP A 1 64  ? 4.506   -19.785 43.941  1.00 42.77  ? 61  ASP A CB  1 
ATOM   490  C CG  . ASP A 1 64  ? 5.600   -20.824 43.757  1.00 43.89  ? 61  ASP A CG  1 
ATOM   491  O OD1 . ASP A 1 64  ? 6.690   -20.488 43.254  1.00 47.69  ? 61  ASP A OD1 1 
ATOM   492  O OD2 . ASP A 1 64  ? 5.362   -21.993 44.118  1.00 51.51  ? 61  ASP A OD2 1 
ATOM   493  N N   . ALA A 1 65  ? 6.703   -17.432 42.353  1.00 35.50  ? 62  ALA A N   1 
ATOM   494  C CA  . ALA A 1 65  ? 7.303   -17.101 41.068  1.00 35.25  ? 62  ALA A CA  1 
ATOM   495  C C   . ALA A 1 65  ? 8.542   -17.949 40.828  1.00 30.89  ? 62  ALA A C   1 
ATOM   496  O O   . ALA A 1 65  ? 9.599   -17.433 40.475  1.00 31.56  ? 62  ALA A O   1 
ATOM   497  C CB  . ALA A 1 65  ? 7.653   -15.620 41.005  1.00 32.30  ? 62  ALA A CB  1 
ATOM   498  N N   . THR A 1 66  ? 8.417   -19.255 41.028  1.00 33.74  ? 63  THR A N   1 
ATOM   499  C CA  . THR A 1 66  ? 9.574   -20.128 40.926  1.00 33.89  ? 63  THR A CA  1 
ATOM   500  C C   . THR A 1 66  ? 9.552   -21.010 39.682  1.00 38.01  ? 63  THR A C   1 
ATOM   501  O O   . THR A 1 66  ? 10.550  -21.639 39.378  1.00 37.58  ? 63  THR A O   1 
ATOM   502  C CB  . THR A 1 66  ? 9.705   -21.050 42.157  1.00 33.94  ? 63  THR A CB  1 
ATOM   503  O OG1 . THR A 1 66  ? 8.554   -21.895 42.237  1.00 33.48  ? 63  THR A OG1 1 
ATOM   504  C CG2 . THR A 1 66  ? 9.839   -20.232 43.443  1.00 35.85  ? 63  THR A CG2 1 
ATOM   505  N N   . THR A 1 67  ? 8.423   -21.086 38.981  1.00 36.18  ? 64  THR A N   1 
ATOM   506  C CA  . THR A 1 67  ? 8.359   -21.899 37.759  1.00 38.37  ? 64  THR A CA  1 
ATOM   507  C C   . THR A 1 67  ? 7.646   -21.190 36.610  1.00 35.81  ? 64  THR A C   1 
ATOM   508  O O   . THR A 1 67  ? 6.834   -20.289 36.833  1.00 31.87  ? 64  THR A O   1 
ATOM   509  C CB  . THR A 1 67  ? 7.647   -23.253 37.996  1.00 40.50  ? 64  THR A CB  1 
ATOM   510  O OG1 . THR A 1 67  ? 6.260   -23.030 38.275  1.00 43.03  ? 64  THR A OG1 1 
ATOM   511  C CG2 . THR A 1 67  ? 8.283   -24.017 39.147  1.00 52.04  ? 64  THR A CG2 1 
ATOM   512  N N   . PHE A 1 68  ? 7.958   -21.606 35.381  1.00 32.99  ? 65  PHE A N   1 
ATOM   513  C CA  . PHE A 1 68  ? 7.301   -21.065 34.196  1.00 31.94  ? 65  PHE A CA  1 
ATOM   514  C C   . PHE A 1 68  ? 5.810   -21.346 34.239  1.00 32.85  ? 65  PHE A C   1 
ATOM   515  O O   . PHE A 1 68  ? 5.381   -22.368 34.769  1.00 35.91  ? 65  PHE A O   1 
ATOM   516  C CB  . PHE A 1 68  ? 7.889   -21.663 32.910  1.00 31.95  ? 65  PHE A CB  1 
ATOM   517  C CG  . PHE A 1 68  ? 9.281   -21.205 32.606  1.00 28.63  ? 65  PHE A CG  1 
ATOM   518  C CD1 . PHE A 1 68  ? 9.539   -19.876 32.325  1.00 29.08  ? 65  PHE A CD1 1 
ATOM   519  C CD2 . PHE A 1 68  ? 10.331  -22.108 32.583  1.00 30.34  ? 65  PHE A CD2 1 
ATOM   520  C CE1 . PHE A 1 68  ? 10.818  -19.450 32.039  1.00 30.01  ? 65  PHE A CE1 1 
ATOM   521  C CE2 . PHE A 1 68  ? 11.615  -21.686 32.300  1.00 33.34  ? 65  PHE A CE2 1 
ATOM   522  C CZ  . PHE A 1 68  ? 11.858  -20.355 32.025  1.00 32.03  ? 65  PHE A CZ  1 
ATOM   523  N N   . GLN A 1 69  ? 5.023   -20.440 33.671  1.00 31.79  ? 66  GLN A N   1 
ATOM   524  C CA  . GLN A 1 69  ? 3.584   -20.643 33.579  1.00 33.32  ? 66  GLN A CA  1 
ATOM   525  C C   . GLN A 1 69  ? 3.172   -21.238 32.230  1.00 33.65  ? 66  GLN A C   1 
ATOM   526  O O   . GLN A 1 69  ? 4.025   -21.608 31.419  1.00 29.91  ? 66  GLN A O   1 
ATOM   527  C CB  . GLN A 1 69  ? 2.852   -19.323 33.822  1.00 32.45  ? 66  GLN A CB  1 
ATOM   528  C CG  . GLN A 1 69  ? 2.401   -19.144 35.267  1.00 36.07  ? 66  GLN A CG  1 
ATOM   529  C CD  . GLN A 1 69  ? 1.224   -20.034 35.609  1.00 39.73  ? 66  GLN A CD  1 
ATOM   530  O OE1 . GLN A 1 69  ? 0.698   -20.743 34.749  1.00 38.63  ? 66  GLN A OE1 1 
ATOM   531  N NE2 . GLN A 1 69  ? 0.798   -19.996 36.862  1.00 37.54  ? 66  GLN A NE2 1 
ATOM   532  N N   . ASN A 1 70  ? 1.862   -21.332 32.009  1.00 31.62  ? 67  ASN A N   1 
ATOM   533  C CA  . ASN A 1 70  ? 1.303   -21.918 30.793  1.00 29.15  ? 67  ASN A CA  1 
ATOM   534  C C   . ASN A 1 70  ? 1.761   -21.197 29.533  1.00 31.27  ? 67  ASN A C   1 
ATOM   535  O O   . ASN A 1 70  ? 2.059   -20.006 29.561  1.00 29.91  ? 67  ASN A O   1 
ATOM   536  C CB  . ASN A 1 70  ? -0.230  -21.907 30.837  1.00 33.02  ? 67  ASN A CB  1 
ATOM   537  C CG  . ASN A 1 70  ? -0.792  -22.630 32.052  1.00 36.79  ? 67  ASN A CG  1 
ATOM   538  O OD1 . ASN A 1 70  ? -0.267  -23.656 32.478  1.00 35.48  ? 67  ASN A OD1 1 
ATOM   539  N ND2 . ASN A 1 70  ? -1.876  -22.099 32.605  1.00 34.15  ? 67  ASN A ND2 1 
ATOM   540  N N   . VAL A 1 71  ? 1.804   -21.936 28.430  1.00 29.74  ? 68  VAL A N   1 
ATOM   541  C CA  . VAL A 1 71  ? 2.089   -21.373 27.115  1.00 29.53  ? 68  VAL A CA  1 
ATOM   542  C C   . VAL A 1 71  ? 0.769   -20.985 26.451  1.00 29.00  ? 68  VAL A C   1 
ATOM   543  O O   . VAL A 1 71  ? -0.229  -21.678 26.618  1.00 30.81  ? 68  VAL A O   1 
ATOM   544  C CB  . VAL A 1 71  ? 2.863   -22.389 26.240  1.00 30.41  ? 68  VAL A CB  1 
ATOM   545  C CG1 . VAL A 1 71  ? 2.949   -21.931 24.802  1.00 34.43  ? 68  VAL A CG1 1 
ATOM   546  C CG2 . VAL A 1 71  ? 4.252   -22.626 26.809  1.00 32.56  ? 68  VAL A CG2 1 
ATOM   547  N N   . CYS A 1 72  ? 0.752   -19.873 25.722  1.00 27.08  ? 69  CYS A N   1 
ATOM   548  C CA  . CYS A 1 72  ? -0.468  -19.436 25.053  1.00 29.00  ? 69  CYS A CA  1 
ATOM   549  C C   . CYS A 1 72  ? -0.895  -20.474 24.024  1.00 33.32  ? 69  CYS A C   1 
ATOM   550  O O   . CYS A 1 72  ? -0.059  -21.146 23.425  1.00 30.04  ? 69  CYS A O   1 
ATOM   551  C CB  . CYS A 1 72  ? -0.272  -18.068 24.398  1.00 30.55  ? 69  CYS A CB  1 
ATOM   552  S SG  . CYS A 1 72  ? -0.041  -16.728 25.587  1.00 36.45  ? 69  CYS A SG  1 
ATOM   553  N N   . TYR A 1 73  ? -2.201  -20.617 23.846  1.00 30.47  ? 70  TYR A N   1 
ATOM   554  C CA  . TYR A 1 73  ? -2.732  -21.690 23.025  1.00 34.75  ? 70  TYR A CA  1 
ATOM   555  C C   . TYR A 1 73  ? -2.284  -21.541 21.569  1.00 33.04  ? 70  TYR A C   1 
ATOM   556  O O   . TYR A 1 73  ? -2.395  -20.466 20.983  1.00 31.58  ? 70  TYR A O   1 
ATOM   557  C CB  . TYR A 1 73  ? -4.255  -21.723 23.128  1.00 35.76  ? 70  TYR A CB  1 
ATOM   558  C CG  . TYR A 1 73  ? -4.802  -23.124 23.155  1.00 37.71  ? 70  TYR A CG  1 
ATOM   559  C CD1 . TYR A 1 73  ? -4.987  -23.828 21.979  1.00 41.02  ? 70  TYR A CD1 1 
ATOM   560  C CD2 . TYR A 1 73  ? -5.117  -23.751 24.357  1.00 42.64  ? 70  TYR A CD2 1 
ATOM   561  C CE1 . TYR A 1 73  ? -5.476  -25.109 21.984  1.00 46.12  ? 70  TYR A CE1 1 
ATOM   562  C CE2 . TYR A 1 73  ? -5.610  -25.044 24.375  1.00 42.83  ? 70  TYR A CE2 1 
ATOM   563  C CZ  . TYR A 1 73  ? -5.786  -25.716 23.179  1.00 45.76  ? 70  TYR A CZ  1 
ATOM   564  O OH  . TYR A 1 73  ? -6.276  -27.002 23.156  1.00 55.06  ? 70  TYR A OH  1 
ATOM   565  N N   . GLN A 1 74  ? -1.761  -22.624 21.002  1.00 31.68  ? 71  GLN A N   1 
ATOM   566  C CA  . GLN A 1 74  ? -1.149  -22.570 19.682  1.00 35.07  ? 71  GLN A CA  1 
ATOM   567  C C   . GLN A 1 74  ? -1.021  -23.940 19.037  1.00 35.12  ? 71  GLN A C   1 
ATOM   568  O O   . GLN A 1 74  ? -1.114  -24.974 19.708  1.00 33.57  ? 71  GLN A O   1 
ATOM   569  C CB  . GLN A 1 74  ? 0.235   -21.936 19.778  1.00 34.21  ? 71  GLN A CB  1 
ATOM   570  C CG  . GLN A 1 74  ? 1.214   -22.787 20.573  1.00 32.43  ? 71  GLN A CG  1 
ATOM   571  C CD  . GLN A 1 74  ? 2.456   -22.029 20.959  1.00 34.38  ? 71  GLN A CD  1 
ATOM   572  O OE1 . GLN A 1 74  ? 3.549   -22.309 20.464  1.00 33.56  ? 71  GLN A OE1 1 
ATOM   573  N NE2 . GLN A 1 74  ? 2.299   -21.053 21.846  1.00 31.77  ? 71  GLN A NE2 1 
ATOM   574  N N   . TYR A 1 75  ? -0.798  -23.930 17.727  1.00 35.74  ? 72  TYR A N   1 
ATOM   575  C CA  . TYR A 1 75  ? -0.493  -25.137 16.971  1.00 37.49  ? 72  TYR A CA  1 
ATOM   576  C C   . TYR A 1 75  ? 0.853   -25.726 17.384  1.00 38.43  ? 72  TYR A C   1 
ATOM   577  O O   . TYR A 1 75  ? 1.833   -25.001 17.556  1.00 39.89  ? 72  TYR A O   1 
ATOM   578  C CB  . TYR A 1 75  ? -0.492  -24.837 15.467  1.00 42.84  ? 72  TYR A CB  1 
ATOM   579  C CG  . TYR A 1 75  ? -0.009  -25.993 14.615  1.00 47.68  ? 72  TYR A CG  1 
ATOM   580  C CD1 . TYR A 1 75  ? -0.859  -27.041 14.285  1.00 49.60  ? 72  TYR A CD1 1 
ATOM   581  C CD2 . TYR A 1 75  ? 1.300   -26.039 14.150  1.00 46.17  ? 72  TYR A CD2 1 
ATOM   582  C CE1 . TYR A 1 75  ? -0.420  -28.103 13.513  1.00 52.44  ? 72  TYR A CE1 1 
ATOM   583  C CE2 . TYR A 1 75  ? 1.748   -27.096 13.378  1.00 52.31  ? 72  TYR A CE2 1 
ATOM   584  C CZ  . TYR A 1 75  ? 0.884   -28.125 13.062  1.00 55.77  ? 72  TYR A CZ  1 
ATOM   585  O OH  . TYR A 1 75  ? 1.327   -29.180 12.295  1.00 67.30  ? 72  TYR A OH  1 
ATOM   586  N N   . VAL A 1 76  ? 0.898   -27.044 17.537  1.00 39.09  ? 73  VAL A N   1 
ATOM   587  C CA  . VAL A 1 76  ? 2.133   -27.731 17.895  1.00 39.98  ? 73  VAL A CA  1 
ATOM   588  C C   . VAL A 1 76  ? 2.644   -28.582 16.729  1.00 46.82  ? 73  VAL A C   1 
ATOM   589  O O   . VAL A 1 76  ? 1.945   -29.476 16.253  1.00 45.33  ? 73  VAL A O   1 
ATOM   590  C CB  . VAL A 1 76  ? 1.937   -28.621 19.132  1.00 41.17  ? 73  VAL A CB  1 
ATOM   591  C CG1 . VAL A 1 76  ? 3.209   -29.396 19.438  1.00 43.38  ? 73  VAL A CG1 1 
ATOM   592  C CG2 . VAL A 1 76  ? 1.514   -27.774 20.328  1.00 42.31  ? 73  VAL A CG2 1 
ATOM   593  N N   . ASP A 1 77  ? 3.861   -28.293 16.277  1.00 47.02  ? 74  ASP A N   1 
ATOM   594  C CA  . ASP A 1 77  ? 4.463   -28.995 15.144  1.00 50.37  ? 74  ASP A CA  1 
ATOM   595  C C   . ASP A 1 77  ? 4.776   -30.449 15.489  1.00 49.71  ? 74  ASP A C   1 
ATOM   596  O O   . ASP A 1 77  ? 5.588   -30.723 16.370  1.00 48.20  ? 74  ASP A O   1 
ATOM   597  C CB  . ASP A 1 77  ? 5.740   -28.277 14.691  1.00 47.94  ? 74  ASP A CB  1 
ATOM   598  C CG  . ASP A 1 77  ? 6.253   -28.769 13.343  1.00 56.40  ? 74  ASP A CG  1 
ATOM   599  O OD1 . ASP A 1 77  ? 6.440   -29.992 13.166  1.00 55.33  ? 74  ASP A OD1 1 
ATOM   600  O OD2 . ASP A 1 77  ? 6.475   -27.924 12.453  1.00 59.00  ? 74  ASP A OD2 1 
ATOM   601  N N   . THR A 1 78  ? 4.135   -31.376 14.785  1.00 54.72  ? 75  THR A N   1 
ATOM   602  C CA  . THR A 1 78  ? 4.388   -32.798 14.988  1.00 56.21  ? 75  THR A CA  1 
ATOM   603  C C   . THR A 1 78  ? 4.863   -33.460 13.699  1.00 60.40  ? 75  THR A C   1 
ATOM   604  O O   . THR A 1 78  ? 4.815   -34.684 13.567  1.00 62.81  ? 75  THR A O   1 
ATOM   605  C CB  . THR A 1 78  ? 3.132   -33.533 15.499  1.00 55.02  ? 75  THR A CB  1 
ATOM   606  O OG1 . THR A 1 78  ? 2.028   -33.261 14.627  1.00 57.48  ? 75  THR A OG1 1 
ATOM   607  C CG2 . THR A 1 78  ? 2.783   -33.077 16.906  1.00 50.15  ? 75  THR A CG2 1 
ATOM   608  N N   . LEU A 1 79  ? 5.323   -32.640 12.757  1.00 62.10  ? 76  LEU A N   1 
ATOM   609  C CA  . LEU A 1 79  ? 5.789   -33.115 11.456  1.00 61.65  ? 76  LEU A CA  1 
ATOM   610  C C   . LEU A 1 79  ? 6.900   -34.158 11.582  1.00 64.39  ? 76  LEU A C   1 
ATOM   611  O O   . LEU A 1 79  ? 6.908   -35.157 10.862  1.00 66.62  ? 76  LEU A O   1 
ATOM   612  C CB  . LEU A 1 79  ? 6.274   -31.934 10.608  1.00 58.62  ? 76  LEU A CB  1 
ATOM   613  C CG  . LEU A 1 79  ? 6.546   -32.183 9.122   1.00 69.53  ? 76  LEU A CG  1 
ATOM   614  C CD1 . LEU A 1 79  ? 5.292   -32.679 8.420   1.00 71.36  ? 76  LEU A CD1 1 
ATOM   615  C CD2 . LEU A 1 79  ? 7.070   -30.921 8.445   1.00 64.76  ? 76  LEU A CD2 1 
ATOM   616  N N   . TYR A 1 80  ? 7.830   -33.927 12.504  1.00 59.95  ? 77  TYR A N   1 
ATOM   617  C CA  . TYR A 1 80  ? 8.955   -34.834 12.699  1.00 54.30  ? 77  TYR A CA  1 
ATOM   618  C C   . TYR A 1 80  ? 9.078   -35.284 14.153  1.00 58.30  ? 77  TYR A C   1 
ATOM   619  O O   . TYR A 1 80  ? 9.726   -34.617 14.960  1.00 54.95  ? 77  TYR A O   1 
ATOM   620  C CB  . TYR A 1 80  ? 10.263  -34.172 12.264  1.00 52.54  ? 77  TYR A CB  1 
ATOM   621  C CG  . TYR A 1 80  ? 10.276  -33.644 10.848  1.00 57.40  ? 77  TYR A CG  1 
ATOM   622  C CD1 . TYR A 1 80  ? 10.299  -34.509 9.760   1.00 55.74  ? 77  TYR A CD1 1 
ATOM   623  C CD2 . TYR A 1 80  ? 10.295  -32.279 10.601  1.00 54.71  ? 77  TYR A CD2 1 
ATOM   624  C CE1 . TYR A 1 80  ? 10.324  -34.024 8.463   1.00 56.76  ? 77  TYR A CE1 1 
ATOM   625  C CE2 . TYR A 1 80  ? 10.321  -31.786 9.315   1.00 59.07  ? 77  TYR A CE2 1 
ATOM   626  C CZ  . TYR A 1 80  ? 10.334  -32.660 8.248   1.00 61.18  ? 77  TYR A CZ  1 
ATOM   627  O OH  . TYR A 1 80  ? 10.359  -32.161 6.967   1.00 62.23  ? 77  TYR A OH  1 
ATOM   628  N N   . PRO A 1 81  ? 8.460   -36.426 14.487  1.00 57.68  ? 78  PRO A N   1 
ATOM   629  C CA  . PRO A 1 81  ? 8.499   -36.994 15.839  1.00 55.00  ? 78  PRO A CA  1 
ATOM   630  C C   . PRO A 1 81  ? 9.920   -37.222 16.353  1.00 55.11  ? 78  PRO A C   1 
ATOM   631  O O   . PRO A 1 81  ? 10.677  -37.978 15.746  1.00 55.51  ? 78  PRO A O   1 
ATOM   632  C CB  . PRO A 1 81  ? 7.768   -38.331 15.679  1.00 60.11  ? 78  PRO A CB  1 
ATOM   633  C CG  . PRO A 1 81  ? 6.880   -38.136 14.498  1.00 62.82  ? 78  PRO A CG  1 
ATOM   634  C CD  . PRO A 1 81  ? 7.638   -37.235 13.569  1.00 57.85  ? 78  PRO A CD  1 
ATOM   635  N N   . GLY A 1 82  ? 10.272  -36.567 17.456  1.00 52.55  ? 79  GLY A N   1 
ATOM   636  C CA  . GLY A 1 82  ? 11.556  -36.781 18.099  1.00 49.24  ? 79  GLY A CA  1 
ATOM   637  C C   . GLY A 1 82  ? 12.711  -35.987 17.515  1.00 49.75  ? 79  GLY A C   1 
ATOM   638  O O   . GLY A 1 82  ? 13.851  -36.123 17.959  1.00 51.82  ? 79  GLY A O   1 
ATOM   639  N N   . PHE A 1 83  ? 12.418  -35.153 16.521  1.00 48.43  ? 80  PHE A N   1 
ATOM   640  C CA  . PHE A 1 83  ? 13.442  -34.354 15.854  1.00 42.51  ? 80  PHE A CA  1 
ATOM   641  C C   . PHE A 1 83  ? 13.709  -33.051 16.597  1.00 40.31  ? 80  PHE A C   1 
ATOM   642  O O   . PHE A 1 83  ? 12.799  -32.255 16.800  1.00 38.92  ? 80  PHE A O   1 
ATOM   643  C CB  . PHE A 1 83  ? 13.018  -34.062 14.416  1.00 41.80  ? 80  PHE A CB  1 
ATOM   644  C CG  . PHE A 1 83  ? 13.991  -33.219 13.647  1.00 38.17  ? 80  PHE A CG  1 
ATOM   645  C CD1 . PHE A 1 83  ? 15.306  -33.620 13.488  1.00 38.93  ? 80  PHE A CD1 1 
ATOM   646  C CD2 . PHE A 1 83  ? 13.577  -32.040 13.049  1.00 41.69  ? 80  PHE A CD2 1 
ATOM   647  C CE1 . PHE A 1 83  ? 16.196  -32.851 12.758  1.00 42.35  ? 80  PHE A CE1 1 
ATOM   648  C CE2 . PHE A 1 83  ? 14.461  -31.266 12.317  1.00 42.47  ? 80  PHE A CE2 1 
ATOM   649  C CZ  . PHE A 1 83  ? 15.773  -31.672 12.172  1.00 40.36  ? 80  PHE A CZ  1 
ATOM   650  N N   . GLU A 1 84  ? 14.962  -32.834 16.984  1.00 40.88  ? 81  GLU A N   1 
ATOM   651  C CA  . GLU A 1 84  ? 15.323  -31.688 17.815  1.00 44.73  ? 81  GLU A CA  1 
ATOM   652  C C   . GLU A 1 84  ? 15.076  -30.362 17.100  1.00 44.72  ? 81  GLU A C   1 
ATOM   653  O O   . GLU A 1 84  ? 14.641  -29.382 17.717  1.00 40.05  ? 81  GLU A O   1 
ATOM   654  C CB  . GLU A 1 84  ? 16.790  -31.791 18.246  1.00 45.57  ? 81  GLU A CB  1 
ATOM   655  C CG  . GLU A 1 84  ? 17.268  -30.682 19.179  1.00 55.40  ? 81  GLU A CG  1 
ATOM   656  C CD  . GLU A 1 84  ? 16.602  -30.715 20.552  1.00 62.87  ? 81  GLU A CD  1 
ATOM   657  O OE1 . GLU A 1 84  ? 15.948  -31.727 20.890  1.00 67.25  ? 81  GLU A OE1 1 
ATOM   658  O OE2 . GLU A 1 84  ? 16.739  -29.721 21.299  1.00 63.35  ? 81  GLU A OE2 1 
ATOM   659  N N   . GLY A 1 85  ? 15.337  -30.351 15.793  1.00 40.47  ? 82  GLY A N   1 
ATOM   660  C CA  . GLY A 1 85  ? 15.210  -29.155 14.981  1.00 37.77  ? 82  GLY A CA  1 
ATOM   661  C C   . GLY A 1 85  ? 13.844  -28.500 15.042  1.00 36.71  ? 82  GLY A C   1 
ATOM   662  O O   . GLY A 1 85  ? 13.737  -27.280 14.966  1.00 34.55  ? 82  GLY A O   1 
ATOM   663  N N   . THR A 1 86  ? 12.798  -29.307 15.177  1.00 35.07  ? 83  THR A N   1 
ATOM   664  C CA  . THR A 1 86  ? 11.454  -28.772 15.362  1.00 35.89  ? 83  THR A CA  1 
ATOM   665  C C   . THR A 1 86  ? 11.067  -28.705 16.844  1.00 38.98  ? 83  THR A C   1 
ATOM   666  O O   . THR A 1 86  ? 10.530  -27.697 17.299  1.00 39.58  ? 83  THR A O   1 
ATOM   667  C CB  . THR A 1 86  ? 10.405  -29.608 14.615  1.00 40.65  ? 83  THR A CB  1 
ATOM   668  O OG1 . THR A 1 86  ? 10.607  -30.993 14.910  1.00 41.94  ? 83  THR A OG1 1 
ATOM   669  C CG2 . THR A 1 86  ? 10.523  -29.396 13.108  1.00 41.81  ? 83  THR A CG2 1 
ATOM   670  N N   . GLU A 1 87  ? 11.345  -29.777 17.586  1.00 38.05  ? 84  GLU A N   1 
ATOM   671  C CA  . GLU A 1 87  ? 10.906  -29.892 18.978  1.00 40.87  ? 84  GLU A CA  1 
ATOM   672  C C   . GLU A 1 87  ? 11.438  -28.783 19.879  1.00 40.03  ? 84  GLU A C   1 
ATOM   673  O O   . GLU A 1 87  ? 10.760  -28.384 20.828  1.00 40.64  ? 84  GLU A O   1 
ATOM   674  C CB  . GLU A 1 87  ? 11.312  -31.247 19.572  1.00 45.17  ? 84  GLU A CB  1 
ATOM   675  C CG  . GLU A 1 87  ? 10.635  -32.462 18.947  1.00 49.64  ? 84  GLU A CG  1 
ATOM   676  C CD  . GLU A 1 87  ? 9.190   -32.641 19.371  1.00 57.62  ? 84  GLU A CD  1 
ATOM   677  O OE1 . GLU A 1 87  ? 8.684   -31.826 20.178  1.00 62.30  ? 84  GLU A OE1 1 
ATOM   678  O OE2 . GLU A 1 87  ? 8.560   -33.610 18.892  1.00 59.21  ? 84  GLU A OE2 1 
ATOM   679  N N   . MET A 1 88  ? 12.639  -28.280 19.600  1.00 37.34  ? 85  MET A N   1 
ATOM   680  C CA  . MET A 1 88  ? 13.199  -27.242 20.464  1.00 41.08  ? 85  MET A CA  1 
ATOM   681  C C   . MET A 1 88  ? 12.385  -25.943 20.423  1.00 40.56  ? 85  MET A C   1 
ATOM   682  O O   . MET A 1 88  ? 12.555  -25.078 21.282  1.00 34.75  ? 85  MET A O   1 
ATOM   683  C CB  . MET A 1 88  ? 14.657  -26.950 20.102  1.00 40.92  ? 85  MET A CB  1 
ATOM   684  C CG  . MET A 1 88  ? 14.874  -26.325 18.740  1.00 39.60  ? 85  MET A CG  1 
ATOM   685  S SD  . MET A 1 88  ? 16.599  -25.844 18.518  1.00 51.10  ? 85  MET A SD  1 
ATOM   686  C CE  . MET A 1 88  ? 16.642  -24.279 19.384  1.00 42.11  ? 85  MET A CE  1 
ATOM   687  N N   . TRP A 1 89  ? 11.498  -25.813 19.436  1.00 34.41  ? 86  TRP A N   1 
ATOM   688  C CA  . TRP A 1 89  ? 10.638  -24.633 19.336  1.00 34.26  ? 86  TRP A CA  1 
ATOM   689  C C   . TRP A 1 89  ? 9.215   -24.877 19.849  1.00 33.59  ? 86  TRP A C   1 
ATOM   690  O O   . TRP A 1 89  ? 8.421   -23.942 19.944  1.00 33.57  ? 86  TRP A O   1 
ATOM   691  C CB  . TRP A 1 89  ? 10.582  -24.141 17.884  1.00 31.05  ? 86  TRP A CB  1 
ATOM   692  C CG  . TRP A 1 89  ? 11.935  -23.942 17.287  1.00 32.04  ? 86  TRP A CG  1 
ATOM   693  C CD1 . TRP A 1 89  ? 12.564  -24.762 16.395  1.00 34.10  ? 86  TRP A CD1 1 
ATOM   694  C CD2 . TRP A 1 89  ? 12.842  -22.865 17.550  1.00 30.42  ? 86  TRP A CD2 1 
ATOM   695  N NE1 . TRP A 1 89  ? 13.803  -24.260 16.084  1.00 34.08  ? 86  TRP A NE1 1 
ATOM   696  C CE2 . TRP A 1 89  ? 13.999  -23.096 16.779  1.00 33.44  ? 86  TRP A CE2 1 
ATOM   697  C CE3 . TRP A 1 89  ? 12.790  -21.728 18.363  1.00 33.19  ? 86  TRP A CE3 1 
ATOM   698  C CZ2 . TRP A 1 89  ? 15.092  -22.229 16.790  1.00 34.28  ? 86  TRP A CZ2 1 
ATOM   699  C CZ3 . TRP A 1 89  ? 13.878  -20.873 18.380  1.00 32.63  ? 86  TRP A CZ3 1 
ATOM   700  C CH2 . TRP A 1 89  ? 15.013  -21.126 17.598  1.00 35.39  ? 86  TRP A CH2 1 
ATOM   701  N N   . ASN A 1 90  ? 8.893   -26.127 20.170  1.00 31.59  ? 87  ASN A N   1 
ATOM   702  C CA  . ASN A 1 90  ? 7.549   -26.484 20.615  1.00 34.62  ? 87  ASN A CA  1 
ATOM   703  C C   . ASN A 1 90  ? 7.343   -26.095 22.077  1.00 32.71  ? 87  ASN A C   1 
ATOM   704  O O   . ASN A 1 90  ? 8.314   -25.986 22.819  1.00 32.82  ? 87  ASN A O   1 
ATOM   705  C CB  . ASN A 1 90  ? 7.295   -27.987 20.435  1.00 35.76  ? 87  ASN A CB  1 
ATOM   706  C CG  . ASN A 1 90  ? 6.909   -28.359 19.008  1.00 42.21  ? 87  ASN A CG  1 
ATOM   707  O OD1 . ASN A 1 90  ? 6.521   -27.507 18.202  1.00 40.76  ? 87  ASN A OD1 1 
ATOM   708  N ND2 . ASN A 1 90  ? 6.999   -29.644 18.698  1.00 41.96  ? 87  ASN A ND2 1 
ATOM   709  N N   . PRO A 1 91  ? 6.079   -25.881 22.489  1.00 31.57  ? 88  PRO A N   1 
ATOM   710  C CA  . PRO A 1 91  ? 5.780   -25.529 23.885  1.00 35.17  ? 88  PRO A CA  1 
ATOM   711  C C   . PRO A 1 91  ? 6.351   -26.530 24.887  1.00 37.38  ? 88  PRO A C   1 
ATOM   712  O O   . PRO A 1 91  ? 6.270   -27.742 24.677  1.00 39.73  ? 88  PRO A O   1 
ATOM   713  C CB  . PRO A 1 91  ? 4.249   -25.531 23.928  1.00 34.42  ? 88  PRO A CB  1 
ATOM   714  C CG  . PRO A 1 91  ? 3.841   -25.193 22.521  1.00 32.98  ? 88  PRO A CG  1 
ATOM   715  C CD  . PRO A 1 91  ? 4.873   -25.840 21.640  1.00 32.22  ? 88  PRO A CD  1 
ATOM   716  N N   . ASN A 1 92  ? 6.939   -26.017 25.962  1.00 35.75  ? 89  ASN A N   1 
ATOM   717  C CA  . ASN A 1 92  ? 7.479   -26.867 27.010  1.00 38.87  ? 89  ASN A CA  1 
ATOM   718  C C   . ASN A 1 92  ? 6.668   -26.735 28.298  1.00 39.40  ? 89  ASN A C   1 
ATOM   719  O O   . ASN A 1 92  ? 7.097   -27.170 29.364  1.00 41.99  ? 89  ASN A O   1 
ATOM   720  C CB  . ASN A 1 92  ? 8.953   -26.538 27.258  1.00 38.49  ? 89  ASN A CB  1 
ATOM   721  C CG  . ASN A 1 92  ? 9.169   -25.100 27.696  1.00 39.62  ? 89  ASN A CG  1 
ATOM   722  O OD1 . ASN A 1 92  ? 8.310   -24.240 27.502  1.00 36.04  ? 89  ASN A OD1 1 
ATOM   723  N ND2 . ASN A 1 92  ? 10.327  -24.833 28.290  1.00 42.46  ? 89  ASN A ND2 1 
ATOM   724  N N   . ARG A 1 93  ? 5.490   -26.128 28.180  1.00 36.50  ? 90  ARG A N   1 
ATOM   725  C CA  . ARG A 1 93  ? 4.517   -26.077 29.267  1.00 41.43  ? 90  ARG A CA  1 
ATOM   726  C C   . ARG A 1 93  ? 3.119   -26.316 28.700  1.00 40.71  ? 90  ARG A C   1 
ATOM   727  O O   . ARG A 1 93  ? 2.921   -26.268 27.484  1.00 36.45  ? 90  ARG A O   1 
ATOM   728  C CB  . ARG A 1 93  ? 4.572   -24.732 30.001  1.00 33.92  ? 90  ARG A CB  1 
ATOM   729  C CG  . ARG A 1 93  ? 5.813   -24.524 30.840  1.00 36.04  ? 90  ARG A CG  1 
ATOM   730  C CD  . ARG A 1 93  ? 5.776   -25.434 32.064  1.00 42.26  ? 90  ARG A CD  1 
ATOM   731  N NE  . ARG A 1 93  ? 6.906   -25.222 32.959  1.00 49.09  ? 90  ARG A NE  1 
ATOM   732  C CZ  . ARG A 1 93  ? 8.099   -25.788 32.804  1.00 58.67  ? 90  ARG A CZ  1 
ATOM   733  N NH1 . ARG A 1 93  ? 8.319   -26.599 31.778  1.00 56.85  ? 90  ARG A NH1 1 
ATOM   734  N NH2 . ARG A 1 93  ? 9.072   -25.542 33.672  1.00 58.04  ? 90  ARG A NH2 1 
ATOM   735  N N   . GLU A 1 94  ? 2.161   -26.571 29.586  1.00 37.97  ? 91  GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 0.769   -26.791 29.202  1.00 37.72  ? 91  GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 0.206   -25.609 28.410  1.00 36.83  ? 91  GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 0.500   -24.451 28.718  1.00 32.71  ? 91  GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? -0.079  -27.049 30.454  1.00 41.23  ? 91  GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? -1.592  -26.929 30.278  1.00 41.08  ? 91  GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? -2.348  -27.094 31.599  1.00 50.90  ? 91  GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? -3.536  -26.704 31.671  1.00 48.17  ? 91  GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? -1.750  -27.614 32.566  1.00 50.45  ? 91  GLU A OE2 1 
ATOM   744  N N   . LEU A 1 95  ? -0.587  -25.907 27.384  1.00 30.12  ? 92  LEU A N   1 
ATOM   745  C CA  . LEU A 1 95  ? -1.269  -24.874 26.614  1.00 32.44  ? 92  LEU A CA  1 
ATOM   746  C C   . LEU A 1 95  ? -2.505  -24.371 27.353  1.00 35.69  ? 92  LEU A C   1 
ATOM   747  O O   . LEU A 1 95  ? -3.313  -25.158 27.839  1.00 35.42  ? 92  LEU A O   1 
ATOM   748  C CB  . LEU A 1 95  ? -1.677  -25.396 25.230  1.00 34.30  ? 92  LEU A CB  1 
ATOM   749  C CG  . LEU A 1 95  ? -0.570  -25.884 24.293  1.00 33.34  ? 92  LEU A CG  1 
ATOM   750  C CD1 . LEU A 1 95  ? -1.133  -26.246 22.911  1.00 36.07  ? 92  LEU A CD1 1 
ATOM   751  C CD2 . LEU A 1 95  ? 0.517   -24.842 24.164  1.00 30.58  ? 92  LEU A CD2 1 
ATOM   752  N N   . SER A 1 96  ? -2.654  -23.054 27.423  1.00 32.48  ? 93  SER A N   1 
ATOM   753  C CA  . SER A 1 96  ? -3.837  -22.465 28.027  1.00 28.77  ? 93  SER A CA  1 
ATOM   754  C C   . SER A 1 96  ? -4.078  -21.067 27.489  1.00 30.56  ? 93  SER A C   1 
ATOM   755  O O   . SER A 1 96  ? -3.138  -20.369 27.112  1.00 31.79  ? 93  SER A O   1 
ATOM   756  C CB  . SER A 1 96  ? -3.693  -22.423 29.556  1.00 28.50  ? 93  SER A CB  1 
ATOM   757  O OG  . SER A 1 96  ? -4.840  -21.849 30.152  1.00 30.89  ? 93  SER A OG  1 
ATOM   758  N N   . GLU A 1 97  ? -5.338  -20.651 27.456  1.00 29.55  ? 94  GLU A N   1 
ATOM   759  C CA  . GLU A 1 97  ? -5.648  -19.256 27.177  1.00 26.70  ? 94  GLU A CA  1 
ATOM   760  C C   . GLU A 1 97  ? -5.222  -18.367 28.352  1.00 33.16  ? 94  GLU A C   1 
ATOM   761  O O   . GLU A 1 97  ? -4.982  -17.173 28.180  1.00 31.90  ? 94  GLU A O   1 
ATOM   762  C CB  . GLU A 1 97  ? -7.136  -19.083 26.884  1.00 30.86  ? 94  GLU A CB  1 
ATOM   763  C CG  . GLU A 1 97  ? -7.557  -19.644 25.523  1.00 31.68  ? 94  GLU A CG  1 
ATOM   764  C CD  . GLU A 1 97  ? -8.992  -19.317 25.195  1.00 32.69  ? 94  GLU A CD  1 
ATOM   765  O OE1 . GLU A 1 97  ? -9.249  -18.191 24.715  1.00 33.73  ? 94  GLU A OE1 1 
ATOM   766  O OE2 . GLU A 1 97  ? -9.864  -20.175 25.440  1.00 36.46  ? 94  GLU A OE2 1 
ATOM   767  N N   . ASP A 1 98  ? -5.139  -18.965 29.539  1.00 29.87  ? 95  ASP A N   1 
ATOM   768  C CA  . ASP A 1 98  ? -4.598  -18.301 30.729  1.00 30.77  ? 95  ASP A CA  1 
ATOM   769  C C   . ASP A 1 98  ? -3.079  -18.356 30.664  1.00 29.00  ? 95  ASP A C   1 
ATOM   770  O O   . ASP A 1 98  ? -2.466  -19.258 31.227  1.00 29.05  ? 95  ASP A O   1 
ATOM   771  C CB  . ASP A 1 98  ? -5.114  -18.990 31.996  1.00 29.73  ? 95  ASP A CB  1 
ATOM   772  C CG  . ASP A 1 98  ? -4.729  -18.261 33.284  1.00 34.29  ? 95  ASP A CG  1 
ATOM   773  O OD1 . ASP A 1 98  ? -3.840  -17.380 33.285  1.00 32.69  ? 95  ASP A OD1 1 
ATOM   774  O OD2 . ASP A 1 98  ? -5.335  -18.595 34.315  1.00 36.40  ? 95  ASP A OD2 1 
ATOM   775  N N   . CYS A 1 99  ? -2.467  -17.395 29.978  1.00 28.41  ? 96  CYS A N   1 
ATOM   776  C CA  . CYS A 1 99  ? -1.048  -17.510 29.660  1.00 27.62  ? 96  CYS A CA  1 
ATOM   777  C C   . CYS A 1 99  ? -0.269  -16.209 29.771  1.00 30.05  ? 96  CYS A C   1 
ATOM   778  O O   . CYS A 1 99  ? 0.924   -16.178 29.474  1.00 29.83  ? 96  CYS A O   1 
ATOM   779  C CB  . CYS A 1 99  ? -0.883  -18.057 28.241  1.00 28.66  ? 96  CYS A CB  1 
ATOM   780  S SG  . CYS A 1 99  ? -1.537  -16.947 26.962  1.00 32.41  ? 96  CYS A SG  1 
ATOM   781  N N   . LEU A 1 100 ? -0.921  -15.134 30.197  1.00 28.86  ? 97  LEU A N   1 
ATOM   782  C CA  . LEU A 1 100 ? -0.252  -13.838 30.191  1.00 27.64  ? 97  LEU A CA  1 
ATOM   783  C C   . LEU A 1 100 ? 0.615   -13.667 31.429  1.00 31.95  ? 97  LEU A C   1 
ATOM   784  O O   . LEU A 1 100 ? 0.223   -13.035 32.415  1.00 32.90  ? 97  LEU A O   1 
ATOM   785  C CB  . LEU A 1 100 ? -1.274  -12.705 30.061  1.00 27.11  ? 97  LEU A CB  1 
ATOM   786  C CG  . LEU A 1 100 ? -1.991  -12.714 28.704  1.00 32.34  ? 97  LEU A CG  1 
ATOM   787  C CD1 . LEU A 1 100 ? -2.902  -11.495 28.524  1.00 30.86  ? 97  LEU A CD1 1 
ATOM   788  C CD2 . LEU A 1 100 ? -0.986  -12.819 27.545  1.00 29.82  ? 97  LEU A CD2 1 
ATOM   789  N N   . TYR A 1 101 ? 1.810   -14.243 31.355  1.00 29.12  ? 98  TYR A N   1 
ATOM   790  C CA  . TYR A 1 101 ? 2.770   -14.204 32.446  1.00 31.08  ? 98  TYR A CA  1 
ATOM   791  C C   . TYR A 1 101 ? 4.125   -13.780 31.904  1.00 31.09  ? 98  TYR A C   1 
ATOM   792  O O   . TYR A 1 101 ? 4.411   -13.981 30.721  1.00 30.67  ? 98  TYR A O   1 
ATOM   793  C CB  . TYR A 1 101 ? 2.868   -15.573 33.123  1.00 29.15  ? 98  TYR A CB  1 
ATOM   794  C CG  . TYR A 1 101 ? 1.555   -16.068 33.688  1.00 33.03  ? 98  TYR A CG  1 
ATOM   795  C CD1 . TYR A 1 101 ? 0.644   -16.749 32.889  1.00 31.67  ? 98  TYR A CD1 1 
ATOM   796  C CD2 . TYR A 1 101 ? 1.228   -15.857 35.025  1.00 33.57  ? 98  TYR A CD2 1 
ATOM   797  C CE1 . TYR A 1 101 ? -0.559  -17.201 33.403  1.00 33.76  ? 98  TYR A CE1 1 
ATOM   798  C CE2 . TYR A 1 101 ? 0.031   -16.304 35.548  1.00 32.48  ? 98  TYR A CE2 1 
ATOM   799  C CZ  . TYR A 1 101 ? -0.859  -16.977 34.736  1.00 34.69  ? 98  TYR A CZ  1 
ATOM   800  O OH  . TYR A 1 101 ? -2.053  -17.421 35.257  1.00 33.13  ? 98  TYR A OH  1 
ATOM   801  N N   . LEU A 1 102 ? 4.959   -13.186 32.751  1.00 28.47  ? 99  LEU A N   1 
ATOM   802  C CA  . LEU A 1 102 ? 6.300   -12.812 32.323  1.00 28.16  ? 99  LEU A CA  1 
ATOM   803  C C   . LEU A 1 102 ? 7.359   -13.350 33.278  1.00 28.15  ? 99  LEU A C   1 
ATOM   804  O O   . LEU A 1 102 ? 7.049   -13.840 34.361  1.00 30.43  ? 99  LEU A O   1 
ATOM   805  C CB  . LEU A 1 102 ? 6.424   -11.286 32.170  1.00 28.58  ? 99  LEU A CB  1 
ATOM   806  C CG  . LEU A 1 102 ? 6.189   -10.299 33.327  1.00 30.39  ? 99  LEU A CG  1 
ATOM   807  C CD1 . LEU A 1 102 ? 7.370   -10.232 34.301  1.00 28.52  ? 99  LEU A CD1 1 
ATOM   808  C CD2 . LEU A 1 102 ? 5.879   -8.913  32.773  1.00 27.33  ? 99  LEU A CD2 1 
ATOM   809  N N   . ASN A 1 103 ? 8.613   -13.243 32.861  1.00 29.74  ? 100 ASN A N   1 
ATOM   810  C CA  . ASN A 1 103 ? 9.739   -13.820 33.573  1.00 30.12  ? 100 ASN A CA  1 
ATOM   811  C C   . ASN A 1 103 ? 10.852  -12.801 33.709  1.00 31.66  ? 100 ASN A C   1 
ATOM   812  O O   . ASN A 1 103 ? 11.072  -12.000 32.797  1.00 29.00  ? 100 ASN A O   1 
ATOM   813  C CB  . ASN A 1 103 ? 10.261  -15.059 32.842  1.00 29.21  ? 100 ASN A CB  1 
ATOM   814  C CG  . ASN A 1 103 ? 9.150   -15.974 32.387  1.00 31.64  ? 100 ASN A CG  1 
ATOM   815  O OD1 . ASN A 1 103 ? 8.453   -16.569 33.206  1.00 30.32  ? 100 ASN A OD1 1 
ATOM   816  N ND2 . ASN A 1 103 ? 8.980   -16.097 31.070  1.00 30.53  ? 100 ASN A ND2 1 
ATOM   817  N N   . VAL A 1 104 ? 11.551  -12.841 34.843  1.00 28.95  ? 101 VAL A N   1 
ATOM   818  C CA  . VAL A 1 104 ? 12.642  -11.914 35.129  1.00 26.96  ? 101 VAL A CA  1 
ATOM   819  C C   . VAL A 1 104 ? 13.886  -12.656 35.624  1.00 32.13  ? 101 VAL A C   1 
ATOM   820  O O   . VAL A 1 104 ? 13.822  -13.386 36.603  1.00 33.44  ? 101 VAL A O   1 
ATOM   821  C CB  . VAL A 1 104 ? 12.242  -10.870 36.214  1.00 30.92  ? 101 VAL A CB  1 
ATOM   822  C CG1 . VAL A 1 104 ? 13.361  -9.862  36.423  1.00 29.41  ? 101 VAL A CG1 1 
ATOM   823  C CG2 . VAL A 1 104 ? 10.937  -10.162 35.853  1.00 28.68  ? 101 VAL A CG2 1 
ATOM   824  N N   . TRP A 1 105 ? 15.019  -12.455 34.966  1.00 30.44  ? 102 TRP A N   1 
ATOM   825  C CA  . TRP A 1 105 ? 16.296  -12.963 35.456  1.00 31.65  ? 102 TRP A CA  1 
ATOM   826  C C   . TRP A 1 105 ? 17.159  -11.797 35.908  1.00 32.36  ? 102 TRP A C   1 
ATOM   827  O O   . TRP A 1 105 ? 17.238  -10.780 35.221  1.00 32.00  ? 102 TRP A O   1 
ATOM   828  C CB  . TRP A 1 105 ? 17.038  -13.757 34.377  1.00 32.68  ? 102 TRP A CB  1 
ATOM   829  C CG  . TRP A 1 105 ? 16.468  -15.102 34.074  1.00 32.27  ? 102 TRP A CG  1 
ATOM   830  C CD1 . TRP A 1 105 ? 16.794  -16.286 34.674  1.00 32.75  ? 102 TRP A CD1 1 
ATOM   831  C CD2 . TRP A 1 105 ? 15.485  -15.411 33.083  1.00 29.73  ? 102 TRP A CD2 1 
ATOM   832  N NE1 . TRP A 1 105 ? 16.066  -17.311 34.123  1.00 33.73  ? 102 TRP A NE1 1 
ATOM   833  C CE2 . TRP A 1 105 ? 15.258  -16.801 33.140  1.00 35.99  ? 102 TRP A CE2 1 
ATOM   834  C CE3 . TRP A 1 105 ? 14.776  -14.649 32.152  1.00 35.28  ? 102 TRP A CE3 1 
ATOM   835  C CZ2 . TRP A 1 105 ? 14.352  -17.446 32.297  1.00 34.80  ? 102 TRP A CZ2 1 
ATOM   836  C CZ3 . TRP A 1 105 ? 13.878  -15.292 31.311  1.00 36.36  ? 102 TRP A CZ3 1 
ATOM   837  C CH2 . TRP A 1 105 ? 13.673  -16.678 31.393  1.00 35.26  ? 102 TRP A CH2 1 
ATOM   838  N N   . THR A 1 106 ? 17.797  -11.934 37.067  1.00 32.63  ? 103 THR A N   1 
ATOM   839  C CA  . THR A 1 106 ? 18.744  -10.928 37.542  1.00 32.60  ? 103 THR A CA  1 
ATOM   840  C C   . THR A 1 106 ? 19.942  -11.636 38.161  1.00 33.43  ? 103 THR A C   1 
ATOM   841  O O   . THR A 1 106 ? 19.878  -12.831 38.411  1.00 31.65  ? 103 THR A O   1 
ATOM   842  C CB  . THR A 1 106 ? 18.120  -9.978  38.595  1.00 35.50  ? 103 THR A CB  1 
ATOM   843  O OG1 . THR A 1 106 ? 17.988  -10.672 39.840  1.00 34.03  ? 103 THR A OG1 1 
ATOM   844  C CG2 . THR A 1 106 ? 16.759  -9.455  38.150  1.00 31.28  ? 103 THR A CG2 1 
ATOM   845  N N   . PRO A 1 107 ? 21.046  -10.910 38.396  1.00 34.36  ? 104 PRO A N   1 
ATOM   846  C CA  . PRO A 1 107 ? 22.121  -11.493 39.208  1.00 35.71  ? 104 PRO A CA  1 
ATOM   847  C C   . PRO A 1 107 ? 21.638  -11.919 40.601  1.00 35.67  ? 104 PRO A C   1 
ATOM   848  O O   . PRO A 1 107 ? 20.588  -11.466 41.058  1.00 38.14  ? 104 PRO A O   1 
ATOM   849  C CB  . PRO A 1 107 ? 23.136  -10.354 39.309  1.00 36.96  ? 104 PRO A CB  1 
ATOM   850  C CG  . PRO A 1 107 ? 22.942  -9.584  38.028  1.00 34.16  ? 104 PRO A CG  1 
ATOM   851  C CD  . PRO A 1 107 ? 21.465  -9.659  37.734  1.00 33.25  ? 104 PRO A CD  1 
ATOM   852  N N   . TYR A 1 108 ? 22.390  -12.801 41.251  1.00 38.19  ? 105 TYR A N   1 
ATOM   853  C CA  . TYR A 1 108 ? 22.096  -13.202 42.627  1.00 38.40  ? 105 TYR A CA  1 
ATOM   854  C C   . TYR A 1 108 ? 23.315  -12.929 43.504  1.00 42.15  ? 105 TYR A C   1 
ATOM   855  O O   . TYR A 1 108 ? 24.381  -13.501 43.271  1.00 41.71  ? 105 TYR A O   1 
ATOM   856  C CB  . TYR A 1 108 ? 21.699  -14.682 42.698  1.00 36.23  ? 105 TYR A CB  1 
ATOM   857  C CG  . TYR A 1 108 ? 21.365  -15.180 44.096  1.00 36.80  ? 105 TYR A CG  1 
ATOM   858  C CD1 . TYR A 1 108 ? 22.364  -15.600 44.969  1.00 37.38  ? 105 TYR A CD1 1 
ATOM   859  C CD2 . TYR A 1 108 ? 20.048  -15.242 44.534  1.00 36.10  ? 105 TYR A CD2 1 
ATOM   860  C CE1 . TYR A 1 108 ? 22.059  -16.053 46.246  1.00 37.67  ? 105 TYR A CE1 1 
ATOM   861  C CE2 . TYR A 1 108 ? 19.733  -15.704 45.810  1.00 35.86  ? 105 TYR A CE2 1 
ATOM   862  C CZ  . TYR A 1 108 ? 20.743  -16.107 46.659  1.00 38.55  ? 105 TYR A CZ  1 
ATOM   863  O OH  . TYR A 1 108 ? 20.435  -16.566 47.928  1.00 36.80  ? 105 TYR A OH  1 
ATOM   864  N N   . PRO A 1 109 ? 23.175  -12.038 44.506  1.00 40.34  ? 106 PRO A N   1 
ATOM   865  C CA  . PRO A 1 109 ? 21.983  -11.237 44.817  1.00 40.05  ? 106 PRO A CA  1 
ATOM   866  C C   . PRO A 1 109 ? 21.678  -10.189 43.745  1.00 39.61  ? 106 PRO A C   1 
ATOM   867  O O   . PRO A 1 109 ? 22.520  -9.941  42.879  1.00 37.84  ? 106 PRO A O   1 
ATOM   868  C CB  . PRO A 1 109 ? 22.353  -10.561 46.143  1.00 44.29  ? 106 PRO A CB  1 
ATOM   869  C CG  . PRO A 1 109 ? 23.835  -10.486 46.117  1.00 43.13  ? 106 PRO A CG  1 
ATOM   870  C CD  . PRO A 1 109 ? 24.286  -11.746 45.429  1.00 38.93  ? 106 PRO A CD  1 
ATOM   871  N N   . ARG A 1 110 ? 20.488  -9.597  43.805  1.00 40.65  ? 107 ARG A N   1 
ATOM   872  C CA  . ARG A 1 110 ? 20.063  -8.611  42.815  1.00 38.89  ? 107 ARG A CA  1 
ATOM   873  C C   . ARG A 1 110 ? 21.031  -7.433  42.778  1.00 40.41  ? 107 ARG A C   1 
ATOM   874  O O   . ARG A 1 110 ? 21.710  -7.161  43.765  1.00 43.19  ? 107 ARG A O   1 
ATOM   875  C CB  . ARG A 1 110 ? 18.638  -8.130  43.113  1.00 38.59  ? 107 ARG A CB  1 
ATOM   876  C CG  . ARG A 1 110 ? 17.592  -9.225  43.013  1.00 34.16  ? 107 ARG A CG  1 
ATOM   877  C CD  . ARG A 1 110 ? 16.182  -8.662  43.054  1.00 35.66  ? 107 ARG A CD  1 
ATOM   878  N NE  . ARG A 1 110 ? 15.914  -7.897  44.271  1.00 38.91  ? 107 ARG A NE  1 
ATOM   879  C CZ  . ARG A 1 110 ? 15.612  -8.442  45.446  1.00 38.78  ? 107 ARG A CZ  1 
ATOM   880  N NH1 . ARG A 1 110 ? 15.554  -9.761  45.571  1.00 35.31  ? 107 ARG A NH1 1 
ATOM   881  N NH2 . ARG A 1 110 ? 15.378  -7.667  46.501  1.00 36.23  ? 107 ARG A NH2 1 
ATOM   882  N N   . PRO A 1 111 ? 21.119  -6.747  41.629  1.00 39.25  ? 108 PRO A N   1 
ATOM   883  C CA  . PRO A 1 111 ? 22.031  -5.604  41.487  1.00 40.49  ? 108 PRO A CA  1 
ATOM   884  C C   . PRO A 1 111 ? 21.791  -4.514  42.529  1.00 43.71  ? 108 PRO A C   1 
ATOM   885  O O   . PRO A 1 111 ? 20.651  -4.305  42.946  1.00 42.75  ? 108 PRO A O   1 
ATOM   886  C CB  . PRO A 1 111 ? 21.721  -5.084  40.084  1.00 40.06  ? 108 PRO A CB  1 
ATOM   887  C CG  . PRO A 1 111 ? 21.221  -6.273  39.348  1.00 40.19  ? 108 PRO A CG  1 
ATOM   888  C CD  . PRO A 1 111 ? 20.448  -7.076  40.358  1.00 37.73  ? 108 PRO A CD  1 
ATOM   889  N N   . ALA A 1 112 ? 22.859  -3.830  42.931  1.00 43.20  ? 109 ALA A N   1 
ATOM   890  C CA  . ALA A 1 112 ? 22.780  -2.788  43.952  1.00 50.96  ? 109 ALA A CA  1 
ATOM   891  C C   . ALA A 1 112 ? 22.391  -1.442  43.346  1.00 51.55  ? 109 ALA A C   1 
ATOM   892  O O   . ALA A 1 112 ? 21.706  -0.639  43.977  1.00 51.13  ? 109 ALA A O   1 
ATOM   893  C CB  . ALA A 1 112 ? 24.105  -2.673  44.689  1.00 48.97  ? 109 ALA A CB  1 
ATOM   894  N N   . SER A 1 113 ? 22.834  -1.202  42.117  1.00 45.29  ? 110 SER A N   1 
ATOM   895  C CA  . SER A 1 113 ? 22.526  0.034   41.413  1.00 45.29  ? 110 SER A CA  1 
ATOM   896  C C   . SER A 1 113 ? 21.691  -0.284  40.169  1.00 43.44  ? 110 SER A C   1 
ATOM   897  O O   . SER A 1 113 ? 21.729  -1.414  39.680  1.00 41.62  ? 110 SER A O   1 
ATOM   898  C CB  . SER A 1 113 ? 23.817  0.765   41.039  1.00 50.20  ? 110 SER A CB  1 
ATOM   899  O OG  . SER A 1 113 ? 24.642  -0.052  40.229  1.00 58.56  ? 110 SER A OG  1 
ATOM   900  N N   . PRO A 1 114 ? 20.921  0.701   39.668  1.00 41.24  ? 111 PRO A N   1 
ATOM   901  C CA  . PRO A 1 114 ? 20.069  0.494   38.487  1.00 39.95  ? 111 PRO A CA  1 
ATOM   902  C C   . PRO A 1 114 ? 20.820  -0.123  37.308  1.00 40.46  ? 111 PRO A C   1 
ATOM   903  O O   . PRO A 1 114 ? 21.874  0.378   36.921  1.00 42.15  ? 111 PRO A O   1 
ATOM   904  C CB  . PRO A 1 114 ? 19.593  1.908   38.152  1.00 38.96  ? 111 PRO A CB  1 
ATOM   905  C CG  . PRO A 1 114 ? 19.573  2.603   39.484  1.00 40.38  ? 111 PRO A CG  1 
ATOM   906  C CD  . PRO A 1 114 ? 20.749  2.051   40.238  1.00 38.61  ? 111 PRO A CD  1 
ATOM   907  N N   . THR A 1 115 ? 20.270  -1.202  36.758  1.00 37.02  ? 112 THR A N   1 
ATOM   908  C CA  . THR A 1 115 ? 20.934  -1.982  35.720  1.00 37.30  ? 112 THR A CA  1 
ATOM   909  C C   . THR A 1 115 ? 20.114  -2.016  34.427  1.00 37.14  ? 112 THR A C   1 
ATOM   910  O O   . THR A 1 115 ? 18.915  -2.273  34.471  1.00 35.17  ? 112 THR A O   1 
ATOM   911  C CB  . THR A 1 115 ? 21.171  -3.422  36.206  1.00 37.80  ? 112 THR A CB  1 
ATOM   912  O OG1 . THR A 1 115 ? 21.870  -3.389  37.458  1.00 41.19  ? 112 THR A OG1 1 
ATOM   913  C CG2 . THR A 1 115 ? 21.969  -4.222  35.193  1.00 35.10  ? 112 THR A CG2 1 
ATOM   914  N N   . PRO A 1 116 ? 20.760  -1.754  33.276  1.00 38.05  ? 113 PRO A N   1 
ATOM   915  C CA  . PRO A 1 116 ? 20.072  -1.804  31.978  1.00 36.76  ? 113 PRO A CA  1 
ATOM   916  C C   . PRO A 1 116 ? 19.215  -3.060  31.816  1.00 32.15  ? 113 PRO A C   1 
ATOM   917  O O   . PRO A 1 116 ? 19.639  -4.150  32.194  1.00 32.45  ? 113 PRO A O   1 
ATOM   918  C CB  . PRO A 1 116 ? 21.227  -1.786  30.978  1.00 35.76  ? 113 PRO A CB  1 
ATOM   919  C CG  . PRO A 1 116 ? 22.273  -0.976  31.669  1.00 42.08  ? 113 PRO A CG  1 
ATOM   920  C CD  . PRO A 1 116 ? 22.172  -1.354  33.130  1.00 36.33  ? 113 PRO A CD  1 
ATOM   921  N N   . VAL A 1 117 ? 18.006  -2.885  31.290  1.00 32.72  ? 114 VAL A N   1 
ATOM   922  C CA  . VAL A 1 117 ? 17.051  -3.975  31.148  1.00 29.46  ? 114 VAL A CA  1 
ATOM   923  C C   . VAL A 1 117 ? 16.937  -4.429  29.688  1.00 31.71  ? 114 VAL A C   1 
ATOM   924  O O   . VAL A 1 117 ? 16.771  -3.604  28.794  1.00 30.38  ? 114 VAL A O   1 
ATOM   925  C CB  . VAL A 1 117 ? 15.653  -3.555  31.661  1.00 29.52  ? 114 VAL A CB  1 
ATOM   926  C CG1 . VAL A 1 117 ? 14.643  -4.663  31.430  1.00 26.59  ? 114 VAL A CG1 1 
ATOM   927  C CG2 . VAL A 1 117 ? 15.712  -3.162  33.168  1.00 29.40  ? 114 VAL A CG2 1 
ATOM   928  N N   . LEU A 1 118 ? 17.036  -5.737  29.457  1.00 31.16  ? 115 LEU A N   1 
ATOM   929  C CA  . LEU A 1 118 ? 16.756  -6.306  28.137  1.00 32.23  ? 115 LEU A CA  1 
ATOM   930  C C   . LEU A 1 118 ? 15.399  -6.978  28.174  1.00 28.90  ? 115 LEU A C   1 
ATOM   931  O O   . LEU A 1 118 ? 15.132  -7.767  29.070  1.00 32.32  ? 115 LEU A O   1 
ATOM   932  C CB  . LEU A 1 118 ? 17.831  -7.317  27.729  1.00 34.06  ? 115 LEU A CB  1 
ATOM   933  C CG  . LEU A 1 118 ? 19.190  -6.786  27.273  1.00 37.37  ? 115 LEU A CG  1 
ATOM   934  C CD1 . LEU A 1 118 ? 20.210  -7.903  27.222  1.00 41.28  ? 115 LEU A CD1 1 
ATOM   935  C CD2 . LEU A 1 118 ? 19.044  -6.176  25.906  1.00 37.83  ? 115 LEU A CD2 1 
ATOM   936  N N   . ILE A 1 119 ? 14.529  -6.653  27.227  1.00 29.09  ? 116 ILE A N   1 
ATOM   937  C CA  . ILE A 1 119 ? 13.234  -7.324  27.149  1.00 27.78  ? 116 ILE A CA  1 
ATOM   938  C C   . ILE A 1 119 ? 13.113  -8.144  25.863  1.00 29.73  ? 116 ILE A C   1 
ATOM   939  O O   . ILE A 1 119 ? 13.124  -7.590  24.765  1.00 28.48  ? 116 ILE A O   1 
ATOM   940  C CB  . ILE A 1 119 ? 12.070  -6.331  27.213  1.00 28.08  ? 116 ILE A CB  1 
ATOM   941  C CG1 . ILE A 1 119 ? 12.105  -5.539  28.526  1.00 30.65  ? 116 ILE A CG1 1 
ATOM   942  C CG2 . ILE A 1 119 ? 10.750  -7.069  27.084  1.00 27.81  ? 116 ILE A CG2 1 
ATOM   943  C CD1 . ILE A 1 119 ? 10.974  -4.542  28.647  1.00 26.49  ? 116 ILE A CD1 1 
ATOM   944  N N   . TRP A 1 120 ? 12.990  -9.461  26.015  1.00 29.63  ? 117 TRP A N   1 
ATOM   945  C CA  . TRP A 1 120 ? 12.890  -10.391 24.888  1.00 30.16  ? 117 TRP A CA  1 
ATOM   946  C C   . TRP A 1 120 ? 11.453  -10.594 24.425  1.00 32.20  ? 117 TRP A C   1 
ATOM   947  O O   . TRP A 1 120 ? 10.560  -10.855 25.234  1.00 27.95  ? 117 TRP A O   1 
ATOM   948  C CB  . TRP A 1 120 ? 13.492  -11.751 25.258  1.00 27.37  ? 117 TRP A CB  1 
ATOM   949  C CG  . TRP A 1 120 ? 13.336  -12.792 24.175  1.00 29.67  ? 117 TRP A CG  1 
ATOM   950  C CD1 . TRP A 1 120 ? 12.513  -13.886 24.193  1.00 27.37  ? 117 TRP A CD1 1 
ATOM   951  C CD2 . TRP A 1 120 ? 14.017  -12.824 22.914  1.00 26.97  ? 117 TRP A CD2 1 
ATOM   952  N NE1 . TRP A 1 120 ? 12.651  -14.601 23.023  1.00 27.00  ? 117 TRP A NE1 1 
ATOM   953  C CE2 . TRP A 1 120 ? 13.568  -13.971 22.223  1.00 28.13  ? 117 TRP A CE2 1 
ATOM   954  C CE3 . TRP A 1 120 ? 14.971  -12.002 22.308  1.00 28.79  ? 117 TRP A CE3 1 
ATOM   955  C CZ2 . TRP A 1 120 ? 14.031  -14.309 20.946  1.00 27.05  ? 117 TRP A CZ2 1 
ATOM   956  C CZ3 . TRP A 1 120 ? 15.435  -12.347 21.027  1.00 28.95  ? 117 TRP A CZ3 1 
ATOM   957  C CH2 . TRP A 1 120 ? 14.963  -13.491 20.372  1.00 25.37  ? 117 TRP A CH2 1 
ATOM   958  N N   . ILE A 1 121 ? 11.241  -10.484 23.116  1.00 27.63  ? 118 ILE A N   1 
ATOM   959  C CA  . ILE A 1 121 ? 9.955   -10.795 22.509  1.00 27.98  ? 118 ILE A CA  1 
ATOM   960  C C   . ILE A 1 121 ? 10.148  -11.922 21.494  1.00 29.69  ? 118 ILE A C   1 
ATOM   961  O O   . ILE A 1 121 ? 10.809  -11.725 20.476  1.00 26.72  ? 118 ILE A O   1 
ATOM   962  C CB  . ILE A 1 121 ? 9.352   -9.565  21.806  1.00 33.63  ? 118 ILE A CB  1 
ATOM   963  C CG1 . ILE A 1 121 ? 9.183   -8.414  22.807  1.00 31.06  ? 118 ILE A CG1 1 
ATOM   964  C CG2 . ILE A 1 121 ? 8.040   -9.925  21.111  1.00 29.39  ? 118 ILE A CG2 1 
ATOM   965  C CD1 . ILE A 1 121 ? 8.629   -7.152  22.189  1.00 30.28  ? 118 ILE A CD1 1 
ATOM   966  N N   . TYR A 1 122 ? 9.586   -13.098 21.773  1.00 26.27  ? 119 TYR A N   1 
ATOM   967  C CA  . TYR A 1 122 ? 9.835   -14.268 20.930  1.00 29.65  ? 119 TYR A CA  1 
ATOM   968  C C   . TYR A 1 122 ? 9.128   -14.172 19.591  1.00 27.66  ? 119 TYR A C   1 
ATOM   969  O O   . TYR A 1 122 ? 8.138   -13.451 19.443  1.00 25.92  ? 119 TYR A O   1 
ATOM   970  C CB  . TYR A 1 122 ? 9.410   -15.570 21.627  1.00 27.52  ? 119 TYR A CB  1 
ATOM   971  C CG  . TYR A 1 122 ? 7.966   -15.627 22.084  1.00 28.08  ? 119 TYR A CG  1 
ATOM   972  C CD1 . TYR A 1 122 ? 6.926   -15.848 21.181  1.00 29.06  ? 119 TYR A CD1 1 
ATOM   973  C CD2 . TYR A 1 122 ? 7.647   -15.498 23.431  1.00 27.35  ? 119 TYR A CD2 1 
ATOM   974  C CE1 . TYR A 1 122 ? 5.608   -15.907 21.608  1.00 27.62  ? 119 TYR A CE1 1 
ATOM   975  C CE2 . TYR A 1 122 ? 6.339   -15.555 23.865  1.00 27.73  ? 119 TYR A CE2 1 
ATOM   976  C CZ  . TYR A 1 122 ? 5.324   -15.758 22.959  1.00 29.49  ? 119 TYR A CZ  1 
ATOM   977  O OH  . TYR A 1 122 ? 4.023   -15.816 23.411  1.00 27.28  ? 119 TYR A OH  1 
ATOM   978  N N   . GLY A 1 123 ? 9.644   -14.921 18.622  1.00 26.72  ? 120 GLY A N   1 
ATOM   979  C CA  . GLY A 1 123 ? 9.019   -15.034 17.318  1.00 30.14  ? 120 GLY A CA  1 
ATOM   980  C C   . GLY A 1 123 ? 8.256   -16.337 17.216  1.00 32.67  ? 120 GLY A C   1 
ATOM   981  O O   . GLY A 1 123 ? 7.982   -16.984 18.227  1.00 31.15  ? 120 GLY A O   1 
ATOM   982  N N   . GLY A 1 124 ? 7.929   -16.737 15.993  1.00 29.81  ? 121 GLY A N   1 
ATOM   983  C CA  . GLY A 1 124 ? 7.095   -17.904 15.780  1.00 29.27  ? 121 GLY A CA  1 
ATOM   984  C C   . GLY A 1 124 ? 5.908   -17.580 14.900  1.00 31.45  ? 121 GLY A C   1 
ATOM   985  O O   . GLY A 1 124 ? 4.836   -18.173 15.040  1.00 31.79  ? 121 GLY A O   1 
ATOM   986  N N   . GLY A 1 125 ? 6.105   -16.623 13.997  1.00 30.61  ? 122 GLY A N   1 
ATOM   987  C CA  . GLY A 1 125 ? 5.139   -16.314 12.954  1.00 30.49  ? 122 GLY A CA  1 
ATOM   988  C C   . GLY A 1 125 ? 3.803   -15.775 13.426  1.00 32.90  ? 122 GLY A C   1 
ATOM   989  O O   . GLY A 1 125 ? 2.822   -15.821 12.687  1.00 28.87  ? 122 GLY A O   1 
ATOM   990  N N   . PHE A 1 126 ? 3.773   -15.265 14.658  1.00 28.57  ? 123 PHE A N   1 
ATOM   991  C CA  . PHE A 1 126 ? 2.556   -14.761 15.305  1.00 28.44  ? 123 PHE A CA  1 
ATOM   992  C C   . PHE A 1 126 ? 1.505   -15.843 15.537  1.00 28.31  ? 123 PHE A C   1 
ATOM   993  O O   . PHE A 1 126 ? 0.373   -15.538 15.910  1.00 28.52  ? 123 PHE A O   1 
ATOM   994  C CB  . PHE A 1 126 ? 1.928   -13.614 14.504  1.00 25.25  ? 123 PHE A CB  1 
ATOM   995  C CG  . PHE A 1 126 ? 2.740   -12.352 14.505  1.00 30.78  ? 123 PHE A CG  1 
ATOM   996  C CD1 . PHE A 1 126 ? 2.908   -11.623 15.675  1.00 29.49  ? 123 PHE A CD1 1 
ATOM   997  C CD2 . PHE A 1 126 ? 3.321   -11.882 13.338  1.00 27.21  ? 123 PHE A CD2 1 
ATOM   998  C CE1 . PHE A 1 126 ? 3.648   -10.453 15.681  1.00 30.04  ? 123 PHE A CE1 1 
ATOM   999  C CE2 . PHE A 1 126 ? 4.064   -10.712 13.335  1.00 30.61  ? 123 PHE A CE2 1 
ATOM   1000 C CZ  . PHE A 1 126 ? 4.226   -9.994  14.510  1.00 28.13  ? 123 PHE A CZ  1 
ATOM   1001 N N   . TYR A 1 127 ? 1.873   -17.102 15.328  1.00 31.72  ? 124 TYR A N   1 
ATOM   1002 C CA  . TYR A 1 127 ? 0.953   -18.201 15.595  1.00 33.42  ? 124 TYR A CA  1 
ATOM   1003 C C   . TYR A 1 127 ? 1.509   -19.156 16.656  1.00 30.26  ? 124 TYR A C   1 
ATOM   1004 O O   . TYR A 1 127 ? 0.839   -20.110 17.042  1.00 30.85  ? 124 TYR A O   1 
ATOM   1005 C CB  . TYR A 1 127 ? 0.633   -18.972 14.301  1.00 31.32  ? 124 TYR A CB  1 
ATOM   1006 C CG  . TYR A 1 127 ? 1.800   -19.758 13.746  1.00 33.87  ? 124 TYR A CG  1 
ATOM   1007 C CD1 . TYR A 1 127 ? 2.070   -21.051 14.190  1.00 37.29  ? 124 TYR A CD1 1 
ATOM   1008 C CD2 . TYR A 1 127 ? 2.636   -19.209 12.780  1.00 34.63  ? 124 TYR A CD2 1 
ATOM   1009 C CE1 . TYR A 1 127 ? 3.143   -21.768 13.693  1.00 39.23  ? 124 TYR A CE1 1 
ATOM   1010 C CE2 . TYR A 1 127 ? 3.708   -19.922 12.275  1.00 38.91  ? 124 TYR A CE2 1 
ATOM   1011 C CZ  . TYR A 1 127 ? 3.956   -21.201 12.736  1.00 42.24  ? 124 TYR A CZ  1 
ATOM   1012 O OH  . TYR A 1 127 ? 5.021   -21.914 12.237  1.00 47.92  ? 124 TYR A OH  1 
ATOM   1013 N N   . SER A 1 128 ? 2.732   -18.909 17.117  1.00 31.40  ? 125 SER A N   1 
ATOM   1014 C CA  . SER A 1 128 ? 3.376   -19.818 18.070  1.00 31.87  ? 125 SER A CA  1 
ATOM   1015 C C   . SER A 1 128 ? 4.476   -19.139 18.882  1.00 29.57  ? 125 SER A C   1 
ATOM   1016 O O   . SER A 1 128 ? 4.824   -17.986 18.636  1.00 29.64  ? 125 SER A O   1 
ATOM   1017 C CB  . SER A 1 128 ? 3.967   -21.028 17.334  1.00 35.21  ? 125 SER A CB  1 
ATOM   1018 O OG  . SER A 1 128 ? 5.036   -20.638 16.490  1.00 32.94  ? 125 SER A OG  1 
ATOM   1019 N N   . GLY A 1 129 ? 5.029   -19.870 19.845  1.00 27.24  ? 126 GLY A N   1 
ATOM   1020 C CA  . GLY A 1 129 ? 6.144   -19.374 20.624  1.00 28.87  ? 126 GLY A CA  1 
ATOM   1021 C C   . GLY A 1 129 ? 5.849   -19.316 22.112  1.00 28.72  ? 126 GLY A C   1 
ATOM   1022 O O   . GLY A 1 129 ? 4.695   -19.402 22.537  1.00 28.79  ? 126 GLY A O   1 
ATOM   1023 N N   . ALA A 1 130 ? 6.904   -19.182 22.904  1.00 26.76  ? 127 ALA A N   1 
ATOM   1024 C CA  . ALA A 1 130 ? 6.774   -19.093 24.358  1.00 30.24  ? 127 ALA A CA  1 
ATOM   1025 C C   . ALA A 1 130 ? 8.031   -18.477 24.953  1.00 29.44  ? 127 ALA A C   1 
ATOM   1026 O O   . ALA A 1 130 ? 9.122   -18.636 24.411  1.00 29.01  ? 127 ALA A O   1 
ATOM   1027 C CB  . ALA A 1 130 ? 6.514   -20.468 24.960  1.00 30.55  ? 127 ALA A CB  1 
ATOM   1028 N N   . ALA A 1 131 ? 7.874   -17.762 26.062  1.00 31.87  ? 128 ALA A N   1 
ATOM   1029 C CA  . ALA A 1 131 ? 9.010   -17.146 26.729  1.00 31.71  ? 128 ALA A CA  1 
ATOM   1030 C C   . ALA A 1 131 ? 9.774   -18.182 27.545  1.00 32.10  ? 128 ALA A C   1 
ATOM   1031 O O   . ALA A 1 131 ? 10.882  -17.924 28.009  1.00 32.44  ? 128 ALA A O   1 
ATOM   1032 C CB  . ALA A 1 131 ? 8.548   -15.999 27.624  1.00 30.46  ? 128 ALA A CB  1 
ATOM   1033 N N   . SER A 1 132 ? 9.179   -19.359 27.703  1.00 31.33  ? 129 SER A N   1 
ATOM   1034 C CA  . SER A 1 132 ? 9.746   -20.400 28.556  1.00 34.01  ? 129 SER A CA  1 
ATOM   1035 C C   . SER A 1 132 ? 10.661  -21.379 27.825  1.00 34.01  ? 129 SER A C   1 
ATOM   1036 O O   . SER A 1 132 ? 11.191  -22.297 28.445  1.00 33.80  ? 129 SER A O   1 
ATOM   1037 C CB  . SER A 1 132 ? 8.621   -21.183 29.238  1.00 34.95  ? 129 SER A CB  1 
ATOM   1038 O OG  . SER A 1 132 ? 7.759   -21.770 28.277  1.00 32.57  ? 129 SER A OG  1 
ATOM   1039 N N   . LEU A 1 133 ? 10.843  -21.196 26.516  1.00 30.87  ? 130 LEU A N   1 
ATOM   1040 C CA  . LEU A 1 133 ? 11.705  -22.090 25.745  1.00 33.07  ? 130 LEU A CA  1 
ATOM   1041 C C   . LEU A 1 133 ? 13.139  -22.040 26.260  1.00 34.33  ? 130 LEU A C   1 
ATOM   1042 O O   . LEU A 1 133 ? 13.615  -20.985 26.685  1.00 31.31  ? 130 LEU A O   1 
ATOM   1043 C CB  . LEU A 1 133 ? 11.673  -21.733 24.249  1.00 27.41  ? 130 LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 133 ? 10.299  -21.811 23.577  1.00 29.74  ? 130 LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 133 ? 10.415  -21.728 22.050  1.00 27.09  ? 130 LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 133 ? 9.563   -23.078 24.004  1.00 33.35  ? 130 LEU A CD2 1 
ATOM   1047 N N   . ASP A 1 134 ? 13.821  -23.183 26.216  1.00 35.23  ? 131 ASP A N   1 
ATOM   1048 C CA  . ASP A 1 134 ? 15.203  -23.284 26.684  1.00 33.98  ? 131 ASP A CA  1 
ATOM   1049 C C   . ASP A 1 134 ? 16.134  -22.321 25.954  1.00 35.68  ? 131 ASP A C   1 
ATOM   1050 O O   . ASP A 1 134 ? 17.105  -21.830 26.527  1.00 33.16  ? 131 ASP A O   1 
ATOM   1051 C CB  . ASP A 1 134 ? 15.729  -24.713 26.516  1.00 38.70  ? 131 ASP A CB  1 
ATOM   1052 C CG  . ASP A 1 134 ? 15.146  -25.683 27.528  1.00 43.95  ? 131 ASP A CG  1 
ATOM   1053 O OD1 . ASP A 1 134 ? 14.463  -25.242 28.481  1.00 43.66  ? 131 ASP A OD1 1 
ATOM   1054 O OD2 . ASP A 1 134 ? 15.388  -26.900 27.374  1.00 51.31  ? 131 ASP A OD2 1 
ATOM   1055 N N   . VAL A 1 135 ? 15.837  -22.056 24.685  1.00 32.32  ? 132 VAL A N   1 
ATOM   1056 C CA  . VAL A 1 135 ? 16.699  -21.223 23.857  1.00 32.80  ? 132 VAL A CA  1 
ATOM   1057 C C   . VAL A 1 135 ? 16.615  -19.745 24.270  1.00 33.74  ? 132 VAL A C   1 
ATOM   1058 O O   . VAL A 1 135 ? 17.479  -18.944 23.907  1.00 33.17  ? 132 VAL A O   1 
ATOM   1059 C CB  . VAL A 1 135 ? 16.349  -21.410 22.343  1.00 38.00  ? 132 VAL A CB  1 
ATOM   1060 C CG1 . VAL A 1 135 ? 14.912  -21.005 22.055  1.00 33.52  ? 132 VAL A CG1 1 
ATOM   1061 C CG2 . VAL A 1 135 ? 17.318  -20.657 21.446  1.00 35.37  ? 132 VAL A CG2 1 
ATOM   1062 N N   . TYR A 1 136 ? 15.602  -19.398 25.066  1.00 34.36  ? 133 TYR A N   1 
ATOM   1063 C CA  . TYR A 1 136 ? 15.441  -18.032 25.577  1.00 29.30  ? 133 TYR A CA  1 
ATOM   1064 C C   . TYR A 1 136 ? 15.801  -17.924 27.069  1.00 32.08  ? 133 TYR A C   1 
ATOM   1065 O O   . TYR A 1 136 ? 15.353  -17.008 27.755  1.00 30.50  ? 133 TYR A O   1 
ATOM   1066 C CB  . TYR A 1 136 ? 14.001  -17.538 25.369  1.00 28.64  ? 133 TYR A CB  1 
ATOM   1067 C CG  . TYR A 1 136 ? 13.449  -17.735 23.964  1.00 32.18  ? 133 TYR A CG  1 
ATOM   1068 C CD1 . TYR A 1 136 ? 14.255  -17.571 22.845  1.00 29.47  ? 133 TYR A CD1 1 
ATOM   1069 C CD2 . TYR A 1 136 ? 12.119  -18.090 23.764  1.00 31.29  ? 133 TYR A CD2 1 
ATOM   1070 C CE1 . TYR A 1 136 ? 13.748  -17.751 21.556  1.00 30.79  ? 133 TYR A CE1 1 
ATOM   1071 C CE2 . TYR A 1 136 ? 11.607  -18.278 22.482  1.00 29.79  ? 133 TYR A CE2 1 
ATOM   1072 C CZ  . TYR A 1 136 ? 12.425  -18.106 21.386  1.00 28.66  ? 133 TYR A CZ  1 
ATOM   1073 O OH  . TYR A 1 136 ? 11.914  -18.294 20.116  1.00 30.66  ? 133 TYR A OH  1 
ATOM   1074 N N   . ASP A 1 137 ? 16.615  -18.854 27.559  1.00 30.68  ? 134 ASP A N   1 
ATOM   1075 C CA  . ASP A 1 137 ? 16.990  -18.888 28.973  1.00 34.98  ? 134 ASP A CA  1 
ATOM   1076 C C   . ASP A 1 137 ? 17.843  -17.673 29.356  1.00 34.38  ? 134 ASP A C   1 
ATOM   1077 O O   . ASP A 1 137 ? 18.969  -17.515 28.882  1.00 33.31  ? 134 ASP A O   1 
ATOM   1078 C CB  . ASP A 1 137 ? 17.738  -20.188 29.281  1.00 31.79  ? 134 ASP A CB  1 
ATOM   1079 C CG  . ASP A 1 137 ? 17.914  -20.436 30.775  1.00 38.76  ? 134 ASP A CG  1 
ATOM   1080 O OD1 . ASP A 1 137 ? 17.810  -19.482 31.571  1.00 36.55  ? 134 ASP A OD1 1 
ATOM   1081 O OD2 . ASP A 1 137 ? 18.168  -21.599 31.148  1.00 42.30  ? 134 ASP A OD2 1 
ATOM   1082 N N   . GLY A 1 138 ? 17.308  -16.827 30.229  1.00 32.85  ? 135 GLY A N   1 
ATOM   1083 C CA  . GLY A 1 138 ? 17.987  -15.596 30.592  1.00 32.56  ? 135 GLY A CA  1 
ATOM   1084 C C   . GLY A 1 138 ? 19.132  -15.714 31.584  1.00 30.19  ? 135 GLY A C   1 
ATOM   1085 O O   . GLY A 1 138 ? 19.766  -14.709 31.908  1.00 30.76  ? 135 GLY A O   1 
ATOM   1086 N N   . ARG A 1 139 ? 19.421  -16.923 32.058  1.00 31.92  ? 136 ARG A N   1 
ATOM   1087 C CA  . ARG A 1 139 ? 20.345  -17.075 33.194  1.00 34.72  ? 136 ARG A CA  1 
ATOM   1088 C C   . ARG A 1 139 ? 21.794  -16.736 32.832  1.00 35.62  ? 136 ARG A C   1 
ATOM   1089 O O   . ARG A 1 139 ? 22.551  -16.264 33.678  1.00 33.74  ? 136 ARG A O   1 
ATOM   1090 C CB  . ARG A 1 139 ? 20.262  -18.496 33.776  1.00 34.67  ? 136 ARG A CB  1 
ATOM   1091 C CG  . ARG A 1 139 ? 20.994  -19.578 32.991  1.00 37.93  ? 136 ARG A CG  1 
ATOM   1092 C CD  . ARG A 1 139 ? 20.825  -20.942 33.650  1.00 37.69  ? 136 ARG A CD  1 
ATOM   1093 N NE  . ARG A 1 139 ? 19.428  -21.370 33.646  1.00 38.38  ? 136 ARG A NE  1 
ATOM   1094 C CZ  . ARG A 1 139 ? 18.928  -22.305 34.448  1.00 45.40  ? 136 ARG A CZ  1 
ATOM   1095 N NH1 . ARG A 1 139 ? 17.641  -22.622 34.375  1.00 44.86  ? 136 ARG A NH1 1 
ATOM   1096 N NH2 . ARG A 1 139 ? 19.709  -22.915 35.331  1.00 43.37  ? 136 ARG A NH2 1 
ATOM   1097 N N   . PHE A 1 140 ? 22.173  -16.944 31.572  1.00 33.61  ? 137 PHE A N   1 
ATOM   1098 C CA  . PHE A 1 140 ? 23.556  -16.721 31.158  1.00 33.12  ? 137 PHE A CA  1 
ATOM   1099 C C   . PHE A 1 140 ? 23.869  -15.235 31.019  1.00 34.70  ? 137 PHE A C   1 
ATOM   1100 O O   . PHE A 1 140 ? 24.919  -14.774 31.465  1.00 38.65  ? 137 PHE A O   1 
ATOM   1101 C CB  . PHE A 1 140 ? 23.848  -17.459 29.846  1.00 33.57  ? 137 PHE A CB  1 
ATOM   1102 C CG  . PHE A 1 140 ? 23.492  -18.914 29.894  1.00 33.17  ? 137 PHE A CG  1 
ATOM   1103 C CD1 . PHE A 1 140 ? 24.335  -19.828 30.505  1.00 35.81  ? 137 PHE A CD1 1 
ATOM   1104 C CD2 . PHE A 1 140 ? 22.300  -19.365 29.354  1.00 33.74  ? 137 PHE A CD2 1 
ATOM   1105 C CE1 . PHE A 1 140 ? 23.999  -21.168 30.568  1.00 38.72  ? 137 PHE A CE1 1 
ATOM   1106 C CE2 . PHE A 1 140 ? 21.960  -20.701 29.407  1.00 36.20  ? 137 PHE A CE2 1 
ATOM   1107 C CZ  . PHE A 1 140 ? 22.810  -21.605 30.019  1.00 39.78  ? 137 PHE A CZ  1 
ATOM   1108 N N   . LEU A 1 141 ? 22.962  -14.487 30.402  1.00 32.53  ? 138 LEU A N   1 
ATOM   1109 C CA  . LEU A 1 141 ? 23.128  -13.041 30.293  1.00 32.23  ? 138 LEU A CA  1 
ATOM   1110 C C   . LEU A 1 141 ? 23.104  -12.399 31.681  1.00 32.07  ? 138 LEU A C   1 
ATOM   1111 O O   . LEU A 1 141 ? 23.885  -11.491 31.969  1.00 33.46  ? 138 LEU A O   1 
ATOM   1112 C CB  . LEU A 1 141 ? 22.040  -12.441 29.402  1.00 28.99  ? 138 LEU A CB  1 
ATOM   1113 C CG  . LEU A 1 141 ? 22.214  -12.706 27.897  1.00 30.69  ? 138 LEU A CG  1 
ATOM   1114 C CD1 . LEU A 1 141 ? 20.883  -12.610 27.171  1.00 29.77  ? 138 LEU A CD1 1 
ATOM   1115 C CD2 . LEU A 1 141 ? 23.212  -11.729 27.293  1.00 30.09  ? 138 LEU A CD2 1 
ATOM   1116 N N   . ALA A 1 142 ? 22.210  -12.886 32.536  1.00 31.64  ? 139 ALA A N   1 
ATOM   1117 C CA  . ALA A 1 142 ? 22.118  -12.384 33.909  1.00 36.15  ? 139 ALA A CA  1 
ATOM   1118 C C   . ALA A 1 142 ? 23.410  -12.628 34.684  1.00 34.89  ? 139 ALA A C   1 
ATOM   1119 O O   . ALA A 1 142 ? 23.954  -11.708 35.288  1.00 39.06  ? 139 ALA A O   1 
ATOM   1120 C CB  . ALA A 1 142 ? 20.942  -13.023 34.633  1.00 33.80  ? 139 ALA A CB  1 
ATOM   1121 N N   . GLN A 1 143 ? 23.907  -13.861 34.659  1.00 34.40  ? 140 GLN A N   1 
ATOM   1122 C CA  . GLN A 1 143 ? 25.091  -14.202 35.444  1.00 36.40  ? 140 GLN A CA  1 
ATOM   1123 C C   . GLN A 1 143 ? 26.348  -13.545 34.893  1.00 38.85  ? 140 GLN A C   1 
ATOM   1124 O O   . GLN A 1 143 ? 27.087  -12.892 35.630  1.00 37.07  ? 140 GLN A O   1 
ATOM   1125 C CB  . GLN A 1 143 ? 25.286  -15.719 35.503  1.00 37.91  ? 140 GLN A CB  1 
ATOM   1126 C CG  . GLN A 1 143 ? 26.067  -16.207 36.729  1.00 39.34  ? 140 GLN A CG  1 
ATOM   1127 C CD  . GLN A 1 143 ? 27.553  -15.905 36.647  1.00 41.93  ? 140 GLN A CD  1 
ATOM   1128 O OE1 . GLN A 1 143 ? 28.173  -16.064 35.596  1.00 41.43  ? 140 GLN A OE1 1 
ATOM   1129 N NE2 . GLN A 1 143 ? 28.130  -15.457 37.756  1.00 39.04  ? 140 GLN A NE2 1 
ATOM   1130 N N   . VAL A 1 144 ? 26.581  -13.713 33.594  1.00 37.54  ? 141 VAL A N   1 
ATOM   1131 C CA  . VAL A 1 144 ? 27.825  -13.273 32.972  1.00 36.97  ? 141 VAL A CA  1 
ATOM   1132 C C   . VAL A 1 144 ? 27.873  -11.765 32.745  1.00 39.20  ? 141 VAL A C   1 
ATOM   1133 O O   . VAL A 1 144 ? 28.895  -11.130 33.005  1.00 41.66  ? 141 VAL A O   1 
ATOM   1134 C CB  . VAL A 1 144 ? 28.055  -13.993 31.618  1.00 39.41  ? 141 VAL A CB  1 
ATOM   1135 C CG1 . VAL A 1 144 ? 29.331  -13.502 30.954  1.00 38.51  ? 141 VAL A CG1 1 
ATOM   1136 C CG2 . VAL A 1 144 ? 28.113  -15.495 31.828  1.00 38.25  ? 141 VAL A CG2 1 
ATOM   1137 N N   . GLU A 1 145 ? 26.778  -11.184 32.259  1.00 37.80  ? 142 GLU A N   1 
ATOM   1138 C CA  . GLU A 1 145 ? 26.788  -9.762  31.939  1.00 33.90  ? 142 GLU A CA  1 
ATOM   1139 C C   . GLU A 1 145 ? 26.150  -8.894  33.015  1.00 34.75  ? 142 GLU A C   1 
ATOM   1140 O O   . GLU A 1 145 ? 26.212  -7.668  32.941  1.00 36.12  ? 142 GLU A O   1 
ATOM   1141 C CB  . GLU A 1 145 ? 26.087  -9.513  30.603  1.00 38.80  ? 142 GLU A CB  1 
ATOM   1142 C CG  . GLU A 1 145 ? 26.735  -10.227 29.424  1.00 36.76  ? 142 GLU A CG  1 
ATOM   1143 C CD  . GLU A 1 145 ? 28.181  -9.819  29.225  1.00 43.50  ? 142 GLU A CD  1 
ATOM   1144 O OE1 . GLU A 1 145 ? 28.549  -8.685  29.606  1.00 45.24  ? 142 GLU A OE1 1 
ATOM   1145 O OE2 . GLU A 1 145 ? 28.955  -10.639 28.694  1.00 50.73  ? 142 GLU A OE2 1 
ATOM   1146 N N   . GLY A 1 146 ? 25.534  -9.523  34.011  1.00 36.71  ? 143 GLY A N   1 
ATOM   1147 C CA  . GLY A 1 146 ? 24.890  -8.778  35.078  1.00 34.49  ? 143 GLY A CA  1 
ATOM   1148 C C   . GLY A 1 146 ? 23.589  -8.148  34.621  1.00 37.69  ? 143 GLY A C   1 
ATOM   1149 O O   . GLY A 1 146 ? 23.064  -7.248  35.264  1.00 36.69  ? 143 GLY A O   1 
ATOM   1150 N N   . ALA A 1 147 ? 23.057  -8.630  33.502  1.00 33.69  ? 144 ALA A N   1 
ATOM   1151 C CA  . ALA A 1 147 ? 21.853  -8.045  32.933  1.00 31.40  ? 144 ALA A CA  1 
ATOM   1152 C C   . ALA A 1 147 ? 20.601  -8.369  33.741  1.00 31.29  ? 144 ALA A C   1 
ATOM   1153 O O   . ALA A 1 147 ? 20.525  -9.400  34.412  1.00 34.99  ? 144 ALA A O   1 
ATOM   1154 C CB  . ALA A 1 147 ? 21.676  -8.515  31.479  1.00 34.98  ? 144 ALA A CB  1 
ATOM   1155 N N   . VAL A 1 148 ? 19.629  -7.464  33.692  1.00 30.71  ? 145 VAL A N   1 
ATOM   1156 C CA  . VAL A 1 148 ? 18.265  -7.789  34.084  1.00 30.65  ? 145 VAL A CA  1 
ATOM   1157 C C   . VAL A 1 148 ? 17.477  -8.113  32.809  1.00 32.92  ? 145 VAL A C   1 
ATOM   1158 O O   . VAL A 1 148 ? 17.306  -7.251  31.949  1.00 32.72  ? 145 VAL A O   1 
ATOM   1159 C CB  . VAL A 1 148 ? 17.591  -6.641  34.853  1.00 32.74  ? 145 VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 148 ? 16.099  -6.897  34.983  1.00 33.99  ? 145 VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 148 ? 18.226  -6.486  36.236  1.00 32.24  ? 145 VAL A CG2 1 
ATOM   1162 N N   . LEU A 1 149 ? 17.017  -9.355  32.683  1.00 30.65  ? 146 LEU A N   1 
ATOM   1163 C CA  . LEU A 1 149 ? 16.333  -9.778  31.464  1.00 32.75  ? 146 LEU A CA  1 
ATOM   1164 C C   . LEU A 1 149 ? 14.880  -10.138 31.736  1.00 31.70  ? 146 LEU A C   1 
ATOM   1165 O O   . LEU A 1 149 ? 14.580  -10.868 32.665  1.00 31.55  ? 146 LEU A O   1 
ATOM   1166 C CB  . LEU A 1 149 ? 17.054  -10.967 30.826  1.00 32.02  ? 146 LEU A CB  1 
ATOM   1167 C CG  . LEU A 1 149 ? 16.570  -11.312 29.409  1.00 37.31  ? 146 LEU A CG  1 
ATOM   1168 C CD1 . LEU A 1 149 ? 17.730  -11.399 28.447  1.00 32.56  ? 146 LEU A CD1 1 
ATOM   1169 C CD2 . LEU A 1 149 ? 15.776  -12.609 29.413  1.00 36.29  ? 146 LEU A CD2 1 
ATOM   1170 N N   . VAL A 1 150 ? 13.980  -9.613  30.918  1.00 29.82  ? 147 VAL A N   1 
ATOM   1171 C CA  . VAL A 1 150 ? 12.556  -9.870  31.061  1.00 28.03  ? 147 VAL A CA  1 
ATOM   1172 C C   . VAL A 1 150 ? 12.030  -10.490 29.789  1.00 29.33  ? 147 VAL A C   1 
ATOM   1173 O O   . VAL A 1 150 ? 12.391  -10.046 28.714  1.00 29.10  ? 147 VAL A O   1 
ATOM   1174 C CB  . VAL A 1 150 ? 11.766  -8.580  31.337  1.00 28.36  ? 147 VAL A CB  1 
ATOM   1175 C CG1 . VAL A 1 150 ? 10.282  -8.889  31.489  1.00 27.41  ? 147 VAL A CG1 1 
ATOM   1176 C CG2 . VAL A 1 150 ? 12.314  -7.867  32.571  1.00 26.69  ? 147 VAL A CG2 1 
ATOM   1177 N N   . SER A 1 151 ? 11.176  -11.500 29.892  1.00 29.86  ? 148 SER A N   1 
ATOM   1178 C CA  . SER A 1 151 ? 10.499  -11.992 28.694  1.00 32.29  ? 148 SER A CA  1 
ATOM   1179 C C   . SER A 1 151 ? 9.028   -12.209 29.004  1.00 31.56  ? 148 SER A C   1 
ATOM   1180 O O   . SER A 1 151 ? 8.689   -12.565 30.117  1.00 29.83  ? 148 SER A O   1 
ATOM   1181 C CB  . SER A 1 151 ? 11.148  -13.278 28.192  1.00 28.69  ? 148 SER A CB  1 
ATOM   1182 O OG  . SER A 1 151 ? 11.083  -14.305 29.164  1.00 30.71  ? 148 SER A OG  1 
ATOM   1183 N N   . MET A 1 152 ? 8.146   -11.971 28.041  1.00 29.56  ? 149 MET A N   1 
ATOM   1184 C CA  . MET A 1 152 ? 6.722   -12.134 28.313  1.00 27.78  ? 149 MET A CA  1 
ATOM   1185 C C   . MET A 1 152 ? 6.082   -13.108 27.342  1.00 32.89  ? 149 MET A C   1 
ATOM   1186 O O   . MET A 1 152 ? 6.517   -13.238 26.199  1.00 29.10  ? 149 MET A O   1 
ATOM   1187 C CB  . MET A 1 152 ? 5.987   -10.787 28.244  1.00 26.88  ? 149 MET A CB  1 
ATOM   1188 C CG  . MET A 1 152 ? 5.554   -10.354 26.831  1.00 30.34  ? 149 MET A CG  1 
ATOM   1189 S SD  . MET A 1 152 ? 6.915   -9.891  25.742  1.00 32.21  ? 149 MET A SD  1 
ATOM   1190 C CE  . MET A 1 152 ? 7.251   -8.222  26.303  1.00 26.20  ? 149 MET A CE  1 
ATOM   1191 N N   . ASN A 1 153 ? 5.051   -13.803 27.806  1.00 28.06  ? 150 ASN A N   1 
ATOM   1192 C CA  . ASN A 1 153 ? 4.153   -14.468 26.883  1.00 32.68  ? 150 ASN A CA  1 
ATOM   1193 C C   . ASN A 1 153 ? 3.214   -13.426 26.308  1.00 32.87  ? 150 ASN A C   1 
ATOM   1194 O O   . ASN A 1 153 ? 2.857   -12.463 26.991  1.00 29.95  ? 150 ASN A O   1 
ATOM   1195 C CB  . ASN A 1 153 ? 3.354   -15.576 27.567  1.00 28.75  ? 150 ASN A CB  1 
ATOM   1196 C CG  . ASN A 1 153 ? 4.179   -16.813 27.837  1.00 31.48  ? 150 ASN A CG  1 
ATOM   1197 O OD1 . ASN A 1 153 ? 5.324   -16.922 27.398  1.00 31.26  ? 150 ASN A OD1 1 
ATOM   1198 N ND2 . ASN A 1 153 ? 3.588   -17.771 28.546  1.00 27.93  ? 150 ASN A ND2 1 
ATOM   1199 N N   . TYR A 1 154 ? 2.834   -13.606 25.049  1.00 24.19  ? 151 TYR A N   1 
ATOM   1200 C CA  . TYR A 1 154 ? 1.776   -12.808 24.446  1.00 27.94  ? 151 TYR A CA  1 
ATOM   1201 C C   . TYR A 1 154 ? 0.919   -13.721 23.594  1.00 28.96  ? 151 TYR A C   1 
ATOM   1202 O O   . TYR A 1 154 ? 1.407   -14.722 23.067  1.00 29.62  ? 151 TYR A O   1 
ATOM   1203 C CB  . TYR A 1 154 ? 2.337   -11.644 23.612  1.00 27.49  ? 151 TYR A CB  1 
ATOM   1204 C CG  . TYR A 1 154 ? 3.192   -12.045 22.423  1.00 28.71  ? 151 TYR A CG  1 
ATOM   1205 C CD1 . TYR A 1 154 ? 4.557   -12.248 22.566  1.00 30.09  ? 151 TYR A CD1 1 
ATOM   1206 C CD2 . TYR A 1 154 ? 2.633   -12.194 21.153  1.00 28.81  ? 151 TYR A CD2 1 
ATOM   1207 C CE1 . TYR A 1 154 ? 5.346   -12.606 21.485  1.00 27.42  ? 151 TYR A CE1 1 
ATOM   1208 C CE2 . TYR A 1 154 ? 3.415   -12.558 20.057  1.00 29.99  ? 151 TYR A CE2 1 
ATOM   1209 C CZ  . TYR A 1 154 ? 4.770   -12.759 20.232  1.00 30.18  ? 151 TYR A CZ  1 
ATOM   1210 O OH  . TYR A 1 154 ? 5.561   -13.114 19.161  1.00 27.37  ? 151 TYR A OH  1 
ATOM   1211 N N   . ARG A 1 155 ? -0.362  -13.388 23.476  1.00 26.58  ? 152 ARG A N   1 
ATOM   1212 C CA  . ARG A 1 155 ? -1.291  -14.216 22.720  1.00 25.75  ? 152 ARG A CA  1 
ATOM   1213 C C   . ARG A 1 155 ? -0.905  -14.292 21.245  1.00 26.89  ? 152 ARG A C   1 
ATOM   1214 O O   . ARG A 1 155 ? -0.525  -13.292 20.635  1.00 27.54  ? 152 ARG A O   1 
ATOM   1215 C CB  . ARG A 1 155 ? -2.717  -13.685 22.860  1.00 26.50  ? 152 ARG A CB  1 
ATOM   1216 C CG  . ARG A 1 155 ? -3.368  -14.002 24.197  1.00 30.34  ? 152 ARG A CG  1 
ATOM   1217 C CD  . ARG A 1 155 ? -4.691  -13.269 24.342  1.00 29.92  ? 152 ARG A CD  1 
ATOM   1218 N NE  . ARG A 1 155 ? -4.503  -11.861 24.674  1.00 29.39  ? 152 ARG A NE  1 
ATOM   1219 C CZ  . ARG A 1 155 ? -5.490  -10.973 24.754  1.00 32.39  ? 152 ARG A CZ  1 
ATOM   1220 N NH1 . ARG A 1 155 ? -6.742  -11.343 24.513  1.00 30.08  ? 152 ARG A NH1 1 
ATOM   1221 N NH2 . ARG A 1 155 ? -5.226  -9.713  25.071  1.00 34.59  ? 152 ARG A NH2 1 
ATOM   1222 N N   . VAL A 1 156 ? -1.008  -15.489 20.683  1.00 28.50  ? 153 VAL A N   1 
ATOM   1223 C CA  . VAL A 1 156 ? -0.700  -15.711 19.272  1.00 26.45  ? 153 VAL A CA  1 
ATOM   1224 C C   . VAL A 1 156 ? -1.904  -16.326 18.566  1.00 29.37  ? 153 VAL A C   1 
ATOM   1225 O O   . VAL A 1 156 ? -2.917  -16.628 19.201  1.00 29.17  ? 153 VAL A O   1 
ATOM   1226 C CB  . VAL A 1 156 ? 0.523   -16.630 19.107  1.00 28.92  ? 153 VAL A CB  1 
ATOM   1227 C CG1 . VAL A 1 156 ? 1.766   -15.988 19.726  1.00 28.92  ? 153 VAL A CG1 1 
ATOM   1228 C CG2 . VAL A 1 156 ? 0.253   -17.977 19.747  1.00 27.57  ? 153 VAL A CG2 1 
ATOM   1229 N N   . GLY A 1 157 ? -1.792  -16.520 17.256  1.00 27.57  ? 154 GLY A N   1 
ATOM   1230 C CA  . GLY A 1 157 ? -2.871  -17.108 16.482  1.00 29.04  ? 154 GLY A CA  1 
ATOM   1231 C C   . GLY A 1 157 ? -4.113  -16.242 16.517  1.00 30.04  ? 154 GLY A C   1 
ATOM   1232 O O   . GLY A 1 157 ? -4.022  -15.017 16.617  1.00 27.81  ? 154 GLY A O   1 
ATOM   1233 N N   . THR A 1 158 ? -5.278  -16.875 16.443  1.00 28.04  ? 155 THR A N   1 
ATOM   1234 C CA  . THR A 1 158 ? -6.539  -16.146 16.505  1.00 28.03  ? 155 THR A CA  1 
ATOM   1235 C C   . THR A 1 158 ? -6.695  -15.402 17.829  1.00 29.28  ? 155 THR A C   1 
ATOM   1236 O O   . THR A 1 158 ? -7.234  -14.296 17.871  1.00 30.11  ? 155 THR A O   1 
ATOM   1237 C CB  . THR A 1 158 ? -7.739  -17.084 16.318  1.00 29.69  ? 155 THR A CB  1 
ATOM   1238 O OG1 . THR A 1 158 ? -7.702  -18.109 17.313  1.00 28.40  ? 155 THR A OG1 1 
ATOM   1239 C CG2 . THR A 1 158 ? -7.695  -17.733 14.934  1.00 28.43  ? 155 THR A CG2 1 
ATOM   1240 N N   . PHE A 1 159 ? -6.214  -16.013 18.907  1.00 28.33  ? 156 PHE A N   1 
ATOM   1241 C CA  . PHE A 1 159 ? -6.371  -15.448 20.237  1.00 27.48  ? 156 PHE A CA  1 
ATOM   1242 C C   . PHE A 1 159 ? -5.670  -14.098 20.341  1.00 29.18  ? 156 PHE A C   1 
ATOM   1243 O O   . PHE A 1 159 ? -6.153  -13.178 21.009  1.00 32.20  ? 156 PHE A O   1 
ATOM   1244 C CB  . PHE A 1 159 ? -5.833  -16.429 21.284  1.00 28.40  ? 156 PHE A CB  1 
ATOM   1245 C CG  . PHE A 1 159 ? -6.380  -17.815 21.131  1.00 27.62  ? 156 PHE A CG  1 
ATOM   1246 C CD1 . PHE A 1 159 ? -7.599  -18.157 21.690  1.00 28.97  ? 156 PHE A CD1 1 
ATOM   1247 C CD2 . PHE A 1 159 ? -5.690  -18.770 20.401  1.00 30.34  ? 156 PHE A CD2 1 
ATOM   1248 C CE1 . PHE A 1 159 ? -8.115  -19.429 21.535  1.00 33.88  ? 156 PHE A CE1 1 
ATOM   1249 C CE2 . PHE A 1 159 ? -6.201  -20.043 20.237  1.00 30.14  ? 156 PHE A CE2 1 
ATOM   1250 C CZ  . PHE A 1 159 ? -7.414  -20.375 20.806  1.00 32.46  ? 156 PHE A CZ  1 
ATOM   1251 N N   . GLY A 1 160 ? -4.537  -13.975 19.662  1.00 27.89  ? 157 GLY A N   1 
ATOM   1252 C CA  . GLY A 1 160 ? -3.791  -12.735 19.676  1.00 27.08  ? 157 GLY A CA  1 
ATOM   1253 C C   . GLY A 1 160 ? -4.097  -11.768 18.547  1.00 29.87  ? 157 GLY A C   1 
ATOM   1254 O O   . GLY A 1 160 ? -3.916  -10.559 18.702  1.00 27.50  ? 157 GLY A O   1 
ATOM   1255 N N   . PHE A 1 161 ? -4.541  -12.270 17.398  1.00 31.42  ? 158 PHE A N   1 
ATOM   1256 C CA  . PHE A 1 161 ? -4.573  -11.398 16.225  1.00 27.88  ? 158 PHE A CA  1 
ATOM   1257 C C   . PHE A 1 161 ? -5.793  -11.512 15.311  1.00 31.45  ? 158 PHE A C   1 
ATOM   1258 O O   . PHE A 1 161 ? -5.857  -10.827 14.286  1.00 30.37  ? 158 PHE A O   1 
ATOM   1259 C CB  . PHE A 1 161 ? -3.286  -11.615 15.415  1.00 30.57  ? 158 PHE A CB  1 
ATOM   1260 C CG  . PHE A 1 161 ? -2.049  -11.208 16.165  1.00 29.74  ? 158 PHE A CG  1 
ATOM   1261 C CD1 . PHE A 1 161 ? -1.644  -9.884  16.191  1.00 30.99  ? 158 PHE A CD1 1 
ATOM   1262 C CD2 . PHE A 1 161 ? -1.328  -12.140 16.901  1.00 31.25  ? 158 PHE A CD2 1 
ATOM   1263 C CE1 . PHE A 1 161 ? -0.524  -9.500  16.917  1.00 31.37  ? 158 PHE A CE1 1 
ATOM   1264 C CE2 . PHE A 1 161 ? -0.206  -11.767 17.619  1.00 26.07  ? 158 PHE A CE2 1 
ATOM   1265 C CZ  . PHE A 1 161 ? 0.193   -10.444 17.632  1.00 29.38  ? 158 PHE A CZ  1 
ATOM   1266 N N   . LEU A 1 162 ? -6.771  -12.336 15.676  1.00 32.64  ? 159 LEU A N   1 
ATOM   1267 C CA  . LEU A 1 162 ? -8.036  -12.316 14.948  1.00 32.11  ? 159 LEU A CA  1 
ATOM   1268 C C   . LEU A 1 162 ? -8.688  -10.959 15.176  1.00 37.93  ? 159 LEU A C   1 
ATOM   1269 O O   . LEU A 1 162 ? -8.778  -10.477 16.310  1.00 35.15  ? 159 LEU A O   1 
ATOM   1270 C CB  . LEU A 1 162 ? -8.975  -13.448 15.380  1.00 31.76  ? 159 LEU A CB  1 
ATOM   1271 C CG  . LEU A 1 162 ? -10.316 -13.521 14.633  1.00 34.33  ? 159 LEU A CG  1 
ATOM   1272 C CD1 . LEU A 1 162 ? -10.697 -14.963 14.357  1.00 33.34  ? 159 LEU A CD1 1 
ATOM   1273 C CD2 . LEU A 1 162 ? -11.447 -12.810 15.385  1.00 32.30  ? 159 LEU A CD2 1 
ATOM   1274 N N   . ALA A 1 163 ? -9.142  -10.350 14.090  1.00 33.04  ? 160 ALA A N   1 
ATOM   1275 C CA  . ALA A 1 163 ? -9.648  -8.993  14.139  1.00 34.98  ? 160 ALA A CA  1 
ATOM   1276 C C   . ALA A 1 163 ? -10.868 -8.808  13.260  1.00 41.78  ? 160 ALA A C   1 
ATOM   1277 O O   . ALA A 1 163 ? -10.895 -9.246  12.108  1.00 36.64  ? 160 ALA A O   1 
ATOM   1278 C CB  . ALA A 1 163 ? -8.563  -8.017  13.713  1.00 36.88  ? 160 ALA A CB  1 
ATOM   1279 N N   . LEU A 1 164 ? -11.880 -8.156  13.814  1.00 39.22  ? 161 LEU A N   1 
ATOM   1280 C CA  . LEU A 1 164 ? -12.941 -7.594  12.999  1.00 41.29  ? 161 LEU A CA  1 
ATOM   1281 C C   . LEU A 1 164 ? -12.837 -6.086  13.143  1.00 42.80  ? 161 LEU A C   1 
ATOM   1282 O O   . LEU A 1 164 ? -13.503 -5.488  13.989  1.00 43.46  ? 161 LEU A O   1 
ATOM   1283 C CB  . LEU A 1 164 ? -14.304 -8.138  13.415  1.00 39.46  ? 161 LEU A CB  1 
ATOM   1284 C CG  . LEU A 1 164 ? -14.402 -9.572  12.882  1.00 44.98  ? 161 LEU A CG  1 
ATOM   1285 C CD1 . LEU A 1 164 ? -15.088 -10.501 13.854  1.00 42.48  ? 161 LEU A CD1 1 
ATOM   1286 C CD2 . LEU A 1 164 ? -15.084 -9.609  11.523  1.00 38.80  ? 161 LEU A CD2 1 
ATOM   1287 N N   . PRO A 1 165 ? -11.959 -5.476  12.328  1.00 39.30  ? 162 PRO A N   1 
ATOM   1288 C CA  . PRO A 1 165 ? -11.534 -4.079  12.457  1.00 41.68  ? 162 PRO A CA  1 
ATOM   1289 C C   . PRO A 1 165 ? -12.714 -3.131  12.571  1.00 41.46  ? 162 PRO A C   1 
ATOM   1290 O O   . PRO A 1 165 ? -13.644 -3.210  11.772  1.00 43.60  ? 162 PRO A O   1 
ATOM   1291 C CB  . PRO A 1 165 ? -10.747 -3.838  11.167  1.00 42.72  ? 162 PRO A CB  1 
ATOM   1292 C CG  . PRO A 1 165 ? -10.216 -5.185  10.818  1.00 39.02  ? 162 PRO A CG  1 
ATOM   1293 C CD  . PRO A 1 165 ? -11.322 -6.132  11.172  1.00 37.90  ? 162 PRO A CD  1 
ATOM   1294 N N   . GLY A 1 166 ? -12.680 -2.263  13.575  1.00 45.34  ? 163 GLY A N   1 
ATOM   1295 C CA  . GLY A 1 166 ? -13.776 -1.349  13.825  1.00 45.79  ? 163 GLY A CA  1 
ATOM   1296 C C   . GLY A 1 166 ? -14.682 -1.814  14.949  1.00 47.17  ? 163 GLY A C   1 
ATOM   1297 O O   . GLY A 1 166 ? -15.412 -1.016  15.532  1.00 52.07  ? 163 GLY A O   1 
ATOM   1298 N N   . SER A 1 167 ? -14.642 -3.106  15.258  1.00 44.19  ? 164 SER A N   1 
ATOM   1299 C CA  . SER A 1 167 ? -15.507 -3.649  16.298  1.00 46.11  ? 164 SER A CA  1 
ATOM   1300 C C   . SER A 1 167 ? -14.971 -3.335  17.683  1.00 45.03  ? 164 SER A C   1 
ATOM   1301 O O   . SER A 1 167 ? -13.808 -2.962  17.850  1.00 44.06  ? 164 SER A O   1 
ATOM   1302 C CB  . SER A 1 167 ? -15.670 -5.161  16.148  1.00 46.04  ? 164 SER A CB  1 
ATOM   1303 O OG  . SER A 1 167 ? -14.484 -5.837  16.526  1.00 40.54  ? 164 SER A OG  1 
ATOM   1304 N N   . ARG A 1 168 ? -15.838 -3.498  18.673  1.00 49.09  ? 165 ARG A N   1 
ATOM   1305 C CA  . ARG A 1 168 ? -15.488 -3.299  20.072  1.00 53.29  ? 165 ARG A CA  1 
ATOM   1306 C C   . ARG A 1 168 ? -14.923 -4.582  20.671  1.00 49.27  ? 165 ARG A C   1 
ATOM   1307 O O   . ARG A 1 168 ? -14.037 -4.556  21.523  1.00 49.46  ? 165 ARG A O   1 
ATOM   1308 C CB  . ARG A 1 168 ? -16.725 -2.844  20.849  1.00 56.43  ? 165 ARG A CB  1 
ATOM   1309 C CG  . ARG A 1 168 ? -16.664 -2.994  22.359  1.00 67.46  ? 165 ARG A CG  1 
ATOM   1310 C CD  . ARG A 1 168 ? -17.990 -2.572  22.999  1.00 74.48  ? 165 ARG A CD  1 
ATOM   1311 N NE  . ARG A 1 168 ? -18.810 -1.758  22.097  1.00 86.62  ? 165 ARG A NE  1 
ATOM   1312 C CZ  . ARG A 1 168 ? -19.911 -2.183  21.477  1.00 84.47  ? 165 ARG A CZ  1 
ATOM   1313 N NH1 . ARG A 1 168 ? -20.344 -3.425  21.653  1.00 80.16  ? 165 ARG A NH1 1 
ATOM   1314 N NH2 . ARG A 1 168 ? -20.579 -1.363  20.675  1.00 86.87  ? 165 ARG A NH2 1 
ATOM   1315 N N   . GLU A 1 169 ? -15.434 -5.710  20.194  1.00 46.57  ? 166 GLU A N   1 
ATOM   1316 C CA  . GLU A 1 169 ? -15.167 -7.000  20.816  1.00 46.09  ? 166 GLU A CA  1 
ATOM   1317 C C   . GLU A 1 169 ? -13.929 -7.705  20.252  1.00 44.71  ? 166 GLU A C   1 
ATOM   1318 O O   . GLU A 1 169 ? -13.366 -8.579  20.907  1.00 41.26  ? 166 GLU A O   1 
ATOM   1319 C CB  . GLU A 1 169 ? -16.395 -7.903  20.674  1.00 46.75  ? 166 GLU A CB  1 
ATOM   1320 C CG  . GLU A 1 169 ? -17.705 -7.256  21.132  1.00 51.58  ? 166 GLU A CG  1 
ATOM   1321 C CD  . GLU A 1 169 ? -18.427 -6.496  20.023  1.00 59.56  ? 166 GLU A CD  1 
ATOM   1322 O OE1 . GLU A 1 169 ? -17.815 -6.232  18.963  1.00 55.30  ? 166 GLU A OE1 1 
ATOM   1323 O OE2 . GLU A 1 169 ? -19.613 -6.155  20.219  1.00 63.81  ? 166 GLU A OE2 1 
ATOM   1324 N N   . ALA A 1 170 ? -13.507 -7.330  19.046  1.00 43.26  ? 167 ALA A N   1 
ATOM   1325 C CA  . ALA A 1 170 ? -12.299 -7.901  18.445  1.00 38.97  ? 167 ALA A CA  1 
ATOM   1326 C C   . ALA A 1 170 ? -11.568 -6.861  17.612  1.00 40.14  ? 167 ALA A C   1 
ATOM   1327 O O   . ALA A 1 170 ? -11.577 -6.924  16.383  1.00 40.11  ? 167 ALA A O   1 
ATOM   1328 C CB  . ALA A 1 170 ? -12.643 -9.115  17.589  1.00 39.99  ? 167 ALA A CB  1 
ATOM   1329 N N   . PRO A 1 171 ? -10.918 -5.902  18.282  1.00 40.16  ? 168 PRO A N   1 
ATOM   1330 C CA  . PRO A 1 171 ? -10.327 -4.750  17.596  1.00 39.30  ? 168 PRO A CA  1 
ATOM   1331 C C   . PRO A 1 171 ? -9.033  -5.076  16.853  1.00 35.57  ? 168 PRO A C   1 
ATOM   1332 O O   . PRO A 1 171 ? -8.597  -4.281  16.025  1.00 36.84  ? 168 PRO A O   1 
ATOM   1333 C CB  . PRO A 1 171 ? -10.058 -3.775  18.744  1.00 36.06  ? 168 PRO A CB  1 
ATOM   1334 C CG  . PRO A 1 171 ? -9.778  -4.663  19.902  1.00 37.11  ? 168 PRO A CG  1 
ATOM   1335 C CD  . PRO A 1 171 ? -10.683 -5.856  19.736  1.00 36.77  ? 168 PRO A CD  1 
ATOM   1336 N N   . GLY A 1 172 ? -8.421  -6.214  17.160  1.00 34.90  ? 169 GLY A N   1 
ATOM   1337 C CA  . GLY A 1 172 ? -7.156  -6.576  16.544  1.00 34.95  ? 169 GLY A CA  1 
ATOM   1338 C C   . GLY A 1 172 ? -5.940  -6.177  17.358  1.00 35.35  ? 169 GLY A C   1 
ATOM   1339 O O   . GLY A 1 172 ? -6.042  -5.381  18.293  1.00 34.00  ? 169 GLY A O   1 
ATOM   1340 N N   . ASN A 1 173 ? -4.795  -6.758  17.008  1.00 32.02  ? 170 ASN A N   1 
ATOM   1341 C CA  . ASN A 1 173 ? -3.507  -6.423  17.612  1.00 30.51  ? 170 ASN A CA  1 
ATOM   1342 C C   . ASN A 1 173 ? -3.401  -6.634  19.125  1.00 30.62  ? 170 ASN A C   1 
ATOM   1343 O O   . ASN A 1 173 ? -2.517  -6.062  19.755  1.00 31.65  ? 170 ASN A O   1 
ATOM   1344 C CB  . ASN A 1 173 ? -3.151  -4.966  17.298  1.00 31.61  ? 170 ASN A CB  1 
ATOM   1345 C CG  . ASN A 1 173 ? -2.901  -4.735  15.819  1.00 34.67  ? 170 ASN A CG  1 
ATOM   1346 O OD1 . ASN A 1 173 ? -2.433  -5.630  15.118  1.00 32.56  ? 170 ASN A OD1 1 
ATOM   1347 N ND2 . ASN A 1 173 ? -3.200  -3.530  15.341  1.00 31.96  ? 170 ASN A ND2 1 
ATOM   1348 N N   . VAL A 1 174 ? -4.268  -7.453  19.713  1.00 28.52  ? 171 VAL A N   1 
ATOM   1349 C CA  . VAL A 1 174 ? -4.256  -7.572  21.172  1.00 31.63  ? 171 VAL A CA  1 
ATOM   1350 C C   . VAL A 1 174 ? -3.014  -8.312  21.677  1.00 30.03  ? 171 VAL A C   1 
ATOM   1351 O O   . VAL A 1 174 ? -2.635  -8.142  22.825  1.00 32.58  ? 171 VAL A O   1 
ATOM   1352 C CB  . VAL A 1 174 ? -5.533  -8.265  21.722  1.00 32.83  ? 171 VAL A CB  1 
ATOM   1353 C CG1 . VAL A 1 174 ? -6.784  -7.548  21.230  1.00 31.64  ? 171 VAL A CG1 1 
ATOM   1354 C CG2 . VAL A 1 174 ? -5.568  -9.742  21.363  1.00 32.13  ? 171 VAL A CG2 1 
ATOM   1355 N N   . GLY A 1 175 ? -2.369  -9.114  20.830  1.00 28.44  ? 172 GLY A N   1 
ATOM   1356 C CA  . GLY A 1 175 ? -1.100  -9.726  21.204  1.00 27.28  ? 172 GLY A CA  1 
ATOM   1357 C C   . GLY A 1 175 ? -0.016  -8.673  21.406  1.00 29.04  ? 172 GLY A C   1 
ATOM   1358 O O   . GLY A 1 175 ? 0.827   -8.760  22.319  1.00 31.82  ? 172 GLY A O   1 
ATOM   1359 N N   . LEU A 1 176 ? -0.046  -7.661  20.543  1.00 27.36  ? 173 LEU A N   1 
ATOM   1360 C CA  . LEU A 1 176 ? 0.855   -6.525  20.662  1.00 28.27  ? 173 LEU A CA  1 
ATOM   1361 C C   . LEU A 1 176 ? 0.531   -5.702  21.912  1.00 29.22  ? 173 LEU A C   1 
ATOM   1362 O O   . LEU A 1 176 ? 1.422   -5.119  22.529  1.00 25.97  ? 173 LEU A O   1 
ATOM   1363 C CB  . LEU A 1 176 ? 0.774   -5.643  19.411  1.00 28.61  ? 173 LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 176 ? 1.255   -6.283  18.101  1.00 29.40  ? 173 LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 176 ? 1.032   -5.349  16.908  1.00 27.58  ? 173 LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 176 ? 2.720   -6.664  18.209  1.00 26.58  ? 173 LEU A CD2 1 
ATOM   1367 N N   . LEU A 1 177 ? -0.748  -5.642  22.268  1.00 30.87  ? 174 LEU A N   1 
ATOM   1368 C CA  . LEU A 1 177 ? -1.163  -4.943  23.483  1.00 29.93  ? 174 LEU A CA  1 
ATOM   1369 C C   . LEU A 1 177 ? -0.739  -5.724  24.727  1.00 29.38  ? 174 LEU A C   1 
ATOM   1370 O O   . LEU A 1 177 ? -0.477  -5.129  25.772  1.00 34.19  ? 174 LEU A O   1 
ATOM   1371 C CB  . LEU A 1 177 ? -2.677  -4.712  23.489  1.00 31.15  ? 174 LEU A CB  1 
ATOM   1372 C CG  . LEU A 1 177 ? -3.227  -3.739  22.442  1.00 34.55  ? 174 LEU A CG  1 
ATOM   1373 C CD1 . LEU A 1 177 ? -4.744  -3.651  22.527  1.00 32.00  ? 174 LEU A CD1 1 
ATOM   1374 C CD2 . LEU A 1 177 ? -2.597  -2.360  22.608  1.00 32.29  ? 174 LEU A CD2 1 
ATOM   1375 N N   . ASP A 1 178 ? -0.683  -7.052  24.619  1.00 28.15  ? 175 ASP A N   1 
ATOM   1376 C CA  . ASP A 1 178 ? -0.158  -7.885  25.701  1.00 31.00  ? 175 ASP A CA  1 
ATOM   1377 C C   . ASP A 1 178 ? 1.299   -7.509  25.910  1.00 33.71  ? 175 ASP A C   1 
ATOM   1378 O O   . ASP A 1 178 ? 1.746   -7.251  27.046  1.00 31.45  ? 175 ASP A O   1 
ATOM   1379 C CB  . ASP A 1 178 ? -0.269  -9.383  25.387  1.00 31.38  ? 175 ASP A CB  1 
ATOM   1380 C CG  . ASP A 1 178 ? -1.703  -9.855  25.226  1.00 32.69  ? 175 ASP A CG  1 
ATOM   1381 O OD1 . ASP A 1 178 ? -2.624  -9.164  25.710  1.00 29.16  ? 175 ASP A OD1 1 
ATOM   1382 O OD2 . ASP A 1 178 ? -1.909  -10.927 24.607  1.00 30.71  ? 175 ASP A OD2 1 
ATOM   1383 N N   . GLN A 1 179 ? 2.038   -7.474  24.800  1.00 29.76  ? 176 GLN A N   1 
ATOM   1384 C CA  . GLN A 1 179 ? 3.440   -7.058  24.856  1.00 27.72  ? 176 GLN A CA  1 
ATOM   1385 C C   . GLN A 1 179 ? 3.604   -5.675  25.498  1.00 29.36  ? 176 GLN A C   1 
ATOM   1386 O O   . GLN A 1 179 ? 4.484   -5.468  26.344  1.00 31.58  ? 176 GLN A O   1 
ATOM   1387 C CB  . GLN A 1 179 ? 4.055   -7.040  23.456  1.00 29.32  ? 176 GLN A CB  1 
ATOM   1388 C CG  . GLN A 1 179 ? 4.157   -8.393  22.780  1.00 25.86  ? 176 GLN A CG  1 
ATOM   1389 C CD  . GLN A 1 179 ? 4.611   -8.260  21.340  1.00 30.79  ? 176 GLN A CD  1 
ATOM   1390 O OE1 . GLN A 1 179 ? 5.086   -7.201  20.931  1.00 28.76  ? 176 GLN A OE1 1 
ATOM   1391 N NE2 . GLN A 1 179 ? 4.461   -9.331  20.560  1.00 25.91  ? 176 GLN A NE2 1 
ATOM   1392 N N   . ARG A 1 180 ? 2.760   -4.730  25.084  1.00 29.05  ? 177 ARG A N   1 
ATOM   1393 C CA  . ARG A 1 180 ? 2.845   -3.364  25.594  1.00 31.69  ? 177 ARG A CA  1 
ATOM   1394 C C   . ARG A 1 180 ? 2.555   -3.310  27.093  1.00 31.48  ? 177 ARG A C   1 
ATOM   1395 O O   . ARG A 1 180 ? 3.230   -2.596  27.835  1.00 31.74  ? 177 ARG A O   1 
ATOM   1396 C CB  . ARG A 1 180 ? 1.884   -2.437  24.842  1.00 30.16  ? 177 ARG A CB  1 
ATOM   1397 C CG  . ARG A 1 180 ? 1.801   -1.030  25.438  1.00 30.48  ? 177 ARG A CG  1 
ATOM   1398 C CD  . ARG A 1 180 ? 0.826   -0.143  24.685  1.00 30.45  ? 177 ARG A CD  1 
ATOM   1399 N NE  . ARG A 1 180 ? 1.383   0.281   23.405  1.00 37.73  ? 177 ARG A NE  1 
ATOM   1400 C CZ  . ARG A 1 180 ? 0.665   0.749   22.386  1.00 39.71  ? 177 ARG A CZ  1 
ATOM   1401 N NH1 . ARG A 1 180 ? -0.655  0.853   22.487  1.00 35.04  ? 177 ARG A NH1 1 
ATOM   1402 N NH2 . ARG A 1 180 ? 1.273   1.111   21.262  1.00 30.45  ? 177 ARG A NH2 1 
ATOM   1403 N N   . LEU A 1 181 ? 1.551   -4.065  27.530  1.00 30.98  ? 178 LEU A N   1 
ATOM   1404 C CA  . LEU A 1 181 ? 1.200   -4.118  28.940  1.00 32.38  ? 178 LEU A CA  1 
ATOM   1405 C C   . LEU A 1 181 ? 2.373   -4.666  29.744  1.00 33.64  ? 178 LEU A C   1 
ATOM   1406 O O   . LEU A 1 181 ? 2.657   -4.184  30.842  1.00 30.83  ? 178 LEU A O   1 
ATOM   1407 C CB  . LEU A 1 181 ? -0.055  -4.969  29.165  1.00 30.90  ? 178 LEU A CB  1 
ATOM   1408 C CG  . LEU A 1 181 ? -0.540  -5.125  30.611  1.00 34.72  ? 178 LEU A CG  1 
ATOM   1409 C CD1 . LEU A 1 181 ? -0.854  -3.770  31.238  1.00 32.76  ? 178 LEU A CD1 1 
ATOM   1410 C CD2 . LEU A 1 181 ? -1.758  -6.036  30.673  1.00 31.38  ? 178 LEU A CD2 1 
ATOM   1411 N N   . ALA A 1 182 ? 3.067   -5.664  29.199  1.00 29.23  ? 179 ALA A N   1 
ATOM   1412 C CA  . ALA A 1 182 ? 4.263   -6.168  29.873  1.00 30.20  ? 179 ALA A CA  1 
ATOM   1413 C C   . ALA A 1 182 ? 5.336   -5.076  29.956  1.00 31.17  ? 179 ALA A C   1 
ATOM   1414 O O   . ALA A 1 182 ? 6.013   -4.938  30.988  1.00 30.28  ? 179 ALA A O   1 
ATOM   1415 C CB  . ALA A 1 182 ? 4.806   -7.407  29.172  1.00 29.33  ? 179 ALA A CB  1 
ATOM   1416 N N   . LEU A 1 183 ? 5.475   -4.288  28.887  1.00 27.33  ? 180 LEU A N   1 
ATOM   1417 C CA  . LEU A 1 183 ? 6.416   -3.159  28.902  1.00 28.32  ? 180 LEU A CA  1 
ATOM   1418 C C   . LEU A 1 183 ? 6.091   -2.132  30.004  1.00 27.68  ? 180 LEU A C   1 
ATOM   1419 O O   . LEU A 1 183 ? 6.993   -1.589  30.657  1.00 30.19  ? 180 LEU A O   1 
ATOM   1420 C CB  . LEU A 1 183 ? 6.439   -2.449  27.541  1.00 27.24  ? 180 LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 183 ? 6.815   -3.249  26.289  1.00 33.16  ? 180 LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 183 ? 7.083   -2.310  25.107  1.00 29.45  ? 180 LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 183 ? 7.998   -4.162  26.536  1.00 26.67  ? 180 LEU A CD2 1 
ATOM   1424 N N   . GLN A 1 184 ? 4.803   -1.860  30.189  1.00 26.88  ? 181 GLN A N   1 
ATOM   1425 C CA  . GLN A 1 184 ? 4.348   -0.944  31.237  1.00 31.83  ? 181 GLN A CA  1 
ATOM   1426 C C   . GLN A 1 184 ? 4.619   -1.536  32.622  1.00 30.68  ? 181 GLN A C   1 
ATOM   1427 O O   . GLN A 1 184 ? 5.019   -0.823  33.563  1.00 32.37  ? 181 GLN A O   1 
ATOM   1428 C CB  . GLN A 1 184 ? 2.856   -0.638  31.066  1.00 32.16  ? 181 GLN A CB  1 
ATOM   1429 C CG  . GLN A 1 184 ? 2.540   0.166   29.805  1.00 37.42  ? 181 GLN A CG  1 
ATOM   1430 C CD  . GLN A 1 184 ? 1.057   0.223   29.487  1.00 37.90  ? 181 GLN A CD  1 
ATOM   1431 O OE1 . GLN A 1 184 ? 0.279   -0.618  29.934  1.00 41.42  ? 181 GLN A OE1 1 
ATOM   1432 N NE2 . GLN A 1 184 ? 0.661   1.214   28.699  1.00 46.36  ? 181 GLN A NE2 1 
ATOM   1433 N N   . TRP A 1 185 ? 4.410   -2.846  32.735  1.00 29.05  ? 182 TRP A N   1 
ATOM   1434 C CA  . TRP A 1 185 ? 4.708   -3.559  33.972  1.00 31.53  ? 182 TRP A CA  1 
ATOM   1435 C C   . TRP A 1 185 ? 6.164   -3.353  34.345  1.00 33.78  ? 182 TRP A C   1 
ATOM   1436 O O   . TRP A 1 185 ? 6.488   -3.085  35.506  1.00 31.63  ? 182 TRP A O   1 
ATOM   1437 C CB  . TRP A 1 185 ? 4.415   -5.052  33.843  1.00 27.44  ? 182 TRP A CB  1 
ATOM   1438 C CG  . TRP A 1 185 ? 4.605   -5.808  35.133  1.00 32.91  ? 182 TRP A CG  1 
ATOM   1439 C CD1 . TRP A 1 185 ? 3.638   -6.122  36.047  1.00 28.46  ? 182 TRP A CD1 1 
ATOM   1440 C CD2 . TRP A 1 185 ? 5.833   -6.337  35.656  1.00 29.84  ? 182 TRP A CD2 1 
ATOM   1441 N NE1 . TRP A 1 185 ? 4.184   -6.822  37.092  1.00 31.94  ? 182 TRP A NE1 1 
ATOM   1442 C CE2 . TRP A 1 185 ? 5.530   -6.965  36.878  1.00 30.21  ? 182 TRP A CE2 1 
ATOM   1443 C CE3 . TRP A 1 185 ? 7.156   -6.346  35.202  1.00 30.37  ? 182 TRP A CE3 1 
ATOM   1444 C CZ2 . TRP A 1 185 ? 6.501   -7.591  37.659  1.00 32.22  ? 182 TRP A CZ2 1 
ATOM   1445 C CZ3 . TRP A 1 185 ? 8.119   -6.970  35.978  1.00 33.10  ? 182 TRP A CZ3 1 
ATOM   1446 C CH2 . TRP A 1 185 ? 7.787   -7.583  37.193  1.00 30.56  ? 182 TRP A CH2 1 
ATOM   1447 N N   . VAL A 1 186 ? 7.040   -3.483  33.354  1.00 30.66  ? 183 VAL A N   1 
ATOM   1448 C CA  . VAL A 1 186 ? 8.463   -3.255  33.577  1.00 31.41  ? 183 VAL A CA  1 
ATOM   1449 C C   . VAL A 1 186 ? 8.732   -1.812  34.002  1.00 34.14  ? 183 VAL A C   1 
ATOM   1450 O O   . VAL A 1 186 ? 9.501   -1.575  34.941  1.00 33.70  ? 183 VAL A O   1 
ATOM   1451 C CB  . VAL A 1 186 ? 9.292   -3.589  32.322  1.00 29.92  ? 183 VAL A CB  1 
ATOM   1452 C CG1 . VAL A 1 186 ? 10.709  -3.026  32.442  1.00 24.80  ? 183 VAL A CG1 1 
ATOM   1453 C CG2 . VAL A 1 186 ? 9.325   -5.089  32.117  1.00 25.61  ? 183 VAL A CG2 1 
ATOM   1454 N N   . GLN A 1 187 ? 8.095   -0.851  33.332  1.00 32.02  ? 184 GLN A N   1 
ATOM   1455 C CA  . GLN A 1 187 ? 8.278   0.549   33.723  1.00 31.99  ? 184 GLN A CA  1 
ATOM   1456 C C   . GLN A 1 187 ? 7.933   0.792   35.199  1.00 35.58  ? 184 GLN A C   1 
ATOM   1457 O O   . GLN A 1 187 ? 8.670   1.489   35.899  1.00 31.63  ? 184 GLN A O   1 
ATOM   1458 C CB  . GLN A 1 187 ? 7.450   1.480   32.837  1.00 32.53  ? 184 GLN A CB  1 
ATOM   1459 C CG  . GLN A 1 187 ? 8.081   1.742   31.474  1.00 35.28  ? 184 GLN A CG  1 
ATOM   1460 C CD  . GLN A 1 187 ? 9.429   2.432   31.588  1.00 36.86  ? 184 GLN A CD  1 
ATOM   1461 O OE1 . GLN A 1 187 ? 9.517   3.587   32.009  1.00 42.06  ? 184 GLN A OE1 1 
ATOM   1462 N NE2 . GLN A 1 187 ? 10.489  1.722   31.225  1.00 33.70  ? 184 GLN A NE2 1 
ATOM   1463 N N   . GLU A 1 188 ? 6.837   0.213   35.683  1.00 32.55  ? 185 GLU A N   1 
ATOM   1464 C CA  . GLU A 1 188 ? 6.455   0.458   37.075  1.00 33.45  ? 185 GLU A CA  1 
ATOM   1465 C C   . GLU A 1 188 ? 7.243   -0.380  38.089  1.00 36.56  ? 185 GLU A C   1 
ATOM   1466 O O   . GLU A 1 188 ? 7.512   0.073   39.209  1.00 32.68  ? 185 GLU A O   1 
ATOM   1467 C CB  . GLU A 1 188 ? 4.956   0.215   37.281  1.00 33.77  ? 185 GLU A CB  1 
ATOM   1468 C CG  . GLU A 1 188 ? 4.556   0.253   38.761  1.00 34.01  ? 185 GLU A CG  1 
ATOM   1469 C CD  . GLU A 1 188 ? 3.100   0.595   38.999  1.00 40.63  ? 185 GLU A CD  1 
ATOM   1470 O OE1 . GLU A 1 188 ? 2.260   0.306   38.120  1.00 38.21  ? 185 GLU A OE1 1 
ATOM   1471 O OE2 . GLU A 1 188 ? 2.798   1.161   40.076  1.00 36.02  ? 185 GLU A OE2 1 
ATOM   1472 N N   . ASN A 1 189 ? 7.631   -1.592  37.703  1.00 28.88  ? 186 ASN A N   1 
ATOM   1473 C CA  . ASN A 1 189 ? 8.102   -2.556  38.689  1.00 31.93  ? 186 ASN A CA  1 
ATOM   1474 C C   . ASN A 1 189 ? 9.555   -3.014  38.618  1.00 33.60  ? 186 ASN A C   1 
ATOM   1475 O O   . ASN A 1 189 ? 10.056  -3.561  39.594  1.00 27.99  ? 186 ASN A O   1 
ATOM   1476 C CB  . ASN A 1 189 ? 7.214   -3.799  38.637  1.00 29.39  ? 186 ASN A CB  1 
ATOM   1477 C CG  . ASN A 1 189 ? 5.763   -3.478  38.911  1.00 33.35  ? 186 ASN A CG  1 
ATOM   1478 O OD1 . ASN A 1 189 ? 5.389   -3.174  40.042  1.00 31.06  ? 186 ASN A OD1 1 
ATOM   1479 N ND2 . ASN A 1 189 ? 4.936   -3.530  37.872  1.00 32.88  ? 186 ASN A ND2 1 
ATOM   1480 N N   . ILE A 1 190 ? 10.240  -2.811  37.494  1.00 31.46  ? 187 ILE A N   1 
ATOM   1481 C CA  . ILE A 1 190 ? 11.561  -3.430  37.352  1.00 30.03  ? 187 ILE A CA  1 
ATOM   1482 C C   . ILE A 1 190 ? 12.596  -2.878  38.345  1.00 32.81  ? 187 ILE A C   1 
ATOM   1483 O O   . ILE A 1 190 ? 13.581  -3.553  38.664  1.00 31.10  ? 187 ILE A O   1 
ATOM   1484 C CB  . ILE A 1 190 ? 12.106  -3.292  35.903  1.00 29.73  ? 187 ILE A CB  1 
ATOM   1485 C CG1 . ILE A 1 190 ? 13.073  -4.438  35.602  1.00 28.77  ? 187 ILE A CG1 1 
ATOM   1486 C CG2 . ILE A 1 190 ? 12.740  -1.920  35.657  1.00 30.98  ? 187 ILE A CG2 1 
ATOM   1487 C CD1 . ILE A 1 190 ? 12.426  -5.810  35.682  1.00 28.48  ? 187 ILE A CD1 1 
ATOM   1488 N N   . ALA A 1 191 ? 12.362  -1.670  38.851  1.00 33.76  ? 188 ALA A N   1 
ATOM   1489 C CA  . ALA A 1 191 ? 13.277  -1.062  39.815  1.00 33.87  ? 188 ALA A CA  1 
ATOM   1490 C C   . ALA A 1 191 ? 13.363  -1.902  41.090  1.00 33.12  ? 188 ALA A C   1 
ATOM   1491 O O   . ALA A 1 191 ? 14.410  -1.965  41.727  1.00 35.29  ? 188 ALA A O   1 
ATOM   1492 C CB  . ALA A 1 191 ? 12.847  0.362   40.137  1.00 31.54  ? 188 ALA A CB  1 
ATOM   1493 N N   . ALA A 1 192 ? 12.271  -2.576  41.434  1.00 29.70  ? 189 ALA A N   1 
ATOM   1494 C CA  . ALA A 1 192 ? 12.245  -3.441  42.610  1.00 33.02  ? 189 ALA A CA  1 
ATOM   1495 C C   . ALA A 1 192 ? 13.209  -4.617  42.476  1.00 37.24  ? 189 ALA A C   1 
ATOM   1496 O O   . ALA A 1 192 ? 13.580  -5.243  43.470  1.00 34.72  ? 189 ALA A O   1 
ATOM   1497 C CB  . ALA A 1 192 ? 10.834  -3.946  42.859  1.00 34.10  ? 189 ALA A CB  1 
ATOM   1498 N N   . PHE A 1 193 ? 13.607  -4.916  41.242  1.00 32.62  ? 190 PHE A N   1 
ATOM   1499 C CA  . PHE A 1 193 ? 14.524  -6.017  40.968  1.00 29.74  ? 190 PHE A CA  1 
ATOM   1500 C C   . PHE A 1 193 ? 15.945  -5.520  40.723  1.00 32.45  ? 190 PHE A C   1 
ATOM   1501 O O   . PHE A 1 193 ? 16.853  -6.313  40.480  1.00 35.25  ? 190 PHE A O   1 
ATOM   1502 C CB  . PHE A 1 193 ? 14.056  -6.821  39.751  1.00 28.34  ? 190 PHE A CB  1 
ATOM   1503 C CG  . PHE A 1 193 ? 12.707  -7.456  39.917  1.00 26.31  ? 190 PHE A CG  1 
ATOM   1504 C CD1 . PHE A 1 193 ? 11.551  -6.741  39.649  1.00 27.84  ? 190 PHE A CD1 1 
ATOM   1505 C CD2 . PHE A 1 193 ? 12.596  -8.777  40.314  1.00 27.73  ? 190 PHE A CD2 1 
ATOM   1506 C CE1 . PHE A 1 193 ? 10.309  -7.329  39.789  1.00 27.29  ? 190 PHE A CE1 1 
ATOM   1507 C CE2 . PHE A 1 193 ? 11.357  -9.373  40.454  1.00 28.62  ? 190 PHE A CE2 1 
ATOM   1508 C CZ  . PHE A 1 193 ? 10.212  -8.648  40.193  1.00 31.50  ? 190 PHE A CZ  1 
ATOM   1509 N N   . GLY A 1 194 ? 16.132  -4.206  40.776  1.00 31.12  ? 191 GLY A N   1 
ATOM   1510 C CA  . GLY A 1 194 ? 17.428  -3.615  40.492  1.00 33.26  ? 191 GLY A CA  1 
ATOM   1511 C C   . GLY A 1 194 ? 17.584  -3.221  39.031  1.00 37.16  ? 191 GLY A C   1 
ATOM   1512 O O   . GLY A 1 194 ? 18.688  -2.921  38.575  1.00 34.77  ? 191 GLY A O   1 
ATOM   1513 N N   . GLY A 1 195 ? 16.476  -3.228  38.294  1.00 34.55  ? 192 GLY A N   1 
ATOM   1514 C CA  . GLY A 1 195 ? 16.484  -2.828  36.897  1.00 33.14  ? 192 GLY A CA  1 
ATOM   1515 C C   . GLY A 1 195 ? 16.259  -1.335  36.758  1.00 34.59  ? 192 GLY A C   1 
ATOM   1516 O O   . GLY A 1 195 ? 15.605  -0.715  37.593  1.00 32.59  ? 192 GLY A O   1 
ATOM   1517 N N   . ASP A 1 196 ? 16.811  -0.764  35.697  1.00 33.83  ? 193 ASP A N   1 
ATOM   1518 C CA  . ASP A 1 196 ? 16.700  0.657   35.404  1.00 34.15  ? 193 ASP A CA  1 
ATOM   1519 C C   . ASP A 1 196 ? 15.636  0.875   34.336  1.00 35.44  ? 193 ASP A C   1 
ATOM   1520 O O   . ASP A 1 196 ? 15.866  0.586   33.158  1.00 33.36  ? 193 ASP A O   1 
ATOM   1521 C CB  . ASP A 1 196 ? 18.053  1.202   34.939  1.00 33.72  ? 193 ASP A CB  1 
ATOM   1522 C CG  . ASP A 1 196 ? 18.029  2.691   34.641  1.00 37.35  ? 193 ASP A CG  1 
ATOM   1523 O OD1 . ASP A 1 196 ? 16.964  3.335   34.763  1.00 37.65  ? 193 ASP A OD1 1 
ATOM   1524 O OD2 . ASP A 1 196 ? 19.095  3.222   34.268  1.00 42.15  ? 193 ASP A OD2 1 
ATOM   1525 N N   . PRO A 1 197 ? 14.471  1.399   34.739  1.00 34.85  ? 194 PRO A N   1 
ATOM   1526 C CA  . PRO A 1 197 ? 13.389  1.640   33.776  1.00 33.80  ? 194 PRO A CA  1 
ATOM   1527 C C   . PRO A 1 197 ? 13.739  2.721   32.749  1.00 35.49  ? 194 PRO A C   1 
ATOM   1528 O O   . PRO A 1 197 ? 13.043  2.838   31.740  1.00 35.27  ? 194 PRO A O   1 
ATOM   1529 C CB  . PRO A 1 197 ? 12.223  2.085   34.662  1.00 34.06  ? 194 PRO A CB  1 
ATOM   1530 C CG  . PRO A 1 197 ? 12.882  2.662   35.884  1.00 32.88  ? 194 PRO A CG  1 
ATOM   1531 C CD  . PRO A 1 197 ? 14.112  1.830   36.103  1.00 34.68  ? 194 PRO A CD  1 
ATOM   1532 N N   . MET A 1 198 ? 14.796  3.491   32.996  1.00 34.44  ? 195 MET A N   1 
ATOM   1533 C CA  . MET A 1 198 ? 15.226  4.514   32.040  1.00 39.12  ? 195 MET A CA  1 
ATOM   1534 C C   . MET A 1 198 ? 16.286  3.979   31.075  1.00 36.68  ? 195 MET A C   1 
ATOM   1535 O O   . MET A 1 198 ? 16.830  4.727   30.262  1.00 37.12  ? 195 MET A O   1 
ATOM   1536 C CB  . MET A 1 198 ? 15.753  5.756   32.766  1.00 37.76  ? 195 MET A CB  1 
ATOM   1537 C CG  . MET A 1 198 ? 14.673  6.557   33.491  1.00 40.47  ? 195 MET A CG  1 
ATOM   1538 S SD  . MET A 1 198 ? 15.282  8.061   34.283  1.00 55.56  ? 195 MET A SD  1 
ATOM   1539 C CE  . MET A 1 198 ? 15.516  9.127   32.864  1.00 54.52  ? 195 MET A CE  1 
ATOM   1540 N N   . SER A 1 199 ? 16.576  2.685   31.166  1.00 35.57  ? 196 SER A N   1 
ATOM   1541 C CA  . SER A 1 199 ? 17.421  2.033   30.175  1.00 36.27  ? 196 SER A CA  1 
ATOM   1542 C C   . SER A 1 199 ? 16.857  0.660   29.829  1.00 37.47  ? 196 SER A C   1 
ATOM   1543 O O   . SER A 1 199 ? 17.275  -0.363  30.377  1.00 33.50  ? 196 SER A O   1 
ATOM   1544 C CB  . SER A 1 199 ? 18.862  1.910   30.661  1.00 38.74  ? 196 SER A CB  1 
ATOM   1545 O OG  . SER A 1 199 ? 19.700  1.484   29.593  1.00 40.02  ? 196 SER A OG  1 
ATOM   1546 N N   . VAL A 1 200 ? 15.898  0.659   28.911  1.00 34.46  ? 197 VAL A N   1 
ATOM   1547 C CA  . VAL A 1 200 ? 15.222  -0.558  28.499  1.00 31.13  ? 197 VAL A CA  1 
ATOM   1548 C C   . VAL A 1 200 ? 15.459  -0.794  27.011  1.00 34.17  ? 197 VAL A C   1 
ATOM   1549 O O   . VAL A 1 200 ? 15.195  0.076   26.187  1.00 32.67  ? 197 VAL A O   1 
ATOM   1550 C CB  . VAL A 1 200 ? 13.708  -0.490  28.786  1.00 32.26  ? 197 VAL A CB  1 
ATOM   1551 C CG1 . VAL A 1 200 ? 12.984  -1.640  28.114  1.00 32.13  ? 197 VAL A CG1 1 
ATOM   1552 C CG2 . VAL A 1 200 ? 13.444  -0.486  30.302  1.00 32.07  ? 197 VAL A CG2 1 
ATOM   1553 N N   . THR A 1 201 ? 15.978  -1.971  26.684  1.00 33.01  ? 198 THR A N   1 
ATOM   1554 C CA  . THR A 1 201 ? 16.254  -2.337  25.302  1.00 34.59  ? 198 THR A CA  1 
ATOM   1555 C C   . THR A 1 201 ? 15.368  -3.506  24.897  1.00 32.49  ? 198 THR A C   1 
ATOM   1556 O O   . THR A 1 201 ? 15.414  -4.563  25.519  1.00 30.94  ? 198 THR A O   1 
ATOM   1557 C CB  . THR A 1 201 ? 17.733  -2.721  25.104  1.00 34.10  ? 198 THR A CB  1 
ATOM   1558 O OG1 . THR A 1 201 ? 18.567  -1.608  25.444  1.00 32.01  ? 198 THR A OG1 1 
ATOM   1559 C CG2 . THR A 1 201 ? 18.002  -3.121  23.658  1.00 32.49  ? 198 THR A CG2 1 
ATOM   1560 N N   . LEU A 1 202 ? 14.543  -3.313  23.873  1.00 31.37  ? 199 LEU A N   1 
ATOM   1561 C CA  . LEU A 1 202 ? 13.751  -4.420  23.353  1.00 30.54  ? 199 LEU A CA  1 
ATOM   1562 C C   . LEU A 1 202 ? 14.598  -5.230  22.387  1.00 30.42  ? 199 LEU A C   1 
ATOM   1563 O O   . LEU A 1 202 ? 15.354  -4.661  21.596  1.00 33.06  ? 199 LEU A O   1 
ATOM   1564 C CB  . LEU A 1 202 ? 12.488  -3.925  22.643  1.00 28.65  ? 199 LEU A CB  1 
ATOM   1565 C CG  . LEU A 1 202 ? 11.553  -2.929  23.332  1.00 31.14  ? 199 LEU A CG  1 
ATOM   1566 C CD1 . LEU A 1 202 ? 10.311  -2.721  22.472  1.00 28.02  ? 199 LEU A CD1 1 
ATOM   1567 C CD2 . LEU A 1 202 ? 11.171  -3.384  24.743  1.00 27.28  ? 199 LEU A CD2 1 
ATOM   1568 N N   . PHE A 1 203 ? 14.484  -6.554  22.439  1.00 29.34  ? 200 PHE A N   1 
ATOM   1569 C CA  . PHE A 1 203 ? 15.046  -7.364  21.358  1.00 30.49  ? 200 PHE A CA  1 
ATOM   1570 C C   . PHE A 1 203 ? 14.187  -8.595  21.088  1.00 30.15  ? 200 PHE A C   1 
ATOM   1571 O O   . PHE A 1 203 ? 13.497  -9.106  21.964  1.00 28.57  ? 200 PHE A O   1 
ATOM   1572 C CB  . PHE A 1 203 ? 16.521  -7.742  21.631  1.00 29.63  ? 200 PHE A CB  1 
ATOM   1573 C CG  . PHE A 1 203 ? 16.744  -8.723  22.760  1.00 31.63  ? 200 PHE A CG  1 
ATOM   1574 C CD1 . PHE A 1 203 ? 17.558  -9.835  22.567  1.00 30.70  ? 200 PHE A CD1 1 
ATOM   1575 C CD2 . PHE A 1 203 ? 16.185  -8.523  24.009  1.00 27.71  ? 200 PHE A CD2 1 
ATOM   1576 C CE1 . PHE A 1 203 ? 17.794  -10.731 23.591  1.00 32.11  ? 200 PHE A CE1 1 
ATOM   1577 C CE2 . PHE A 1 203 ? 16.411  -9.419  25.039  1.00 33.25  ? 200 PHE A CE2 1 
ATOM   1578 C CZ  . PHE A 1 203 ? 17.212  -10.524 24.833  1.00 32.17  ? 200 PHE A CZ  1 
ATOM   1579 N N   . GLY A 1 204 ? 14.185  -9.025  19.832  1.00 28.61  ? 201 GLY A N   1 
ATOM   1580 C CA  . GLY A 1 204 ? 13.338  -10.118 19.410  1.00 27.19  ? 201 GLY A CA  1 
ATOM   1581 C C   . GLY A 1 204 ? 13.803  -10.655 18.075  1.00 27.51  ? 201 GLY A C   1 
ATOM   1582 O O   . GLY A 1 204 ? 14.580  -10.009 17.375  1.00 28.01  ? 201 GLY A O   1 
ATOM   1583 N N   . GLU A 1 205 ? 13.331  -11.847 17.734  1.00 29.84  ? 202 GLU A N   1 
ATOM   1584 C CA  . GLU A 1 205 ? 13.699  -12.481 16.481  1.00 27.07  ? 202 GLU A CA  1 
ATOM   1585 C C   . GLU A 1 205 ? 12.439  -12.834 15.705  1.00 29.25  ? 202 GLU A C   1 
ATOM   1586 O O   . GLU A 1 205 ? 11.417  -13.202 16.291  1.00 26.27  ? 202 GLU A O   1 
ATOM   1587 C CB  . GLU A 1 205 ? 14.562  -13.727 16.729  1.00 27.79  ? 202 GLU A CB  1 
ATOM   1588 C CG  . GLU A 1 205 ? 15.139  -14.372 15.457  1.00 29.58  ? 202 GLU A CG  1 
ATOM   1589 C CD  . GLU A 1 205 ? 14.280  -15.505 14.926  1.00 32.53  ? 202 GLU A CD  1 
ATOM   1590 O OE1 . GLU A 1 205 ? 13.343  -15.915 15.642  1.00 30.54  ? 202 GLU A OE1 1 
ATOM   1591 O OE2 . GLU A 1 205 ? 14.537  -15.987 13.793  1.00 35.11  ? 202 GLU A OE2 1 
ATOM   1592 N N   . SER A 1 206 ? 12.523  -12.688 14.384  1.00 30.36  ? 203 SER A N   1 
ATOM   1593 C CA  . SER A 1 206 ? 11.433  -13.010 13.468  1.00 32.02  ? 203 SER A CA  1 
ATOM   1594 C C   . SER A 1 206 ? 10.175  -12.191 13.764  1.00 27.17  ? 203 SER A C   1 
ATOM   1595 O O   . SER A 1 206 ? 10.202  -10.960 13.706  1.00 29.37  ? 203 SER A O   1 
ATOM   1596 C CB  . SER A 1 206 ? 11.129  -14.509 13.518  1.00 35.25  ? 203 SER A CB  1 
ATOM   1597 O OG  . SER A 1 206 ? 10.517  -14.940 12.311  1.00 41.01  ? 203 SER A OG  1 
ATOM   1598 N N   . ALA A 1 207 ? 9.072   -12.864 14.074  1.00 22.72  ? 204 ALA A N   1 
ATOM   1599 C CA  . ALA A 1 207 ? 7.848   -12.156 14.434  1.00 25.57  ? 204 ALA A CA  1 
ATOM   1600 C C   . ALA A 1 207 ? 8.056   -11.315 15.705  1.00 27.64  ? 204 ALA A C   1 
ATOM   1601 O O   . ALA A 1 207 ? 7.373   -10.313 15.911  1.00 26.77  ? 204 ALA A O   1 
ATOM   1602 C CB  . ALA A 1 207 ? 6.700   -13.135 14.622  1.00 27.44  ? 204 ALA A CB  1 
ATOM   1603 N N   . GLY A 1 208 ? 9.006   -11.715 16.543  1.00 24.79  ? 205 GLY A N   1 
ATOM   1604 C CA  . GLY A 1 208 ? 9.360   -10.923 17.714  1.00 28.19  ? 205 GLY A CA  1 
ATOM   1605 C C   . GLY A 1 208 ? 10.055  -9.633  17.308  1.00 30.21  ? 205 GLY A C   1 
ATOM   1606 O O   . GLY A 1 208 ? 9.850   -8.577  17.916  1.00 30.16  ? 205 GLY A O   1 
ATOM   1607 N N   . ALA A 1 209 ? 10.876  -9.724  16.264  1.00 28.41  ? 206 ALA A N   1 
ATOM   1608 C CA  . ALA A 1 209 ? 11.546  -8.558  15.688  1.00 29.61  ? 206 ALA A CA  1 
ATOM   1609 C C   . ALA A 1 209 ? 10.539  -7.629  15.021  1.00 27.81  ? 206 ALA A C   1 
ATOM   1610 O O   . ALA A 1 209 ? 10.605  -6.409  15.188  1.00 28.91  ? 206 ALA A O   1 
ATOM   1611 C CB  . ALA A 1 209 ? 12.611  -8.992  14.681  1.00 29.56  ? 206 ALA A CB  1 
ATOM   1612 N N   . ALA A 1 210 ? 9.615   -8.208  14.259  1.00 27.78  ? 207 ALA A N   1 
ATOM   1613 C CA  . ALA A 1 210 ? 8.523   -7.433  13.677  1.00 29.82  ? 207 ALA A CA  1 
ATOM   1614 C C   . ALA A 1 210 ? 7.737   -6.721  14.787  1.00 29.72  ? 207 ALA A C   1 
ATOM   1615 O O   . ALA A 1 210 ? 7.363   -5.556  14.643  1.00 29.92  ? 207 ALA A O   1 
ATOM   1616 C CB  . ALA A 1 210 ? 7.605   -8.329  12.855  1.00 27.43  ? 207 ALA A CB  1 
ATOM   1617 N N   . SER A 1 211 ? 7.503   -7.426  15.894  1.00 28.39  ? 208 SER A N   1 
ATOM   1618 C CA  . SER A 1 211 ? 6.837   -6.834  17.058  1.00 28.59  ? 208 SER A CA  1 
ATOM   1619 C C   . SER A 1 211 ? 7.600   -5.624  17.591  1.00 27.02  ? 208 SER A C   1 
ATOM   1620 O O   . SER A 1 211 ? 7.017   -4.559  17.839  1.00 30.77  ? 208 SER A O   1 
ATOM   1621 C CB  . SER A 1 211 ? 6.681   -7.871  18.175  1.00 29.06  ? 208 SER A CB  1 
ATOM   1622 O OG  . SER A 1 211 ? 5.717   -8.852  17.839  1.00 29.23  ? 208 SER A OG  1 
ATOM   1623 N N   . VAL A 1 212 ? 8.904   -5.797  17.782  1.00 25.32  ? 209 VAL A N   1 
ATOM   1624 C CA  . VAL A 1 212 ? 9.745   -4.707  18.263  1.00 27.35  ? 209 VAL A CA  1 
ATOM   1625 C C   . VAL A 1 212 ? 9.629   -3.504  17.327  1.00 29.87  ? 209 VAL A C   1 
ATOM   1626 O O   . VAL A 1 212 ? 9.438   -2.359  17.767  1.00 31.57  ? 209 VAL A O   1 
ATOM   1627 C CB  . VAL A 1 212 ? 11.217  -5.144  18.383  1.00 30.89  ? 209 VAL A CB  1 
ATOM   1628 C CG1 . VAL A 1 212 ? 12.124  -3.935  18.514  1.00 31.31  ? 209 VAL A CG1 1 
ATOM   1629 C CG2 . VAL A 1 212 ? 11.400  -6.097  19.568  1.00 28.91  ? 209 VAL A CG2 1 
ATOM   1630 N N   . GLY A 1 213 ? 9.709   -3.779  16.028  1.00 28.68  ? 210 GLY A N   1 
ATOM   1631 C CA  . GLY A 1 213 ? 9.557   -2.744  15.028  1.00 28.85  ? 210 GLY A CA  1 
ATOM   1632 C C   . GLY A 1 213 ? 8.233   -2.022  15.168  1.00 30.88  ? 210 GLY A C   1 
ATOM   1633 O O   . GLY A 1 213 ? 8.161   -0.806  15.013  1.00 32.72  ? 210 GLY A O   1 
ATOM   1634 N N   . MET A 1 214 ? 7.175   -2.761  15.474  1.00 26.79  ? 211 MET A N   1 
ATOM   1635 C CA  . MET A 1 214 ? 5.867   -2.132  15.588  1.00 29.90  ? 211 MET A CA  1 
ATOM   1636 C C   . MET A 1 214 ? 5.741   -1.295  16.860  1.00 32.46  ? 211 MET A C   1 
ATOM   1637 O O   . MET A 1 214 ? 4.968   -0.334  16.897  1.00 29.31  ? 211 MET A O   1 
ATOM   1638 C CB  . MET A 1 214 ? 4.773   -3.185  15.520  1.00 28.88  ? 211 MET A CB  1 
ATOM   1639 C CG  . MET A 1 214 ? 4.554   -3.659  14.069  1.00 35.52  ? 211 MET A CG  1 
ATOM   1640 S SD  . MET A 1 214 ? 3.536   -5.122  14.040  1.00 47.49  ? 211 MET A SD  1 
ATOM   1641 C CE  . MET A 1 214 ? 4.049   -5.837  12.479  1.00 30.59  ? 211 MET A CE  1 
ATOM   1642 N N   . HIS A 1 215 ? 6.495   -1.653  17.896  1.00 28.00  ? 212 HIS A N   1 
ATOM   1643 C CA  . HIS A 1 215 ? 6.550   -0.793  19.077  1.00 32.84  ? 212 HIS A CA  1 
ATOM   1644 C C   . HIS A 1 215 ? 7.296   0.496   18.758  1.00 33.33  ? 212 HIS A C   1 
ATOM   1645 O O   . HIS A 1 215 ? 6.938   1.561   19.257  1.00 33.82  ? 212 HIS A O   1 
ATOM   1646 C CB  . HIS A 1 215 ? 7.192   -1.515  20.254  1.00 26.74  ? 212 HIS A CB  1 
ATOM   1647 C CG  . HIS A 1 215 ? 6.329   -2.587  20.828  1.00 26.43  ? 212 HIS A CG  1 
ATOM   1648 N ND1 . HIS A 1 215 ? 5.093   -2.326  21.387  1.00 27.81  ? 212 HIS A ND1 1 
ATOM   1649 C CD2 . HIS A 1 215 ? 6.498   -3.926  20.905  1.00 28.08  ? 212 HIS A CD2 1 
ATOM   1650 C CE1 . HIS A 1 215 ? 4.549   -3.455  21.793  1.00 31.14  ? 212 HIS A CE1 1 
ATOM   1651 N NE2 . HIS A 1 215 ? 5.380   -4.447  21.508  1.00 32.29  ? 212 HIS A NE2 1 
ATOM   1652 N N   . ILE A 1 216 ? 8.325   0.397   17.920  1.00 33.15  ? 213 ILE A N   1 
ATOM   1653 C CA  . ILE A 1 216 ? 9.002   1.596   17.417  1.00 32.88  ? 213 ILE A CA  1 
ATOM   1654 C C   . ILE A 1 216 ? 8.018   2.518   16.685  1.00 34.87  ? 213 ILE A C   1 
ATOM   1655 O O   . ILE A 1 216 ? 8.107   3.741   16.784  1.00 36.99  ? 213 ILE A O   1 
ATOM   1656 C CB  . ILE A 1 216 ? 10.169  1.231   16.466  1.00 35.68  ? 213 ILE A CB  1 
ATOM   1657 C CG1 . ILE A 1 216 ? 11.309  0.577   17.248  1.00 31.46  ? 213 ILE A CG1 1 
ATOM   1658 C CG2 . ILE A 1 216 ? 10.685  2.461   15.719  1.00 34.41  ? 213 ILE A CG2 1 
ATOM   1659 C CD1 . ILE A 1 216 ? 12.440  0.074   16.381  1.00 33.11  ? 213 ILE A CD1 1 
ATOM   1660 N N   . LEU A 1 217 ? 7.061   1.926   15.978  1.00 35.31  ? 214 LEU A N   1 
ATOM   1661 C CA  . LEU A 1 217 ? 6.173   2.692   15.104  1.00 35.14  ? 214 LEU A CA  1 
ATOM   1662 C C   . LEU A 1 217 ? 4.840   3.059   15.748  1.00 35.98  ? 214 LEU A C   1 
ATOM   1663 O O   . LEU A 1 217 ? 3.972   3.629   15.091  1.00 36.90  ? 214 LEU A O   1 
ATOM   1664 C CB  . LEU A 1 217 ? 5.910   1.909   13.814  1.00 34.94  ? 214 LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 217 ? 7.143   1.585   12.973  1.00 34.46  ? 214 LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 217 ? 6.757   0.767   11.744  1.00 36.76  ? 214 LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 217 ? 7.868   2.864   12.575  1.00 33.66  ? 214 LEU A CD2 1 
ATOM   1668 N N   . SER A 1 218 ? 4.671   2.727   17.025  1.00 35.15  ? 215 SER A N   1 
ATOM   1669 C CA  . SER A 1 218 ? 3.429   3.032   17.724  1.00 35.02  ? 215 SER A CA  1 
ATOM   1670 C C   . SER A 1 218 ? 3.706   3.921   18.932  1.00 37.74  ? 215 SER A C   1 
ATOM   1671 O O   . SER A 1 218 ? 4.304   3.480   19.915  1.00 38.29  ? 215 SER A O   1 
ATOM   1672 C CB  . SER A 1 218 ? 2.721   1.747   18.153  1.00 33.10  ? 215 SER A CB  1 
ATOM   1673 O OG  . SER A 1 218 ? 1.402   2.012   18.601  1.00 34.58  ? 215 SER A OG  1 
ATOM   1674 N N   . LEU A 1 219 ? 3.256   5.169   18.851  1.00 37.03  ? 216 LEU A N   1 
ATOM   1675 C CA  . LEU A 1 219 ? 3.600   6.193   19.839  1.00 43.23  ? 216 LEU A CA  1 
ATOM   1676 C C   . LEU A 1 219 ? 3.415   5.790   21.310  1.00 36.34  ? 216 LEU A C   1 
ATOM   1677 O O   . LEU A 1 219 ? 4.321   6.016   22.106  1.00 42.76  ? 216 LEU A O   1 
ATOM   1678 C CB  . LEU A 1 219 ? 2.813   7.475   19.557  1.00 45.79  ? 216 LEU A CB  1 
ATOM   1679 C CG  . LEU A 1 219 ? 3.705   8.643   19.131  1.00 55.47  ? 216 LEU A CG  1 
ATOM   1680 C CD1 . LEU A 1 219 ? 2.882   9.779   18.538  1.00 61.04  ? 216 LEU A CD1 1 
ATOM   1681 C CD2 . LEU A 1 219 ? 4.532   9.136   20.315  1.00 50.94  ? 216 LEU A CD2 1 
ATOM   1682 N N   . PRO A 1 220 ? 2.268   5.181   21.680  1.00 36.10  ? 217 PRO A N   1 
ATOM   1683 C CA  . PRO A 1 220 ? 2.139   4.825   23.102  1.00 38.11  ? 217 PRO A CA  1 
ATOM   1684 C C   . PRO A 1 220 ? 3.235   3.879   23.607  1.00 40.63  ? 217 PRO A C   1 
ATOM   1685 O O   . PRO A 1 220 ? 3.528   3.897   24.796  1.00 37.76  ? 217 PRO A O   1 
ATOM   1686 C CB  . PRO A 1 220 ? 0.766   4.144   23.172  1.00 37.71  ? 217 PRO A CB  1 
ATOM   1687 C CG  . PRO A 1 220 ? 0.016   4.684   22.012  1.00 37.36  ? 217 PRO A CG  1 
ATOM   1688 C CD  . PRO A 1 220 ? 1.034   4.878   20.932  1.00 37.49  ? 217 PRO A CD  1 
ATOM   1689 N N   . SER A 1 221 ? 3.834   3.081   22.724  1.00 38.90  ? 218 SER A N   1 
ATOM   1690 C CA  . SER A 1 221 ? 4.910   2.170   23.127  1.00 35.06  ? 218 SER A CA  1 
ATOM   1691 C C   . SER A 1 221 ? 6.245   2.888   23.317  1.00 36.58  ? 218 SER A C   1 
ATOM   1692 O O   . SER A 1 221 ? 7.114   2.405   24.044  1.00 32.72  ? 218 SER A O   1 
ATOM   1693 C CB  . SER A 1 221 ? 5.095   1.050   22.090  1.00 31.15  ? 218 SER A CB  1 
ATOM   1694 O OG  . SER A 1 221 ? 4.014   0.135   22.104  1.00 31.92  ? 218 SER A OG  1 
ATOM   1695 N N   . ARG A 1 222 ? 6.406   4.032   22.656  1.00 36.73  ? 219 ARG A N   1 
ATOM   1696 C CA  . ARG A 1 222 ? 7.707   4.695   22.560  1.00 38.31  ? 219 ARG A CA  1 
ATOM   1697 C C   . ARG A 1 222 ? 8.248   5.221   23.881  1.00 40.88  ? 219 ARG A C   1 
ATOM   1698 O O   . ARG A 1 222 ? 9.460   5.355   24.049  1.00 44.03  ? 219 ARG A O   1 
ATOM   1699 C CB  . ARG A 1 222 ? 7.640   5.849   21.559  1.00 43.93  ? 219 ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 222 ? 7.634   5.411   20.115  1.00 37.85  ? 219 ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 222 ? 8.868   4.576   19.783  1.00 42.18  ? 219 ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 222 ? 10.106  5.337   19.929  1.00 43.22  ? 219 ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 222 ? 10.646  6.082   18.971  1.00 49.09  ? 219 ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 222 ? 10.067  6.164   17.778  1.00 48.05  ? 219 ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 222 ? 11.774  6.740   19.204  1.00 54.15  ? 219 ARG A NH2 1 
ATOM   1706 N N   . SER A 1 223 ? 7.361   5.527   24.819  1.00 39.58  ? 220 SER A N   1 
ATOM   1707 C CA  . SER A 1 223 ? 7.802   6.014   26.113  1.00 42.58  ? 220 SER A CA  1 
ATOM   1708 C C   . SER A 1 223 ? 8.130   4.848   27.035  1.00 42.61  ? 220 SER A C   1 
ATOM   1709 O O   . SER A 1 223 ? 8.403   5.047   28.211  1.00 39.25  ? 220 SER A O   1 
ATOM   1710 C CB  . SER A 1 223 ? 6.736   6.907   26.752  1.00 43.32  ? 220 SER A CB  1 
ATOM   1711 O OG  . SER A 1 223 ? 5.550   6.177   27.015  1.00 45.90  ? 220 SER A OG  1 
ATOM   1712 N N   . LEU A 1 224 ? 8.110   3.630   26.497  1.00 37.27  ? 221 LEU A N   1 
ATOM   1713 C CA  . LEU A 1 224 ? 8.304   2.444   27.324  1.00 34.35  ? 221 LEU A CA  1 
ATOM   1714 C C   . LEU A 1 224 ? 9.635   1.746   27.074  1.00 33.61  ? 221 LEU A C   1 
ATOM   1715 O O   . LEU A 1 224 ? 9.927   0.726   27.698  1.00 36.60  ? 221 LEU A O   1 
ATOM   1716 C CB  . LEU A 1 224 ? 7.163   1.453   27.102  1.00 34.35  ? 221 LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 224 ? 5.743   1.962   27.357  1.00 36.64  ? 221 LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 224 ? 4.731   0.885   27.008  1.00 33.99  ? 221 LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 224 ? 5.562   2.429   28.813  1.00 31.45  ? 221 LEU A CD2 1 
ATOM   1720 N N   . PHE A 1 225 ? 10.436  2.284   26.162  1.00 33.12  ? 222 PHE A N   1 
ATOM   1721 C CA  . PHE A 1 225 ? 11.756  1.723   25.900  1.00 34.16  ? 222 PHE A CA  1 
ATOM   1722 C C   . PHE A 1 225 ? 12.657  2.756   25.242  1.00 35.28  ? 222 PHE A C   1 
ATOM   1723 O O   . PHE A 1 225 ? 12.197  3.815   24.818  1.00 37.92  ? 222 PHE A O   1 
ATOM   1724 C CB  . PHE A 1 225 ? 11.658  0.455   25.031  1.00 33.07  ? 222 PHE A CB  1 
ATOM   1725 C CG  . PHE A 1 225 ? 11.177  0.699   23.623  1.00 29.29  ? 222 PHE A CG  1 
ATOM   1726 C CD1 . PHE A 1 225 ? 9.826   0.842   23.353  1.00 30.51  ? 222 PHE A CD1 1 
ATOM   1727 C CD2 . PHE A 1 225 ? 12.073  0.745   22.568  1.00 33.19  ? 222 PHE A CD2 1 
ATOM   1728 C CE1 . PHE A 1 225 ? 9.377   1.047   22.051  1.00 34.50  ? 222 PHE A CE1 1 
ATOM   1729 C CE2 . PHE A 1 225 ? 11.632  0.948   21.264  1.00 33.83  ? 222 PHE A CE2 1 
ATOM   1730 C CZ  . PHE A 1 225 ? 10.283  1.102   21.009  1.00 31.10  ? 222 PHE A CZ  1 
ATOM   1731 N N   . HIS A 1 226 ? 13.943  2.442   25.154  1.00 35.54  ? 223 HIS A N   1 
ATOM   1732 C CA  . HIS A 1 226 ? 14.919  3.422   24.699  1.00 39.31  ? 223 HIS A CA  1 
ATOM   1733 C C   . HIS A 1 226 ? 15.764  2.938   23.524  1.00 37.45  ? 223 HIS A C   1 
ATOM   1734 O O   . HIS A 1 226 ? 16.241  3.747   22.739  1.00 41.27  ? 223 HIS A O   1 
ATOM   1735 C CB  . HIS A 1 226 ? 15.806  3.818   25.877  1.00 35.63  ? 223 HIS A CB  1 
ATOM   1736 C CG  . HIS A 1 226 ? 15.022  4.168   27.101  1.00 42.28  ? 223 HIS A CG  1 
ATOM   1737 N ND1 . HIS A 1 226 ? 14.630  3.224   28.028  1.00 39.57  ? 223 HIS A ND1 1 
ATOM   1738 C CD2 . HIS A 1 226 ? 14.506  5.347   27.521  1.00 42.11  ? 223 HIS A CD2 1 
ATOM   1739 C CE1 . HIS A 1 226 ? 13.922  3.811   28.975  1.00 40.88  ? 223 HIS A CE1 1 
ATOM   1740 N NE2 . HIS A 1 226 ? 13.839  5.101   28.697  1.00 43.29  ? 223 HIS A NE2 1 
ATOM   1741 N N   . ARG A 1 227 ? 15.946  1.626   23.411  1.00 39.59  ? 224 ARG A N   1 
ATOM   1742 C CA  . ARG A 1 227 ? 16.700  1.046   22.299  1.00 36.67  ? 224 ARG A CA  1 
ATOM   1743 C C   . ARG A 1 227 ? 16.055  -0.248  21.827  1.00 35.51  ? 224 ARG A C   1 
ATOM   1744 O O   . ARG A 1 227 ? 15.258  -0.848  22.546  1.00 36.19  ? 224 ARG A O   1 
ATOM   1745 C CB  . ARG A 1 227 ? 18.152  0.798   22.706  1.00 39.48  ? 224 ARG A CB  1 
ATOM   1746 C CG  . ARG A 1 227 ? 18.992  2.057   22.721  1.00 49.14  ? 224 ARG A CG  1 
ATOM   1747 C CD  . ARG A 1 227 ? 20.326  1.830   23.401  1.00 43.41  ? 224 ARG A CD  1 
ATOM   1748 N NE  . ARG A 1 227 ? 20.156  1.591   24.820  1.00 49.57  ? 224 ARG A NE  1 
ATOM   1749 C CZ  . ARG A 1 227 ? 19.963  2.549   25.719  1.00 50.83  ? 224 ARG A CZ  1 
ATOM   1750 N NH1 . ARG A 1 227 ? 19.923  3.822   25.345  1.00 51.69  ? 224 ARG A NH1 1 
ATOM   1751 N NH2 . ARG A 1 227 ? 19.810  2.230   26.993  1.00 45.84  ? 224 ARG A NH2 1 
ATOM   1752 N N   . ALA A 1 228 ? 16.407  -0.687  20.623  1.00 31.53  ? 225 ALA A N   1 
ATOM   1753 C CA  . ALA A 1 228 ? 15.750  -1.846  20.039  1.00 31.46  ? 225 ALA A CA  1 
ATOM   1754 C C   . ALA A 1 228 ? 16.699  -2.690  19.201  1.00 35.48  ? 225 ALA A C   1 
ATOM   1755 O O   . ALA A 1 228 ? 17.611  -2.170  18.557  1.00 33.31  ? 225 ALA A O   1 
ATOM   1756 C CB  . ALA A 1 228 ? 14.569  -1.399  19.197  1.00 35.16  ? 225 ALA A CB  1 
ATOM   1757 N N   . VAL A 1 229 ? 16.471  -4.000  19.221  1.00 33.46  ? 226 VAL A N   1 
ATOM   1758 C CA  . VAL A 1 229 ? 17.224  -4.938  18.404  1.00 29.08  ? 226 VAL A CA  1 
ATOM   1759 C C   . VAL A 1 229 ? 16.256  -5.794  17.596  1.00 33.43  ? 226 VAL A C   1 
ATOM   1760 O O   . VAL A 1 229 ? 15.363  -6.425  18.158  1.00 29.10  ? 226 VAL A O   1 
ATOM   1761 C CB  . VAL A 1 229 ? 18.130  -5.857  19.253  1.00 32.24  ? 226 VAL A CB  1 
ATOM   1762 C CG1 . VAL A 1 229 ? 18.975  -6.756  18.362  1.00 35.49  ? 226 VAL A CG1 1 
ATOM   1763 C CG2 . VAL A 1 229 ? 19.012  -5.038  20.192  1.00 33.66  ? 226 VAL A CG2 1 
ATOM   1764 N N   . LEU A 1 230 ? 16.434  -5.805  16.277  1.00 27.90  ? 227 LEU A N   1 
ATOM   1765 C CA  . LEU A 1 230 ? 15.580  -6.585  15.390  1.00 32.02  ? 227 LEU A CA  1 
ATOM   1766 C C   . LEU A 1 230 ? 16.386  -7.668  14.684  1.00 33.23  ? 227 LEU A C   1 
ATOM   1767 O O   . LEU A 1 230 ? 17.180  -7.374  13.789  1.00 32.52  ? 227 LEU A O   1 
ATOM   1768 C CB  . LEU A 1 230 ? 14.896  -5.686  14.348  1.00 30.20  ? 227 LEU A CB  1 
ATOM   1769 C CG  . LEU A 1 230 ? 13.785  -4.749  14.836  1.00 32.02  ? 227 LEU A CG  1 
ATOM   1770 C CD1 . LEU A 1 230 ? 14.354  -3.484  15.484  1.00 30.70  ? 227 LEU A CD1 1 
ATOM   1771 C CD2 . LEU A 1 230 ? 12.824  -4.404  13.706  1.00 29.67  ? 227 LEU A CD2 1 
ATOM   1772 N N   . GLN A 1 231 ? 16.162  -8.914  15.084  1.00 31.90  ? 228 GLN A N   1 
ATOM   1773 C CA  . GLN A 1 231 ? 16.885  -10.057 14.541  1.00 29.50  ? 228 GLN A CA  1 
ATOM   1774 C C   . GLN A 1 231 ? 16.019  -10.802 13.530  1.00 30.61  ? 228 GLN A C   1 
ATOM   1775 O O   . GLN A 1 231 ? 15.041  -11.442 13.906  1.00 30.06  ? 228 GLN A O   1 
ATOM   1776 C CB  . GLN A 1 231 ? 17.317  -11.010 15.672  1.00 28.74  ? 228 GLN A CB  1 
ATOM   1777 C CG  . GLN A 1 231 ? 18.157  -10.348 16.767  1.00 27.88  ? 228 GLN A CG  1 
ATOM   1778 C CD  . GLN A 1 231 ? 18.388  -11.242 17.981  1.00 31.98  ? 228 GLN A CD  1 
ATOM   1779 O OE1 . GLN A 1 231 ? 18.643  -10.751 19.083  1.00 30.22  ? 228 GLN A OE1 1 
ATOM   1780 N NE2 . GLN A 1 231 ? 18.306  -12.554 17.783  1.00 30.43  ? 228 GLN A NE2 1 
ATOM   1781 N N   . SER A 1 232 ? 16.370  -10.703 12.250  1.00 32.11  ? 229 SER A N   1 
ATOM   1782 C CA  . SER A 1 232 ? 15.692  -11.469 11.201  1.00 29.45  ? 229 SER A CA  1 
ATOM   1783 C C   . SER A 1 232 ? 14.195  -11.207 11.126  1.00 27.63  ? 229 SER A C   1 
ATOM   1784 O O   . SER A 1 232 ? 13.412  -12.142 10.987  1.00 29.71  ? 229 SER A O   1 
ATOM   1785 C CB  . SER A 1 232 ? 15.914  -12.968 11.407  1.00 28.56  ? 229 SER A CB  1 
ATOM   1786 O OG  . SER A 1 232 ? 17.288  -13.292 11.359  1.00 30.85  ? 229 SER A OG  1 
ATOM   1787 N N   . GLY A 1 233 ? 13.797  -9.944  11.222  1.00 29.58  ? 230 GLY A N   1 
ATOM   1788 C CA  . GLY A 1 233 ? 12.394  -9.589  11.115  1.00 27.63  ? 230 GLY A CA  1 
ATOM   1789 C C   . GLY A 1 233 ? 12.182  -8.090  11.151  1.00 29.88  ? 230 GLY A C   1 
ATOM   1790 O O   . GLY A 1 233 ? 13.001  -7.351  11.698  1.00 31.16  ? 230 GLY A O   1 
ATOM   1791 N N   . THR A 1 234 ? 11.077  -7.642  10.563  1.00 30.40  ? 231 THR A N   1 
ATOM   1792 C CA  . THR A 1 234 ? 10.798  -6.223  10.382  1.00 28.27  ? 231 THR A CA  1 
ATOM   1793 C C   . THR A 1 234 ? 9.300   -5.992  10.441  1.00 28.59  ? 231 THR A C   1 
ATOM   1794 O O   . THR A 1 234 ? 8.531   -6.899  10.143  1.00 30.61  ? 231 THR A O   1 
ATOM   1795 C CB  . THR A 1 234 ? 11.317  -5.705  9.018   1.00 32.64  ? 231 THR A CB  1 
ATOM   1796 O OG1 . THR A 1 234 ? 10.784  -6.531  7.976   1.00 29.49  ? 231 THR A OG1 1 
ATOM   1797 C CG2 . THR A 1 234 ? 12.835  -5.727  8.954   1.00 30.81  ? 231 THR A CG2 1 
ATOM   1798 N N   . PRO A 1 235 ? 8.874   -4.776  10.814  1.00 29.45  ? 232 PRO A N   1 
ATOM   1799 C CA  . PRO A 1 235 ? 7.437   -4.482  10.764  1.00 30.33  ? 232 PRO A CA  1 
ATOM   1800 C C   . PRO A 1 235 ? 6.980   -4.295  9.321   1.00 31.16  ? 232 PRO A C   1 
ATOM   1801 O O   . PRO A 1 235 ? 5.839   -4.607  8.976   1.00 29.93  ? 232 PRO A O   1 
ATOM   1802 C CB  . PRO A 1 235 ? 7.311   -3.181  11.565  1.00 29.63  ? 232 PRO A CB  1 
ATOM   1803 C CG  . PRO A 1 235 ? 8.645   -2.530  11.429  1.00 31.39  ? 232 PRO A CG  1 
ATOM   1804 C CD  . PRO A 1 235 ? 9.660   -3.642  11.334  1.00 28.04  ? 232 PRO A CD  1 
ATOM   1805 N N   . ASN A 1 236 ? 7.876   -3.778  8.489   1.00 31.42  ? 233 ASN A N   1 
ATOM   1806 C CA  . ASN A 1 236 ? 7.635   -3.719  7.055   1.00 33.13  ? 233 ASN A CA  1 
ATOM   1807 C C   . ASN A 1 236 ? 7.843   -5.095  6.441   1.00 34.94  ? 233 ASN A C   1 
ATOM   1808 O O   . ASN A 1 236 ? 8.253   -6.034  7.125   1.00 33.98  ? 233 ASN A O   1 
ATOM   1809 C CB  . ASN A 1 236 ? 8.553   -2.690  6.395   1.00 36.17  ? 233 ASN A CB  1 
ATOM   1810 C CG  . ASN A 1 236 ? 10.008  -2.886  6.773   1.00 37.21  ? 233 ASN A CG  1 
ATOM   1811 O OD1 . ASN A 1 236 ? 10.392  -2.694  7.929   1.00 33.64  ? 233 ASN A OD1 1 
ATOM   1812 N ND2 . ASN A 1 236 ? 10.827  -3.264  5.799   1.00 31.33  ? 233 ASN A ND2 1 
ATOM   1813 N N   . GLY A 1 237 ? 7.560   -5.220  5.152   1.00 33.43  ? 234 GLY A N   1 
ATOM   1814 C CA  . GLY A 1 237 ? 7.700   -6.499  4.488   1.00 37.33  ? 234 GLY A CA  1 
ATOM   1815 C C   . GLY A 1 237 ? 6.358   -7.159  4.257   1.00 36.18  ? 234 GLY A C   1 
ATOM   1816 O O   . GLY A 1 237 ? 5.325   -6.649  4.692   1.00 35.48  ? 234 GLY A O   1 
ATOM   1817 N N   . PRO A 1 238 ? 6.370   -8.316  3.585   1.00 35.66  ? 235 PRO A N   1 
ATOM   1818 C CA  . PRO A 1 238 ? 5.141   -8.913  3.059   1.00 31.44  ? 235 PRO A CA  1 
ATOM   1819 C C   . PRO A 1 238 ? 4.334   -9.776  4.029   1.00 32.58  ? 235 PRO A C   1 
ATOM   1820 O O   . PRO A 1 238 ? 3.193   -10.084 3.691   1.00 33.40  ? 235 PRO A O   1 
ATOM   1821 C CB  . PRO A 1 238 ? 5.656   -9.772  1.902   1.00 34.79  ? 235 PRO A CB  1 
ATOM   1822 C CG  . PRO A 1 238 ? 7.018   -10.177 2.324   1.00 33.37  ? 235 PRO A CG  1 
ATOM   1823 C CD  . PRO A 1 238 ? 7.574   -9.049  3.152   1.00 35.05  ? 235 PRO A CD  1 
ATOM   1824 N N   . TRP A 1 239 ? 4.878   -10.150 5.188   1.00 31.12  ? 236 TRP A N   1 
ATOM   1825 C CA  . TRP A 1 239 ? 4.192   -11.109 6.061   1.00 31.86  ? 236 TRP A CA  1 
ATOM   1826 C C   . TRP A 1 239 ? 3.777   -10.564 7.442   1.00 29.50  ? 236 TRP A C   1 
ATOM   1827 O O   . TRP A 1 239 ? 2.912   -11.147 8.097   1.00 28.20  ? 236 TRP A O   1 
ATOM   1828 C CB  . TRP A 1 239 ? 5.071   -12.358 6.268   1.00 29.73  ? 236 TRP A CB  1 
ATOM   1829 C CG  . TRP A 1 239 ? 6.436   -12.041 6.825   1.00 31.74  ? 236 TRP A CG  1 
ATOM   1830 C CD1 . TRP A 1 239 ? 7.580   -11.814 6.112   1.00 31.45  ? 236 TRP A CD1 1 
ATOM   1831 C CD2 . TRP A 1 239 ? 6.794   -11.894 8.213   1.00 32.27  ? 236 TRP A CD2 1 
ATOM   1832 N NE1 . TRP A 1 239 ? 8.624   -11.537 6.966   1.00 34.55  ? 236 TRP A NE1 1 
ATOM   1833 C CE2 . TRP A 1 239 ? 8.170   -11.585 8.258   1.00 32.15  ? 236 TRP A CE2 1 
ATOM   1834 C CE3 . TRP A 1 239 ? 6.087   -12.002 9.416   1.00 30.66  ? 236 TRP A CE3 1 
ATOM   1835 C CZ2 . TRP A 1 239 ? 8.851   -11.373 9.462   1.00 32.67  ? 236 TRP A CZ2 1 
ATOM   1836 C CZ3 . TRP A 1 239 ? 6.766   -11.796 10.611  1.00 32.05  ? 236 TRP A CZ3 1 
ATOM   1837 C CH2 . TRP A 1 239 ? 8.133   -11.486 10.624  1.00 32.04  ? 236 TRP A CH2 1 
ATOM   1838 N N   . ALA A 1 240 ? 4.382   -9.467  7.892   1.00 28.07  ? 237 ALA A N   1 
ATOM   1839 C CA  . ALA A 1 240 ? 4.202   -9.044  9.292   1.00 33.92  ? 237 ALA A CA  1 
ATOM   1840 C C   . ALA A 1 240 ? 2.877   -8.325  9.559   1.00 34.63  ? 237 ALA A C   1 
ATOM   1841 O O   . ALA A 1 240 ? 2.437   -8.243  10.706  1.00 33.01  ? 237 ALA A O   1 
ATOM   1842 C CB  . ALA A 1 240 ? 5.368   -8.161  9.732   1.00 29.03  ? 237 ALA A CB  1 
ATOM   1843 N N   . THR A 1 241 ? 2.251   -7.792  8.513   1.00 30.80  ? 238 THR A N   1 
ATOM   1844 C CA  . THR A 1 241 ? 0.960   -7.126  8.670   1.00 28.98  ? 238 THR A CA  1 
ATOM   1845 C C   . THR A 1 241 ? -0.043  -7.535  7.606   1.00 33.06  ? 238 THR A C   1 
ATOM   1846 O O   . THR A 1 241 ? 0.328   -7.967  6.516   1.00 33.48  ? 238 THR A O   1 
ATOM   1847 C CB  . THR A 1 241 ? 1.083   -5.582  8.615   1.00 31.94  ? 238 THR A CB  1 
ATOM   1848 O OG1 . THR A 1 241 ? 1.673   -5.185  7.370   1.00 34.44  ? 238 THR A OG1 1 
ATOM   1849 C CG2 . THR A 1 241 ? 1.924   -5.053  9.763   1.00 29.19  ? 238 THR A CG2 1 
ATOM   1850 N N   . VAL A 1 242 ? -1.320  -7.383  7.935   1.00 34.39  ? 239 VAL A N   1 
ATOM   1851 C CA  . VAL A 1 242 ? -2.385  -7.453  6.947   1.00 33.80  ? 239 VAL A CA  1 
ATOM   1852 C C   . VAL A 1 242 ? -3.196  -6.169  7.013   1.00 38.31  ? 239 VAL A C   1 
ATOM   1853 O O   . VAL A 1 242 ? -3.173  -5.461  8.024   1.00 35.11  ? 239 VAL A O   1 
ATOM   1854 C CB  . VAL A 1 242 ? -3.321  -8.656  7.170   1.00 35.70  ? 239 VAL A CB  1 
ATOM   1855 C CG1 . VAL A 1 242 ? -2.628  -9.958  6.784   1.00 34.90  ? 239 VAL A CG1 1 
ATOM   1856 C CG2 . VAL A 1 242 ? -3.822  -8.689  8.618   1.00 31.84  ? 239 VAL A CG2 1 
ATOM   1857 N N   . SER A 1 243 ? -3.906  -5.868  5.933   1.00 34.24  ? 240 SER A N   1 
ATOM   1858 C CA  . SER A 1 243 ? -4.820  -4.737  5.915   1.00 34.96  ? 240 SER A CA  1 
ATOM   1859 C C   . SER A 1 243 ? -6.086  -5.085  6.682   1.00 33.88  ? 240 SER A C   1 
ATOM   1860 O O   . SER A 1 243 ? -6.345  -6.256  6.965   1.00 36.81  ? 240 SER A O   1 
ATOM   1861 C CB  . SER A 1 243 ? -5.170  -4.346  4.476   1.00 34.88  ? 240 SER A CB  1 
ATOM   1862 O OG  . SER A 1 243 ? -6.016  -5.323  3.898   1.00 35.56  ? 240 SER A OG  1 
ATOM   1863 N N   . ALA A 1 244 ? -6.878  -4.069  7.005   1.00 37.70  ? 241 ALA A N   1 
ATOM   1864 C CA  . ALA A 1 244 ? -8.120  -4.268  7.743   1.00 38.05  ? 241 ALA A CA  1 
ATOM   1865 C C   . ALA A 1 244 ? -9.102  -5.145  6.970   1.00 36.48  ? 241 ALA A C   1 
ATOM   1866 O O   . ALA A 1 244 ? -9.758  -6.015  7.547   1.00 38.47  ? 241 ALA A O   1 
ATOM   1867 C CB  . ALA A 1 244 ? -8.756  -2.922  8.073   1.00 39.02  ? 241 ALA A CB  1 
ATOM   1868 N N   . GLY A 1 245 ? -9.201  -4.914  5.664   1.00 38.82  ? 242 GLY A N   1 
ATOM   1869 C CA  . GLY A 1 245 ? -10.097 -5.690  4.824   1.00 36.93  ? 242 GLY A CA  1 
ATOM   1870 C C   . GLY A 1 245 ? -9.727  -7.161  4.788   1.00 35.73  ? 242 GLY A C   1 
ATOM   1871 O O   . GLY A 1 245 ? -10.593 -8.038  4.843   1.00 38.67  ? 242 GLY A O   1 
ATOM   1872 N N   . GLU A 1 246 ? -8.431  -7.435  4.708   1.00 32.69  ? 243 GLU A N   1 
ATOM   1873 C CA  . GLU A 1 246 ? -7.952  -8.808  4.658   1.00 36.69  ? 243 GLU A CA  1 
ATOM   1874 C C   . GLU A 1 246 ? -8.122  -9.496  6.016   1.00 37.19  ? 243 GLU A C   1 
ATOM   1875 O O   . GLU A 1 246 ? -8.468  -10.677 6.079   1.00 37.27  ? 243 GLU A O   1 
ATOM   1876 C CB  . GLU A 1 246 ? -6.489  -8.843  4.202   1.00 35.33  ? 243 GLU A CB  1 
ATOM   1877 C CG  . GLU A 1 246 ? -5.849  -10.225 4.198   1.00 36.64  ? 243 GLU A CG  1 
ATOM   1878 C CD  . GLU A 1 246 ? -6.409  -11.139 3.119   1.00 41.77  ? 243 GLU A CD  1 
ATOM   1879 O OE1 . GLU A 1 246 ? -7.216  -10.675 2.289   1.00 41.77  ? 243 GLU A OE1 1 
ATOM   1880 O OE2 . GLU A 1 246 ? -6.042  -12.332 3.101   1.00 40.14  ? 243 GLU A OE2 1 
ATOM   1881 N N   . ALA A 1 247 ? -7.894  -8.755  7.100   1.00 35.70  ? 244 ALA A N   1 
ATOM   1882 C CA  . ALA A 1 247 ? -8.121  -9.293  8.440   1.00 35.93  ? 244 ALA A CA  1 
ATOM   1883 C C   . ALA A 1 247 ? -9.587  -9.675  8.601   1.00 34.79  ? 244 ALA A C   1 
ATOM   1884 O O   . ALA A 1 247 ? -9.905  -10.773 9.061   1.00 32.47  ? 244 ALA A O   1 
ATOM   1885 C CB  . ALA A 1 247 ? -7.709  -8.281  9.513   1.00 32.34  ? 244 ALA A CB  1 
ATOM   1886 N N   . ARG A 1 248 ? -10.475 -8.768  8.200   1.00 38.83  ? 245 ARG A N   1 
ATOM   1887 C CA  . ARG A 1 248 ? -11.912 -9.018  8.284   1.00 39.90  ? 245 ARG A CA  1 
ATOM   1888 C C   . ARG A 1 248 ? -12.294 -10.246 7.454   1.00 36.88  ? 245 ARG A C   1 
ATOM   1889 O O   . ARG A 1 248 ? -13.063 -11.102 7.908   1.00 36.08  ? 245 ARG A O   1 
ATOM   1890 C CB  . ARG A 1 248 ? -12.698 -7.784  7.826   1.00 39.99  ? 245 ARG A CB  1 
ATOM   1891 C CG  . ARG A 1 248 ? -14.204 -8.002  7.697   1.00 40.98  ? 245 ARG A CG  1 
ATOM   1892 C CD  . ARG A 1 248 ? -14.951 -6.675  7.579   1.00 42.22  ? 245 ARG A CD  1 
ATOM   1893 N NE  . ARG A 1 248 ? -14.877 -5.888  8.810   1.00 40.44  ? 245 ARG A NE  1 
ATOM   1894 C CZ  . ARG A 1 248 ? -15.654 -6.078  9.873   1.00 42.70  ? 245 ARG A CZ  1 
ATOM   1895 N NH1 . ARG A 1 248 ? -16.569 -7.038  9.869   1.00 40.20  ? 245 ARG A NH1 1 
ATOM   1896 N NH2 . ARG A 1 248 ? -15.510 -5.313  10.948  1.00 44.92  ? 245 ARG A NH2 1 
ATOM   1897 N N   . ARG A 1 249 ? -11.737 -10.333 6.248   1.00 36.86  ? 246 ARG A N   1 
ATOM   1898 C CA  . ARG A 1 249 ? -11.969 -11.485 5.380   1.00 38.16  ? 246 ARG A CA  1 
ATOM   1899 C C   . ARG A 1 249 ? -11.584 -12.790 6.085   1.00 37.89  ? 246 ARG A C   1 
ATOM   1900 O O   . ARG A 1 249 ? -12.390 -13.724 6.188   1.00 34.72  ? 246 ARG A O   1 
ATOM   1901 C CB  . ARG A 1 249 ? -11.176 -11.344 4.077   1.00 35.37  ? 246 ARG A CB  1 
ATOM   1902 C CG  . ARG A 1 249 ? -11.751 -12.125 2.904   1.00 45.58  ? 246 ARG A CG  1 
ATOM   1903 C CD  . ARG A 1 249 ? -10.664 -12.594 1.941   1.00 44.13  ? 246 ARG A CD  1 
ATOM   1904 N NE  . ARG A 1 249 ? -10.280 -13.976 2.227   1.00 50.39  ? 246 ARG A NE  1 
ATOM   1905 C CZ  . ARG A 1 249 ? -9.032  -14.386 2.424   1.00 47.36  ? 246 ARG A CZ  1 
ATOM   1906 N NH1 . ARG A 1 249 ? -8.029  -13.526 2.349   1.00 50.11  ? 246 ARG A NH1 1 
ATOM   1907 N NH2 . ARG A 1 249 ? -8.784  -15.661 2.684   1.00 48.09  ? 246 ARG A NH2 1 
ATOM   1908 N N   . ARG A 1 250 ? -10.350 -12.841 6.579   1.00 34.32  ? 247 ARG A N   1 
ATOM   1909 C CA  . ARG A 1 250 ? -9.830  -14.054 7.205   1.00 37.46  ? 247 ARG A CA  1 
ATOM   1910 C C   . ARG A 1 250 ? -10.619 -14.452 8.452   1.00 32.46  ? 247 ARG A C   1 
ATOM   1911 O O   . ARG A 1 250 ? -10.917 -15.632 8.651   1.00 32.53  ? 247 ARG A O   1 
ATOM   1912 C CB  . ARG A 1 250 ? -8.348  -13.881 7.544   1.00 34.57  ? 247 ARG A CB  1 
ATOM   1913 C CG  . ARG A 1 250 ? -7.469  -13.678 6.312   1.00 38.25  ? 247 ARG A CG  1 
ATOM   1914 C CD  . ARG A 1 250 ? -5.997  -13.702 6.666   1.00 38.00  ? 247 ARG A CD  1 
ATOM   1915 N NE  . ARG A 1 250 ? -5.160  -13.300 5.542   1.00 34.45  ? 247 ARG A NE  1 
ATOM   1916 C CZ  . ARG A 1 250 ? -3.833  -13.222 5.593   1.00 41.23  ? 247 ARG A CZ  1 
ATOM   1917 N NH1 . ARG A 1 250 ? -3.191  -13.526 6.716   1.00 34.79  ? 247 ARG A NH1 1 
ATOM   1918 N NH2 . ARG A 1 250 ? -3.148  -12.840 4.522   1.00 33.27  ? 247 ARG A NH2 1 
ATOM   1919 N N   . ALA A 1 251 ? -10.967 -13.467 9.278   1.00 36.63  ? 248 ALA A N   1 
ATOM   1920 C CA  . ALA A 1 251 ? -11.732 -13.729 10.497  1.00 34.49  ? 248 ALA A CA  1 
ATOM   1921 C C   . ALA A 1 251 ? -13.118 -14.274 10.167  1.00 35.87  ? 248 ALA A C   1 
ATOM   1922 O O   . ALA A 1 251 ? -13.606 -15.206 10.814  1.00 35.20  ? 248 ALA A O   1 
ATOM   1923 C CB  . ALA A 1 251 ? -11.846 -12.463 11.335  1.00 33.23  ? 248 ALA A CB  1 
ATOM   1924 N N   . THR A 1 252 ? -13.744 -13.681 9.155   1.00 34.13  ? 249 THR A N   1 
ATOM   1925 C CA  . THR A 1 252 ? -15.062 -14.112 8.704   1.00 37.42  ? 249 THR A CA  1 
ATOM   1926 C C   . THR A 1 252 ? -15.032 -15.552 8.192   1.00 36.10  ? 249 THR A C   1 
ATOM   1927 O O   . THR A 1 252 ? -15.887 -16.373 8.552   1.00 40.25  ? 249 THR A O   1 
ATOM   1928 C CB  . THR A 1 252 ? -15.591 -13.184 7.594   1.00 39.71  ? 249 THR A CB  1 
ATOM   1929 O OG1 . THR A 1 252 ? -15.523 -11.824 8.043   1.00 42.21  ? 249 THR A OG1 1 
ATOM   1930 C CG2 . THR A 1 252 ? -17.028 -13.530 7.233   1.00 37.66  ? 249 THR A CG2 1 
ATOM   1931 N N   . LEU A 1 253 ? -14.042 -15.852 7.352   1.00 36.61  ? 250 LEU A N   1 
ATOM   1932 C CA  . LEU A 1 253 ? -13.856 -17.206 6.836   1.00 34.13  ? 250 LEU A CA  1 
ATOM   1933 C C   . LEU A 1 253 ? -13.648 -18.223 7.963   1.00 36.17  ? 250 LEU A C   1 
ATOM   1934 O O   . LEU A 1 253 ? -14.308 -19.262 7.995   1.00 35.21  ? 250 LEU A O   1 
ATOM   1935 C CB  . LEU A 1 253 ? -12.675 -17.252 5.865   1.00 37.34  ? 250 LEU A CB  1 
ATOM   1936 C CG  . LEU A 1 253 ? -12.335 -18.614 5.250   1.00 42.54  ? 250 LEU A CG  1 
ATOM   1937 C CD1 . LEU A 1 253 ? -13.566 -19.265 4.637   1.00 43.09  ? 250 LEU A CD1 1 
ATOM   1938 C CD2 . LEU A 1 253 ? -11.236 -18.463 4.208   1.00 43.33  ? 250 LEU A CD2 1 
ATOM   1939 N N   . LEU A 1 254 ? -12.736 -17.927 8.886   1.00 35.52  ? 251 LEU A N   1 
ATOM   1940 C CA  . LEU A 1 254 ? -12.506 -18.828 10.017  1.00 33.90  ? 251 LEU A CA  1 
ATOM   1941 C C   . LEU A 1 254 ? -13.790 -19.072 10.805  1.00 32.66  ? 251 LEU A C   1 
ATOM   1942 O O   . LEU A 1 254 ? -14.126 -20.219 11.148  1.00 34.26  ? 251 LEU A O   1 
ATOM   1943 C CB  . LEU A 1 254 ? -11.436 -18.274 10.947  1.00 34.55  ? 251 LEU A CB  1 
ATOM   1944 C CG  . LEU A 1 254 ? -11.226 -19.193 12.155  1.00 37.19  ? 251 LEU A CG  1 
ATOM   1945 C CD1 . LEU A 1 254 ? -10.138 -20.224 11.880  1.00 36.10  ? 251 LEU A CD1 1 
ATOM   1946 C CD2 . LEU A 1 254 ? -10.924 -18.389 13.376  1.00 34.29  ? 251 LEU A CD2 1 
ATOM   1947 N N   . ALA A 1 255 ? -14.507 -17.983 11.077  1.00 35.26  ? 252 ALA A N   1 
ATOM   1948 C CA  . ALA A 1 255 ? -15.784 -18.063 11.776  1.00 39.68  ? 252 ALA A CA  1 
ATOM   1949 C C   . ALA A 1 255 ? -16.722 -19.038 11.073  1.00 38.46  ? 252 ALA A C   1 
ATOM   1950 O O   . ALA A 1 255 ? -17.315 -19.907 11.711  1.00 38.16  ? 252 ALA A O   1 
ATOM   1951 C CB  . ALA A 1 255 ? -16.424 -16.691 11.877  1.00 38.07  ? 252 ALA A CB  1 
ATOM   1952 N N   . ARG A 1 256 ? -16.844 -18.902 9.757   1.00 39.72  ? 253 ARG A N   1 
ATOM   1953 C CA  . ARG A 1 256 ? -17.684 -19.827 9.003   1.00 41.37  ? 253 ARG A CA  1 
ATOM   1954 C C   . ARG A 1 256 ? -17.181 -21.268 9.120   1.00 38.41  ? 253 ARG A C   1 
ATOM   1955 O O   . ARG A 1 256 ? -17.973 -22.198 9.247   1.00 38.99  ? 253 ARG A O   1 
ATOM   1956 C CB  . ARG A 1 256 ? -17.765 -19.404 7.535   1.00 44.23  ? 253 ARG A CB  1 
ATOM   1957 C CG  . ARG A 1 256 ? -19.033 -18.637 7.206   1.00 48.39  ? 253 ARG A CG  1 
ATOM   1958 C CD  . ARG A 1 256 ? -19.076 -18.197 5.751   1.00 55.46  ? 253 ARG A CD  1 
ATOM   1959 N NE  . ARG A 1 256 ? -18.652 -19.263 4.850   1.00 61.67  ? 253 ARG A NE  1 
ATOM   1960 C CZ  . ARG A 1 256 ? -17.626 -19.168 4.011   1.00 62.13  ? 253 ARG A CZ  1 
ATOM   1961 N NH1 . ARG A 1 256 ? -17.309 -20.192 3.232   1.00 55.01  ? 253 ARG A NH1 1 
ATOM   1962 N NH2 . ARG A 1 256 ? -16.920 -18.047 3.944   1.00 60.17  ? 253 ARG A NH2 1 
ATOM   1963 N N   . LEU A 1 257 ? -15.864 -21.448 9.103   1.00 37.18  ? 254 LEU A N   1 
ATOM   1964 C CA  . LEU A 1 257 ? -15.281 -22.782 9.202   1.00 35.82  ? 254 LEU A CA  1 
ATOM   1965 C C   . LEU A 1 257 ? -15.556 -23.462 10.541  1.00 39.45  ? 254 LEU A C   1 
ATOM   1966 O O   . LEU A 1 257 ? -15.624 -24.691 10.607  1.00 37.52  ? 254 LEU A O   1 
ATOM   1967 C CB  . LEU A 1 257 ? -13.773 -22.725 8.957   1.00 38.68  ? 254 LEU A CB  1 
ATOM   1968 C CG  . LEU A 1 257 ? -13.353 -22.399 7.522   1.00 38.46  ? 254 LEU A CG  1 
ATOM   1969 C CD1 . LEU A 1 257 ? -11.841 -22.373 7.399   1.00 41.00  ? 254 LEU A CD1 1 
ATOM   1970 C CD2 . LEU A 1 257 ? -13.967 -23.390 6.539   1.00 41.99  ? 254 LEU A CD2 1 
ATOM   1971 N N   . VAL A 1 258 ? -15.705 -22.687 11.613  1.00 39.45  ? 255 VAL A N   1 
ATOM   1972 C CA  . VAL A 1 258 ? -16.032 -23.312 12.895  1.00 37.89  ? 255 VAL A CA  1 
ATOM   1973 C C   . VAL A 1 258 ? -17.512 -23.199 13.251  1.00 43.58  ? 255 VAL A C   1 
ATOM   1974 O O   . VAL A 1 258 ? -17.906 -23.480 14.382  1.00 49.91  ? 255 VAL A O   1 
ATOM   1975 C CB  . VAL A 1 258 ? -15.196 -22.724 14.051  1.00 41.77  ? 255 VAL A CB  1 
ATOM   1976 C CG1 . VAL A 1 258 ? -13.730 -23.096 13.886  1.00 39.71  ? 255 VAL A CG1 1 
ATOM   1977 C CG2 . VAL A 1 258 ? -15.379 -21.220 14.131  1.00 33.80  ? 255 VAL A CG2 1 
ATOM   1978 N N   . GLY A 1 259 ? -18.329 -22.789 12.288  1.00 43.55  ? 256 GLY A N   1 
ATOM   1979 C CA  . GLY A 1 259 ? -19.774 -22.855 12.442  1.00 48.05  ? 256 GLY A CA  1 
ATOM   1980 C C   . GLY A 1 259 ? -20.436 -21.622 13.029  1.00 49.53  ? 256 GLY A C   1 
ATOM   1981 O O   . GLY A 1 259 ? -21.494 -21.723 13.652  1.00 56.05  ? 256 GLY A O   1 
ATOM   1982 N N   . CYS A 1 260 ? -19.839 -20.456 12.813  1.00 48.36  ? 257 CYS A N   1 
ATOM   1983 C CA  . CYS A 1 260 ? -20.400 -19.225 13.349  1.00 54.48  ? 257 CYS A CA  1 
ATOM   1984 C C   . CYS A 1 260 ? -20.824 -18.273 12.241  1.00 63.61  ? 257 CYS A C   1 
ATOM   1985 O O   . CYS A 1 260 ? -20.140 -18.186 11.208  1.00 61.40  ? 257 CYS A O   1 
ATOM   1986 C CB  . CYS A 1 260 ? -19.392 -18.540 14.252  1.00 50.90  ? 257 CYS A CB  1 
ATOM   1987 S SG  . CYS A 1 260 ? -19.051 -19.484 15.724  1.00 52.49  ? 257 CYS A SG  1 
ATOM   1988 N N   . PRO A 1 261 ? -21.963 -17.561 12.432  1.00 78.53  ? 258 PRO A N   1 
ATOM   1989 C CA  . PRO A 1 261 ? -22.566 -16.652 11.443  1.00 79.09  ? 258 PRO A CA  1 
ATOM   1990 C C   . PRO A 1 261 ? -21.585 -15.681 10.761  1.00 76.86  ? 258 PRO A C   1 
ATOM   1991 O O   . PRO A 1 261 ? -21.806 -15.350 9.594   1.00 78.06  ? 258 PRO A O   1 
ATOM   1992 C CB  . PRO A 1 261 ? -23.590 -15.878 12.288  1.00 82.73  ? 258 PRO A CB  1 
ATOM   1993 C CG  . PRO A 1 261 ? -23.192 -16.202 13.763  1.00 76.76  ? 258 PRO A CG  1 
ATOM   1994 C CD  . PRO A 1 261 ? -22.746 -17.557 13.678  1.00 74.99  ? 258 PRO A CD  1 
ATOM   1995 N N   . ASN A 1 268 ? -23.666 -8.598  11.643  1.00 60.75  ? 265 ASN A N   1 
ATOM   1996 C CA  . ASN A 1 268 ? -23.232 -7.890  12.839  1.00 57.13  ? 265 ASN A CA  1 
ATOM   1997 C C   . ASN A 1 268 ? -21.994 -8.551  13.429  1.00 55.85  ? 265 ASN A C   1 
ATOM   1998 O O   . ASN A 1 268 ? -21.930 -9.774  13.570  1.00 50.04  ? 265 ASN A O   1 
ATOM   1999 C CB  . ASN A 1 268 ? -24.364 -7.834  13.870  1.00 59.28  ? 265 ASN A CB  1 
ATOM   2000 C CG  . ASN A 1 268 ? -23.860 -7.798  15.306  1.00 62.83  ? 265 ASN A CG  1 
ATOM   2001 O OD1 . ASN A 1 268 ? -23.085 -6.920  15.683  1.00 69.36  ? 265 ASN A OD1 1 
ATOM   2002 N ND2 . ASN A 1 268 ? -24.322 -8.744  16.120  1.00 61.38  ? 265 ASN A ND2 1 
ATOM   2003 N N   . ASP A 1 269 ? -21.016 -7.729  13.793  1.00 53.39  ? 266 ASP A N   1 
ATOM   2004 C CA  . ASP A 1 269 ? -19.751 -8.230  14.324  1.00 51.48  ? 266 ASP A CA  1 
ATOM   2005 C C   . ASP A 1 269 ? -19.919 -8.852  15.711  1.00 48.57  ? 266 ASP A C   1 
ATOM   2006 O O   . ASP A 1 269 ? -19.297 -9.870  16.018  1.00 45.97  ? 266 ASP A O   1 
ATOM   2007 C CB  . ASP A 1 269 ? -18.709 -7.104  14.380  1.00 46.20  ? 266 ASP A CB  1 
ATOM   2008 C CG  . ASP A 1 269 ? -18.097 -6.803  13.024  1.00 48.63  ? 266 ASP A CG  1 
ATOM   2009 O OD1 . ASP A 1 269 ? -18.258 -7.621  12.092  1.00 46.76  ? 266 ASP A OD1 1 
ATOM   2010 O OD2 . ASP A 1 269 ? -17.453 -5.743  12.887  1.00 47.71  ? 266 ASP A OD2 1 
ATOM   2011 N N   . THR A 1 270 ? -20.764 -8.238  16.538  1.00 50.96  ? 267 THR A N   1 
ATOM   2012 C CA  . THR A 1 270 ? -20.941 -8.659  17.931  1.00 51.75  ? 267 THR A CA  1 
ATOM   2013 C C   . THR A 1 270 ? -21.339 -10.130 18.075  1.00 47.85  ? 267 THR A C   1 
ATOM   2014 O O   . THR A 1 270 ? -20.770 -10.863 18.880  1.00 47.94  ? 267 THR A O   1 
ATOM   2015 C CB  . THR A 1 270 ? -22.009 -7.804  18.650  1.00 54.36  ? 267 THR A CB  1 
ATOM   2016 O OG1 . THR A 1 270 ? -21.658 -6.417  18.572  1.00 55.68  ? 267 THR A OG1 1 
ATOM   2017 C CG2 . THR A 1 270 ? -22.127 -8.214  20.120  1.00 49.24  ? 267 THR A CG2 1 
ATOM   2018 N N   . GLU A 1 271 ? -22.315 -10.560 17.284  1.00 49.62  ? 268 GLU A N   1 
ATOM   2019 C CA  . GLU A 1 271 ? -22.830 -11.927 17.365  1.00 56.67  ? 268 GLU A CA  1 
ATOM   2020 C C   . GLU A 1 271 ? -21.835 -12.944 16.803  1.00 46.88  ? 268 GLU A C   1 
ATOM   2021 O O   . GLU A 1 271 ? -21.696 -14.052 17.334  1.00 49.51  ? 268 GLU A O   1 
ATOM   2022 C CB  . GLU A 1 271 ? -24.168 -12.038 16.627  1.00 61.18  ? 268 GLU A CB  1 
ATOM   2023 C CG  . GLU A 1 271 ? -24.976 -13.275 16.978  1.00 70.86  ? 268 GLU A CG  1 
ATOM   2024 C CD  . GLU A 1 271 ? -25.989 -13.624 15.900  1.00 82.63  ? 268 GLU A CD  1 
ATOM   2025 O OE1 . GLU A 1 271 ? -26.268 -12.758 15.040  1.00 86.33  ? 268 GLU A OE1 1 
ATOM   2026 O OE2 . GLU A 1 271 ? -26.506 -14.762 15.908  1.00 85.93  ? 268 GLU A OE2 1 
ATOM   2027 N N   . LEU A 1 272 ? -21.150 -12.560 15.730  1.00 47.19  ? 269 LEU A N   1 
ATOM   2028 C CA  . LEU A 1 272 ? -20.102 -13.388 15.147  1.00 45.75  ? 269 LEU A CA  1 
ATOM   2029 C C   . LEU A 1 272 ? -19.016 -13.644 16.192  1.00 38.54  ? 269 LEU A C   1 
ATOM   2030 O O   . LEU A 1 272 ? -18.641 -14.792 16.456  1.00 39.34  ? 269 LEU A O   1 
ATOM   2031 C CB  . LEU A 1 272 ? -19.521 -12.708 13.899  1.00 43.90  ? 269 LEU A CB  1 
ATOM   2032 C CG  . LEU A 1 272 ? -18.596 -13.509 12.981  1.00 46.20  ? 269 LEU A CG  1 
ATOM   2033 C CD1 . LEU A 1 272 ? -18.613 -12.931 11.578  1.00 48.98  ? 269 LEU A CD1 1 
ATOM   2034 C CD2 . LEU A 1 272 ? -17.177 -13.510 13.514  1.00 47.98  ? 269 LEU A CD2 1 
ATOM   2035 N N   . ILE A 1 273 ? -18.522 -12.562 16.786  1.00 42.52  ? 270 ILE A N   1 
ATOM   2036 C CA  . ILE A 1 273 ? -17.460 -12.647 17.781  1.00 41.46  ? 270 ILE A CA  1 
ATOM   2037 C C   . ILE A 1 273 ? -17.905 -13.429 19.012  1.00 37.37  ? 270 ILE A C   1 
ATOM   2038 O O   . ILE A 1 273 ? -17.141 -14.228 19.544  1.00 39.33  ? 270 ILE A O   1 
ATOM   2039 C CB  . ILE A 1 273 ? -16.974 -11.250 18.203  1.00 39.36  ? 270 ILE A CB  1 
ATOM   2040 C CG1 . ILE A 1 273 ? -16.445 -10.498 16.986  1.00 44.50  ? 270 ILE A CG1 1 
ATOM   2041 C CG2 . ILE A 1 273 ? -15.873 -11.361 19.249  1.00 42.62  ? 270 ILE A CG2 1 
ATOM   2042 C CD1 . ILE A 1 273 ? -16.252 -9.015  17.194  1.00 47.98  ? 270 ILE A CD1 1 
ATOM   2043 N N   . ALA A 1 274 ? -19.141 -13.216 19.455  1.00 41.59  ? 271 ALA A N   1 
ATOM   2044 C CA  . ALA A 1 274 ? -19.664 -13.954 20.610  1.00 39.28  ? 271 ALA A CA  1 
ATOM   2045 C C   . ALA A 1 274 ? -19.697 -15.456 20.325  1.00 40.17  ? 271 ALA A C   1 
ATOM   2046 O O   . ALA A 1 274 ? -19.295 -16.292 21.163  1.00 40.91  ? 271 ALA A O   1 
ATOM   2047 C CB  . ALA A 1 274 ? -21.049 -13.451 20.974  1.00 38.61  ? 271 ALA A CB  1 
ATOM   2048 N N   . CYS A 1 275 ? -20.174 -15.796 19.128  1.00 42.63  ? 272 CYS A N   1 
ATOM   2049 C CA  . CYS A 1 275 ? -20.203 -17.190 18.719  1.00 40.64  ? 272 CYS A CA  1 
ATOM   2050 C C   . CYS A 1 275 ? -18.794 -17.760 18.742  1.00 37.45  ? 272 CYS A C   1 
ATOM   2051 O O   . CYS A 1 275 ? -18.576 -18.858 19.247  1.00 41.59  ? 272 CYS A O   1 
ATOM   2052 C CB  . CYS A 1 275 ? -20.812 -17.356 17.328  1.00 46.08  ? 272 CYS A CB  1 
ATOM   2053 S SG  . CYS A 1 275 ? -20.760 -19.070 16.778  1.00 56.56  ? 272 CYS A SG  1 
ATOM   2054 N N   . LEU A 1 276 ? -17.841 -17.003 18.203  1.00 36.02  ? 273 LEU A N   1 
ATOM   2055 C CA  . LEU A 1 276 ? -16.438 -17.402 18.257  1.00 36.06  ? 273 LEU A CA  1 
ATOM   2056 C C   . LEU A 1 276 ? -15.973 -17.640 19.692  1.00 38.56  ? 273 LEU A C   1 
ATOM   2057 O O   . LEU A 1 276 ? -15.190 -18.552 19.955  1.00 37.17  ? 273 LEU A O   1 
ATOM   2058 C CB  . LEU A 1 276 ? -15.550 -16.347 17.598  1.00 34.17  ? 273 LEU A CB  1 
ATOM   2059 C CG  . LEU A 1 276 ? -15.484 -16.387 16.069  1.00 36.62  ? 273 LEU A CG  1 
ATOM   2060 C CD1 . LEU A 1 276 ? -14.602 -15.265 15.549  1.00 35.60  ? 273 LEU A CD1 1 
ATOM   2061 C CD2 . LEU A 1 276 ? -14.976 -17.744 15.605  1.00 34.81  ? 273 LEU A CD2 1 
ATOM   2062 N N   . ARG A 1 277 ? -16.461 -16.820 20.618  1.00 37.20  ? 274 ARG A N   1 
ATOM   2063 C CA  . ARG A 1 277 ? -16.058 -16.943 22.011  1.00 37.71  ? 274 ARG A CA  1 
ATOM   2064 C C   . ARG A 1 277 ? -16.640 -18.202 22.634  1.00 40.49  ? 274 ARG A C   1 
ATOM   2065 O O   . ARG A 1 277 ? -16.115 -18.702 23.627  1.00 39.05  ? 274 ARG A O   1 
ATOM   2066 C CB  . ARG A 1 277 ? -16.473 -15.706 22.817  1.00 36.58  ? 274 ARG A CB  1 
ATOM   2067 C CG  . ARG A 1 277 ? -15.612 -14.478 22.544  1.00 37.32  ? 274 ARG A CG  1 
ATOM   2068 C CD  . ARG A 1 277 ? -15.735 -13.451 23.667  1.00 37.32  ? 274 ARG A CD  1 
ATOM   2069 N NE  . ARG A 1 277 ? -17.130 -13.104 23.906  1.00 38.78  ? 274 ARG A NE  1 
ATOM   2070 C CZ  . ARG A 1 277 ? -17.732 -12.042 23.385  1.00 40.45  ? 274 ARG A CZ  1 
ATOM   2071 N NH1 . ARG A 1 277 ? -17.053 -11.206 22.610  1.00 42.27  ? 274 ARG A NH1 1 
ATOM   2072 N NH2 . ARG A 1 277 ? -19.011 -11.813 23.645  1.00 41.46  ? 274 ARG A NH2 1 
ATOM   2073 N N   . THR A 1 278 ? -17.717 -18.729 22.058  1.00 41.48  ? 275 THR A N   1 
ATOM   2074 C CA  . THR A 1 278 ? -18.233 -20.006 22.563  1.00 38.66  ? 275 THR A CA  1 
ATOM   2075 C C   . THR A 1 278 ? -17.426 -21.225 22.091  1.00 41.08  ? 275 THR A C   1 
ATOM   2076 O O   . THR A 1 278 ? -17.603 -22.320 22.613  1.00 41.80  ? 275 THR A O   1 
ATOM   2077 C CB  . THR A 1 278 ? -19.699 -20.235 22.158  1.00 39.81  ? 275 THR A CB  1 
ATOM   2078 O OG1 . THR A 1 278 ? -19.781 -20.408 20.737  1.00 42.38  ? 275 THR A OG1 1 
ATOM   2079 C CG2 . THR A 1 278 ? -20.569 -19.065 22.591  1.00 39.76  ? 275 THR A CG2 1 
ATOM   2080 N N   . ARG A 1 279 ? -16.550 -21.048 21.105  1.00 40.47  ? 276 ARG A N   1 
ATOM   2081 C CA  . ARG A 1 279 ? -15.823 -22.188 20.543  1.00 41.33  ? 276 ARG A CA  1 
ATOM   2082 C C   . ARG A 1 279 ? -14.625 -22.594 21.400  1.00 39.85  ? 276 ARG A C   1 
ATOM   2083 O O   . ARG A 1 279 ? -13.940 -21.741 21.959  1.00 40.49  ? 276 ARG A O   1 
ATOM   2084 C CB  . ARG A 1 279 ? -15.343 -21.882 19.119  1.00 42.41  ? 276 ARG A CB  1 
ATOM   2085 C CG  . ARG A 1 279 ? -16.414 -21.346 18.165  1.00 44.14  ? 276 ARG A CG  1 
ATOM   2086 C CD  . ARG A 1 279 ? -17.662 -22.213 18.159  1.00 42.96  ? 276 ARG A CD  1 
ATOM   2087 N NE  . ARG A 1 279 ? -17.362 -23.609 17.856  1.00 51.35  ? 276 ARG A NE  1 
ATOM   2088 C CZ  . ARG A 1 279 ? -17.985 -24.643 18.414  1.00 57.24  ? 276 ARG A CZ  1 
ATOM   2089 N NH1 . ARG A 1 279 ? -18.943 -24.437 19.309  1.00 59.68  ? 276 ARG A NH1 1 
ATOM   2090 N NH2 . ARG A 1 279 ? -17.648 -25.884 18.080  1.00 52.95  ? 276 ARG A NH2 1 
ATOM   2091 N N   . PRO A 1 280 ? -14.361 -23.907 21.495  1.00 43.61  ? 277 PRO A N   1 
ATOM   2092 C CA  . PRO A 1 280 ? -13.161 -24.399 22.181  1.00 43.24  ? 277 PRO A CA  1 
ATOM   2093 C C   . PRO A 1 280 ? -11.878 -23.909 21.507  1.00 44.85  ? 277 PRO A C   1 
ATOM   2094 O O   . PRO A 1 280 ? -11.847 -23.763 20.280  1.00 36.46  ? 277 PRO A O   1 
ATOM   2095 C CB  . PRO A 1 280 ? -13.288 -25.924 22.070  1.00 44.58  ? 277 PRO A CB  1 
ATOM   2096 C CG  . PRO A 1 280 ? -14.734 -26.178 21.796  1.00 45.19  ? 277 PRO A CG  1 
ATOM   2097 C CD  . PRO A 1 280 ? -15.200 -25.007 20.990  1.00 41.76  ? 277 PRO A CD  1 
ATOM   2098 N N   . ALA A 1 281 ? -10.836 -23.665 22.302  1.00 39.11  ? 278 ALA A N   1 
ATOM   2099 C CA  . ALA A 1 281 ? -9.571  -23.140 21.782  1.00 40.00  ? 278 ALA A CA  1 
ATOM   2100 C C   . ALA A 1 281 ? -9.004  -24.011 20.656  1.00 38.41  ? 278 ALA A C   1 
ATOM   2101 O O   . ALA A 1 281 ? -8.548  -23.512 19.606  1.00 34.32  ? 278 ALA A O   1 
ATOM   2102 C CB  . ALA A 1 281 ? -8.557  -23.014 22.910  1.00 37.43  ? 278 ALA A CB  1 
ATOM   2103 N N   . GLN A 1 282 ? -9.050  -25.320 20.877  1.00 39.65  ? 279 GLN A N   1 
ATOM   2104 C CA  . GLN A 1 282 ? -8.468  -26.261 19.934  1.00 41.68  ? 279 GLN A CA  1 
ATOM   2105 C C   . GLN A 1 282 ? -9.165  -26.231 18.577  1.00 38.96  ? 279 GLN A C   1 
ATOM   2106 O O   . GLN A 1 282 ? -8.542  -26.531 17.568  1.00 39.32  ? 279 GLN A O   1 
ATOM   2107 C CB  . GLN A 1 282 ? -8.494  -27.682 20.496  1.00 40.93  ? 279 GLN A CB  1 
ATOM   2108 C CG  . GLN A 1 282 ? -7.673  -28.659 19.674  1.00 41.28  ? 279 GLN A CG  1 
ATOM   2109 C CD  . GLN A 1 282 ? -6.219  -28.238 19.555  1.00 41.74  ? 279 GLN A CD  1 
ATOM   2110 O OE1 . GLN A 1 282 ? -5.584  -27.871 20.544  1.00 48.66  ? 279 GLN A OE1 1 
ATOM   2111 N NE2 . GLN A 1 282 ? -5.684  -28.290 18.340  1.00 46.23  ? 279 GLN A NE2 1 
ATOM   2112 N N   . ASP A 1 283 ? -10.447 -25.880 18.542  1.00 39.43  ? 280 ASP A N   1 
ATOM   2113 C CA  . ASP A 1 283 ? -11.145 -25.777 17.259  1.00 40.77  ? 280 ASP A CA  1 
ATOM   2114 C C   . ASP A 1 283 ? -10.574 -24.627 16.431  1.00 40.64  ? 280 ASP A C   1 
ATOM   2115 O O   . ASP A 1 283 ? -10.303 -24.769 15.222  1.00 38.77  ? 280 ASP A O   1 
ATOM   2116 C CB  . ASP A 1 283 ? -12.647 -25.581 17.466  1.00 45.74  ? 280 ASP A CB  1 
ATOM   2117 C CG  . ASP A 1 283 ? -13.332 -26.830 18.000  1.00 55.69  ? 280 ASP A CG  1 
ATOM   2118 O OD1 . ASP A 1 283 ? -12.628 -27.723 18.518  1.00 52.56  ? 280 ASP A OD1 1 
ATOM   2119 O OD2 . ASP A 1 283 ? -14.577 -26.917 17.901  1.00 64.02  ? 280 ASP A OD2 1 
ATOM   2120 N N   . LEU A 1 284 ? -10.383 -23.488 17.094  1.00 36.75  ? 281 LEU A N   1 
ATOM   2121 C CA  . LEU A 1 284 ? -9.783  -22.327 16.447  1.00 39.71  ? 281 LEU A CA  1 
ATOM   2122 C C   . LEU A 1 284 ? -8.410  -22.693 15.905  1.00 37.38  ? 281 LEU A C   1 
ATOM   2123 O O   . LEU A 1 284 ? -8.091  -22.400 14.746  1.00 38.26  ? 281 LEU A O   1 
ATOM   2124 C CB  . LEU A 1 284 ? -9.674  -21.147 17.416  1.00 36.91  ? 281 LEU A CB  1 
ATOM   2125 C CG  . LEU A 1 284 ? -10.974 -20.647 18.048  1.00 39.12  ? 281 LEU A CG  1 
ATOM   2126 C CD1 . LEU A 1 284 ? -10.730 -19.345 18.793  1.00 37.06  ? 281 LEU A CD1 1 
ATOM   2127 C CD2 . LEU A 1 284 ? -12.058 -20.469 17.000  1.00 36.67  ? 281 LEU A CD2 1 
ATOM   2128 N N   . VAL A 1 285 ? -7.607  -23.354 16.738  1.00 37.30  ? 282 VAL A N   1 
ATOM   2129 C CA  . VAL A 1 285 ? -6.281  -23.788 16.299  1.00 35.36  ? 282 VAL A CA  1 
ATOM   2130 C C   . VAL A 1 285 ? -6.368  -24.750 15.104  1.00 38.29  ? 282 VAL A C   1 
ATOM   2131 O O   . VAL A 1 285 ? -5.610  -24.632 14.143  1.00 37.57  ? 282 VAL A O   1 
ATOM   2132 C CB  . VAL A 1 285 ? -5.501  -24.462 17.449  1.00 36.61  ? 282 VAL A CB  1 
ATOM   2133 C CG1 . VAL A 1 285 ? -4.195  -25.049 16.946  1.00 34.12  ? 282 VAL A CG1 1 
ATOM   2134 C CG2 . VAL A 1 285 ? -5.240  -23.456 18.566  1.00 32.26  ? 282 VAL A CG2 1 
ATOM   2135 N N   . ASP A 1 286 ? -7.311  -25.684 15.167  1.00 34.95  ? 283 ASP A N   1 
ATOM   2136 C CA  . ASP A 1 286 ? -7.495  -26.687 14.127  1.00 37.74  ? 283 ASP A CA  1 
ATOM   2137 C C   . ASP A 1 286 ? -7.906  -26.076 12.795  1.00 40.47  ? 283 ASP A C   1 
ATOM   2138 O O   . ASP A 1 286 ? -7.717  -26.696 11.748  1.00 37.09  ? 283 ASP A O   1 
ATOM   2139 C CB  . ASP A 1 286 ? -8.550  -27.720 14.542  1.00 35.20  ? 283 ASP A CB  1 
ATOM   2140 C CG  . ASP A 1 286 ? -8.048  -28.687 15.601  1.00 41.45  ? 283 ASP A CG  1 
ATOM   2141 O OD1 . ASP A 1 286 ? -6.820  -28.762 15.824  1.00 40.15  ? 283 ASP A OD1 1 
ATOM   2142 O OD2 . ASP A 1 286 ? -8.894  -29.377 16.208  1.00 38.69  ? 283 ASP A OD2 1 
ATOM   2143 N N   . HIS A 1 287 ? -8.482  -24.877 12.819  1.00 38.68  ? 284 HIS A N   1 
ATOM   2144 C CA  . HIS A 1 287 ? -8.941  -24.294 11.558  1.00 38.55  ? 284 HIS A CA  1 
ATOM   2145 C C   . HIS A 1 287 ? -8.184  -23.052 11.072  1.00 41.24  ? 284 HIS A C   1 
ATOM   2146 O O   . HIS A 1 287 ? -8.395  -22.603 9.941   1.00 36.44  ? 284 HIS A O   1 
ATOM   2147 C CB  . HIS A 1 287 ? -10.429 -23.971 11.665  1.00 39.32  ? 284 HIS A CB  1 
ATOM   2148 C CG  . HIS A 1 287 ? -11.300 -25.186 11.694  1.00 39.01  ? 284 HIS A CG  1 
ATOM   2149 N ND1 . HIS A 1 287 ? -11.705 -25.785 12.867  1.00 41.24  ? 284 HIS A ND1 1 
ATOM   2150 C CD2 . HIS A 1 287 ? -11.820 -25.933 10.692  1.00 40.76  ? 284 HIS A CD2 1 
ATOM   2151 C CE1 . HIS A 1 287 ? -12.450 -26.838 12.586  1.00 39.09  ? 284 HIS A CE1 1 
ATOM   2152 N NE2 . HIS A 1 287 ? -12.536 -26.950 11.275  1.00 43.85  ? 284 HIS A NE2 1 
ATOM   2153 N N   . GLU A 1 288 ? -7.294  -22.510 11.899  1.00 39.01  ? 285 GLU A N   1 
ATOM   2154 C CA  . GLU A 1 288 ? -6.635  -21.248 11.555  1.00 40.01  ? 285 GLU A CA  1 
ATOM   2155 C C   . GLU A 1 288 ? -5.785  -21.310 10.274  1.00 42.48  ? 285 GLU A C   1 
ATOM   2156 O O   . GLU A 1 288 ? -5.543  -20.285 9.637   1.00 40.12  ? 285 GLU A O   1 
ATOM   2157 C CB  . GLU A 1 288 ? -5.770  -20.766 12.727  1.00 36.66  ? 285 GLU A CB  1 
ATOM   2158 C CG  . GLU A 1 288 ? -4.464  -21.517 12.917  1.00 40.19  ? 285 GLU A CG  1 
ATOM   2159 C CD  . GLU A 1 288 ? -3.636  -20.960 14.070  1.00 43.35  ? 285 GLU A CD  1 
ATOM   2160 O OE1 . GLU A 1 288 ? -2.709  -21.656 14.527  1.00 43.99  ? 285 GLU A OE1 1 
ATOM   2161 O OE2 . GLU A 1 288 ? -3.918  -19.830 14.521  1.00 42.16  ? 285 GLU A OE2 1 
ATOM   2162 N N   . TRP A 1 289 ? -5.352  -22.500 9.876   1.00 43.72  ? 286 TRP A N   1 
ATOM   2163 C CA  . TRP A 1 289 ? -4.457  -22.606 8.726   1.00 46.78  ? 286 TRP A CA  1 
ATOM   2164 C C   . TRP A 1 289 ? -5.182  -22.721 7.389   1.00 48.27  ? 286 TRP A C   1 
ATOM   2165 O O   . TRP A 1 289 ? -4.543  -22.791 6.342   1.00 53.29  ? 286 TRP A O   1 
ATOM   2166 C CB  . TRP A 1 289 ? -3.507  -23.789 8.911   1.00 49.76  ? 286 TRP A CB  1 
ATOM   2167 C CG  . TRP A 1 289 ? -2.447  -23.475 9.917   1.00 59.36  ? 286 TRP A CG  1 
ATOM   2168 C CD1 . TRP A 1 289 ? -2.361  -23.938 11.200  1.00 56.62  ? 286 TRP A CD1 1 
ATOM   2169 C CD2 . TRP A 1 289 ? -1.342  -22.580 9.738   1.00 57.32  ? 286 TRP A CD2 1 
ATOM   2170 N NE1 . TRP A 1 289 ? -1.258  -23.401 11.823  1.00 57.86  ? 286 TRP A NE1 1 
ATOM   2171 C CE2 . TRP A 1 289 ? -0.617  -22.565 10.946  1.00 56.55  ? 286 TRP A CE2 1 
ATOM   2172 C CE3 . TRP A 1 289 ? -0.891  -21.798 8.666   1.00 57.75  ? 286 TRP A CE3 1 
ATOM   2173 C CZ2 . TRP A 1 289 ? 0.535   -21.798 11.115  1.00 55.54  ? 286 TRP A CZ2 1 
ATOM   2174 C CZ3 . TRP A 1 289 ? 0.252   -21.039 8.834   1.00 57.13  ? 286 TRP A CZ3 1 
ATOM   2175 C CH2 . TRP A 1 289 ? 0.953   -21.044 10.051  1.00 59.46  ? 286 TRP A CH2 1 
ATOM   2176 N N   . HIS A 1 290 ? -6.509  -22.709 7.419   1.00 46.77  ? 287 HIS A N   1 
ATOM   2177 C CA  . HIS A 1 290 ? -7.289  -22.888 6.200   1.00 46.80  ? 287 HIS A CA  1 
ATOM   2178 C C   . HIS A 1 290 ? -7.842  -21.573 5.652   1.00 49.19  ? 287 HIS A C   1 
ATOM   2179 O O   . HIS A 1 290 ? -8.720  -21.587 4.791   1.00 45.89  ? 287 HIS A O   1 
ATOM   2180 C CB  . HIS A 1 290 ? -8.444  -23.863 6.446   1.00 48.22  ? 287 HIS A CB  1 
ATOM   2181 C CG  . HIS A 1 290 ? -8.021  -25.161 7.065   1.00 56.62  ? 287 HIS A CG  1 
ATOM   2182 N ND1 . HIS A 1 290 ? -6.751  -25.676 6.925   1.00 64.87  ? 287 HIS A ND1 1 
ATOM   2183 C CD2 . HIS A 1 290 ? -8.702  -26.044 7.835   1.00 56.63  ? 287 HIS A CD2 1 
ATOM   2184 C CE1 . HIS A 1 290 ? -6.666  -26.821 7.581   1.00 60.31  ? 287 HIS A CE1 1 
ATOM   2185 N NE2 . HIS A 1 290 ? -7.836  -27.066 8.141   1.00 60.99  ? 287 HIS A NE2 1 
ATOM   2186 N N   . VAL A 1 291 ? -7.334  -20.440 6.135   1.00 42.91  ? 288 VAL A N   1 
ATOM   2187 C CA  . VAL A 1 291 ? -7.866  -19.150 5.693   1.00 44.63  ? 288 VAL A CA  1 
ATOM   2188 C C   . VAL A 1 291 ? -6.898  -18.297 4.863   1.00 46.64  ? 288 VAL A C   1 
ATOM   2189 O O   . VAL A 1 291 ? -7.254  -17.193 4.450   1.00 45.96  ? 288 VAL A O   1 
ATOM   2190 C CB  . VAL A 1 291 ? -8.335  -18.290 6.890   1.00 41.51  ? 288 VAL A CB  1 
ATOM   2191 C CG1 . VAL A 1 291 ? -9.313  -19.068 7.762   1.00 44.50  ? 288 VAL A CG1 1 
ATOM   2192 C CG2 . VAL A 1 291 ? -7.148  -17.817 7.705   1.00 42.11  ? 288 VAL A CG2 1 
ATOM   2193 N N   . LEU A 1 292 ? -5.685  -18.788 4.620   1.00 43.69  ? 289 LEU A N   1 
ATOM   2194 C CA  . LEU A 1 292 ? -4.741  -18.050 3.778   1.00 46.45  ? 289 LEU A CA  1 
ATOM   2195 C C   . LEU A 1 292 ? -5.310  -17.904 2.366   1.00 51.34  ? 289 LEU A C   1 
ATOM   2196 O O   . LEU A 1 292 ? -5.983  -18.810 1.878   1.00 52.02  ? 289 LEU A O   1 
ATOM   2197 C CB  . LEU A 1 292 ? -3.378  -18.744 3.739   1.00 45.94  ? 289 LEU A CB  1 
ATOM   2198 C CG  . LEU A 1 292 ? -2.482  -18.589 4.969   1.00 50.73  ? 289 LEU A CG  1 
ATOM   2199 C CD1 . LEU A 1 292 ? -1.224  -19.439 4.818   1.00 48.48  ? 289 LEU A CD1 1 
ATOM   2200 C CD2 . LEU A 1 292 ? -2.134  -17.114 5.198   1.00 41.96  ? 289 LEU A CD2 1 
ATOM   2201 N N   . PRO A 1 293 ? -5.055  -16.756 1.713   1.00 51.32  ? 290 PRO A N   1 
ATOM   2202 C CA  . PRO A 1 293 ? -5.648  -16.494 0.394   1.00 55.02  ? 290 PRO A CA  1 
ATOM   2203 C C   . PRO A 1 293 ? -5.047  -17.350 -0.720  1.00 56.52  ? 290 PRO A C   1 
ATOM   2204 O O   . PRO A 1 293 ? -5.770  -17.736 -1.636  1.00 56.74  ? 290 PRO A O   1 
ATOM   2205 C CB  . PRO A 1 293 ? -5.349  -15.008 0.163   1.00 50.25  ? 290 PRO A CB  1 
ATOM   2206 C CG  . PRO A 1 293 ? -4.134  -14.738 0.969   1.00 54.21  ? 290 PRO A CG  1 
ATOM   2207 C CD  . PRO A 1 293 ? -4.238  -15.624 2.186   1.00 49.93  ? 290 PRO A CD  1 
ATOM   2208 N N   . GLN A 1 294 ? -3.751  -17.637 -0.646  1.00 63.81  ? 291 GLN A N   1 
ATOM   2209 C CA  . GLN A 1 294 ? -3.097  -18.454 -1.663  1.00 66.93  ? 291 GLN A CA  1 
ATOM   2210 C C   . GLN A 1 294 ? -2.290  -19.589 -1.044  1.00 66.24  ? 291 GLN A C   1 
ATOM   2211 O O   . GLN A 1 294 ? -2.095  -19.642 0.172   1.00 61.34  ? 291 GLN A O   1 
ATOM   2212 C CB  . GLN A 1 294 ? -2.171  -17.603 -2.542  1.00 65.22  ? 291 GLN A CB  1 
ATOM   2213 C CG  . GLN A 1 294 ? -2.554  -16.137 -2.666  1.00 67.52  ? 291 GLN A CG  1 
ATOM   2214 C CD  . GLN A 1 294 ? -1.877  -15.267 -1.619  1.00 70.84  ? 291 GLN A CD  1 
ATOM   2215 O OE1 . GLN A 1 294 ? -1.295  -15.768 -0.656  1.00 70.24  ? 291 GLN A OE1 1 
ATOM   2216 N NE2 . GLN A 1 294 ? -1.946  -13.955 -1.810  1.00 76.06  ? 291 GLN A NE2 1 
ATOM   2217 N N   . GLU A 1 295 ? -1.829  -20.497 -1.898  1.00 57.95  ? 292 GLU A N   1 
ATOM   2218 C CA  . GLU A 1 295 ? -0.835  -21.489 -1.515  1.00 58.87  ? 292 GLU A CA  1 
ATOM   2219 C C   . GLU A 1 295 ? 0.487   -20.756 -1.303  1.00 53.82  ? 292 GLU A C   1 
ATOM   2220 O O   . GLU A 1 295 ? 0.942   -20.027 -2.185  1.00 52.72  ? 292 GLU A O   1 
ATOM   2221 C CB  . GLU A 1 295 ? -0.709  -22.567 -2.595  1.00 58.76  ? 292 GLU A CB  1 
ATOM   2222 C CG  . GLU A 1 295 ? 0.029   -23.820 -2.168  1.00 62.67  ? 292 GLU A CG  1 
ATOM   2223 C CD  . GLU A 1 295 ? 0.226   -24.795 -3.318  1.00 66.46  ? 292 GLU A CD  1 
ATOM   2224 O OE1 . GLU A 1 295 ? -0.209  -24.487 -4.450  1.00 71.17  ? 292 GLU A OE1 1 
ATOM   2225 O OE2 . GLU A 1 295 ? 0.813   -25.872 -3.088  1.00 66.74  ? 292 GLU A OE2 1 
ATOM   2226 N N   . SER A 1 296 ? 1.100   -20.926 -0.137  1.00 46.91  ? 293 SER A N   1 
ATOM   2227 C CA  . SER A 1 296 ? 2.236   -20.082 0.217   1.00 47.65  ? 293 SER A CA  1 
ATOM   2228 C C   . SER A 1 296 ? 3.130   -20.655 1.309   1.00 43.56  ? 293 SER A C   1 
ATOM   2229 O O   . SER A 1 296 ? 2.748   -21.577 2.029   1.00 42.53  ? 293 SER A O   1 
ATOM   2230 C CB  . SER A 1 296 ? 1.736   -18.704 0.664   1.00 49.73  ? 293 SER A CB  1 
ATOM   2231 O OG  . SER A 1 296 ? 0.797   -18.827 1.723   1.00 43.37  ? 293 SER A OG  1 
ATOM   2232 N N   . ILE A 1 297 ? 4.331   -20.094 1.407   1.00 42.06  ? 294 ILE A N   1 
ATOM   2233 C CA  . ILE A 1 297 ? 5.193   -20.288 2.565   1.00 44.35  ? 294 ILE A CA  1 
ATOM   2234 C C   . ILE A 1 297 ? 5.539   -18.916 3.136   1.00 44.21  ? 294 ILE A C   1 
ATOM   2235 O O   . ILE A 1 297 ? 5.395   -17.899 2.455   1.00 44.76  ? 294 ILE A O   1 
ATOM   2236 C CB  . ILE A 1 297 ? 6.485   -21.057 2.224   1.00 43.13  ? 294 ILE A CB  1 
ATOM   2237 C CG1 . ILE A 1 297 ? 7.246   -20.366 1.088   1.00 43.00  ? 294 ILE A CG1 1 
ATOM   2238 C CG2 . ILE A 1 297 ? 6.168   -22.499 1.874   1.00 45.41  ? 294 ILE A CG2 1 
ATOM   2239 C CD1 . ILE A 1 297 ? 8.559   -21.046 0.721   1.00 38.56  ? 294 ILE A CD1 1 
ATOM   2240 N N   . PHE A 1 298 ? 6.000   -18.903 4.381   1.00 38.75  ? 295 PHE A N   1 
ATOM   2241 C CA  . PHE A 1 298 ? 6.248   -17.677 5.139   1.00 42.30  ? 295 PHE A CA  1 
ATOM   2242 C C   . PHE A 1 298 ? 5.060   -16.713 5.074   1.00 35.67  ? 295 PHE A C   1 
ATOM   2243 O O   . PHE A 1 298 ? 5.236   -15.508 4.923   1.00 37.17  ? 295 PHE A O   1 
ATOM   2244 C CB  . PHE A 1 298 ? 7.507   -16.953 4.652   1.00 38.82  ? 295 PHE A CB  1 
ATOM   2245 C CG  . PHE A 1 298 ? 8.228   -16.210 5.748   1.00 43.45  ? 295 PHE A CG  1 
ATOM   2246 C CD1 . PHE A 1 298 ? 9.603   -16.272 5.852   1.00 40.25  ? 295 PHE A CD1 1 
ATOM   2247 C CD2 . PHE A 1 298 ? 7.523   -15.523 6.724   1.00 38.87  ? 295 PHE A CD2 1 
ATOM   2248 C CE1 . PHE A 1 298 ? 10.258  -15.608 6.881   1.00 40.95  ? 295 PHE A CE1 1 
ATOM   2249 C CE2 . PHE A 1 298 ? 8.163   -14.868 7.729   1.00 41.65  ? 295 PHE A CE2 1 
ATOM   2250 C CZ  . PHE A 1 298 ? 9.532   -14.914 7.819   1.00 39.98  ? 295 PHE A CZ  1 
ATOM   2251 N N   . ARG A 1 299 ? 3.855   -17.254 5.170   1.00 35.21  ? 296 ARG A N   1 
ATOM   2252 C CA  . ARG A 1 299 ? 2.646   -16.451 5.300   1.00 34.09  ? 296 ARG A CA  1 
ATOM   2253 C C   . ARG A 1 299 ? 1.820   -17.016 6.445   1.00 38.68  ? 296 ARG A C   1 
ATOM   2254 O O   . ARG A 1 299 ? 1.602   -18.225 6.531   1.00 35.70  ? 296 ARG A O   1 
ATOM   2255 C CB  . ARG A 1 299 ? 1.833   -16.442 4.006   1.00 40.00  ? 296 ARG A CB  1 
ATOM   2256 C CG  . ARG A 1 299 ? 2.524   -15.760 2.829   1.00 40.06  ? 296 ARG A CG  1 
ATOM   2257 C CD  . ARG A 1 299 ? 2.721   -14.260 3.060   1.00 39.71  ? 296 ARG A CD  1 
ATOM   2258 N NE  . ARG A 1 299 ? 3.331   -13.625 1.893   1.00 44.04  ? 296 ARG A NE  1 
ATOM   2259 C CZ  . ARG A 1 299 ? 4.642   -13.494 1.713   1.00 42.56  ? 296 ARG A CZ  1 
ATOM   2260 N NH1 . ARG A 1 299 ? 5.485   -13.945 2.636   1.00 38.41  ? 296 ARG A NH1 1 
ATOM   2261 N NH2 . ARG A 1 299 ? 5.109   -12.913 0.613   1.00 39.54  ? 296 ARG A NH2 1 
ATOM   2262 N N   . PHE A 1 300 ? 1.374   -16.138 7.332   1.00 34.84  ? 297 PHE A N   1 
ATOM   2263 C CA  . PHE A 1 300 ? 0.656   -16.576 8.515   1.00 34.81  ? 297 PHE A CA  1 
ATOM   2264 C C   . PHE A 1 300 ? -0.727  -15.934 8.541   1.00 33.77  ? 297 PHE A C   1 
ATOM   2265 O O   . PHE A 1 300 ? -0.905  -14.789 8.128   1.00 33.11  ? 297 PHE A O   1 
ATOM   2266 C CB  . PHE A 1 300 ? 1.477   -16.250 9.766   1.00 36.22  ? 297 PHE A CB  1 
ATOM   2267 C CG  . PHE A 1 300 ? 2.955   -16.483 9.578   1.00 34.32  ? 297 PHE A CG  1 
ATOM   2268 C CD1 . PHE A 1 300 ? 3.453   -17.772 9.429   1.00 35.59  ? 297 PHE A CD1 1 
ATOM   2269 C CD2 . PHE A 1 300 ? 3.838   -15.419 9.510   1.00 33.95  ? 297 PHE A CD2 1 
ATOM   2270 C CE1 . PHE A 1 300 ? 4.809   -17.994 9.235   1.00 36.51  ? 297 PHE A CE1 1 
ATOM   2271 C CE2 . PHE A 1 300 ? 5.195   -15.633 9.317   1.00 38.20  ? 297 PHE A CE2 1 
ATOM   2272 C CZ  . PHE A 1 300 ? 5.681   -16.924 9.180   1.00 38.28  ? 297 PHE A CZ  1 
ATOM   2273 N N   . SER A 1 301 ? -1.704  -16.696 9.010   1.00 35.32  ? 298 SER A N   1 
ATOM   2274 C CA  . SER A 1 301 ? -3.106  -16.319 8.914   1.00 38.17  ? 298 SER A CA  1 
ATOM   2275 C C   . SER A 1 301 ? -3.491  -15.103 9.770   1.00 35.58  ? 298 SER A C   1 
ATOM   2276 O O   . SER A 1 301 ? -4.224  -14.225 9.317   1.00 34.85  ? 298 SER A O   1 
ATOM   2277 C CB  . SER A 1 301 ? -3.972  -17.519 9.303   1.00 41.25  ? 298 SER A CB  1 
ATOM   2278 O OG  . SER A 1 301 ? -3.662  -18.654 8.504   1.00 42.91  ? 298 SER A OG  1 
ATOM   2279 N N   . PHE A 1 302 ? -3.000  -15.048 11.002  1.00 29.25  ? 299 PHE A N   1 
ATOM   2280 C CA  . PHE A 1 302 ? -3.438  -14.001 11.927  1.00 33.00  ? 299 PHE A CA  1 
ATOM   2281 C C   . PHE A 1 302 ? -2.249  -13.255 12.500  1.00 27.89  ? 299 PHE A C   1 
ATOM   2282 O O   . PHE A 1 302 ? -1.523  -13.754 13.359  1.00 26.14  ? 299 PHE A O   1 
ATOM   2283 C CB  . PHE A 1 302 ? -4.324  -14.610 13.018  1.00 30.47  ? 299 PHE A CB  1 
ATOM   2284 C CG  . PHE A 1 302 ? -5.587  -15.197 12.467  1.00 29.81  ? 299 PHE A CG  1 
ATOM   2285 C CD1 . PHE A 1 302 ? -6.660  -14.380 12.148  1.00 30.98  ? 299 PHE A CD1 1 
ATOM   2286 C CD2 . PHE A 1 302 ? -5.676  -16.552 12.193  1.00 35.71  ? 299 PHE A CD2 1 
ATOM   2287 C CE1 . PHE A 1 302 ? -7.816  -14.908 11.588  1.00 35.08  ? 299 PHE A CE1 1 
ATOM   2288 C CE2 . PHE A 1 302 ? -6.827  -17.090 11.632  1.00 36.17  ? 299 PHE A CE2 1 
ATOM   2289 C CZ  . PHE A 1 302 ? -7.900  -16.264 11.331  1.00 33.51  ? 299 PHE A CZ  1 
ATOM   2290 N N   . VAL A 1 303 ? -2.060  -12.052 11.971  1.00 29.37  ? 300 VAL A N   1 
ATOM   2291 C CA  . VAL A 1 303 ? -0.886  -11.232 12.220  1.00 28.84  ? 300 VAL A CA  1 
ATOM   2292 C C   . VAL A 1 303 ? -1.348  -9.818  12.563  1.00 28.67  ? 300 VAL A C   1 
ATOM   2293 O O   . VAL A 1 303 ? -2.545  -9.535  12.484  1.00 30.75  ? 300 VAL A O   1 
ATOM   2294 C CB  . VAL A 1 303 ? 0.047   -11.211 10.981  1.00 26.79  ? 300 VAL A CB  1 
ATOM   2295 C CG1 . VAL A 1 303 ? 0.519   -12.624 10.636  1.00 26.01  ? 300 VAL A CG1 1 
ATOM   2296 C CG2 . VAL A 1 303 ? -0.656  -10.557 9.802   1.00 28.50  ? 300 VAL A CG2 1 
ATOM   2297 N N   . PRO A 1 304 ? -0.416  -8.929  12.959  1.00 29.37  ? 301 PRO A N   1 
ATOM   2298 C CA  . PRO A 1 304 ? -0.821  -7.541  13.197  1.00 30.21  ? 301 PRO A CA  1 
ATOM   2299 C C   . PRO A 1 304 ? -1.600  -6.931  12.037  1.00 33.42  ? 301 PRO A C   1 
ATOM   2300 O O   . PRO A 1 304 ? -1.306  -7.202  10.872  1.00 32.18  ? 301 PRO A O   1 
ATOM   2301 C CB  . PRO A 1 304 ? 0.514   -6.833  13.393  1.00 28.42  ? 301 PRO A CB  1 
ATOM   2302 C CG  . PRO A 1 304 ? 1.337   -7.856  14.087  1.00 30.44  ? 301 PRO A CG  1 
ATOM   2303 C CD  . PRO A 1 304 ? 0.949   -9.177  13.464  1.00 32.72  ? 301 PRO A CD  1 
ATOM   2304 N N   . VAL A 1 305 ? -2.602  -6.128  12.368  1.00 31.74  ? 302 VAL A N   1 
ATOM   2305 C CA  . VAL A 1 305 ? -3.453  -5.517  11.361  1.00 32.14  ? 302 VAL A CA  1 
ATOM   2306 C C   . VAL A 1 305 ? -3.238  -4.004  11.340  1.00 36.09  ? 302 VAL A C   1 
ATOM   2307 O O   . VAL A 1 305 ? -3.053  -3.382  12.389  1.00 35.05  ? 302 VAL A O   1 
ATOM   2308 C CB  . VAL A 1 305 ? -4.941  -5.849  11.619  1.00 32.70  ? 302 VAL A CB  1 
ATOM   2309 C CG1 . VAL A 1 305 ? -5.364  -5.403  13.026  1.00 32.85  ? 302 VAL A CG1 1 
ATOM   2310 C CG2 . VAL A 1 305 ? -5.834  -5.238  10.541  1.00 35.89  ? 302 VAL A CG2 1 
ATOM   2311 N N   . VAL A 1 306 ? -3.225  -3.422  10.144  1.00 32.88  ? 303 VAL A N   1 
ATOM   2312 C CA  . VAL A 1 306 ? -3.143  -1.974  10.001  1.00 35.63  ? 303 VAL A CA  1 
ATOM   2313 C C   . VAL A 1 306 ? -4.500  -1.396  10.368  1.00 37.75  ? 303 VAL A C   1 
ATOM   2314 O O   . VAL A 1 306 ? -5.386  -1.257  9.520   1.00 36.73  ? 303 VAL A O   1 
ATOM   2315 C CB  . VAL A 1 306 ? -2.744  -1.551  8.574   1.00 36.35  ? 303 VAL A CB  1 
ATOM   2316 C CG1 . VAL A 1 306 ? -2.654  -0.036  8.476   1.00 35.98  ? 303 VAL A CG1 1 
ATOM   2317 C CG2 . VAL A 1 306 ? -1.420  -2.184  8.194   1.00 37.88  ? 303 VAL A CG2 1 
ATOM   2318 N N   . ASP A 1 307 ? -4.651  -1.067  11.647  1.00 35.65  ? 304 ASP A N   1 
ATOM   2319 C CA  . ASP A 1 307 ? -5.957  -0.773  12.224  1.00 38.31  ? 304 ASP A CA  1 
ATOM   2320 C C   . ASP A 1 307 ? -6.288  0.710   12.280  1.00 38.81  ? 304 ASP A C   1 
ATOM   2321 O O   . ASP A 1 307 ? -7.425  1.079   12.567  1.00 43.77  ? 304 ASP A O   1 
ATOM   2322 C CB  . ASP A 1 307 ? -6.049  -1.368  13.637  1.00 35.59  ? 304 ASP A CB  1 
ATOM   2323 C CG  . ASP A 1 307 ? -4.957  -0.853  14.576  1.00 39.04  ? 304 ASP A CG  1 
ATOM   2324 O OD1 . ASP A 1 307 ? -3.989  -0.211  14.107  1.00 34.86  ? 304 ASP A OD1 1 
ATOM   2325 O OD2 . ASP A 1 307 ? -5.061  -1.117  15.796  1.00 39.11  ? 304 ASP A OD2 1 
ATOM   2326 N N   . GLY A 1 308 ? -5.302  1.558   12.010  1.00 40.68  ? 305 GLY A N   1 
ATOM   2327 C CA  . GLY A 1 308 ? -5.484  2.992   12.151  1.00 41.34  ? 305 GLY A CA  1 
ATOM   2328 C C   . GLY A 1 308 ? -5.468  3.404   13.616  1.00 44.90  ? 305 GLY A C   1 
ATOM   2329 O O   . GLY A 1 308 ? -5.857  4.519   13.964  1.00 46.35  ? 305 GLY A O   1 
ATOM   2330 N N   . ASP A 1 309 ? -5.020  2.494   14.477  1.00 40.42  ? 306 ASP A N   1 
ATOM   2331 C CA  . ASP A 1 309 ? -4.925  2.767   15.909  1.00 39.03  ? 306 ASP A CA  1 
ATOM   2332 C C   . ASP A 1 309 ? -3.524  2.443   16.428  1.00 42.72  ? 306 ASP A C   1 
ATOM   2333 O O   . ASP A 1 309 ? -2.673  3.329   16.502  1.00 42.59  ? 306 ASP A O   1 
ATOM   2334 C CB  . ASP A 1 309 ? -5.982  1.974   16.680  1.00 39.68  ? 306 ASP A CB  1 
ATOM   2335 C CG  . ASP A 1 309 ? -6.056  2.374   18.141  1.00 45.06  ? 306 ASP A CG  1 
ATOM   2336 O OD1 . ASP A 1 309 ? -5.509  3.439   18.491  1.00 48.30  ? 306 ASP A OD1 1 
ATOM   2337 O OD2 . ASP A 1 309 ? -6.665  1.632   18.937  1.00 43.29  ? 306 ASP A OD2 1 
ATOM   2338 N N   . PHE A 1 310 ? -3.288  1.179   16.786  1.00 41.14  ? 307 PHE A N   1 
ATOM   2339 C CA  . PHE A 1 310 ? -1.947  0.731   17.160  1.00 36.21  ? 307 PHE A CA  1 
ATOM   2340 C C   . PHE A 1 310 ? -0.969  1.069   16.041  1.00 37.18  ? 307 PHE A C   1 
ATOM   2341 O O   . PHE A 1 310 ? 0.119   1.584   16.287  1.00 37.56  ? 307 PHE A O   1 
ATOM   2342 C CB  . PHE A 1 310 ? -1.916  -0.774  17.454  1.00 35.28  ? 307 PHE A CB  1 
ATOM   2343 C CG  . PHE A 1 310 ? -0.669  -1.223  18.172  1.00 33.03  ? 307 PHE A CG  1 
ATOM   2344 C CD1 . PHE A 1 310 ? 0.527   -1.381  17.487  1.00 29.96  ? 307 PHE A CD1 1 
ATOM   2345 C CD2 . PHE A 1 310 ? -0.692  -1.481  19.534  1.00 35.13  ? 307 PHE A CD2 1 
ATOM   2346 C CE1 . PHE A 1 310 ? 1.674   -1.787  18.146  1.00 32.92  ? 307 PHE A CE1 1 
ATOM   2347 C CE2 . PHE A 1 310 ? 0.452   -1.891  20.201  1.00 32.85  ? 307 PHE A CE2 1 
ATOM   2348 C CZ  . PHE A 1 310 ? 1.637   -2.038  19.508  1.00 30.61  ? 307 PHE A CZ  1 
ATOM   2349 N N   . LEU A 1 311 ? -1.369  0.765   14.809  1.00 37.48  ? 308 LEU A N   1 
ATOM   2350 C CA  . LEU A 1 311 ? -0.633  1.201   13.632  1.00 38.22  ? 308 LEU A CA  1 
ATOM   2351 C C   . LEU A 1 311 ? -1.469  2.254   12.922  1.00 39.22  ? 308 LEU A C   1 
ATOM   2352 O O   . LEU A 1 311 ? -2.481  1.932   12.301  1.00 38.53  ? 308 LEU A O   1 
ATOM   2353 C CB  . LEU A 1 311 ? -0.330  0.025   12.695  1.00 37.38  ? 308 LEU A CB  1 
ATOM   2354 C CG  . LEU A 1 311 ? 0.555   -1.098  13.245  1.00 39.90  ? 308 LEU A CG  1 
ATOM   2355 C CD1 . LEU A 1 311 ? 0.632   -2.260  12.256  1.00 38.73  ? 308 LEU A CD1 1 
ATOM   2356 C CD2 . LEU A 1 311 ? 1.946   -0.577  13.574  1.00 37.40  ? 308 LEU A CD2 1 
ATOM   2357 N N   . SER A 1 312 ? -1.054  3.512   13.027  1.00 41.60  ? 309 SER A N   1 
ATOM   2358 C CA  . SER A 1 312 ? -1.819  4.613   12.451  1.00 44.21  ? 309 SER A CA  1 
ATOM   2359 C C   . SER A 1 312 ? -1.818  4.556   10.927  1.00 40.91  ? 309 SER A C   1 
ATOM   2360 O O   . SER A 1 312 ? -2.701  5.118   10.279  1.00 45.45  ? 309 SER A O   1 
ATOM   2361 C CB  . SER A 1 312 ? -1.269  5.959   12.927  1.00 41.86  ? 309 SER A CB  1 
ATOM   2362 O OG  . SER A 1 312 ? 0.017   6.199   12.387  1.00 42.74  ? 309 SER A OG  1 
ATOM   2363 N N   . ASP A 1 313 ? -0.823  3.875   10.365  1.00 38.98  ? 310 ASP A N   1 
ATOM   2364 C CA  . ASP A 1 313 ? -0.721  3.674   8.921   1.00 38.80  ? 310 ASP A CA  1 
ATOM   2365 C C   . ASP A 1 313 ? 0.080   2.398   8.675   1.00 40.47  ? 310 ASP A C   1 
ATOM   2366 O O   . ASP A 1 313 ? 0.496   1.737   9.628   1.00 37.49  ? 310 ASP A O   1 
ATOM   2367 C CB  . ASP A 1 313 ? -0.059  4.881   8.247   1.00 35.87  ? 310 ASP A CB  1 
ATOM   2368 C CG  . ASP A 1 313 ? -0.388  4.988   6.762   1.00 42.95  ? 310 ASP A CG  1 
ATOM   2369 O OD1 . ASP A 1 313 ? -0.974  4.041   6.196   1.00 39.95  ? 310 ASP A OD1 1 
ATOM   2370 O OD2 . ASP A 1 313 ? -0.049  6.026   6.158   1.00 44.77  ? 310 ASP A OD2 1 
ATOM   2371 N N   . THR A 1 314 ? 0.285   2.038   7.410   1.00 37.95  ? 311 THR A N   1 
ATOM   2372 C CA  . THR A 1 314 ? 1.119   0.885   7.083   1.00 36.91  ? 311 THR A CA  1 
ATOM   2373 C C   . THR A 1 314 ? 2.531   1.128   7.594   1.00 38.88  ? 311 THR A C   1 
ATOM   2374 O O   . THR A 1 314 ? 2.991   2.268   7.622   1.00 41.53  ? 311 THR A O   1 
ATOM   2375 C CB  . THR A 1 314 ? 1.179   0.611   5.562   1.00 38.63  ? 311 THR A CB  1 
ATOM   2376 O OG1 . THR A 1 314 ? 1.919   1.656   4.921   1.00 36.61  ? 311 THR A OG1 1 
ATOM   2377 C CG2 . THR A 1 314 ? -0.223  0.523   4.964   1.00 35.61  ? 311 THR A CG2 1 
ATOM   2378 N N   . PRO A 1 315 ? 3.221   0.062   8.019   1.00 41.34  ? 312 PRO A N   1 
ATOM   2379 C CA  . PRO A 1 315 ? 4.608   0.225   8.461   1.00 40.27  ? 312 PRO A CA  1 
ATOM   2380 C C   . PRO A 1 315 ? 5.508   0.865   7.400   1.00 40.63  ? 312 PRO A C   1 
ATOM   2381 O O   . PRO A 1 315 ? 6.394   1.627   7.768   1.00 41.38  ? 312 PRO A O   1 
ATOM   2382 C CB  . PRO A 1 315 ? 5.043   -1.210  8.764   1.00 37.85  ? 312 PRO A CB  1 
ATOM   2383 C CG  . PRO A 1 315 ? 3.777   -1.878  9.197   1.00 37.87  ? 312 PRO A CG  1 
ATOM   2384 C CD  . PRO A 1 315 ? 2.698   -1.282  8.326   1.00 39.18  ? 312 PRO A CD  1 
ATOM   2385 N N   . GLU A 1 316 ? 5.287   0.581   6.117   1.00 43.89  ? 313 GLU A N   1 
ATOM   2386 C CA  . GLU A 1 316 ? 6.133   1.171   5.078   1.00 42.18  ? 313 GLU A CA  1 
ATOM   2387 C C   . GLU A 1 316 ? 5.972   2.690   5.072   1.00 40.67  ? 313 GLU A C   1 
ATOM   2388 O O   . GLU A 1 316 ? 6.958   3.429   5.031   1.00 44.45  ? 313 GLU A O   1 
ATOM   2389 C CB  . GLU A 1 316 ? 5.818   0.585   3.696   1.00 47.10  ? 313 GLU A CB  1 
ATOM   2390 C CG  . GLU A 1 316 ? 6.242   1.487   2.541   1.00 53.15  ? 313 GLU A CG  1 
ATOM   2391 C CD  . GLU A 1 316 ? 5.871   0.928   1.174   1.00 66.02  ? 313 GLU A CD  1 
ATOM   2392 O OE1 . GLU A 1 316 ? 5.105   -0.060  1.114   1.00 68.34  ? 313 GLU A OE1 1 
ATOM   2393 O OE2 . GLU A 1 316 ? 6.355   1.474   0.157   1.00 67.49  ? 313 GLU A OE2 1 
ATOM   2394 N N   . ALA A 1 317 ? 4.730   3.150   5.149   1.00 38.68  ? 314 ALA A N   1 
ATOM   2395 C CA  . ALA A 1 317 ? 4.455   4.574   5.255   1.00 43.49  ? 314 ALA A CA  1 
ATOM   2396 C C   . ALA A 1 317 ? 5.106   5.179   6.500   1.00 47.18  ? 314 ALA A C   1 
ATOM   2397 O O   . ALA A 1 317 ? 5.749   6.230   6.427   1.00 50.04  ? 314 ALA A O   1 
ATOM   2398 C CB  . ALA A 1 317 ? 2.955   4.819   5.273   1.00 43.04  ? 314 ALA A CB  1 
ATOM   2399 N N   . LEU A 1 318 ? 4.944   4.508   7.639   1.00 41.07  ? 315 LEU A N   1 
ATOM   2400 C CA  . LEU A 1 318 ? 5.449   5.024   8.910   1.00 42.67  ? 315 LEU A CA  1 
ATOM   2401 C C   . LEU A 1 318 ? 6.974   5.108   8.949   1.00 41.37  ? 315 LEU A C   1 
ATOM   2402 O O   . LEU A 1 318 ? 7.530   6.032   9.541   1.00 46.11  ? 315 LEU A O   1 
ATOM   2403 C CB  . LEU A 1 318 ? 4.946   4.166   10.074  1.00 38.62  ? 315 LEU A CB  1 
ATOM   2404 C CG  . LEU A 1 318 ? 3.435   4.173   10.302  1.00 41.07  ? 315 LEU A CG  1 
ATOM   2405 C CD1 . LEU A 1 318 ? 3.074   3.335   11.517  1.00 42.35  ? 315 LEU A CD1 1 
ATOM   2406 C CD2 . LEU A 1 318 ? 2.925   5.596   10.464  1.00 42.53  ? 315 LEU A CD2 1 
ATOM   2407 N N   . ILE A 1 319 ? 7.654   4.151   8.327   1.00 41.81  ? 316 ILE A N   1 
ATOM   2408 C CA  . ILE A 1 319 ? 9.110   4.199   8.290   1.00 43.78  ? 316 ILE A CA  1 
ATOM   2409 C C   . ILE A 1 319 ? 9.575   5.170   7.206   1.00 50.95  ? 316 ILE A C   1 
ATOM   2410 O O   . ILE A 1 319 ? 10.701  5.665   7.256   1.00 54.36  ? 316 ILE A O   1 
ATOM   2411 C CB  . ILE A 1 319 ? 9.748   2.805   8.055   1.00 40.62  ? 316 ILE A CB  1 
ATOM   2412 C CG1 . ILE A 1 319 ? 9.451   2.285   6.650   1.00 47.85  ? 316 ILE A CG1 1 
ATOM   2413 C CG2 . ILE A 1 319 ? 9.296   1.805   9.125   1.00 39.19  ? 316 ILE A CG2 1 
ATOM   2414 C CD1 . ILE A 1 319 ? 10.253  1.051   6.276   1.00 42.71  ? 316 ILE A CD1 1 
ATOM   2415 N N   . ASN A 1 320 ? 8.706   5.455   6.237   1.00 47.47  ? 317 ASN A N   1 
ATOM   2416 C CA  . ASN A 1 320 ? 9.043   6.423   5.192   1.00 56.96  ? 317 ASN A CA  1 
ATOM   2417 C C   . ASN A 1 320 ? 8.906   7.870   5.662   1.00 56.61  ? 317 ASN A C   1 
ATOM   2418 O O   . ASN A 1 320 ? 9.639   8.747   5.204   1.00 58.81  ? 317 ASN A O   1 
ATOM   2419 C CB  . ASN A 1 320 ? 8.175   6.209   3.947   1.00 51.47  ? 317 ASN A CB  1 
ATOM   2420 C CG  . ASN A 1 320 ? 8.621   5.018   3.119   1.00 54.39  ? 317 ASN A CG  1 
ATOM   2421 O OD1 . ASN A 1 320 ? 9.726   4.503   3.293   1.00 58.97  ? 317 ASN A OD1 1 
ATOM   2422 N ND2 . ASN A 1 320 ? 7.760   4.576   2.207   1.00 59.33  ? 317 ASN A ND2 1 
ATOM   2423 N N   . THR A 1 321 ? 7.972   8.122   6.575   1.00 53.72  ? 318 THR A N   1 
ATOM   2424 C CA  . THR A 1 321 ? 7.704   9.492   7.006   1.00 55.86  ? 318 THR A CA  1 
ATOM   2425 C C   . THR A 1 321 ? 8.119   9.764   8.451   1.00 57.72  ? 318 THR A C   1 
ATOM   2426 O O   . THR A 1 321 ? 7.909   10.862  8.964   1.00 62.25  ? 318 THR A O   1 
ATOM   2427 C CB  . THR A 1 321 ? 6.209   9.838   6.864   1.00 58.80  ? 318 THR A CB  1 
ATOM   2428 O OG1 . THR A 1 321 ? 5.462   9.178   7.892   1.00 61.73  ? 318 THR A OG1 1 
ATOM   2429 C CG2 . THR A 1 321 ? 5.687   9.411   5.498   1.00 58.72  ? 318 THR A CG2 1 
ATOM   2430 N N   . GLY A 1 322 ? 8.711   8.771   9.103   1.00 56.50  ? 319 GLY A N   1 
ATOM   2431 C CA  . GLY A 1 322 ? 9.021   8.886   10.515  1.00 56.75  ? 319 GLY A CA  1 
ATOM   2432 C C   . GLY A 1 322 ? 10.304  9.621   10.862  1.00 55.92  ? 319 GLY A C   1 
ATOM   2433 O O   . GLY A 1 322 ? 11.280  9.594   10.113  1.00 55.11  ? 319 GLY A O   1 
ATOM   2434 N N   . ASP A 1 323 ? 10.289  10.278  12.018  1.00 56.74  ? 320 ASP A N   1 
ATOM   2435 C CA  . ASP A 1 323 ? 11.477  10.906  12.586  1.00 57.01  ? 320 ASP A CA  1 
ATOM   2436 C C   . ASP A 1 323 ? 12.040  10.011  13.685  1.00 57.19  ? 320 ASP A C   1 
ATOM   2437 O O   . ASP A 1 323 ? 11.406  9.814   14.722  1.00 53.45  ? 320 ASP A O   1 
ATOM   2438 C CB  . ASP A 1 323 ? 11.140  12.295  13.136  1.00 61.05  ? 320 ASP A CB  1 
ATOM   2439 C CG  . ASP A 1 323 ? 12.297  12.928  13.894  1.00 61.98  ? 320 ASP A CG  1 
ATOM   2440 O OD1 . ASP A 1 323 ? 13.468  12.676  13.539  1.00 65.36  ? 320 ASP A OD1 1 
ATOM   2441 O OD2 . ASP A 1 323 ? 12.029  13.682  14.852  1.00 67.67  ? 320 ASP A OD2 1 
ATOM   2442 N N   . PHE A 1 324 ? 13.231  9.467   13.456  1.00 55.68  ? 321 PHE A N   1 
ATOM   2443 C CA  . PHE A 1 324 ? 13.804  8.492   14.378  1.00 55.06  ? 321 PHE A CA  1 
ATOM   2444 C C   . PHE A 1 324 ? 15.110  8.972   15.001  1.00 54.68  ? 321 PHE A C   1 
ATOM   2445 O O   . PHE A 1 324 ? 15.968  8.166   15.356  1.00 55.39  ? 321 PHE A O   1 
ATOM   2446 C CB  . PHE A 1 324 ? 14.029  7.164   13.653  1.00 51.66  ? 321 PHE A CB  1 
ATOM   2447 C CG  . PHE A 1 324 ? 12.783  6.596   13.040  1.00 51.06  ? 321 PHE A CG  1 
ATOM   2448 C CD1 . PHE A 1 324 ? 11.794  6.044   13.838  1.00 49.57  ? 321 PHE A CD1 1 
ATOM   2449 C CD2 . PHE A 1 324 ? 12.595  6.619   11.667  1.00 53.24  ? 321 PHE A CD2 1 
ATOM   2450 C CE1 . PHE A 1 324 ? 10.644  5.523   13.280  1.00 51.54  ? 321 PHE A CE1 1 
ATOM   2451 C CE2 . PHE A 1 324 ? 11.447  6.097   11.101  1.00 51.45  ? 321 PHE A CE2 1 
ATOM   2452 C CZ  . PHE A 1 324 ? 10.469  5.549   11.909  1.00 50.59  ? 321 PHE A CZ  1 
ATOM   2453 N N   . GLN A 1 325 ? 15.239  10.286  15.158  1.00 57.68  ? 322 GLN A N   1 
ATOM   2454 C CA  . GLN A 1 325 ? 16.497  10.906  15.570  1.00 59.90  ? 322 GLN A CA  1 
ATOM   2455 C C   . GLN A 1 325 ? 17.044  10.418  16.915  1.00 58.52  ? 322 GLN A C   1 
ATOM   2456 O O   . GLN A 1 325 ? 18.257  10.280  17.077  1.00 63.23  ? 322 GLN A O   1 
ATOM   2457 C CB  . GLN A 1 325 ? 16.330  12.423  15.612  1.00 63.08  ? 322 GLN A CB  1 
ATOM   2458 C CG  . GLN A 1 325 ? 17.555  13.185  15.147  1.00 68.65  ? 322 GLN A CG  1 
ATOM   2459 C CD  . GLN A 1 325 ? 17.212  14.569  14.636  1.00 77.12  ? 322 GLN A CD  1 
ATOM   2460 O OE1 . GLN A 1 325 ? 16.196  15.149  15.019  1.00 81.23  ? 322 GLN A OE1 1 
ATOM   2461 N NE2 . GLN A 1 325 ? 18.054  15.101  13.758  1.00 77.17  ? 322 GLN A NE2 1 
ATOM   2462 N N   . ASP A 1 326 ? 16.165  10.157  17.875  1.00 53.69  ? 323 ASP A N   1 
ATOM   2463 C CA  . ASP A 1 326 ? 16.619  9.727   19.198  1.00 60.44  ? 323 ASP A CA  1 
ATOM   2464 C C   . ASP A 1 326 ? 16.485  8.220   19.386  1.00 57.52  ? 323 ASP A C   1 
ATOM   2465 O O   . ASP A 1 326 ? 16.126  7.746   20.463  1.00 56.94  ? 323 ASP A O   1 
ATOM   2466 C CB  . ASP A 1 326 ? 15.845  10.461  20.295  1.00 64.11  ? 323 ASP A CB  1 
ATOM   2467 C CG  . ASP A 1 326 ? 16.117  11.953  20.300  1.00 74.53  ? 323 ASP A CG  1 
ATOM   2468 O OD1 . ASP A 1 326 ? 17.289  12.345  20.493  1.00 77.48  ? 323 ASP A OD1 1 
ATOM   2469 O OD2 . ASP A 1 326 ? 15.160  12.735  20.116  1.00 79.18  ? 323 ASP A OD2 1 
ATOM   2470 N N   . LEU A 1 327 ? 16.781  7.471   18.332  1.00 56.79  ? 324 LEU A N   1 
ATOM   2471 C CA  . LEU A 1 327 ? 16.646  6.025   18.372  1.00 50.31  ? 324 LEU A CA  1 
ATOM   2472 C C   . LEU A 1 327 ? 17.949  5.352   17.970  1.00 44.04  ? 324 LEU A C   1 
ATOM   2473 O O   . LEU A 1 327 ? 18.561  5.717   16.968  1.00 46.42  ? 324 LEU A O   1 
ATOM   2474 C CB  . LEU A 1 327 ? 15.511  5.572   17.453  1.00 50.95  ? 324 LEU A CB  1 
ATOM   2475 C CG  . LEU A 1 327 ? 15.038  4.125   17.574  1.00 50.39  ? 324 LEU A CG  1 
ATOM   2476 C CD1 . LEU A 1 327 ? 14.418  3.882   18.932  1.00 52.42  ? 324 LEU A CD1 1 
ATOM   2477 C CD2 . LEU A 1 327 ? 14.050  3.797   16.464  1.00 54.94  ? 324 LEU A CD2 1 
ATOM   2478 N N   . GLN A 1 328 ? 18.380  4.381   18.765  1.00 41.75  ? 325 GLN A N   1 
ATOM   2479 C CA  . GLN A 1 328 ? 19.494  3.528   18.380  1.00 40.89  ? 325 GLN A CA  1 
ATOM   2480 C C   . GLN A 1 328 ? 18.966  2.122   18.146  1.00 39.95  ? 325 GLN A C   1 
ATOM   2481 O O   . GLN A 1 328 ? 18.227  1.582   18.967  1.00 36.77  ? 325 GLN A O   1 
ATOM   2482 C CB  . GLN A 1 328 ? 20.596  3.523   19.439  1.00 39.56  ? 325 GLN A CB  1 
ATOM   2483 C CG  . GLN A 1 328 ? 21.166  4.895   19.742  1.00 41.71  ? 325 GLN A CG  1 
ATOM   2484 C CD  . GLN A 1 328 ? 20.678  5.433   21.062  1.00 49.56  ? 325 GLN A CD  1 
ATOM   2485 O OE1 . GLN A 1 328 ? 20.749  4.747   22.081  1.00 47.76  ? 325 GLN A OE1 1 
ATOM   2486 N NE2 . GLN A 1 328 ? 20.171  6.660   21.056  1.00 51.89  ? 325 GLN A NE2 1 
ATOM   2487 N N   . VAL A 1 329 ? 19.332  1.536   17.013  1.00 37.88  ? 326 VAL A N   1 
ATOM   2488 C CA  . VAL A 1 329 ? 18.784  0.244   16.631  1.00 37.80  ? 326 VAL A CA  1 
ATOM   2489 C C   . VAL A 1 329 ? 19.878  -0.702  16.150  1.00 36.85  ? 326 VAL A C   1 
ATOM   2490 O O   . VAL A 1 329 ? 20.812  -0.295  15.460  1.00 41.99  ? 326 VAL A O   1 
ATOM   2491 C CB  . VAL A 1 329 ? 17.705  0.397   15.531  1.00 41.94  ? 326 VAL A CB  1 
ATOM   2492 C CG1 . VAL A 1 329 ? 17.146  -0.946  15.142  1.00 43.24  ? 326 VAL A CG1 1 
ATOM   2493 C CG2 . VAL A 1 329 ? 16.574  1.277   16.017  1.00 40.26  ? 326 VAL A CG2 1 
ATOM   2494 N N   . LEU A 1 330 ? 19.755  -1.965  16.538  1.00 34.70  ? 327 LEU A N   1 
ATOM   2495 C CA  . LEU A 1 330 ? 20.629  -3.027  16.071  1.00 36.31  ? 327 LEU A CA  1 
ATOM   2496 C C   . LEU A 1 330 ? 19.798  -4.002  15.239  1.00 34.39  ? 327 LEU A C   1 
ATOM   2497 O O   . LEU A 1 330 ? 18.810  -4.543  15.729  1.00 33.28  ? 327 LEU A O   1 
ATOM   2498 C CB  . LEU A 1 330 ? 21.284  -3.727  17.263  1.00 38.35  ? 327 LEU A CB  1 
ATOM   2499 C CG  . LEU A 1 330 ? 22.171  -4.954  17.075  1.00 39.37  ? 327 LEU A CG  1 
ATOM   2500 C CD1 . LEU A 1 330 ? 23.287  -4.650  16.112  1.00 41.01  ? 327 LEU A CD1 1 
ATOM   2501 C CD2 . LEU A 1 330 ? 22.732  -5.361  18.437  1.00 40.92  ? 327 LEU A CD2 1 
ATOM   2502 N N   . VAL A 1 331 ? 20.176  -4.201  13.977  1.00 34.63  ? 328 VAL A N   1 
ATOM   2503 C CA  . VAL A 1 331 ? 19.413  -5.058  13.064  1.00 33.44  ? 328 VAL A CA  1 
ATOM   2504 C C   . VAL A 1 331 ? 20.304  -6.030  12.298  1.00 33.96  ? 328 VAL A C   1 
ATOM   2505 O O   . VAL A 1 331 ? 21.458  -5.729  12.009  1.00 35.75  ? 328 VAL A O   1 
ATOM   2506 C CB  . VAL A 1 331 ? 18.618  -4.235  12.025  1.00 37.34  ? 328 VAL A CB  1 
ATOM   2507 C CG1 . VAL A 1 331 ? 17.575  -3.389  12.698  1.00 33.92  ? 328 VAL A CG1 1 
ATOM   2508 C CG2 . VAL A 1 331 ? 19.556  -3.364  11.194  1.00 38.86  ? 328 VAL A CG2 1 
ATOM   2509 N N   . GLY A 1 332 ? 19.768  -7.193  11.953  1.00 31.26  ? 329 GLY A N   1 
ATOM   2510 C CA  . GLY A 1 332 ? 20.548  -8.145  11.185  1.00 32.72  ? 329 GLY A CA  1 
ATOM   2511 C C   . GLY A 1 332 ? 19.811  -9.389  10.749  1.00 29.66  ? 329 GLY A C   1 
ATOM   2512 O O   . GLY A 1 332 ? 18.632  -9.569  11.049  1.00 31.92  ? 329 GLY A O   1 
ATOM   2513 N N   . VAL A 1 333 ? 20.535  -10.251 10.040  1.00 29.18  ? 330 VAL A N   1 
ATOM   2514 C CA  . VAL A 1 333 ? 19.986  -11.454 9.435   1.00 28.96  ? 330 VAL A CA  1 
ATOM   2515 C C   . VAL A 1 333 ? 20.954  -12.612 9.624   1.00 32.05  ? 330 VAL A C   1 
ATOM   2516 O O   . VAL A 1 333 ? 22.129  -12.399 9.933   1.00 29.77  ? 330 VAL A O   1 
ATOM   2517 C CB  . VAL A 1 333 ? 19.727  -11.265 7.912   1.00 33.12  ? 330 VAL A CB  1 
ATOM   2518 C CG1 . VAL A 1 333 ? 18.732  -10.139 7.656   1.00 29.02  ? 330 VAL A CG1 1 
ATOM   2519 C CG2 . VAL A 1 333 ? 21.036  -10.993 7.182   1.00 29.56  ? 330 VAL A CG2 1 
ATOM   2520 N N   . VAL A 1 334 ? 20.472  -13.837 9.429   1.00 28.47  ? 331 VAL A N   1 
ATOM   2521 C CA  . VAL A 1 334 ? 21.364  -14.990 9.396   1.00 29.51  ? 331 VAL A CA  1 
ATOM   2522 C C   . VAL A 1 334 ? 21.693  -15.292 7.936   1.00 32.25  ? 331 VAL A C   1 
ATOM   2523 O O   . VAL A 1 334 ? 21.072  -14.737 7.035   1.00 30.51  ? 331 VAL A O   1 
ATOM   2524 C CB  . VAL A 1 334 ? 20.754  -16.238 10.072  1.00 31.43  ? 331 VAL A CB  1 
ATOM   2525 C CG1 . VAL A 1 334 ? 20.536  -15.990 11.578  1.00 29.68  ? 331 VAL A CG1 1 
ATOM   2526 C CG2 . VAL A 1 334 ? 19.461  -16.644 9.384   1.00 31.92  ? 331 VAL A CG2 1 
ATOM   2527 N N   . LYS A 1 335 ? 22.667  -16.164 7.711   1.00 35.42  ? 332 LYS A N   1 
ATOM   2528 C CA  . LYS A 1 335 ? 23.172  -16.416 6.362   1.00 36.19  ? 332 LYS A CA  1 
ATOM   2529 C C   . LYS A 1 335 ? 22.118  -17.014 5.427   1.00 35.37  ? 332 LYS A C   1 
ATOM   2530 O O   . LYS A 1 335 ? 22.077  -16.686 4.244   1.00 36.97  ? 332 LYS A O   1 
ATOM   2531 C CB  . LYS A 1 335 ? 24.394  -17.334 6.430   1.00 39.53  ? 332 LYS A CB  1 
ATOM   2532 C CG  . LYS A 1 335 ? 25.136  -17.497 5.109   1.00 44.90  ? 332 LYS A CG  1 
ATOM   2533 C CD  . LYS A 1 335 ? 26.489  -18.163 5.329   1.00 44.64  ? 332 LYS A CD  1 
ATOM   2534 C CE  . LYS A 1 335 ? 26.581  -19.511 4.629   1.00 57.67  ? 332 LYS A CE  1 
ATOM   2535 N NZ  . LYS A 1 335 ? 25.766  -20.564 5.296   1.00 48.10  ? 332 LYS A NZ  1 
ATOM   2536 N N   . ASP A 1 336 ? 21.259  -17.879 5.958   1.00 34.14  ? 333 ASP A N   1 
ATOM   2537 C CA  . ASP A 1 336 ? 20.275  -18.566 5.123   1.00 36.41  ? 333 ASP A CA  1 
ATOM   2538 C C   . ASP A 1 336 ? 18.840  -18.431 5.626   1.00 32.83  ? 333 ASP A C   1 
ATOM   2539 O O   . ASP A 1 336 ? 18.239  -19.410 6.066   1.00 32.12  ? 333 ASP A O   1 
ATOM   2540 C CB  . ASP A 1 336 ? 20.637  -20.046 5.010   1.00 35.30  ? 333 ASP A CB  1 
ATOM   2541 C CG  . ASP A 1 336 ? 22.011  -20.264 4.410   1.00 37.49  ? 333 ASP A CG  1 
ATOM   2542 O OD1 . ASP A 1 336 ? 22.115  -20.327 3.166   1.00 40.38  ? 333 ASP A OD1 1 
ATOM   2543 O OD2 . ASP A 1 336 ? 22.987  -20.366 5.182   1.00 39.49  ? 333 ASP A OD2 1 
ATOM   2544 N N   . GLU A 1 337 ? 18.283  -17.227 5.521   1.00 32.95  ? 334 GLU A N   1 
ATOM   2545 C CA  . GLU A 1 337 ? 16.953  -16.943 6.060   1.00 35.65  ? 334 GLU A CA  1 
ATOM   2546 C C   . GLU A 1 337 ? 15.843  -17.821 5.467   1.00 38.34  ? 334 GLU A C   1 
ATOM   2547 O O   . GLU A 1 337 ? 14.898  -18.188 6.164   1.00 37.34  ? 334 GLU A O   1 
ATOM   2548 C CB  . GLU A 1 337 ? 16.604  -15.467 5.845   1.00 32.21  ? 334 GLU A CB  1 
ATOM   2549 C CG  . GLU A 1 337 ? 17.459  -14.484 6.651   1.00 28.44  ? 334 GLU A CG  1 
ATOM   2550 C CD  . GLU A 1 337 ? 17.097  -14.458 8.132   1.00 33.44  ? 334 GLU A CD  1 
ATOM   2551 O OE1 . GLU A 1 337 ? 16.085  -15.083 8.513   1.00 32.60  ? 334 GLU A OE1 1 
ATOM   2552 O OE2 . GLU A 1 337 ? 17.831  -13.814 8.910   1.00 31.11  ? 334 GLU A OE2 1 
ATOM   2553 N N   . GLY A 1 338 ? 15.954  -18.170 4.189   1.00 35.18  ? 335 GLY A N   1 
ATOM   2554 C CA  . GLY A 1 338 ? 14.858  -18.850 3.521   1.00 34.68  ? 335 GLY A CA  1 
ATOM   2555 C C   . GLY A 1 338 ? 14.819  -20.368 3.576   1.00 37.71  ? 335 GLY A C   1 
ATOM   2556 O O   . GLY A 1 338 ? 13.784  -20.964 3.276   1.00 40.83  ? 335 GLY A O   1 
ATOM   2557 N N   . SER A 1 339 ? 15.927  -20.996 3.962   1.00 38.32  ? 336 SER A N   1 
ATOM   2558 C CA  . SER A 1 339 ? 16.105  -22.437 3.752   1.00 38.11  ? 336 SER A CA  1 
ATOM   2559 C C   . SER A 1 339 ? 15.063  -23.294 4.467   1.00 43.18  ? 336 SER A C   1 
ATOM   2560 O O   . SER A 1 339 ? 14.529  -24.252 3.897   1.00 41.08  ? 336 SER A O   1 
ATOM   2561 C CB  . SER A 1 339 ? 17.508  -22.858 4.192   1.00 36.49  ? 336 SER A CB  1 
ATOM   2562 O OG  . SER A 1 339 ? 17.664  -22.737 5.597   1.00 40.19  ? 336 SER A OG  1 
ATOM   2563 N N   . TYR A 1 340 ? 14.786  -22.928 5.713   1.00 41.36  ? 337 TYR A N   1 
ATOM   2564 C CA  . TYR A 1 340 ? 13.857  -23.631 6.594   1.00 50.04  ? 337 TYR A CA  1 
ATOM   2565 C C   . TYR A 1 340 ? 12.473  -23.803 5.978   1.00 47.80  ? 337 TYR A C   1 
ATOM   2566 O O   . TYR A 1 340 ? 11.927  -24.902 5.935   1.00 46.15  ? 337 TYR A O   1 
ATOM   2567 C CB  . TYR A 1 340 ? 13.766  -22.855 7.918   1.00 47.81  ? 337 TYR A CB  1 
ATOM   2568 C CG  . TYR A 1 340 ? 12.777  -23.341 8.949   1.00 55.61  ? 337 TYR A CG  1 
ATOM   2569 C CD1 . TYR A 1 340 ? 13.056  -24.442 9.748   1.00 61.09  ? 337 TYR A CD1 1 
ATOM   2570 C CD2 . TYR A 1 340 ? 11.584  -22.658 9.168   1.00 59.42  ? 337 TYR A CD2 1 
ATOM   2571 C CE1 . TYR A 1 340 ? 12.161  -24.873 10.716  1.00 64.11  ? 337 TYR A CE1 1 
ATOM   2572 C CE2 . TYR A 1 340 ? 10.677  -23.082 10.134  1.00 65.26  ? 337 TYR A CE2 1 
ATOM   2573 C CZ  . TYR A 1 340 ? 10.972  -24.194 10.908  1.00 73.50  ? 337 TYR A CZ  1 
ATOM   2574 O OH  . TYR A 1 340 ? 10.088  -24.631 11.877  1.00 71.67  ? 337 TYR A OH  1 
ATOM   2575 N N   . PHE A 1 341 ? 11.930  -22.702 5.478   1.00 48.66  ? 338 PHE A N   1 
ATOM   2576 C CA  . PHE A 1 341 ? 10.543  -22.642 5.033   1.00 46.26  ? 338 PHE A CA  1 
ATOM   2577 C C   . PHE A 1 341 ? 10.262  -23.514 3.812   1.00 47.80  ? 338 PHE A C   1 
ATOM   2578 O O   . PHE A 1 341 ? 9.114   -23.884 3.562   1.00 49.61  ? 338 PHE A O   1 
ATOM   2579 C CB  . PHE A 1 341 ? 10.170  -21.182 4.752   1.00 40.75  ? 338 PHE A CB  1 
ATOM   2580 C CG  . PHE A 1 341 ? 10.322  -20.291 5.954   1.00 46.79  ? 338 PHE A CG  1 
ATOM   2581 C CD1 . PHE A 1 341 ? 9.271   -20.115 6.838   1.00 42.91  ? 338 PHE A CD1 1 
ATOM   2582 C CD2 . PHE A 1 341 ? 11.530  -19.663 6.222   1.00 43.86  ? 338 PHE A CD2 1 
ATOM   2583 C CE1 . PHE A 1 341 ? 9.413   -19.310 7.960   1.00 45.22  ? 338 PHE A CE1 1 
ATOM   2584 C CE2 . PHE A 1 341 ? 11.677  -18.858 7.341   1.00 45.20  ? 338 PHE A CE2 1 
ATOM   2585 C CZ  . PHE A 1 341 ? 10.618  -18.684 8.209   1.00 41.97  ? 338 PHE A CZ  1 
ATOM   2586 N N   . LEU A 1 342 ? 11.311  -23.858 3.072   1.00 47.29  ? 339 LEU A N   1 
ATOM   2587 C CA  . LEU A 1 342 ? 11.169  -24.637 1.839   1.00 42.70  ? 339 LEU A CA  1 
ATOM   2588 C C   . LEU A 1 342 ? 10.570  -26.023 2.074   1.00 49.15  ? 339 LEU A C   1 
ATOM   2589 O O   . LEU A 1 342 ? 9.715   -26.468 1.311   1.00 52.71  ? 339 LEU A O   1 
ATOM   2590 C CB  . LEU A 1 342 ? 12.523  -24.774 1.146   1.00 36.45  ? 339 LEU A CB  1 
ATOM   2591 C CG  . LEU A 1 342 ? 13.190  -23.430 0.860   1.00 43.16  ? 339 LEU A CG  1 
ATOM   2592 C CD1 . LEU A 1 342 ? 14.500  -23.624 0.109   1.00 44.58  ? 339 LEU A CD1 1 
ATOM   2593 C CD2 . LEU A 1 342 ? 12.239  -22.518 0.086   1.00 40.01  ? 339 LEU A CD2 1 
ATOM   2594 N N   . VAL A 1 343 ? 11.008  -26.701 3.132   1.00 47.81  ? 340 VAL A N   1 
ATOM   2595 C CA  . VAL A 1 343 ? 10.488  -28.033 3.434   1.00 50.44  ? 340 VAL A CA  1 
ATOM   2596 C C   . VAL A 1 343 ? 9.053   -27.990 3.947   1.00 49.82  ? 340 VAL A C   1 
ATOM   2597 O O   . VAL A 1 343 ? 8.439   -29.030 4.168   1.00 55.89  ? 340 VAL A O   1 
ATOM   2598 C CB  . VAL A 1 343 ? 11.362  -28.771 4.473   1.00 51.86  ? 340 VAL A CB  1 
ATOM   2599 C CG1 . VAL A 1 343 ? 12.765  -28.943 3.942   1.00 53.06  ? 340 VAL A CG1 1 
ATOM   2600 C CG2 . VAL A 1 343 ? 11.372  -28.032 5.804   1.00 50.81  ? 340 VAL A CG2 1 
ATOM   2601 N N   . TYR A 1 344 ? 8.517   -26.790 4.128   1.00 52.09  ? 341 TYR A N   1 
ATOM   2602 C CA  . TYR A 1 344 ? 7.161   -26.641 4.636   1.00 53.94  ? 341 TYR A CA  1 
ATOM   2603 C C   . TYR A 1 344 ? 6.154   -26.209 3.572   1.00 57.79  ? 341 TYR A C   1 
ATOM   2604 O O   . TYR A 1 344 ? 5.221   -25.463 3.871   1.00 61.03  ? 341 TYR A O   1 
ATOM   2605 C CB  . TYR A 1 344 ? 7.137   -25.637 5.791   1.00 54.86  ? 341 TYR A CB  1 
ATOM   2606 C CG  . TYR A 1 344 ? 7.559   -26.219 7.119   1.00 57.07  ? 341 TYR A CG  1 
ATOM   2607 C CD1 . TYR A 1 344 ? 8.894   -26.237 7.501   1.00 55.63  ? 341 TYR A CD1 1 
ATOM   2608 C CD2 . TYR A 1 344 ? 6.620   -26.754 7.993   1.00 59.00  ? 341 TYR A CD2 1 
ATOM   2609 C CE1 . TYR A 1 344 ? 9.283   -26.772 8.716   1.00 56.83  ? 341 TYR A CE1 1 
ATOM   2610 C CE2 . TYR A 1 344 ? 6.998   -27.289 9.210   1.00 58.40  ? 341 TYR A CE2 1 
ATOM   2611 C CZ  . TYR A 1 344 ? 8.330   -27.295 9.566   1.00 59.47  ? 341 TYR A CZ  1 
ATOM   2612 O OH  . TYR A 1 344 ? 8.709   -27.829 10.777  1.00 57.16  ? 341 TYR A OH  1 
ATOM   2613 N N   . GLY A 1 345 ? 6.328   -26.669 2.337   1.00 52.53  ? 342 GLY A N   1 
ATOM   2614 C CA  . GLY A 1 345 ? 5.322   -26.410 1.323   1.00 56.20  ? 342 GLY A CA  1 
ATOM   2615 C C   . GLY A 1 345 ? 5.767   -26.311 -0.124  1.00 56.01  ? 342 GLY A C   1 
ATOM   2616 O O   . GLY A 1 345 ? 4.931   -26.161 -1.014  1.00 58.17  ? 342 GLY A O   1 
ATOM   2617 N N   . VAL A 1 346 ? 7.069   -26.383 -0.375  1.00 50.82  ? 343 VAL A N   1 
ATOM   2618 C CA  . VAL A 1 346 ? 7.556   -26.353 -1.750  1.00 49.81  ? 343 VAL A CA  1 
ATOM   2619 C C   . VAL A 1 346 ? 7.871   -27.768 -2.226  1.00 48.58  ? 343 VAL A C   1 
ATOM   2620 O O   . VAL A 1 346 ? 8.757   -28.424 -1.678  1.00 49.09  ? 343 VAL A O   1 
ATOM   2621 C CB  . VAL A 1 346 ? 8.809   -25.471 -1.899  1.00 51.87  ? 343 VAL A CB  1 
ATOM   2622 C CG1 . VAL A 1 346 ? 9.162   -25.305 -3.371  1.00 49.90  ? 343 VAL A CG1 1 
ATOM   2623 C CG2 . VAL A 1 346 ? 8.583   -24.118 -1.253  1.00 51.93  ? 343 VAL A CG2 1 
ATOM   2624 N N   . PRO A 1 347 ? 7.135   -28.245 -3.244  1.00 54.05  ? 344 PRO A N   1 
ATOM   2625 C CA  . PRO A 1 347 ? 7.340   -29.594 -3.788  1.00 51.34  ? 344 PRO A CA  1 
ATOM   2626 C C   . PRO A 1 347 ? 8.798   -29.844 -4.164  1.00 49.77  ? 344 PRO A C   1 
ATOM   2627 O O   . PRO A 1 347 ? 9.408   -29.009 -4.837  1.00 47.06  ? 344 PRO A O   1 
ATOM   2628 C CB  . PRO A 1 347 ? 6.443   -29.614 -5.030  1.00 55.95  ? 344 PRO A CB  1 
ATOM   2629 C CG  . PRO A 1 347 ? 5.382   -28.608 -4.740  1.00 57.41  ? 344 PRO A CG  1 
ATOM   2630 C CD  . PRO A 1 347 ? 6.062   -27.523 -3.951  1.00 51.41  ? 344 PRO A CD  1 
ATOM   2631 N N   . GLY A 1 348 ? 9.347   -30.968 -3.712  1.00 47.15  ? 345 GLY A N   1 
ATOM   2632 C CA  . GLY A 1 348 ? 10.719  -31.331 -4.019  1.00 44.04  ? 345 GLY A CA  1 
ATOM   2633 C C   . GLY A 1 348 ? 11.692  -31.098 -2.877  1.00 49.12  ? 345 GLY A C   1 
ATOM   2634 O O   . GLY A 1 348 ? 12.843  -31.532 -2.938  1.00 46.67  ? 345 GLY A O   1 
ATOM   2635 N N   . PHE A 1 349 ? 11.238  -30.415 -1.831  1.00 47.55  ? 346 PHE A N   1 
ATOM   2636 C CA  . PHE A 1 349 ? 12.109  -30.111 -0.700  1.00 46.53  ? 346 PHE A CA  1 
ATOM   2637 C C   . PHE A 1 349 ? 11.811  -30.997 0.503   1.00 51.41  ? 346 PHE A C   1 
ATOM   2638 O O   . PHE A 1 349 ? 10.653  -31.270 0.826   1.00 53.15  ? 346 PHE A O   1 
ATOM   2639 C CB  . PHE A 1 349 ? 11.990  -28.634 -0.306  1.00 50.25  ? 346 PHE A CB  1 
ATOM   2640 C CG  . PHE A 1 349 ? 12.603  -27.690 -1.307  1.00 48.43  ? 346 PHE A CG  1 
ATOM   2641 C CD1 . PHE A 1 349 ? 11.887  -27.280 -2.417  1.00 45.68  ? 346 PHE A CD1 1 
ATOM   2642 C CD2 . PHE A 1 349 ? 13.897  -27.220 -1.137  1.00 43.96  ? 346 PHE A CD2 1 
ATOM   2643 C CE1 . PHE A 1 349 ? 12.447  -26.413 -3.343  1.00 46.80  ? 346 PHE A CE1 1 
ATOM   2644 C CE2 . PHE A 1 349 ? 14.463  -26.354 -2.060  1.00 42.73  ? 346 PHE A CE2 1 
ATOM   2645 C CZ  . PHE A 1 349 ? 13.736  -25.951 -3.165  1.00 42.63  ? 346 PHE A CZ  1 
ATOM   2646 N N   . SER A 1 350 ? 12.877  -31.442 1.158   1.00 51.87  ? 347 SER A N   1 
ATOM   2647 C CA  . SER A 1 350 ? 12.784  -32.307 2.325   1.00 49.66  ? 347 SER A CA  1 
ATOM   2648 C C   . SER A 1 350 ? 14.028  -32.123 3.184   1.00 51.91  ? 347 SER A C   1 
ATOM   2649 O O   . SER A 1 350 ? 15.098  -31.800 2.667   1.00 46.86  ? 347 SER A O   1 
ATOM   2650 C CB  . SER A 1 350 ? 12.632  -33.771 1.904   1.00 50.77  ? 347 SER A CB  1 
ATOM   2651 O OG  . SER A 1 350 ? 12.905  -34.648 2.983   1.00 51.24  ? 347 SER A OG  1 
ATOM   2652 N N   . LYS A 1 351 ? 13.891  -32.321 4.493   1.00 47.59  ? 348 LYS A N   1 
ATOM   2653 C CA  . LYS A 1 351 ? 15.036  -32.209 5.387   1.00 47.25  ? 348 LYS A CA  1 
ATOM   2654 C C   . LYS A 1 351 ? 15.875  -33.480 5.345   1.00 48.96  ? 348 LYS A C   1 
ATOM   2655 O O   . LYS A 1 351 ? 17.004  -33.505 5.838   1.00 52.66  ? 348 LYS A O   1 
ATOM   2656 C CB  . LYS A 1 351 ? 14.586  -31.930 6.826   1.00 47.84  ? 348 LYS A CB  1 
ATOM   2657 C CG  . LYS A 1 351 ? 14.188  -33.173 7.605   1.00 46.73  ? 348 LYS A CG  1 
ATOM   2658 C CD  . LYS A 1 351 ? 13.977  -32.856 9.077   1.00 47.15  ? 348 LYS A CD  1 
ATOM   2659 C CE  . LYS A 1 351 ? 13.736  -34.121 9.889   1.00 45.29  ? 348 LYS A CE  1 
ATOM   2660 N NZ  . LYS A 1 351 ? 14.912  -35.033 9.857   1.00 43.93  ? 348 LYS A NZ  1 
ATOM   2661 N N   . ASP A 1 352 ? 15.321  -34.532 4.749   1.00 49.40  ? 349 ASP A N   1 
ATOM   2662 C CA  . ASP A 1 352 ? 15.936  -35.855 4.803   1.00 51.79  ? 349 ASP A CA  1 
ATOM   2663 C C   . ASP A 1 352 ? 16.591  -36.299 3.488   1.00 53.85  ? 349 ASP A C   1 
ATOM   2664 O O   . ASP A 1 352 ? 17.123  -37.406 3.404   1.00 50.16  ? 349 ASP A O   1 
ATOM   2665 C CB  . ASP A 1 352 ? 14.895  -36.885 5.245   1.00 51.11  ? 349 ASP A CB  1 
ATOM   2666 C CG  . ASP A 1 352 ? 14.440  -36.668 6.680   1.00 52.51  ? 349 ASP A CG  1 
ATOM   2667 O OD1 . ASP A 1 352 ? 15.296  -36.339 7.531   1.00 50.21  ? 349 ASP A OD1 1 
ATOM   2668 O OD2 . ASP A 1 352 ? 13.231  -36.819 6.956   1.00 50.17  ? 349 ASP A OD2 1 
ATOM   2669 N N   . ASN A 1 353 ? 16.542  -35.445 2.467   1.00 52.57  ? 350 ASN A N   1 
ATOM   2670 C CA  . ASN A 1 353 ? 17.400  -35.614 1.297   1.00 49.12  ? 350 ASN A CA  1 
ATOM   2671 C C   . ASN A 1 353 ? 18.027  -34.267 0.939   1.00 50.60  ? 350 ASN A C   1 
ATOM   2672 O O   . ASN A 1 353 ? 17.835  -33.288 1.657   1.00 50.42  ? 350 ASN A O   1 
ATOM   2673 C CB  . ASN A 1 353 ? 16.636  -36.237 0.109   1.00 47.18  ? 350 ASN A CB  1 
ATOM   2674 C CG  . ASN A 1 353 ? 15.508  -35.356 -0.432  1.00 52.22  ? 350 ASN A CG  1 
ATOM   2675 O OD1 . ASN A 1 353 ? 15.644  -34.142 -0.557  1.00 51.65  ? 350 ASN A OD1 1 
ATOM   2676 N ND2 . ASN A 1 353 ? 14.391  -35.988 -0.784  1.00 50.49  ? 350 ASN A ND2 1 
ATOM   2677 N N   . GLU A 1 354 ? 18.779  -34.212 -0.156  1.00 46.06  ? 351 GLU A N   1 
ATOM   2678 C CA  . GLU A 1 354 ? 19.530  -33.005 -0.490  1.00 44.08  ? 351 GLU A CA  1 
ATOM   2679 C C   . GLU A 1 354 ? 18.675  -31.933 -1.167  1.00 42.00  ? 351 GLU A C   1 
ATOM   2680 O O   . GLU A 1 354 ? 19.153  -30.830 -1.425  1.00 42.48  ? 351 GLU A O   1 
ATOM   2681 C CB  . GLU A 1 354 ? 20.727  -33.357 -1.377  1.00 51.46  ? 351 GLU A CB  1 
ATOM   2682 C CG  . GLU A 1 354 ? 21.755  -34.232 -0.681  1.00 52.42  ? 351 GLU A CG  1 
ATOM   2683 C CD  . GLU A 1 354 ? 22.154  -33.675 0.669   1.00 56.34  ? 351 GLU A CD  1 
ATOM   2684 O OE1 . GLU A 1 354 ? 22.773  -32.591 0.702   1.00 57.43  ? 351 GLU A OE1 1 
ATOM   2685 O OE2 . GLU A 1 354 ? 21.838  -34.312 1.696   1.00 62.41  ? 351 GLU A OE2 1 
ATOM   2686 N N   . SER A 1 355 ? 17.419  -32.268 -1.450  1.00 41.77  ? 352 SER A N   1 
ATOM   2687 C CA  . SER A 1 355 ? 16.447  -31.327 -2.010  1.00 43.81  ? 352 SER A CA  1 
ATOM   2688 C C   . SER A 1 355 ? 16.914  -30.659 -3.304  1.00 42.48  ? 352 SER A C   1 
ATOM   2689 O O   . SER A 1 355 ? 16.619  -29.490 -3.554  1.00 41.68  ? 352 SER A O   1 
ATOM   2690 C CB  . SER A 1 355 ? 16.093  -30.256 -0.975  1.00 42.78  ? 352 SER A CB  1 
ATOM   2691 O OG  . SER A 1 355 ? 15.424  -30.838 0.131   1.00 44.11  ? 352 SER A OG  1 
ATOM   2692 N N   . LEU A 1 356 ? 17.644  -31.404 -4.123  1.00 42.23  ? 353 LEU A N   1 
ATOM   2693 C CA  . LEU A 1 356 ? 17.997  -30.927 -5.453  1.00 39.92  ? 353 LEU A CA  1 
ATOM   2694 C C   . LEU A 1 356 ? 16.735  -30.870 -6.300  1.00 40.54  ? 353 LEU A C   1 
ATOM   2695 O O   . LEU A 1 356 ? 16.063  -31.882 -6.485  1.00 48.57  ? 353 LEU A O   1 
ATOM   2696 C CB  . LEU A 1 356 ? 19.043  -31.839 -6.090  1.00 39.78  ? 353 LEU A CB  1 
ATOM   2697 C CG  . LEU A 1 356 ? 20.289  -32.067 -5.239  1.00 44.49  ? 353 LEU A CG  1 
ATOM   2698 C CD1 . LEU A 1 356 ? 21.180  -33.130 -5.859  1.00 49.71  ? 353 LEU A CD1 1 
ATOM   2699 C CD2 . LEU A 1 356 ? 21.045  -30.762 -5.054  1.00 43.35  ? 353 LEU A CD2 1 
ATOM   2700 N N   . ILE A 1 357 ? 16.398  -29.688 -6.802  1.00 40.60  ? 354 ILE A N   1 
ATOM   2701 C CA  . ILE A 1 357 ? 15.169  -29.534 -7.571  1.00 37.59  ? 354 ILE A CA  1 
ATOM   2702 C C   . ILE A 1 357 ? 15.419  -29.243 -9.048  1.00 38.95  ? 354 ILE A C   1 
ATOM   2703 O O   . ILE A 1 357 ? 16.519  -28.862 -9.444  1.00 36.17  ? 354 ILE A O   1 
ATOM   2704 C CB  . ILE A 1 357 ? 14.290  -28.416 -6.994  1.00 37.17  ? 354 ILE A CB  1 
ATOM   2705 C CG1 . ILE A 1 357 ? 15.097  -27.121 -6.871  1.00 34.31  ? 354 ILE A CG1 1 
ATOM   2706 C CG2 . ILE A 1 357 ? 13.734  -28.836 -5.633  1.00 42.15  ? 354 ILE A CG2 1 
ATOM   2707 C CD1 . ILE A 1 357 ? 14.248  -25.878 -6.778  1.00 35.41  ? 354 ILE A CD1 1 
ATOM   2708 N N   . SER A 1 358 ? 14.376  -29.431 -9.850  1.00 36.68  ? 355 SER A N   1 
ATOM   2709 C CA  . SER A 1 358 ? 14.416  -29.159 -11.279 1.00 36.64  ? 355 SER A CA  1 
ATOM   2710 C C   . SER A 1 358 ? 14.073  -27.703 -11.543 1.00 38.16  ? 355 SER A C   1 
ATOM   2711 O O   . SER A 1 358 ? 13.674  -26.984 -10.632 1.00 33.79  ? 355 SER A O   1 
ATOM   2712 C CB  . SER A 1 358 ? 13.438  -30.066 -12.017 1.00 36.11  ? 355 SER A CB  1 
ATOM   2713 O OG  . SER A 1 358 ? 12.104  -29.743 -11.658 1.00 37.90  ? 355 SER A OG  1 
ATOM   2714 N N   . ARG A 1 359 ? 14.208  -27.268 -12.790 1.00 33.67  ? 356 ARG A N   1 
ATOM   2715 C CA  . ARG A 1 359 ? 13.855  -25.899 -13.131 1.00 34.76  ? 356 ARG A CA  1 
ATOM   2716 C C   . ARG A 1 359 ? 12.345  -25.667 -13.017 1.00 39.57  ? 356 ARG A C   1 
ATOM   2717 O O   . ARG A 1 359 ? 11.901  -24.604 -12.564 1.00 41.15  ? 356 ARG A O   1 
ATOM   2718 C CB  . ARG A 1 359 ? 14.349  -25.549 -14.532 1.00 37.50  ? 356 ARG A CB  1 
ATOM   2719 C CG  . ARG A 1 359 ? 13.988  -24.145 -14.945 1.00 40.40  ? 356 ARG A CG  1 
ATOM   2720 C CD  . ARG A 1 359 ? 14.937  -23.583 -15.984 1.00 43.86  ? 356 ARG A CD  1 
ATOM   2721 N NE  . ARG A 1 359 ? 14.712  -22.150 -16.125 1.00 46.60  ? 356 ARG A NE  1 
ATOM   2722 C CZ  . ARG A 1 359 ? 15.337  -21.228 -15.403 1.00 36.85  ? 356 ARG A CZ  1 
ATOM   2723 N NH1 . ARG A 1 359 ? 16.244  -21.589 -14.504 1.00 36.81  ? 356 ARG A NH1 1 
ATOM   2724 N NH2 . ARG A 1 359 ? 15.065  -19.948 -15.589 1.00 40.70  ? 356 ARG A NH2 1 
ATOM   2725 N N   . ALA A 1 360 ? 11.558  -26.665 -13.410 1.00 34.25  ? 357 ALA A N   1 
ATOM   2726 C CA  . ALA A 1 360 ? 10.105  -26.594 -13.268 1.00 38.16  ? 357 ALA A CA  1 
ATOM   2727 C C   . ALA A 1 360 ? 9.686   -26.381 -11.805 1.00 35.71  ? 357 ALA A C   1 
ATOM   2728 O O   . ALA A 1 360 ? 8.802   -25.564 -11.505 1.00 37.44  ? 357 ALA A O   1 
ATOM   2729 C CB  . ALA A 1 360 ? 9.463   -27.856 -13.818 1.00 39.39  ? 357 ALA A CB  1 
ATOM   2730 N N   . GLN A 1 361 ? 10.331  -27.121 -10.908 1.00 33.57  ? 358 GLN A N   1 
ATOM   2731 C CA  . GLN A 1 361 ? 10.065  -27.016 -9.478  1.00 37.18  ? 358 GLN A CA  1 
ATOM   2732 C C   . GLN A 1 361 ? 10.508  -25.662 -8.942  1.00 36.87  ? 358 GLN A C   1 
ATOM   2733 O O   . GLN A 1 361 ? 9.926   -25.143 -7.992  1.00 39.66  ? 358 GLN A O   1 
ATOM   2734 C CB  . GLN A 1 361 ? 10.766  -28.139 -8.710  1.00 34.16  ? 358 GLN A CB  1 
ATOM   2735 C CG  . GLN A 1 361 ? 10.163  -29.518 -8.934  1.00 37.88  ? 358 GLN A CG  1 
ATOM   2736 C CD  . GLN A 1 361 ? 10.975  -30.628 -8.291  1.00 40.00  ? 358 GLN A CD  1 
ATOM   2737 O OE1 . GLN A 1 361 ? 12.201  -30.666 -8.407  1.00 39.34  ? 358 GLN A OE1 1 
ATOM   2738 N NE2 . GLN A 1 361 ? 10.292  -31.541 -7.608  1.00 43.30  ? 358 GLN A NE2 1 
ATOM   2739 N N   . PHE A 1 362 ? 11.544  -25.092 -9.548  1.00 34.14  ? 359 PHE A N   1 
ATOM   2740 C CA  . PHE A 1 362 ? 12.012  -23.775 -9.151  1.00 34.36  ? 359 PHE A CA  1 
ATOM   2741 C C   . PHE A 1 362 ? 10.981  -22.716 -9.526  1.00 39.72  ? 359 PHE A C   1 
ATOM   2742 O O   . PHE A 1 362 ? 10.660  -21.855 -8.712  1.00 35.22  ? 359 PHE A O   1 
ATOM   2743 C CB  . PHE A 1 362 ? 13.368  -23.457 -9.785  1.00 33.83  ? 359 PHE A CB  1 
ATOM   2744 C CG  . PHE A 1 362 ? 13.840  -22.047 -9.540  1.00 35.28  ? 359 PHE A CG  1 
ATOM   2745 C CD1 . PHE A 1 362 ? 14.100  -21.599 -8.252  1.00 37.89  ? 359 PHE A CD1 1 
ATOM   2746 C CD2 . PHE A 1 362 ? 14.028  -21.172 -10.599 1.00 34.89  ? 359 PHE A CD2 1 
ATOM   2747 C CE1 . PHE A 1 362 ? 14.532  -20.303 -8.027  1.00 34.87  ? 359 PHE A CE1 1 
ATOM   2748 C CE2 . PHE A 1 362 ? 14.462  -19.879 -10.383 1.00 35.27  ? 359 PHE A CE2 1 
ATOM   2749 C CZ  . PHE A 1 362 ? 14.715  -19.443 -9.095  1.00 37.13  ? 359 PHE A CZ  1 
ATOM   2750 N N   . LEU A 1 363 ? 10.459  -22.782 -10.752 1.00 37.51  ? 360 LEU A N   1 
ATOM   2751 C CA  . LEU A 1 363 ? 9.433   -21.827 -11.184 1.00 39.44  ? 360 LEU A CA  1 
ATOM   2752 C C   . LEU A 1 363 ? 8.165   -21.925 -10.321 1.00 38.29  ? 360 LEU A C   1 
ATOM   2753 O O   . LEU A 1 363 ? 7.616   -20.900 -9.857  1.00 41.82  ? 360 LEU A O   1 
ATOM   2754 C CB  . LEU A 1 363 ? 9.085   -22.038 -12.667 1.00 35.80  ? 360 LEU A CB  1 
ATOM   2755 C CG  . LEU A 1 363 ? 9.906   -21.281 -13.721 1.00 40.56  ? 360 LEU A CG  1 
ATOM   2756 C CD1 . LEU A 1 363 ? 11.391  -21.593 -13.628 1.00 39.10  ? 360 LEU A CD1 1 
ATOM   2757 C CD2 . LEU A 1 363 ? 9.388   -21.573 -15.137 1.00 44.05  ? 360 LEU A CD2 1 
ATOM   2758 N N   . ALA A 1 364 ? 7.708   -23.157 -10.097 1.00 36.01  ? 361 ALA A N   1 
ATOM   2759 C CA  . ALA A 1 364 ? 6.545   -23.384 -9.238  1.00 37.87  ? 361 ALA A CA  1 
ATOM   2760 C C   . ALA A 1 364 ? 6.793   -22.838 -7.826  1.00 38.39  ? 361 ALA A C   1 
ATOM   2761 O O   . ALA A 1 364 ? 5.939   -22.159 -7.229  1.00 38.76  ? 361 ALA A O   1 
ATOM   2762 C CB  . ALA A 1 364 ? 6.207   -24.868 -9.183  1.00 35.95  ? 361 ALA A CB  1 
ATOM   2763 N N   . GLY A 1 365 ? 7.981   -23.137 -7.311  1.00 34.53  ? 362 GLY A N   1 
ATOM   2764 C CA  . GLY A 1 365 ? 8.402   -22.673 -6.002  1.00 39.10  ? 362 GLY A CA  1 
ATOM   2765 C C   . GLY A 1 365 ? 8.416   -21.161 -5.902  1.00 37.93  ? 362 GLY A C   1 
ATOM   2766 O O   . GLY A 1 365 ? 8.084   -20.611 -4.862  1.00 39.86  ? 362 GLY A O   1 
ATOM   2767 N N   . VAL A 1 366 ? 8.802   -20.490 -6.982  1.00 36.12  ? 363 VAL A N   1 
ATOM   2768 C CA  . VAL A 1 366 ? 8.763   -19.034 -7.020  1.00 34.32  ? 363 VAL A CA  1 
ATOM   2769 C C   . VAL A 1 366 ? 7.319   -18.563 -6.931  1.00 38.21  ? 363 VAL A C   1 
ATOM   2770 O O   . VAL A 1 366 ? 7.030   -17.555 -6.276  1.00 36.86  ? 363 VAL A O   1 
ATOM   2771 C CB  . VAL A 1 366 ? 9.430   -18.467 -8.294  1.00 36.53  ? 363 VAL A CB  1 
ATOM   2772 C CG1 . VAL A 1 366 ? 8.980   -17.031 -8.564  1.00 29.23  ? 363 VAL A CG1 1 
ATOM   2773 C CG2 . VAL A 1 366 ? 10.943  -18.540 -8.172  1.00 34.93  ? 363 VAL A CG2 1 
ATOM   2774 N N   . ARG A 1 367 ? 6.402   -19.294 -7.563  1.00 38.69  ? 364 ARG A N   1 
ATOM   2775 C CA  . ARG A 1 367 ? 4.992   -18.908 -7.437  1.00 39.77  ? 364 ARG A CA  1 
ATOM   2776 C C   . ARG A 1 367 ? 4.486   -19.073 -5.998  1.00 39.55  ? 364 ARG A C   1 
ATOM   2777 O O   . ARG A 1 367 ? 3.644   -18.299 -5.540  1.00 36.65  ? 364 ARG A O   1 
ATOM   2778 C CB  . ARG A 1 367 ? 4.096   -19.705 -8.388  1.00 39.30  ? 364 ARG A CB  1 
ATOM   2779 C CG  . ARG A 1 367 ? 4.341   -19.458 -9.879  1.00 41.68  ? 364 ARG A CG  1 
ATOM   2780 C CD  . ARG A 1 367 ? 4.836   -18.044 -10.178 1.00 43.19  ? 364 ARG A CD  1 
ATOM   2781 N NE  . ARG A 1 367 ? 3.802   -17.012 -10.092 1.00 41.12  ? 364 ARG A NE  1 
ATOM   2782 C CZ  . ARG A 1 367 ? 3.084   -16.576 -11.123 1.00 49.53  ? 364 ARG A CZ  1 
ATOM   2783 N NH1 . ARG A 1 367 ? 3.271   -17.089 -12.334 1.00 45.56  ? 364 ARG A NH1 1 
ATOM   2784 N NH2 . ARG A 1 367 ? 2.175   -15.625 -10.943 1.00 48.68  ? 364 ARG A NH2 1 
ATOM   2785 N N   . ILE A 1 368 ? 4.992   -20.078 -5.289  1.00 38.76  ? 365 ILE A N   1 
ATOM   2786 C CA  . ILE A 1 368 ? 4.565   -20.294 -3.905  1.00 40.14  ? 365 ILE A CA  1 
ATOM   2787 C C   . ILE A 1 368 ? 5.215   -19.307 -2.917  1.00 41.57  ? 365 ILE A C   1 
ATOM   2788 O O   . ILE A 1 368 ? 4.566   -18.822 -1.988  1.00 40.88  ? 365 ILE A O   1 
ATOM   2789 C CB  . ILE A 1 368 ? 4.862   -21.743 -3.465  1.00 42.04  ? 365 ILE A CB  1 
ATOM   2790 C CG1 . ILE A 1 368 ? 3.983   -22.716 -4.255  1.00 41.34  ? 365 ILE A CG1 1 
ATOM   2791 C CG2 . ILE A 1 368 ? 4.637   -21.924 -1.965  1.00 41.22  ? 365 ILE A CG2 1 
ATOM   2792 C CD1 . ILE A 1 368 ? 4.337   -24.170 -4.039  1.00 43.58  ? 365 ILE A CD1 1 
ATOM   2793 N N   . GLY A 1 369 ? 6.489   -19.000 -3.134  1.00 39.45  ? 366 GLY A N   1 
ATOM   2794 C CA  . GLY A 1 369 ? 7.241   -18.130 -2.248  1.00 37.45  ? 366 GLY A CA  1 
ATOM   2795 C C   . GLY A 1 369 ? 6.934   -16.658 -2.442  1.00 41.21  ? 366 GLY A C   1 
ATOM   2796 O O   . GLY A 1 369 ? 7.095   -15.856 -1.523  1.00 38.48  ? 366 GLY A O   1 
ATOM   2797 N N   . VAL A 1 370 ? 6.497   -16.293 -3.644  1.00 33.79  ? 367 VAL A N   1 
ATOM   2798 C CA  . VAL A 1 370 ? 6.075   -14.923 -3.910  1.00 34.44  ? 367 VAL A CA  1 
ATOM   2799 C C   . VAL A 1 370 ? 4.625   -14.942 -4.385  1.00 38.70  ? 367 VAL A C   1 
ATOM   2800 O O   . VAL A 1 370 ? 4.348   -14.696 -5.561  1.00 41.33  ? 367 VAL A O   1 
ATOM   2801 C CB  . VAL A 1 370 ? 6.973   -14.234 -4.967  1.00 37.92  ? 367 VAL A CB  1 
ATOM   2802 C CG1 . VAL A 1 370 ? 6.757   -12.726 -4.956  1.00 36.62  ? 367 VAL A CG1 1 
ATOM   2803 C CG2 . VAL A 1 370 ? 8.441   -14.554 -4.717  1.00 32.43  ? 367 VAL A CG2 1 
ATOM   2804 N N   . PRO A 1 371 ? 3.689   -15.240 -3.468  1.00 39.68  ? 368 PRO A N   1 
ATOM   2805 C CA  . PRO A 1 371 ? 2.294   -15.492 -3.848  1.00 40.79  ? 368 PRO A CA  1 
ATOM   2806 C C   . PRO A 1 371 ? 1.585   -14.286 -4.456  1.00 45.41  ? 368 PRO A C   1 
ATOM   2807 O O   . PRO A 1 371 ? 0.546   -14.452 -5.095  1.00 50.20  ? 368 PRO A O   1 
ATOM   2808 C CB  . PRO A 1 371 ? 1.639   -15.896 -2.522  1.00 45.72  ? 368 PRO A CB  1 
ATOM   2809 C CG  . PRO A 1 371 ? 2.493   -15.282 -1.476  1.00 39.79  ? 368 PRO A CG  1 
ATOM   2810 C CD  . PRO A 1 371 ? 3.887   -15.339 -2.009  1.00 39.09  ? 368 PRO A CD  1 
ATOM   2811 N N   . GLN A 1 372 ? 2.143   -13.094 -4.276  1.00 45.90  ? 369 GLN A N   1 
ATOM   2812 C CA  . GLN A 1 372 ? 1.521   -11.882 -4.796  1.00 47.52  ? 369 GLN A CA  1 
ATOM   2813 C C   . GLN A 1 372 ? 2.027   -11.517 -6.184  1.00 51.38  ? 369 GLN A C   1 
ATOM   2814 O O   . GLN A 1 372 ? 1.496   -10.611 -6.823  1.00 54.00  ? 369 GLN A O   1 
ATOM   2815 C CB  . GLN A 1 372 ? 1.753   -10.711 -3.840  1.00 55.21  ? 369 GLN A CB  1 
ATOM   2816 C CG  . GLN A 1 372 ? 0.926   -10.781 -2.567  1.00 56.37  ? 369 GLN A CG  1 
ATOM   2817 C CD  . GLN A 1 372 ? -0.548  -11.009 -2.846  1.00 64.27  ? 369 GLN A CD  1 
ATOM   2818 O OE1 . GLN A 1 372 ? -1.195  -11.819 -2.184  1.00 68.41  ? 369 GLN A OE1 1 
ATOM   2819 N NE2 . GLN A 1 372 ? -1.087  -10.295 -3.833  1.00 65.94  ? 369 GLN A NE2 1 
ATOM   2820 N N   . ALA A 1 373 ? 3.051   -12.225 -6.647  1.00 48.07  ? 370 ALA A N   1 
ATOM   2821 C CA  . ALA A 1 373 ? 3.674   -11.909 -7.925  1.00 49.61  ? 370 ALA A CA  1 
ATOM   2822 C C   . ALA A 1 373 ? 2.750   -12.179 -9.105  1.00 49.95  ? 370 ALA A C   1 
ATOM   2823 O O   . ALA A 1 373 ? 2.168   -13.257 -9.217  1.00 47.27  ? 370 ALA A O   1 
ATOM   2824 C CB  . ALA A 1 373 ? 4.966   -12.695 -8.092  1.00 43.24  ? 370 ALA A CB  1 
ATOM   2825 N N   . SER A 1 374 ? 2.621   -11.187 -9.981  1.00 48.29  ? 371 SER A N   1 
ATOM   2826 C CA  . SER A 1 374 ? 2.019   -11.401 -11.292 1.00 51.76  ? 371 SER A CA  1 
ATOM   2827 C C   . SER A 1 374 ? 2.948   -12.278 -12.121 1.00 44.85  ? 371 SER A C   1 
ATOM   2828 O O   . SER A 1 374 ? 4.078   -12.545 -11.713 1.00 43.27  ? 371 SER A O   1 
ATOM   2829 C CB  . SER A 1 374 ? 1.767   -10.071 -12.003 1.00 51.56  ? 371 SER A CB  1 
ATOM   2830 O OG  . SER A 1 374 ? 2.987   -9.395  -12.261 1.00 48.54  ? 371 SER A OG  1 
ATOM   2831 N N   . ASP A 1 375 ? 2.479   -12.725 -13.282 1.00 45.61  ? 372 ASP A N   1 
ATOM   2832 C CA  . ASP A 1 375 ? 3.299   -13.553 -14.161 1.00 42.56  ? 372 ASP A CA  1 
ATOM   2833 C C   . ASP A 1 375 ? 4.609   -12.852 -14.522 1.00 39.31  ? 372 ASP A C   1 
ATOM   2834 O O   . ASP A 1 375 ? 5.677   -13.469 -14.529 1.00 41.12  ? 372 ASP A O   1 
ATOM   2835 C CB  . ASP A 1 375 ? 2.523   -13.922 -15.429 1.00 48.25  ? 372 ASP A CB  1 
ATOM   2836 C CG  . ASP A 1 375 ? 1.446   -14.962 -15.171 1.00 52.11  ? 372 ASP A CG  1 
ATOM   2837 O OD1 . ASP A 1 375 ? 1.400   -15.505 -14.047 1.00 53.16  ? 372 ASP A OD1 1 
ATOM   2838 O OD2 . ASP A 1 375 ? 0.650   -15.243 -16.090 1.00 57.00  ? 372 ASP A OD2 1 
ATOM   2839 N N   . LEU A 1 376 ? 4.523   -11.555 -14.797 1.00 36.82  ? 373 LEU A N   1 
ATOM   2840 C CA  . LEU A 1 376 ? 5.702   -10.770 -15.141 1.00 40.13  ? 373 LEU A CA  1 
ATOM   2841 C C   . LEU A 1 376 ? 6.673   -10.636 -13.964 1.00 39.96  ? 373 LEU A C   1 
ATOM   2842 O O   . LEU A 1 376 ? 7.891   -10.731 -14.137 1.00 37.03  ? 373 LEU A O   1 
ATOM   2843 C CB  . LEU A 1 376 ? 5.292   -9.382  -15.632 1.00 37.12  ? 373 LEU A CB  1 
ATOM   2844 C CG  . LEU A 1 376 ? 6.472   -8.554  -16.139 1.00 39.81  ? 373 LEU A CG  1 
ATOM   2845 C CD1 . LEU A 1 376 ? 7.080   -9.228  -17.365 1.00 42.30  ? 373 LEU A CD1 1 
ATOM   2846 C CD2 . LEU A 1 376 ? 6.060   -7.120  -16.437 1.00 44.88  ? 373 LEU A CD2 1 
ATOM   2847 N N   . ALA A 1 377 ? 6.130   -10.406 -12.772 1.00 40.03  ? 374 ALA A N   1 
ATOM   2848 C CA  . ALA A 1 377 ? 6.952   -10.296 -11.570 1.00 38.45  ? 374 ALA A CA  1 
ATOM   2849 C C   . ALA A 1 377 ? 7.682   -11.609 -11.300 1.00 35.49  ? 374 ALA A C   1 
ATOM   2850 O O   . ALA A 1 377 ? 8.885   -11.624 -11.015 1.00 35.16  ? 374 ALA A O   1 
ATOM   2851 C CB  . ALA A 1 377 ? 6.095   -9.904  -10.374 1.00 41.51  ? 374 ALA A CB  1 
ATOM   2852 N N   . ALA A 1 378 ? 6.942   -12.708 -11.402 1.00 32.16  ? 375 ALA A N   1 
ATOM   2853 C CA  . ALA A 1 378 ? 7.500   -14.036 -11.205 1.00 33.94  ? 375 ALA A CA  1 
ATOM   2854 C C   . ALA A 1 378 ? 8.612   -14.305 -12.207 1.00 38.43  ? 375 ALA A C   1 
ATOM   2855 O O   . ALA A 1 378 ? 9.676   -14.827 -11.853 1.00 34.56  ? 375 ALA A O   1 
ATOM   2856 C CB  . ALA A 1 378 ? 6.415   -15.086 -11.325 1.00 38.90  ? 375 ALA A CB  1 
ATOM   2857 N N   . GLU A 1 379 ? 8.362   -13.945 -13.464 1.00 34.91  ? 376 GLU A N   1 
ATOM   2858 C CA  . GLU A 1 379 ? 9.380   -14.107 -14.484 1.00 36.47  ? 376 GLU A CA  1 
ATOM   2859 C C   . GLU A 1 379 ? 10.620  -13.282 -14.162 1.00 35.72  ? 376 GLU A C   1 
ATOM   2860 O O   . GLU A 1 379 ? 11.734  -13.741 -14.372 1.00 34.70  ? 376 GLU A O   1 
ATOM   2861 C CB  . GLU A 1 379 ? 8.848   -13.717 -15.864 1.00 37.70  ? 376 GLU A CB  1 
ATOM   2862 C CG  . GLU A 1 379 ? 9.878   -13.940 -16.944 1.00 41.08  ? 376 GLU A CG  1 
ATOM   2863 C CD  . GLU A 1 379 ? 9.459   -13.383 -18.285 1.00 49.23  ? 376 GLU A CD  1 
ATOM   2864 O OE1 . GLU A 1 379 ? 8.238   -13.225 -18.513 1.00 47.38  ? 376 GLU A OE1 1 
ATOM   2865 O OE2 . GLU A 1 379 ? 10.360  -13.109 -19.107 1.00 44.83  ? 376 GLU A OE2 1 
ATOM   2866 N N   . ALA A 1 380 ? 10.425  -12.069 -13.649 1.00 33.05  ? 377 ALA A N   1 
ATOM   2867 C CA  . ALA A 1 380 ? 11.552  -11.209 -13.281 1.00 34.99  ? 377 ALA A CA  1 
ATOM   2868 C C   . ALA A 1 380 ? 12.383  -11.808 -12.145 1.00 37.77  ? 377 ALA A C   1 
ATOM   2869 O O   . ALA A 1 380 ? 13.618  -11.731 -12.152 1.00 34.90  ? 377 ALA A O   1 
ATOM   2870 C CB  . ALA A 1 380 ? 11.059  -9.822  -12.896 1.00 37.71  ? 377 ALA A CB  1 
ATOM   2871 N N   . VAL A 1 381 ? 11.705  -12.399 -11.166 1.00 34.78  ? 378 VAL A N   1 
ATOM   2872 C CA  . VAL A 1 381 ? 12.395  -13.078 -10.073 1.00 32.11  ? 378 VAL A CA  1 
ATOM   2873 C C   . VAL A 1 381 ? 13.207  -14.259 -10.601 1.00 34.59  ? 378 VAL A C   1 
ATOM   2874 O O   . VAL A 1 381 ? 14.399  -14.398 -10.308 1.00 31.75  ? 378 VAL A O   1 
ATOM   2875 C CB  . VAL A 1 381 ? 11.403  -13.574 -9.008  1.00 32.26  ? 378 VAL A CB  1 
ATOM   2876 C CG1 . VAL A 1 381 ? 12.126  -14.420 -7.966  1.00 31.42  ? 378 VAL A CG1 1 
ATOM   2877 C CG2 . VAL A 1 381 ? 10.699  -12.390 -8.362  1.00 33.22  ? 378 VAL A CG2 1 
ATOM   2878 N N   . VAL A 1 382 ? 12.551  -15.103 -11.390 1.00 34.79  ? 379 VAL A N   1 
ATOM   2879 C CA  . VAL A 1 382 ? 13.220  -16.228 -12.038 1.00 37.77  ? 379 VAL A CA  1 
ATOM   2880 C C   . VAL A 1 382 ? 14.440  -15.764 -12.845 1.00 35.32  ? 379 VAL A C   1 
ATOM   2881 O O   . VAL A 1 382 ? 15.493  -16.399 -12.815 1.00 39.61  ? 379 VAL A O   1 
ATOM   2882 C CB  . VAL A 1 382 ? 12.235  -16.986 -12.948 1.00 40.50  ? 379 VAL A CB  1 
ATOM   2883 C CG1 . VAL A 1 382 ? 12.972  -17.904 -13.927 1.00 34.76  ? 379 VAL A CG1 1 
ATOM   2884 C CG2 . VAL A 1 382 ? 11.234  -17.761 -12.090 1.00 36.47  ? 379 VAL A CG2 1 
ATOM   2885 N N   . LEU A 1 383 ? 14.292  -14.637 -13.530 1.00 37.02  ? 380 LEU A N   1 
ATOM   2886 C CA  . LEU A 1 383 ? 15.361  -14.036 -14.323 1.00 37.13  ? 380 LEU A CA  1 
ATOM   2887 C C   . LEU A 1 383 ? 16.547  -13.681 -13.441 1.00 38.99  ? 380 LEU A C   1 
ATOM   2888 O O   . LEU A 1 383 ? 17.680  -14.093 -13.702 1.00 34.55  ? 380 LEU A O   1 
ATOM   2889 C CB  . LEU A 1 383 ? 14.846  -12.784 -15.042 1.00 38.58  ? 380 LEU A CB  1 
ATOM   2890 C CG  . LEU A 1 383 ? 15.613  -12.155 -16.220 1.00 46.18  ? 380 LEU A CG  1 
ATOM   2891 C CD1 . LEU A 1 383 ? 16.744  -11.242 -15.747 1.00 45.01  ? 380 LEU A CD1 1 
ATOM   2892 C CD2 . LEU A 1 383 ? 16.137  -13.214 -17.190 1.00 41.86  ? 380 LEU A CD2 1 
ATOM   2893 N N   . HIS A 1 384 ? 16.274  -12.916 -12.390 1.00 36.06  ? 381 HIS A N   1 
ATOM   2894 C CA  . HIS A 1 384 ? 17.324  -12.439 -11.500 1.00 37.48  ? 381 HIS A CA  1 
ATOM   2895 C C   . HIS A 1 384 ? 18.051  -13.571 -10.783 1.00 36.51  ? 381 HIS A C   1 
ATOM   2896 O O   . HIS A 1 384 ? 19.269  -13.520 -10.607 1.00 34.99  ? 381 HIS A O   1 
ATOM   2897 C CB  . HIS A 1 384 ? 16.742  -11.476 -10.464 1.00 33.89  ? 381 HIS A CB  1 
ATOM   2898 C CG  . HIS A 1 384 ? 17.773  -10.837 -9.591  1.00 36.90  ? 381 HIS A CG  1 
ATOM   2899 N ND1 . HIS A 1 384 ? 18.480  -9.714  -9.971  1.00 35.51  ? 381 HIS A ND1 1 
ATOM   2900 C CD2 . HIS A 1 384 ? 18.218  -11.157 -8.351  1.00 38.18  ? 381 HIS A CD2 1 
ATOM   2901 C CE1 . HIS A 1 384 ? 19.314  -9.375  -9.007  1.00 38.09  ? 381 HIS A CE1 1 
ATOM   2902 N NE2 . HIS A 1 384 ? 19.179  -10.234 -8.013  1.00 39.62  ? 381 HIS A NE2 1 
ATOM   2903 N N   . TYR A 1 385 ? 17.310  -14.598 -10.379 1.00 32.62  ? 382 TYR A N   1 
ATOM   2904 C CA  . TYR A 1 385 ? 17.891  -15.642 -9.541  1.00 33.08  ? 382 TYR A CA  1 
ATOM   2905 C C   . TYR A 1 385 ? 18.410  -16.863 -10.298 1.00 33.83  ? 382 TYR A C   1 
ATOM   2906 O O   . TYR A 1 385 ? 19.109  -17.694 -9.726  1.00 33.05  ? 382 TYR A O   1 
ATOM   2907 C CB  . TYR A 1 385 ? 16.872  -16.082 -8.493  1.00 32.99  ? 382 TYR A CB  1 
ATOM   2908 C CG  . TYR A 1 385 ? 16.779  -15.113 -7.335  1.00 34.10  ? 382 TYR A CG  1 
ATOM   2909 C CD1 . TYR A 1 385 ? 15.919  -14.022 -7.378  1.00 31.72  ? 382 TYR A CD1 1 
ATOM   2910 C CD2 . TYR A 1 385 ? 17.566  -15.284 -6.201  1.00 32.73  ? 382 TYR A CD2 1 
ATOM   2911 C CE1 . TYR A 1 385 ? 15.839  -13.130 -6.307  1.00 32.52  ? 382 TYR A CE1 1 
ATOM   2912 C CE2 . TYR A 1 385 ? 17.496  -14.399 -5.131  1.00 32.88  ? 382 TYR A CE2 1 
ATOM   2913 C CZ  . TYR A 1 385 ? 16.632  -13.328 -5.189  1.00 34.31  ? 382 TYR A CZ  1 
ATOM   2914 O OH  . TYR A 1 385 ? 16.562  -12.454 -4.120  1.00 30.33  ? 382 TYR A OH  1 
ATOM   2915 N N   . THR A 1 386 ? 18.084  -16.977 -11.580 1.00 33.78  ? 383 THR A N   1 
ATOM   2916 C CA  . THR A 1 386 ? 18.646  -18.063 -12.373 1.00 30.20  ? 383 THR A CA  1 
ATOM   2917 C C   . THR A 1 386 ? 20.129  -17.805 -12.611 1.00 29.97  ? 383 THR A C   1 
ATOM   2918 O O   . THR A 1 386 ? 20.537  -16.671 -12.865 1.00 31.58  ? 383 THR A O   1 
ATOM   2919 C CB  . THR A 1 386 ? 17.903  -18.217 -13.717 1.00 33.26  ? 383 THR A CB  1 
ATOM   2920 O OG1 . THR A 1 386 ? 16.572  -18.687 -13.469 1.00 34.54  ? 383 THR A OG1 1 
ATOM   2921 C CG2 . THR A 1 386 ? 18.626  -19.200 -14.649 1.00 34.53  ? 383 THR A CG2 1 
ATOM   2922 N N   . ASP A 1 387 ? 20.942  -18.847 -12.485 1.00 28.07  ? 384 ASP A N   1 
ATOM   2923 C CA  . ASP A 1 387 ? 22.309  -18.791 -12.975 1.00 32.18  ? 384 ASP A CA  1 
ATOM   2924 C C   . ASP A 1 387 ? 22.266  -19.138 -14.465 1.00 37.06  ? 384 ASP A C   1 
ATOM   2925 O O   . ASP A 1 387 ? 22.121  -20.298 -14.830 1.00 36.57  ? 384 ASP A O   1 
ATOM   2926 C CB  . ASP A 1 387 ? 23.214  -19.758 -12.210 1.00 37.85  ? 384 ASP A CB  1 
ATOM   2927 C CG  . ASP A 1 387 ? 24.673  -19.682 -12.646 1.00 46.00  ? 384 ASP A CG  1 
ATOM   2928 O OD1 . ASP A 1 387 ? 24.985  -18.999 -13.648 1.00 42.84  ? 384 ASP A OD1 1 
ATOM   2929 O OD2 . ASP A 1 387 ? 25.514  -20.327 -11.987 1.00 49.33  ? 384 ASP A OD2 1 
ATOM   2930 N N   . TRP A 1 388 ? 22.382  -18.134 -15.324 1.00 37.06  ? 385 TRP A N   1 
ATOM   2931 C CA  . TRP A 1 388 ? 22.183  -18.363 -16.755 1.00 34.56  ? 385 TRP A CA  1 
ATOM   2932 C C   . TRP A 1 388 ? 23.363  -19.070 -17.416 1.00 35.97  ? 385 TRP A C   1 
ATOM   2933 O O   . TRP A 1 388 ? 23.285  -19.473 -18.577 1.00 40.37  ? 385 TRP A O   1 
ATOM   2934 C CB  . TRP A 1 388 ? 21.868  -17.040 -17.444 1.00 33.34  ? 385 TRP A CB  1 
ATOM   2935 C CG  . TRP A 1 388 ? 20.502  -16.572 -17.069 1.00 33.64  ? 385 TRP A CG  1 
ATOM   2936 C CD1 . TRP A 1 388 ? 20.180  -15.557 -16.204 1.00 34.03  ? 385 TRP A CD1 1 
ATOM   2937 C CD2 . TRP A 1 388 ? 19.264  -17.140 -17.500 1.00 36.95  ? 385 TRP A CD2 1 
ATOM   2938 N NE1 . TRP A 1 388 ? 18.815  -15.445 -16.098 1.00 33.14  ? 385 TRP A NE1 1 
ATOM   2939 C CE2 . TRP A 1 388 ? 18.229  -16.411 -16.880 1.00 36.32  ? 385 TRP A CE2 1 
ATOM   2940 C CE3 . TRP A 1 388 ? 18.926  -18.192 -18.364 1.00 38.60  ? 385 TRP A CE3 1 
ATOM   2941 C CZ2 . TRP A 1 388 ? 16.881  -16.698 -17.091 1.00 35.02  ? 385 TRP A CZ2 1 
ATOM   2942 C CZ3 . TRP A 1 388 ? 17.588  -18.476 -18.573 1.00 37.35  ? 385 TRP A CZ3 1 
ATOM   2943 C CH2 . TRP A 1 388 ? 16.582  -17.730 -17.940 1.00 39.24  ? 385 TRP A CH2 1 
ATOM   2944 N N   . LEU A 1 389 ? 24.447  -19.244 -16.671 1.00 37.57  ? 386 LEU A N   1 
ATOM   2945 C CA  . LEU A 1 389 ? 25.534  -20.104 -17.118 1.00 38.22  ? 386 LEU A CA  1 
ATOM   2946 C C   . LEU A 1 389 ? 25.192  -21.572 -16.846 1.00 43.57  ? 386 LEU A C   1 
ATOM   2947 O O   . LEU A 1 389 ? 25.563  -22.458 -17.613 1.00 42.89  ? 386 LEU A O   1 
ATOM   2948 C CB  . LEU A 1 389 ? 26.844  -19.721 -16.430 1.00 36.71  ? 386 LEU A CB  1 
ATOM   2949 C CG  . LEU A 1 389 ? 28.093  -20.466 -16.901 1.00 42.79  ? 386 LEU A CG  1 
ATOM   2950 C CD1 . LEU A 1 389 ? 28.311  -20.280 -18.416 1.00 39.44  ? 386 LEU A CD1 1 
ATOM   2951 C CD2 . LEU A 1 389 ? 29.307  -20.011 -16.105 1.00 40.80  ? 386 LEU A CD2 1 
ATOM   2952 N N   . HIS A 1 390 ? 24.481  -21.820 -15.748 1.00 41.38  ? 387 HIS A N   1 
ATOM   2953 C CA  . HIS A 1 390 ? 24.027  -23.168 -15.406 1.00 40.97  ? 387 HIS A CA  1 
ATOM   2954 C C   . HIS A 1 390 ? 22.543  -23.172 -15.040 1.00 40.46  ? 387 HIS A C   1 
ATOM   2955 O O   . HIS A 1 390 ? 22.193  -23.389 -13.886 1.00 38.86  ? 387 HIS A O   1 
ATOM   2956 C CB  . HIS A 1 390 ? 24.839  -23.732 -14.238 1.00 43.42  ? 387 HIS A CB  1 
ATOM   2957 C CG  . HIS A 1 390 ? 26.317  -23.726 -14.462 1.00 45.35  ? 387 HIS A CG  1 
ATOM   2958 N ND1 . HIS A 1 390 ? 27.144  -22.741 -13.959 1.00 43.94  ? 387 HIS A ND1 1 
ATOM   2959 C CD2 . HIS A 1 390 ? 27.126  -24.592 -15.118 1.00 47.24  ? 387 HIS A CD2 1 
ATOM   2960 C CE1 . HIS A 1 390 ? 28.390  -22.997 -14.303 1.00 45.17  ? 387 HIS A CE1 1 
ATOM   2961 N NE2 . HIS A 1 390 ? 28.410  -24.116 -15.007 1.00 47.80  ? 387 HIS A NE2 1 
ATOM   2962 N N   . PRO A 1 391 ? 21.662  -22.934 -16.023 1.00 41.26  ? 388 PRO A N   1 
ATOM   2963 C CA  . PRO A 1 391 ? 20.248  -22.709 -15.688 1.00 38.71  ? 388 PRO A CA  1 
ATOM   2964 C C   . PRO A 1 391 ? 19.482  -23.957 -15.255 1.00 38.26  ? 388 PRO A C   1 
ATOM   2965 O O   . PRO A 1 391 ? 18.333  -23.832 -14.834 1.00 40.37  ? 388 PRO A O   1 
ATOM   2966 C CB  . PRO A 1 391 ? 19.668  -22.153 -16.992 1.00 38.93  ? 388 PRO A CB  1 
ATOM   2967 C CG  . PRO A 1 391 ? 20.541  -22.717 -18.062 1.00 41.04  ? 388 PRO A CG  1 
ATOM   2968 C CD  . PRO A 1 391 ? 21.922  -22.807 -17.468 1.00 39.88  ? 388 PRO A CD  1 
ATOM   2969 N N   . GLU A 1 392 ? 20.104  -25.129 -15.344 1.00 39.23  ? 389 GLU A N   1 
ATOM   2970 C CA  . GLU A 1 392 ? 19.423  -26.382 -15.027 1.00 41.57  ? 389 GLU A CA  1 
ATOM   2971 C C   . GLU A 1 392 ? 20.017  -27.071 -13.806 1.00 39.56  ? 389 GLU A C   1 
ATOM   2972 O O   . GLU A 1 392 ? 19.533  -28.119 -13.381 1.00 38.61  ? 389 GLU A O   1 
ATOM   2973 C CB  . GLU A 1 392 ? 19.482  -27.335 -16.223 1.00 43.69  ? 389 GLU A CB  1 
ATOM   2974 C CG  . GLU A 1 392 ? 19.079  -26.699 -17.542 1.00 49.00  ? 389 GLU A CG  1 
ATOM   2975 C CD  . GLU A 1 392 ? 17.667  -27.057 -17.958 1.00 58.51  ? 389 GLU A CD  1 
ATOM   2976 O OE1 . GLU A 1 392 ? 16.757  -27.018 -17.104 1.00 52.38  ? 389 GLU A OE1 1 
ATOM   2977 O OE2 . GLU A 1 392 ? 17.471  -27.384 -19.146 1.00 65.70  ? 389 GLU A OE2 1 
ATOM   2978 N N   . ASP A 1 393 ? 21.070  -26.484 -13.248 1.00 38.48  ? 390 ASP A N   1 
ATOM   2979 C CA  . ASP A 1 393 ? 21.799  -27.127 -12.170 1.00 37.21  ? 390 ASP A CA  1 
ATOM   2980 C C   . ASP A 1 393 ? 20.959  -27.149 -10.891 1.00 37.30  ? 390 ASP A C   1 
ATOM   2981 O O   . ASP A 1 393 ? 20.598  -26.099 -10.366 1.00 34.90  ? 390 ASP A O   1 
ATOM   2982 C CB  . ASP A 1 393 ? 23.132  -26.422 -11.929 1.00 37.28  ? 390 ASP A CB  1 
ATOM   2983 C CG  . ASP A 1 393 ? 23.991  -27.149 -10.921 1.00 43.05  ? 390 ASP A CG  1 
ATOM   2984 O OD1 . ASP A 1 393 ? 24.597  -28.170 -11.293 1.00 47.37  ? 390 ASP A OD1 1 
ATOM   2985 O OD2 . ASP A 1 393 ? 24.054  -26.710 -9.756  1.00 42.98  ? 390 ASP A OD2 1 
ATOM   2986 N N   . PRO A 1 394 ? 20.642  -28.358 -10.401 1.00 34.50  ? 391 PRO A N   1 
ATOM   2987 C CA  . PRO A 1 394 ? 19.728  -28.591 -9.275  1.00 36.93  ? 391 PRO A CA  1 
ATOM   2988 C C   . PRO A 1 394 ? 20.194  -27.948 -7.969  1.00 36.25  ? 391 PRO A C   1 
ATOM   2989 O O   . PRO A 1 394 ? 19.361  -27.490 -7.182  1.00 37.99  ? 391 PRO A O   1 
ATOM   2990 C CB  . PRO A 1 394 ? 19.711  -30.121 -9.141  1.00 36.33  ? 391 PRO A CB  1 
ATOM   2991 C CG  . PRO A 1 394 ? 20.213  -30.640 -10.434 1.00 41.50  ? 391 PRO A CG  1 
ATOM   2992 C CD  . PRO A 1 394 ? 21.191  -29.618 -10.930 1.00 40.30  ? 391 PRO A CD  1 
ATOM   2993 N N   . THR A 1 395 ? 21.502  -27.921 -7.742  1.00 34.61  ? 392 THR A N   1 
ATOM   2994 C CA  . THR A 1 395 ? 22.049  -27.325 -6.526  1.00 37.83  ? 392 THR A CA  1 
ATOM   2995 C C   . THR A 1 395 ? 21.860  -25.810 -6.532  1.00 39.23  ? 392 THR A C   1 
ATOM   2996 O O   . THR A 1 395 ? 21.397  -25.222 -5.542  1.00 36.73  ? 392 THR A O   1 
ATOM   2997 C CB  . THR A 1 395 ? 23.540  -27.657 -6.363  1.00 37.30  ? 392 THR A CB  1 
ATOM   2998 O OG1 . THR A 1 395 ? 23.708  -29.081 -6.335  1.00 37.80  ? 392 THR A OG1 1 
ATOM   2999 C CG2 . THR A 1 395 ? 24.085  -27.055 -5.070  1.00 41.26  ? 392 THR A CG2 1 
ATOM   3000 N N   . HIS A 1 396 ? 22.212  -25.187 -7.656  0.90 35.07  ? 393 HIS A N   1 
ATOM   3001 C CA  . HIS A 1 396 ? 22.021  -23.755 -7.827  0.90 35.69  ? 393 HIS A CA  1 
ATOM   3002 C C   . HIS A 1 396 ? 20.548  -23.390 -7.722  0.90 36.86  ? 393 HIS A C   1 
ATOM   3003 O O   . HIS A 1 396 ? 20.208  -22.373 -7.135  0.90 34.09  ? 393 HIS A O   1 
ATOM   3004 C CB  . HIS A 1 396 ? 22.573  -23.274 -9.173  0.90 40.66  ? 393 HIS A CB  1 
ATOM   3005 C CG  . HIS A 1 396 ? 24.070  -23.258 -9.246  0.90 50.46  ? 393 HIS A CG  1 
ATOM   3006 N ND1 . HIS A 1 396 ? 24.755  -22.913 -10.391 0.90 50.64  ? 393 HIS A ND1 1 
ATOM   3007 C CD2 . HIS A 1 396 ? 25.011  -23.544 -8.315  0.90 53.35  ? 393 HIS A CD2 1 
ATOM   3008 C CE1 . HIS A 1 396 ? 26.057  -22.988 -10.163 0.90 48.70  ? 393 HIS A CE1 1 
ATOM   3009 N NE2 . HIS A 1 396 ? 26.237  -23.369 -8.912  0.90 58.68  ? 393 HIS A NE2 1 
ATOM   3010 N N   . LEU A 1 397 ? 19.677  -24.216 -8.296  1.00 32.14  ? 394 LEU A N   1 
ATOM   3011 C CA  . LEU A 1 397 ? 18.239  -23.954 -8.240  1.00 31.64  ? 394 LEU A CA  1 
ATOM   3012 C C   . LEU A 1 397 ? 17.701  -24.059 -6.805  1.00 33.44  ? 394 LEU A C   1 
ATOM   3013 O O   . LEU A 1 397 ? 16.875  -23.250 -6.381  1.00 31.19  ? 394 LEU A O   1 
ATOM   3014 C CB  . LEU A 1 397 ? 17.482  -24.911 -9.161  1.00 31.99  ? 394 LEU A CB  1 
ATOM   3015 C CG  . LEU A 1 397 ? 17.731  -24.698 -10.662 1.00 35.00  ? 394 LEU A CG  1 
ATOM   3016 C CD1 . LEU A 1 397 ? 17.203  -25.874 -11.490 1.00 33.95  ? 394 LEU A CD1 1 
ATOM   3017 C CD2 . LEU A 1 397 ? 17.117  -23.385 -11.124 1.00 32.37  ? 394 LEU A CD2 1 
ATOM   3018 N N   . ARG A 1 398 ? 18.168  -25.057 -6.066  1.00 33.08  ? 395 ARG A N   1 
ATOM   3019 C CA  . ARG A 1 398 ? 17.768  -25.199 -4.664  1.00 33.32  ? 395 ARG A CA  1 
ATOM   3020 C C   . ARG A 1 398 ? 18.181  -23.964 -3.854  1.00 34.19  ? 395 ARG A C   1 
ATOM   3021 O O   . ARG A 1 398 ? 17.361  -23.339 -3.147  1.00 35.76  ? 395 ARG A O   1 
ATOM   3022 C CB  . ARG A 1 398 ? 18.387  -26.459 -4.068  1.00 33.12  ? 395 ARG A CB  1 
ATOM   3023 C CG  . ARG A 1 398 ? 18.090  -26.669 -2.585  1.00 31.97  ? 395 ARG A CG  1 
ATOM   3024 C CD  . ARG A 1 398 ? 19.059  -27.667 -1.988  1.00 33.46  ? 395 ARG A CD  1 
ATOM   3025 N NE  . ARG A 1 398 ? 20.415  -27.131 -1.927  1.00 32.43  ? 395 ARG A NE  1 
ATOM   3026 C CZ  . ARG A 1 398 ? 21.499  -27.862 -1.695  1.00 33.19  ? 395 ARG A CZ  1 
ATOM   3027 N NH1 . ARG A 1 398 ? 21.398  -29.172 -1.514  1.00 32.31  ? 395 ARG A NH1 1 
ATOM   3028 N NH2 . ARG A 1 398 ? 22.690  -27.282 -1.655  1.00 31.39  ? 395 ARG A NH2 1 
ATOM   3029 N N   . ASP A 1 399 ? 19.455  -23.602 -3.986  1.00 33.40  ? 396 ASP A N   1 
ATOM   3030 C CA  . ASP A 1 399 ? 19.998  -22.473 -3.247  1.00 35.14  ? 396 ASP A CA  1 
ATOM   3031 C C   . ASP A 1 399 ? 19.343  -21.155 -3.668  1.00 36.13  ? 396 ASP A C   1 
ATOM   3032 O O   . ASP A 1 399 ? 19.155  -20.252 -2.848  1.00 34.88  ? 396 ASP A O   1 
ATOM   3033 C CB  . ASP A 1 399 ? 21.519  -22.407 -3.418  1.00 34.30  ? 396 ASP A CB  1 
ATOM   3034 C CG  . ASP A 1 399 ? 22.228  -23.594 -2.774  1.00 37.30  ? 396 ASP A CG  1 
ATOM   3035 O OD1 . ASP A 1 399 ? 21.579  -24.313 -1.986  1.00 38.42  ? 396 ASP A OD1 1 
ATOM   3036 O OD2 . ASP A 1 399 ? 23.432  -23.806 -3.040  1.00 37.37  ? 396 ASP A OD2 1 
ATOM   3037 N N   . ALA A 1 400 ? 18.968  -21.060 -4.938  1.00 30.01  ? 397 ALA A N   1 
ATOM   3038 C CA  . ALA A 1 400 ? 18.306  -19.873 -5.454  1.00 31.02  ? 397 ALA A CA  1 
ATOM   3039 C C   . ALA A 1 400 ? 16.893  -19.779 -4.903  1.00 31.35  ? 397 ALA A C   1 
ATOM   3040 O O   . ALA A 1 400 ? 16.417  -18.692 -4.614  1.00 32.71  ? 397 ALA A O   1 
ATOM   3041 C CB  . ALA A 1 400 ? 18.283  -19.876 -7.002  1.00 32.70  ? 397 ALA A CB  1 
ATOM   3042 N N   . MET A 1 401 ? 16.216  -20.914 -4.775  1.00 31.97  ? 398 MET A N   1 
ATOM   3043 C CA  . MET A 1 401 ? 14.882  -20.925 -4.184  1.00 33.38  ? 398 MET A CA  1 
ATOM   3044 C C   . MET A 1 401 ? 14.944  -20.400 -2.740  1.00 30.95  ? 398 MET A C   1 
ATOM   3045 O O   . MET A 1 401 ? 14.157  -19.511 -2.329  1.00 31.05  ? 398 MET A O   1 
ATOM   3046 C CB  . MET A 1 401 ? 14.297  -22.335 -4.214  1.00 33.50  ? 398 MET A CB  1 
ATOM   3047 C CG  . MET A 1 401 ? 12.852  -22.412 -3.768  1.00 36.35  ? 398 MET A CG  1 
ATOM   3048 S SD  . MET A 1 401 ? 11.773  -21.629 -4.980  1.00 37.69  ? 398 MET A SD  1 
ATOM   3049 C CE  . MET A 1 401 ? 11.450  -20.026 -4.240  1.00 36.55  ? 398 MET A CE  1 
ATOM   3050 N N   . SER A 1 402 ? 15.903  -20.945 -1.993  1.00 30.01  ? 399 SER A N   1 
ATOM   3051 C CA  . SER A 1 402 ? 16.147  -20.497 -0.620  1.00 33.85  ? 399 SER A CA  1 
ATOM   3052 C C   . SER A 1 402 ? 16.406  -18.989 -0.558  1.00 33.60  ? 399 SER A C   1 
ATOM   3053 O O   . SER A 1 402 ? 15.818  -18.271 0.265   1.00 35.76  ? 399 SER A O   1 
ATOM   3054 C CB  . SER A 1 402 ? 17.323  -21.263 -0.017  1.00 32.66  ? 399 SER A CB  1 
ATOM   3055 O OG  . SER A 1 402 ? 17.557  -20.879 1.330   1.00 36.13  ? 399 SER A OG  1 
ATOM   3056 N N   . ALA A 1 403 ? 17.272  -18.509 -1.446  1.00 33.06  ? 400 ALA A N   1 
ATOM   3057 C CA  . ALA A 1 403 ? 17.618  -17.092 -1.477  1.00 32.48  ? 400 ALA A CA  1 
ATOM   3058 C C   . ALA A 1 403 ? 16.426  -16.212 -1.852  1.00 33.70  ? 400 ALA A C   1 
ATOM   3059 O O   . ALA A 1 403 ? 16.268  -15.127 -1.310  1.00 30.97  ? 400 ALA A O   1 
ATOM   3060 C CB  . ALA A 1 403 ? 18.776  -16.853 -2.431  1.00 31.39  ? 400 ALA A CB  1 
ATOM   3061 N N   . VAL A 1 404 ? 15.589  -16.671 -2.778  1.00 31.29  ? 401 VAL A N   1 
ATOM   3062 C CA  . VAL A 1 404 ? 14.386  -15.925 -3.132  1.00 28.94  ? 401 VAL A CA  1 
ATOM   3063 C C   . VAL A 1 404 ? 13.522  -15.709 -1.890  1.00 33.91  ? 401 VAL A C   1 
ATOM   3064 O O   . VAL A 1 404 ? 13.130  -14.576 -1.587  1.00 31.50  ? 401 VAL A O   1 
ATOM   3065 C CB  . VAL A 1 404 ? 13.541  -16.640 -4.204  1.00 32.91  ? 401 VAL A CB  1 
ATOM   3066 C CG1 . VAL A 1 404 ? 12.143  -16.045 -4.253  1.00 30.23  ? 401 VAL A CG1 1 
ATOM   3067 C CG2 . VAL A 1 404 ? 14.218  -16.564 -5.586  1.00 30.14  ? 401 VAL A CG2 1 
ATOM   3068 N N   . VAL A 1 405 ? 13.241  -16.798 -1.173  1.00 32.89  ? 402 VAL A N   1 
ATOM   3069 C CA  . VAL A 1 405 ? 12.363  -16.701 -0.007  1.00 34.84  ? 402 VAL A CA  1 
ATOM   3070 C C   . VAL A 1 405 ? 12.967  -15.811 1.098   1.00 33.77  ? 402 VAL A C   1 
ATOM   3071 O O   . VAL A 1 405 ? 12.299  -14.906 1.627   1.00 33.61  ? 402 VAL A O   1 
ATOM   3072 C CB  . VAL A 1 405 ? 12.043  -18.102 0.556   1.00 35.28  ? 402 VAL A CB  1 
ATOM   3073 C CG1 . VAL A 1 405 ? 11.192  -18.004 1.805   1.00 36.55  ? 402 VAL A CG1 1 
ATOM   3074 C CG2 . VAL A 1 405 ? 11.331  -18.939 -0.502  1.00 34.33  ? 402 VAL A CG2 1 
ATOM   3075 N N   . GLY A 1 406 ? 14.238  -16.053 1.413   1.00 30.40  ? 403 GLY A N   1 
ATOM   3076 C CA  . GLY A 1 406 ? 14.936  -15.291 2.434   1.00 32.54  ? 403 GLY A CA  1 
ATOM   3077 C C   . GLY A 1 406 ? 15.069  -13.809 2.128   1.00 36.97  ? 403 GLY A C   1 
ATOM   3078 O O   . GLY A 1 406 ? 14.919  -12.967 3.022   1.00 28.87  ? 403 GLY A O   1 
ATOM   3079 N N   . ASP A 1 407 ? 15.355  -13.486 0.868   1.00 29.65  ? 404 ASP A N   1 
ATOM   3080 C CA  . ASP A 1 407 ? 15.526  -12.099 0.446   1.00 30.83  ? 404 ASP A CA  1 
ATOM   3081 C C   . ASP A 1 407 ? 14.197  -11.368 0.455   1.00 32.45  ? 404 ASP A C   1 
ATOM   3082 O O   . ASP A 1 407 ? 14.110  -10.227 0.917   1.00 34.52  ? 404 ASP A O   1 
ATOM   3083 C CB  . ASP A 1 407 ? 16.145  -12.015 -0.962  1.00 30.33  ? 404 ASP A CB  1 
ATOM   3084 C CG  . ASP A 1 407 ? 17.582  -12.500 -1.000  1.00 35.58  ? 404 ASP A CG  1 
ATOM   3085 O OD1 . ASP A 1 407 ? 18.208  -12.600 0.075   1.00 33.64  ? 404 ASP A OD1 1 
ATOM   3086 O OD2 . ASP A 1 407 ? 18.085  -12.791 -2.108  1.00 32.34  ? 404 ASP A OD2 1 
ATOM   3087 N N   . HIS A 1 408 ? 13.166  -12.026 -0.067  1.00 27.86  ? 405 HIS A N   1 
ATOM   3088 C CA  . HIS A 1 408 ? 11.843  -11.418 -0.137  1.00 30.15  ? 405 HIS A CA  1 
ATOM   3089 C C   . HIS A 1 408 ? 11.262  -11.156 1.261   1.00 31.94  ? 405 HIS A C   1 
ATOM   3090 O O   . HIS A 1 408 ? 10.698  -10.089 1.520   1.00 28.06  ? 405 HIS A O   1 
ATOM   3091 C CB  . HIS A 1 408 ? 10.900  -12.312 -0.942  1.00 32.17  ? 405 HIS A CB  1 
ATOM   3092 C CG  . HIS A 1 408 ? 9.514   -11.768 -1.090  1.00 30.47  ? 405 HIS A CG  1 
ATOM   3093 N ND1 . HIS A 1 408 ? 9.260   -10.448 -1.399  1.00 32.03  ? 405 HIS A ND1 1 
ATOM   3094 C CD2 . HIS A 1 408 ? 8.305   -12.366 -0.982  1.00 30.40  ? 405 HIS A CD2 1 
ATOM   3095 C CE1 . HIS A 1 408 ? 7.957   -10.258 -1.469  1.00 31.96  ? 405 HIS A CE1 1 
ATOM   3096 N NE2 . HIS A 1 408 ? 7.352   -11.407 -1.220  1.00 32.90  ? 405 HIS A NE2 1 
ATOM   3097 N N   . ASN A 1 409 ? 11.407  -12.124 2.159   1.00 29.37  ? 406 ASN A N   1 
ATOM   3098 C CA  . ASN A 1 409 ? 10.733  -12.019 3.448   1.00 31.84  ? 406 ASN A CA  1 
ATOM   3099 C C   . ASN A 1 409 ? 11.554  -11.366 4.552   1.00 32.39  ? 406 ASN A C   1 
ATOM   3100 O O   . ASN A 1 409 ? 10.986  -10.807 5.494   1.00 33.31  ? 406 ASN A O   1 
ATOM   3101 C CB  . ASN A 1 409 ? 10.277  -13.401 3.914   1.00 31.88  ? 406 ASN A CB  1 
ATOM   3102 C CG  . ASN A 1 409 ? 9.163   -13.960 3.053   1.00 37.86  ? 406 ASN A CG  1 
ATOM   3103 O OD1 . ASN A 1 409 ? 8.042   -13.450 3.063   1.00 38.66  ? 406 ASN A OD1 1 
ATOM   3104 N ND2 . ASN A 1 409 ? 9.466   -15.015 2.303   1.00 35.17  ? 406 ASN A ND2 1 
ATOM   3105 N N   . VAL A 1 410 ? 12.880  -11.438 4.463   1.00 31.98  ? 407 VAL A N   1 
ATOM   3106 C CA  . VAL A 1 410 ? 13.704  -10.952 5.574   1.00 31.71  ? 407 VAL A CA  1 
ATOM   3107 C C   . VAL A 1 410 ? 14.833  -10.005 5.172   1.00 31.85  ? 407 VAL A C   1 
ATOM   3108 O O   . VAL A 1 410 ? 14.879  -8.874  5.649   1.00 29.83  ? 407 VAL A O   1 
ATOM   3109 C CB  . VAL A 1 410 ? 14.323  -12.122 6.370   1.00 28.78  ? 407 VAL A CB  1 
ATOM   3110 C CG1 . VAL A 1 410 ? 15.157  -11.591 7.535   1.00 30.56  ? 407 VAL A CG1 1 
ATOM   3111 C CG2 . VAL A 1 410 ? 13.233  -13.053 6.885   1.00 30.11  ? 407 VAL A CG2 1 
ATOM   3112 N N   . VAL A 1 411 ? 15.743  -10.450 4.305   1.00 31.60  ? 408 VAL A N   1 
ATOM   3113 C CA  . VAL A 1 411 ? 16.960  -9.673  4.061   1.00 33.06  ? 408 VAL A CA  1 
ATOM   3114 C C   . VAL A 1 411 ? 16.681  -8.291  3.470   1.00 33.04  ? 408 VAL A C   1 
ATOM   3115 O O   . VAL A 1 411 ? 17.192  -7.287  3.959   1.00 33.95  ? 408 VAL A O   1 
ATOM   3116 C CB  . VAL A 1 411 ? 17.941  -10.408 3.128   1.00 36.26  ? 408 VAL A CB  1 
ATOM   3117 C CG1 . VAL A 1 411 ? 19.252  -9.638  3.053   1.00 36.78  ? 408 VAL A CG1 1 
ATOM   3118 C CG2 . VAL A 1 411 ? 18.193  -11.817 3.624   1.00 34.57  ? 408 VAL A CG2 1 
ATOM   3119 N N   . CYS A 1 412 ? 15.868  -8.229  2.424   1.00 33.23  ? 409 CYS A N   1 
ATOM   3120 C CA  . CYS A 1 412 ? 15.589  -6.942  1.799   1.00 31.74  ? 409 CYS A CA  1 
ATOM   3121 C C   . CYS A 1 412 ? 14.621  -6.056  2.617   1.00 34.88  ? 409 CYS A C   1 
ATOM   3122 O O   . CYS A 1 412 ? 14.770  -4.836  2.621   1.00 31.32  ? 409 CYS A O   1 
ATOM   3123 C CB  . CYS A 1 412 ? 15.080  -7.166  0.376   1.00 35.24  ? 409 CYS A CB  1 
ATOM   3124 S SG  . CYS A 1 412 ? 16.351  -7.988  -0.646  1.00 35.00  ? 409 CYS A SG  1 
ATOM   3125 N N   . PRO A 1 413 ? 13.631  -6.653  3.308   1.00 32.31  ? 410 PRO A N   1 
ATOM   3126 C CA  . PRO A 1 413 ? 12.919  -5.790  4.258   1.00 34.43  ? 410 PRO A CA  1 
ATOM   3127 C C   . PRO A 1 413 ? 13.838  -5.200  5.338   1.00 32.19  ? 410 PRO A C   1 
ATOM   3128 O O   . PRO A 1 413 ? 13.666  -4.038  5.715   1.00 34.86  ? 410 PRO A O   1 
ATOM   3129 C CB  . PRO A 1 413 ? 11.882  -6.737  4.863   1.00 37.72  ? 410 PRO A CB  1 
ATOM   3130 C CG  . PRO A 1 413 ? 11.554  -7.653  3.693   1.00 33.40  ? 410 PRO A CG  1 
ATOM   3131 C CD  . PRO A 1 413 ? 12.888  -7.901  3.046   1.00 30.17  ? 410 PRO A CD  1 
ATOM   3132 N N   . VAL A 1 414 ? 14.809  -5.977  5.810   1.00 32.48  ? 411 VAL A N   1 
ATOM   3133 C CA  . VAL A 1 414 ? 15.768  -5.473  6.789   1.00 33.39  ? 411 VAL A CA  1 
ATOM   3134 C C   . VAL A 1 414 ? 16.627  -4.359  6.183   1.00 34.62  ? 411 VAL A C   1 
ATOM   3135 O O   . VAL A 1 414 ? 16.807  -3.312  6.798   1.00 32.18  ? 411 VAL A O   1 
ATOM   3136 C CB  . VAL A 1 414 ? 16.676  -6.598  7.342   1.00 34.86  ? 411 VAL A CB  1 
ATOM   3137 C CG1 . VAL A 1 414 ? 17.876  -6.007  8.059   1.00 33.02  ? 411 VAL A CG1 1 
ATOM   3138 C CG2 . VAL A 1 414 ? 15.895  -7.503  8.295   1.00 31.03  ? 411 VAL A CG2 1 
ATOM   3139 N N   . ALA A 1 415 ? 17.143  -4.576  4.975   1.00 33.42  ? 412 ALA A N   1 
ATOM   3140 C CA  . ALA A 1 415 ? 17.920  -3.548  4.276   1.00 30.76  ? 412 ALA A CA  1 
ATOM   3141 C C   . ALA A 1 415 ? 17.114  -2.258  4.105   1.00 31.34  ? 412 ALA A C   1 
ATOM   3142 O O   . ALA A 1 415 ? 17.630  -1.152  4.298   1.00 34.15  ? 412 ALA A O   1 
ATOM   3143 C CB  . ALA A 1 415 ? 18.389  -4.072  2.910   1.00 34.10  ? 412 ALA A CB  1 
ATOM   3144 N N   . GLN A 1 416 ? 15.843  -2.416  3.751   1.00 28.97  ? 413 GLN A N   1 
ATOM   3145 C CA  . GLN A 1 416 ? 14.926  -1.295  3.588   1.00 30.98  ? 413 GLN A CA  1 
ATOM   3146 C C   . GLN A 1 416 ? 14.763  -0.528  4.900   1.00 35.76  ? 413 GLN A C   1 
ATOM   3147 O O   . GLN A 1 416 ? 14.900  0.700   4.940   1.00 32.01  ? 413 GLN A O   1 
ATOM   3148 C CB  . GLN A 1 416 ? 13.565  -1.799  3.091   1.00 33.31  ? 413 GLN A CB  1 
ATOM   3149 C CG  . GLN A 1 416 ? 12.488  -0.736  2.963   1.00 35.09  ? 413 GLN A CG  1 
ATOM   3150 C CD  . GLN A 1 416 ? 12.753  0.236   1.835   1.00 45.91  ? 413 GLN A CD  1 
ATOM   3151 O OE1 . GLN A 1 416 ? 13.550  -0.036  0.935   1.00 49.06  ? 413 GLN A OE1 1 
ATOM   3152 N NE2 . GLN A 1 416 ? 12.078  1.380   1.871   1.00 53.14  ? 413 GLN A NE2 1 
ATOM   3153 N N   . LEU A 1 417 ? 14.481  -1.264  5.973   1.00 32.31  ? 414 LEU A N   1 
ATOM   3154 C CA  . LEU A 1 417 ? 14.321  -0.654  7.290   1.00 30.70  ? 414 LEU A CA  1 
ATOM   3155 C C   . LEU A 1 417 ? 15.577  0.101   7.712   1.00 34.48  ? 414 LEU A C   1 
ATOM   3156 O O   . LEU A 1 417 ? 15.511  1.274   8.073   1.00 37.06  ? 414 LEU A O   1 
ATOM   3157 C CB  . LEU A 1 417 ? 13.977  -1.715  8.341   1.00 29.60  ? 414 LEU A CB  1 
ATOM   3158 C CG  . LEU A 1 417 ? 13.820  -1.178  9.765   1.00 31.05  ? 414 LEU A CG  1 
ATOM   3159 C CD1 . LEU A 1 417 ? 12.663  -0.197  9.829   1.00 32.48  ? 414 LEU A CD1 1 
ATOM   3160 C CD2 . LEU A 1 417 ? 13.620  -2.318  10.753  1.00 29.55  ? 414 LEU A CD2 1 
ATOM   3161 N N   . ALA A 1 418 ? 16.716  -0.580  7.669   1.00 32.08  ? 415 ALA A N   1 
ATOM   3162 C CA  . ALA A 1 418 ? 17.989  0.014   8.059   1.00 33.31  ? 415 ALA A CA  1 
ATOM   3163 C C   . ALA A 1 418 ? 18.253  1.294   7.276   1.00 38.30  ? 415 ALA A C   1 
ATOM   3164 O O   . ALA A 1 418 ? 18.672  2.306   7.843   1.00 37.85  ? 415 ALA A O   1 
ATOM   3165 C CB  . ALA A 1 418 ? 19.121  -0.975  7.850   1.00 34.75  ? 415 ALA A CB  1 
ATOM   3166 N N   . GLY A 1 419 ? 17.997  1.243   5.971   1.00 36.91  ? 416 GLY A N   1 
ATOM   3167 C CA  . GLY A 1 419 ? 18.150  2.413   5.128   1.00 36.65  ? 416 GLY A CA  1 
ATOM   3168 C C   . GLY A 1 419 ? 17.268  3.575   5.548   1.00 39.62  ? 416 GLY A C   1 
ATOM   3169 O O   . GLY A 1 419 ? 17.757  4.691   5.737   1.00 45.37  ? 416 GLY A O   1 
ATOM   3170 N N   . ARG A 1 420 ? 15.970  3.321   5.698   1.00 37.07  ? 417 ARG A N   1 
ATOM   3171 C CA  . ARG A 1 420 ? 15.044  4.386   6.075   1.00 40.45  ? 417 ARG A CA  1 
ATOM   3172 C C   . ARG A 1 420 ? 15.385  4.976   7.444   1.00 42.47  ? 417 ARG A C   1 
ATOM   3173 O O   . ARG A 1 420 ? 15.394  6.194   7.608   1.00 46.11  ? 417 ARG A O   1 
ATOM   3174 C CB  . ARG A 1 420 ? 13.600  3.881   6.075   1.00 41.92  ? 417 ARG A CB  1 
ATOM   3175 C CG  . ARG A 1 420 ? 13.141  3.261   4.761   1.00 44.68  ? 417 ARG A CG  1 
ATOM   3176 C CD  . ARG A 1 420 ? 13.414  4.173   3.578   1.00 52.05  ? 417 ARG A CD  1 
ATOM   3177 N NE  . ARG A 1 420 ? 12.769  5.475   3.720   1.00 55.81  ? 417 ARG A NE  1 
ATOM   3178 C CZ  . ARG A 1 420 ? 12.253  6.167   2.708   1.00 61.93  ? 417 ARG A CZ  1 
ATOM   3179 N NH1 . ARG A 1 420 ? 12.297  5.674   1.475   1.00 60.54  ? 417 ARG A NH1 1 
ATOM   3180 N NH2 . ARG A 1 420 ? 11.686  7.347   2.930   1.00 58.95  ? 417 ARG A NH2 1 
ATOM   3181 N N   . LEU A 1 421 ? 15.669  4.112   8.416   1.00 39.72  ? 418 LEU A N   1 
ATOM   3182 C CA  . LEU A 1 421 ? 15.980  4.558   9.773   1.00 44.82  ? 418 LEU A CA  1 
ATOM   3183 C C   . LEU A 1 421 ? 17.244  5.402   9.796   1.00 45.50  ? 418 LEU A C   1 
ATOM   3184 O O   . LEU A 1 421 ? 17.277  6.463   10.420  1.00 45.55  ? 418 LEU A O   1 
ATOM   3185 C CB  . LEU A 1 421 ? 16.145  3.368   10.726  1.00 40.62  ? 418 LEU A CB  1 
ATOM   3186 C CG  . LEU A 1 421 ? 14.927  2.503   11.049  1.00 41.27  ? 418 LEU A CG  1 
ATOM   3187 C CD1 . LEU A 1 421 ? 15.322  1.367   11.987  1.00 38.72  ? 418 LEU A CD1 1 
ATOM   3188 C CD2 . LEU A 1 421 ? 13.804  3.329   11.649  1.00 43.08  ? 418 LEU A CD2 1 
ATOM   3189 N N   . ALA A 1 422 ? 18.287  4.920   9.125   1.00 42.17  ? 419 ALA A N   1 
ATOM   3190 C CA  . ALA A 1 422 ? 19.547  5.651   9.076   1.00 46.33  ? 419 ALA A CA  1 
ATOM   3191 C C   . ALA A 1 422 ? 19.373  7.000   8.385   1.00 49.78  ? 419 ALA A C   1 
ATOM   3192 O O   . ALA A 1 422 ? 19.929  8.006   8.825   1.00 54.33  ? 419 ALA A O   1 
ATOM   3193 C CB  . ALA A 1 422 ? 20.612  4.834   8.371   1.00 47.65  ? 419 ALA A CB  1 
ATOM   3194 N N   . ALA A 1 423 ? 18.590  7.019   7.311   1.00 44.66  ? 420 ALA A N   1 
ATOM   3195 C CA  . ALA A 1 423 ? 18.376  8.250   6.556   1.00 49.35  ? 420 ALA A CA  1 
ATOM   3196 C C   . ALA A 1 423 ? 17.566  9.269   7.348   1.00 49.81  ? 420 ALA A C   1 
ATOM   3197 O O   . ALA A 1 423 ? 17.622  10.465  7.071   1.00 53.16  ? 420 ALA A O   1 
ATOM   3198 C CB  . ALA A 1 423 ? 17.686  7.947   5.230   1.00 48.63  ? 420 ALA A CB  1 
ATOM   3199 N N   . GLN A 1 424 ? 16.821  8.802   8.343   1.00 49.87  ? 421 GLN A N   1 
ATOM   3200 C CA  . GLN A 1 424 ? 15.910  9.686   9.050   1.00 49.20  ? 421 GLN A CA  1 
ATOM   3201 C C   . GLN A 1 424 ? 16.216  9.815   10.541  1.00 47.13  ? 421 GLN A C   1 
ATOM   3202 O O   . GLN A 1 424 ? 15.307  9.958   11.358  1.00 50.19  ? 421 GLN A O   1 
ATOM   3203 C CB  . GLN A 1 424 ? 14.471  9.219   8.827   1.00 50.19  ? 421 GLN A CB  1 
ATOM   3204 C CG  . GLN A 1 424 ? 13.979  9.554   7.420   1.00 52.91  ? 421 GLN A CG  1 
ATOM   3205 C CD  . GLN A 1 424 ? 12.968  8.563   6.882   1.00 56.95  ? 421 GLN A CD  1 
ATOM   3206 O OE1 . GLN A 1 424 ? 13.045  8.152   5.721   1.00 60.75  ? 421 GLN A OE1 1 
ATOM   3207 N NE2 . GLN A 1 424 ? 12.005  8.185   7.715   1.00 54.24  ? 421 GLN A NE2 1 
ATOM   3208 N N   . GLY A 1 425 ? 17.501  9.775   10.884  1.00 45.88  ? 422 GLY A N   1 
ATOM   3209 C CA  . GLY A 1 425 ? 17.949  10.183  12.204  1.00 51.00  ? 422 GLY A CA  1 
ATOM   3210 C C   . GLY A 1 425 ? 18.478  9.118   13.147  1.00 53.89  ? 422 GLY A C   1 
ATOM   3211 O O   . GLY A 1 425 ? 19.216  9.431   14.082  1.00 53.38  ? 422 GLY A O   1 
ATOM   3212 N N   . ALA A 1 426 ? 18.106  7.863   12.921  1.00 49.92  ? 423 ALA A N   1 
ATOM   3213 C CA  . ALA A 1 426 ? 18.456  6.805   13.863  1.00 49.23  ? 423 ALA A CA  1 
ATOM   3214 C C   . ALA A 1 426 ? 19.915  6.387   13.732  1.00 44.46  ? 423 ALA A C   1 
ATOM   3215 O O   . ALA A 1 426 ? 20.497  6.467   12.653  1.00 44.82  ? 423 ALA A O   1 
ATOM   3216 C CB  . ALA A 1 426 ? 17.544  5.604   13.670  1.00 46.99  ? 423 ALA A CB  1 
ATOM   3217 N N   . ARG A 1 427 ? 20.510  5.967   14.844  1.00 41.74  ? 424 ARG A N   1 
ATOM   3218 C CA  . ARG A 1 427 ? 21.814  5.321   14.795  1.00 43.33  ? 424 ARG A CA  1 
ATOM   3219 C C   . ARG A 1 427 ? 21.591  3.829   14.596  1.00 44.23  ? 424 ARG A C   1 
ATOM   3220 O O   . ARG A 1 427 ? 20.937  3.176   15.413  1.00 41.81  ? 424 ARG A O   1 
ATOM   3221 C CB  . ARG A 1 427 ? 22.628  5.583   16.062  1.00 43.41  ? 424 ARG A CB  1 
ATOM   3222 C CG  . ARG A 1 427 ? 23.954  4.833   16.089  1.00 45.29  ? 424 ARG A CG  1 
ATOM   3223 C CD  . ARG A 1 427 ? 24.693  5.039   17.398  0.71 49.57  ? 424 ARG A CD  1 
ATOM   3224 N NE  . ARG A 1 427 ? 25.678  6.111   17.308  0.80 59.09  ? 424 ARG A NE  1 
ATOM   3225 C CZ  . ARG A 1 427 ? 26.301  6.636   18.357  0.51 60.20  ? 424 ARG A CZ  1 
ATOM   3226 N NH1 . ARG A 1 427 ? 26.032  6.189   19.577  1.00 58.46  ? 424 ARG A NH1 1 
ATOM   3227 N NH2 . ARG A 1 427 ? 27.186  7.610   18.188  0.82 67.14  ? 424 ARG A NH2 1 
ATOM   3228 N N   . VAL A 1 428 ? 22.125  3.299   13.501  1.00 40.89  ? 425 VAL A N   1 
ATOM   3229 C CA  . VAL A 1 428 ? 21.868  1.919   13.112  1.00 40.99  ? 425 VAL A CA  1 
ATOM   3230 C C   . VAL A 1 428 ? 23.145  1.087   13.075  1.00 38.22  ? 425 VAL A C   1 
ATOM   3231 O O   . VAL A 1 428 ? 24.161  1.526   12.542  1.00 38.99  ? 425 VAL A O   1 
ATOM   3232 C CB  . VAL A 1 428 ? 21.187  1.857   11.723  1.00 39.69  ? 425 VAL A CB  1 
ATOM   3233 C CG1 . VAL A 1 428 ? 20.840  0.422   11.352  1.00 34.32  ? 425 VAL A CG1 1 
ATOM   3234 C CG2 . VAL A 1 428 ? 19.942  2.733   11.703  1.00 39.68  ? 425 VAL A CG2 1 
ATOM   3235 N N   . TYR A 1 429 ? 23.083  -0.108  13.657  1.00 35.10  ? 426 TYR A N   1 
ATOM   3236 C CA  . TYR A 1 429 ? 24.136  -1.108  13.509  1.00 37.53  ? 426 TYR A CA  1 
ATOM   3237 C C   . TYR A 1 429 ? 23.567  -2.351  12.826  1.00 37.58  ? 426 TYR A C   1 
ATOM   3238 O O   . TYR A 1 429 ? 22.496  -2.834  13.196  1.00 37.32  ? 426 TYR A O   1 
ATOM   3239 C CB  . TYR A 1 429 ? 24.742  -1.474  14.866  1.00 39.91  ? 426 TYR A CB  1 
ATOM   3240 C CG  . TYR A 1 429 ? 25.489  -0.334  15.526  1.00 39.81  ? 426 TYR A CG  1 
ATOM   3241 C CD1 . TYR A 1 429 ? 26.831  -0.104  15.246  1.00 38.89  ? 426 TYR A CD1 1 
ATOM   3242 C CD2 . TYR A 1 429 ? 24.850  0.518   16.419  1.00 40.57  ? 426 TYR A CD2 1 
ATOM   3243 C CE1 . TYR A 1 429 ? 27.518  0.939   15.841  1.00 42.24  ? 426 TYR A CE1 1 
ATOM   3244 C CE2 . TYR A 1 429 ? 25.530  1.564   17.021  1.00 41.94  ? 426 TYR A CE2 1 
ATOM   3245 C CZ  . TYR A 1 429 ? 26.864  1.769   16.728  1.00 42.95  ? 426 TYR A CZ  1 
ATOM   3246 O OH  . TYR A 1 429 ? 27.548  2.806   17.318  1.00 42.54  ? 426 TYR A OH  1 
ATOM   3247 N N   . ALA A 1 430 ? 24.283  -2.867  11.831  1.00 37.08  ? 427 ALA A N   1 
ATOM   3248 C CA  . ALA A 1 430 ? 23.781  -3.987  11.037  1.00 35.96  ? 427 ALA A CA  1 
ATOM   3249 C C   . ALA A 1 430 ? 24.744  -5.172  11.039  1.00 34.05  ? 427 ALA A C   1 
ATOM   3250 O O   . ALA A 1 430 ? 25.957  -4.995  11.105  1.00 37.11  ? 427 ALA A O   1 
ATOM   3251 C CB  . ALA A 1 430 ? 23.500  -3.535  9.607   1.00 32.81  ? 427 ALA A CB  1 
ATOM   3252 N N   . TYR A 1 431 ? 24.200  -6.383  10.975  1.00 30.75  ? 428 TYR A N   1 
ATOM   3253 C CA  . TYR A 1 431 ? 25.041  -7.575  10.964  1.00 33.80  ? 428 TYR A CA  1 
ATOM   3254 C C   . TYR A 1 431 ? 24.509  -8.649  10.026  1.00 32.98  ? 428 TYR A C   1 
ATOM   3255 O O   . TYR A 1 431 ? 23.330  -8.658  9.668   1.00 32.00  ? 428 TYR A O   1 
ATOM   3256 C CB  . TYR A 1 431 ? 25.173  -8.166  12.379  1.00 30.67  ? 428 TYR A CB  1 
ATOM   3257 C CG  . TYR A 1 431 ? 23.884  -8.750  12.928  1.00 32.79  ? 428 TYR A CG  1 
ATOM   3258 C CD1 . TYR A 1 431 ? 23.469  -10.034 12.575  1.00 32.64  ? 428 TYR A CD1 1 
ATOM   3259 C CD2 . TYR A 1 431 ? 23.088  -8.026  13.811  1.00 32.65  ? 428 TYR A CD2 1 
ATOM   3260 C CE1 . TYR A 1 431 ? 22.296  -10.569 13.065  1.00 32.68  ? 428 TYR A CE1 1 
ATOM   3261 C CE2 . TYR A 1 431 ? 21.910  -8.560  14.316  1.00 30.03  ? 428 TYR A CE2 1 
ATOM   3262 C CZ  . TYR A 1 431 ? 21.522  -9.830  13.939  1.00 30.18  ? 428 TYR A CZ  1 
ATOM   3263 O OH  . TYR A 1 431 ? 20.352  -10.368 14.415  1.00 28.73  ? 428 TYR A OH  1 
ATOM   3264 N N   . ILE A 1 432 ? 25.387  -9.570  9.651   1.00 31.56  ? 429 ILE A N   1 
ATOM   3265 C CA  . ILE A 1 432 ? 24.949  -10.842 9.108   1.00 32.50  ? 429 ILE A CA  1 
ATOM   3266 C C   . ILE A 1 432 ? 25.603  -11.945 9.934   1.00 34.80  ? 429 ILE A C   1 
ATOM   3267 O O   . ILE A 1 432 ? 26.809  -11.922 10.189  1.00 35.14  ? 429 ILE A O   1 
ATOM   3268 C CB  . ILE A 1 432 ? 25.281  -10.998 7.596   1.00 33.30  ? 429 ILE A CB  1 
ATOM   3269 C CG1 . ILE A 1 432 ? 24.804  -12.359 7.090   1.00 32.64  ? 429 ILE A CG1 1 
ATOM   3270 C CG2 . ILE A 1 432 ? 26.768  -10.812 7.329   1.00 35.60  ? 429 ILE A CG2 1 
ATOM   3271 C CD1 . ILE A 1 432 ? 24.929  -12.537 5.581   1.00 41.50  ? 429 ILE A CD1 1 
ATOM   3272 N N   . PHE A 1 433 ? 24.783  -12.890 10.378  1.00 34.39  ? 430 PHE A N   1 
ATOM   3273 C CA  . PHE A 1 433 ? 25.228  -13.980 11.235  1.00 34.99  ? 430 PHE A CA  1 
ATOM   3274 C C   . PHE A 1 433 ? 25.496  -15.229 10.399  1.00 34.70  ? 430 PHE A C   1 
ATOM   3275 O O   . PHE A 1 433 ? 24.580  -15.784 9.796   1.00 34.97  ? 430 PHE A O   1 
ATOM   3276 C CB  . PHE A 1 433 ? 24.172  -14.252 12.312  1.00 32.12  ? 430 PHE A CB  1 
ATOM   3277 C CG  . PHE A 1 433 ? 24.569  -15.291 13.314  1.00 34.78  ? 430 PHE A CG  1 
ATOM   3278 C CD1 . PHE A 1 433 ? 24.316  -16.631 13.080  1.00 35.33  ? 430 PHE A CD1 1 
ATOM   3279 C CD2 . PHE A 1 433 ? 25.174  -14.926 14.505  1.00 37.93  ? 430 PHE A CD2 1 
ATOM   3280 C CE1 . PHE A 1 433 ? 24.672  -17.589 14.006  1.00 38.53  ? 430 PHE A CE1 1 
ATOM   3281 C CE2 . PHE A 1 433 ? 25.529  -15.879 15.436  1.00 36.59  ? 430 PHE A CE2 1 
ATOM   3282 C CZ  . PHE A 1 433 ? 25.280  -17.213 15.185  1.00 36.72  ? 430 PHE A CZ  1 
ATOM   3283 N N   . GLU A 1 434 ? 26.746  -15.679 10.378  1.00 37.88  ? 431 GLU A N   1 
ATOM   3284 C CA  . GLU A 1 434 ? 27.159  -16.691 9.410   1.00 40.11  ? 431 GLU A CA  1 
ATOM   3285 C C   . GLU A 1 434 ? 27.658  -17.998 10.018  1.00 39.52  ? 431 GLU A C   1 
ATOM   3286 O O   . GLU A 1 434 ? 28.069  -18.895 9.287   1.00 39.81  ? 431 GLU A O   1 
ATOM   3287 C CB  . GLU A 1 434 ? 28.249  -16.117 8.501   1.00 39.28  ? 431 GLU A CB  1 
ATOM   3288 C CG  . GLU A 1 434 ? 27.792  -14.942 7.650   1.00 40.08  ? 431 GLU A CG  1 
ATOM   3289 C CD  . GLU A 1 434 ? 28.882  -14.421 6.727   1.00 43.94  ? 431 GLU A CD  1 
ATOM   3290 O OE1 . GLU A 1 434 ? 30.065  -14.420 7.133   1.00 44.26  ? 431 GLU A OE1 1 
ATOM   3291 O OE2 . GLU A 1 434 ? 28.553  -14.011 5.594   1.00 45.39  ? 431 GLU A OE2 1 
ATOM   3292 N N   . HIS A 1 435 ? 27.624  -18.124 11.341  1.00 39.32  ? 432 HIS A N   1 
ATOM   3293 C CA  . HIS A 1 435 ? 28.117  -19.349 11.957  1.00 38.15  ? 432 HIS A CA  1 
ATOM   3294 C C   . HIS A 1 435 ? 27.026  -20.401 12.134  1.00 39.21  ? 432 HIS A C   1 
ATOM   3295 O O   . HIS A 1 435 ? 25.978  -20.133 12.722  1.00 40.15  ? 432 HIS A O   1 
ATOM   3296 C CB  . HIS A 1 435 ? 28.759  -19.063 13.314  1.00 38.30  ? 432 HIS A CB  1 
ATOM   3297 C CG  . HIS A 1 435 ? 29.166  -20.302 14.045  1.00 38.41  ? 432 HIS A CG  1 
ATOM   3298 N ND1 . HIS A 1 435 ? 30.252  -21.063 13.670  1.00 40.14  ? 432 HIS A ND1 1 
ATOM   3299 C CD2 . HIS A 1 435 ? 28.611  -20.936 15.107  1.00 39.60  ? 432 HIS A CD2 1 
ATOM   3300 C CE1 . HIS A 1 435 ? 30.360  -22.101 14.481  1.00 40.71  ? 432 HIS A CE1 1 
ATOM   3301 N NE2 . HIS A 1 435 ? 29.377  -22.048 15.359  1.00 39.96  ? 432 HIS A NE2 1 
ATOM   3302 N N   . ARG A 1 436 ? 27.286  -21.605 11.635  1.00 37.94  ? 433 ARG A N   1 
ATOM   3303 C CA  . ARG A 1 436 ? 26.367  -22.722 11.816  1.00 37.55  ? 433 ARG A CA  1 
ATOM   3304 C C   . ARG A 1 436 ? 26.730  -23.492 13.069  1.00 40.91  ? 433 ARG A C   1 
ATOM   3305 O O   . ARG A 1 436 ? 27.868  -23.936 13.216  1.00 40.34  ? 433 ARG A O   1 
ATOM   3306 C CB  . ARG A 1 436 ? 26.389  -23.659 10.608  1.00 40.99  ? 433 ARG A CB  1 
ATOM   3307 C CG  . ARG A 1 436 ? 25.462  -24.858 10.751  1.00 40.49  ? 433 ARG A CG  1 
ATOM   3308 C CD  . ARG A 1 436 ? 25.611  -25.821 9.576   1.00 41.68  ? 433 ARG A CD  1 
ATOM   3309 N NE  . ARG A 1 436 ? 24.343  -26.462 9.243   1.00 45.70  ? 433 ARG A NE  1 
ATOM   3310 C CZ  . ARG A 1 436 ? 23.996  -27.679 9.645   1.00 43.77  ? 433 ARG A CZ  1 
ATOM   3311 N NH1 . ARG A 1 436 ? 24.830  -28.394 10.383  1.00 48.75  ? 433 ARG A NH1 1 
ATOM   3312 N NH2 . ARG A 1 436 ? 22.821  -28.186 9.300   1.00 45.44  ? 433 ARG A NH2 1 
ATOM   3313 N N   . ALA A 1 437 ? 25.761  -23.646 13.967  1.00 39.71  ? 434 ALA A N   1 
ATOM   3314 C CA  . ALA A 1 437 ? 25.978  -24.340 15.230  1.00 41.82  ? 434 ALA A CA  1 
ATOM   3315 C C   . ALA A 1 437 ? 26.453  -25.763 14.983  1.00 42.76  ? 434 ALA A C   1 
ATOM   3316 O O   . ALA A 1 437 ? 25.934  -26.451 14.106  1.00 42.31  ? 434 ALA A O   1 
ATOM   3317 C CB  . ALA A 1 437 ? 24.702  -24.343 16.064  1.00 34.90  ? 434 ALA A CB  1 
ATOM   3318 N N   . SER A 1 438 ? 27.441  -26.197 15.760  1.00 40.88  ? 435 SER A N   1 
ATOM   3319 C CA  . SER A 1 438 ? 27.958  -27.556 15.655  1.00 40.56  ? 435 SER A CA  1 
ATOM   3320 C C   . SER A 1 438 ? 26.890  -28.587 16.014  1.00 42.01  ? 435 SER A C   1 
ATOM   3321 O O   . SER A 1 438 ? 26.970  -29.744 15.607  1.00 39.92  ? 435 SER A O   1 
ATOM   3322 C CB  . SER A 1 438 ? 29.184  -27.732 16.556  1.00 41.68  ? 435 SER A CB  1 
ATOM   3323 O OG  . SER A 1 438 ? 28.839  -27.605 17.927  1.00 44.70  ? 435 SER A OG  1 
ATOM   3324 N N   . THR A 1 439 ? 25.884  -28.152 16.768  1.00 43.36  ? 436 THR A N   1 
ATOM   3325 C CA  . THR A 1 439 ? 24.846  -29.039 17.283  1.00 39.29  ? 436 THR A CA  1 
ATOM   3326 C C   . THR A 1 439 ? 23.567  -29.050 16.442  1.00 37.26  ? 436 THR A C   1 
ATOM   3327 O O   . THR A 1 439 ? 22.612  -29.752 16.770  1.00 39.06  ? 436 THR A O   1 
ATOM   3328 C CB  . THR A 1 439 ? 24.470  -28.646 18.722  1.00 42.14  ? 436 THR A CB  1 
ATOM   3329 O OG1 . THR A 1 439 ? 24.059  -27.274 18.735  1.00 43.06  ? 436 THR A OG1 1 
ATOM   3330 C CG2 . THR A 1 439 ? 25.665  -28.813 19.648  1.00 43.90  ? 436 THR A CG2 1 
ATOM   3331 N N   . LEU A 1 440 ? 23.543  -28.276 15.363  1.00 39.83  ? 437 LEU A N   1 
ATOM   3332 C CA  . LEU A 1 440 ? 22.356  -28.203 14.515  1.00 41.35  ? 437 LEU A CA  1 
ATOM   3333 C C   . LEU A 1 440 ? 21.966  -29.575 13.955  1.00 39.28  ? 437 LEU A C   1 
ATOM   3334 O O   . LEU A 1 440 ? 22.821  -30.337 13.506  1.00 39.24  ? 437 LEU A O   1 
ATOM   3335 C CB  . LEU A 1 440 ? 22.581  -27.208 13.372  1.00 40.25  ? 437 LEU A CB  1 
ATOM   3336 C CG  . LEU A 1 440 ? 21.719  -25.947 13.450  1.00 37.83  ? 437 LEU A CG  1 
ATOM   3337 C CD1 . LEU A 1 440 ? 22.234  -24.875 12.515  1.00 37.95  ? 437 LEU A CD1 1 
ATOM   3338 C CD2 . LEU A 1 440 ? 20.272  -26.281 13.132  1.00 35.41  ? 437 LEU A CD2 1 
ATOM   3339 N N   . THR A 1 441 ? 20.674  -29.889 14.001  1.00 35.35  ? 438 THR A N   1 
ATOM   3340 C CA  . THR A 1 441 ? 20.188  -31.173 13.508  1.00 35.60  ? 438 THR A CA  1 
ATOM   3341 C C   . THR A 1 441 ? 19.492  -31.054 12.145  1.00 38.75  ? 438 THR A C   1 
ATOM   3342 O O   . THR A 1 441 ? 19.098  -32.061 11.563  1.00 37.98  ? 438 THR A O   1 
ATOM   3343 C CB  . THR A 1 441 ? 19.217  -31.834 14.510  1.00 38.67  ? 438 THR A CB  1 
ATOM   3344 O OG1 . THR A 1 441 ? 18.062  -31.006 14.693  1.00 39.00  ? 438 THR A OG1 1 
ATOM   3345 C CG2 . THR A 1 441 ? 19.901  -32.048 15.854  1.00 40.86  ? 438 THR A CG2 1 
ATOM   3346 N N   . TRP A 1 442 ? 19.331  -29.832 11.645  1.00 37.06  ? 439 TRP A N   1 
ATOM   3347 C CA  . TRP A 1 442 ? 18.841  -29.637 10.278  1.00 38.38  ? 439 TRP A CA  1 
ATOM   3348 C C   . TRP A 1 442 ? 19.977  -29.958 9.309   1.00 37.66  ? 439 TRP A C   1 
ATOM   3349 O O   . TRP A 1 442 ? 21.143  -29.796 9.664   1.00 36.09  ? 439 TRP A O   1 
ATOM   3350 C CB  . TRP A 1 442 ? 18.338  -28.206 10.069  1.00 36.29  ? 439 TRP A CB  1 
ATOM   3351 C CG  . TRP A 1 442 ? 17.087  -27.874 10.825  1.00 37.04  ? 439 TRP A CG  1 
ATOM   3352 C CD1 . TRP A 1 442 ? 17.001  -27.202 12.014  1.00 35.92  ? 439 TRP A CD1 1 
ATOM   3353 C CD2 . TRP A 1 442 ? 15.742  -28.185 10.442  1.00 38.43  ? 439 TRP A CD2 1 
ATOM   3354 N NE1 . TRP A 1 442 ? 15.686  -27.082 12.393  1.00 36.92  ? 439 TRP A NE1 1 
ATOM   3355 C CE2 . TRP A 1 442 ? 14.893  -27.678 11.447  1.00 37.53  ? 439 TRP A CE2 1 
ATOM   3356 C CE3 . TRP A 1 442 ? 15.171  -28.843 9.346   1.00 38.54  ? 439 TRP A CE3 1 
ATOM   3357 C CZ2 . TRP A 1 442 ? 13.508  -27.809 11.392  1.00 40.53  ? 439 TRP A CZ2 1 
ATOM   3358 C CZ3 . TRP A 1 442 ? 13.793  -28.973 9.292   1.00 37.84  ? 439 TRP A CZ3 1 
ATOM   3359 C CH2 . TRP A 1 442 ? 12.977  -28.456 10.310  1.00 45.54  ? 439 TRP A CH2 1 
ATOM   3360 N N   . PRO A 1 443 ? 19.650  -30.417 8.085   1.00 39.39  ? 440 PRO A N   1 
ATOM   3361 C CA  . PRO A 1 443 ? 20.711  -30.829 7.154   1.00 41.77  ? 440 PRO A CA  1 
ATOM   3362 C C   . PRO A 1 443 ? 21.687  -29.707 6.814   1.00 41.88  ? 440 PRO A C   1 
ATOM   3363 O O   . PRO A 1 443 ? 21.351  -28.529 6.940   1.00 38.18  ? 440 PRO A O   1 
ATOM   3364 C CB  . PRO A 1 443 ? 19.939  -31.271 5.898   1.00 37.95  ? 440 PRO A CB  1 
ATOM   3365 C CG  . PRO A 1 443 ? 18.612  -30.607 6.002   1.00 41.38  ? 440 PRO A CG  1 
ATOM   3366 C CD  . PRO A 1 443 ? 18.312  -30.542 7.483   1.00 40.38  ? 440 PRO A CD  1 
ATOM   3367 N N   . LEU A 1 444 ? 22.888  -30.086 6.387   1.00 45.38  ? 441 LEU A N   1 
ATOM   3368 C CA  . LEU A 1 444 ? 23.928  -29.123 6.037   1.00 45.55  ? 441 LEU A CA  1 
ATOM   3369 C C   . LEU A 1 444 ? 23.520  -28.166 4.920   1.00 38.98  ? 441 LEU A C   1 
ATOM   3370 O O   . LEU A 1 444 ? 24.001  -27.036 4.874   1.00 39.70  ? 441 LEU A O   1 
ATOM   3371 C CB  . LEU A 1 444 ? 25.213  -29.853 5.633   1.00 45.66  ? 441 LEU A CB  1 
ATOM   3372 C CG  . LEU A 1 444 ? 26.050  -30.406 6.790   1.00 53.30  ? 441 LEU A CG  1 
ATOM   3373 C CD1 . LEU A 1 444 ? 27.153  -31.315 6.273   1.00 59.80  ? 441 LEU A CD1 1 
ATOM   3374 C CD2 . LEU A 1 444 ? 26.634  -29.270 7.619   1.00 52.54  ? 441 LEU A CD2 1 
ATOM   3375 N N   . TRP A 1 445 ? 22.636  -28.599 4.026   1.00 37.64  ? 442 TRP A N   1 
ATOM   3376 C CA  . TRP A 1 445 ? 22.304  -27.757 2.878   1.00 36.67  ? 442 TRP A CA  1 
ATOM   3377 C C   . TRP A 1 445 ? 21.514  -26.518 3.304   1.00 38.66  ? 442 TRP A C   1 
ATOM   3378 O O   . TRP A 1 445 ? 21.476  -25.515 2.591   1.00 38.20  ? 442 TRP A O   1 
ATOM   3379 C CB  . TRP A 1 445 ? 21.543  -28.552 1.802   1.00 35.87  ? 442 TRP A CB  1 
ATOM   3380 C CG  . TRP A 1 445 ? 20.117  -28.989 2.106   1.00 34.41  ? 442 TRP A CG  1 
ATOM   3381 C CD1 . TRP A 1 445 ? 19.704  -30.243 2.461   1.00 36.99  ? 442 TRP A CD1 1 
ATOM   3382 C CD2 . TRP A 1 445 ? 18.925  -28.190 2.012   1.00 31.07  ? 442 TRP A CD2 1 
ATOM   3383 N NE1 . TRP A 1 445 ? 18.336  -30.267 2.616   1.00 35.22  ? 442 TRP A NE1 1 
ATOM   3384 C CE2 . TRP A 1 445 ? 17.836  -29.019 2.351   1.00 34.92  ? 442 TRP A CE2 1 
ATOM   3385 C CE3 . TRP A 1 445 ? 18.677  -26.849 1.697   1.00 34.30  ? 442 TRP A CE3 1 
ATOM   3386 C CZ2 . TRP A 1 445 ? 16.521  -28.554 2.376   1.00 37.85  ? 442 TRP A CZ2 1 
ATOM   3387 C CZ3 . TRP A 1 445 ? 17.371  -26.389 1.726   1.00 33.42  ? 442 TRP A CZ3 1 
ATOM   3388 C CH2 . TRP A 1 445 ? 16.310  -27.239 2.061   1.00 33.29  ? 442 TRP A CH2 1 
ATOM   3389 N N   . MET A 1 446 ? 20.903  -26.580 4.479   1.00 38.76  ? 443 MET A N   1 
ATOM   3390 C CA  . MET A 1 446 ? 20.130  -25.451 4.981   1.00 36.51  ? 443 MET A CA  1 
ATOM   3391 C C   . MET A 1 446 ? 21.002  -24.318 5.522   1.00 32.75  ? 443 MET A C   1 
ATOM   3392 O O   . MET A 1 446 ? 20.508  -23.220 5.771   1.00 36.66  ? 443 MET A O   1 
ATOM   3393 C CB  . MET A 1 446 ? 19.153  -25.933 6.045   1.00 36.44  ? 443 MET A CB  1 
ATOM   3394 C CG  . MET A 1 446 ? 17.942  -26.614 5.443   1.00 38.41  ? 443 MET A CG  1 
ATOM   3395 S SD  . MET A 1 446 ? 16.792  -27.165 6.704   1.00 39.25  ? 443 MET A SD  1 
ATOM   3396 C CE  . MET A 1 446 ? 15.355  -27.557 5.726   1.00 43.34  ? 443 MET A CE  1 
ATOM   3397 N N   . GLY A 1 447 ? 22.295  -24.579 5.687   1.00 32.58  ? 444 GLY A N   1 
ATOM   3398 C CA  . GLY A 1 447 ? 23.234  -23.541 6.073   1.00 34.84  ? 444 GLY A CA  1 
ATOM   3399 C C   . GLY A 1 447 ? 23.006  -23.047 7.495   1.00 35.56  ? 444 GLY A C   1 
ATOM   3400 O O   . GLY A 1 447 ? 22.912  -23.846 8.422   1.00 31.04  ? 444 GLY A O   1 
ATOM   3401 N N   . VAL A 1 448 ? 22.933  -21.727 7.659   1.00 34.53  ? 445 VAL A N   1 
ATOM   3402 C CA  . VAL A 1 448 ? 22.589  -21.111 8.944   1.00 33.26  ? 445 VAL A CA  1 
ATOM   3403 C C   . VAL A 1 448 ? 21.129  -20.692 8.906   1.00 30.06  ? 445 VAL A C   1 
ATOM   3404 O O   . VAL A 1 448 ? 20.803  -19.605 8.431   1.00 29.08  ? 445 VAL A O   1 
ATOM   3405 C CB  . VAL A 1 448 ? 23.459  -19.879 9.254   1.00 33.52  ? 445 VAL A CB  1 
ATOM   3406 C CG1 . VAL A 1 448 ? 23.104  -19.299 10.621  1.00 35.84  ? 445 VAL A CG1 1 
ATOM   3407 C CG2 . VAL A 1 448 ? 24.933  -20.235 9.187   1.00 39.20  ? 445 VAL A CG2 1 
ATOM   3408 N N   . PRO A 1 449 ? 20.236  -21.560 9.392   1.00 30.36  ? 446 PRO A N   1 
ATOM   3409 C CA  . PRO A 1 449 ? 18.826  -21.251 9.168   1.00 32.18  ? 446 PRO A CA  1 
ATOM   3410 C C   . PRO A 1 449 ? 18.279  -20.195 10.117  1.00 33.72  ? 446 PRO A C   1 
ATOM   3411 O O   . PRO A 1 449 ? 18.909  -19.827 11.115  1.00 31.22  ? 446 PRO A O   1 
ATOM   3412 C CB  . PRO A 1 449 ? 18.121  -22.596 9.401   1.00 30.47  ? 446 PRO A CB  1 
ATOM   3413 C CG  . PRO A 1 449 ? 19.220  -23.615 9.621   1.00 34.69  ? 446 PRO A CG  1 
ATOM   3414 C CD  . PRO A 1 449 ? 20.413  -22.845 10.081  1.00 30.99  ? 446 PRO A CD  1 
ATOM   3415 N N   . HIS A 1 450 ? 17.109  -19.699 9.736   1.00 35.58  ? 447 HIS A N   1 
ATOM   3416 C CA  . HIS A 1 450 ? 16.246  -18.852 10.542  1.00 35.57  ? 447 HIS A CA  1 
ATOM   3417 C C   . HIS A 1 450 ? 16.216  -19.264 12.015  1.00 34.43  ? 447 HIS A C   1 
ATOM   3418 O O   . HIS A 1 450 ? 15.802  -20.374 12.335  1.00 33.90  ? 447 HIS A O   1 
ATOM   3419 C CB  . HIS A 1 450 ? 14.837  -18.925 9.950   1.00 38.84  ? 447 HIS A CB  1 
ATOM   3420 C CG  . HIS A 1 450 ? 13.915  -17.843 10.405  1.00 35.35  ? 447 HIS A CG  1 
ATOM   3421 N ND1 . HIS A 1 450 ? 14.167  -16.505 10.180  1.00 40.18  ? 447 HIS A ND1 1 
ATOM   3422 C CD2 . HIS A 1 450 ? 12.716  -17.900 11.027  1.00 40.67  ? 447 HIS A CD2 1 
ATOM   3423 C CE1 . HIS A 1 450 ? 13.169  -15.786 10.656  1.00 37.40  ? 447 HIS A CE1 1 
ATOM   3424 N NE2 . HIS A 1 450 ? 12.277  -16.609 11.185  1.00 45.37  ? 447 HIS A NE2 1 
ATOM   3425 N N   . GLY A 1 451 ? 16.674  -18.376 12.895  1.00 34.41  ? 448 GLY A N   1 
ATOM   3426 C CA  . GLY A 1 451 ? 16.534  -18.564 14.329  1.00 31.30  ? 448 GLY A CA  1 
ATOM   3427 C C   . GLY A 1 451 ? 17.698  -19.197 15.070  1.00 33.04  ? 448 GLY A C   1 
ATOM   3428 O O   . GLY A 1 451 ? 17.643  -19.350 16.296  1.00 35.01  ? 448 GLY A O   1 
ATOM   3429 N N   . TYR A 1 452 ? 18.762  -19.553 14.355  1.00 31.02  ? 449 TYR A N   1 
ATOM   3430 C CA  . TYR A 1 452 ? 19.843  -20.313 14.980  1.00 33.69  ? 449 TYR A CA  1 
ATOM   3431 C C   . TYR A 1 452 ? 21.030  -19.442 15.373  1.00 35.00  ? 449 TYR A C   1 
ATOM   3432 O O   . TYR A 1 452 ? 22.130  -19.936 15.624  1.00 34.75  ? 449 TYR A O   1 
ATOM   3433 C CB  . TYR A 1 452 ? 20.258  -21.476 14.067  1.00 33.72  ? 449 TYR A CB  1 
ATOM   3434 C CG  . TYR A 1 452 ? 19.261  -22.594 14.235  1.00 33.99  ? 449 TYR A CG  1 
ATOM   3435 C CD1 . TYR A 1 452 ? 18.137  -22.672 13.428  1.00 31.73  ? 449 TYR A CD1 1 
ATOM   3436 C CD2 . TYR A 1 452 ? 19.383  -23.505 15.282  1.00 36.42  ? 449 TYR A CD2 1 
ATOM   3437 C CE1 . TYR A 1 452 ? 17.190  -23.661 13.617  1.00 31.95  ? 449 TYR A CE1 1 
ATOM   3438 C CE2 . TYR A 1 452 ? 18.441  -24.500 15.478  1.00 33.46  ? 449 TYR A CE2 1 
ATOM   3439 C CZ  . TYR A 1 452 ? 17.349  -24.574 14.637  1.00 32.68  ? 449 TYR A CZ  1 
ATOM   3440 O OH  . TYR A 1 452 ? 16.403  -25.557 14.819  1.00 37.13  ? 449 TYR A OH  1 
ATOM   3441 N N   . GLU A 1 453 ? 20.780  -18.141 15.466  1.00 32.92  ? 450 GLU A N   1 
ATOM   3442 C CA  . GLU A 1 453 ? 21.702  -17.235 16.135  1.00 33.53  ? 450 GLU A CA  1 
ATOM   3443 C C   . GLU A 1 453 ? 21.288  -17.040 17.597  1.00 34.84  ? 450 GLU A C   1 
ATOM   3444 O O   . GLU A 1 453 ? 22.105  -16.649 18.435  1.00 34.12  ? 450 GLU A O   1 
ATOM   3445 C CB  . GLU A 1 453 ? 21.745  -15.882 15.428  1.00 32.14  ? 450 GLU A CB  1 
ATOM   3446 C CG  . GLU A 1 453 ? 20.651  -14.904 15.851  1.00 31.73  ? 450 GLU A CG  1 
ATOM   3447 C CD  . GLU A 1 453 ? 19.285  -15.199 15.235  1.00 33.01  ? 450 GLU A CD  1 
ATOM   3448 O OE1 . GLU A 1 453 ? 19.006  -16.363 14.881  1.00 32.25  ? 450 GLU A OE1 1 
ATOM   3449 O OE2 . GLU A 1 453 ? 18.479  -14.253 15.111  1.00 33.62  ? 450 GLU A OE2 1 
ATOM   3450 N N   . ILE A 1 454 ? 20.015  -17.308 17.889  1.00 31.42  ? 451 ILE A N   1 
ATOM   3451 C CA  . ILE A 1 454 ? 19.432  -16.973 19.190  1.00 31.17  ? 451 ILE A CA  1 
ATOM   3452 C C   . ILE A 1 454 ? 20.176  -17.642 20.336  1.00 32.12  ? 451 ILE A C   1 
ATOM   3453 O O   . ILE A 1 454 ? 20.512  -16.992 21.322  1.00 35.95  ? 451 ILE A O   1 
ATOM   3454 C CB  . ILE A 1 454 ? 17.944  -17.368 19.274  1.00 29.06  ? 451 ILE A CB  1 
ATOM   3455 C CG1 . ILE A 1 454 ? 17.136  -16.667 18.185  1.00 28.48  ? 451 ILE A CG1 1 
ATOM   3456 C CG2 . ILE A 1 454 ? 17.373  -17.018 20.654  1.00 29.16  ? 451 ILE A CG2 1 
ATOM   3457 C CD1 . ILE A 1 454 ? 15.671  -17.040 18.201  1.00 26.88  ? 451 ILE A CD1 1 
ATOM   3458 N N   . GLU A 1 455 ? 20.448  -18.936 20.193  1.00 33.15  ? 452 GLU A N   1 
ATOM   3459 C CA  . GLU A 1 455 ? 21.126  -19.700 21.238  1.00 35.10  ? 452 GLU A CA  1 
ATOM   3460 C C   . GLU A 1 455 ? 22.517  -19.146 21.558  1.00 37.07  ? 452 GLU A C   1 
ATOM   3461 O O   . GLU A 1 455 ? 23.035  -19.356 22.654  1.00 37.12  ? 452 GLU A O   1 
ATOM   3462 C CB  . GLU A 1 455 ? 21.224  -21.176 20.835  1.00 38.32  ? 452 GLU A CB  1 
ATOM   3463 C CG  . GLU A 1 455 ? 21.951  -21.419 19.512  1.00 38.02  ? 452 GLU A CG  1 
ATOM   3464 C CD  . GLU A 1 455 ? 21.628  -22.774 18.898  1.00 42.10  ? 452 GLU A CD  1 
ATOM   3465 O OE1 . GLU A 1 455 ? 22.563  -23.449 18.421  1.00 46.65  ? 452 GLU A OE1 1 
ATOM   3466 O OE2 . GLU A 1 455 ? 20.440  -23.162 18.882  1.00 41.38  ? 452 GLU A OE2 1 
ATOM   3467 N N   . PHE A 1 456 ? 23.114  -18.432 20.607  1.00 35.48  ? 453 PHE A N   1 
ATOM   3468 C CA  . PHE A 1 456 ? 24.427  -17.825 20.820  1.00 35.59  ? 453 PHE A CA  1 
ATOM   3469 C C   . PHE A 1 456 ? 24.313  -16.468 21.519  1.00 37.31  ? 453 PHE A C   1 
ATOM   3470 O O   . PHE A 1 456 ? 25.165  -16.103 22.335  1.00 36.92  ? 453 PHE A O   1 
ATOM   3471 C CB  . PHE A 1 456 ? 25.174  -17.688 19.483  1.00 37.74  ? 453 PHE A CB  1 
ATOM   3472 C CG  . PHE A 1 456 ? 25.643  -19.007 18.919  1.00 37.64  ? 453 PHE A CG  1 
ATOM   3473 C CD1 . PHE A 1 456 ? 26.825  -19.583 19.362  1.00 36.00  ? 453 PHE A CD1 1 
ATOM   3474 C CD2 . PHE A 1 456 ? 24.890  -19.683 17.970  1.00 36.26  ? 453 PHE A CD2 1 
ATOM   3475 C CE1 . PHE A 1 456 ? 27.256  -20.800 18.864  1.00 36.65  ? 453 PHE A CE1 1 
ATOM   3476 C CE2 . PHE A 1 456 ? 25.316  -20.903 17.466  1.00 37.73  ? 453 PHE A CE2 1 
ATOM   3477 C CZ  . PHE A 1 456 ? 26.500  -21.462 17.915  1.00 36.30  ? 453 PHE A CZ  1 
ATOM   3478 N N   . ILE A 1 457 ? 23.253  -15.728 21.210  1.00 32.73  ? 454 ILE A N   1 
ATOM   3479 C CA  . ILE A 1 457 ? 23.008  -14.443 21.853  1.00 33.24  ? 454 ILE A CA  1 
ATOM   3480 C C   . ILE A 1 457 ? 22.710  -14.643 23.343  1.00 35.59  ? 454 ILE A C   1 
ATOM   3481 O O   . ILE A 1 457 ? 23.180  -13.885 24.190  1.00 37.59  ? 454 ILE A O   1 
ATOM   3482 C CB  . ILE A 1 457 ? 21.836  -13.693 21.185  1.00 31.90  ? 454 ILE A CB  1 
ATOM   3483 C CG1 . ILE A 1 457 ? 22.087  -13.527 19.678  1.00 35.78  ? 454 ILE A CG1 1 
ATOM   3484 C CG2 . ILE A 1 457 ? 21.622  -12.338 21.841  1.00 30.34  ? 454 ILE A CG2 1 
ATOM   3485 C CD1 . ILE A 1 457 ? 23.337  -12.758 19.352  1.00 35.76  ? 454 ILE A CD1 1 
ATOM   3486 N N   . PHE A 1 458 ? 21.945  -15.684 23.652  1.00 32.98  ? 455 PHE A N   1 
ATOM   3487 C CA  . PHE A 1 458 ? 21.544  -15.968 25.022  1.00 35.09  ? 455 PHE A CA  1 
ATOM   3488 C C   . PHE A 1 458 ? 22.621  -16.717 25.806  1.00 38.51  ? 455 PHE A C   1 
ATOM   3489 O O   . PHE A 1 458 ? 22.498  -16.903 27.014  1.00 34.55  ? 455 PHE A O   1 
ATOM   3490 C CB  . PHE A 1 458 ? 20.241  -16.765 25.035  1.00 34.07  ? 455 PHE A CB  1 
ATOM   3491 C CG  . PHE A 1 458 ? 19.006  -15.911 24.929  1.00 35.38  ? 455 PHE A CG  1 
ATOM   3492 C CD1 . PHE A 1 458 ? 18.547  -15.475 23.695  1.00 31.81  ? 455 PHE A CD1 1 
ATOM   3493 C CD2 . PHE A 1 458 ? 18.300  -15.553 26.065  1.00 31.41  ? 455 PHE A CD2 1 
ATOM   3494 C CE1 . PHE A 1 458 ? 17.408  -14.695 23.602  1.00 30.35  ? 455 PHE A CE1 1 
ATOM   3495 C CE2 . PHE A 1 458 ? 17.162  -14.773 25.980  1.00 30.60  ? 455 PHE A CE2 1 
ATOM   3496 C CZ  . PHE A 1 458 ? 16.715  -14.339 24.751  1.00 30.74  ? 455 PHE A CZ  1 
ATOM   3497 N N   . GLY A 1 459 ? 23.669  -17.155 25.116  1.00 36.41  ? 456 GLY A N   1 
ATOM   3498 C CA  . GLY A 1 459 ? 24.831  -17.720 25.779  1.00 34.49  ? 456 GLY A CA  1 
ATOM   3499 C C   . GLY A 1 459 ? 24.745  -19.184 26.167  1.00 37.87  ? 456 GLY A C   1 
ATOM   3500 O O   . GLY A 1 459 ? 25.512  -19.650 27.006  1.00 39.73  ? 456 GLY A O   1 
ATOM   3501 N N   . LEU A 1 460 ? 23.823  -19.916 25.551  1.00 33.42  ? 457 LEU A N   1 
ATOM   3502 C CA  . LEU A 1 460 ? 23.678  -21.345 25.817  1.00 36.81  ? 457 LEU A CA  1 
ATOM   3503 C C   . LEU A 1 460 ? 24.959  -22.190 25.657  1.00 43.49  ? 457 LEU A C   1 
ATOM   3504 O O   . LEU A 1 460 ? 25.133  -23.165 26.390  1.00 41.37  ? 457 LEU A O   1 
ATOM   3505 C CB  . LEU A 1 460 ? 22.577  -21.933 24.931  1.00 38.29  ? 457 LEU A CB  1 
ATOM   3506 C CG  . LEU A 1 460 ? 21.178  -21.967 25.553  1.00 39.58  ? 457 LEU A CG  1 
ATOM   3507 C CD1 . LEU A 1 460 ? 20.630  -20.563 25.768  1.00 36.23  ? 457 LEU A CD1 1 
ATOM   3508 C CD2 . LEU A 1 460 ? 20.227  -22.791 24.703  1.00 41.45  ? 457 LEU A CD2 1 
ATOM   3509 N N   . PRO A 1 461 ? 25.856  -21.839 24.706  1.00 39.98  ? 458 PRO A N   1 
ATOM   3510 C CA  . PRO A 1 461 ? 27.101  -22.620 24.640  1.00 42.43  ? 458 PRO A CA  1 
ATOM   3511 C C   . PRO A 1 461 ? 27.964  -22.587 25.907  1.00 45.16  ? 458 PRO A C   1 
ATOM   3512 O O   . PRO A 1 461 ? 28.911  -23.367 26.008  1.00 45.40  ? 458 PRO A O   1 
ATOM   3513 C CB  . PRO A 1 461 ? 27.852  -21.969 23.476  1.00 41.49  ? 458 PRO A CB  1 
ATOM   3514 C CG  . PRO A 1 461 ? 26.778  -21.484 22.585  1.00 41.11  ? 458 PRO A CG  1 
ATOM   3515 C CD  . PRO A 1 461 ? 25.701  -20.986 23.513  1.00 40.05  ? 458 PRO A CD  1 
ATOM   3516 N N   . LEU A 1 462 ? 27.644  -21.708 26.851  1.00 43.23  ? 459 LEU A N   1 
ATOM   3517 C CA  . LEU A 1 462 ? 28.392  -21.623 28.105  1.00 44.98  ? 459 LEU A CA  1 
ATOM   3518 C C   . LEU A 1 462 ? 28.015  -22.771 29.041  1.00 47.48  ? 459 LEU A C   1 
ATOM   3519 O O   . LEU A 1 462 ? 28.727  -23.064 30.004  1.00 46.72  ? 459 LEU A O   1 
ATOM   3520 C CB  . LEU A 1 462 ? 28.150  -20.272 28.787  1.00 40.74  ? 459 LEU A CB  1 
ATOM   3521 C CG  . LEU A 1 462 ? 29.006  -19.072 28.358  1.00 43.14  ? 459 LEU A CG  1 
ATOM   3522 C CD1 . LEU A 1 462 ? 29.040  -18.885 26.848  1.00 48.41  ? 459 LEU A CD1 1 
ATOM   3523 C CD2 . LEU A 1 462 ? 28.495  -17.807 29.016  1.00 43.23  ? 459 LEU A CD2 1 
ATOM   3524 N N   . ASP A 1 463 ? 26.886  -23.412 28.754  1.00 44.54  ? 460 ASP A N   1 
ATOM   3525 C CA  . ASP A 1 463 ? 26.477  -24.617 29.462  1.00 49.03  ? 460 ASP A CA  1 
ATOM   3526 C C   . ASP A 1 463 ? 27.189  -25.822 28.853  1.00 53.61  ? 460 ASP A C   1 
ATOM   3527 O O   . ASP A 1 463 ? 26.887  -26.215 27.728  1.00 50.85  ? 460 ASP A O   1 
ATOM   3528 C CB  . ASP A 1 463 ? 24.955  -24.794 29.390  1.00 49.69  ? 460 ASP A CB  1 
ATOM   3529 C CG  . ASP A 1 463 ? 24.456  -25.976 30.212  1.00 51.56  ? 460 ASP A CG  1 
ATOM   3530 O OD1 . ASP A 1 463 ? 25.286  -26.733 30.755  1.00 52.17  ? 460 ASP A OD1 1 
ATOM   3531 O OD2 . ASP A 1 463 ? 23.222  -26.157 30.300  1.00 52.63  ? 460 ASP A OD2 1 
ATOM   3532 N N   . PRO A 1 464 ? 28.128  -26.422 29.603  1.00 55.80  ? 461 PRO A N   1 
ATOM   3533 C CA  . PRO A 1 464 ? 28.943  -27.533 29.092  1.00 57.42  ? 461 PRO A CA  1 
ATOM   3534 C C   . PRO A 1 464 ? 28.124  -28.760 28.684  1.00 58.67  ? 461 PRO A C   1 
ATOM   3535 O O   . PRO A 1 464 ? 28.504  -29.466 27.745  1.00 57.20  ? 461 PRO A O   1 
ATOM   3536 C CB  . PRO A 1 464 ? 29.863  -27.864 30.273  1.00 58.27  ? 461 PRO A CB  1 
ATOM   3537 C CG  . PRO A 1 464 ? 29.150  -27.334 31.476  1.00 57.98  ? 461 PRO A CG  1 
ATOM   3538 C CD  . PRO A 1 464 ? 28.456  -26.096 31.001  1.00 52.83  ? 461 PRO A CD  1 
ATOM   3539 N N   . SER A 1 465 ? 27.006  -28.997 29.365  1.00 54.88  ? 462 SER A N   1 
ATOM   3540 C CA  . SER A 1 465 ? 26.180  -30.173 29.096  1.00 51.56  ? 462 SER A CA  1 
ATOM   3541 C C   . SER A 1 465 ? 25.518  -30.161 27.715  1.00 53.60  ? 462 SER A C   1 
ATOM   3542 O O   . SER A 1 465 ? 24.965  -31.173 27.284  1.00 54.89  ? 462 SER A O   1 
ATOM   3543 C CB  . SER A 1 465 ? 25.100  -30.311 30.171  1.00 51.03  ? 462 SER A CB  1 
ATOM   3544 O OG  . SER A 1 465 ? 24.094  -29.325 30.021  1.00 49.35  ? 462 SER A OG  1 
ATOM   3545 N N   . LEU A 1 466 ? 25.577  -29.028 27.021  1.00 52.43  ? 463 LEU A N   1 
ATOM   3546 C CA  . LEU A 1 466 ? 24.904  -28.890 25.727  1.00 53.18  ? 463 LEU A CA  1 
ATOM   3547 C C   . LEU A 1 466 ? 25.814  -29.243 24.536  1.00 52.72  ? 463 LEU A C   1 
ATOM   3548 O O   . LEU A 1 466 ? 25.389  -29.195 23.370  1.00 55.54  ? 463 LEU A O   1 
ATOM   3549 C CB  . LEU A 1 466 ? 24.369  -27.470 25.572  1.00 51.00  ? 463 LEU A CB  1 
ATOM   3550 C CG  . LEU A 1 466 ? 23.243  -27.086 26.531  1.00 52.41  ? 463 LEU A CG  1 
ATOM   3551 C CD1 . LEU A 1 466 ? 22.771  -25.659 26.273  1.00 49.61  ? 463 LEU A CD1 1 
ATOM   3552 C CD2 . LEU A 1 466 ? 22.079  -28.058 26.432  1.00 52.16  ? 463 LEU A CD2 1 
ATOM   3553 N N   . ASN A 1 467 ? 27.053  -29.622 24.843  1.00 50.86  ? 464 ASN A N   1 
ATOM   3554 C CA  . ASN A 1 467 ? 28.056  -30.032 23.846  1.00 53.65  ? 464 ASN A CA  1 
ATOM   3555 C C   . ASN A 1 467 ? 28.301  -29.062 22.687  1.00 49.51  ? 464 ASN A C   1 
ATOM   3556 O O   . ASN A 1 467 ? 28.316  -29.483 21.530  1.00 54.17  ? 464 ASN A O   1 
ATOM   3557 C CB  . ASN A 1 467 ? 27.707  -31.403 23.240  1.00 57.85  ? 464 ASN A CB  1 
ATOM   3558 C CG  . ASN A 1 467 ? 27.096  -32.352 24.245  1.00 62.71  ? 464 ASN A CG  1 
ATOM   3559 O OD1 . ASN A 1 467 ? 25.963  -32.798 24.069  1.00 68.87  ? 464 ASN A OD1 1 
ATOM   3560 N ND2 . ASN A 1 467 ? 27.828  -32.646 25.321  1.00 63.11  ? 464 ASN A ND2 1 
ATOM   3561 N N   . TYR A 1 468 ? 28.489  -27.782 22.989  1.00 48.09  ? 465 TYR A N   1 
ATOM   3562 C CA  . TYR A 1 468 ? 29.018  -26.861 21.999  1.00 47.17  ? 465 TYR A CA  1 
ATOM   3563 C C   . TYR A 1 468 ? 30.538  -26.939 22.055  1.00 49.27  ? 465 TYR A C   1 
ATOM   3564 O O   . TYR A 1 468 ? 31.092  -27.467 23.017  1.00 47.38  ? 465 TYR A O   1 
ATOM   3565 C CB  . TYR A 1 468 ? 28.550  -25.429 22.255  1.00 46.79  ? 465 TYR A CB  1 
ATOM   3566 C CG  . TYR A 1 468 ? 27.091  -25.162 21.964  1.00 46.84  ? 465 TYR A CG  1 
ATOM   3567 C CD1 . TYR A 1 468 ? 26.120  -25.369 22.936  1.00 42.16  ? 465 TYR A CD1 1 
ATOM   3568 C CD2 . TYR A 1 468 ? 26.687  -24.678 20.725  1.00 41.25  ? 465 TYR A CD2 1 
ATOM   3569 C CE1 . TYR A 1 468 ? 24.790  -25.110 22.685  1.00 43.23  ? 465 TYR A CE1 1 
ATOM   3570 C CE2 . TYR A 1 468 ? 25.352  -24.422 20.461  1.00 43.44  ? 465 TYR A CE2 1 
ATOM   3571 C CZ  . TYR A 1 468 ? 24.410  -24.638 21.444  1.00 44.79  ? 465 TYR A CZ  1 
ATOM   3572 O OH  . TYR A 1 468 ? 23.087  -24.380 21.171  1.00 46.08  ? 465 TYR A OH  1 
ATOM   3573 N N   . THR A 1 469 ? 31.217  -26.404 21.044  1.00 46.04  ? 466 THR A N   1 
ATOM   3574 C CA  . THR A 1 469 ? 32.676  -26.397 21.053  1.00 47.96  ? 466 THR A CA  1 
ATOM   3575 C C   . THR A 1 469 ? 33.203  -25.255 21.917  1.00 49.62  ? 466 THR A C   1 
ATOM   3576 O O   . THR A 1 469 ? 32.441  -24.390 22.346  1.00 49.63  ? 466 THR A O   1 
ATOM   3577 C CB  . THR A 1 469 ? 33.259  -26.271 19.633  1.00 46.78  ? 466 THR A CB  1 
ATOM   3578 O OG1 . THR A 1 469 ? 33.080  -24.934 19.151  1.00 49.22  ? 466 THR A OG1 1 
ATOM   3579 C CG2 . THR A 1 469 ? 32.580  -27.249 18.690  1.00 43.95  ? 466 THR A CG2 1 
ATOM   3580 N N   . THR A 1 470 ? 34.505  -25.262 22.175  1.00 52.32  ? 467 THR A N   1 
ATOM   3581 C CA  . THR A 1 470 ? 35.139  -24.206 22.956  1.00 50.85  ? 467 THR A CA  1 
ATOM   3582 C C   . THR A 1 470 ? 35.054  -22.876 22.213  1.00 50.31  ? 467 THR A C   1 
ATOM   3583 O O   . THR A 1 470 ? 34.721  -21.828 22.793  1.00 48.57  ? 467 THR A O   1 
ATOM   3584 C CB  . THR A 1 470 ? 36.610  -24.547 23.250  1.00 56.13  ? 467 THR A CB  1 
ATOM   3585 O OG1 . THR A 1 470 ? 36.671  -25.753 24.021  1.00 58.82  ? 467 THR A OG1 1 
ATOM   3586 C CG2 . THR A 1 470 ? 37.285  -23.421 24.020  1.00 53.35  ? 467 THR A CG2 1 
ATOM   3587 N N   . GLU A 1 471 ? 35.345  -22.936 20.915  1.00 49.97  ? 468 GLU A N   1 
ATOM   3588 C CA  . GLU A 1 471 ? 35.282  -21.766 20.049  1.00 50.18  ? 468 GLU A CA  1 
ATOM   3589 C C   . GLU A 1 471 ? 33.889  -21.155 20.070  1.00 46.01  ? 468 GLU A C   1 
ATOM   3590 O O   . GLU A 1 471 ? 33.734  -19.938 20.004  1.00 46.01  ? 468 GLU A O   1 
ATOM   3591 C CB  . GLU A 1 471 ? 35.668  -22.130 18.610  1.00 55.11  ? 468 GLU A CB  1 
ATOM   3592 C CG  . GLU A 1 471 ? 37.106  -22.595 18.433  1.00 62.48  ? 468 GLU A CG  1 
ATOM   3593 C CD  . GLU A 1 471 ? 37.294  -24.072 18.742  1.00 70.42  ? 468 GLU A CD  1 
ATOM   3594 O OE1 . GLU A 1 471 ? 36.318  -24.729 19.167  1.00 66.93  ? 468 GLU A OE1 1 
ATOM   3595 O OE2 . GLU A 1 471 ? 38.422  -24.577 18.555  1.00 80.85  ? 468 GLU A OE2 1 
ATOM   3596 N N   . GLU A 1 472 ? 32.876  -22.009 20.163  1.00 42.79  ? 469 GLU A N   1 
ATOM   3597 C CA  . GLU A 1 472 ? 31.498  -21.544 20.203  1.00 44.91  ? 469 GLU A CA  1 
ATOM   3598 C C   . GLU A 1 472 ? 31.171  -20.876 21.540  1.00 43.51  ? 469 GLU A C   1 
ATOM   3599 O O   . GLU A 1 472 ? 30.356  -19.954 21.594  1.00 41.36  ? 469 GLU A O   1 
ATOM   3600 C CB  . GLU A 1 472 ? 30.542  -22.704 19.919  1.00 41.34  ? 469 GLU A CB  1 
ATOM   3601 C CG  . GLU A 1 472 ? 30.510  -23.078 18.435  1.00 40.85  ? 469 GLU A CG  1 
ATOM   3602 C CD  . GLU A 1 472 ? 29.585  -24.236 18.124  1.00 42.63  ? 469 GLU A CD  1 
ATOM   3603 O OE1 . GLU A 1 472 ? 29.555  -25.212 18.905  1.00 38.74  ? 469 GLU A OE1 1 
ATOM   3604 O OE2 . GLU A 1 472 ? 28.888  -24.169 17.087  1.00 46.20  ? 469 GLU A OE2 1 
ATOM   3605 N N   . ARG A 1 473 ? 31.817  -21.331 22.610  1.00 40.39  ? 470 ARG A N   1 
ATOM   3606 C CA  . ARG A 1 473 ? 31.660  -20.696 23.919  1.00 44.32  ? 470 ARG A CA  1 
ATOM   3607 C C   . ARG A 1 473 ? 32.246  -19.283 23.876  1.00 45.14  ? 470 ARG A C   1 
ATOM   3608 O O   . ARG A 1 473 ? 31.593  -18.305 24.277  1.00 46.39  ? 470 ARG A O   1 
ATOM   3609 C CB  . ARG A 1 473 ? 32.324  -21.544 25.012  1.00 44.53  ? 470 ARG A CB  1 
ATOM   3610 C CG  . ARG A 1 473 ? 32.774  -20.761 26.239  1.00 55.07  ? 470 ARG A CG  1 
ATOM   3611 C CD  . ARG A 1 473 ? 33.373  -21.683 27.299  1.00 65.66  ? 470 ARG A CD  1 
ATOM   3612 N NE  . ARG A 1 473 ? 34.833  -21.657 27.260  1.00 71.85  ? 470 ARG A NE  1 
ATOM   3613 C CZ  . ARG A 1 473 ? 35.579  -20.698 27.798  1.00 76.64  ? 470 ARG A CZ  1 
ATOM   3614 N NH1 . ARG A 1 473 ? 35.006  -19.685 28.438  1.00 77.52  ? 470 ARG A NH1 1 
ATOM   3615 N NH2 . ARG A 1 473 ? 36.902  -20.756 27.702  1.00 76.46  ? 470 ARG A NH2 1 
ATOM   3616 N N   . ILE A 1 474 ? 33.470  -19.175 23.361  1.00 44.95  ? 471 ILE A N   1 
ATOM   3617 C CA  . ILE A 1 474 ? 34.100  -17.867 23.160  1.00 44.62  ? 471 ILE A CA  1 
ATOM   3618 C C   . ILE A 1 474 ? 33.236  -16.937 22.293  1.00 45.96  ? 471 ILE A C   1 
ATOM   3619 O O   . ILE A 1 474 ? 33.011  -15.764 22.631  1.00 44.55  ? 471 ILE A O   1 
ATOM   3620 C CB  . ILE A 1 474 ? 35.490  -18.016 22.504  1.00 46.44  ? 471 ILE A CB  1 
ATOM   3621 C CG1 . ILE A 1 474 ? 36.407  -18.875 23.379  1.00 51.88  ? 471 ILE A CG1 1 
ATOM   3622 C CG2 . ILE A 1 474 ? 36.111  -16.654 22.244  1.00 46.04  ? 471 ILE A CG2 1 
ATOM   3623 C CD1 . ILE A 1 474 ? 36.639  -18.303 24.753  1.00 55.87  ? 471 ILE A CD1 1 
ATOM   3624 N N   . PHE A 1 475 ? 32.758  -17.480 21.175  1.00 44.07  ? 472 PHE A N   1 
ATOM   3625 C CA  . PHE A 1 475 ? 31.891  -16.766 20.238  1.00 41.99  ? 472 PHE A CA  1 
ATOM   3626 C C   . PHE A 1 475 ? 30.644  -16.207 20.928  1.00 40.14  ? 472 PHE A C   1 
ATOM   3627 O O   . PHE A 1 475 ? 30.320  -15.014 20.810  1.00 37.38  ? 472 PHE A O   1 
ATOM   3628 C CB  . PHE A 1 475 ? 31.494  -17.709 19.099  1.00 41.84  ? 472 PHE A CB  1 
ATOM   3629 C CG  . PHE A 1 475 ? 30.649  -17.072 18.037  1.00 39.63  ? 472 PHE A CG  1 
ATOM   3630 C CD1 . PHE A 1 475 ? 31.007  -15.857 17.482  1.00 39.74  ? 472 PHE A CD1 1 
ATOM   3631 C CD2 . PHE A 1 475 ? 29.511  -17.709 17.570  1.00 39.66  ? 472 PHE A CD2 1 
ATOM   3632 C CE1 . PHE A 1 475 ? 30.233  -15.280 16.491  1.00 41.63  ? 472 PHE A CE1 1 
ATOM   3633 C CE2 . PHE A 1 475 ? 28.734  -17.135 16.578  1.00 37.50  ? 472 PHE A CE2 1 
ATOM   3634 C CZ  . PHE A 1 475 ? 29.096  -15.920 16.041  1.00 36.56  ? 472 PHE A CZ  1 
ATOM   3635 N N   . ALA A 1 476 ? 29.955  -17.085 21.651  1.00 41.73  ? 473 ALA A N   1 
ATOM   3636 C CA  . ALA A 1 476 ? 28.778  -16.710 22.422  1.00 43.24  ? 473 ALA A CA  1 
ATOM   3637 C C   . ALA A 1 476 ? 29.100  -15.573 23.381  1.00 41.19  ? 473 ALA A C   1 
ATOM   3638 O O   . ALA A 1 476 ? 28.346  -14.608 23.468  1.00 40.16  ? 473 ALA A O   1 
ATOM   3639 C CB  . ALA A 1 476 ? 28.234  -17.906 23.185  1.00 39.44  ? 473 ALA A CB  1 
ATOM   3640 N N   . GLN A 1 477 ? 30.224  -15.679 24.084  1.00 43.58  ? 474 GLN A N   1 
ATOM   3641 C CA  . GLN A 1 477 ? 30.622  -14.617 25.009  1.00 44.26  ? 474 GLN A CA  1 
ATOM   3642 C C   . GLN A 1 477 ? 30.784  -13.278 24.287  1.00 41.92  ? 474 GLN A C   1 
ATOM   3643 O O   . GLN A 1 477 ? 30.334  -12.231 24.782  1.00 40.32  ? 474 GLN A O   1 
ATOM   3644 C CB  . GLN A 1 477 ? 31.911  -15.000 25.739  1.00 45.76  ? 474 GLN A CB  1 
ATOM   3645 C CG  . GLN A 1 477 ? 31.713  -16.129 26.739  1.00 48.21  ? 474 GLN A CG  1 
ATOM   3646 C CD  . GLN A 1 477 ? 33.005  -16.566 27.407  1.00 57.68  ? 474 GLN A CD  1 
ATOM   3647 O OE1 . GLN A 1 477 ? 33.867  -17.185 26.780  1.00 61.91  ? 474 GLN A OE1 1 
ATOM   3648 N NE2 . GLN A 1 477 ? 33.143  -16.245 28.688  1.00 53.55  ? 474 GLN A NE2 1 
ATOM   3649 N N   . ARG A 1 478 ? 31.405  -13.323 23.108  1.00 43.43  ? 475 ARG A N   1 
ATOM   3650 C CA  . ARG A 1 478 ? 31.538  -12.139 22.255  1.00 40.98  ? 475 ARG A CA  1 
ATOM   3651 C C   . ARG A 1 478 ? 30.185  -11.505 21.920  1.00 39.63  ? 475 ARG A C   1 
ATOM   3652 O O   . ARG A 1 478 ? 30.005  -10.286 22.038  1.00 39.01  ? 475 ARG A O   1 
ATOM   3653 C CB  . ARG A 1 478 ? 32.252  -12.490 20.943  1.00 43.79  ? 475 ARG A CB  1 
ATOM   3654 C CG  . ARG A 1 478 ? 33.766  -12.593 21.006  1.00 44.14  ? 475 ARG A CG  1 
ATOM   3655 C CD  . ARG A 1 478 ? 34.329  -12.947 19.622  1.00 46.83  ? 475 ARG A CD  1 
ATOM   3656 N NE  . ARG A 1 478 ? 33.909  -11.986 18.603  1.00 41.71  ? 475 ARG A NE  1 
ATOM   3657 C CZ  . ARG A 1 478 ? 33.700  -12.282 17.321  1.00 44.83  ? 475 ARG A CZ  1 
ATOM   3658 N NH1 . ARG A 1 478 ? 33.874  -13.521 16.880  1.00 43.55  ? 475 ARG A NH1 1 
ATOM   3659 N NH2 . ARG A 1 478 ? 33.314  -11.336 16.478  1.00 41.95  ? 475 ARG A NH2 1 
ATOM   3660 N N   . LEU A 1 479 ? 29.243  -12.333 21.477  1.00 40.16  ? 476 LEU A N   1 
ATOM   3661 C CA  . LEU A 1 479 ? 27.932  -11.824 21.078  1.00 38.82  ? 476 LEU A CA  1 
ATOM   3662 C C   . LEU A 1 479 ? 27.156  -11.251 22.268  1.00 37.14  ? 476 LEU A C   1 
ATOM   3663 O O   . LEU A 1 479 ? 26.559  -10.175 22.172  1.00 37.55  ? 476 LEU A O   1 
ATOM   3664 C CB  . LEU A 1 479 ? 27.120  -12.922 20.395  1.00 34.70  ? 476 LEU A CB  1 
ATOM   3665 C CG  . LEU A 1 479 ? 27.713  -13.423 19.074  1.00 38.08  ? 476 LEU A CG  1 
ATOM   3666 C CD1 . LEU A 1 479 ? 26.738  -14.341 18.371  1.00 39.55  ? 476 LEU A CD1 1 
ATOM   3667 C CD2 . LEU A 1 479 ? 28.074  -12.257 18.186  1.00 34.35  ? 476 LEU A CD2 1 
ATOM   3668 N N   . MET A 1 480 ? 27.165  -11.973 23.383  1.00 37.20  ? 477 MET A N   1 
ATOM   3669 C CA  . MET A 1 480 ? 26.569  -11.473 24.619  1.00 38.69  ? 477 MET A CA  1 
ATOM   3670 C C   . MET A 1 480 ? 27.123  -10.091 24.942  1.00 38.77  ? 477 MET A C   1 
ATOM   3671 O O   . MET A 1 480 ? 26.371  -9.173  25.305  1.00 37.34  ? 477 MET A O   1 
ATOM   3672 C CB  . MET A 1 480 ? 26.832  -12.438 25.769  1.00 36.75  ? 477 MET A CB  1 
ATOM   3673 C CG  . MET A 1 480 ? 26.209  -13.805 25.568  1.00 38.56  ? 477 MET A CG  1 
ATOM   3674 S SD  . MET A 1 480 ? 26.729  -14.978 26.828  1.00 47.07  ? 477 MET A SD  1 
ATOM   3675 C CE  . MET A 1 480 ? 26.065  -14.187 28.284  1.00 37.88  ? 477 MET A CE  1 
ATOM   3676 N N   . LYS A 1 481 ? 28.434  -9.934  24.763  1.00 39.33  ? 478 LYS A N   1 
ATOM   3677 C CA  . LYS A 1 481 ? 29.063  -8.639  25.006  1.00 38.68  ? 478 LYS A CA  1 
ATOM   3678 C C   . LYS A 1 481 ? 28.561  -7.563  24.043  1.00 41.61  ? 478 LYS A C   1 
ATOM   3679 O O   . LYS A 1 481 ? 28.274  -6.449  24.476  1.00 39.02  ? 478 LYS A O   1 
ATOM   3680 C CB  . LYS A 1 481 ? 30.584  -8.746  24.916  1.00 45.22  ? 478 LYS A CB  1 
ATOM   3681 C CG  . LYS A 1 481 ? 31.310  -8.102  26.091  1.00 48.88  ? 478 LYS A CG  1 
ATOM   3682 C CD  . LYS A 1 481 ? 31.384  -9.055  27.277  1.00 57.00  ? 478 LYS A CD  1 
ATOM   3683 C CE  . LYS A 1 481 ? 31.935  -8.371  28.530  1.00 56.98  ? 478 LYS A CE  1 
ATOM   3684 N NZ  . LYS A 1 481 ? 31.159  -7.156  28.926  1.00 60.54  ? 478 LYS A NZ  1 
ATOM   3685 N N   . TYR A 1 482 ? 28.456  -7.883  22.750  1.00 37.49  ? 479 TYR A N   1 
ATOM   3686 C CA  . TYR A 1 482 ? 27.907  -6.926  21.781  1.00 37.19  ? 479 TYR A CA  1 
ATOM   3687 C C   . TYR A 1 482 ? 26.512  -6.455  22.183  1.00 35.79  ? 479 TYR A C   1 
ATOM   3688 O O   . TYR A 1 482 ? 26.228  -5.253  22.213  1.00 37.04  ? 479 TYR A O   1 
ATOM   3689 C CB  . TYR A 1 482 ? 27.833  -7.532  20.371  1.00 37.65  ? 479 TYR A CB  1 
ATOM   3690 C CG  . TYR A 1 482 ? 29.167  -7.799  19.713  1.00 37.85  ? 479 TYR A CG  1 
ATOM   3691 C CD1 . TYR A 1 482 ? 30.223  -6.905  19.840  1.00 37.88  ? 479 TYR A CD1 1 
ATOM   3692 C CD2 . TYR A 1 482 ? 29.369  -8.952  18.964  1.00 38.67  ? 479 TYR A CD2 1 
ATOM   3693 C CE1 . TYR A 1 482 ? 31.446  -7.155  19.236  1.00 43.61  ? 479 TYR A CE1 1 
ATOM   3694 C CE2 . TYR A 1 482 ? 30.584  -9.209  18.354  1.00 39.85  ? 479 TYR A CE2 1 
ATOM   3695 C CZ  . TYR A 1 482 ? 31.619  -8.310  18.493  1.00 45.62  ? 479 TYR A CZ  1 
ATOM   3696 O OH  . TYR A 1 482 ? 32.828  -8.572  17.890  1.00 46.17  ? 479 TYR A OH  1 
ATOM   3697 N N   . TRP A 1 483 ? 25.646  -7.420  22.482  1.00 34.39  ? 480 TRP A N   1 
ATOM   3698 C CA  . TRP A 1 483 ? 24.245  -7.134  22.763  1.00 35.51  ? 480 TRP A CA  1 
ATOM   3699 C C   . TRP A 1 483 ? 24.073  -6.313  24.043  1.00 35.39  ? 480 TRP A C   1 
ATOM   3700 O O   . TRP A 1 483 ? 23.338  -5.319  24.053  1.00 34.80  ? 480 TRP A O   1 
ATOM   3701 C CB  . TRP A 1 483 ? 23.450  -8.440  22.852  1.00 34.16  ? 480 TRP A CB  1 
ATOM   3702 C CG  . TRP A 1 483 ? 22.656  -8.763  21.606  1.00 37.34  ? 480 TRP A CG  1 
ATOM   3703 C CD1 . TRP A 1 483 ? 21.302  -8.906  21.514  1.00 35.07  ? 480 TRP A CD1 1 
ATOM   3704 C CD2 . TRP A 1 483 ? 23.171  -8.971  20.280  1.00 32.44  ? 480 TRP A CD2 1 
ATOM   3705 N NE1 . TRP A 1 483 ? 20.942  -9.200  20.217  1.00 32.14  ? 480 TRP A NE1 1 
ATOM   3706 C CE2 . TRP A 1 483 ? 22.070  -9.245  19.441  1.00 33.12  ? 480 TRP A CE2 1 
ATOM   3707 C CE3 . TRP A 1 483 ? 24.455  -8.954  19.723  1.00 34.32  ? 480 TRP A CE3 1 
ATOM   3708 C CZ2 . TRP A 1 483 ? 22.210  -9.496  18.069  1.00 33.73  ? 480 TRP A CZ2 1 
ATOM   3709 C CZ3 . TRP A 1 483 ? 24.594  -9.207  18.359  1.00 36.96  ? 480 TRP A CZ3 1 
ATOM   3710 C CH2 . TRP A 1 483 ? 23.476  -9.473  17.551  1.00 33.21  ? 480 TRP A CH2 1 
ATOM   3711 N N   . THR A 1 484 ? 24.760  -6.710  25.112  1.00 33.56  ? 481 THR A N   1 
ATOM   3712 C CA  . THR A 1 484 ? 24.628  -5.981  26.376  1.00 36.40  ? 481 THR A CA  1 
ATOM   3713 C C   . THR A 1 484 ? 25.314  -4.615  26.306  1.00 34.79  ? 481 THR A C   1 
ATOM   3714 O O   . THR A 1 484 ? 24.837  -3.651  26.909  1.00 38.52  ? 481 THR A O   1 
ATOM   3715 C CB  . THR A 1 484 ? 25.181  -6.792  27.572  1.00 33.75  ? 481 THR A CB  1 
ATOM   3716 O OG1 . THR A 1 484 ? 26.521  -7.222  27.305  1.00 36.06  ? 481 THR A OG1 1 
ATOM   3717 C CG2 . THR A 1 484 ? 24.308  -8.011  27.821  1.00 34.02  ? 481 THR A CG2 1 
ATOM   3718 N N   . ASN A 1 485 ? 26.414  -4.522  25.558  1.00 38.81  ? 482 ASN A N   1 
ATOM   3719 C CA  . ASN A 1 485 ? 27.046  -3.227  25.299  1.00 39.83  ? 482 ASN A CA  1 
ATOM   3720 C C   . ASN A 1 485 ? 26.075  -2.286  24.613  1.00 40.59  ? 482 ASN A C   1 
ATOM   3721 O O   . ASN A 1 485 ? 25.983  -1.108  24.967  1.00 38.50  ? 482 ASN A O   1 
ATOM   3722 C CB  . ASN A 1 485 ? 28.303  -3.366  24.432  1.00 40.50  ? 482 ASN A CB  1 
ATOM   3723 C CG  . ASN A 1 485 ? 29.522  -3.808  25.222  1.00 45.09  ? 482 ASN A CG  1 
ATOM   3724 O OD1 . ASN A 1 485 ? 29.485  -3.902  26.447  1.00 39.65  ? 482 ASN A OD1 1 
ATOM   3725 N ND2 . ASN A 1 485 ? 30.616  -4.073  24.516  1.00 48.76  ? 482 ASN A ND2 1 
ATOM   3726 N N   . PHE A 1 486 ? 25.356  -2.807  23.622  1.00 37.79  ? 483 PHE A N   1 
ATOM   3727 C CA  . PHE A 1 486 ? 24.378  -1.992  22.913  1.00 38.53  ? 483 PHE A CA  1 
ATOM   3728 C C   . PHE A 1 486 ? 23.237  -1.576  23.844  1.00 36.12  ? 483 PHE A C   1 
ATOM   3729 O O   . PHE A 1 486 ? 22.820  -0.417  23.849  1.00 38.95  ? 483 PHE A O   1 
ATOM   3730 C CB  . PHE A 1 486 ? 23.825  -2.736  21.693  1.00 35.86  ? 483 PHE A CB  1 
ATOM   3731 C CG  . PHE A 1 486 ? 22.754  -1.980  20.969  1.00 35.72  ? 483 PHE A CG  1 
ATOM   3732 C CD1 . PHE A 1 486 ? 23.084  -0.945  20.110  1.00 33.00  ? 483 PHE A CD1 1 
ATOM   3733 C CD2 . PHE A 1 486 ? 21.418  -2.291  21.160  1.00 35.26  ? 483 PHE A CD2 1 
ATOM   3734 C CE1 . PHE A 1 486 ? 22.103  -0.238  19.448  1.00 34.84  ? 483 PHE A CE1 1 
ATOM   3735 C CE2 . PHE A 1 486 ? 20.432  -1.590  20.501  1.00 36.04  ? 483 PHE A CE2 1 
ATOM   3736 C CZ  . PHE A 1 486 ? 20.773  -0.561  19.641  1.00 34.87  ? 483 PHE A CZ  1 
ATOM   3737 N N   . ALA A 1 487 ? 22.736  -2.525  24.629  1.00 34.01  ? 484 ALA A N   1 
ATOM   3738 C CA  . ALA A 1 487 ? 21.694  -2.233  25.608  1.00 39.80  ? 484 ALA A CA  1 
ATOM   3739 C C   . ALA A 1 487 ? 22.118  -1.103  26.550  1.00 38.52  ? 484 ALA A C   1 
ATOM   3740 O O   . ALA A 1 487 ? 21.338  -0.197  26.843  1.00 37.55  ? 484 ALA A O   1 
ATOM   3741 C CB  . ALA A 1 487 ? 21.351  -3.482  26.406  1.00 36.13  ? 484 ALA A CB  1 
ATOM   3742 N N   . ARG A 1 488 ? 23.368  -1.149  26.992  1.00 36.80  ? 485 ARG A N   1 
ATOM   3743 C CA  . ARG A 1 488 ? 23.871  -0.197  27.978  1.00 40.60  ? 485 ARG A CA  1 
ATOM   3744 C C   . ARG A 1 488 ? 24.172  1.177   27.387  1.00 42.88  ? 485 ARG A C   1 
ATOM   3745 O O   . ARG A 1 488 ? 23.918  2.198   28.026  1.00 40.05  ? 485 ARG A O   1 
ATOM   3746 C CB  . ARG A 1 488 ? 25.130  -0.758  28.639  1.00 42.57  ? 485 ARG A CB  1 
ATOM   3747 C CG  . ARG A 1 488 ? 25.650  0.059   29.807  1.00 51.45  ? 485 ARG A CG  1 
ATOM   3748 C CD  . ARG A 1 488 ? 26.890  -0.584  30.410  1.00 56.32  ? 485 ARG A CD  1 
ATOM   3749 N NE  . ARG A 1 488 ? 26.640  -1.955  30.857  1.00 63.17  ? 485 ARG A NE  1 
ATOM   3750 C CZ  . ARG A 1 488 ? 27.038  -3.041  30.199  1.00 57.37  ? 485 ARG A CZ  1 
ATOM   3751 N NH1 . ARG A 1 488 ? 27.708  -2.917  29.061  1.00 53.13  ? 485 ARG A NH1 1 
ATOM   3752 N NH2 . ARG A 1 488 ? 26.766  -4.249  30.679  1.00 55.37  ? 485 ARG A NH2 1 
ATOM   3753 N N   . THR A 1 489 ? 24.708  1.202   26.169  1.00 39.89  ? 486 THR A N   1 
ATOM   3754 C CA  . THR A 1 489 ? 25.255  2.436   25.611  1.00 39.01  ? 486 THR A CA  1 
ATOM   3755 C C   . THR A 1 489 ? 24.703  2.847   24.249  1.00 40.77  ? 486 THR A C   1 
ATOM   3756 O O   . THR A 1 489 ? 24.910  3.979   23.820  1.00 45.44  ? 486 THR A O   1 
ATOM   3757 C CB  . THR A 1 489 ? 26.789  2.344   25.465  1.00 42.46  ? 486 THR A CB  1 
ATOM   3758 O OG1 . THR A 1 489 ? 27.121  1.371   24.466  1.00 41.05  ? 486 THR A OG1 1 
ATOM   3759 C CG2 . THR A 1 489 ? 27.440  1.958   26.785  1.00 41.53  ? 486 THR A CG2 1 
ATOM   3760 N N   . GLY A 1 490 ? 24.016  1.939   23.560  1.00 41.28  ? 487 GLY A N   1 
ATOM   3761 C CA  . GLY A 1 490 ? 23.555  2.227   22.210  1.00 39.17  ? 487 GLY A CA  1 
ATOM   3762 C C   . GLY A 1 490 ? 24.681  2.043   21.214  1.00 39.77  ? 487 GLY A C   1 
ATOM   3763 O O   . GLY A 1 490 ? 24.618  2.504   20.072  1.00 43.43  ? 487 GLY A O   1 
ATOM   3764 N N   . ASP A 1 491 ? 25.716  1.349   21.667  1.00 40.69  ? 488 ASP A N   1 
ATOM   3765 C CA  . ASP A 1 491 ? 26.914  1.096   20.883  1.00 41.80  ? 488 ASP A CA  1 
ATOM   3766 C C   . ASP A 1 491 ? 27.428  -0.288  21.271  1.00 41.83  ? 488 ASP A C   1 
ATOM   3767 O O   . ASP A 1 491 ? 27.767  -0.517  22.430  1.00 41.16  ? 488 ASP A O   1 
ATOM   3768 C CB  . ASP A 1 491 ? 27.960  2.182   21.151  1.00 43.35  ? 488 ASP A CB  1 
ATOM   3769 C CG  . ASP A 1 491 ? 29.178  2.080   20.250  1.00 44.68  ? 488 ASP A CG  1 
ATOM   3770 O OD1 . ASP A 1 491 ? 29.489  0.981   19.745  1.00 48.09  ? 488 ASP A OD1 1 
ATOM   3771 O OD2 . ASP A 1 491 ? 29.843  3.119   20.057  1.00 48.80  ? 488 ASP A OD2 1 
ATOM   3772 N N   . PRO A 1 492 ? 27.473  -1.222  20.307  1.00 39.44  ? 489 PRO A N   1 
ATOM   3773 C CA  . PRO A 1 492 ? 27.908  -2.592  20.605  1.00 37.34  ? 489 PRO A CA  1 
ATOM   3774 C C   . PRO A 1 492 ? 29.410  -2.703  20.864  1.00 39.36  ? 489 PRO A C   1 
ATOM   3775 O O   . PRO A 1 492 ? 29.869  -3.736  21.351  1.00 40.75  ? 489 PRO A O   1 
ATOM   3776 C CB  . PRO A 1 492 ? 27.520  -3.363  19.339  1.00 38.80  ? 489 PRO A CB  1 
ATOM   3777 C CG  . PRO A 1 492 ? 27.601  -2.336  18.255  1.00 37.21  ? 489 PRO A CG  1 
ATOM   3778 C CD  . PRO A 1 492 ? 27.128  -1.051  18.882  1.00 39.46  ? 489 PRO A CD  1 
ATOM   3779 N N   . ASN A 1 493 ? 30.163  -1.655  20.544  1.00 40.14  ? 490 ASN A N   1 
ATOM   3780 C CA  . ASN A 1 493 ? 31.611  -1.684  20.724  1.00 47.13  ? 490 ASN A CA  1 
ATOM   3781 C C   . ASN A 1 493 ? 32.027  -1.508  22.174  1.00 54.31  ? 490 ASN A C   1 
ATOM   3782 O O   . ASN A 1 493 ? 31.392  -0.771  22.925  1.00 52.55  ? 490 ASN A O   1 
ATOM   3783 C CB  . ASN A 1 493 ? 32.281  -0.604  19.876  1.00 45.10  ? 490 ASN A CB  1 
ATOM   3784 C CG  . ASN A 1 493 ? 32.124  -0.852  18.395  1.00 44.30  ? 490 ASN A CG  1 
ATOM   3785 O OD1 . ASN A 1 493 ? 32.764  -1.739  17.836  1.00 43.94  ? 490 ASN A OD1 1 
ATOM   3786 N ND2 . ASN A 1 493 ? 31.272  -0.068  17.751  1.00 40.65  ? 490 ASN A ND2 1 
ATOM   3787 N N   . ASP A 1 494 ? 33.102  -2.189  22.555  1.00 63.86  ? 491 ASP A N   1 
ATOM   3788 C CA  . ASP A 1 494 ? 33.696  -2.017  23.874  1.00 77.62  ? 491 ASP A CA  1 
ATOM   3789 C C   . ASP A 1 494 ? 34.593  -0.784  23.864  1.00 85.04  ? 491 ASP A C   1 
ATOM   3790 O O   . ASP A 1 494 ? 35.553  -0.719  23.095  1.00 83.87  ? 491 ASP A O   1 
ATOM   3791 C CB  . ASP A 1 494 ? 34.494  -3.263  24.276  1.00 83.20  ? 491 ASP A CB  1 
ATOM   3792 C CG  . ASP A 1 494 ? 34.770  -3.331  25.772  1.00 92.25  ? 491 ASP A CG  1 
ATOM   3793 O OD1 . ASP A 1 494 ? 34.923  -2.268  26.409  1.00 96.04  ? 491 ASP A OD1 1 
ATOM   3794 O OD2 . ASP A 1 494 ? 34.836  -4.455  26.313  1.00 91.90  ? 491 ASP A OD2 1 
ATOM   3795 N N   . PRO A 1 495 ? 34.279  0.205   24.715  1.00 90.35  ? 492 PRO A N   1 
ATOM   3796 C CA  . PRO A 1 495 ? 35.068  1.440   24.809  1.00 92.17  ? 492 PRO A CA  1 
ATOM   3797 C C   . PRO A 1 495 ? 36.484  1.203   25.328  1.00 97.77  ? 492 PRO A C   1 
ATOM   3798 O O   . PRO A 1 495 ? 37.334  2.088   25.220  1.00 98.33  ? 492 PRO A O   1 
ATOM   3799 C CB  . PRO A 1 495 ? 34.270  2.292   25.802  1.00 91.49  ? 492 PRO A CB  1 
ATOM   3800 C CG  . PRO A 1 495 ? 33.472  1.307   26.591  1.00 90.52  ? 492 PRO A CG  1 
ATOM   3801 C CD  . PRO A 1 495 ? 33.122  0.219   25.627  1.00 87.26  ? 492 PRO A CD  1 
ATOM   3802 N N   . ARG A 1 496 ? 36.721  0.025   25.898  1.00 98.91  ? 493 ARG A N   1 
ATOM   3803 C CA  . ARG A 1 496 ? 38.010  -0.301  26.496  1.00 104.29 ? 493 ARG A CA  1 
ATOM   3804 C C   . ARG A 1 496 ? 38.842  -1.178  25.573  1.00 106.19 ? 493 ARG A C   1 
ATOM   3805 O O   . ARG A 1 496 ? 40.036  -1.378  25.801  1.00 109.82 ? 493 ARG A O   1 
ATOM   3806 C CB  . ARG A 1 496 ? 37.812  -1.004  27.841  1.00 109.15 ? 493 ARG A CB  1 
ATOM   3807 C CG  . ARG A 1 496 ? 37.778  -2.517  27.747  1.00 113.00 ? 493 ARG A CG  1 
ATOM   3808 C CD  . ARG A 1 496 ? 37.205  -3.148  28.996  1.00 121.99 ? 493 ARG A CD  1 
ATOM   3809 N NE  . ARG A 1 496 ? 38.245  -3.615  29.906  1.00 129.70 ? 493 ARG A NE  1 
ATOM   3810 C CZ  . ARG A 1 496 ? 38.835  -4.801  29.814  1.00 129.05 ? 493 ARG A CZ  1 
ATOM   3811 N NH1 . ARG A 1 496 ? 38.485  -5.640  28.848  1.00 126.05 ? 493 ARG A NH1 1 
ATOM   3812 N NH2 . ARG A 1 496 ? 39.771  -5.149  30.688  1.00 127.69 ? 493 ARG A NH2 1 
ATOM   3813 N N   . ASP A 1 497 ? 38.213  -1.690  24.522  1.00 104.25 ? 494 ASP A N   1 
ATOM   3814 C CA  . ASP A 1 497 ? 38.871  -2.667  23.663  1.00 103.28 ? 494 ASP A CA  1 
ATOM   3815 C C   . ASP A 1 497 ? 39.172  -2.104  22.279  1.00 103.48 ? 494 ASP A C   1 
ATOM   3816 O O   . ASP A 1 497 ? 38.520  -2.463  21.301  1.00 101.49 ? 494 ASP A O   1 
ATOM   3817 C CB  . ASP A 1 497 ? 38.000  -3.918  23.535  1.00 101.60 ? 494 ASP A CB  1 
ATOM   3818 C CG  . ASP A 1 497 ? 38.795  -5.152  23.172  1.00 103.77 ? 494 ASP A CG  1 
ATOM   3819 O OD1 . ASP A 1 497 ? 40.014  -5.163  23.408  1.00 103.53 ? 494 ASP A OD1 1 
ATOM   3820 O OD2 . ASP A 1 497 ? 38.200  -6.116  22.651  1.00 105.41 ? 494 ASP A OD2 1 
ATOM   3821 N N   . SER A 1 498 ? 40.169  -1.232  22.194  1.00 104.82 ? 495 SER A N   1 
ATOM   3822 C CA  . SER A 1 498 ? 40.525  -0.628  20.917  1.00 104.85 ? 495 SER A CA  1 
ATOM   3823 C C   . SER A 1 498 ? 41.303  -1.587  20.007  1.00 102.50 ? 495 SER A C   1 
ATOM   3824 O O   . SER A 1 498 ? 41.488  -1.309  18.827  1.00 100.14 ? 495 SER A O   1 
ATOM   3825 C CB  . SER A 1 498 ? 41.337  0.645   21.142  1.00 106.20 ? 495 SER A CB  1 
ATOM   3826 O OG  . SER A 1 498 ? 41.706  1.228   19.904  1.00 108.75 ? 495 SER A OG  1 
ATOM   3827 N N   . LYS A 1 499 ? 41.764  -2.710  20.550  1.00 103.27 ? 496 LYS A N   1 
ATOM   3828 C CA  . LYS A 1 499 ? 42.447  -3.707  19.727  1.00 101.96 ? 496 LYS A CA  1 
ATOM   3829 C C   . LYS A 1 499 ? 41.476  -4.389  18.760  1.00 99.96  ? 496 LYS A C   1 
ATOM   3830 O O   . LYS A 1 499 ? 41.733  -4.408  17.549  1.00 97.68  ? 496 LYS A O   1 
ATOM   3831 C CB  . LYS A 1 499 ? 43.182  -4.749  20.597  1.00 102.93 ? 496 LYS A CB  1 
ATOM   3832 C CG  . LYS A 1 499 ? 42.739  -4.844  22.045  1.00 102.26 ? 496 LYS A CG  1 
ATOM   3833 C CD  . LYS A 1 499 ? 42.913  -6.267  22.615  1.00 99.86  ? 496 LYS A CD  1 
ATOM   3834 C CE  . LYS A 1 499 ? 44.287  -6.858  22.307  1.00 97.46  ? 496 LYS A CE  1 
ATOM   3835 N NZ  . LYS A 1 499 ? 44.540  -8.102  23.099  1.00 93.09  ? 496 LYS A NZ  1 
ATOM   3836 N N   . SER A 1 500 ? 40.382  -4.945  19.286  1.00 97.79  ? 497 SER A N   1 
ATOM   3837 C CA  . SER A 1 500 ? 39.363  -5.569  18.447  1.00 90.59  ? 497 SER A CA  1 
ATOM   3838 C C   . SER A 1 500 ? 38.861  -4.616  17.367  1.00 83.85  ? 497 SER A C   1 
ATOM   3839 O O   . SER A 1 500 ? 38.780  -3.408  17.592  1.00 85.47  ? 497 SER A O   1 
ATOM   3840 C CB  . SER A 1 500 ? 38.185  -6.051  19.294  1.00 90.99  ? 497 SER A CB  1 
ATOM   3841 O OG  . SER A 1 500 ? 38.613  -6.637  20.511  1.00 92.01  ? 497 SER A OG  1 
ATOM   3842 N N   . PRO A 1 501 ? 38.544  -5.157  16.180  1.00 78.75  ? 498 PRO A N   1 
ATOM   3843 C CA  . PRO A 1 501 ? 37.996  -4.323  15.106  1.00 74.84  ? 498 PRO A CA  1 
ATOM   3844 C C   . PRO A 1 501 ? 36.691  -3.673  15.546  1.00 66.54  ? 498 PRO A C   1 
ATOM   3845 O O   . PRO A 1 501 ? 35.939  -4.271  16.316  1.00 66.04  ? 498 PRO A O   1 
ATOM   3846 C CB  . PRO A 1 501 ? 37.762  -5.318  13.961  1.00 69.06  ? 498 PRO A CB  1 
ATOM   3847 C CG  . PRO A 1 501 ? 38.655  -6.478  14.268  1.00 73.36  ? 498 PRO A CG  1 
ATOM   3848 C CD  . PRO A 1 501 ? 38.700  -6.562  15.764  1.00 76.35  ? 498 PRO A CD  1 
ATOM   3849 N N   . GLN A 1 502 ? 36.434  -2.459  15.077  1.00 61.30  ? 499 GLN A N   1 
ATOM   3850 C CA  . GLN A 1 502 ? 35.235  -1.739  15.481  1.00 57.92  ? 499 GLN A CA  1 
ATOM   3851 C C   . GLN A 1 502 ? 34.038  -2.103  14.610  1.00 55.41  ? 499 GLN A C   1 
ATOM   3852 O O   . GLN A 1 502 ? 34.185  -2.566  13.477  1.00 52.80  ? 499 GLN A O   1 
ATOM   3853 C CB  . GLN A 1 502 ? 35.475  -0.228  15.440  1.00 57.29  ? 499 GLN A CB  1 
ATOM   3854 C CG  . GLN A 1 502 ? 36.485  0.263   16.467  1.00 59.94  ? 499 GLN A CG  1 
ATOM   3855 C CD  . GLN A 1 502 ? 36.056  -0.036  17.890  1.00 62.97  ? 499 GLN A CD  1 
ATOM   3856 O OE1 . GLN A 1 502 ? 35.202  0.652   18.452  1.00 60.12  ? 499 GLN A OE1 1 
ATOM   3857 N NE2 . GLN A 1 502 ? 36.644  -1.071  18.479  1.00 67.55  ? 499 GLN A NE2 1 
ATOM   3858 N N   . TRP A 1 503 ? 32.852  -1.890  15.165  1.00 50.35  ? 500 TRP A N   1 
ATOM   3859 C CA  . TRP A 1 503 ? 31.600  -2.122  14.464  1.00 46.86  ? 500 TRP A CA  1 
ATOM   3860 C C   . TRP A 1 503 ? 31.029  -0.766  14.066  1.00 45.94  ? 500 TRP A C   1 
ATOM   3861 O O   . TRP A 1 503 ? 30.418  -0.081  14.889  1.00 44.90  ? 500 TRP A O   1 
ATOM   3862 C CB  . TRP A 1 503 ? 30.636  -2.905  15.362  1.00 45.63  ? 500 TRP A CB  1 
ATOM   3863 C CG  . TRP A 1 503 ? 29.338  -3.346  14.740  1.00 41.08  ? 500 TRP A CG  1 
ATOM   3864 C CD1 . TRP A 1 503 ? 28.737  -2.845  13.621  1.00 40.31  ? 500 TRP A CD1 1 
ATOM   3865 C CD2 . TRP A 1 503 ? 28.482  -4.388  15.222  1.00 39.43  ? 500 TRP A CD2 1 
ATOM   3866 N NE1 . TRP A 1 503 ? 27.559  -3.510  13.379  1.00 38.34  ? 500 TRP A NE1 1 
ATOM   3867 C CE2 . TRP A 1 503 ? 27.380  -4.461  14.349  1.00 39.25  ? 500 TRP A CE2 1 
ATOM   3868 C CE3 . TRP A 1 503 ? 28.540  -5.265  16.313  1.00 39.02  ? 500 TRP A CE3 1 
ATOM   3869 C CZ2 . TRP A 1 503 ? 26.346  -5.377  14.530  1.00 37.99  ? 500 TRP A CZ2 1 
ATOM   3870 C CZ3 . TRP A 1 503 ? 27.516  -6.174  16.489  1.00 37.94  ? 500 TRP A CZ3 1 
ATOM   3871 C CH2 . TRP A 1 503 ? 26.434  -6.227  15.601  1.00 35.22  ? 500 TRP A CH2 1 
ATOM   3872 N N   . PRO A 1 504 ? 31.244  -0.363  12.803  1.00 44.60  ? 501 PRO A N   1 
ATOM   3873 C CA  . PRO A 1 504 ? 30.793  0.957   12.362  1.00 43.01  ? 501 PRO A CA  1 
ATOM   3874 C C   . PRO A 1 504 ? 29.282  1.013   12.216  1.00 39.47  ? 501 PRO A C   1 
ATOM   3875 O O   . PRO A 1 504 ? 28.661  -0.014  11.959  1.00 43.91  ? 501 PRO A O   1 
ATOM   3876 C CB  . PRO A 1 504 ? 31.481  1.125   11.006  1.00 45.01  ? 501 PRO A CB  1 
ATOM   3877 C CG  . PRO A 1 504 ? 31.625  -0.265  10.499  1.00 41.95  ? 501 PRO A CG  1 
ATOM   3878 C CD  . PRO A 1 504 ? 31.877  -1.123  11.708  1.00 41.42  ? 501 PRO A CD  1 
ATOM   3879 N N   . PRO A 1 505 ? 28.691  2.197   12.409  1.00 39.72  ? 502 PRO A N   1 
ATOM   3880 C CA  . PRO A 1 505 ? 27.262  2.368   12.147  1.00 38.58  ? 502 PRO A CA  1 
ATOM   3881 C C   . PRO A 1 505 ? 26.909  2.115   10.690  1.00 46.03  ? 502 PRO A C   1 
ATOM   3882 O O   . PRO A 1 505 ? 27.739  2.339   9.805   1.00 40.22  ? 502 PRO A O   1 
ATOM   3883 C CB  . PRO A 1 505 ? 27.014  3.831   12.513  1.00 42.42  ? 502 PRO A CB  1 
ATOM   3884 C CG  . PRO A 1 505 ? 28.054  4.135   13.534  1.00 42.64  ? 502 PRO A CG  1 
ATOM   3885 C CD  . PRO A 1 505 ? 29.269  3.370   13.088  1.00 41.87  ? 502 PRO A CD  1 
ATOM   3886 N N   . TYR A 1 506 ? 25.690  1.647   10.450  1.00 44.92  ? 503 TYR A N   1 
ATOM   3887 C CA  . TYR A 1 506 ? 25.165  1.552   9.100   1.00 39.78  ? 503 TYR A CA  1 
ATOM   3888 C C   . TYR A 1 506 ? 24.679  2.927   8.664   1.00 44.00  ? 503 TYR A C   1 
ATOM   3889 O O   . TYR A 1 506 ? 23.907  3.571   9.373   1.00 40.58  ? 503 TYR A O   1 
ATOM   3890 C CB  . TYR A 1 506 ? 24.028  0.528   9.022   1.00 38.21  ? 503 TYR A CB  1 
ATOM   3891 C CG  . TYR A 1 506 ? 23.463  0.336   7.631   1.00 39.26  ? 503 TYR A CG  1 
ATOM   3892 C CD1 . TYR A 1 506 ? 22.427  1.136   7.163   1.00 40.23  ? 503 TYR A CD1 1 
ATOM   3893 C CD2 . TYR A 1 506 ? 23.964  -0.645  6.786   1.00 37.85  ? 503 TYR A CD2 1 
ATOM   3894 C CE1 . TYR A 1 506 ? 21.909  0.969   5.892   1.00 37.99  ? 503 TYR A CE1 1 
ATOM   3895 C CE2 . TYR A 1 506 ? 23.446  -0.825  5.513   1.00 38.92  ? 503 TYR A CE2 1 
ATOM   3896 C CZ  . TYR A 1 506 ? 22.420  -0.012  5.071   1.00 41.45  ? 503 TYR A CZ  1 
ATOM   3897 O OH  . TYR A 1 506 ? 21.902  -0.178  3.804   1.00 42.59  ? 503 TYR A OH  1 
ATOM   3898 N N   . THR A 1 507 ? 25.137  3.370   7.496   1.00 41.80  ? 504 THR A N   1 
ATOM   3899 C CA  . THR A 1 507 ? 24.747  4.659   6.936   1.00 43.88  ? 504 THR A CA  1 
ATOM   3900 C C   . THR A 1 507 ? 24.329  4.471   5.484   1.00 45.06  ? 504 THR A C   1 
ATOM   3901 O O   . THR A 1 507 ? 24.789  3.541   4.831   1.00 43.57  ? 504 THR A O   1 
ATOM   3902 C CB  . THR A 1 507 ? 25.895  5.680   6.995   1.00 48.19  ? 504 THR A CB  1 
ATOM   3903 O OG1 . THR A 1 507 ? 26.984  5.215   6.184   1.00 46.64  ? 504 THR A OG1 1 
ATOM   3904 C CG2 . THR A 1 507 ? 26.376  5.875   8.428   1.00 43.43  ? 504 THR A CG2 1 
ATOM   3905 N N   . THR A 1 508 ? 23.469  5.342   4.969   1.00 44.73  ? 505 THR A N   1 
ATOM   3906 C CA  . THR A 1 508 ? 23.059  5.222   3.570   1.00 49.75  ? 505 THR A CA  1 
ATOM   3907 C C   . THR A 1 508 ? 24.236  5.445   2.623   1.00 47.18  ? 505 THR A C   1 
ATOM   3908 O O   . THR A 1 508 ? 24.259  4.914   1.513   1.00 45.83  ? 505 THR A O   1 
ATOM   3909 C CB  . THR A 1 508 ? 21.933  6.211   3.208   1.00 48.92  ? 505 THR A CB  1 
ATOM   3910 O OG1 . THR A 1 508 ? 22.376  7.552   3.442   1.00 57.19  ? 505 THR A OG1 1 
ATOM   3911 C CG2 . THR A 1 508 ? 20.688  5.931   4.041   1.00 52.24  ? 505 THR A CG2 1 
ATOM   3912 N N   . ALA A 1 509 ? 25.219  6.216   3.076   1.00 49.41  ? 506 ALA A N   1 
ATOM   3913 C CA  . ALA A 1 509 ? 26.373  6.557   2.252   1.00 49.74  ? 506 ALA A CA  1 
ATOM   3914 C C   . ALA A 1 509 ? 27.360  5.401   2.099   1.00 49.57  ? 506 ALA A C   1 
ATOM   3915 O O   . ALA A 1 509 ? 27.896  5.182   1.014   1.00 49.34  ? 506 ALA A O   1 
ATOM   3916 C CB  . ALA A 1 509 ? 27.085  7.775   2.828   1.00 51.30  ? 506 ALA A CB  1 
ATOM   3917 N N   . ALA A 1 510 ? 27.608  4.667   3.180   1.00 45.71  ? 507 ALA A N   1 
ATOM   3918 C CA  . ALA A 1 510 ? 28.621  3.614   3.155   1.00 44.21  ? 507 ALA A CA  1 
ATOM   3919 C C   . ALA A 1 510 ? 28.029  2.214   3.328   1.00 44.66  ? 507 ALA A C   1 
ATOM   3920 O O   . ALA A 1 510 ? 28.666  1.221   2.973   1.00 41.77  ? 507 ALA A O   1 
ATOM   3921 C CB  . ALA A 1 510 ? 29.673  3.876   4.224   1.00 44.84  ? 507 ALA A CB  1 
ATOM   3922 N N   . GLN A 1 511 ? 26.822  2.145   3.887   1.00 42.79  ? 508 GLN A N   1 
ATOM   3923 C CA  . GLN A 1 511 ? 26.084  0.888   4.017   1.00 40.31  ? 508 GLN A CA  1 
ATOM   3924 C C   . GLN A 1 511 ? 26.905  -0.215  4.669   1.00 40.21  ? 508 GLN A C   1 
ATOM   3925 O O   . GLN A 1 511 ? 26.868  -1.365  4.238   1.00 39.86  ? 508 GLN A O   1 
ATOM   3926 C CB  . GLN A 1 511 ? 25.590  0.423   2.642   1.00 41.05  ? 508 GLN A CB  1 
ATOM   3927 C CG  . GLN A 1 511 ? 24.688  1.426   1.944   1.00 39.96  ? 508 GLN A CG  1 
ATOM   3928 C CD  . GLN A 1 511 ? 24.299  0.987   0.544   1.00 46.83  ? 508 GLN A CD  1 
ATOM   3929 O OE1 . GLN A 1 511 ? 24.000  -0.185  0.308   1.00 41.73  ? 508 GLN A OE1 1 
ATOM   3930 N NE2 . GLN A 1 511 ? 24.315  1.926   -0.396  1.00 46.11  ? 508 GLN A NE2 1 
ATOM   3931 N N   . GLN A 1 512 ? 27.648  0.137   5.711   1.00 38.79  ? 509 GLN A N   1 
ATOM   3932 C CA  . GLN A 1 512 ? 28.532  -0.823  6.356   1.00 39.61  ? 509 GLN A CA  1 
ATOM   3933 C C   . GLN A 1 512 ? 27.794  -1.709  7.352   1.00 41.69  ? 509 GLN A C   1 
ATOM   3934 O O   . GLN A 1 512 ? 26.979  -1.235  8.145   1.00 42.45  ? 509 GLN A O   1 
ATOM   3935 C CB  . GLN A 1 512 ? 29.676  -0.103  7.066   1.00 43.30  ? 509 GLN A CB  1 
ATOM   3936 C CG  . GLN A 1 512 ? 30.596  0.684   6.152   1.00 43.02  ? 509 GLN A CG  1 
ATOM   3937 C CD  . GLN A 1 512 ? 31.531  1.581   6.937   1.00 46.03  ? 509 GLN A CD  1 
ATOM   3938 O OE1 . GLN A 1 512 ? 32.719  1.290   7.074   1.00 49.24  ? 509 GLN A OE1 1 
ATOM   3939 N NE2 . GLN A 1 512 ? 30.992  2.671   7.473   1.00 42.01  ? 509 GLN A NE2 1 
ATOM   3940 N N   . TYR A 1 513 ? 28.097  -3.001  7.304   1.00 36.63  ? 510 TYR A N   1 
ATOM   3941 C CA  . TYR A 1 513 ? 27.589  -3.959  8.273   1.00 39.06  ? 510 TYR A CA  1 
ATOM   3942 C C   . TYR A 1 513 ? 28.716  -4.926  8.602   1.00 40.60  ? 510 TYR A C   1 
ATOM   3943 O O   . TYR A 1 513 ? 29.749  -4.905  7.942   1.00 41.93  ? 510 TYR A O   1 
ATOM   3944 C CB  . TYR A 1 513 ? 26.360  -4.695  7.733   1.00 38.01  ? 510 TYR A CB  1 
ATOM   3945 C CG  . TYR A 1 513 ? 26.610  -5.539  6.499   1.00 39.50  ? 510 TYR A CG  1 
ATOM   3946 C CD1 . TYR A 1 513 ? 26.676  -4.959  5.232   1.00 39.90  ? 510 TYR A CD1 1 
ATOM   3947 C CD2 . TYR A 1 513 ? 26.758  -6.917  6.597   1.00 36.96  ? 510 TYR A CD2 1 
ATOM   3948 C CE1 . TYR A 1 513 ? 26.897  -5.730  4.101   1.00 40.20  ? 510 TYR A CE1 1 
ATOM   3949 C CE2 . TYR A 1 513 ? 26.976  -7.696  5.471   1.00 38.79  ? 510 TYR A CE2 1 
ATOM   3950 C CZ  . TYR A 1 513 ? 27.046  -7.096  4.226   1.00 43.15  ? 510 TYR A CZ  1 
ATOM   3951 O OH  . TYR A 1 513 ? 27.261  -7.873  3.110   1.00 43.38  ? 510 TYR A OH  1 
ATOM   3952 N N   . VAL A 1 514 ? 28.543  -5.762  9.619   1.00 36.04  ? 511 VAL A N   1 
ATOM   3953 C CA  . VAL A 1 514 ? 29.613  -6.688  9.978   1.00 38.58  ? 511 VAL A CA  1 
ATOM   3954 C C   . VAL A 1 514 ? 29.176  -8.138  9.884   1.00 38.55  ? 511 VAL A C   1 
ATOM   3955 O O   . VAL A 1 514 ? 27.986  -8.445  9.942   1.00 38.57  ? 511 VAL A O   1 
ATOM   3956 C CB  . VAL A 1 514 ? 30.145  -6.425  11.402  1.00 41.03  ? 511 VAL A CB  1 
ATOM   3957 C CG1 . VAL A 1 514 ? 30.602  -4.982  11.535  1.00 40.16  ? 511 VAL A CG1 1 
ATOM   3958 C CG2 . VAL A 1 514 ? 29.088  -6.769  12.450  1.00 41.93  ? 511 VAL A CG2 1 
ATOM   3959 N N   . SER A 1 515 ? 30.151  -9.029  9.729   1.00 37.04  ? 512 SER A N   1 
ATOM   3960 C CA  . SER A 1 515 ? 29.875  -10.459 9.746   1.00 37.43  ? 512 SER A CA  1 
ATOM   3961 C C   . SER A 1 515 ? 30.137  -11.037 11.131  1.00 39.27  ? 512 SER A C   1 
ATOM   3962 O O   . SER A 1 515 ? 31.211  -10.845 11.701  1.00 38.41  ? 512 SER A O   1 
ATOM   3963 C CB  . SER A 1 515 ? 30.728  -11.195 8.709   1.00 40.93  ? 512 SER A CB  1 
ATOM   3964 O OG  . SER A 1 515 ? 32.104  -11.110 9.034   1.00 45.49  ? 512 SER A OG  1 
ATOM   3965 N N   . LEU A 1 516 ? 29.154  -11.750 11.667  1.00 40.65  ? 513 LEU A N   1 
ATOM   3966 C CA  . LEU A 1 516 ? 29.321  -12.410 12.955  1.00 39.15  ? 513 LEU A CA  1 
ATOM   3967 C C   . LEU A 1 516 ? 29.571  -13.899 12.756  1.00 36.41  ? 513 LEU A C   1 
ATOM   3968 O O   . LEU A 1 516 ? 28.678  -14.640 12.343  1.00 37.00  ? 513 LEU A O   1 
ATOM   3969 C CB  . LEU A 1 516 ? 28.094  -12.184 13.844  1.00 36.79  ? 513 LEU A CB  1 
ATOM   3970 C CG  . LEU A 1 516 ? 27.746  -10.729 14.167  1.00 36.21  ? 513 LEU A CG  1 
ATOM   3971 C CD1 . LEU A 1 516 ? 26.437  -10.644 14.932  1.00 35.41  ? 513 LEU A CD1 1 
ATOM   3972 C CD2 . LEU A 1 516 ? 28.866  -10.061 14.950  1.00 37.36  ? 513 LEU A CD2 1 
ATOM   3973 N N   . ASN A 1 517 ? 30.801  -14.320 13.036  1.00 37.42  ? 514 ASN A N   1 
ATOM   3974 C CA  . ASN A 1 517 ? 31.190  -15.725 12.960  1.00 39.70  ? 514 ASN A CA  1 
ATOM   3975 C C   . ASN A 1 517 ? 32.405  -15.968 13.851  1.00 42.69  ? 514 ASN A C   1 
ATOM   3976 O O   . ASN A 1 517 ? 32.764  -15.106 14.652  1.00 44.57  ? 514 ASN A O   1 
ATOM   3977 C CB  . ASN A 1 517 ? 31.472  -16.144 11.507  1.00 41.86  ? 514 ASN A CB  1 
ATOM   3978 C CG  . ASN A 1 517 ? 32.394  -15.178 10.780  1.00 43.94  ? 514 ASN A CG  1 
ATOM   3979 O OD1 . ASN A 1 517 ? 33.393  -14.717 11.329  1.00 48.18  ? 514 ASN A OD1 1 
ATOM   3980 N ND2 . ASN A 1 517 ? 32.059  -14.869 9.531   1.00 48.57  ? 514 ASN A ND2 1 
ATOM   3981 N N   . LEU A 1 518 ? 33.039  -17.129 13.715  1.00 45.36  ? 515 LEU A N   1 
ATOM   3982 C CA  . LEU A 1 518 ? 34.129  -17.508 14.615  1.00 45.83  ? 515 LEU A CA  1 
ATOM   3983 C C   . LEU A 1 518 ? 35.357  -16.613 14.471  1.00 47.26  ? 515 LEU A C   1 
ATOM   3984 O O   . LEU A 1 518 ? 36.178  -16.517 15.385  1.00 49.68  ? 515 LEU A O   1 
ATOM   3985 C CB  . LEU A 1 518 ? 34.525  -18.967 14.385  1.00 46.60  ? 515 LEU A CB  1 
ATOM   3986 C CG  . LEU A 1 518 ? 33.497  -20.002 14.842  1.00 48.29  ? 515 LEU A CG  1 
ATOM   3987 C CD1 . LEU A 1 518 ? 34.091  -21.399 14.799  1.00 49.34  ? 515 LEU A CD1 1 
ATOM   3988 C CD2 . LEU A 1 518 ? 32.991  -19.675 16.239  1.00 43.39  ? 515 LEU A CD2 1 
ATOM   3989 N N   . LYS A 1 519 ? 35.473  -15.957 13.323  1.00 48.33  ? 516 LYS A N   1 
ATOM   3990 C CA  . LYS A 1 519 ? 36.582  -15.052 13.052  1.00 47.85  ? 516 LYS A CA  1 
ATOM   3991 C C   . LYS A 1 519 ? 36.252  -13.657 13.574  1.00 48.39  ? 516 LYS A C   1 
ATOM   3992 O O   . LYS A 1 519 ? 35.083  -13.352 13.809  1.00 48.72  ? 516 LYS A O   1 
ATOM   3993 C CB  . LYS A 1 519 ? 36.880  -15.027 11.547  1.00 49.61  ? 516 LYS A CB  1 
ATOM   3994 C CG  . LYS A 1 519 ? 37.331  -16.379 11.001  1.00 52.59  ? 516 LYS A CG  1 
ATOM   3995 C CD  . LYS A 1 519 ? 37.543  -16.353 9.494   1.00 55.19  ? 516 LYS A CD  1 
ATOM   3996 C CE  . LYS A 1 519 ? 36.334  -16.903 8.750   1.00 62.16  ? 516 LYS A CE  1 
ATOM   3997 N NZ  . LYS A 1 519 ? 36.594  -17.026 7.284   1.00 66.69  ? 516 LYS A NZ  1 
ATOM   3998 N N   . PRO A 1 520 ? 37.277  -12.809 13.778  1.00 48.91  ? 517 PRO A N   1 
ATOM   3999 C CA  . PRO A 1 520 ? 37.024  -11.441 14.247  1.00 49.75  ? 517 PRO A CA  1 
ATOM   4000 C C   . PRO A 1 520 ? 36.121  -10.648 13.304  1.00 49.83  ? 517 PRO A C   1 
ATOM   4001 O O   . PRO A 1 520 ? 35.968  -11.035 12.145  1.00 47.33  ? 517 PRO A O   1 
ATOM   4002 C CB  . PRO A 1 520 ? 38.425  -10.825 14.301  1.00 52.35  ? 517 PRO A CB  1 
ATOM   4003 C CG  . PRO A 1 520 ? 39.329  -11.981 14.510  1.00 50.83  ? 517 PRO A CG  1 
ATOM   4004 C CD  . PRO A 1 520 ? 38.719  -13.114 13.735  1.00 48.26  ? 517 PRO A CD  1 
ATOM   4005 N N   . LEU A 1 521 ? 35.537  -9.560  13.805  1.00 47.38  ? 518 LEU A N   1 
ATOM   4006 C CA  . LEU A 1 521 ? 34.621  -8.736  13.019  1.00 47.96  ? 518 LEU A CA  1 
ATOM   4007 C C   . LEU A 1 521 ? 35.185  -8.369  11.657  1.00 49.49  ? 518 LEU A C   1 
ATOM   4008 O O   . LEU A 1 521 ? 36.294  -7.850  11.551  1.00 51.54  ? 518 LEU A O   1 
ATOM   4009 C CB  . LEU A 1 521 ? 34.266  -7.446  13.760  1.00 49.03  ? 518 LEU A CB  1 
ATOM   4010 C CG  . LEU A 1 521 ? 33.230  -7.471  14.880  1.00 49.75  ? 518 LEU A CG  1 
ATOM   4011 C CD1 . LEU A 1 521 ? 32.760  -6.053  15.163  1.00 48.95  ? 518 LEU A CD1 1 
ATOM   4012 C CD2 . LEU A 1 521 ? 32.058  -8.373  14.533  1.00 46.30  ? 518 LEU A CD2 1 
ATOM   4013 N N   . GLU A 1 522 ? 34.409  -8.644  10.619  1.00 42.57  ? 519 GLU A N   1 
ATOM   4014 C CA  . GLU A 1 522 ? 34.747  -8.199  9.280   1.00 45.81  ? 519 GLU A CA  1 
ATOM   4015 C C   . GLU A 1 522 ? 33.700  -7.204  8.811   1.00 44.21  ? 519 GLU A C   1 
ATOM   4016 O O   . GLU A 1 522 ? 32.499  -7.475  8.894   1.00 44.60  ? 519 GLU A O   1 
ATOM   4017 C CB  . GLU A 1 522 ? 34.837  -9.378  8.314   1.00 44.23  ? 519 GLU A CB  1 
ATOM   4018 C CG  . GLU A 1 522 ? 35.040  -8.958  6.865   1.00 56.02  ? 519 GLU A CG  1 
ATOM   4019 C CD  . GLU A 1 522 ? 35.087  -10.135 5.914   1.00 55.08  ? 519 GLU A CD  1 
ATOM   4020 O OE1 . GLU A 1 522 ? 35.884  -11.067 6.158   1.00 62.61  ? 519 GLU A OE1 1 
ATOM   4021 O OE2 . GLU A 1 522 ? 34.324  -10.129 4.924   1.00 56.54  ? 519 GLU A OE2 1 
ATOM   4022 N N   . VAL A 1 523 ? 34.161  -6.051  8.337   1.00 42.86  ? 520 VAL A N   1 
ATOM   4023 C CA  . VAL A 1 523 ? 33.275  -5.009  7.838   1.00 42.03  ? 520 VAL A CA  1 
ATOM   4024 C C   . VAL A 1 523 ? 33.046  -5.145  6.335   1.00 45.70  ? 520 VAL A C   1 
ATOM   4025 O O   . VAL A 1 523 ? 33.993  -5.188  5.555   1.00 47.47  ? 520 VAL A O   1 
ATOM   4026 C CB  . VAL A 1 523 ? 33.834  -3.607  8.136   1.00 45.44  ? 520 VAL A CB  1 
ATOM   4027 C CG1 . VAL A 1 523 ? 32.918  -2.540  7.568   1.00 44.77  ? 520 VAL A CG1 1 
ATOM   4028 C CG2 . VAL A 1 523 ? 34.017  -3.419  9.640   1.00 44.90  ? 520 VAL A CG2 1 
ATOM   4029 N N   . ARG A 1 524 ? 31.778  -5.217  5.944   1.00 41.72  ? 521 ARG A N   1 
ATOM   4030 C CA  . ARG A 1 524 ? 31.385  -5.313  4.547   1.00 42.81  ? 521 ARG A CA  1 
ATOM   4031 C C   . ARG A 1 524 ? 30.456  -4.161  4.200   1.00 44.07  ? 521 ARG A C   1 
ATOM   4032 O O   . ARG A 1 524 ? 29.927  -3.489  5.089   1.00 43.63  ? 521 ARG A O   1 
ATOM   4033 C CB  . ARG A 1 524 ? 30.704  -6.652  4.267   1.00 42.75  ? 521 ARG A CB  1 
ATOM   4034 C CG  . ARG A 1 524 ? 31.541  -7.857  4.656   1.00 43.53  ? 521 ARG A CG  1 
ATOM   4035 C CD  . ARG A 1 524 ? 30.806  -9.155  4.396   1.00 41.05  ? 521 ARG A CD  1 
ATOM   4036 N NE  . ARG A 1 524 ? 31.507  -10.285 4.992   1.00 41.26  ? 521 ARG A NE  1 
ATOM   4037 C CZ  . ARG A 1 524 ? 30.968  -11.486 5.174   1.00 44.09  ? 521 ARG A CZ  1 
ATOM   4038 N NH1 . ARG A 1 524 ? 29.714  -11.714 4.810   1.00 40.81  ? 521 ARG A NH1 1 
ATOM   4039 N NH2 . ARG A 1 524 ? 31.682  -12.457 5.731   1.00 41.78  ? 521 ARG A NH2 1 
ATOM   4040 N N   . ARG A 1 525 ? 30.260  -3.932  2.908   1.00 41.53  ? 522 ARG A N   1 
ATOM   4041 C CA  . ARG A 1 525 ? 29.454  -2.807  2.455   1.00 42.66  ? 522 ARG A CA  1 
ATOM   4042 C C   . ARG A 1 525 ? 28.346  -3.246  1.509   1.00 46.19  ? 522 ARG A C   1 
ATOM   4043 O O   . ARG A 1 525 ? 28.580  -3.988  0.549   1.00 43.51  ? 522 ARG A O   1 
ATOM   4044 C CB  . ARG A 1 525 ? 30.335  -1.760  1.774   1.00 44.00  ? 522 ARG A CB  1 
ATOM   4045 C CG  . ARG A 1 525 ? 31.346  -1.100  2.697   1.00 49.82  ? 522 ARG A CG  1 
ATOM   4046 C CD  . ARG A 1 525 ? 31.917  0.166   2.068   1.00 56.64  ? 522 ARG A CD  1 
ATOM   4047 N NE  . ARG A 1 525 ? 30.869  0.995   1.474   1.00 58.17  ? 522 ARG A NE  1 
ATOM   4048 C CZ  . ARG A 1 525 ? 31.069  1.867   0.489   1.00 63.01  ? 522 ARG A CZ  1 
ATOM   4049 N NH1 . ARG A 1 525 ? 32.285  2.029   -0.018  1.00 69.75  ? 522 ARG A NH1 1 
ATOM   4050 N NH2 . ARG A 1 525 ? 30.054  2.576   0.005   1.00 59.72  ? 522 ARG A NH2 1 
ATOM   4051 N N   . GLY A 1 526 ? 27.137  -2.771  1.785   1.00 41.88  ? 523 GLY A N   1 
ATOM   4052 C CA  . GLY A 1 526 ? 25.993  -3.063  0.947   1.00 43.17  ? 523 GLY A CA  1 
ATOM   4053 C C   . GLY A 1 526 ? 25.369  -4.401  1.275   1.00 44.31  ? 523 GLY A C   1 
ATOM   4054 O O   . GLY A 1 526 ? 25.921  -5.456  0.957   1.00 46.09  ? 523 GLY A O   1 
ATOM   4055 N N   . LEU A 1 527 ? 24.206  -4.355  1.913   1.00 41.00  ? 524 LEU A N   1 
ATOM   4056 C CA  . LEU A 1 527 ? 23.488  -5.570  2.259   1.00 41.43  ? 524 LEU A CA  1 
ATOM   4057 C C   . LEU A 1 527 ? 22.695  -6.057  1.052   1.00 39.96  ? 524 LEU A C   1 
ATOM   4058 O O   . LEU A 1 527 ? 21.584  -5.589  0.798   1.00 40.06  ? 524 LEU A O   1 
ATOM   4059 C CB  . LEU A 1 527 ? 22.566  -5.332  3.458   1.00 42.95  ? 524 LEU A CB  1 
ATOM   4060 C CG  . LEU A 1 527 ? 21.901  -6.576  4.056   1.00 48.60  ? 524 LEU A CG  1 
ATOM   4061 C CD1 . LEU A 1 527 ? 22.926  -7.677  4.280   1.00 43.97  ? 524 LEU A CD1 1 
ATOM   4062 C CD2 . LEU A 1 527 ? 21.190  -6.236  5.364   1.00 45.31  ? 524 LEU A CD2 1 
ATOM   4063 N N   . ARG A 1 528 ? 23.290  -6.988  0.313   1.00 37.18  ? 525 ARG A N   1 
ATOM   4064 C CA  . ARG A 1 528 ? 22.684  -7.554  -0.892  1.00 45.26  ? 525 ARG A CA  1 
ATOM   4065 C C   . ARG A 1 528 ? 22.109  -6.449  -1.788  1.00 37.61  ? 525 ARG A C   1 
ATOM   4066 O O   . ARG A 1 528 ? 20.965  -6.530  -2.240  1.00 37.65  ? 525 ARG A O   1 
ATOM   4067 C CB  . ARG A 1 528 ? 21.603  -8.565  -0.499  1.00 41.47  ? 525 ARG A CB  1 
ATOM   4068 C CG  . ARG A 1 528 ? 21.488  -9.740  -1.445  1.00 49.87  ? 525 ARG A CG  1 
ATOM   4069 C CD  . ARG A 1 528 ? 21.086  -11.005 -0.709  1.00 46.50  ? 525 ARG A CD  1 
ATOM   4070 N NE  . ARG A 1 528 ? 22.047  -11.352 0.333   1.00 50.56  ? 525 ARG A NE  1 
ATOM   4071 C CZ  . ARG A 1 528 ? 22.016  -12.484 1.028   1.00 51.59  ? 525 ARG A CZ  1 
ATOM   4072 N NH1 . ARG A 1 528 ? 21.071  -13.385 0.787   1.00 48.45  ? 525 ARG A NH1 1 
ATOM   4073 N NH2 . ARG A 1 528 ? 22.929  -12.716 1.963   1.00 54.71  ? 525 ARG A NH2 1 
ATOM   4074 N N   . ALA A 1 529 ? 22.921  -5.422  -2.033  1.00 36.23  ? 526 ALA A N   1 
ATOM   4075 C CA  . ALA A 1 529 ? 22.455  -4.147  -2.588  1.00 40.48  ? 526 ALA A CA  1 
ATOM   4076 C C   . ALA A 1 529 ? 21.730  -4.232  -3.941  1.00 36.22  ? 526 ALA A C   1 
ATOM   4077 O O   . ALA A 1 529 ? 20.659  -3.636  -4.109  1.00 35.14  ? 526 ALA A O   1 
ATOM   4078 C CB  . ALA A 1 529 ? 23.633  -3.182  -2.699  1.00 41.48  ? 526 ALA A CB  1 
ATOM   4079 N N   . GLN A 1 530 ? 22.304  -4.944  -4.906  1.00 37.58  ? 527 GLN A N   1 
ATOM   4080 C CA  . GLN A 1 530 ? 21.675  -5.047  -6.225  1.00 38.96  ? 527 GLN A CA  1 
ATOM   4081 C C   . GLN A 1 530 ? 20.319  -5.727  -6.094  1.00 36.66  ? 527 GLN A C   1 
ATOM   4082 O O   . GLN A 1 530 ? 19.289  -5.233  -6.577  1.00 35.85  ? 527 GLN A O   1 
ATOM   4083 C CB  . GLN A 1 530 ? 22.566  -5.825  -7.199  1.00 38.93  ? 527 GLN A CB  1 
ATOM   4084 C CG  . GLN A 1 530 ? 23.882  -5.138  -7.515  1.00 39.58  ? 527 GLN A CG  1 
ATOM   4085 C CD  . GLN A 1 530 ? 23.692  -3.726  -8.040  1.00 43.34  ? 527 GLN A CD  1 
ATOM   4086 O OE1 . GLN A 1 530 ? 23.939  -2.753  -7.327  1.00 40.49  ? 527 GLN A OE1 1 
ATOM   4087 N NE2 . GLN A 1 530 ? 23.245  -3.607  -9.294  1.00 37.87  ? 527 GLN A NE2 1 
ATOM   4088 N N   . THR A 1 531 ? 20.335  -6.853  -5.395  1.00 34.85  ? 528 THR A N   1 
ATOM   4089 C CA  . THR A 1 531 ? 19.162  -7.697  -5.248  1.00 34.25  ? 528 THR A CA  1 
ATOM   4090 C C   . THR A 1 531 ? 18.056  -6.991  -4.471  1.00 35.69  ? 528 THR A C   1 
ATOM   4091 O O   . THR A 1 531 ? 16.890  -7.030  -4.862  1.00 33.36  ? 528 THR A O   1 
ATOM   4092 C CB  . THR A 1 531 ? 19.541  -9.022  -4.561  1.00 39.46  ? 528 THR A CB  1 
ATOM   4093 O OG1 . THR A 1 531 ? 20.330  -9.811  -5.463  1.00 37.36  ? 528 THR A OG1 1 
ATOM   4094 C CG2 . THR A 1 531 ? 18.299  -9.804  -4.160  1.00 38.54  ? 528 THR A CG2 1 
ATOM   4095 N N   . CYS A 1 532 ? 18.414  -6.329  -3.375  1.00 33.79  ? 529 CYS A N   1 
ATOM   4096 C CA  . CYS A 1 532 ? 17.400  -5.641  -2.596  1.00 33.81  ? 529 CYS A CA  1 
ATOM   4097 C C   . CYS A 1 532 ? 16.921  -4.374  -3.290  1.00 35.87  ? 529 CYS A C   1 
ATOM   4098 O O   . CYS A 1 532 ? 15.806  -3.934  -3.055  1.00 37.13  ? 529 CYS A O   1 
ATOM   4099 C CB  . CYS A 1 532 ? 17.918  -5.338  -1.188  1.00 39.08  ? 529 CYS A CB  1 
ATOM   4100 S SG  . CYS A 1 532 ? 17.981  -6.847  -0.197  1.00 39.64  ? 529 CYS A SG  1 
ATOM   4101 N N   . ALA A 1 533 ? 17.745  -3.789  -4.152  1.00 34.51  ? 530 ALA A N   1 
ATOM   4102 C CA  . ALA A 1 533 ? 17.239  -2.745  -5.039  1.00 39.14  ? 530 ALA A CA  1 
ATOM   4103 C C   . ALA A 1 533 ? 16.160  -3.339  -5.944  1.00 37.65  ? 530 ALA A C   1 
ATOM   4104 O O   . ALA A 1 533 ? 15.120  -2.718  -6.183  1.00 39.49  ? 530 ALA A O   1 
ATOM   4105 C CB  . ALA A 1 533 ? 18.355  -2.141  -5.865  1.00 40.28  ? 530 ALA A CB  1 
ATOM   4106 N N   . PHE A 1 534 ? 16.409  -4.551  -6.435  1.00 35.73  ? 531 PHE A N   1 
ATOM   4107 C CA  . PHE A 1 534 ? 15.416  -5.259  -7.246  1.00 37.09  ? 531 PHE A CA  1 
ATOM   4108 C C   . PHE A 1 534 ? 14.104  -5.441  -6.472  1.00 37.94  ? 531 PHE A C   1 
ATOM   4109 O O   . PHE A 1 534 ? 13.035  -5.071  -6.964  1.00 34.73  ? 531 PHE A O   1 
ATOM   4110 C CB  . PHE A 1 534 ? 15.979  -6.611  -7.711  1.00 34.46  ? 531 PHE A CB  1 
ATOM   4111 C CG  . PHE A 1 534 ? 14.958  -7.534  -8.332  1.00 35.90  ? 531 PHE A CG  1 
ATOM   4112 C CD1 . PHE A 1 534 ? 14.602  -7.402  -9.666  1.00 37.19  ? 531 PHE A CD1 1 
ATOM   4113 C CD2 . PHE A 1 534 ? 14.386  -8.558  -7.587  1.00 36.00  ? 531 PHE A CD2 1 
ATOM   4114 C CE1 . PHE A 1 534 ? 13.679  -8.257  -10.242 1.00 36.66  ? 531 PHE A CE1 1 
ATOM   4115 C CE2 . PHE A 1 534 ? 13.459  -9.417  -8.156  1.00 37.86  ? 531 PHE A CE2 1 
ATOM   4116 C CZ  . PHE A 1 534 ? 13.108  -9.267  -9.492  1.00 38.29  ? 531 PHE A CZ  1 
ATOM   4117 N N   . TRP A 1 535 ? 14.186  -5.979  -5.253  1.00 34.04  ? 532 TRP A N   1 
ATOM   4118 C CA  . TRP A 1 535 ? 12.982  -6.245  -4.461  1.00 35.59  ? 532 TRP A CA  1 
ATOM   4119 C C   . TRP A 1 535 ? 12.265  -4.986  -3.966  1.00 35.98  ? 532 TRP A C   1 
ATOM   4120 O O   . TRP A 1 535 ? 11.038  -4.944  -3.929  1.00 38.80  ? 532 TRP A O   1 
ATOM   4121 C CB  . TRP A 1 535 ? 13.316  -7.130  -3.248  1.00 32.49  ? 532 TRP A CB  1 
ATOM   4122 C CG  . TRP A 1 535 ? 13.588  -8.558  -3.603  1.00 31.00  ? 532 TRP A CG  1 
ATOM   4123 C CD1 . TRP A 1 535 ? 14.808  -9.163  -3.687  1.00 31.29  ? 532 TRP A CD1 1 
ATOM   4124 C CD2 . TRP A 1 535 ? 12.618  -9.560  -3.938  1.00 30.63  ? 532 TRP A CD2 1 
ATOM   4125 N NE1 . TRP A 1 535 ? 14.658  -10.485 -4.042  1.00 30.25  ? 532 TRP A NE1 1 
ATOM   4126 C CE2 . TRP A 1 535 ? 13.323  -10.751 -4.207  1.00 30.83  ? 532 TRP A CE2 1 
ATOM   4127 C CE3 . TRP A 1 535 ? 11.222  -9.567  -4.031  1.00 34.12  ? 532 TRP A CE3 1 
ATOM   4128 C CZ2 . TRP A 1 535 ? 12.682  -11.937 -4.567  1.00 30.94  ? 532 TRP A CZ2 1 
ATOM   4129 C CZ3 . TRP A 1 535 ? 10.585  -10.749 -4.392  1.00 33.88  ? 532 TRP A CZ3 1 
ATOM   4130 C CH2 . TRP A 1 535 ? 11.318  -11.917 -4.653  1.00 29.54  ? 532 TRP A CH2 1 
ATOM   4131 N N   . ASN A 1 536 ? 13.025  -3.967  -3.582  1.00 34.68  ? 533 ASN A N   1 
ATOM   4132 C CA  . ASN A 1 536 ? 12.462  -2.811  -2.885  1.00 37.42  ? 533 ASN A CA  1 
ATOM   4133 C C   . ASN A 1 536 ? 12.136  -1.614  -3.773  1.00 43.81  ? 533 ASN A C   1 
ATOM   4134 O O   . ASN A 1 536 ? 11.321  -0.774  -3.396  1.00 40.96  ? 533 ASN A O   1 
ATOM   4135 C CB  . ASN A 1 536 ? 13.414  -2.360  -1.774  1.00 38.18  ? 533 ASN A CB  1 
ATOM   4136 C CG  . ASN A 1 536 ? 13.662  -3.446  -0.750  1.00 36.70  ? 533 ASN A CG  1 
ATOM   4137 O OD1 . ASN A 1 536 ? 12.825  -4.326  -0.555  1.00 41.14  ? 533 ASN A OD1 1 
ATOM   4138 N ND2 . ASN A 1 536 ? 14.815  -3.398  -0.097  1.00 37.05  ? 533 ASN A ND2 1 
ATOM   4139 N N   . ARG A 1 537 ? 12.763  -1.525  -4.944  1.00 36.63  ? 534 ARG A N   1 
ATOM   4140 C CA  . ARG A 1 537 ? 12.529  -0.373  -5.816  1.00 42.65  ? 534 ARG A CA  1 
ATOM   4141 C C   . ARG A 1 537 ? 11.768  -0.735  -7.090  1.00 44.98  ? 534 ARG A C   1 
ATOM   4142 O O   . ARG A 1 537 ? 10.802  -0.063  -7.453  1.00 46.03  ? 534 ARG A O   1 
ATOM   4143 C CB  . ARG A 1 537 ? 13.855  0.299   -6.183  1.00 43.07  ? 534 ARG A CB  1 
ATOM   4144 C CG  . ARG A 1 537 ? 14.577  0.933   -5.004  1.00 43.82  ? 534 ARG A CG  1 
ATOM   4145 C CD  . ARG A 1 537 ? 15.960  1.413   -5.409  1.00 44.73  ? 534 ARG A CD  1 
ATOM   4146 N NE  . ARG A 1 537 ? 16.792  1.740   -4.255  1.00 49.45  ? 534 ARG A NE  1 
ATOM   4147 C CZ  . ARG A 1 537 ? 16.983  2.973   -3.795  1.00 48.57  ? 534 ARG A CZ  1 
ATOM   4148 N NH1 . ARG A 1 537 ? 16.403  4.005   -4.393  1.00 48.94  ? 534 ARG A NH1 1 
ATOM   4149 N NH2 . ARG A 1 537 ? 17.759  3.173   -2.737  1.00 52.19  ? 534 ARG A NH2 1 
ATOM   4150 N N   . PHE A 1 538 ? 12.198  -1.798  -7.763  1.00 40.95  ? 535 PHE A N   1 
ATOM   4151 C CA  . PHE A 1 538 ? 11.614  -2.155  -9.054  1.00 43.89  ? 535 PHE A CA  1 
ATOM   4152 C C   . PHE A 1 538 ? 10.346  -2.994  -8.925  1.00 43.29  ? 535 PHE A C   1 
ATOM   4153 O O   . PHE A 1 538 ? 9.279   -2.610  -9.402  1.00 46.38  ? 535 PHE A O   1 
ATOM   4154 C CB  . PHE A 1 538 ? 12.634  -2.906  -9.908  1.00 42.67  ? 535 PHE A CB  1 
ATOM   4155 C CG  . PHE A 1 538 ? 12.091  -3.348  -11.238 1.00 42.26  ? 535 PHE A CG  1 
ATOM   4156 C CD1 . PHE A 1 538 ? 11.903  -2.432  -12.260 1.00 43.57  ? 535 PHE A CD1 1 
ATOM   4157 C CD2 . PHE A 1 538 ? 11.752  -4.673  -11.461 1.00 42.81  ? 535 PHE A CD2 1 
ATOM   4158 C CE1 . PHE A 1 538 ? 11.397  -2.829  -13.483 1.00 42.93  ? 535 PHE A CE1 1 
ATOM   4159 C CE2 . PHE A 1 538 ? 11.243  -5.077  -12.688 1.00 42.76  ? 535 PHE A CE2 1 
ATOM   4160 C CZ  . PHE A 1 538 ? 11.066  -4.153  -13.697 1.00 39.58  ? 535 PHE A CZ  1 
ATOM   4161 N N   . LEU A 1 539 ? 10.474  -4.137  -8.266  1.00 40.23  ? 536 LEU A N   1 
ATOM   4162 C CA  . LEU A 1 539 ? 9.404   -5.130  -8.202  1.00 39.94  ? 536 LEU A CA  1 
ATOM   4163 C C   . LEU A 1 539 ? 8.066   -4.754  -7.515  1.00 49.53  ? 536 LEU A C   1 
ATOM   4164 O O   . LEU A 1 539 ? 7.035   -5.313  -7.890  1.00 47.35  ? 536 LEU A O   1 
ATOM   4165 C CB  . LEU A 1 539 ? 9.953   -6.392  -7.530  1.00 40.18  ? 536 LEU A CB  1 
ATOM   4166 C CG  . LEU A 1 539 ? 9.250   -7.695  -7.912  1.00 45.30  ? 536 LEU A CG  1 
ATOM   4167 C CD1 . LEU A 1 539 ? 9.304   -7.920  -9.428  1.00 40.49  ? 536 LEU A CD1 1 
ATOM   4168 C CD2 . LEU A 1 539 ? 9.855   -8.869  -7.173  1.00 37.52  ? 536 LEU A CD2 1 
ATOM   4169 N N   . PRO A 1 540 ? 8.062   -3.845  -6.507  1.00 47.93  ? 537 PRO A N   1 
ATOM   4170 C CA  . PRO A 1 540 ? 6.786   -3.601  -5.810  1.00 51.46  ? 537 PRO A CA  1 
ATOM   4171 C C   . PRO A 1 540 ? 5.580   -3.250  -6.694  1.00 57.65  ? 537 PRO A C   1 
ATOM   4172 O O   . PRO A 1 540 ? 4.464   -3.622  -6.325  1.00 57.24  ? 537 PRO A O   1 
ATOM   4173 C CB  . PRO A 1 540 ? 7.119   -2.424  -4.889  1.00 51.22  ? 537 PRO A CB  1 
ATOM   4174 C CG  . PRO A 1 540 ? 8.538   -2.629  -4.555  1.00 49.03  ? 537 PRO A CG  1 
ATOM   4175 C CD  . PRO A 1 540 ? 9.176   -3.167  -5.815  1.00 44.20  ? 537 PRO A CD  1 
ATOM   4176 N N   . LYS A 1 541 ? 5.796   -2.567  -7.819  1.00 54.54  ? 538 LYS A N   1 
ATOM   4177 C CA  . LYS A 1 541 ? 4.709   -2.252  -8.750  1.00 60.05  ? 538 LYS A CA  1 
ATOM   4178 C C   . LYS A 1 541 ? 3.942   -3.496  -9.174  1.00 58.33  ? 538 LYS A C   1 
ATOM   4179 O O   . LYS A 1 541 ? 2.717   -3.481  -9.296  1.00 61.98  ? 538 LYS A O   1 
ATOM   4180 C CB  . LYS A 1 541 ? 5.233   -1.583  -10.025 1.00 56.87  ? 538 LYS A CB  1 
ATOM   4181 C CG  . LYS A 1 541 ? 6.404   -0.655  -9.860  1.00 60.17  ? 538 LYS A CG  1 
ATOM   4182 C CD  . LYS A 1 541 ? 6.960   -0.289  -11.223 1.00 52.26  ? 538 LYS A CD  1 
ATOM   4183 C CE  . LYS A 1 541 ? 8.421   0.077   -11.129 1.00 55.65  ? 538 LYS A CE  1 
ATOM   4184 N NZ  . LYS A 1 541 ? 8.671   1.111   -10.090 1.00 58.98  ? 538 LYS A NZ  1 
ATOM   4185 N N   . LEU A 1 542 ? 4.690   -4.568  -9.406  1.00 56.67  ? 539 LEU A N   1 
ATOM   4186 C CA  . LEU A 1 542 ? 4.194   -5.717  -10.151 1.00 56.77  ? 539 LEU A CA  1 
ATOM   4187 C C   . LEU A 1 542 ? 3.598   -6.828  -9.287  1.00 59.42  ? 539 LEU A C   1 
ATOM   4188 O O   . LEU A 1 542 ? 3.154   -7.848  -9.812  1.00 58.90  ? 539 LEU A O   1 
ATOM   4189 C CB  . LEU A 1 542 ? 5.327   -6.290  -11.002 1.00 51.19  ? 539 LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 542 ? 6.178   -5.267  -11.761 1.00 53.91  ? 539 LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 542 ? 7.258   -5.971  -12.575 1.00 46.23  ? 539 LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 542 ? 5.311   -4.382  -12.652 1.00 51.58  ? 539 LEU A CD2 1 
ATOM   4193 N N   . LEU A 1 543 ? 3.587   -6.641  -7.971  1.00 58.11  ? 540 LEU A N   1 
ATOM   4194 C CA  . LEU A 1 543 ? 3.053   -7.672  -7.085  1.00 61.48  ? 540 LEU A CA  1 
ATOM   4195 C C   . LEU A 1 543 ? 1.530   -7.598  -7.009  1.00 67.44  ? 540 LEU A C   1 
ATOM   4196 O O   . LEU A 1 543 ? 0.969   -6.929  -6.142  1.00 69.60  ? 540 LEU A O   1 
ATOM   4197 C CB  . LEU A 1 543 ? 3.673   -7.558  -5.691  1.00 55.19  ? 540 LEU A CB  1 
ATOM   4198 C CG  . LEU A 1 543 ? 5.184   -7.816  -5.685  1.00 53.44  ? 540 LEU A CG  1 
ATOM   4199 C CD1 . LEU A 1 543 ? 5.726   -7.931  -4.277  1.00 51.53  ? 540 LEU A CD1 1 
ATOM   4200 C CD2 . LEU A 1 543 ? 5.525   -9.063  -6.501  1.00 54.71  ? 540 LEU A CD2 1 
ATOM   4201 N N   . SER A 1 544 ? 0.875   -8.300  -7.931  1.00 84.06  ? 541 SER A N   1 
ATOM   4202 C CA  . SER A 1 544 ? -0.581  -8.299  -8.032  1.00 77.29  ? 541 SER A CA  1 
ATOM   4203 C C   . SER A 1 544 ? -1.083  -9.503  -8.835  1.00 80.53  ? 541 SER A C   1 
ATOM   4204 O O   . SER A 1 544 ? -1.062  -9.491  -10.067 1.00 79.80  ? 541 SER A O   1 
ATOM   4205 C CB  . SER A 1 544 ? -1.069  -7.000  -8.680  1.00 79.03  ? 541 SER A CB  1 
ATOM   4206 O OG  . SER A 1 544 ? -0.198  -6.587  -9.721  1.00 78.77  ? 541 SER A OG  1 
ATOM   4207 N N   . ALA A 1 545 ? -1.527  -10.542 -8.131  1.00 77.44  ? 542 ALA A N   1 
ATOM   4208 C CA  . ALA A 1 545 ? -2.086  -11.729 -8.775  1.00 77.65  ? 542 ALA A CA  1 
ATOM   4209 C C   . ALA A 1 545 ? -3.159  -12.368 -7.900  1.00 85.24  ? 542 ALA A C   1 
ATOM   4210 O O   . ALA A 1 545 ? -2.852  -13.139 -6.990  1.00 83.00  ? 542 ALA A O   1 
ATOM   4211 C CB  . ALA A 1 545 ? -0.990  -12.737 -9.087  1.00 68.71  ? 542 ALA A CB  1 
ATOM   4212 N N   . GLU B 1 7   ? 57.531  -4.692  -67.942 1.00 83.79  ? 4   GLU B N   1 
ATOM   4213 C CA  . GLU B 1 7   ? 56.346  -5.543  -67.946 1.00 79.40  ? 4   GLU B CA  1 
ATOM   4214 C C   . GLU B 1 7   ? 56.490  -6.711  -66.973 1.00 75.50  ? 4   GLU B C   1 
ATOM   4215 O O   . GLU B 1 7   ? 57.086  -7.737  -67.302 1.00 75.98  ? 4   GLU B O   1 
ATOM   4216 C CB  . GLU B 1 7   ? 56.063  -6.067  -69.358 1.00 84.25  ? 4   GLU B CB  1 
ATOM   4217 C CG  . GLU B 1 7   ? 57.307  -6.390  -70.178 1.00 90.13  ? 4   GLU B CG  1 
ATOM   4218 C CD  . GLU B 1 7   ? 57.819  -5.193  -70.959 1.00 92.71  ? 4   GLU B CD  1 
ATOM   4219 O OE1 . GLU B 1 7   ? 56.993  -4.488  -71.578 1.00 90.77  ? 4   GLU B OE1 1 
ATOM   4220 O OE2 . GLU B 1 7   ? 59.045  -4.954  -70.947 1.00 93.10  ? 4   GLU B OE2 1 
ATOM   4221 N N   . ASP B 1 8   ? 55.942  -6.547  -65.774 1.00 70.90  ? 5   ASP B N   1 
ATOM   4222 C CA  . ASP B 1 8   ? 55.957  -7.604  -64.767 1.00 61.18  ? 5   ASP B CA  1 
ATOM   4223 C C   . ASP B 1 8   ? 54.744  -8.512  -64.952 1.00 58.97  ? 5   ASP B C   1 
ATOM   4224 O O   . ASP B 1 8   ? 53.613  -8.097  -64.702 1.00 59.23  ? 5   ASP B O   1 
ATOM   4225 C CB  . ASP B 1 8   ? 55.970  -7.002  -63.359 1.00 59.52  ? 5   ASP B CB  1 
ATOM   4226 C CG  . ASP B 1 8   ? 56.370  -8.007  -62.291 1.00 58.52  ? 5   ASP B CG  1 
ATOM   4227 O OD1 . ASP B 1 8   ? 56.249  -9.228  -62.527 1.00 58.87  ? 5   ASP B OD1 1 
ATOM   4228 O OD2 . ASP B 1 8   ? 56.806  -7.568  -61.206 1.00 58.27  ? 5   ASP B OD2 1 
ATOM   4229 N N   . PRO B 1 9   ? 54.976  -9.759  -65.392 1.00 59.97  ? 6   PRO B N   1 
ATOM   4230 C CA  . PRO B 1 9   ? 53.886  -10.704 -65.662 1.00 58.17  ? 6   PRO B CA  1 
ATOM   4231 C C   . PRO B 1 9   ? 53.145  -11.126 -64.395 1.00 60.27  ? 6   PRO B C   1 
ATOM   4232 O O   . PRO B 1 9   ? 52.017  -11.614 -64.480 1.00 60.97  ? 6   PRO B O   1 
ATOM   4233 C CB  . PRO B 1 9   ? 54.604  -11.897 -66.299 1.00 58.65  ? 6   PRO B CB  1 
ATOM   4234 C CG  . PRO B 1 9   ? 55.993  -11.821 -65.777 1.00 62.18  ? 6   PRO B CG  1 
ATOM   4235 C CD  . PRO B 1 9   ? 56.300  -10.358 -65.635 1.00 63.24  ? 6   PRO B CD  1 
ATOM   4236 N N   . GLN B 1 10  ? 53.773  -10.940 -63.238 1.00 55.91  ? 7   GLN B N   1 
ATOM   4237 C CA  . GLN B 1 10  ? 53.108  -11.195 -61.966 1.00 58.74  ? 7   GLN B CA  1 
ATOM   4238 C C   . GLN B 1 10  ? 52.053  -10.128 -61.692 1.00 57.64  ? 7   GLN B C   1 
ATOM   4239 O O   . GLN B 1 10  ? 51.186  -10.303 -60.834 1.00 57.78  ? 7   GLN B O   1 
ATOM   4240 C CB  . GLN B 1 10  ? 54.125  -11.240 -60.821 1.00 58.28  ? 7   GLN B CB  1 
ATOM   4241 C CG  . GLN B 1 10  ? 55.044  -12.449 -60.853 1.00 60.58  ? 7   GLN B CG  1 
ATOM   4242 C CD  . GLN B 1 10  ? 54.316  -13.735 -60.516 1.00 63.53  ? 7   GLN B CD  1 
ATOM   4243 O OE1 . GLN B 1 10  ? 53.475  -13.768 -59.617 1.00 63.03  ? 7   GLN B OE1 1 
ATOM   4244 N NE2 . GLN B 1 10  ? 54.630  -14.800 -61.243 1.00 63.77  ? 7   GLN B NE2 1 
ATOM   4245 N N   . LEU B 1 11  ? 52.135  -9.022  -62.428 1.00 52.62  ? 8   LEU B N   1 
ATOM   4246 C CA  . LEU B 1 11  ? 51.227  -7.897  -62.237 1.00 49.36  ? 8   LEU B CA  1 
ATOM   4247 C C   . LEU B 1 11  ? 50.208  -7.766  -63.368 1.00 50.03  ? 8   LEU B C   1 
ATOM   4248 O O   . LEU B 1 11  ? 49.418  -6.823  -63.389 1.00 49.90  ? 8   LEU B O   1 
ATOM   4249 C CB  . LEU B 1 11  ? 52.016  -6.595  -62.106 1.00 47.73  ? 8   LEU B CB  1 
ATOM   4250 C CG  . LEU B 1 11  ? 52.983  -6.486  -60.928 1.00 52.48  ? 8   LEU B CG  1 
ATOM   4251 C CD1 . LEU B 1 11  ? 53.689  -5.139  -60.962 1.00 51.91  ? 8   LEU B CD1 1 
ATOM   4252 C CD2 . LEU B 1 11  ? 52.255  -6.692  -59.601 1.00 46.29  ? 8   LEU B CD2 1 
ATOM   4253 N N   . LEU B 1 12  ? 50.227  -8.707  -64.304 1.00 48.31  ? 9   LEU B N   1 
ATOM   4254 C CA  . LEU B 1 12  ? 49.271  -8.700  -65.404 1.00 49.03  ? 9   LEU B CA  1 
ATOM   4255 C C   . LEU B 1 12  ? 48.352  -9.904  -65.274 1.00 47.56  ? 9   LEU B C   1 
ATOM   4256 O O   . LEU B 1 12  ? 48.805  -11.049 -65.320 1.00 51.85  ? 9   LEU B O   1 
ATOM   4257 C CB  . LEU B 1 12  ? 49.989  -8.710  -66.760 1.00 47.34  ? 9   LEU B CB  1 
ATOM   4258 C CG  . LEU B 1 12  ? 49.112  -8.553  -68.007 1.00 52.74  ? 9   LEU B CG  1 
ATOM   4259 C CD1 . LEU B 1 12  ? 48.434  -7.190  -68.028 1.00 50.84  ? 9   LEU B CD1 1 
ATOM   4260 C CD2 . LEU B 1 12  ? 49.923  -8.761  -69.279 1.00 53.78  ? 9   LEU B CD2 1 
ATOM   4261 N N   . VAL B 1 13  ? 47.060  -9.653  -65.099 1.00 43.92  ? 10  VAL B N   1 
ATOM   4262 C CA  . VAL B 1 13  ? 46.122  -10.747 -64.863 1.00 43.48  ? 10  VAL B CA  1 
ATOM   4263 C C   . VAL B 1 13  ? 44.942  -10.650 -65.804 1.00 40.24  ? 10  VAL B C   1 
ATOM   4264 O O   . VAL B 1 13  ? 44.444  -9.564  -66.055 1.00 45.35  ? 10  VAL B O   1 
ATOM   4265 C CB  . VAL B 1 13  ? 45.604  -10.750 -63.401 1.00 44.64  ? 10  VAL B CB  1 
ATOM   4266 C CG1 . VAL B 1 13  ? 44.558  -11.840 -63.200 1.00 42.25  ? 10  VAL B CG1 1 
ATOM   4267 C CG2 . VAL B 1 13  ? 46.751  -10.936 -62.430 1.00 48.32  ? 10  VAL B CG2 1 
ATOM   4268 N N   . ARG B 1 14  ? 44.486  -11.781 -66.326 1.00 41.04  ? 11  ARG B N   1 
ATOM   4269 C CA  . ARG B 1 14  ? 43.296  -11.777 -67.158 1.00 44.14  ? 11  ARG B CA  1 
ATOM   4270 C C   . ARG B 1 14  ? 42.083  -12.292 -66.392 1.00 42.63  ? 11  ARG B C   1 
ATOM   4271 O O   . ARG B 1 14  ? 42.051  -13.445 -65.958 1.00 40.14  ? 11  ARG B O   1 
ATOM   4272 C CB  . ARG B 1 14  ? 43.513  -12.614 -68.422 1.00 44.28  ? 11  ARG B CB  1 
ATOM   4273 C CG  . ARG B 1 14  ? 42.264  -12.759 -69.280 1.00 47.05  ? 11  ARG B CG  1 
ATOM   4274 C CD  . ARG B 1 14  ? 42.560  -13.444 -70.615 1.00 52.93  ? 11  ARG B CD  1 
ATOM   4275 N NE  . ARG B 1 14  ? 43.485  -12.670 -71.439 1.00 58.44  ? 11  ARG B NE  1 
ATOM   4276 C CZ  . ARG B 1 14  ? 43.122  -11.675 -72.244 1.00 56.97  ? 11  ARG B CZ  1 
ATOM   4277 N NH1 . ARG B 1 14  ? 41.846  -11.325 -72.341 1.00 50.45  ? 11  ARG B NH1 1 
ATOM   4278 N NH2 . ARG B 1 14  ? 44.037  -11.028 -72.954 1.00 60.02  ? 11  ARG B NH2 1 
ATOM   4279 N N   . VAL B 1 15  ? 41.087  -11.427 -66.227 1.00 38.83  ? 12  VAL B N   1 
ATOM   4280 C CA  . VAL B 1 15  ? 39.818  -11.831 -65.636 1.00 38.22  ? 12  VAL B CA  1 
ATOM   4281 C C   . VAL B 1 15  ? 38.770  -11.920 -66.735 1.00 41.33  ? 12  VAL B C   1 
ATOM   4282 O O   . VAL B 1 15  ? 39.051  -11.574 -67.883 1.00 43.76  ? 12  VAL B O   1 
ATOM   4283 C CB  . VAL B 1 15  ? 39.364  -10.856 -64.531 1.00 43.36  ? 12  VAL B CB  1 
ATOM   4284 C CG1 . VAL B 1 15  ? 40.308  -10.937 -63.340 1.00 35.82  ? 12  VAL B CG1 1 
ATOM   4285 C CG2 . VAL B 1 15  ? 39.300  -9.432  -65.058 1.00 35.60  ? 12  VAL B CG2 1 
ATOM   4286 N N   . ARG B 1 16  ? 37.570  -12.384 -66.395 1.00 40.23  ? 13  ARG B N   1 
ATOM   4287 C CA  . ARG B 1 16  ? 36.518  -12.576 -67.393 1.00 41.59  ? 13  ARG B CA  1 
ATOM   4288 C C   . ARG B 1 16  ? 36.210  -11.308 -68.189 1.00 42.67  ? 13  ARG B C   1 
ATOM   4289 O O   . ARG B 1 16  ? 35.825  -11.384 -69.352 1.00 37.13  ? 13  ARG B O   1 
ATOM   4290 C CB  . ARG B 1 16  ? 35.232  -13.087 -66.736 1.00 44.70  ? 13  ARG B CB  1 
ATOM   4291 C CG  . ARG B 1 16  ? 35.216  -14.585 -66.479 1.00 49.74  ? 13  ARG B CG  1 
ATOM   4292 C CD  . ARG B 1 16  ? 33.794  -15.099 -66.278 1.00 54.00  ? 13  ARG B CD  1 
ATOM   4293 N NE  . ARG B 1 16  ? 33.772  -16.415 -65.640 1.00 65.26  ? 13  ARG B NE  1 
ATOM   4294 C CZ  . ARG B 1 16  ? 32.668  -17.032 -65.228 1.00 66.32  ? 13  ARG B CZ  1 
ATOM   4295 N NH1 . ARG B 1 16  ? 31.483  -16.456 -65.389 1.00 68.70  ? 13  ARG B NH1 1 
ATOM   4296 N NH2 . ARG B 1 16  ? 32.748  -18.227 -64.653 1.00 64.37  ? 13  ARG B NH2 1 
ATOM   4297 N N   . GLY B 1 17  ? 36.386  -10.146 -67.570 1.00 39.38  ? 14  GLY B N   1 
ATOM   4298 C CA  . GLY B 1 17  ? 36.090  -8.894  -68.245 1.00 41.19  ? 14  GLY B CA  1 
ATOM   4299 C C   . GLY B 1 17  ? 37.194  -8.397  -69.166 1.00 37.82  ? 14  GLY B C   1 
ATOM   4300 O O   . GLY B 1 17  ? 36.979  -7.490  -69.968 1.00 37.65  ? 14  GLY B O   1 
ATOM   4301 N N   . GLY B 1 18  ? 38.380  -8.983  -69.049 1.00 37.64  ? 15  GLY B N   1 
ATOM   4302 C CA  . GLY B 1 18  ? 39.527  -8.515  -69.806 1.00 38.48  ? 15  GLY B CA  1 
ATOM   4303 C C   . GLY B 1 18  ? 40.781  -8.457  -68.957 1.00 42.99  ? 15  GLY B C   1 
ATOM   4304 O O   . GLY B 1 18  ? 40.833  -9.034  -67.866 1.00 41.41  ? 15  GLY B O   1 
ATOM   4305 N N   . GLN B 1 19  ? 41.790  -7.747  -69.448 1.00 39.90  ? 16  GLN B N   1 
ATOM   4306 C CA  . GLN B 1 19  ? 43.080  -7.694  -68.771 1.00 41.92  ? 16  GLN B CA  1 
ATOM   4307 C C   . GLN B 1 19  ? 43.172  -6.572  -67.744 1.00 41.50  ? 16  GLN B C   1 
ATOM   4308 O O   . GLN B 1 19  ? 42.561  -5.516  -67.902 1.00 38.63  ? 16  GLN B O   1 
ATOM   4309 C CB  . GLN B 1 19  ? 44.207  -7.549  -69.795 1.00 42.76  ? 16  GLN B CB  1 
ATOM   4310 C CG  . GLN B 1 19  ? 44.594  -8.863  -70.454 1.00 48.77  ? 16  GLN B CG  1 
ATOM   4311 C CD  . GLN B 1 19  ? 45.696  -8.707  -71.483 1.00 55.62  ? 16  GLN B CD  1 
ATOM   4312 O OE1 . GLN B 1 19  ? 45.861  -7.644  -72.085 1.00 59.91  ? 16  GLN B OE1 1 
ATOM   4313 N NE2 . GLN B 1 19  ? 46.467  -9.768  -71.681 1.00 61.84  ? 16  GLN B NE2 1 
ATOM   4314 N N   . LEU B 1 20  ? 43.946  -6.832  -66.693 1.00 38.47  ? 17  LEU B N   1 
ATOM   4315 C CA  . LEU B 1 20  ? 44.224  -5.886  -65.619 1.00 39.95  ? 17  LEU B CA  1 
ATOM   4316 C C   . LEU B 1 20  ? 45.721  -5.786  -65.385 1.00 39.82  ? 17  LEU B C   1 
ATOM   4317 O O   . LEU B 1 20  ? 46.439  -6.789  -65.488 1.00 43.75  ? 17  LEU B O   1 
ATOM   4318 C CB  . LEU B 1 20  ? 43.564  -6.316  -64.300 1.00 42.96  ? 17  LEU B CB  1 
ATOM   4319 C CG  . LEU B 1 20  ? 42.067  -6.562  -64.161 1.00 42.66  ? 17  LEU B CG  1 
ATOM   4320 C CD1 . LEU B 1 20  ? 41.809  -7.260  -62.831 1.00 37.04  ? 17  LEU B CD1 1 
ATOM   4321 C CD2 . LEU B 1 20  ? 41.311  -5.246  -64.228 1.00 42.18  ? 17  LEU B CD2 1 
ATOM   4322 N N   . ARG B 1 21  ? 46.184  -4.589  -65.038 1.00 39.66  ? 18  ARG B N   1 
ATOM   4323 C CA  . ARG B 1 21  ? 47.556  -4.421  -64.575 1.00 44.54  ? 18  ARG B CA  1 
ATOM   4324 C C   . ARG B 1 21  ? 47.571  -3.971  -63.123 1.00 42.80  ? 18  ARG B C   1 
ATOM   4325 O O   . ARG B 1 21  ? 47.014  -2.927  -62.785 1.00 40.53  ? 18  ARG B O   1 
ATOM   4326 C CB  . ARG B 1 21  ? 48.319  -3.410  -65.429 1.00 44.74  ? 18  ARG B CB  1 
ATOM   4327 C CG  . ARG B 1 21  ? 49.776  -3.251  -65.005 1.00 50.27  ? 18  ARG B CG  1 
ATOM   4328 C CD  . ARG B 1 21  ? 50.497  -2.179  -65.811 1.00 55.07  ? 18  ARG B CD  1 
ATOM   4329 N NE  . ARG B 1 21  ? 50.304  -2.356  -67.246 1.00 59.75  ? 18  ARG B NE  1 
ATOM   4330 C CZ  . ARG B 1 21  ? 49.503  -1.599  -67.990 1.00 61.57  ? 18  ARG B CZ  1 
ATOM   4331 N NH1 . ARG B 1 21  ? 48.821  -0.604  -67.430 1.00 56.20  ? 18  ARG B NH1 1 
ATOM   4332 N NH2 . ARG B 1 21  ? 49.385  -1.838  -69.290 1.00 57.72  ? 18  ARG B NH2 1 
ATOM   4333 N N   . GLY B 1 22  ? 48.216  -4.761  -62.272 1.00 41.83  ? 19  GLY B N   1 
ATOM   4334 C CA  . GLY B 1 22  ? 48.314  -4.437  -60.864 1.00 42.09  ? 19  GLY B CA  1 
ATOM   4335 C C   . GLY B 1 22  ? 49.579  -3.671  -60.547 1.00 44.67  ? 19  GLY B C   1 
ATOM   4336 O O   . GLY B 1 22  ? 50.239  -3.142  -61.440 1.00 40.48  ? 19  GLY B O   1 
ATOM   4337 N N   . ILE B 1 23  ? 49.919  -3.625  -59.265 1.00 40.47  ? 20  ILE B N   1 
ATOM   4338 C CA  . ILE B 1 23  ? 51.061  -2.866  -58.785 1.00 42.49  ? 20  ILE B CA  1 
ATOM   4339 C C   . ILE B 1 23  ? 51.773  -3.617  -57.656 1.00 48.70  ? 20  ILE B C   1 
ATOM   4340 O O   . ILE B 1 23  ? 51.138  -4.255  -56.809 1.00 46.34  ? 20  ILE B O   1 
ATOM   4341 C CB  . ILE B 1 23  ? 50.632  -1.460  -58.306 1.00 42.62  ? 20  ILE B CB  1 
ATOM   4342 C CG1 . ILE B 1 23  ? 51.849  -0.638  -57.880 1.00 46.97  ? 20  ILE B CG1 1 
ATOM   4343 C CG2 . ILE B 1 23  ? 49.601  -1.555  -57.180 1.00 41.72  ? 20  ILE B CG2 1 
ATOM   4344 C CD1 . ILE B 1 23  ? 51.509  0.751   -57.411 1.00 45.70  ? 20  ILE B CD1 1 
ATOM   4345 N N   . ARG B 1 24  ? 53.099  -3.548  -57.669 1.00 51.23  ? 21  ARG B N   1 
ATOM   4346 C CA  . ARG B 1 24  ? 53.931  -4.219  -56.681 1.00 49.01  ? 21  ARG B CA  1 
ATOM   4347 C C   . ARG B 1 24  ? 54.109  -3.329  -55.458 1.00 50.47  ? 21  ARG B C   1 
ATOM   4348 O O   . ARG B 1 24  ? 54.687  -2.246  -55.549 1.00 49.63  ? 21  ARG B O   1 
ATOM   4349 C CB  . ARG B 1 24  ? 55.282  -4.579  -57.302 1.00 54.93  ? 21  ARG B CB  1 
ATOM   4350 C CG  . ARG B 1 24  ? 56.252  -5.313  -56.398 1.00 57.81  ? 21  ARG B CG  1 
ATOM   4351 C CD  . ARG B 1 24  ? 57.531  -5.631  -57.164 1.00 59.65  ? 21  ARG B CD  1 
ATOM   4352 N NE  . ARG B 1 24  ? 58.517  -6.326  -56.344 1.00 68.89  ? 21  ARG B NE  1 
ATOM   4353 C CZ  . ARG B 1 24  ? 59.406  -5.714  -55.569 1.00 77.84  ? 21  ARG B CZ  1 
ATOM   4354 N NH1 . ARG B 1 24  ? 59.434  -4.388  -55.508 1.00 79.81  ? 21  ARG B NH1 1 
ATOM   4355 N NH2 . ARG B 1 24  ? 60.268  -6.427  -54.854 1.00 76.86  ? 21  ARG B NH2 1 
ATOM   4356 N N   . LEU B 1 25  ? 53.590  -3.784  -54.319 1.00 47.66  ? 22  LEU B N   1 
ATOM   4357 C CA  . LEU B 1 25  ? 53.646  -3.019  -53.077 1.00 49.45  ? 22  LEU B CA  1 
ATOM   4358 C C   . LEU B 1 25  ? 54.689  -3.571  -52.119 1.00 50.77  ? 22  LEU B C   1 
ATOM   4359 O O   . LEU B 1 25  ? 54.977  -4.769  -52.122 1.00 50.77  ? 22  LEU B O   1 
ATOM   4360 C CB  . LEU B 1 25  ? 52.287  -3.014  -52.379 1.00 48.84  ? 22  LEU B CB  1 
ATOM   4361 C CG  . LEU B 1 25  ? 51.089  -2.395  -53.094 1.00 49.46  ? 22  LEU B CG  1 
ATOM   4362 C CD1 . LEU B 1 25  ? 49.892  -2.422  -52.158 1.00 45.93  ? 22  LEU B CD1 1 
ATOM   4363 C CD2 . LEU B 1 25  ? 51.396  -0.978  -53.550 1.00 49.46  ? 22  LEU B CD2 1 
ATOM   4364 N N   . LYS B 1 26  ? 55.236  -2.690  -51.289 1.00 50.19  ? 23  LYS B N   1 
ATOM   4365 C CA  . LYS B 1 26  ? 56.215  -3.088  -50.290 1.00 52.72  ? 23  LYS B CA  1 
ATOM   4366 C C   . LYS B 1 26  ? 55.570  -3.303  -48.927 1.00 55.12  ? 23  LYS B C   1 
ATOM   4367 O O   . LYS B 1 26  ? 55.036  -2.373  -48.323 1.00 53.31  ? 23  LYS B O   1 
ATOM   4368 C CB  . LYS B 1 26  ? 57.329  -2.045  -50.176 1.00 58.03  ? 23  LYS B CB  1 
ATOM   4369 C CG  . LYS B 1 26  ? 58.409  -2.414  -49.167 1.00 61.82  ? 23  LYS B CG  1 
ATOM   4370 C CD  . LYS B 1 26  ? 59.502  -1.357  -49.098 1.00 70.02  ? 23  LYS B CD  1 
ATOM   4371 C CE  . LYS B 1 26  ? 60.331  -1.490  -47.823 1.00 74.41  ? 23  LYS B CE  1 
ATOM   4372 N NZ  . LYS B 1 26  ? 60.309  -2.872  -47.265 1.00 66.36  ? 23  LYS B NZ  1 
ATOM   4373 N N   . ALA B 1 27  ? 55.613  -4.547  -48.467 1.00 53.68  ? 24  ALA B N   1 
ATOM   4374 C CA  . ALA B 1 27  ? 55.261  -4.902  -47.098 1.00 54.50  ? 24  ALA B CA  1 
ATOM   4375 C C   . ALA B 1 27  ? 56.564  -5.127  -46.334 1.00 55.52  ? 24  ALA B C   1 
ATOM   4376 O O   . ALA B 1 27  ? 57.591  -5.413  -46.953 1.00 59.32  ? 24  ALA B O   1 
ATOM   4377 C CB  . ALA B 1 27  ? 54.376  -6.147  -47.072 1.00 49.18  ? 24  ALA B CB  1 
ATOM   4378 N N   . PRO B 1 28  ? 56.538  -4.990  -44.994 1.00 59.11  ? 25  PRO B N   1 
ATOM   4379 C CA  . PRO B 1 28  ? 57.762  -5.121  -44.191 1.00 54.07  ? 25  PRO B CA  1 
ATOM   4380 C C   . PRO B 1 28  ? 58.584  -6.374  -44.499 1.00 55.68  ? 25  PRO B C   1 
ATOM   4381 O O   . PRO B 1 28  ? 59.810  -6.296  -44.555 1.00 62.31  ? 25  PRO B O   1 
ATOM   4382 C CB  . PRO B 1 28  ? 57.228  -5.168  -42.759 1.00 56.93  ? 25  PRO B CB  1 
ATOM   4383 C CG  . PRO B 1 28  ? 55.980  -4.367  -42.813 1.00 55.17  ? 25  PRO B CG  1 
ATOM   4384 C CD  . PRO B 1 28  ? 55.371  -4.654  -44.156 1.00 55.90  ? 25  PRO B CD  1 
ATOM   4385 N N   . GLY B 1 29  ? 57.920  -7.504  -44.716 1.00 54.95  ? 26  GLY B N   1 
ATOM   4386 C CA  . GLY B 1 29  ? 58.618  -8.751  -44.970 1.00 53.37  ? 26  GLY B CA  1 
ATOM   4387 C C   . GLY B 1 29  ? 58.952  -9.012  -46.427 1.00 55.42  ? 26  GLY B C   1 
ATOM   4388 O O   . GLY B 1 29  ? 59.670  -9.959  -46.743 1.00 53.78  ? 26  GLY B O   1 
ATOM   4389 N N   . GLY B 1 30  ? 58.432  -8.179  -47.322 1.00 55.42  ? 27  GLY B N   1 
ATOM   4390 C CA  . GLY B 1 30  ? 58.658  -8.375  -48.745 1.00 54.64  ? 27  GLY B CA  1 
ATOM   4391 C C   . GLY B 1 30  ? 57.540  -7.816  -49.602 1.00 54.36  ? 27  GLY B C   1 
ATOM   4392 O O   . GLY B 1 30  ? 56.651  -7.140  -49.097 1.00 53.57  ? 27  GLY B O   1 
ATOM   4393 N N   . PRO B 1 31  ? 57.575  -8.097  -50.912 1.00 52.55  ? 28  PRO B N   1 
ATOM   4394 C CA  . PRO B 1 31  ? 56.599  -7.530  -51.848 1.00 52.74  ? 28  PRO B CA  1 
ATOM   4395 C C   . PRO B 1 31  ? 55.276  -8.292  -51.906 1.00 52.78  ? 28  PRO B C   1 
ATOM   4396 O O   . PRO B 1 31  ? 55.246  -9.503  -51.679 1.00 52.06  ? 28  PRO B O   1 
ATOM   4397 C CB  . PRO B 1 31  ? 57.323  -7.626  -53.189 1.00 53.91  ? 28  PRO B CB  1 
ATOM   4398 C CG  . PRO B 1 31  ? 58.140  -8.869  -53.053 1.00 57.00  ? 28  PRO B CG  1 
ATOM   4399 C CD  . PRO B 1 31  ? 58.582  -8.922  -51.603 1.00 52.57  ? 28  PRO B CD  1 
ATOM   4400 N N   . VAL B 1 32  ? 54.193  -7.577  -52.200 1.00 51.23  ? 29  VAL B N   1 
ATOM   4401 C CA  . VAL B 1 32  ? 52.916  -8.209  -52.525 1.00 47.39  ? 29  VAL B CA  1 
ATOM   4402 C C   . VAL B 1 32  ? 52.373  -7.622  -53.818 1.00 47.87  ? 29  VAL B C   1 
ATOM   4403 O O   . VAL B 1 32  ? 52.767  -6.533  -54.222 1.00 46.72  ? 29  VAL B O   1 
ATOM   4404 C CB  . VAL B 1 32  ? 51.858  -8.026  -51.415 1.00 44.11  ? 29  VAL B CB  1 
ATOM   4405 C CG1 . VAL B 1 32  ? 52.387  -8.524  -50.086 1.00 44.11  ? 29  VAL B CG1 1 
ATOM   4406 C CG2 . VAL B 1 32  ? 51.433  -6.572  -51.315 1.00 40.61  ? 29  VAL B CG2 1 
ATOM   4407 N N   . SER B 1 33  ? 51.476  -8.348  -54.472 1.00 46.18  ? 30  SER B N   1 
ATOM   4408 C CA  . SER B 1 33  ? 50.789  -7.807  -55.632 1.00 44.80  ? 30  SER B CA  1 
ATOM   4409 C C   . SER B 1 33  ? 49.444  -7.238  -55.204 1.00 46.21  ? 30  SER B C   1 
ATOM   4410 O O   . SER B 1 33  ? 48.724  -7.844  -54.407 1.00 48.50  ? 30  SER B O   1 
ATOM   4411 C CB  . SER B 1 33  ? 50.605  -8.873  -56.710 1.00 47.47  ? 30  SER B CB  1 
ATOM   4412 O OG  . SER B 1 33  ? 51.840  -9.484  -57.039 1.00 50.89  ? 30  SER B OG  1 
ATOM   4413 N N   . ALA B 1 34  ? 49.129  -6.056  -55.717 1.00 39.81  ? 31  ALA B N   1 
ATOM   4414 C CA  . ALA B 1 34  ? 47.856  -5.409  -55.447 1.00 34.36  ? 31  ALA B CA  1 
ATOM   4415 C C   . ALA B 1 34  ? 47.141  -5.072  -56.748 1.00 43.86  ? 31  ALA B C   1 
ATOM   4416 O O   . ALA B 1 34  ? 47.744  -4.564  -57.682 1.00 43.20  ? 31  ALA B O   1 
ATOM   4417 C CB  . ALA B 1 34  ? 48.062  -4.162  -54.630 1.00 36.00  ? 31  ALA B CB  1 
ATOM   4418 N N   . PHE B 1 35  ? 45.851  -5.361  -56.795 1.00 39.83  ? 32  PHE B N   1 
ATOM   4419 C CA  . PHE B 1 35  ? 45.007  -5.042  -57.930 1.00 38.60  ? 32  PHE B CA  1 
ATOM   4420 C C   . PHE B 1 35  ? 43.850  -4.210  -57.401 1.00 40.15  ? 32  PHE B C   1 
ATOM   4421 O O   . PHE B 1 35  ? 42.853  -4.742  -56.910 1.00 37.80  ? 32  PHE B O   1 
ATOM   4422 C CB  . PHE B 1 35  ? 44.539  -6.319  -58.620 1.00 38.87  ? 32  PHE B CB  1 
ATOM   4423 C CG  . PHE B 1 35  ? 45.672  -7.206  -59.053 1.00 44.64  ? 32  PHE B CG  1 
ATOM   4424 C CD1 . PHE B 1 35  ? 46.249  -8.104  -58.167 1.00 41.75  ? 32  PHE B CD1 1 
ATOM   4425 C CD2 . PHE B 1 35  ? 46.183  -7.118  -60.337 1.00 42.52  ? 32  PHE B CD2 1 
ATOM   4426 C CE1 . PHE B 1 35  ? 47.302  -8.907  -58.557 1.00 44.98  ? 32  PHE B CE1 1 
ATOM   4427 C CE2 . PHE B 1 35  ? 47.236  -7.918  -60.734 1.00 48.01  ? 32  PHE B CE2 1 
ATOM   4428 C CZ  . PHE B 1 35  ? 47.796  -8.814  -59.844 1.00 47.34  ? 32  PHE B CZ  1 
ATOM   4429 N N   . LEU B 1 36  ? 44.021  -2.893  -57.478 1.00 35.80  ? 33  LEU B N   1 
ATOM   4430 C CA  . LEU B 1 36  ? 43.146  -1.946  -56.805 1.00 33.75  ? 33  LEU B CA  1 
ATOM   4431 C C   . LEU B 1 36  ? 42.199  -1.255  -57.778 1.00 39.40  ? 33  LEU B C   1 
ATOM   4432 O O   . LEU B 1 36  ? 42.595  -0.871  -58.879 1.00 36.63  ? 33  LEU B O   1 
ATOM   4433 C CB  . LEU B 1 36  ? 43.982  -0.900  -56.063 1.00 32.41  ? 33  LEU B CB  1 
ATOM   4434 C CG  . LEU B 1 36  ? 45.072  -1.437  -55.126 1.00 36.37  ? 33  LEU B CG  1 
ATOM   4435 C CD1 . LEU B 1 36  ? 45.794  -0.295  -54.422 1.00 35.84  ? 33  LEU B CD1 1 
ATOM   4436 C CD2 . LEU B 1 36  ? 44.489  -2.409  -54.107 1.00 33.61  ? 33  LEU B CD2 1 
ATOM   4437 N N   . GLY B 1 37  ? 40.949  -1.092  -57.361 1.00 36.16  ? 34  GLY B N   1 
ATOM   4438 C CA  . GLY B 1 37  ? 39.968  -0.379  -58.155 1.00 34.12  ? 34  GLY B CA  1 
ATOM   4439 C C   . GLY B 1 37  ? 39.466  -1.163  -59.349 1.00 38.17  ? 34  GLY B C   1 
ATOM   4440 O O   . GLY B 1 37  ? 39.284  -0.607  -60.432 1.00 33.93  ? 34  GLY B O   1 
ATOM   4441 N N   . ILE B 1 38  ? 39.236  -2.457  -59.155 1.00 32.59  ? 35  ILE B N   1 
ATOM   4442 C CA  . ILE B 1 38  ? 38.672  -3.290  -60.212 1.00 33.27  ? 35  ILE B CA  1 
ATOM   4443 C C   . ILE B 1 38  ? 37.160  -3.120  -60.259 1.00 34.03  ? 35  ILE B C   1 
ATOM   4444 O O   . ILE B 1 38  ? 36.486  -3.348  -59.260 1.00 32.76  ? 35  ILE B O   1 
ATOM   4445 C CB  . ILE B 1 38  ? 38.997  -4.779  -60.003 1.00 31.70  ? 35  ILE B CB  1 
ATOM   4446 C CG1 . ILE B 1 38  ? 40.488  -4.970  -59.726 1.00 31.49  ? 35  ILE B CG1 1 
ATOM   4447 C CG2 . ILE B 1 38  ? 38.540  -5.601  -61.209 1.00 32.34  ? 35  ILE B CG2 1 
ATOM   4448 C CD1 . ILE B 1 38  ? 40.872  -6.419  -59.480 1.00 34.28  ? 35  ILE B CD1 1 
ATOM   4449 N N   . PRO B 1 39  ? 36.617  -2.720  -61.420 1.00 35.93  ? 36  PRO B N   1 
ATOM   4450 C CA  . PRO B 1 39  ? 35.161  -2.563  -61.521 1.00 32.64  ? 36  PRO B CA  1 
ATOM   4451 C C   . PRO B 1 39  ? 34.452  -3.908  -61.502 1.00 32.58  ? 36  PRO B C   1 
ATOM   4452 O O   . PRO B 1 39  ? 34.863  -4.810  -62.230 1.00 33.29  ? 36  PRO B O   1 
ATOM   4453 C CB  . PRO B 1 39  ? 34.973  -1.860  -62.873 1.00 35.78  ? 36  PRO B CB  1 
ATOM   4454 C CG  . PRO B 1 39  ? 36.164  -2.269  -63.674 1.00 32.89  ? 36  PRO B CG  1 
ATOM   4455 C CD  . PRO B 1 39  ? 37.301  -2.401  -62.688 1.00 35.22  ? 36  PRO B CD  1 
ATOM   4456 N N   . PHE B 1 40  ? 33.418  -4.055  -60.676 1.00 31.01  ? 37  PHE B N   1 
ATOM   4457 C CA  . PHE B 1 40  ? 32.680  -5.311  -60.659 1.00 30.57  ? 37  PHE B CA  1 
ATOM   4458 C C   . PHE B 1 40  ? 31.220  -5.093  -61.029 1.00 27.88  ? 37  PHE B C   1 
ATOM   4459 O O   . PHE B 1 40  ? 30.469  -6.050  -61.212 1.00 31.80  ? 37  PHE B O   1 
ATOM   4460 C CB  . PHE B 1 40  ? 32.809  -6.018  -59.290 1.00 29.98  ? 37  PHE B CB  1 
ATOM   4461 C CG  . PHE B 1 40  ? 32.136  -5.303  -58.137 1.00 28.46  ? 37  PHE B CG  1 
ATOM   4462 C CD1 . PHE B 1 40  ? 30.814  -5.570  -57.809 1.00 31.63  ? 37  PHE B CD1 1 
ATOM   4463 C CD2 . PHE B 1 40  ? 32.843  -4.407  -57.351 1.00 27.45  ? 37  PHE B CD2 1 
ATOM   4464 C CE1 . PHE B 1 40  ? 30.197  -4.934  -56.729 1.00 30.58  ? 37  PHE B CE1 1 
ATOM   4465 C CE2 . PHE B 1 40  ? 32.235  -3.763  -56.270 1.00 30.87  ? 37  PHE B CE2 1 
ATOM   4466 C CZ  . PHE B 1 40  ? 30.909  -4.028  -55.961 1.00 28.31  ? 37  PHE B CZ  1 
ATOM   4467 N N   . ALA B 1 41  ? 30.824  -3.835  -61.168 1.00 30.43  ? 38  ALA B N   1 
ATOM   4468 C CA  . ALA B 1 41  ? 29.470  -3.521  -61.614 1.00 32.97  ? 38  ALA B CA  1 
ATOM   4469 C C   . ALA B 1 41  ? 29.453  -2.345  -62.581 1.00 31.94  ? 38  ALA B C   1 
ATOM   4470 O O   . ALA B 1 41  ? 30.382  -1.538  -62.599 1.00 30.07  ? 38  ALA B O   1 
ATOM   4471 C CB  . ALA B 1 41  ? 28.574  -3.217  -60.413 1.00 27.46  ? 38  ALA B CB  1 
ATOM   4472 N N   . GLU B 1 42  ? 28.390  -2.242  -63.373 1.00 31.39  ? 39  GLU B N   1 
ATOM   4473 C CA  . GLU B 1 42  ? 28.116  -0.998  -64.081 1.00 35.97  ? 39  GLU B CA  1 
ATOM   4474 C C   . GLU B 1 42  ? 27.950  0.101   -63.041 1.00 35.94  ? 39  GLU B C   1 
ATOM   4475 O O   . GLU B 1 42  ? 27.316  -0.123  -62.012 1.00 33.25  ? 39  GLU B O   1 
ATOM   4476 C CB  . GLU B 1 42  ? 26.858  -1.106  -64.945 1.00 34.67  ? 39  GLU B CB  1 
ATOM   4477 C CG  . GLU B 1 42  ? 26.972  -2.088  -66.104 1.00 34.35  ? 39  GLU B CG  1 
ATOM   4478 C CD  . GLU B 1 42  ? 28.034  -1.681  -67.110 1.00 38.66  ? 39  GLU B CD  1 
ATOM   4479 O OE1 . GLU B 1 42  ? 27.742  -0.824  -67.977 1.00 40.24  ? 39  GLU B OE1 1 
ATOM   4480 O OE2 . GLU B 1 42  ? 29.162  -2.215  -67.031 1.00 34.53  ? 39  GLU B OE2 1 
ATOM   4481 N N   . PRO B 1 43  ? 28.537  1.280   -63.291 1.00 35.80  ? 40  PRO B N   1 
ATOM   4482 C CA  . PRO B 1 43  ? 28.367  2.395   -62.354 1.00 29.31  ? 40  PRO B CA  1 
ATOM   4483 C C   . PRO B 1 43  ? 26.888  2.689   -62.110 1.00 35.54  ? 40  PRO B C   1 
ATOM   4484 O O   . PRO B 1 43  ? 26.140  2.892   -63.064 1.00 31.50  ? 40  PRO B O   1 
ATOM   4485 C CB  . PRO B 1 43  ? 29.064  3.561   -63.059 1.00 32.61  ? 40  PRO B CB  1 
ATOM   4486 C CG  . PRO B 1 43  ? 30.093  2.905   -63.927 1.00 32.96  ? 40  PRO B CG  1 
ATOM   4487 C CD  . PRO B 1 43  ? 29.456  1.613   -64.395 1.00 33.21  ? 40  PRO B CD  1 
ATOM   4488 N N   . PRO B 1 44  ? 26.467  2.677   -60.834 1.00 33.61  ? 41  PRO B N   1 
ATOM   4489 C CA  . PRO B 1 44  ? 25.070  2.875   -60.437 1.00 30.39  ? 41  PRO B CA  1 
ATOM   4490 C C   . PRO B 1 44  ? 24.674  4.347   -60.474 1.00 35.94  ? 41  PRO B C   1 
ATOM   4491 O O   . PRO B 1 44  ? 24.267  4.899   -59.452 1.00 34.07  ? 41  PRO B O   1 
ATOM   4492 C CB  . PRO B 1 44  ? 25.042  2.339   -59.001 1.00 35.48  ? 41  PRO B CB  1 
ATOM   4493 C CG  . PRO B 1 44  ? 26.408  2.659   -58.483 1.00 33.64  ? 41  PRO B CG  1 
ATOM   4494 C CD  . PRO B 1 44  ? 27.349  2.490   -59.667 1.00 33.93  ? 41  PRO B CD  1 
ATOM   4495 N N   . VAL B 1 45  ? 24.797  4.974   -61.642 1.00 35.26  ? 42  VAL B N   1 
ATOM   4496 C CA  . VAL B 1 45  ? 24.519  6.398   -61.769 1.00 31.36  ? 42  VAL B CA  1 
ATOM   4497 C C   . VAL B 1 45  ? 23.259  6.666   -62.587 1.00 36.25  ? 42  VAL B C   1 
ATOM   4498 O O   . VAL B 1 45  ? 22.744  5.775   -63.267 1.00 35.29  ? 42  VAL B O   1 
ATOM   4499 C CB  . VAL B 1 45  ? 25.706  7.139   -62.408 1.00 35.91  ? 42  VAL B CB  1 
ATOM   4500 C CG1 . VAL B 1 45  ? 26.962  6.951   -61.557 1.00 34.41  ? 42  VAL B CG1 1 
ATOM   4501 C CG2 . VAL B 1 45  ? 25.933  6.655   -63.838 1.00 34.49  ? 42  VAL B CG2 1 
ATOM   4502 N N   . GLY B 1 46  ? 22.764  7.897   -62.507 1.00 39.04  ? 43  GLY B N   1 
ATOM   4503 C CA  . GLY B 1 46  ? 21.570  8.295   -63.230 1.00 38.93  ? 43  GLY B CA  1 
ATOM   4504 C C   . GLY B 1 46  ? 20.378  7.426   -62.889 1.00 41.56  ? 43  GLY B C   1 
ATOM   4505 O O   . GLY B 1 46  ? 19.934  7.372   -61.737 1.00 40.26  ? 43  GLY B O   1 
ATOM   4506 N N   . SER B 1 47  ? 19.871  6.725   -63.896 1.00 36.19  ? 44  SER B N   1 
ATOM   4507 C CA  . SER B 1 47  ? 18.693  5.884   -63.723 1.00 41.44  ? 44  SER B CA  1 
ATOM   4508 C C   . SER B 1 47  ? 18.992  4.606   -62.940 1.00 37.74  ? 44  SER B C   1 
ATOM   4509 O O   . SER B 1 47  ? 18.070  3.892   -62.545 1.00 39.31  ? 44  SER B O   1 
ATOM   4510 C CB  . SER B 1 47  ? 18.100  5.517   -65.082 1.00 35.88  ? 44  SER B CB  1 
ATOM   4511 O OG  . SER B 1 47  ? 18.906  4.541   -65.720 1.00 42.62  ? 44  SER B OG  1 
ATOM   4512 N N   . ARG B 1 48  ? 20.272  4.306   -62.732 1.00 36.64  ? 45  ARG B N   1 
ATOM   4513 C CA  . ARG B 1 48  ? 20.652  3.119   -61.971 1.00 34.67  ? 45  ARG B CA  1 
ATOM   4514 C C   . ARG B 1 48  ? 20.704  3.398   -60.467 1.00 35.13  ? 45  ARG B C   1 
ATOM   4515 O O   . ARG B 1 48  ? 20.961  2.489   -59.676 1.00 36.92  ? 45  ARG B O   1 
ATOM   4516 C CB  . ARG B 1 48  ? 22.007  2.577   -62.441 1.00 34.33  ? 45  ARG B CB  1 
ATOM   4517 C CG  . ARG B 1 48  ? 22.026  2.058   -63.885 1.00 38.47  ? 45  ARG B CG  1 
ATOM   4518 C CD  . ARG B 1 48  ? 23.384  1.446   -64.224 1.00 39.80  ? 45  ARG B CD  1 
ATOM   4519 N NE  . ARG B 1 48  ? 23.568  1.264   -65.665 1.00 53.75  ? 45  ARG B NE  1 
ATOM   4520 C CZ  . ARG B 1 48  ? 24.514  1.858   -66.389 1.00 44.91  ? 45  ARG B CZ  1 
ATOM   4521 N NH1 . ARG B 1 48  ? 25.397  2.672   -65.818 1.00 36.07  ? 45  ARG B NH1 1 
ATOM   4522 N NH2 . ARG B 1 48  ? 24.587  1.623   -67.693 1.00 52.00  ? 45  ARG B NH2 1 
ATOM   4523 N N   . ARG B 1 49  ? 20.474  4.648   -60.072 1.00 35.01  ? 46  ARG B N   1 
ATOM   4524 C CA  . ARG B 1 49  ? 20.434  4.990   -58.649 1.00 34.66  ? 46  ARG B CA  1 
ATOM   4525 C C   . ARG B 1 49  ? 19.277  4.248   -57.987 1.00 35.16  ? 46  ARG B C   1 
ATOM   4526 O O   . ARG B 1 49  ? 18.179  4.191   -58.543 1.00 34.27  ? 46  ARG B O   1 
ATOM   4527 C CB  . ARG B 1 49  ? 20.299  6.505   -58.445 1.00 33.29  ? 46  ARG B CB  1 
ATOM   4528 C CG  . ARG B 1 49  ? 20.465  6.962   -56.994 1.00 36.10  ? 46  ARG B CG  1 
ATOM   4529 C CD  . ARG B 1 49  ? 20.092  8.427   -56.804 1.00 37.98  ? 46  ARG B CD  1 
ATOM   4530 N NE  . ARG B 1 49  ? 21.229  9.337   -56.940 1.00 32.73  ? 46  ARG B NE  1 
ATOM   4531 C CZ  . ARG B 1 49  ? 21.118  10.661  -56.916 1.00 33.58  ? 46  ARG B CZ  1 
ATOM   4532 N NH1 . ARG B 1 49  ? 19.925  11.220  -56.772 1.00 35.83  ? 46  ARG B NH1 1 
ATOM   4533 N NH2 . ARG B 1 49  ? 22.193  11.427  -57.042 1.00 31.34  ? 46  ARG B NH2 1 
ATOM   4534 N N   . PHE B 1 50  ? 19.556  3.667   -56.817 1.00 35.07  ? 47  PHE B N   1 
ATOM   4535 C CA  . PHE B 1 50  ? 18.604  2.886   -56.003 1.00 32.18  ? 47  PHE B CA  1 
ATOM   4536 C C   . PHE B 1 50  ? 18.318  1.500   -56.567 1.00 36.19  ? 47  PHE B C   1 
ATOM   4537 O O   . PHE B 1 50  ? 17.602  0.718   -55.942 1.00 35.20  ? 47  PHE B O   1 
ATOM   4538 C CB  . PHE B 1 50  ? 17.271  3.625   -55.826 1.00 33.39  ? 47  PHE B CB  1 
ATOM   4539 C CG  . PHE B 1 50  ? 17.412  5.028   -55.322 1.00 35.18  ? 47  PHE B CG  1 
ATOM   4540 C CD1 . PHE B 1 50  ? 18.204  5.311   -54.219 1.00 34.39  ? 47  PHE B CD1 1 
ATOM   4541 C CD2 . PHE B 1 50  ? 16.746  6.069   -55.950 1.00 35.03  ? 47  PHE B CD2 1 
ATOM   4542 C CE1 . PHE B 1 50  ? 18.332  6.606   -53.756 1.00 31.88  ? 47  PHE B CE1 1 
ATOM   4543 C CE2 . PHE B 1 50  ? 16.867  7.366   -55.492 1.00 38.70  ? 47  PHE B CE2 1 
ATOM   4544 C CZ  . PHE B 1 50  ? 17.660  7.636   -54.391 1.00 37.59  ? 47  PHE B CZ  1 
ATOM   4545 N N   . MET B 1 51  ? 18.866  1.195   -57.742 1.00 31.22  ? 48  MET B N   1 
ATOM   4546 C CA  . MET B 1 51  ? 18.605  -0.082  -58.400 1.00 33.84  ? 48  MET B CA  1 
ATOM   4547 C C   . MET B 1 51  ? 19.675  -1.118  -58.077 1.00 30.72  ? 48  MET B C   1 
ATOM   4548 O O   . MET B 1 51  ? 20.811  -0.760  -57.765 1.00 31.19  ? 48  MET B O   1 
ATOM   4549 C CB  . MET B 1 51  ? 18.518  0.104   -59.928 1.00 33.07  ? 48  MET B CB  1 
ATOM   4550 C CG  . MET B 1 51  ? 17.416  1.046   -60.394 1.00 33.90  ? 48  MET B CG  1 
ATOM   4551 S SD  . MET B 1 51  ? 17.003  0.777   -62.128 1.00 52.85  ? 48  MET B SD  1 
ATOM   4552 C CE  . MET B 1 51  ? 16.111  -0.772  -62.008 1.00 51.97  ? 48  MET B CE  1 
ATOM   4553 N N   . PRO B 1 52  ? 19.312  -2.408  -58.158 1.00 33.47  ? 49  PRO B N   1 
ATOM   4554 C CA  . PRO B 1 52  ? 20.280  -3.507  -58.051 1.00 35.48  ? 49  PRO B CA  1 
ATOM   4555 C C   . PRO B 1 52  ? 21.449  -3.343  -59.020 1.00 38.79  ? 49  PRO B C   1 
ATOM   4556 O O   . PRO B 1 52  ? 21.262  -2.830  -60.125 1.00 36.14  ? 49  PRO B O   1 
ATOM   4557 C CB  . PRO B 1 52  ? 19.449  -4.743  -58.414 1.00 35.34  ? 49  PRO B CB  1 
ATOM   4558 C CG  . PRO B 1 52  ? 18.064  -4.379  -58.028 1.00 39.68  ? 49  PRO B CG  1 
ATOM   4559 C CD  . PRO B 1 52  ? 17.933  -2.905  -58.312 1.00 33.71  ? 49  PRO B CD  1 
ATOM   4560 N N   . PRO B 1 53  ? 22.649  -3.778  -58.611 1.00 36.21  ? 50  PRO B N   1 
ATOM   4561 C CA  . PRO B 1 53  ? 23.825  -3.636  -59.471 1.00 32.66  ? 50  PRO B CA  1 
ATOM   4562 C C   . PRO B 1 53  ? 23.762  -4.581  -60.660 1.00 36.07  ? 50  PRO B C   1 
ATOM   4563 O O   . PRO B 1 53  ? 23.263  -5.696  -60.520 1.00 32.25  ? 50  PRO B O   1 
ATOM   4564 C CB  . PRO B 1 53  ? 24.982  -4.009  -58.547 1.00 34.48  ? 50  PRO B CB  1 
ATOM   4565 C CG  . PRO B 1 53  ? 24.369  -4.969  -57.570 1.00 32.72  ? 50  PRO B CG  1 
ATOM   4566 C CD  . PRO B 1 53  ? 22.962  -4.483  -57.356 1.00 32.96  ? 50  PRO B CD  1 
ATOM   4567 N N   . GLU B 1 54  ? 24.251  -4.129  -61.812 1.00 32.84  ? 51  GLU B N   1 
ATOM   4568 C CA  . GLU B 1 54  ? 24.410  -4.996  -62.974 1.00 34.42  ? 51  GLU B CA  1 
ATOM   4569 C C   . GLU B 1 54  ? 25.889  -5.325  -63.139 1.00 31.41  ? 51  GLU B C   1 
ATOM   4570 O O   . GLU B 1 54  ? 26.736  -4.474  -62.879 1.00 31.93  ? 51  GLU B O   1 
ATOM   4571 C CB  . GLU B 1 54  ? 23.875  -4.320  -64.240 1.00 34.17  ? 51  GLU B CB  1 
ATOM   4572 C CG  . GLU B 1 54  ? 22.469  -3.762  -64.120 1.00 40.00  ? 51  GLU B CG  1 
ATOM   4573 C CD  . GLU B 1 54  ? 22.103  -2.868  -65.294 1.00 54.63  ? 51  GLU B CD  1 
ATOM   4574 O OE1 . GLU B 1 54  ? 22.022  -3.381  -66.433 1.00 61.58  ? 51  GLU B OE1 1 
ATOM   4575 O OE2 . GLU B 1 54  ? 21.915  -1.648  -65.082 1.00 54.91  ? 51  GLU B OE2 1 
ATOM   4576 N N   . PRO B 1 55  ? 26.206  -6.553  -63.580 1.00 30.24  ? 52  PRO B N   1 
ATOM   4577 C CA  . PRO B 1 55  ? 27.610  -6.939  -63.783 1.00 31.51  ? 52  PRO B CA  1 
ATOM   4578 C C   . PRO B 1 55  ? 28.348  -5.998  -64.740 1.00 34.92  ? 52  PRO B C   1 
ATOM   4579 O O   . PRO B 1 55  ? 27.756  -5.510  -65.702 1.00 34.05  ? 52  PRO B O   1 
ATOM   4580 C CB  . PRO B 1 55  ? 27.511  -8.347  -64.382 1.00 32.48  ? 52  PRO B CB  1 
ATOM   4581 C CG  . PRO B 1 55  ? 26.150  -8.834  -64.014 1.00 36.33  ? 52  PRO B CG  1 
ATOM   4582 C CD  . PRO B 1 55  ? 25.274  -7.621  -63.975 1.00 32.88  ? 52  PRO B CD  1 
ATOM   4583 N N   . LYS B 1 56  ? 29.622  -5.745  -64.454 1.00 33.24  ? 53  LYS B N   1 
ATOM   4584 C CA  . LYS B 1 56  ? 30.457  -4.875  -65.272 1.00 31.92  ? 53  LYS B CA  1 
ATOM   4585 C C   . LYS B 1 56  ? 30.652  -5.443  -66.675 1.00 33.24  ? 53  LYS B C   1 
ATOM   4586 O O   . LYS B 1 56  ? 31.006  -6.611  -66.831 1.00 31.18  ? 53  LYS B O   1 
ATOM   4587 C CB  . LYS B 1 56  ? 31.821  -4.665  -64.605 1.00 34.00  ? 53  LYS B CB  1 
ATOM   4588 C CG  . LYS B 1 56  ? 32.833  -3.902  -65.458 1.00 32.93  ? 53  LYS B CG  1 
ATOM   4589 C CD  . LYS B 1 56  ? 32.505  -2.418  -65.531 1.00 29.55  ? 53  LYS B CD  1 
ATOM   4590 C CE  . LYS B 1 56  ? 33.501  -1.676  -66.420 1.00 36.27  ? 53  LYS B CE  1 
ATOM   4591 N NZ  . LYS B 1 56  ? 33.270  -1.926  -67.876 1.00 34.00  ? 53  LYS B NZ  1 
ATOM   4592 N N   . ARG B 1 57  ? 30.418  -4.616  -67.691 1.00 33.87  ? 54  ARG B N   1 
ATOM   4593 C CA  . ARG B 1 57  ? 30.664  -5.025  -69.076 1.00 32.54  ? 54  ARG B CA  1 
ATOM   4594 C C   . ARG B 1 57  ? 32.161  -5.211  -69.325 1.00 31.31  ? 54  ARG B C   1 
ATOM   4595 O O   . ARG B 1 57  ? 32.980  -4.469  -68.779 1.00 31.68  ? 54  ARG B O   1 
ATOM   4596 C CB  . ARG B 1 57  ? 30.093  -3.991  -70.057 1.00 32.67  ? 54  ARG B CB  1 
ATOM   4597 C CG  . ARG B 1 57  ? 28.569  -3.887  -70.071 1.00 34.66  ? 54  ARG B CG  1 
ATOM   4598 C CD  . ARG B 1 57  ? 28.093  -2.728  -70.959 1.00 31.00  ? 54  ARG B CD  1 
ATOM   4599 N NE  . ARG B 1 57  ? 28.684  -1.465  -70.523 1.00 34.43  ? 54  ARG B NE  1 
ATOM   4600 C CZ  . ARG B 1 57  ? 29.516  -0.727  -71.251 1.00 37.42  ? 54  ARG B CZ  1 
ATOM   4601 N NH1 . ARG B 1 57  ? 30.007  0.397   -70.746 1.00 33.15  ? 54  ARG B NH1 1 
ATOM   4602 N NH2 . ARG B 1 57  ? 29.847  -1.103  -72.484 1.00 34.40  ? 54  ARG B NH2 1 
ATOM   4603 N N   . PRO B 1 58  ? 32.523  -6.195  -70.164 1.00 40.00  ? 55  PRO B N   1 
ATOM   4604 C CA  . PRO B 1 58  ? 33.927  -6.414  -70.534 1.00 39.00  ? 55  PRO B CA  1 
ATOM   4605 C C   . PRO B 1 58  ? 34.567  -5.166  -71.145 1.00 36.03  ? 55  PRO B C   1 
ATOM   4606 O O   . PRO B 1 58  ? 33.871  -4.342  -71.733 1.00 37.39  ? 55  PRO B O   1 
ATOM   4607 C CB  . PRO B 1 58  ? 33.851  -7.548  -71.565 1.00 42.43  ? 55  PRO B CB  1 
ATOM   4608 C CG  . PRO B 1 58  ? 32.546  -8.224  -71.299 1.00 45.55  ? 55  PRO B CG  1 
ATOM   4609 C CD  . PRO B 1 58  ? 31.619  -7.133  -70.853 1.00 39.36  ? 55  PRO B CD  1 
ATOM   4610 N N   . TRP B 1 59  ? 35.879  -5.037  -70.991 1.00 37.36  ? 56  TRP B N   1 
ATOM   4611 C CA  . TRP B 1 59  ? 36.614  -3.883  -71.490 1.00 35.89  ? 56  TRP B CA  1 
ATOM   4612 C C   . TRP B 1 59  ? 37.747  -4.298  -72.417 1.00 39.93  ? 56  TRP B C   1 
ATOM   4613 O O   . TRP B 1 59  ? 38.200  -5.448  -72.396 1.00 33.83  ? 56  TRP B O   1 
ATOM   4614 C CB  . TRP B 1 59  ? 37.188  -3.077  -70.332 1.00 37.03  ? 56  TRP B CB  1 
ATOM   4615 C CG  . TRP B 1 59  ? 38.062  -3.902  -69.444 1.00 40.56  ? 56  TRP B CG  1 
ATOM   4616 C CD1 . TRP B 1 59  ? 39.398  -4.144  -69.597 1.00 37.55  ? 56  TRP B CD1 1 
ATOM   4617 C CD2 . TRP B 1 59  ? 37.660  -4.599  -68.261 1.00 37.59  ? 56  TRP B CD2 1 
ATOM   4618 N NE1 . TRP B 1 59  ? 39.851  -4.953  -68.583 1.00 38.79  ? 56  TRP B NE1 1 
ATOM   4619 C CE2 . TRP B 1 59  ? 38.804  -5.243  -67.747 1.00 41.65  ? 56  TRP B CE2 1 
ATOM   4620 C CE3 . TRP B 1 59  ? 36.443  -4.743  -67.587 1.00 36.82  ? 56  TRP B CE3 1 
ATOM   4621 C CZ2 . TRP B 1 59  ? 38.766  -6.019  -66.589 1.00 37.19  ? 56  TRP B CZ2 1 
ATOM   4622 C CZ3 . TRP B 1 59  ? 36.409  -5.514  -66.436 1.00 36.69  ? 56  TRP B CZ3 1 
ATOM   4623 C CH2 . TRP B 1 59  ? 37.563  -6.141  -65.951 1.00 36.98  ? 56  TRP B CH2 1 
ATOM   4624 N N   . SER B 1 60  ? 38.219  -3.339  -73.209 1.00 35.35  ? 57  SER B N   1 
ATOM   4625 C CA  . SER B 1 60  ? 39.313  -3.573  -74.141 1.00 38.66  ? 57  SER B CA  1 
ATOM   4626 C C   . SER B 1 60  ? 40.649  -3.208  -73.508 1.00 37.78  ? 57  SER B C   1 
ATOM   4627 O O   . SER B 1 60  ? 40.700  -2.431  -72.552 1.00 38.43  ? 57  SER B O   1 
ATOM   4628 C CB  . SER B 1 60  ? 39.110  -2.757  -75.423 1.00 37.34  ? 57  SER B CB  1 
ATOM   4629 O OG  . SER B 1 60  ? 39.206  -1.370  -75.135 1.00 38.08  ? 57  SER B OG  1 
ATOM   4630 N N   . GLY B 1 61  ? 41.729  -3.760  -74.054 1.00 35.84  ? 58  GLY B N   1 
ATOM   4631 C CA  . GLY B 1 61  ? 43.067  -3.422  -73.607 1.00 37.07  ? 58  GLY B CA  1 
ATOM   4632 C C   . GLY B 1 61  ? 43.337  -3.841  -72.171 1.00 39.16  ? 58  GLY B C   1 
ATOM   4633 O O   . GLY B 1 61  ? 42.687  -4.744  -71.641 1.00 39.52  ? 58  GLY B O   1 
ATOM   4634 N N   . VAL B 1 62  ? 44.305  -3.175  -71.552 1.00 38.19  ? 59  VAL B N   1 
ATOM   4635 C CA  . VAL B 1 62  ? 44.689  -3.446  -70.175 1.00 39.19  ? 59  VAL B CA  1 
ATOM   4636 C C   . VAL B 1 62  ? 44.159  -2.363  -69.245 1.00 38.28  ? 59  VAL B C   1 
ATOM   4637 O O   . VAL B 1 62  ? 44.574  -1.208  -69.324 1.00 42.21  ? 59  VAL B O   1 
ATOM   4638 C CB  . VAL B 1 62  ? 46.217  -3.528  -70.023 1.00 41.49  ? 59  VAL B CB  1 
ATOM   4639 C CG1 . VAL B 1 62  ? 46.589  -3.926  -68.599 1.00 44.42  ? 59  VAL B CG1 1 
ATOM   4640 C CG2 . VAL B 1 62  ? 46.799  -4.507  -71.035 1.00 43.42  ? 59  VAL B CG2 1 
ATOM   4641 N N   . LEU B 1 63  ? 43.240  -2.742  -68.364 1.00 42.35  ? 60  LEU B N   1 
ATOM   4642 C CA  . LEU B 1 63  ? 42.679  -1.806  -67.394 1.00 38.64  ? 60  LEU B CA  1 
ATOM   4643 C C   . LEU B 1 63  ? 43.660  -1.560  -66.250 1.00 36.96  ? 60  LEU B C   1 
ATOM   4644 O O   . LEU B 1 63  ? 44.210  -2.499  -65.660 1.00 41.53  ? 60  LEU B O   1 
ATOM   4645 C CB  . LEU B 1 63  ? 41.342  -2.332  -66.864 1.00 41.84  ? 60  LEU B CB  1 
ATOM   4646 C CG  . LEU B 1 63  ? 40.465  -1.430  -65.987 1.00 42.98  ? 60  LEU B CG  1 
ATOM   4647 C CD1 . LEU B 1 63  ? 40.253  -0.063  -66.630 1.00 46.05  ? 60  LEU B CD1 1 
ATOM   4648 C CD2 . LEU B 1 63  ? 39.129  -2.106  -65.756 1.00 36.86  ? 60  LEU B CD2 1 
ATOM   4649 N N   . ASP B 1 64  ? 43.888  -0.284  -65.965 1.00 34.63  ? 61  ASP B N   1 
ATOM   4650 C CA  . ASP B 1 64  ? 44.778  0.141   -64.898 1.00 39.65  ? 61  ASP B CA  1 
ATOM   4651 C C   . ASP B 1 64  ? 44.154  -0.170  -63.533 1.00 40.43  ? 61  ASP B C   1 
ATOM   4652 O O   . ASP B 1 64  ? 43.158  0.439   -63.148 1.00 38.24  ? 61  ASP B O   1 
ATOM   4653 C CB  . ASP B 1 64  ? 45.072  1.641   -65.034 1.00 41.17  ? 61  ASP B CB  1 
ATOM   4654 C CG  . ASP B 1 64  ? 46.019  2.167   -63.964 1.00 45.52  ? 61  ASP B CG  1 
ATOM   4655 O OD1 . ASP B 1 64  ? 46.364  1.428   -63.024 1.00 49.47  ? 61  ASP B OD1 1 
ATOM   4656 O OD2 . ASP B 1 64  ? 46.414  3.348   -64.056 1.00 55.45  ? 61  ASP B OD2 1 
ATOM   4657 N N   . ALA B 1 65  ? 44.750  -1.111  -62.808 1.00 37.18  ? 62  ALA B N   1 
ATOM   4658 C CA  . ALA B 1 65  ? 44.300  -1.432  -61.455 1.00 37.32  ? 62  ALA B CA  1 
ATOM   4659 C C   . ALA B 1 65  ? 45.425  -1.213  -60.454 1.00 37.04  ? 62  ALA B C   1 
ATOM   4660 O O   . ALA B 1 65  ? 45.752  -2.100  -59.667 1.00 41.79  ? 62  ALA B O   1 
ATOM   4661 C CB  . ALA B 1 65  ? 43.794  -2.869  -61.380 1.00 34.94  ? 62  ALA B CB  1 
ATOM   4662 N N   . THR B 1 66  ? 46.019  -0.027  -60.488 1.00 38.05  ? 63  THR B N   1 
ATOM   4663 C CA  . THR B 1 66  ? 47.157  0.273   -59.628 1.00 39.85  ? 63  THR B CA  1 
ATOM   4664 C C   . THR B 1 66  ? 46.797  1.258   -58.531 1.00 37.63  ? 63  THR B C   1 
ATOM   4665 O O   . THR B 1 66  ? 47.648  1.644   -57.737 1.00 38.67  ? 63  THR B O   1 
ATOM   4666 C CB  . THR B 1 66  ? 48.331  0.868   -60.429 1.00 40.47  ? 63  THR B CB  1 
ATOM   4667 O OG1 . THR B 1 66  ? 47.948  2.147   -60.944 1.00 40.44  ? 63  THR B OG1 1 
ATOM   4668 C CG2 . THR B 1 66  ? 48.737  -0.049  -61.575 1.00 35.70  ? 63  THR B CG2 1 
ATOM   4669 N N   . THR B 1 67  ? 45.539  1.681   -58.493 1.00 39.02  ? 64  THR B N   1 
ATOM   4670 C CA  . THR B 1 67  ? 45.139  2.733   -57.567 1.00 38.50  ? 64  THR B CA  1 
ATOM   4671 C C   . THR B 1 67  ? 43.728  2.515   -57.015 1.00 36.38  ? 64  THR B C   1 
ATOM   4672 O O   . THR B 1 67  ? 42.856  1.983   -57.708 1.00 37.82  ? 64  THR B O   1 
ATOM   4673 C CB  . THR B 1 67  ? 45.220  4.119   -58.256 1.00 42.37  ? 64  THR B CB  1 
ATOM   4674 O OG1 . THR B 1 67  ? 44.873  5.148   -57.323 1.00 56.88  ? 64  THR B OG1 1 
ATOM   4675 C CG2 . THR B 1 67  ? 44.282  4.181   -59.432 1.00 35.67  ? 64  THR B CG2 1 
ATOM   4676 N N   . PHE B 1 68  ? 43.512  2.909   -55.760 1.00 40.38  ? 65  PHE B N   1 
ATOM   4677 C CA  . PHE B 1 68  ? 42.176  2.853   -55.168 1.00 37.97  ? 65  PHE B CA  1 
ATOM   4678 C C   . PHE B 1 68  ? 41.197  3.716   -55.955 1.00 38.84  ? 65  PHE B C   1 
ATOM   4679 O O   . PHE B 1 68  ? 41.533  4.821   -56.376 1.00 40.27  ? 65  PHE B O   1 
ATOM   4680 C CB  . PHE B 1 68  ? 42.189  3.315   -53.705 1.00 36.06  ? 65  PHE B CB  1 
ATOM   4681 C CG  . PHE B 1 68  ? 42.690  2.277   -52.738 1.00 37.42  ? 65  PHE B CG  1 
ATOM   4682 C CD1 . PHE B 1 68  ? 42.080  1.036   -52.654 1.00 36.14  ? 65  PHE B CD1 1 
ATOM   4683 C CD2 . PHE B 1 68  ? 43.753  2.555   -51.895 1.00 39.46  ? 65  PHE B CD2 1 
ATOM   4684 C CE1 . PHE B 1 68  ? 42.533  0.082   -51.760 1.00 38.05  ? 65  PHE B CE1 1 
ATOM   4685 C CE2 . PHE B 1 68  ? 44.212  1.606   -50.996 1.00 37.55  ? 65  PHE B CE2 1 
ATOM   4686 C CZ  . PHE B 1 68  ? 43.601  0.369   -50.928 1.00 36.25  ? 65  PHE B CZ  1 
ATOM   4687 N N   . GLN B 1 69  ? 39.983  3.211   -56.141 1.00 35.87  ? 66  GLN B N   1 
ATOM   4688 C CA  . GLN B 1 69  ? 38.934  3.986   -56.785 1.00 36.02  ? 66  GLN B CA  1 
ATOM   4689 C C   . GLN B 1 69  ? 38.177  4.850   -55.787 1.00 37.81  ? 66  GLN B C   1 
ATOM   4690 O O   . GLN B 1 69  ? 38.475  4.855   -54.587 1.00 37.97  ? 66  GLN B O   1 
ATOM   4691 C CB  . GLN B 1 69  ? 37.964  3.067   -57.524 1.00 30.81  ? 66  GLN B CB  1 
ATOM   4692 C CG  . GLN B 1 69  ? 38.273  2.915   -59.010 1.00 34.24  ? 66  GLN B CG  1 
ATOM   4693 C CD  . GLN B 1 69  ? 37.948  4.169   -59.816 1.00 40.45  ? 66  GLN B CD  1 
ATOM   4694 O OE1 . GLN B 1 69  ? 37.486  5.178   -59.272 1.00 39.58  ? 66  GLN B OE1 1 
ATOM   4695 N NE2 . GLN B 1 69  ? 38.190  4.108   -61.122 1.00 37.81  ? 66  GLN B NE2 1 
ATOM   4696 N N   . ASN B 1 70  ? 37.190  5.579   -56.294 1.00 35.33  ? 67  ASN B N   1 
ATOM   4697 C CA  . ASN B 1 70  ? 36.414  6.502   -55.477 1.00 35.88  ? 67  ASN B CA  1 
ATOM   4698 C C   . ASN B 1 70  ? 35.645  5.819   -54.349 1.00 31.88  ? 67  ASN B C   1 
ATOM   4699 O O   . ASN B 1 70  ? 35.309  4.642   -54.435 1.00 32.74  ? 67  ASN B O   1 
ATOM   4700 C CB  . ASN B 1 70  ? 35.435  7.281   -56.352 1.00 33.69  ? 67  ASN B CB  1 
ATOM   4701 C CG  . ASN B 1 70  ? 36.134  8.110   -57.413 1.00 36.95  ? 67  ASN B CG  1 
ATOM   4702 O OD1 . ASN B 1 70  ? 36.803  9.097   -57.103 1.00 39.88  ? 67  ASN B OD1 1 
ATOM   4703 N ND2 . ASN B 1 70  ? 35.981  7.712   -58.669 1.00 42.20  ? 67  ASN B ND2 1 
ATOM   4704 N N   . VAL B 1 71  ? 35.370  6.585   -53.301 1.00 31.65  ? 68  VAL B N   1 
ATOM   4705 C CA  . VAL B 1 71  ? 34.560  6.128   -52.175 1.00 37.60  ? 68  VAL B CA  1 
ATOM   4706 C C   . VAL B 1 71  ? 33.085  6.357   -52.497 1.00 36.47  ? 68  VAL B C   1 
ATOM   4707 O O   . VAL B 1 71  ? 32.734  7.399   -53.049 1.00 35.06  ? 68  VAL B O   1 
ATOM   4708 C CB  . VAL B 1 71  ? 34.954  6.875   -50.876 1.00 36.80  ? 68  VAL B CB  1 
ATOM   4709 C CG1 . VAL B 1 71  ? 33.983  6.575   -49.738 1.00 37.89  ? 68  VAL B CG1 1 
ATOM   4710 C CG2 . VAL B 1 71  ? 36.391  6.541   -50.483 1.00 34.15  ? 68  VAL B CG2 1 
ATOM   4711 N N   . CYS B 1 72  ? 32.225  5.389   -52.183 1.00 32.24  ? 69  CYS B N   1 
ATOM   4712 C CA  . CYS B 1 72  ? 30.789  5.561   -52.408 1.00 33.57  ? 69  CYS B CA  1 
ATOM   4713 C C   . CYS B 1 72  ? 30.270  6.795   -51.674 1.00 34.40  ? 69  CYS B C   1 
ATOM   4714 O O   . CYS B 1 72  ? 30.690  7.084   -50.547 1.00 35.98  ? 69  CYS B O   1 
ATOM   4715 C CB  . CYS B 1 72  ? 30.009  4.315   -51.979 1.00 34.14  ? 69  CYS B CB  1 
ATOM   4716 S SG  . CYS B 1 72  ? 30.261  2.851   -53.011 1.00 37.25  ? 69  CYS B SG  1 
ATOM   4717 N N   . TYR B 1 73  ? 29.370  7.531   -52.324 1.00 32.91  ? 70  TYR B N   1 
ATOM   4718 C CA  . TYR B 1 73  ? 28.955  8.828   -51.808 1.00 31.84  ? 70  TYR B CA  1 
ATOM   4719 C C   . TYR B 1 73  ? 28.303  8.683   -50.439 1.00 35.76  ? 70  TYR B C   1 
ATOM   4720 O O   . TYR B 1 73  ? 27.421  7.845   -50.244 1.00 34.83  ? 70  TYR B O   1 
ATOM   4721 C CB  . TYR B 1 73  ? 28.001  9.540   -52.765 1.00 32.32  ? 70  TYR B CB  1 
ATOM   4722 C CG  . TYR B 1 73  ? 28.107  11.040  -52.625 1.00 35.77  ? 70  TYR B CG  1 
ATOM   4723 C CD1 . TYR B 1 73  ? 27.476  11.702  -51.583 1.00 34.16  ? 70  TYR B CD1 1 
ATOM   4724 C CD2 . TYR B 1 73  ? 28.871  11.788  -53.512 1.00 34.62  ? 70  TYR B CD2 1 
ATOM   4725 C CE1 . TYR B 1 73  ? 27.585  13.069  -51.435 1.00 36.40  ? 70  TYR B CE1 1 
ATOM   4726 C CE2 . TYR B 1 73  ? 28.988  13.157  -53.373 1.00 36.38  ? 70  TYR B CE2 1 
ATOM   4727 C CZ  . TYR B 1 73  ? 28.342  13.792  -52.330 1.00 39.41  ? 70  TYR B CZ  1 
ATOM   4728 O OH  . TYR B 1 73  ? 28.443  15.155  -52.176 1.00 40.06  ? 70  TYR B OH  1 
ATOM   4729 N N   . GLN B 1 74  ? 28.748  9.509   -49.500 1.00 34.61  ? 71  GLN B N   1 
ATOM   4730 C CA  . GLN B 1 74  ? 28.369  9.336   -48.110 1.00 37.01  ? 71  GLN B CA  1 
ATOM   4731 C C   . GLN B 1 74  ? 28.589  10.579  -47.264 1.00 38.74  ? 71  GLN B C   1 
ATOM   4732 O O   . GLN B 1 74  ? 29.352  11.481  -47.625 1.00 39.14  ? 71  GLN B O   1 
ATOM   4733 C CB  . GLN B 1 74  ? 29.154  8.174   -47.509 1.00 33.71  ? 71  GLN B CB  1 
ATOM   4734 C CG  . GLN B 1 74  ? 30.642  8.449   -47.413 1.00 35.25  ? 71  GLN B CG  1 
ATOM   4735 C CD  . GLN B 1 74  ? 31.430  7.229   -46.987 1.00 39.75  ? 71  GLN B CD  1 
ATOM   4736 O OE1 . GLN B 1 74  ? 32.053  7.215   -45.920 1.00 34.81  ? 71  GLN B OE1 1 
ATOM   4737 N NE2 . GLN B 1 74  ? 31.410  6.194   -47.822 1.00 35.72  ? 71  GLN B NE2 1 
ATOM   4738 N N   . TYR B 1 75  ? 27.909  10.604  -46.124 1.00 40.65  ? 72  TYR B N   1 
ATOM   4739 C CA  . TYR B 1 75  ? 28.117  11.617  -45.103 1.00 39.49  ? 72  TYR B CA  1 
ATOM   4740 C C   . TYR B 1 75  ? 29.549  11.570  -44.581 1.00 41.37  ? 72  TYR B C   1 
ATOM   4741 O O   . TYR B 1 75  ? 30.098  10.494  -44.356 1.00 40.57  ? 72  TYR B O   1 
ATOM   4742 C CB  . TYR B 1 75  ? 27.121  11.407  -43.958 1.00 42.51  ? 72  TYR B CB  1 
ATOM   4743 C CG  . TYR B 1 75  ? 27.318  12.328  -42.779 1.00 44.59  ? 72  TYR B CG  1 
ATOM   4744 C CD1 . TYR B 1 75  ? 26.861  13.638  -42.815 1.00 45.28  ? 72  TYR B CD1 1 
ATOM   4745 C CD2 . TYR B 1 75  ? 27.954  11.886  -41.626 1.00 44.35  ? 72  TYR B CD2 1 
ATOM   4746 C CE1 . TYR B 1 75  ? 27.035  14.485  -41.741 1.00 48.72  ? 72  TYR B CE1 1 
ATOM   4747 C CE2 . TYR B 1 75  ? 28.133  12.728  -40.541 1.00 47.67  ? 72  TYR B CE2 1 
ATOM   4748 C CZ  . TYR B 1 75  ? 27.670  14.026  -40.605 1.00 48.94  ? 72  TYR B CZ  1 
ATOM   4749 O OH  . TYR B 1 75  ? 27.843  14.874  -39.537 1.00 56.82  ? 72  TYR B OH  1 
ATOM   4750 N N   . VAL B 1 76  ? 30.157  12.737  -44.400 1.00 41.10  ? 73  VAL B N   1 
ATOM   4751 C CA  . VAL B 1 76  ? 31.504  12.814  -43.849 1.00 41.40  ? 73  VAL B CA  1 
ATOM   4752 C C   . VAL B 1 76  ? 31.452  13.404  -42.440 1.00 43.51  ? 73  VAL B C   1 
ATOM   4753 O O   . VAL B 1 76  ? 30.849  14.454  -42.223 1.00 39.68  ? 73  VAL B O   1 
ATOM   4754 C CB  . VAL B 1 76  ? 32.441  13.665  -44.728 1.00 41.44  ? 73  VAL B CB  1 
ATOM   4755 C CG1 . VAL B 1 76  ? 33.831  13.726  -44.111 1.00 39.37  ? 73  VAL B CG1 1 
ATOM   4756 C CG2 . VAL B 1 76  ? 32.502  13.109  -46.150 1.00 37.46  ? 73  VAL B CG2 1 
ATOM   4757 N N   . ASP B 1 77  ? 32.084  12.728  -41.487 1.00 43.33  ? 74  ASP B N   1 
ATOM   4758 C CA  . ASP B 1 77  ? 32.018  13.149  -40.089 1.00 46.90  ? 74  ASP B CA  1 
ATOM   4759 C C   . ASP B 1 77  ? 32.821  14.422  -39.829 1.00 47.59  ? 74  ASP B C   1 
ATOM   4760 O O   . ASP B 1 77  ? 33.992  14.518  -40.200 1.00 46.38  ? 74  ASP B O   1 
ATOM   4761 C CB  . ASP B 1 77  ? 32.505  12.030  -39.172 1.00 45.15  ? 74  ASP B CB  1 
ATOM   4762 C CG  . ASP B 1 77  ? 32.279  12.344  -37.708 1.00 51.35  ? 74  ASP B CG  1 
ATOM   4763 O OD1 . ASP B 1 77  ? 31.113  12.289  -37.265 1.00 51.18  ? 74  ASP B OD1 1 
ATOM   4764 O OD2 . ASP B 1 77  ? 33.263  12.649  -37.006 1.00 47.66  ? 74  ASP B OD2 1 
ATOM   4765 N N   . THR B 1 78  ? 32.183  15.397  -39.187 1.00 50.16  ? 75  THR B N   1 
ATOM   4766 C CA  . THR B 1 78  ? 32.834  16.669  -38.887 1.00 53.24  ? 75  THR B CA  1 
ATOM   4767 C C   . THR B 1 78  ? 32.808  17.023  -37.404 1.00 51.37  ? 75  THR B C   1 
ATOM   4768 O O   . THR B 1 78  ? 32.982  18.185  -37.048 1.00 51.33  ? 75  THR B O   1 
ATOM   4769 C CB  . THR B 1 78  ? 32.178  17.833  -39.658 1.00 54.04  ? 75  THR B CB  1 
ATOM   4770 O OG1 . THR B 1 78  ? 30.779  17.884  -39.346 1.00 57.12  ? 75  THR B OG1 1 
ATOM   4771 C CG2 . THR B 1 78  ? 32.359  17.659  -41.154 1.00 53.24  ? 75  THR B CG2 1 
ATOM   4772 N N   . LEU B 1 79  ? 32.588  16.033  -36.543 1.00 54.17  ? 76  LEU B N   1 
ATOM   4773 C CA  . LEU B 1 79  ? 32.483  16.298  -35.108 1.00 55.05  ? 76  LEU B CA  1 
ATOM   4774 C C   . LEU B 1 79  ? 33.792  16.843  -34.543 1.00 54.30  ? 76  LEU B C   1 
ATOM   4775 O O   . LEU B 1 79  ? 33.791  17.782  -33.747 1.00 57.42  ? 76  LEU B O   1 
ATOM   4776 C CB  . LEU B 1 79  ? 32.069  15.035  -34.346 1.00 54.40  ? 76  LEU B CB  1 
ATOM   4777 C CG  . LEU B 1 79  ? 31.769  15.260  -32.859 1.00 55.66  ? 76  LEU B CG  1 
ATOM   4778 C CD1 . LEU B 1 79  ? 30.736  16.364  -32.683 1.00 57.61  ? 76  LEU B CD1 1 
ATOM   4779 C CD2 . LEU B 1 79  ? 31.296  13.980  -32.183 1.00 55.15  ? 76  LEU B CD2 1 
ATOM   4780 N N   . TYR B 1 80  ? 34.906  16.256  -34.963 1.00 54.97  ? 77  TYR B N   1 
ATOM   4781 C CA  . TYR B 1 80  ? 36.220  16.707  -34.521 1.00 54.11  ? 77  TYR B CA  1 
ATOM   4782 C C   . TYR B 1 80  ? 37.188  16.836  -35.693 1.00 55.47  ? 77  TYR B C   1 
ATOM   4783 O O   . TYR B 1 80  ? 37.982  15.930  -35.944 1.00 52.53  ? 77  TYR B O   1 
ATOM   4784 C CB  . TYR B 1 80  ? 36.797  15.746  -33.485 1.00 50.08  ? 77  TYR B CB  1 
ATOM   4785 C CG  . TYR B 1 80  ? 35.931  15.538  -32.265 1.00 58.63  ? 77  TYR B CG  1 
ATOM   4786 C CD1 . TYR B 1 80  ? 35.739  16.558  -31.342 1.00 55.79  ? 77  TYR B CD1 1 
ATOM   4787 C CD2 . TYR B 1 80  ? 35.325  14.312  -32.023 1.00 60.95  ? 77  TYR B CD2 1 
ATOM   4788 C CE1 . TYR B 1 80  ? 34.954  16.366  -30.218 1.00 58.36  ? 77  TYR B CE1 1 
ATOM   4789 C CE2 . TYR B 1 80  ? 34.542  14.108  -30.897 1.00 57.48  ? 77  TYR B CE2 1 
ATOM   4790 C CZ  . TYR B 1 80  ? 34.357  15.139  -30.001 1.00 58.94  ? 77  TYR B CZ  1 
ATOM   4791 O OH  . TYR B 1 80  ? 33.577  14.943  -28.881 1.00 65.26  ? 77  TYR B OH  1 
ATOM   4792 N N   . PRO B 1 81  ? 37.129  17.967  -36.412 1.00 58.02  ? 78  PRO B N   1 
ATOM   4793 C CA  . PRO B 1 81  ? 37.974  18.195  -37.593 1.00 53.85  ? 78  PRO B CA  1 
ATOM   4794 C C   . PRO B 1 81  ? 39.468  18.100  -37.284 1.00 53.24  ? 78  PRO B C   1 
ATOM   4795 O O   . PRO B 1 81  ? 39.941  18.750  -36.354 1.00 57.89  ? 78  PRO B O   1 
ATOM   4796 C CB  . PRO B 1 81  ? 37.601  19.618  -38.020 1.00 56.90  ? 78  PRO B CB  1 
ATOM   4797 C CG  . PRO B 1 81  ? 36.237  19.839  -37.460 1.00 57.07  ? 78  PRO B CG  1 
ATOM   4798 C CD  . PRO B 1 81  ? 36.223  19.099  -36.155 1.00 57.42  ? 78  PRO B CD  1 
ATOM   4799 N N   . GLY B 1 82  ? 40.196  17.295  -38.053 1.00 54.89  ? 79  GLY B N   1 
ATOM   4800 C CA  . GLY B 1 82  ? 41.631  17.155  -37.868 1.00 55.56  ? 79  GLY B CA  1 
ATOM   4801 C C   . GLY B 1 82  ? 42.044  16.113  -36.840 1.00 54.16  ? 79  GLY B C   1 
ATOM   4802 O O   . GLY B 1 82  ? 43.224  15.784  -36.718 1.00 54.33  ? 79  GLY B O   1 
ATOM   4803 N N   . PHE B 1 83  ? 41.069  15.589  -36.104 1.00 52.66  ? 80  PHE B N   1 
ATOM   4804 C CA  . PHE B 1 83  ? 41.321  14.587  -35.069 1.00 49.32  ? 80  PHE B CA  1 
ATOM   4805 C C   . PHE B 1 83  ? 41.496  13.193  -35.673 1.00 48.79  ? 80  PHE B C   1 
ATOM   4806 O O   . PHE B 1 83  ? 40.625  12.708  -36.395 1.00 46.13  ? 80  PHE B O   1 
ATOM   4807 C CB  . PHE B 1 83  ? 40.174  14.603  -34.052 1.00 49.31  ? 80  PHE B CB  1 
ATOM   4808 C CG  . PHE B 1 83  ? 40.301  13.578  -32.960 1.00 49.96  ? 80  PHE B CG  1 
ATOM   4809 C CD1 . PHE B 1 83  ? 41.399  13.569  -32.116 1.00 47.04  ? 80  PHE B CD1 1 
ATOM   4810 C CD2 . PHE B 1 83  ? 39.298  12.643  -32.757 1.00 48.47  ? 80  PHE B CD2 1 
ATOM   4811 C CE1 . PHE B 1 83  ? 41.506  12.630  -31.101 1.00 49.21  ? 80  PHE B CE1 1 
ATOM   4812 C CE2 . PHE B 1 83  ? 39.397  11.705  -31.745 1.00 48.69  ? 80  PHE B CE2 1 
ATOM   4813 C CZ  . PHE B 1 83  ? 40.503  11.697  -30.918 1.00 45.69  ? 80  PHE B CZ  1 
ATOM   4814 N N   . GLU B 1 84  ? 42.626  12.554  -35.375 1.00 47.43  ? 81  GLU B N   1 
ATOM   4815 C CA  . GLU B 1 84  ? 42.948  11.242  -35.939 1.00 50.23  ? 81  GLU B CA  1 
ATOM   4816 C C   . GLU B 1 84  ? 41.868  10.196  -35.663 1.00 49.23  ? 81  GLU B C   1 
ATOM   4817 O O   . GLU B 1 84  ? 41.485  9.429   -36.558 1.00 48.89  ? 81  GLU B O   1 
ATOM   4818 C CB  . GLU B 1 84  ? 44.295  10.750  -35.400 1.00 49.72  ? 81  GLU B CB  1 
ATOM   4819 C CG  . GLU B 1 84  ? 44.630  9.300   -35.745 1.00 54.20  ? 81  GLU B CG  1 
ATOM   4820 C CD  . GLU B 1 84  ? 44.924  9.080   -37.224 1.00 61.98  ? 81  GLU B CD  1 
ATOM   4821 O OE1 . GLU B 1 84  ? 45.000  10.070  -37.986 1.00 66.72  ? 81  GLU B OE1 1 
ATOM   4822 O OE2 . GLU B 1 84  ? 45.078  7.906   -37.629 1.00 63.58  ? 81  GLU B OE2 1 
ATOM   4823 N N   . GLY B 1 85  ? 41.374  10.185  -34.427 1.00 49.89  ? 82  GLY B N   1 
ATOM   4824 C CA  . GLY B 1 85  ? 40.377  9.223   -33.992 1.00 47.16  ? 82  GLY B CA  1 
ATOM   4825 C C   . GLY B 1 85  ? 39.124  9.193   -34.846 1.00 47.13  ? 82  GLY B C   1 
ATOM   4826 O O   . GLY B 1 85  ? 38.442  8.174   -34.920 1.00 44.56  ? 82  GLY B O   1 
ATOM   4827 N N   . THR B 1 86  ? 38.814  10.312  -35.492 1.00 45.68  ? 83  THR B N   1 
ATOM   4828 C CA  . THR B 1 86  ? 37.666  10.369  -36.388 1.00 47.56  ? 83  THR B CA  1 
ATOM   4829 C C   . THR B 1 86  ? 38.099  10.326  -37.850 1.00 46.94  ? 83  THR B C   1 
ATOM   4830 O O   . THR B 1 86  ? 37.439  9.702   -38.677 1.00 45.61  ? 83  THR B O   1 
ATOM   4831 C CB  . THR B 1 86  ? 36.822  11.636  -36.159 1.00 47.60  ? 83  THR B CB  1 
ATOM   4832 O OG1 . THR B 1 86  ? 37.668  12.792  -36.208 1.00 49.44  ? 83  THR B OG1 1 
ATOM   4833 C CG2 . THR B 1 86  ? 36.121  11.577  -34.810 1.00 44.63  ? 83  THR B CG2 1 
ATOM   4834 N N   . GLU B 1 87  ? 39.211  10.983  -38.164 1.00 47.59  ? 84  GLU B N   1 
ATOM   4835 C CA  . GLU B 1 87  ? 39.642  11.115  -39.551 1.00 48.00  ? 84  GLU B CA  1 
ATOM   4836 C C   . GLU B 1 87  ? 40.094  9.784   -40.148 1.00 46.29  ? 84  GLU B C   1 
ATOM   4837 O O   . GLU B 1 87  ? 40.017  9.592   -41.363 1.00 40.83  ? 84  GLU B O   1 
ATOM   4838 C CB  . GLU B 1 87  ? 40.770  12.147  -39.673 1.00 48.74  ? 84  GLU B CB  1 
ATOM   4839 C CG  . GLU B 1 87  ? 40.378  13.580  -39.306 1.00 50.95  ? 84  GLU B CG  1 
ATOM   4840 C CD  . GLU B 1 87  ? 39.515  14.267  -40.354 1.00 58.11  ? 84  GLU B CD  1 
ATOM   4841 O OE1 . GLU B 1 87  ? 39.175  13.627  -41.373 1.00 53.56  ? 84  GLU B OE1 1 
ATOM   4842 O OE2 . GLU B 1 87  ? 39.175  15.455  -40.153 1.00 58.67  ? 84  GLU B OE2 1 
ATOM   4843 N N   . MET B 1 88  ? 40.551  8.862   -39.304 1.00 42.79  ? 85  MET B N   1 
ATOM   4844 C CA  . MET B 1 88  ? 41.005  7.563   -39.803 1.00 43.22  ? 85  MET B CA  1 
ATOM   4845 C C   . MET B 1 88  ? 39.853  6.733   -40.375 1.00 40.59  ? 85  MET B C   1 
ATOM   4846 O O   . MET B 1 88  ? 40.080  5.721   -41.038 1.00 40.39  ? 85  MET B O   1 
ATOM   4847 C CB  . MET B 1 88  ? 41.717  6.772   -38.702 0.92 44.39  ? 85  MET B CB  1 
ATOM   4848 C CG  . MET B 1 88  ? 40.824  6.350   -37.555 0.85 44.70  ? 85  MET B CG  1 
ATOM   4849 S SD  . MET B 1 88  ? 41.726  5.430   -36.291 0.92 49.84  ? 85  MET B SD  1 
ATOM   4850 C CE  . MET B 1 88  ? 41.794  3.802   -37.021 1.00 38.00  ? 85  MET B CE  1 
ATOM   4851 N N   . TRP B 1 89  ? 38.623  7.170   -40.124 1.00 40.78  ? 86  TRP B N   1 
ATOM   4852 C CA  . TRP B 1 89  ? 37.442  6.487   -40.644 1.00 39.09  ? 86  TRP B CA  1 
ATOM   4853 C C   . TRP B 1 89  ? 36.792  7.236   -41.816 1.00 40.55  ? 86  TRP B C   1 
ATOM   4854 O O   . TRP B 1 89  ? 35.921  6.696   -42.498 1.00 36.73  ? 86  TRP B O   1 
ATOM   4855 C CB  . TRP B 1 89  ? 36.415  6.289   -39.527 1.00 36.72  ? 86  TRP B CB  1 
ATOM   4856 C CG  . TRP B 1 89  ? 36.968  5.588   -38.319 1.00 37.31  ? 86  TRP B CG  1 
ATOM   4857 C CD1 . TRP B 1 89  ? 37.214  6.137   -37.092 1.00 39.67  ? 86  TRP B CD1 1 
ATOM   4858 C CD2 . TRP B 1 89  ? 37.349  4.210   -38.226 1.00 37.35  ? 86  TRP B CD2 1 
ATOM   4859 N NE1 . TRP B 1 89  ? 37.718  5.183   -36.239 1.00 36.71  ? 86  TRP B NE1 1 
ATOM   4860 C CE2 . TRP B 1 89  ? 37.809  3.991   -36.909 1.00 38.82  ? 86  TRP B CE2 1 
ATOM   4861 C CE3 . TRP B 1 89  ? 37.342  3.138   -39.125 1.00 36.32  ? 86  TRP B CE3 1 
ATOM   4862 C CZ2 . TRP B 1 89  ? 38.262  2.749   -36.472 1.00 35.73  ? 86  TRP B CZ2 1 
ATOM   4863 C CZ3 . TRP B 1 89  ? 37.791  1.903   -38.689 1.00 36.43  ? 86  TRP B CZ3 1 
ATOM   4864 C CH2 . TRP B 1 89  ? 38.242  1.718   -37.373 1.00 36.87  ? 86  TRP B CH2 1 
ATOM   4865 N N   . ASN B 1 90  ? 37.214  8.477   -42.038 1.00 39.91  ? 87  ASN B N   1 
ATOM   4866 C CA  . ASN B 1 90  ? 36.650  9.303   -43.103 1.00 40.44  ? 87  ASN B CA  1 
ATOM   4867 C C   . ASN B 1 90  ? 37.146  8.882   -44.488 1.00 36.89  ? 87  ASN B C   1 
ATOM   4868 O O   . ASN B 1 90  ? 38.202  8.261   -44.610 1.00 37.80  ? 87  ASN B O   1 
ATOM   4869 C CB  . ASN B 1 90  ? 36.978  10.779  -42.856 1.00 41.73  ? 87  ASN B CB  1 
ATOM   4870 C CG  . ASN B 1 90  ? 35.966  11.460  -41.951 1.00 46.51  ? 87  ASN B CG  1 
ATOM   4871 O OD1 . ASN B 1 90  ? 34.819  11.021  -41.833 1.00 46.86  ? 87  ASN B OD1 1 
ATOM   4872 N ND2 . ASN B 1 90  ? 36.386  12.546  -41.313 1.00 46.34  ? 87  ASN B ND2 1 
ATOM   4873 N N   . PRO B 1 91  ? 36.378  9.212   -45.538 1.00 40.49  ? 88  PRO B N   1 
ATOM   4874 C CA  . PRO B 1 91  ? 36.803  8.870   -46.902 1.00 38.73  ? 88  PRO B CA  1 
ATOM   4875 C C   . PRO B 1 91  ? 38.201  9.397   -47.220 1.00 37.79  ? 88  PRO B C   1 
ATOM   4876 O O   . PRO B 1 91  ? 38.491  10.561  -46.954 1.00 43.06  ? 88  PRO B O   1 
ATOM   4877 C CB  . PRO B 1 91  ? 35.746  9.549   -47.772 1.00 39.21  ? 88  PRO B CB  1 
ATOM   4878 C CG  . PRO B 1 91  ? 34.530  9.576   -46.911 1.00 38.02  ? 88  PRO B CG  1 
ATOM   4879 C CD  . PRO B 1 91  ? 35.046  9.845   -45.525 1.00 37.76  ? 88  PRO B CD  1 
ATOM   4880 N N   . ASN B 1 92  ? 39.061  8.540   -47.760 1.00 38.23  ? 89  ASN B N   1 
ATOM   4881 C CA  . ASN B 1 92  ? 40.417  8.946   -48.100 1.00 40.83  ? 89  ASN B CA  1 
ATOM   4882 C C   . ASN B 1 92  ? 40.619  9.013   -49.613 1.00 40.71  ? 89  ASN B C   1 
ATOM   4883 O O   . ASN B 1 92  ? 41.739  9.161   -50.097 1.00 43.55  ? 89  ASN B O   1 
ATOM   4884 C CB  . ASN B 1 92  ? 41.437  8.002   -47.462 1.00 41.74  ? 89  ASN B CB  1 
ATOM   4885 C CG  . ASN B 1 92  ? 41.362  6.599   -48.018 1.00 42.69  ? 89  ASN B CG  1 
ATOM   4886 O OD1 . ASN B 1 92  ? 40.338  6.184   -48.563 1.00 40.36  ? 89  ASN B OD1 1 
ATOM   4887 N ND2 . ASN B 1 92  ? 42.453  5.853   -47.879 1.00 43.89  ? 89  ASN B ND2 1 
ATOM   4888 N N   . ARG B 1 93  ? 39.520  8.883   -50.348 1.00 38.38  ? 90  ARG B N   1 
ATOM   4889 C CA  . ARG B 1 93  ? 39.498  9.159   -51.781 1.00 41.77  ? 90  ARG B CA  1 
ATOM   4890 C C   . ARG B 1 93  ? 38.264  9.993   -52.080 1.00 42.18  ? 90  ARG B C   1 
ATOM   4891 O O   . ARG B 1 93  ? 37.435  10.215  -51.201 1.00 37.13  ? 90  ARG B O   1 
ATOM   4892 C CB  . ARG B 1 93  ? 39.484  7.873   -52.614 1.00 41.78  ? 90  ARG B CB  1 
ATOM   4893 C CG  . ARG B 1 93  ? 40.741  7.023   -52.505 1.00 44.25  ? 90  ARG B CG  1 
ATOM   4894 C CD  . ARG B 1 93  ? 41.961  7.756   -53.034 1.00 45.03  ? 90  ARG B CD  1 
ATOM   4895 N NE  . ARG B 1 93  ? 43.149  6.908   -53.027 1.00 45.34  ? 90  ARG B NE  1 
ATOM   4896 C CZ  . ARG B 1 93  ? 43.897  6.675   -51.951 1.00 49.63  ? 90  ARG B CZ  1 
ATOM   4897 N NH1 . ARG B 1 93  ? 43.576  7.222   -50.785 1.00 46.01  ? 90  ARG B NH1 1 
ATOM   4898 N NH2 . ARG B 1 93  ? 44.963  5.889   -52.039 1.00 45.65  ? 90  ARG B NH2 1 
ATOM   4899 N N   . GLU B 1 94  ? 38.134  10.440  -53.324 1.00 42.79  ? 91  GLU B N   1 
ATOM   4900 C CA  . GLU B 1 94  ? 37.013  11.284  -53.709 1.00 41.50  ? 91  GLU B CA  1 
ATOM   4901 C C   . GLU B 1 94  ? 35.676  10.567  -53.594 1.00 36.28  ? 91  GLU B C   1 
ATOM   4902 O O   . GLU B 1 94  ? 35.572  9.378   -53.888 1.00 36.56  ? 91  GLU B O   1 
ATOM   4903 C CB  . GLU B 1 94  ? 37.200  11.786  -55.141 1.00 40.11  ? 91  GLU B CB  1 
ATOM   4904 C CG  . GLU B 1 94  ? 38.326  12.777  -55.288 1.00 51.31  ? 91  GLU B CG  1 
ATOM   4905 C CD  . GLU B 1 94  ? 37.818  14.186  -55.475 1.00 55.39  ? 91  GLU B CD  1 
ATOM   4906 O OE1 . GLU B 1 94  ? 37.331  14.781  -54.488 1.00 57.28  ? 91  GLU B OE1 1 
ATOM   4907 O OE2 . GLU B 1 94  ? 37.904  14.692  -56.613 1.00 54.71  ? 91  GLU B OE2 1 
ATOM   4908 N N   . LEU B 1 95  ? 34.654  11.303  -53.174 1.00 36.74  ? 92  LEU B N   1 
ATOM   4909 C CA  . LEU B 1 95  ? 33.291  10.787  -53.170 1.00 32.74  ? 92  LEU B CA  1 
ATOM   4910 C C   . LEU B 1 95  ? 32.740  10.699  -54.585 1.00 37.20  ? 92  LEU B C   1 
ATOM   4911 O O   . LEU B 1 95  ? 32.934  11.612  -55.380 1.00 35.45  ? 92  LEU B O   1 
ATOM   4912 C CB  . LEU B 1 95  ? 32.385  11.678  -52.327 1.00 30.50  ? 92  LEU B CB  1 
ATOM   4913 C CG  . LEU B 1 95  ? 32.703  11.754  -50.837 1.00 34.17  ? 92  LEU B CG  1 
ATOM   4914 C CD1 . LEU B 1 95  ? 31.615  12.541  -50.132 1.00 30.64  ? 92  LEU B CD1 1 
ATOM   4915 C CD2 . LEU B 1 95  ? 32.816  10.354  -50.273 1.00 34.43  ? 92  LEU B CD2 1 
ATOM   4916 N N   . SER B 1 96  ? 32.043  9.609   -54.887 1.00 33.31  ? 93  SER B N   1 
ATOM   4917 C CA  . SER B 1 96  ? 31.368  9.453   -56.172 1.00 33.80  ? 93  SER B CA  1 
ATOM   4918 C C   . SER B 1 96  ? 30.301  8.375   -56.066 1.00 34.52  ? 93  SER B C   1 
ATOM   4919 O O   . SER B 1 96  ? 30.457  7.417   -55.309 1.00 34.43  ? 93  SER B O   1 
ATOM   4920 C CB  . SER B 1 96  ? 32.367  9.094   -57.276 1.00 33.87  ? 93  SER B CB  1 
ATOM   4921 O OG  . SER B 1 96  ? 31.720  8.965   -58.531 1.00 34.52  ? 93  SER B OG  1 
ATOM   4922 N N   . GLU B 1 97  ? 29.214  8.527   -56.814 1.00 32.02  ? 94  GLU B N   1 
ATOM   4923 C CA  . GLU B 1 97  ? 28.250  7.439   -56.942 1.00 31.66  ? 94  GLU B CA  1 
ATOM   4924 C C   . GLU B 1 97  ? 28.837  6.354   -57.847 1.00 35.42  ? 94  GLU B C   1 
ATOM   4925 O O   . GLU B 1 97  ? 28.389  5.209   -57.834 1.00 35.08  ? 94  GLU B O   1 
ATOM   4926 C CB  . GLU B 1 97  ? 26.915  7.940   -57.494 1.00 31.31  ? 94  GLU B CB  1 
ATOM   4927 C CG  . GLU B 1 97  ? 26.088  8.752   -56.505 1.00 33.29  ? 94  GLU B CG  1 
ATOM   4928 C CD  . GLU B 1 97  ? 24.732  9.142   -57.067 1.00 36.30  ? 94  GLU B CD  1 
ATOM   4929 O OE1 . GLU B 1 97  ? 23.836  8.272   -57.119 1.00 34.36  ? 94  GLU B OE1 1 
ATOM   4930 O OE2 . GLU B 1 97  ? 24.564  10.316  -57.460 1.00 38.53  ? 94  GLU B OE2 1 
ATOM   4931 N N   . ASP B 1 98  ? 29.840  6.735   -58.634 1.00 30.96  ? 95  ASP B N   1 
ATOM   4932 C CA  . ASP B 1 98  ? 30.603  5.797   -59.455 1.00 32.92  ? 95  ASP B CA  1 
ATOM   4933 C C   . ASP B 1 98  ? 31.665  5.169   -58.560 1.00 32.79  ? 95  ASP B C   1 
ATOM   4934 O O   . ASP B 1 98  ? 32.802  5.636   -58.506 1.00 31.92  ? 95  ASP B O   1 
ATOM   4935 C CB  . ASP B 1 98  ? 31.216  6.531   -60.658 1.00 32.96  ? 95  ASP B CB  1 
ATOM   4936 C CG  . ASP B 1 98  ? 32.065  5.634   -61.554 1.00 36.33  ? 95  ASP B CG  1 
ATOM   4937 O OD1 . ASP B 1 98  ? 32.053  4.394   -61.394 1.00 30.55  ? 95  ASP B OD1 1 
ATOM   4938 O OD2 . ASP B 1 98  ? 32.745  6.194   -62.450 1.00 36.05  ? 95  ASP B OD2 1 
ATOM   4939 N N   . CYS B 1 99  ? 31.285  4.120   -57.831 1.00 33.80  ? 96  CYS B N   1 
ATOM   4940 C CA  . CYS B 1 99  ? 32.137  3.613   -56.759 1.00 30.23  ? 96  CYS B CA  1 
ATOM   4941 C C   . CYS B 1 99  ? 32.200  2.101   -56.622 1.00 34.21  ? 96  CYS B C   1 
ATOM   4942 O O   . CYS B 1 99  ? 32.829  1.595   -55.689 1.00 31.42  ? 96  CYS B O   1 
ATOM   4943 C CB  . CYS B 1 99  ? 31.663  4.175   -55.422 1.00 34.32  ? 96  CYS B CB  1 
ATOM   4944 S SG  . CYS B 1 99  ? 30.027  3.551   -54.939 1.00 29.49  ? 96  CYS B SG  1 
ATOM   4945 N N   . LEU B 1 100 ? 31.546  1.368   -57.513 1.00 28.83  ? 97  LEU B N   1 
ATOM   4946 C CA  . LEU B 1 100 ? 31.471  -0.077  -57.328 1.00 30.55  ? 97  LEU B CA  1 
ATOM   4947 C C   . LEU B 1 100 ? 32.720  -0.766  -57.857 1.00 32.10  ? 97  LEU B C   1 
ATOM   4948 O O   . LEU B 1 100 ? 32.726  -1.343  -58.946 1.00 31.70  ? 97  LEU B O   1 
ATOM   4949 C CB  . LEU B 1 100 ? 30.208  -0.644  -57.982 1.00 27.63  ? 97  LEU B CB  1 
ATOM   4950 C CG  . LEU B 1 100 ? 28.934  -0.210  -57.245 1.00 29.44  ? 97  LEU B CG  1 
ATOM   4951 C CD1 . LEU B 1 100 ? 27.697  -0.913  -57.789 1.00 30.22  ? 97  LEU B CD1 1 
ATOM   4952 C CD2 . LEU B 1 100 ? 29.068  -0.444  -55.721 1.00 25.84  ? 97  LEU B CD2 1 
ATOM   4953 N N   . TYR B 1 101 ? 33.779  -0.689  -57.058 1.00 31.48  ? 98  TYR B N   1 
ATOM   4954 C CA  . TYR B 1 101 ? 35.062  -1.293  -57.381 1.00 31.09  ? 98  TYR B CA  1 
ATOM   4955 C C   . TYR B 1 101 ? 35.539  -2.161  -56.216 1.00 34.04  ? 98  TYR B C   1 
ATOM   4956 O O   . TYR B 1 101 ? 35.128  -1.947  -55.080 1.00 29.67  ? 98  TYR B O   1 
ATOM   4957 C CB  . TYR B 1 101 ? 36.089  -0.206  -57.708 1.00 33.06  ? 98  TYR B CB  1 
ATOM   4958 C CG  . TYR B 1 101 ? 35.651  0.689   -58.856 1.00 30.01  ? 98  TYR B CG  1 
ATOM   4959 C CD1 . TYR B 1 101 ? 34.819  1.784   -58.636 1.00 31.34  ? 98  TYR B CD1 1 
ATOM   4960 C CD2 . TYR B 1 101 ? 36.063  0.435   -60.155 1.00 32.96  ? 98  TYR B CD2 1 
ATOM   4961 C CE1 . TYR B 1 101 ? 34.405  2.602   -59.688 1.00 32.07  ? 98  TYR B CE1 1 
ATOM   4962 C CE2 . TYR B 1 101 ? 35.660  1.247   -61.214 1.00 33.90  ? 98  TYR B CE2 1 
ATOM   4963 C CZ  . TYR B 1 101 ? 34.833  2.327   -60.974 1.00 34.95  ? 98  TYR B CZ  1 
ATOM   4964 O OH  . TYR B 1 101 ? 34.429  3.131   -62.027 1.00 33.84  ? 98  TYR B OH  1 
ATOM   4965 N N   . LEU B 1 102 ? 36.388  -3.143  -56.506 1.00 31.35  ? 99  LEU B N   1 
ATOM   4966 C CA  . LEU B 1 102 ? 36.969  -3.982  -55.462 1.00 32.21  ? 99  LEU B CA  1 
ATOM   4967 C C   . LEU B 1 102 ? 38.491  -4.067  -55.598 1.00 35.89  ? 99  LEU B C   1 
ATOM   4968 O O   . LEU B 1 102 ? 39.060  -3.679  -56.619 1.00 34.66  ? 99  LEU B O   1 
ATOM   4969 C CB  . LEU B 1 102 ? 36.344  -5.389  -55.479 1.00 30.28  ? 99  LEU B CB  1 
ATOM   4970 C CG  . LEU B 1 102 ? 36.359  -6.272  -56.734 1.00 29.82  ? 99  LEU B CG  1 
ATOM   4971 C CD1 . LEU B 1 102 ? 37.698  -6.981  -56.939 1.00 29.61  ? 99  LEU B CD1 1 
ATOM   4972 C CD2 . LEU B 1 102 ? 35.220  -7.285  -56.696 1.00 28.73  ? 99  LEU B CD2 1 
ATOM   4973 N N   . ASN B 1 103 ? 39.127  -4.586  -54.554 1.00 33.59  ? 100 ASN B N   1 
ATOM   4974 C CA  . ASN B 1 103 ? 40.574  -4.669  -54.434 1.00 35.15  ? 100 ASN B CA  1 
ATOM   4975 C C   . ASN B 1 103 ? 41.028  -6.078  -54.090 1.00 38.62  ? 100 ASN B C   1 
ATOM   4976 O O   . ASN B 1 103 ? 40.392  -6.769  -53.284 1.00 38.45  ? 100 ASN B O   1 
ATOM   4977 C CB  . ASN B 1 103 ? 41.079  -3.711  -53.357 1.00 32.99  ? 100 ASN B CB  1 
ATOM   4978 C CG  . ASN B 1 103 ? 40.432  -2.353  -53.441 1.00 38.95  ? 100 ASN B CG  1 
ATOM   4979 O OD1 . ASN B 1 103 ? 40.600  -1.636  -54.429 1.00 35.30  ? 100 ASN B OD1 1 
ATOM   4980 N ND2 . ASN B 1 103 ? 39.699  -1.978  -52.394 1.00 35.62  ? 100 ASN B ND2 1 
ATOM   4981 N N   . VAL B 1 104 ? 42.140  -6.488  -54.693 1.00 38.45  ? 101 VAL B N   1 
ATOM   4982 C CA  . VAL B 1 104 ? 42.722  -7.800  -54.452 1.00 37.96  ? 101 VAL B CA  1 
ATOM   4983 C C   . VAL B 1 104 ? 44.186  -7.674  -54.037 1.00 41.71  ? 101 VAL B C   1 
ATOM   4984 O O   . VAL B 1 104 ? 44.969  -7.017  -54.705 1.00 36.97  ? 101 VAL B O   1 
ATOM   4985 C CB  . VAL B 1 104 ? 42.628  -8.695  -55.707 1.00 36.13  ? 101 VAL B CB  1 
ATOM   4986 C CG1 . VAL B 1 104 ? 43.223  -10.072 -55.433 1.00 37.89  ? 101 VAL B CG1 1 
ATOM   4987 C CG2 . VAL B 1 104 ? 41.187  -8.816  -56.167 1.00 32.78  ? 101 VAL B CG2 1 
ATOM   4988 N N   . TRP B 1 105 ? 44.545  -8.290  -52.918 1.00 37.86  ? 102 TRP B N   1 
ATOM   4989 C CA  . TRP B 1 105 ? 45.935  -8.436  -52.515 1.00 37.64  ? 102 TRP B CA  1 
ATOM   4990 C C   . TRP B 1 105 ? 46.325  -9.904  -52.589 1.00 41.37  ? 102 TRP B C   1 
ATOM   4991 O O   . TRP B 1 105 ? 45.594  -10.777 -52.110 1.00 39.75  ? 102 TRP B O   1 
ATOM   4992 C CB  . TRP B 1 105 ? 46.167  -7.927  -51.095 1.00 38.27  ? 102 TRP B CB  1 
ATOM   4993 C CG  . TRP B 1 105 ? 46.140  -6.444  -50.917 1.00 37.89  ? 102 TRP B CG  1 
ATOM   4994 C CD1 . TRP B 1 105 ? 47.205  -5.593  -50.976 1.00 39.20  ? 102 TRP B CD1 1 
ATOM   4995 C CD2 . TRP B 1 105 ? 45.000  -5.637  -50.601 1.00 35.55  ? 102 TRP B CD2 1 
ATOM   4996 N NE1 . TRP B 1 105 ? 46.797  -4.305  -50.730 1.00 38.80  ? 102 TRP B NE1 1 
ATOM   4997 C CE2 . TRP B 1 105 ? 45.447  -4.305  -50.499 1.00 36.39  ? 102 TRP B CE2 1 
ATOM   4998 C CE3 . TRP B 1 105 ? 43.643  -5.912  -50.402 1.00 36.57  ? 102 TRP B CE3 1 
ATOM   4999 C CZ2 . TRP B 1 105 ? 44.588  -3.249  -50.201 1.00 36.32  ? 102 TRP B CZ2 1 
ATOM   5000 C CZ3 . TRP B 1 105 ? 42.791  -4.862  -50.106 1.00 36.96  ? 102 TRP B CZ3 1 
ATOM   5001 C CH2 . TRP B 1 105 ? 43.267  -3.547  -50.010 1.00 37.17  ? 102 TRP B CH2 1 
ATOM   5002 N N   . THR B 1 106 ? 47.484  -10.171 -53.176 1.00 43.65  ? 103 THR B N   1 
ATOM   5003 C CA  . THR B 1 106 ? 47.977  -11.533 -53.304 1.00 45.42  ? 103 THR B CA  1 
ATOM   5004 C C   . THR B 1 106 ? 49.473  -11.528 -52.997 1.00 48.09  ? 103 THR B C   1 
ATOM   5005 O O   . THR B 1 106 ? 50.114  -10.482 -53.074 1.00 46.91  ? 103 THR B O   1 
ATOM   5006 C CB  . THR B 1 106 ? 47.700  -12.100 -54.717 1.00 45.73  ? 103 THR B CB  1 
ATOM   5007 O OG1 . THR B 1 106 ? 47.661  -13.532 -54.677 1.00 52.49  ? 103 THR B OG1 1 
ATOM   5008 C CG2 . THR B 1 106 ? 48.762  -11.656 -55.696 1.00 48.77  ? 103 THR B CG2 1 
ATOM   5009 N N   . PRO B 1 107 ? 50.029  -12.683 -52.602 1.00 48.63  ? 104 PRO B N   1 
ATOM   5010 C CA  . PRO B 1 107 ? 51.484  -12.732 -52.428 1.00 48.10  ? 104 PRO B CA  1 
ATOM   5011 C C   . PRO B 1 107 ? 52.235  -12.483 -53.736 1.00 51.52  ? 104 PRO B C   1 
ATOM   5012 O O   . PRO B 1 107 ? 51.707  -12.748 -54.816 1.00 49.54  ? 104 PRO B O   1 
ATOM   5013 C CB  . PRO B 1 107 ? 51.728  -14.158 -51.925 1.00 51.04  ? 104 PRO B CB  1 
ATOM   5014 C CG  . PRO B 1 107 ? 50.449  -14.544 -51.264 1.00 48.27  ? 104 PRO B CG  1 
ATOM   5015 C CD  . PRO B 1 107 ? 49.370  -13.894 -52.083 1.00 51.47  ? 104 PRO B CD  1 
ATOM   5016 N N   . TYR B 1 108 ? 53.448  -11.955 -53.627 1.00 52.88  ? 105 TYR B N   1 
ATOM   5017 C CA  . TYR B 1 108 ? 54.342  -11.812 -54.769 1.00 53.28  ? 105 TYR B CA  1 
ATOM   5018 C C   . TYR B 1 108 ? 55.545  -12.721 -54.539 1.00 55.70  ? 105 TYR B C   1 
ATOM   5019 O O   . TYR B 1 108 ? 56.296  -12.523 -53.581 1.00 53.01  ? 105 TYR B O   1 
ATOM   5020 C CB  . TYR B 1 108 ? 54.775  -10.353 -54.943 1.00 52.28  ? 105 TYR B CB  1 
ATOM   5021 C CG  . TYR B 1 108 ? 55.602  -10.069 -56.183 1.00 56.62  ? 105 TYR B CG  1 
ATOM   5022 C CD1 . TYR B 1 108 ? 56.963  -10.352 -56.217 1.00 57.83  ? 105 TYR B CD1 1 
ATOM   5023 C CD2 . TYR B 1 108 ? 55.026  -9.491  -57.309 1.00 55.60  ? 105 TYR B CD2 1 
ATOM   5024 C CE1 . TYR B 1 108 ? 57.722  -10.085 -57.340 1.00 58.83  ? 105 TYR B CE1 1 
ATOM   5025 C CE2 . TYR B 1 108 ? 55.780  -9.218  -58.437 1.00 59.10  ? 105 TYR B CE2 1 
ATOM   5026 C CZ  . TYR B 1 108 ? 57.127  -9.518  -58.446 1.00 60.56  ? 105 TYR B CZ  1 
ATOM   5027 O OH  . TYR B 1 108 ? 57.884  -9.253  -59.562 1.00 61.19  ? 105 TYR B OH  1 
ATOM   5028 N N   . PRO B 1 109 ? 55.731  -13.724 -55.411 1.00 57.52  ? 106 PRO B N   1 
ATOM   5029 C CA  . PRO B 1 109 ? 54.914  -13.983 -56.602 1.00 58.89  ? 106 PRO B CA  1 
ATOM   5030 C C   . PRO B 1 109 ? 53.586  -14.666 -56.292 1.00 56.87  ? 106 PRO B C   1 
ATOM   5031 O O   . PRO B 1 109 ? 53.431  -15.259 -55.225 1.00 59.00  ? 106 PRO B O   1 
ATOM   5032 C CB  . PRO B 1 109 ? 55.804  -14.907 -57.431 1.00 58.37  ? 106 PRO B CB  1 
ATOM   5033 C CG  . PRO B 1 109 ? 56.552  -15.683 -56.403 1.00 61.30  ? 106 PRO B CG  1 
ATOM   5034 C CD  . PRO B 1 109 ? 56.804  -14.724 -55.260 1.00 57.70  ? 106 PRO B CD  1 
ATOM   5035 N N   . ARG B 1 110 ? 52.652  -14.560 -57.232 1.00 57.01  ? 107 ARG B N   1 
ATOM   5036 C CA  . ARG B 1 110 ? 51.338  -15.189 -57.150 1.00 55.78  ? 107 ARG B CA  1 
ATOM   5037 C C   . ARG B 1 110 ? 51.424  -16.633 -56.661 1.00 61.95  ? 107 ARG B C   1 
ATOM   5038 O O   . ARG B 1 110 ? 52.279  -17.391 -57.120 1.00 65.57  ? 107 ARG B O   1 
ATOM   5039 C CB  . ARG B 1 110 ? 50.665  -15.121 -58.524 1.00 60.15  ? 107 ARG B CB  1 
ATOM   5040 C CG  . ARG B 1 110 ? 49.426  -15.975 -58.709 0.84 58.98  ? 107 ARG B CG  1 
ATOM   5041 C CD  . ARG B 1 110 ? 48.866  -15.745 -60.101 1.00 59.37  ? 107 ARG B CD  1 
ATOM   5042 N NE  . ARG B 1 110 ? 49.034  -14.348 -60.499 0.71 61.53  ? 107 ARG B NE  1 
ATOM   5043 C CZ  . ARG B 1 110 ? 49.371  -13.952 -61.722 1.00 60.43  ? 107 ARG B CZ  1 
ATOM   5044 N NH1 . ARG B 1 110 ? 49.509  -12.661 -61.989 1.00 59.06  ? 107 ARG B NH1 1 
ATOM   5045 N NH2 . ARG B 1 110 ? 49.576  -14.846 -62.678 1.00 69.34  ? 107 ARG B NH2 1 
ATOM   5046 N N   . PRO B 1 111 ? 50.549  -17.005 -55.708 1.00 60.20  ? 108 PRO B N   1 
ATOM   5047 C CA  . PRO B 1 111 ? 50.512  -18.325 -55.068 1.00 59.41  ? 108 PRO B CA  1 
ATOM   5048 C C   . PRO B 1 111 ? 50.671  -19.491 -56.037 1.00 59.72  ? 108 PRO B C   1 
ATOM   5049 O O   . PRO B 1 111 ? 50.063  -19.490 -57.107 1.00 62.80  ? 108 PRO B O   1 
ATOM   5050 C CB  . PRO B 1 111 ? 49.127  -18.351 -54.426 1.00 58.84  ? 108 PRO B CB  1 
ATOM   5051 C CG  . PRO B 1 111 ? 48.874  -16.933 -54.073 1.00 56.42  ? 108 PRO B CG  1 
ATOM   5052 C CD  . PRO B 1 111 ? 49.507  -16.112 -55.168 1.00 56.34  ? 108 PRO B CD  1 
ATOM   5053 N N   . ALA B 1 112 ? 51.487  -20.469 -55.656 1.00 62.24  ? 109 ALA B N   1 
ATOM   5054 C CA  . ALA B 1 112 ? 51.751  -21.633 -56.496 1.00 64.68  ? 109 ALA B CA  1 
ATOM   5055 C C   . ALA B 1 112 ? 50.538  -22.552 -56.558 1.00 63.09  ? 109 ALA B C   1 
ATOM   5056 O O   . ALA B 1 112 ? 50.206  -23.096 -57.611 1.00 60.21  ? 109 ALA B O   1 
ATOM   5057 C CB  . ALA B 1 112 ? 52.963  -22.392 -55.980 1.00 65.88  ? 109 ALA B CB  1 
ATOM   5058 N N   . SER B 1 113 ? 49.882  -22.721 -55.416 1.00 61.50  ? 110 SER B N   1 
ATOM   5059 C CA  . SER B 1 113 ? 48.671  -23.526 -55.334 1.00 58.24  ? 110 SER B CA  1 
ATOM   5060 C C   . SER B 1 113 ? 47.516  -22.667 -54.813 1.00 54.55  ? 110 SER B C   1 
ATOM   5061 O O   . SER B 1 113 ? 47.754  -21.623 -54.208 1.00 51.92  ? 110 SER B O   1 
ATOM   5062 C CB  . SER B 1 113 ? 48.911  -24.744 -54.439 1.00 56.96  ? 110 SER B CB  1 
ATOM   5063 O OG  . SER B 1 113 ? 49.562  -24.368 -53.242 1.00 64.00  ? 110 SER B OG  1 
ATOM   5064 N N   . PRO B 1 114 ? 46.262  -23.087 -55.072 1.00 52.31  ? 111 PRO B N   1 
ATOM   5065 C CA  . PRO B 1 114 ? 45.073  -22.357 -54.609 1.00 50.71  ? 111 PRO B CA  1 
ATOM   5066 C C   . PRO B 1 114 ? 45.111  -21.987 -53.126 1.00 48.40  ? 111 PRO B C   1 
ATOM   5067 O O   . PRO B 1 114 ? 45.296  -22.849 -52.265 1.00 49.54  ? 111 PRO B O   1 
ATOM   5068 C CB  . PRO B 1 114 ? 43.934  -23.339 -54.891 1.00 48.91  ? 111 PRO B CB  1 
ATOM   5069 C CG  . PRO B 1 114 ? 44.401  -24.108 -56.062 1.00 51.03  ? 111 PRO B CG  1 
ATOM   5070 C CD  . PRO B 1 114 ? 45.896  -24.234 -55.925 1.00 51.47  ? 111 PRO B CD  1 
ATOM   5071 N N   . THR B 1 115 ? 44.927  -20.699 -52.849 1.00 49.10  ? 112 THR B N   1 
ATOM   5072 C CA  . THR B 1 115 ? 45.033  -20.151 -51.503 1.00 45.82  ? 112 THR B CA  1 
ATOM   5073 C C   . THR B 1 115 ? 43.670  -19.740 -50.951 1.00 44.83  ? 112 THR B C   1 
ATOM   5074 O O   . THR B 1 115 ? 42.841  -19.209 -51.689 1.00 43.66  ? 112 THR B O   1 
ATOM   5075 C CB  . THR B 1 115 ? 45.969  -18.928 -51.491 1.00 48.02  ? 112 THR B CB  1 
ATOM   5076 O OG1 . THR B 1 115 ? 47.204  -19.268 -52.131 1.00 53.45  ? 112 THR B OG1 1 
ATOM   5077 C CG2 . THR B 1 115 ? 46.246  -18.470 -50.081 1.00 46.50  ? 112 THR B CG2 1 
ATOM   5078 N N   . PRO B 1 116 ? 43.427  -20.001 -49.652 1.00 43.54  ? 113 PRO B N   1 
ATOM   5079 C CA  . PRO B 1 116 ? 42.203  -19.521 -49.003 1.00 40.11  ? 113 PRO B CA  1 
ATOM   5080 C C   . PRO B 1 116 ? 41.979  -18.032 -49.226 1.00 32.94  ? 113 PRO B C   1 
ATOM   5081 O O   . PRO B 1 116 ? 42.921  -17.245 -49.128 1.00 34.38  ? 113 PRO B O   1 
ATOM   5082 C CB  . PRO B 1 116 ? 42.458  -19.812 -47.523 1.00 37.88  ? 113 PRO B CB  1 
ATOM   5083 C CG  . PRO B 1 116 ? 43.328  -21.014 -47.540 1.00 45.39  ? 113 PRO B CG  1 
ATOM   5084 C CD  . PRO B 1 116 ? 44.207  -20.881 -48.762 1.00 46.82  ? 113 PRO B CD  1 
ATOM   5085 N N   . VAL B 1 117 ? 40.746  -17.651 -49.531 1.00 32.90  ? 114 VAL B N   1 
ATOM   5086 C CA  . VAL B 1 117 ? 40.439  -16.251 -49.783 1.00 31.60  ? 114 VAL B CA  1 
ATOM   5087 C C   . VAL B 1 117 ? 39.697  -15.624 -48.599 1.00 31.91  ? 114 VAL B C   1 
ATOM   5088 O O   . VAL B 1 117 ? 38.743  -16.198 -48.081 1.00 31.94  ? 114 VAL B O   1 
ATOM   5089 C CB  . VAL B 1 117 ? 39.597  -16.087 -51.064 1.00 35.12  ? 114 VAL B CB  1 
ATOM   5090 C CG1 . VAL B 1 117 ? 39.275  -14.624 -51.296 1.00 33.06  ? 114 VAL B CG1 1 
ATOM   5091 C CG2 . VAL B 1 117 ? 40.339  -16.674 -52.272 1.00 33.42  ? 114 VAL B CG2 1 
ATOM   5092 N N   . LEU B 1 118 ? 40.155  -14.452 -48.172 1.00 30.69  ? 115 LEU B N   1 
ATOM   5093 C CA  . LEU B 1 118 ? 39.457  -13.671 -47.159 1.00 32.15  ? 115 LEU B CA  1 
ATOM   5094 C C   . LEU B 1 118 ? 38.822  -12.437 -47.795 1.00 36.12  ? 115 LEU B C   1 
ATOM   5095 O O   . LEU B 1 118 ? 39.524  -11.640 -48.404 1.00 34.91  ? 115 LEU B O   1 
ATOM   5096 C CB  . LEU B 1 118 ? 40.424  -13.244 -46.056 1.00 32.17  ? 115 LEU B CB  1 
ATOM   5097 C CG  . LEU B 1 118 ? 40.872  -14.296 -45.046 1.00 35.70  ? 115 LEU B CG  1 
ATOM   5098 C CD1 . LEU B 1 118 ? 42.132  -13.845 -44.334 1.00 42.24  ? 115 LEU B CD1 1 
ATOM   5099 C CD2 . LEU B 1 118 ? 39.758  -14.466 -44.052 1.00 38.81  ? 115 LEU B CD2 1 
ATOM   5100 N N   . ILE B 1 119 ? 37.508  -12.277 -47.645 1.00 30.72  ? 116 ILE B N   1 
ATOM   5101 C CA  . ILE B 1 119 ? 36.796  -11.110 -48.166 1.00 31.31  ? 116 ILE B CA  1 
ATOM   5102 C C   . ILE B 1 119 ? 36.300  -10.183 -47.052 1.00 32.68  ? 116 ILE B C   1 
ATOM   5103 O O   . ILE B 1 119 ? 35.426  -10.554 -46.268 1.00 33.02  ? 116 ILE B O   1 
ATOM   5104 C CB  . ILE B 1 119 ? 35.584  -11.525 -49.032 1.00 32.36  ? 116 ILE B CB  1 
ATOM   5105 C CG1 . ILE B 1 119 ? 36.006  -12.524 -50.109 1.00 32.43  ? 116 ILE B CG1 1 
ATOM   5106 C CG2 . ILE B 1 119 ? 34.937  -10.301 -49.678 1.00 32.49  ? 116 ILE B CG2 1 
ATOM   5107 C CD1 . ILE B 1 119 ? 34.879  -12.896 -51.057 1.00 29.21  ? 116 ILE B CD1 1 
ATOM   5108 N N   . TRP B 1 120 ? 36.867  -8.978  -47.001 1.00 33.68  ? 117 TRP B N   1 
ATOM   5109 C CA  . TRP B 1 120 ? 36.504  -7.945  -46.033 1.00 27.82  ? 117 TRP B CA  1 
ATOM   5110 C C   . TRP B 1 120 ? 35.289  -7.124  -46.467 1.00 33.22  ? 117 TRP B C   1 
ATOM   5111 O O   . TRP B 1 120 ? 35.187  -6.683  -47.621 1.00 31.06  ? 117 TRP B O   1 
ATOM   5112 C CB  . TRP B 1 120 ? 37.694  -7.005  -45.793 1.00 28.37  ? 117 TRP B CB  1 
ATOM   5113 C CG  . TRP B 1 120 ? 37.401  -5.841  -44.869 1.00 30.12  ? 117 TRP B CG  1 
ATOM   5114 C CD1 . TRP B 1 120 ? 37.277  -4.520  -45.212 1.00 30.10  ? 117 TRP B CD1 1 
ATOM   5115 C CD2 . TRP B 1 120 ? 37.201  -5.901  -43.449 1.00 30.15  ? 117 TRP B CD2 1 
ATOM   5116 N NE1 . TRP B 1 120 ? 37.016  -3.761  -44.093 1.00 31.89  ? 117 TRP B NE1 1 
ATOM   5117 C CE2 . TRP B 1 120 ? 36.962  -4.587  -43.001 1.00 32.42  ? 117 TRP B CE2 1 
ATOM   5118 C CE3 . TRP B 1 120 ? 37.200  -6.942  -42.517 1.00 36.68  ? 117 TRP B CE3 1 
ATOM   5119 C CZ2 . TRP B 1 120 ? 36.723  -4.285  -41.657 1.00 33.73  ? 117 TRP B CZ2 1 
ATOM   5120 C CZ3 . TRP B 1 120 ? 36.966  -6.637  -41.176 1.00 30.52  ? 117 TRP B CZ3 1 
ATOM   5121 C CH2 . TRP B 1 120 ? 36.730  -5.319  -40.766 1.00 32.07  ? 117 TRP B CH2 1 
ATOM   5122 N N   . ILE B 1 121 ? 34.376  -6.925  -45.524 1.00 30.22  ? 118 ILE B N   1 
ATOM   5123 C CA  . ILE B 1 121 ? 33.223  -6.053  -45.695 1.00 30.41  ? 118 ILE B CA  1 
ATOM   5124 C C   . ILE B 1 121 ? 33.262  -4.979  -44.618 1.00 33.53  ? 118 ILE B C   1 
ATOM   5125 O O   . ILE B 1 121 ? 33.094  -5.280  -43.433 1.00 32.50  ? 118 ILE B O   1 
ATOM   5126 C CB  . ILE B 1 121 ? 31.895  -6.826  -45.605 1.00 31.91  ? 118 ILE B CB  1 
ATOM   5127 C CG1 . ILE B 1 121 ? 31.861  -7.944  -46.649 1.00 31.25  ? 118 ILE B CG1 1 
ATOM   5128 C CG2 . ILE B 1 121 ? 30.709  -5.877  -45.773 1.00 26.07  ? 118 ILE B CG2 1 
ATOM   5129 C CD1 . ILE B 1 121 ? 30.564  -8.712  -46.670 1.00 33.86  ? 118 ILE B CD1 1 
ATOM   5130 N N   . TYR B 1 122 ? 33.495  -3.732  -45.015 1.00 31.33  ? 119 TYR B N   1 
ATOM   5131 C CA  . TYR B 1 122 ? 33.670  -2.664  -44.037 1.00 31.64  ? 119 TYR B CA  1 
ATOM   5132 C C   . TYR B 1 122 ? 32.360  -2.302  -43.345 1.00 32.77  ? 119 TYR B C   1 
ATOM   5133 O O   . TYR B 1 122 ? 31.270  -2.546  -43.873 1.00 29.77  ? 119 TYR B O   1 
ATOM   5134 C CB  . TYR B 1 122 ? 34.290  -1.415  -44.687 1.00 31.21  ? 119 TYR B CB  1 
ATOM   5135 C CG  . TYR B 1 122 ? 33.525  -0.821  -45.857 1.00 34.39  ? 119 TYR B CG  1 
ATOM   5136 C CD1 . TYR B 1 122 ? 32.362  -0.082  -45.660 1.00 32.74  ? 119 TYR B CD1 1 
ATOM   5137 C CD2 . TYR B 1 122 ? 33.996  -0.961  -47.159 1.00 32.89  ? 119 TYR B CD2 1 
ATOM   5138 C CE1 . TYR B 1 122 ? 31.674  0.475   -46.741 1.00 31.02  ? 119 TYR B CE1 1 
ATOM   5139 C CE2 . TYR B 1 122 ? 33.314  -0.412  -48.240 1.00 31.77  ? 119 TYR B CE2 1 
ATOM   5140 C CZ  . TYR B 1 122 ? 32.157  0.302   -48.024 1.00 31.35  ? 119 TYR B CZ  1 
ATOM   5141 O OH  . TYR B 1 122 ? 31.483  0.850   -49.096 1.00 30.42  ? 119 TYR B OH  1 
ATOM   5142 N N   . GLY B 1 123 ? 32.485  -1.730  -42.151 1.00 32.81  ? 120 GLY B N   1 
ATOM   5143 C CA  . GLY B 1 123 ? 31.346  -1.225  -41.407 1.00 31.95  ? 120 GLY B CA  1 
ATOM   5144 C C   . GLY B 1 123 ? 31.240  0.283   -41.536 1.00 36.93  ? 120 GLY B C   1 
ATOM   5145 O O   . GLY B 1 123 ? 31.879  0.885   -42.400 1.00 35.39  ? 120 GLY B O   1 
ATOM   5146 N N   . GLY B 1 124 ? 30.442  0.899   -40.670 1.00 32.35  ? 121 GLY B N   1 
ATOM   5147 C CA  . GLY B 1 124 ? 30.191  2.327   -40.752 1.00 31.22  ? 121 GLY B CA  1 
ATOM   5148 C C   . GLY B 1 124 ? 28.708  2.646   -40.772 1.00 35.33  ? 121 GLY B C   1 
ATOM   5149 O O   . GLY B 1 124 ? 28.268  3.579   -41.448 1.00 31.25  ? 121 GLY B O   1 
ATOM   5150 N N   . GLY B 1 125 ? 27.938  1.845   -40.040 1.00 32.84  ? 122 GLY B N   1 
ATOM   5151 C CA  . GLY B 1 125 ? 26.516  2.076   -39.840 1.00 32.16  ? 122 GLY B CA  1 
ATOM   5152 C C   . GLY B 1 125 ? 25.637  2.051   -41.079 1.00 35.73  ? 122 GLY B C   1 
ATOM   5153 O O   . GLY B 1 125 ? 24.536  2.605   -41.064 1.00 34.79  ? 122 GLY B O   1 
ATOM   5154 N N   . PHE B 1 126 ? 26.120  1.399   -42.137 1.00 35.48  ? 123 PHE B N   1 
ATOM   5155 C CA  . PHE B 1 126 ? 25.461  1.368   -43.450 1.00 33.21  ? 123 PHE B CA  1 
ATOM   5156 C C   . PHE B 1 126 ? 25.298  2.756   -44.079 1.00 33.30  ? 123 PHE B C   1 
ATOM   5157 O O   . PHE B 1 126 ? 24.576  2.907   -45.067 1.00 32.67  ? 123 PHE B O   1 
ATOM   5158 C CB  . PHE B 1 126 ? 24.083  0.689   -43.370 1.00 31.64  ? 123 PHE B CB  1 
ATOM   5159 C CG  . PHE B 1 126 ? 24.140  -0.786  -43.063 1.00 33.24  ? 123 PHE B CG  1 
ATOM   5160 C CD1 . PHE B 1 126 ? 24.551  -1.694  -44.024 1.00 32.93  ? 123 PHE B CD1 1 
ATOM   5161 C CD2 . PHE B 1 126 ? 23.765  -1.263  -41.812 1.00 32.09  ? 123 PHE B CD2 1 
ATOM   5162 C CE1 . PHE B 1 126 ? 24.597  -3.051  -43.747 1.00 34.02  ? 123 PHE B CE1 1 
ATOM   5163 C CE2 . PHE B 1 126 ? 23.807  -2.617  -41.528 1.00 29.59  ? 123 PHE B CE2 1 
ATOM   5164 C CZ  . PHE B 1 126 ? 24.225  -3.513  -42.497 1.00 35.02  ? 123 PHE B CZ  1 
ATOM   5165 N N   . TYR B 1 127 ? 25.970  3.765   -43.529 1.00 28.93  ? 124 TYR B N   1 
ATOM   5166 C CA  . TYR B 1 127 ? 25.889  5.111   -44.095 1.00 33.34  ? 124 TYR B CA  1 
ATOM   5167 C C   . TYR B 1 127 ? 27.262  5.642   -44.519 1.00 33.72  ? 124 TYR B C   1 
ATOM   5168 O O   . TYR B 1 127 ? 27.369  6.733   -45.082 1.00 34.65  ? 124 TYR B O   1 
ATOM   5169 C CB  . TYR B 1 127 ? 25.233  6.080   -43.099 1.00 31.55  ? 124 TYR B CB  1 
ATOM   5170 C CG  . TYR B 1 127 ? 26.083  6.439   -41.899 1.00 37.12  ? 124 TYR B CG  1 
ATOM   5171 C CD1 . TYR B 1 127 ? 26.988  7.491   -41.952 1.00 37.21  ? 124 TYR B CD1 1 
ATOM   5172 C CD2 . TYR B 1 127 ? 25.963  5.740   -40.702 1.00 37.56  ? 124 TYR B CD2 1 
ATOM   5173 C CE1 . TYR B 1 127 ? 27.765  7.826   -40.859 1.00 40.26  ? 124 TYR B CE1 1 
ATOM   5174 C CE2 . TYR B 1 127 ? 26.737  6.070   -39.598 1.00 39.87  ? 124 TYR B CE2 1 
ATOM   5175 C CZ  . TYR B 1 127 ? 27.635  7.114   -39.685 1.00 42.57  ? 124 TYR B CZ  1 
ATOM   5176 O OH  . TYR B 1 127 ? 28.408  7.446   -38.597 1.00 45.92  ? 124 TYR B OH  1 
ATOM   5177 N N   . SER B 1 128 ? 28.305  4.866   -44.254 1.00 31.30  ? 125 SER B N   1 
ATOM   5178 C CA  . SER B 1 128 ? 29.672  5.324   -44.471 1.00 30.97  ? 125 SER B CA  1 
ATOM   5179 C C   . SER B 1 128 ? 30.623  4.148   -44.596 1.00 30.89  ? 125 SER B C   1 
ATOM   5180 O O   . SER B 1 128 ? 30.228  3.000   -44.402 1.00 31.81  ? 125 SER B O   1 
ATOM   5181 C CB  . SER B 1 128 ? 30.126  6.225   -43.320 1.00 33.85  ? 125 SER B CB  1 
ATOM   5182 O OG  . SER B 1 128 ? 30.154  5.493   -42.101 1.00 34.16  ? 125 SER B OG  1 
ATOM   5183 N N   . GLY B 1 129 ? 31.884  4.445   -44.898 1.00 29.98  ? 126 GLY B N   1 
ATOM   5184 C CA  . GLY B 1 129 ? 32.912  3.427   -44.989 1.00 30.54  ? 126 GLY B CA  1 
ATOM   5185 C C   . GLY B 1 129 ? 33.525  3.331   -46.370 1.00 35.52  ? 126 GLY B C   1 
ATOM   5186 O O   . GLY B 1 129 ? 32.959  3.830   -47.344 1.00 30.56  ? 126 GLY B O   1 
ATOM   5187 N N   . ALA B 1 130 ? 34.688  2.692   -46.449 1.00 34.81  ? 127 ALA B N   1 
ATOM   5188 C CA  . ALA B 1 130 ? 35.363  2.467   -47.723 1.00 35.72  ? 127 ALA B CA  1 
ATOM   5189 C C   . ALA B 1 130 ? 36.427  1.390   -47.583 1.00 34.16  ? 127 ALA B C   1 
ATOM   5190 O O   . ALA B 1 130 ? 37.015  1.221   -46.517 1.00 34.57  ? 127 ALA B O   1 
ATOM   5191 C CB  . ALA B 1 130 ? 35.985  3.758   -48.239 1.00 38.50  ? 127 ALA B CB  1 
ATOM   5192 N N   . ALA B 1 131 ? 36.681  0.673   -48.672 1.00 34.57  ? 128 ALA B N   1 
ATOM   5193 C CA  . ALA B 1 131 ? 37.667  -0.399  -48.665 1.00 35.05  ? 128 ALA B CA  1 
ATOM   5194 C C   . ALA B 1 131 ? 39.092  0.144   -48.735 1.00 36.64  ? 128 ALA B C   1 
ATOM   5195 O O   . ALA B 1 131 ? 40.051  -0.601  -48.547 1.00 39.83  ? 128 ALA B O   1 
ATOM   5196 C CB  . ALA B 1 131 ? 37.408  -1.359  -49.822 1.00 32.00  ? 128 ALA B CB  1 
ATOM   5197 N N   . SER B 1 132 ? 39.227  1.445   -48.990 1.00 37.36  ? 129 SER B N   1 
ATOM   5198 C CA  . SER B 1 132 ? 40.538  2.054   -49.225 1.00 35.23  ? 129 SER B CA  1 
ATOM   5199 C C   . SER B 1 132 ? 41.211  2.600   -47.962 1.00 39.41  ? 129 SER B C   1 
ATOM   5200 O O   . SER B 1 132 ? 42.356  3.055   -48.013 1.00 38.23  ? 129 SER B O   1 
ATOM   5201 C CB  . SER B 1 132 ? 40.413  3.179   -50.259 1.00 35.30  ? 129 SER B CB  1 
ATOM   5202 O OG  . SER B 1 132 ? 39.481  4.163   -49.844 1.00 34.96  ? 129 SER B OG  1 
ATOM   5203 N N   . LEU B 1 133 ? 40.505  2.558   -46.835 1.00 38.17  ? 130 LEU B N   1 
ATOM   5204 C CA  . LEU B 1 133 ? 41.061  3.044   -45.575 1.00 38.42  ? 130 LEU B CA  1 
ATOM   5205 C C   . LEU B 1 133 ? 42.347  2.304   -45.215 1.00 36.23  ? 130 LEU B C   1 
ATOM   5206 O O   . LEU B 1 133 ? 42.494  1.120   -45.513 1.00 37.48  ? 130 LEU B O   1 
ATOM   5207 C CB  . LEU B 1 133 ? 40.041  2.903   -44.443 1.00 37.77  ? 130 LEU B CB  1 
ATOM   5208 C CG  . LEU B 1 133 ? 38.691  3.587   -44.663 1.00 40.19  ? 130 LEU B CG  1 
ATOM   5209 C CD1 . LEU B 1 133 ? 37.836  3.512   -43.402 1.00 35.43  ? 130 LEU B CD1 1 
ATOM   5210 C CD2 . LEU B 1 133 ? 38.879  5.033   -45.112 1.00 43.77  ? 130 LEU B CD2 1 
ATOM   5211 N N   . ASP B 1 134 ? 43.275  3.016   -44.582 1.00 41.18  ? 131 ASP B N   1 
ATOM   5212 C CA  . ASP B 1 134 ? 44.554  2.438   -44.171 1.00 44.46  ? 131 ASP B CA  1 
ATOM   5213 C C   . ASP B 1 134 ? 44.394  1.212   -43.264 1.00 42.14  ? 131 ASP B C   1 
ATOM   5214 O O   . ASP B 1 134 ? 45.188  0.276   -43.345 1.00 38.37  ? 131 ASP B O   1 
ATOM   5215 C CB  . ASP B 1 134 ? 45.411  3.488   -43.455 1.00 45.16  ? 131 ASP B CB  1 
ATOM   5216 C CG  . ASP B 1 134 ? 45.930  4.564   -44.396 1.00 49.72  ? 131 ASP B CG  1 
ATOM   5217 O OD1 . ASP B 1 134 ? 45.677  4.472   -45.617 1.00 50.79  ? 131 ASP B OD1 1 
ATOM   5218 O OD2 . ASP B 1 134 ? 46.601  5.498   -43.911 1.00 53.90  ? 131 ASP B OD2 1 
ATOM   5219 N N   . VAL B 1 135 ? 43.372  1.215   -42.408 1.00 36.62  ? 132 VAL B N   1 
ATOM   5220 C CA  . VAL B 1 135 ? 43.175  0.106   -41.468 1.00 39.40  ? 132 VAL B CA  1 
ATOM   5221 C C   . VAL B 1 135 ? 42.713  -1.186  -42.136 1.00 42.03  ? 132 VAL B C   1 
ATOM   5222 O O   . VAL B 1 135 ? 42.724  -2.241  -41.505 1.00 38.57  ? 132 VAL B O   1 
ATOM   5223 C CB  . VAL B 1 135 ? 42.150  0.457   -40.368 1.00 39.97  ? 132 VAL B CB  1 
ATOM   5224 C CG1 . VAL B 1 135 ? 42.812  1.257   -39.269 1.00 43.56  ? 132 VAL B CG1 1 
ATOM   5225 C CG2 . VAL B 1 135 ? 40.958  1.199   -40.958 1.00 41.81  ? 132 VAL B CG2 1 
ATOM   5226 N N   . TYR B 1 136 ? 42.295  -1.103  -43.398 1.00 33.89  ? 133 TYR B N   1 
ATOM   5227 C CA  . TYR B 1 136 ? 41.835  -2.284  -44.127 1.00 37.16  ? 133 TYR B CA  1 
ATOM   5228 C C   . TYR B 1 136 ? 42.881  -2.739  -45.137 1.00 36.11  ? 133 TYR B C   1 
ATOM   5229 O O   . TYR B 1 136 ? 42.593  -3.533  -46.030 1.00 37.39  ? 133 TYR B O   1 
ATOM   5230 C CB  . TYR B 1 136 ? 40.512  -2.009  -44.845 1.00 34.12  ? 133 TYR B CB  1 
ATOM   5231 C CG  . TYR B 1 136 ? 39.417  -1.455  -43.961 1.00 35.01  ? 133 TYR B CG  1 
ATOM   5232 C CD1 . TYR B 1 136 ? 39.326  -1.807  -42.619 1.00 35.20  ? 133 TYR B CD1 1 
ATOM   5233 C CD2 . TYR B 1 136 ? 38.469  -0.580  -44.475 1.00 32.04  ? 133 TYR B CD2 1 
ATOM   5234 C CE1 . TYR B 1 136 ? 38.324  -1.295  -41.815 1.00 32.57  ? 133 TYR B CE1 1 
ATOM   5235 C CE2 . TYR B 1 136 ? 37.467  -0.066  -43.684 1.00 31.62  ? 133 TYR B CE2 1 
ATOM   5236 C CZ  . TYR B 1 136 ? 37.396  -0.430  -42.351 1.00 32.64  ? 133 TYR B CZ  1 
ATOM   5237 O OH  . TYR B 1 136 ? 36.394  0.081   -41.564 1.00 30.91  ? 133 TYR B OH  1 
ATOM   5238 N N   . ASP B 1 137 ? 44.094  -2.222  -44.982 1.00 38.62  ? 134 ASP B N   1 
ATOM   5239 C CA  . ASP B 1 137 ? 45.217  -2.551  -45.850 1.00 37.77  ? 134 ASP B CA  1 
ATOM   5240 C C   . ASP B 1 137 ? 45.545  -4.041  -45.799 1.00 40.62  ? 134 ASP B C   1 
ATOM   5241 O O   . ASP B 1 137 ? 45.985  -4.548  -44.772 1.00 41.51  ? 134 ASP B O   1 
ATOM   5242 C CB  . ASP B 1 137 ? 46.435  -1.726  -45.435 1.00 41.72  ? 134 ASP B CB  1 
ATOM   5243 C CG  . ASP B 1 137 ? 47.548  -1.766  -46.453 1.00 44.61  ? 134 ASP B CG  1 
ATOM   5244 O OD1 . ASP B 1 137 ? 47.570  -2.684  -47.299 1.00 41.54  ? 134 ASP B OD1 1 
ATOM   5245 O OD2 . ASP B 1 137 ? 48.410  -0.865  -46.399 1.00 52.02  ? 134 ASP B OD2 1 
ATOM   5246 N N   . GLY B 1 138 ? 45.361  -4.733  -46.918 1.00 40.91  ? 135 GLY B N   1 
ATOM   5247 C CA  . GLY B 1 138 ? 45.515  -6.178  -46.941 1.00 37.33  ? 135 GLY B CA  1 
ATOM   5248 C C   . GLY B 1 138 ? 46.912  -6.719  -47.195 1.00 36.71  ? 135 GLY B C   1 
ATOM   5249 O O   . GLY B 1 138 ? 47.095  -7.932  -47.289 1.00 38.43  ? 135 GLY B O   1 
ATOM   5250 N N   . ARG B 1 139 ? 47.904  -5.842  -47.301 1.00 39.99  ? 136 ARG B N   1 
ATOM   5251 C CA  . ARG B 1 139 ? 49.235  -6.282  -47.718 1.00 44.09  ? 136 ARG B CA  1 
ATOM   5252 C C   . ARG B 1 139 ? 49.911  -7.156  -46.654 1.00 40.72  ? 136 ARG B C   1 
ATOM   5253 O O   . ARG B 1 139 ? 50.698  -8.046  -46.980 1.00 42.88  ? 136 ARG B O   1 
ATOM   5254 C CB  . ARG B 1 139 ? 50.120  -5.075  -48.058 1.00 42.53  ? 136 ARG B CB  1 
ATOM   5255 C CG  . ARG B 1 139 ? 50.666  -4.325  -46.853 1.00 46.52  ? 136 ARG B CG  1 
ATOM   5256 C CD  . ARG B 1 139 ? 50.694  -2.819  -47.082 1.00 50.68  ? 136 ARG B CD  1 
ATOM   5257 N NE  . ARG B 1 139 ? 51.759  -2.382  -47.976 1.00 55.26  ? 136 ARG B NE  1 
ATOM   5258 C CZ  . ARG B 1 139 ? 51.678  -1.317  -48.770 1.00 53.16  ? 136 ARG B CZ  1 
ATOM   5259 N NH1 . ARG B 1 139 ? 50.573  -0.582  -48.800 1.00 46.86  ? 136 ARG B NH1 1 
ATOM   5260 N NH2 . ARG B 1 139 ? 52.703  -0.992  -49.544 1.00 58.49  ? 136 ARG B NH2 1 
ATOM   5261 N N   . PHE B 1 140 ? 49.584  -6.916  -45.387 1.00 42.60  ? 137 PHE B N   1 
ATOM   5262 C CA  . PHE B 1 140 ? 50.231  -7.628  -44.289 1.00 41.32  ? 137 PHE B CA  1 
ATOM   5263 C C   . PHE B 1 140 ? 49.772  -9.077  -44.226 1.00 41.13  ? 137 PHE B C   1 
ATOM   5264 O O   . PHE B 1 140 ? 50.593  -9.985  -44.147 1.00 42.84  ? 137 PHE B O   1 
ATOM   5265 C CB  . PHE B 1 140 ? 49.963  -6.920  -42.966 1.00 41.47  ? 137 PHE B CB  1 
ATOM   5266 C CG  . PHE B 1 140 ? 50.306  -5.461  -42.991 1.00 43.88  ? 137 PHE B CG  1 
ATOM   5267 C CD1 . PHE B 1 140 ? 51.627  -5.046  -42.952 1.00 47.26  ? 137 PHE B CD1 1 
ATOM   5268 C CD2 . PHE B 1 140 ? 49.309  -4.502  -43.068 1.00 43.98  ? 137 PHE B CD2 1 
ATOM   5269 C CE1 . PHE B 1 140 ? 51.950  -3.699  -42.983 1.00 48.74  ? 137 PHE B CE1 1 
ATOM   5270 C CE2 . PHE B 1 140 ? 49.622  -3.153  -43.101 1.00 45.08  ? 137 PHE B CE2 1 
ATOM   5271 C CZ  . PHE B 1 140 ? 50.946  -2.751  -43.055 1.00 47.22  ? 137 PHE B CZ  1 
ATOM   5272 N N   . LEU B 1 141 ? 48.463  -9.294  -44.279 1.00 40.53  ? 138 LEU B N   1 
ATOM   5273 C CA  . LEU B 1 141 ? 47.926  -10.650 -44.319 1.00 38.93  ? 138 LEU B CA  1 
ATOM   5274 C C   . LEU B 1 141 ? 48.416  -11.415 -45.549 1.00 41.92  ? 138 LEU B C   1 
ATOM   5275 O O   . LEU B 1 141 ? 48.741  -12.604 -45.460 1.00 42.02  ? 138 LEU B O   1 
ATOM   5276 C CB  . LEU B 1 141 ? 46.397  -10.616 -44.278 1.00 37.45  ? 138 LEU B CB  1 
ATOM   5277 C CG  . LEU B 1 141 ? 45.856  -10.251 -42.888 1.00 39.12  ? 138 LEU B CG  1 
ATOM   5278 C CD1 . LEU B 1 141 ? 44.405  -9.822  -42.929 1.00 38.59  ? 138 LEU B CD1 1 
ATOM   5279 C CD2 . LEU B 1 141 ? 46.021  -11.431 -41.953 1.00 40.31  ? 138 LEU B CD2 1 
ATOM   5280 N N   . ALA B 1 142 ? 48.495  -10.725 -46.687 1.00 39.21  ? 139 ALA B N   1 
ATOM   5281 C CA  . ALA B 1 142 ? 48.941  -11.353 -47.926 1.00 42.71  ? 139 ALA B CA  1 
ATOM   5282 C C   . ALA B 1 142 ? 50.405  -11.769 -47.845 1.00 39.94  ? 139 ALA B C   1 
ATOM   5283 O O   . ALA B 1 142 ? 50.760  -12.877 -48.232 1.00 41.35  ? 139 ALA B O   1 
ATOM   5284 C CB  . ALA B 1 142 ? 48.721  -10.413 -49.120 1.00 42.85  ? 139 ALA B CB  1 
ATOM   5285 N N   . GLN B 1 143 ? 51.256  -10.881 -47.345 1.00 39.61  ? 140 GLN B N   1 
ATOM   5286 C CA  . GLN B 1 143 ? 52.685  -11.171 -47.293 1.00 41.55  ? 140 GLN B CA  1 
ATOM   5287 C C   . GLN B 1 143 ? 53.018  -12.186 -46.193 1.00 44.59  ? 140 GLN B C   1 
ATOM   5288 O O   . GLN B 1 143 ? 53.713  -13.170 -46.439 1.00 45.00  ? 140 GLN B O   1 
ATOM   5289 C CB  . GLN B 1 143 ? 53.479  -9.881  -47.081 1.00 44.36  ? 140 GLN B CB  1 
ATOM   5290 C CG  . GLN B 1 143 ? 54.937  -9.959  -47.516 1.00 49.03  ? 140 GLN B CG  1 
ATOM   5291 C CD  . GLN B 1 143 ? 55.820  -10.648 -46.493 1.00 50.17  ? 140 GLN B CD  1 
ATOM   5292 O OE1 . GLN B 1 143 ? 55.705  -10.401 -45.292 1.00 51.66  ? 140 GLN B OE1 1 
ATOM   5293 N NE2 . GLN B 1 143 ? 56.703  -11.521 -46.964 1.00 49.60  ? 140 GLN B NE2 1 
ATOM   5294 N N   . VAL B 1 144 ? 52.516  -11.945 -44.987 1.00 42.71  ? 141 VAL B N   1 
ATOM   5295 C CA  . VAL B 1 144 ? 52.859  -12.775 -43.830 1.00 42.51  ? 141 VAL B CA  1 
ATOM   5296 C C   . VAL B 1 144 ? 52.161  -14.130 -43.841 1.00 44.69  ? 141 VAL B C   1 
ATOM   5297 O O   . VAL B 1 144 ? 52.808  -15.159 -43.644 1.00 47.87  ? 141 VAL B O   1 
ATOM   5298 C CB  . VAL B 1 144 ? 52.523  -12.060 -42.507 1.00 40.82  ? 141 VAL B CB  1 
ATOM   5299 C CG1 . VAL B 1 144 ? 52.882  -12.943 -41.307 1.00 45.47  ? 141 VAL B CG1 1 
ATOM   5300 C CG2 . VAL B 1 144 ? 53.257  -10.739 -42.433 1.00 40.97  ? 141 VAL B CG2 1 
ATOM   5301 N N   . GLU B 1 145 ? 50.851  -14.143 -44.078 1.00 42.81  ? 142 GLU B N   1 
ATOM   5302 C CA  . GLU B 1 145 ? 50.111  -15.401 -44.015 1.00 43.03  ? 142 GLU B CA  1 
ATOM   5303 C C   . GLU B 1 145 ? 49.926  -16.033 -45.386 1.00 46.17  ? 142 GLU B C   1 
ATOM   5304 O O   . GLU B 1 145 ? 49.413  -17.146 -45.505 1.00 44.59  ? 142 GLU B O   1 
ATOM   5305 C CB  . GLU B 1 145 ? 48.753  -15.185 -43.347 1.00 42.10  ? 142 GLU B CB  1 
ATOM   5306 C CG  . GLU B 1 145 ? 48.859  -14.627 -41.939 1.00 43.15  ? 142 GLU B CG  1 
ATOM   5307 C CD  . GLU B 1 145 ? 49.637  -15.533 -41.002 1.00 48.31  ? 142 GLU B CD  1 
ATOM   5308 O OE1 . GLU B 1 145 ? 49.640  -16.766 -41.212 1.00 48.59  ? 142 GLU B OE1 1 
ATOM   5309 O OE2 . GLU B 1 145 ? 50.250  -15.008 -40.053 1.00 54.40  ? 142 GLU B OE2 1 
ATOM   5310 N N   . GLY B 1 146 ? 50.353  -15.321 -46.422 1.00 43.79  ? 143 GLY B N   1 
ATOM   5311 C CA  . GLY B 1 146 ? 50.236  -15.824 -47.776 1.00 44.12  ? 143 GLY B CA  1 
ATOM   5312 C C   . GLY B 1 146 ? 48.796  -15.870 -48.241 1.00 46.08  ? 143 GLY B C   1 
ATOM   5313 O O   . GLY B 1 146 ? 48.453  -16.652 -49.121 1.00 49.93  ? 143 GLY B O   1 
ATOM   5314 N N   . ALA B 1 147 ? 47.952  -15.026 -47.654 1.00 43.47  ? 144 ALA B N   1 
ATOM   5315 C CA  . ALA B 1 147 ? 46.526  -15.032 -47.965 1.00 42.88  ? 144 ALA B CA  1 
ATOM   5316 C C   . ALA B 1 147 ? 46.190  -14.207 -49.207 1.00 41.54  ? 144 ALA B C   1 
ATOM   5317 O O   . ALA B 1 147 ? 46.911  -13.276 -49.558 1.00 41.05  ? 144 ALA B O   1 
ATOM   5318 C CB  . ALA B 1 147 ? 45.730  -14.520 -46.778 1.00 42.05  ? 144 ALA B CB  1 
ATOM   5319 N N   . VAL B 1 148 ? 45.092  -14.564 -49.865 1.00 37.06  ? 145 VAL B N   1 
ATOM   5320 C CA  . VAL B 1 148 ? 44.498  -13.716 -50.896 1.00 38.81  ? 145 VAL B CA  1 
ATOM   5321 C C   . VAL B 1 148 ? 43.366  -12.913 -50.256 1.00 40.26  ? 145 VAL B C   1 
ATOM   5322 O O   . VAL B 1 148 ? 42.382  -13.485 -49.777 1.00 38.28  ? 145 VAL B O   1 
ATOM   5323 C CB  . VAL B 1 148 ? 43.963  -14.541 -52.089 1.00 37.96  ? 145 VAL B CB  1 
ATOM   5324 C CG1 . VAL B 1 148 ? 43.106  -13.677 -53.016 1.00 35.51  ? 145 VAL B CG1 1 
ATOM   5325 C CG2 . VAL B 1 148 ? 45.113  -15.173 -52.850 1.00 40.62  ? 145 VAL B CG2 1 
ATOM   5326 N N   . LEU B 1 149 ? 43.517  -11.592 -50.216 1.00 39.50  ? 146 LEU B N   1 
ATOM   5327 C CA  . LEU B 1 149 ? 42.508  -10.753 -49.580 1.00 34.21  ? 146 LEU B CA  1 
ATOM   5328 C C   . LEU B 1 149 ? 41.751  -9.900  -50.589 1.00 39.90  ? 146 LEU B C   1 
ATOM   5329 O O   . LEU B 1 149 ? 42.344  -9.277  -51.453 1.00 35.55  ? 146 LEU B O   1 
ATOM   5330 C CB  . LEU B 1 149 ? 43.145  -9.855  -48.522 1.00 36.41  ? 146 LEU B CB  1 
ATOM   5331 C CG  . LEU B 1 149 ? 42.175  -9.439  -47.411 1.00 45.62  ? 146 LEU B CG  1 
ATOM   5332 C CD1 . LEU B 1 149 ? 42.892  -9.356  -46.094 1.00 41.23  ? 146 LEU B CD1 1 
ATOM   5333 C CD2 . LEU B 1 149 ? 41.525  -8.097  -47.739 1.00 44.78  ? 146 LEU B CD2 1 
ATOM   5334 N N   . VAL B 1 150 ? 40.432  -9.871  -50.456 1.00 37.36  ? 147 VAL B N   1 
ATOM   5335 C CA  . VAL B 1 150 ? 39.577  -9.084  -51.327 1.00 33.51  ? 147 VAL B CA  1 
ATOM   5336 C C   . VAL B 1 150 ? 38.775  -8.121  -50.476 1.00 35.43  ? 147 VAL B C   1 
ATOM   5337 O O   . VAL B 1 150 ? 38.354  -8.480  -49.382 1.00 35.28  ? 147 VAL B O   1 
ATOM   5338 C CB  . VAL B 1 150 ? 38.613  -9.977  -52.135 1.00 32.13  ? 147 VAL B CB  1 
ATOM   5339 C CG1 . VAL B 1 150 ? 37.728  -9.139  -53.048 1.00 29.35  ? 147 VAL B CG1 1 
ATOM   5340 C CG2 . VAL B 1 150 ? 39.384  -11.019 -52.925 1.00 36.46  ? 147 VAL B CG2 1 
ATOM   5341 N N   . SER B 1 151 ? 38.573  -6.899  -50.952 1.00 33.39  ? 148 SER B N   1 
ATOM   5342 C CA  . SER B 1 151 ? 37.632  -5.998  -50.288 1.00 29.04  ? 148 SER B CA  1 
ATOM   5343 C C   . SER B 1 151 ? 36.848  -5.220  -51.330 1.00 33.87  ? 148 SER B C   1 
ATOM   5344 O O   . SER B 1 151 ? 37.402  -4.822  -52.345 1.00 31.40  ? 148 SER B O   1 
ATOM   5345 C CB  . SER B 1 151 ? 38.357  -5.046  -49.337 1.00 31.84  ? 148 SER B CB  1 
ATOM   5346 O OG  . SER B 1 151 ? 39.246  -4.186  -50.026 1.00 34.57  ? 148 SER B OG  1 
ATOM   5347 N N   . MET B 1 152 ? 35.559  -5.007  -51.104 1.00 33.03  ? 149 MET B N   1 
ATOM   5348 C CA  . MET B 1 152 ? 34.761  -4.310  -52.108 1.00 31.91  ? 149 MET B CA  1 
ATOM   5349 C C   . MET B 1 152 ? 34.134  -3.037  -51.549 1.00 35.78  ? 149 MET B C   1 
ATOM   5350 O O   . MET B 1 152 ? 33.879  -2.934  -50.348 1.00 30.40  ? 149 MET B O   1 
ATOM   5351 C CB  . MET B 1 152 ? 33.673  -5.234  -52.669 1.00 29.52  ? 149 MET B CB  1 
ATOM   5352 C CG  . MET B 1 152 ? 32.358  -5.219  -51.906 1.00 27.78  ? 149 MET B CG  1 
ATOM   5353 S SD  . MET B 1 152 ? 32.508  -5.883  -50.226 1.00 31.32  ? 149 MET B SD  1 
ATOM   5354 C CE  . MET B 1 152 ? 32.522  -7.635  -50.565 1.00 24.55  ? 149 MET B CE  1 
ATOM   5355 N N   . ASN B 1 153 ? 33.930  -2.049  -52.417 1.00 30.87  ? 150 ASN B N   1 
ATOM   5356 C CA  . ASN B 1 153 ? 33.097  -0.912  -52.057 1.00 29.74  ? 150 ASN B CA  1 
ATOM   5357 C C   . ASN B 1 153 ? 31.650  -1.308  -52.288 1.00 31.43  ? 150 ASN B C   1 
ATOM   5358 O O   . ASN B 1 153 ? 31.349  -2.022  -53.243 1.00 29.28  ? 150 ASN B O   1 
ATOM   5359 C CB  . ASN B 1 153 ? 33.449  0.331   -52.877 1.00 31.40  ? 150 ASN B CB  1 
ATOM   5360 C CG  . ASN B 1 153 ? 34.649  1.070   -52.335 1.00 39.10  ? 150 ASN B CG  1 
ATOM   5361 O OD1 . ASN B 1 153 ? 35.216  0.690   -51.311 1.00 36.59  ? 150 ASN B OD1 1 
ATOM   5362 N ND2 . ASN B 1 153 ? 35.047  2.137   -53.021 1.00 36.09  ? 150 ASN B ND2 1 
ATOM   5363 N N   . TYR B 1 154 ? 30.755  -0.877  -51.407 1.00 27.30  ? 151 TYR B N   1 
ATOM   5364 C CA  . TYR B 1 154 ? 29.331  -1.090  -51.633 1.00 26.75  ? 151 TYR B CA  1 
ATOM   5365 C C   . TYR B 1 154 ? 28.576  0.187   -51.302 1.00 27.37  ? 151 TYR B C   1 
ATOM   5366 O O   . TYR B 1 154 ? 29.031  0.995   -50.493 1.00 29.83  ? 151 TYR B O   1 
ATOM   5367 C CB  . TYR B 1 154 ? 28.802  -2.280  -50.816 1.00 27.23  ? 151 TYR B CB  1 
ATOM   5368 C CG  . TYR B 1 154 ? 28.895  -2.117  -49.305 1.00 29.10  ? 151 TYR B CG  1 
ATOM   5369 C CD1 . TYR B 1 154 ? 30.020  -2.540  -48.604 1.00 30.98  ? 151 TYR B CD1 1 
ATOM   5370 C CD2 . TYR B 1 154 ? 27.853  -1.548  -48.582 1.00 27.94  ? 151 TYR B CD2 1 
ATOM   5371 C CE1 . TYR B 1 154 ? 30.106  -2.397  -47.213 1.00 26.51  ? 151 TYR B CE1 1 
ATOM   5372 C CE2 . TYR B 1 154 ? 27.933  -1.399  -47.196 1.00 28.67  ? 151 TYR B CE2 1 
ATOM   5373 C CZ  . TYR B 1 154 ? 29.061  -1.821  -46.522 1.00 29.83  ? 151 TYR B CZ  1 
ATOM   5374 O OH  . TYR B 1 154 ? 29.131  -1.670  -45.147 1.00 33.60  ? 151 TYR B OH  1 
ATOM   5375 N N   . ARG B 1 155 ? 27.434  0.386   -51.951 1.00 27.99  ? 152 ARG B N   1 
ATOM   5376 C CA  . ARG B 1 155 ? 26.671  1.609   -51.752 1.00 27.41  ? 152 ARG B CA  1 
ATOM   5377 C C   . ARG B 1 155 ? 26.121  1.707   -50.335 1.00 32.05  ? 152 ARG B C   1 
ATOM   5378 O O   . ARG B 1 155 ? 25.623  0.728   -49.779 1.00 27.92  ? 152 ARG B O   1 
ATOM   5379 C CB  . ARG B 1 155 ? 25.535  1.699   -52.759 1.00 28.38  ? 152 ARG B CB  1 
ATOM   5380 C CG  . ARG B 1 155 ? 25.995  2.125   -54.153 1.00 30.78  ? 152 ARG B CG  1 
ATOM   5381 C CD  . ARG B 1 155 ? 24.853  2.045   -55.143 1.00 28.37  ? 152 ARG B CD  1 
ATOM   5382 N NE  . ARG B 1 155 ? 24.566  0.671   -55.528 1.00 27.68  ? 152 ARG B NE  1 
ATOM   5383 C CZ  . ARG B 1 155 ? 23.528  0.303   -56.272 1.00 30.07  ? 152 ARG B CZ  1 
ATOM   5384 N NH1 . ARG B 1 155 ? 22.660  1.212   -56.700 1.00 30.71  ? 152 ARG B NH1 1 
ATOM   5385 N NH2 . ARG B 1 155 ? 23.355  -0.973  -56.584 1.00 30.09  ? 152 ARG B NH2 1 
ATOM   5386 N N   . VAL B 1 156 ? 26.215  2.903   -49.766 1.00 29.94  ? 153 VAL B N   1 
ATOM   5387 C CA  . VAL B 1 156 ? 25.724  3.158   -48.419 1.00 29.66  ? 153 VAL B CA  1 
ATOM   5388 C C   . VAL B 1 156 ? 24.736  4.319   -48.424 1.00 34.93  ? 153 VAL B C   1 
ATOM   5389 O O   . VAL B 1 156 ? 24.482  4.935   -49.465 1.00 31.31  ? 153 VAL B O   1 
ATOM   5390 C CB  . VAL B 1 156 ? 26.874  3.480   -47.454 1.00 31.19  ? 153 VAL B CB  1 
ATOM   5391 C CG1 . VAL B 1 156 ? 27.829  2.294   -47.350 1.00 28.45  ? 153 VAL B CG1 1 
ATOM   5392 C CG2 . VAL B 1 156 ? 27.606  4.734   -47.908 1.00 32.94  ? 153 VAL B CG2 1 
ATOM   5393 N N   . GLY B 1 157 ? 24.183  4.622   -47.257 1.00 32.64  ? 154 GLY B N   1 
ATOM   5394 C CA  . GLY B 1 157 ? 23.198  5.679   -47.138 1.00 30.13  ? 154 GLY B CA  1 
ATOM   5395 C C   . GLY B 1 157 ? 21.986  5.394   -48.004 1.00 30.96  ? 154 GLY B C   1 
ATOM   5396 O O   . GLY B 1 157 ? 21.627  4.236   -48.234 1.00 29.76  ? 154 GLY B O   1 
ATOM   5397 N N   . THR B 1 158 ? 21.354  6.458   -48.483 1.00 31.53  ? 155 THR B N   1 
ATOM   5398 C CA  . THR B 1 158 ? 20.184  6.336   -49.338 1.00 35.39  ? 155 THR B CA  1 
ATOM   5399 C C   . THR B 1 158 ? 20.527  5.581   -50.623 1.00 31.36  ? 155 THR B C   1 
ATOM   5400 O O   . THR B 1 158 ? 19.730  4.795   -51.124 1.00 30.14  ? 155 THR B O   1 
ATOM   5401 C CB  . THR B 1 158 ? 19.616  7.719   -49.694 1.00 36.16  ? 155 THR B CB  1 
ATOM   5402 O OG1 . THR B 1 158 ? 20.621  8.481   -50.374 1.00 34.85  ? 155 THR B OG1 1 
ATOM   5403 C CG2 . THR B 1 158 ? 19.196  8.463   -48.429 1.00 34.19  ? 155 THR B CG2 1 
ATOM   5404 N N   . PHE B 1 159 ? 21.733  5.809   -51.127 1.00 30.33  ? 156 PHE B N   1 
ATOM   5405 C CA  . PHE B 1 159 ? 22.175  5.226   -52.391 1.00 29.30  ? 156 PHE B CA  1 
ATOM   5406 C C   . PHE B 1 159 ? 22.198  3.710   -52.337 1.00 33.65  ? 156 PHE B C   1 
ATOM   5407 O O   . PHE B 1 159 ? 22.011  3.041   -53.349 1.00 31.54  ? 156 PHE B O   1 
ATOM   5408 C CB  . PHE B 1 159 ? 23.554  5.772   -52.751 1.00 28.62  ? 156 PHE B CB  1 
ATOM   5409 C CG  . PHE B 1 159 ? 23.624  7.265   -52.690 1.00 33.92  ? 156 PHE B CG  1 
ATOM   5410 C CD1 . PHE B 1 159 ? 23.197  8.034   -53.763 1.00 34.09  ? 156 PHE B CD1 1 
ATOM   5411 C CD2 . PHE B 1 159 ? 24.061  7.903   -51.538 1.00 32.01  ? 156 PHE B CD2 1 
ATOM   5412 C CE1 . PHE B 1 159 ? 23.235  9.409   -53.698 1.00 36.15  ? 156 PHE B CE1 1 
ATOM   5413 C CE2 . PHE B 1 159 ? 24.101  9.277   -51.464 1.00 33.26  ? 156 PHE B CE2 1 
ATOM   5414 C CZ  . PHE B 1 159 ? 23.686  10.034  -52.549 1.00 35.64  ? 156 PHE B CZ  1 
ATOM   5415 N N   . GLY B 1 160 ? 22.415  3.168   -51.144 1.00 31.88  ? 157 GLY B N   1 
ATOM   5416 C CA  . GLY B 1 160 ? 22.506  1.732   -50.990 1.00 30.68  ? 157 GLY B CA  1 
ATOM   5417 C C   . GLY B 1 160 ? 21.319  1.090   -50.301 1.00 33.37  ? 157 GLY B C   1 
ATOM   5418 O O   . GLY B 1 160 ? 21.102  -0.114  -50.444 1.00 33.76  ? 157 GLY B O   1 
ATOM   5419 N N   . PHE B 1 161 ? 20.548  1.871   -49.548 1.00 33.13  ? 158 PHE B N   1 
ATOM   5420 C CA  . PHE B 1 161 ? 19.497  1.263   -48.736 1.00 36.27  ? 158 PHE B CA  1 
ATOM   5421 C C   . PHE B 1 161 ? 18.175  2.024   -48.680 1.00 34.97  ? 158 PHE B C   1 
ATOM   5422 O O   . PHE B 1 161 ? 17.244  1.563   -48.025 1.00 34.37  ? 158 PHE B O   1 
ATOM   5423 C CB  . PHE B 1 161 ? 20.041  1.020   -47.320 1.00 33.32  ? 158 PHE B CB  1 
ATOM   5424 C CG  . PHE B 1 161 ? 21.195  0.066   -47.305 1.00 31.81  ? 158 PHE B CG  1 
ATOM   5425 C CD1 . PHE B 1 161 ? 20.979  -1.296  -47.417 1.00 30.97  ? 158 PHE B CD1 1 
ATOM   5426 C CD2 . PHE B 1 161 ? 22.498  0.533   -47.270 1.00 31.32  ? 158 PHE B CD2 1 
ATOM   5427 C CE1 . PHE B 1 161 ? 22.038  -2.179  -47.451 1.00 28.90  ? 158 PHE B CE1 1 
ATOM   5428 C CE2 . PHE B 1 161 ? 23.560  -0.345  -47.310 1.00 29.83  ? 158 PHE B CE2 1 
ATOM   5429 C CZ  . PHE B 1 161 ? 23.330  -1.702  -47.398 1.00 29.22  ? 158 PHE B CZ  1 
ATOM   5430 N N   . LEU B 1 162 ? 18.061  3.153   -49.380 1.00 34.55  ? 159 LEU B N   1 
ATOM   5431 C CA  . LEU B 1 162 ? 16.741  3.772   -49.501 1.00 38.22  ? 159 LEU B CA  1 
ATOM   5432 C C   . LEU B 1 162 ? 15.834  2.777   -50.204 1.00 37.91  ? 159 LEU B C   1 
ATOM   5433 O O   . LEU B 1 162 ? 16.209  2.195   -51.220 1.00 38.89  ? 159 LEU B O   1 
ATOM   5434 C CB  . LEU B 1 162 ? 16.775  5.098   -50.264 1.00 37.86  ? 159 LEU B CB  1 
ATOM   5435 C CG  . LEU B 1 162 ? 15.387  5.728   -50.454 1.00 35.65  ? 159 LEU B CG  1 
ATOM   5436 C CD1 . LEU B 1 162 ? 15.422  7.223   -50.196 1.00 36.32  ? 159 LEU B CD1 1 
ATOM   5437 C CD2 . LEU B 1 162 ? 14.806  5.433   -51.845 1.00 37.57  ? 159 LEU B CD2 1 
ATOM   5438 N N   . ALA B 1 163 ? 14.647  2.568   -49.655 1.00 38.47  ? 160 ALA B N   1 
ATOM   5439 C CA  . ALA B 1 163 ? 13.780  1.518   -50.155 1.00 36.03  ? 160 ALA B CA  1 
ATOM   5440 C C   . ALA B 1 163 ? 12.328  1.950   -50.206 1.00 40.54  ? 160 ALA B C   1 
ATOM   5441 O O   . ALA B 1 163 ? 11.830  2.620   -49.302 1.00 44.67  ? 160 ALA B O   1 
ATOM   5442 C CB  . ALA B 1 163 ? 13.919  0.268   -49.291 1.00 40.24  ? 160 ALA B CB  1 
ATOM   5443 N N   . LEU B 1 164 ? 11.658  1.563   -51.281 1.00 43.90  ? 161 LEU B N   1 
ATOM   5444 C CA  . LEU B 1 164 ? 10.211  1.627   -51.349 1.00 45.46  ? 161 LEU B CA  1 
ATOM   5445 C C   . LEU B 1 164 ? 9.732   0.221   -51.670 1.00 44.55  ? 161 LEU B C   1 
ATOM   5446 O O   . LEU B 1 164 ? 9.512   -0.118  -52.830 1.00 44.91  ? 161 LEU B O   1 
ATOM   5447 C CB  . LEU B 1 164 ? 9.749   2.651   -52.385 1.00 43.03  ? 161 LEU B CB  1 
ATOM   5448 C CG  . LEU B 1 164 ? 9.992   4.075   -51.876 1.00 45.67  ? 161 LEU B CG  1 
ATOM   5449 C CD1 . LEU B 1 164 ? 10.336  5.016   -52.998 1.00 53.28  ? 161 LEU B CD1 1 
ATOM   5450 C CD2 . LEU B 1 164 ? 8.785   4.589   -51.105 1.00 47.26  ? 161 LEU B CD2 1 
ATOM   5451 N N   . PRO B 1 165 ? 9.601   -0.611  -50.625 1.00 43.96  ? 162 PRO B N   1 
ATOM   5452 C CA  . PRO B 1 165 ? 9.346   -2.051  -50.721 1.00 44.97  ? 162 PRO B CA  1 
ATOM   5453 C C   . PRO B 1 165 ? 8.175   -2.383  -51.629 1.00 41.99  ? 162 PRO B C   1 
ATOM   5454 O O   . PRO B 1 165 ? 7.110   -1.776  -51.516 1.00 45.98  ? 162 PRO B O   1 
ATOM   5455 C CB  . PRO B 1 165 ? 9.044   -2.448  -49.274 1.00 42.64  ? 162 PRO B CB  1 
ATOM   5456 C CG  . PRO B 1 165 ? 9.769   -1.447  -48.460 1.00 44.22  ? 162 PRO B CG  1 
ATOM   5457 C CD  . PRO B 1 165 ? 9.662   -0.161  -49.224 1.00 44.75  ? 162 PRO B CD  1 
ATOM   5458 N N   . GLY B 1 166 ? 8.386   -3.340  -52.525 1.00 45.38  ? 163 GLY B N   1 
ATOM   5459 C CA  . GLY B 1 166 ? 7.377   -3.716  -53.494 1.00 47.66  ? 163 GLY B CA  1 
ATOM   5460 C C   . GLY B 1 166 ? 7.606   -3.068  -54.847 1.00 50.56  ? 163 GLY B C   1 
ATOM   5461 O O   . GLY B 1 166 ? 7.092   -3.544  -55.857 1.00 49.57  ? 163 GLY B O   1 
ATOM   5462 N N   . SER B 1 167 ? 8.380   -1.985  -54.871 1.00 48.88  ? 164 SER B N   1 
ATOM   5463 C CA  . SER B 1 167 ? 8.616   -1.253  -56.116 1.00 49.42  ? 164 SER B CA  1 
ATOM   5464 C C   . SER B 1 167 ? 9.740   -1.867  -56.945 1.00 49.12  ? 164 SER B C   1 
ATOM   5465 O O   . SER B 1 167 ? 10.656  -2.494  -56.416 1.00 43.09  ? 164 SER B O   1 
ATOM   5466 C CB  . SER B 1 167 ? 8.940   0.215   -55.828 1.00 49.49  ? 164 SER B CB  1 
ATOM   5467 O OG  . SER B 1 167 ? 10.239  0.353   -55.275 1.00 44.67  ? 164 SER B OG  1 
ATOM   5468 N N   . ARG B 1 168 ? 9.665   -1.672  -58.254 1.00 50.25  ? 165 ARG B N   1 
ATOM   5469 C CA  . ARG B 1 168 ? 10.686  -2.174  -59.159 1.00 51.42  ? 165 ARG B CA  1 
ATOM   5470 C C   . ARG B 1 168 ? 11.939  -1.305  -59.086 1.00 44.86  ? 165 ARG B C   1 
ATOM   5471 O O   . ARG B 1 168 ? 13.064  -1.797  -59.206 1.00 45.19  ? 165 ARG B O   1 
ATOM   5472 C CB  . ARG B 1 168 ? 10.143  -2.216  -60.593 1.00 58.25  ? 165 ARG B CB  1 
ATOM   5473 C CG  . ARG B 1 168 ? 11.209  -2.087  -61.664 1.00 67.01  ? 165 ARG B CG  1 
ATOM   5474 C CD  . ARG B 1 168 ? 10.619  -2.111  -63.068 1.00 75.38  ? 165 ARG B CD  1 
ATOM   5475 N NE  . ARG B 1 168 ? 11.613  -2.516  -64.059 1.00 85.08  ? 165 ARG B NE  1 
ATOM   5476 C CZ  . ARG B 1 168 ? 12.575  -1.725  -64.524 1.00 89.69  ? 165 ARG B CZ  1 
ATOM   5477 N NH1 . ARG B 1 168 ? 12.679  -0.474  -64.095 1.00 84.17  ? 165 ARG B NH1 1 
ATOM   5478 N NH2 . ARG B 1 168 ? 13.435  -2.186  -65.423 1.00 94.80  ? 165 ARG B NH2 1 
ATOM   5479 N N   . GLU B 1 169 ? 11.730  -0.014  -58.855 1.00 44.48  ? 166 GLU B N   1 
ATOM   5480 C CA  . GLU B 1 169 ? 12.774  0.986   -59.031 1.00 45.07  ? 166 GLU B CA  1 
ATOM   5481 C C   . GLU B 1 169 ? 13.638  1.199   -57.782 1.00 45.33  ? 166 GLU B C   1 
ATOM   5482 O O   . GLU B 1 169 ? 14.779  1.651   -57.887 1.00 41.91  ? 166 GLU B O   1 
ATOM   5483 C CB  . GLU B 1 169 ? 12.146  2.316   -59.465 1.00 47.91  ? 166 GLU B CB  1 
ATOM   5484 C CG  . GLU B 1 169 ? 11.056  2.196   -60.546 1.00 57.09  ? 166 GLU B CG  1 
ATOM   5485 C CD  . GLU B 1 169 ? 9.684   1.837   -59.979 1.00 62.28  ? 166 GLU B CD  1 
ATOM   5486 O OE1 . GLU B 1 169 ? 9.328   2.347   -58.894 1.00 58.28  ? 166 GLU B OE1 1 
ATOM   5487 O OE2 . GLU B 1 169 ? 8.963   1.038   -60.615 1.00 66.05  ? 166 GLU B OE2 1 
ATOM   5488 N N   . ALA B 1 170 ? 13.097  0.883   -56.608 1.00 44.89  ? 167 ALA B N   1 
ATOM   5489 C CA  . ALA B 1 170 ? 13.856  0.991   -55.359 1.00 41.58  ? 167 ALA B CA  1 
ATOM   5490 C C   . ALA B 1 170 ? 13.460  -0.117  -54.384 1.00 42.57  ? 167 ALA B C   1 
ATOM   5491 O O   . ALA B 1 170 ? 12.775  0.138   -53.388 1.00 39.30  ? 167 ALA B O   1 
ATOM   5492 C CB  . ALA B 1 170 ? 13.649  2.356   -54.724 1.00 37.30  ? 167 ALA B CB  1 
ATOM   5493 N N   . PRO B 1 171 ? 13.901  -1.353  -54.668 1.00 41.98  ? 168 PRO B N   1 
ATOM   5494 C CA  . PRO B 1 171 ? 13.468  -2.546  -53.930 1.00 40.47  ? 168 PRO B CA  1 
ATOM   5495 C C   . PRO B 1 171 ? 14.093  -2.670  -52.543 1.00 40.75  ? 168 PRO B C   1 
ATOM   5496 O O   . PRO B 1 171 ? 13.596  -3.434  -51.714 1.00 43.44  ? 168 PRO B O   1 
ATOM   5497 C CB  . PRO B 1 171 ? 13.930  -3.691  -54.830 1.00 43.06  ? 168 PRO B CB  1 
ATOM   5498 C CG  . PRO B 1 171 ? 15.126  -3.142  -55.534 1.00 41.92  ? 168 PRO B CG  1 
ATOM   5499 C CD  . PRO B 1 171 ? 14.864  -1.680  -55.737 1.00 39.34  ? 168 PRO B CD  1 
ATOM   5500 N N   . GLY B 1 172 ? 15.170  -1.934  -52.297 1.00 37.04  ? 169 GLY B N   1 
ATOM   5501 C CA  . GLY B 1 172 ? 15.888  -2.038  -51.042 1.00 36.19  ? 169 GLY B CA  1 
ATOM   5502 C C   . GLY B 1 172 ? 17.031  -3.035  -51.092 1.00 38.20  ? 169 GLY B C   1 
ATOM   5503 O O   . GLY B 1 172 ? 17.123  -3.846  -52.017 1.00 33.92  ? 169 GLY B O   1 
ATOM   5504 N N   . ASN B 1 173 ? 17.910  -2.954  -50.095 1.00 32.44  ? 170 ASN B N   1 
ATOM   5505 C CA  . ASN B 1 173 ? 19.049  -3.859  -49.955 1.00 29.24  ? 170 ASN B CA  1 
ATOM   5506 C C   . ASN B 1 173 ? 20.048  -3.882  -51.123 1.00 30.43  ? 170 ASN B C   1 
ATOM   5507 O O   . ASN B 1 173 ? 20.773  -4.862  -51.285 1.00 31.68  ? 170 ASN B O   1 
ATOM   5508 C CB  . ASN B 1 173 ? 18.541  -5.283  -49.715 1.00 29.31  ? 170 ASN B CB  1 
ATOM   5509 C CG  . ASN B 1 173 ? 17.746  -5.400  -48.430 1.00 33.85  ? 170 ASN B CG  1 
ATOM   5510 O OD1 . ASN B 1 173 ? 17.960  -4.633  -47.496 1.00 30.26  ? 170 ASN B OD1 1 
ATOM   5511 N ND2 . ASN B 1 173 ? 16.820  -6.348  -48.383 1.00 32.11  ? 170 ASN B ND2 1 
ATOM   5512 N N   . VAL B 1 174 ? 20.124  -2.826  -51.928 1.00 28.90  ? 171 VAL B N   1 
ATOM   5513 C CA  . VAL B 1 174 ? 21.004  -2.923  -53.094 1.00 33.04  ? 171 VAL B CA  1 
ATOM   5514 C C   . VAL B 1 174 ? 22.483  -2.828  -52.692 1.00 32.57  ? 171 VAL B C   1 
ATOM   5515 O O   . VAL B 1 174 ? 23.342  -3.261  -53.444 1.00 31.68  ? 171 VAL B O   1 
ATOM   5516 C CB  . VAL B 1 174 ? 20.670  -1.866  -54.183 1.00 31.22  ? 171 VAL B CB  1 
ATOM   5517 C CG1 . VAL B 1 174 ? 19.218  -2.000  -54.611 1.00 30.02  ? 171 VAL B CG1 1 
ATOM   5518 C CG2 . VAL B 1 174 ? 20.973  -0.452  -53.716 1.00 30.16  ? 171 VAL B CG2 1 
ATOM   5519 N N   . GLY B 1 175 ? 22.778  -2.301  -51.502 1.00 30.03  ? 172 GLY B N   1 
ATOM   5520 C CA  . GLY B 1 175 ? 24.138  -2.343  -50.973 1.00 26.80  ? 172 GLY B CA  1 
ATOM   5521 C C   . GLY B 1 175 ? 24.586  -3.772  -50.671 1.00 29.64  ? 172 GLY B C   1 
ATOM   5522 O O   . GLY B 1 175 ? 25.747  -4.170  -50.911 1.00 32.95  ? 172 GLY B O   1 
ATOM   5523 N N   . LEU B 1 176 ? 23.648  -4.560  -50.152 1.00 28.62  ? 173 LEU B N   1 
ATOM   5524 C CA  . LEU B 1 176 ? 23.892  -5.974  -49.908 1.00 29.89  ? 173 LEU B CA  1 
ATOM   5525 C C   . LEU B 1 176 ? 24.057  -6.707  -51.240 1.00 30.78  ? 173 LEU B C   1 
ATOM   5526 O O   . LEU B 1 176 ? 24.853  -7.638  -51.358 1.00 32.71  ? 173 LEU B O   1 
ATOM   5527 C CB  . LEU B 1 176 ? 22.751  -6.582  -49.090 1.00 27.31  ? 173 LEU B CB  1 
ATOM   5528 C CG  . LEU B 1 176 ? 22.614  -6.035  -47.664 1.00 32.22  ? 173 LEU B CG  1 
ATOM   5529 C CD1 . LEU B 1 176 ? 21.362  -6.584  -47.000 1.00 29.34  ? 173 LEU B CD1 1 
ATOM   5530 C CD2 . LEU B 1 176 ? 23.852  -6.381  -46.845 1.00 31.51  ? 173 LEU B CD2 1 
ATOM   5531 N N   . LEU B 1 177 ? 23.296  -6.284  -52.242 1.00 29.84  ? 174 LEU B N   1 
ATOM   5532 C CA  . LEU B 1 177 ? 23.424  -6.859  -53.581 1.00 29.57  ? 174 LEU B CA  1 
ATOM   5533 C C   . LEU B 1 177 ? 24.766  -6.484  -54.224 1.00 26.06  ? 174 LEU B C   1 
ATOM   5534 O O   . LEU B 1 177 ? 25.339  -7.278  -54.965 1.00 27.23  ? 174 LEU B O   1 
ATOM   5535 C CB  . LEU B 1 177 ? 22.253  -6.418  -54.459 1.00 31.74  ? 174 LEU B CB  1 
ATOM   5536 C CG  . LEU B 1 177 ? 20.894  -6.981  -54.030 1.00 34.51  ? 174 LEU B CG  1 
ATOM   5537 C CD1 . LEU B 1 177 ? 19.771  -6.423  -54.896 1.00 35.14  ? 174 LEU B CD1 1 
ATOM   5538 C CD2 . LEU B 1 177 ? 20.910  -8.507  -54.077 1.00 30.68  ? 174 LEU B CD2 1 
ATOM   5539 N N   . ASP B 1 178 ? 25.270  -5.289  -53.926 1.00 28.45  ? 175 ASP B N   1 
ATOM   5540 C CA  . ASP B 1 178 ? 26.615  -4.895  -54.343 1.00 26.39  ? 175 ASP B CA  1 
ATOM   5541 C C   . ASP B 1 178 ? 27.619  -5.881  -53.780 1.00 32.57  ? 175 ASP B C   1 
ATOM   5542 O O   . ASP B 1 178 ? 28.462  -6.434  -54.512 1.00 26.11  ? 175 ASP B O   1 
ATOM   5543 C CB  . ASP B 1 178 ? 26.956  -3.476  -53.871 1.00 27.60  ? 175 ASP B CB  1 
ATOM   5544 C CG  . ASP B 1 178 ? 26.083  -2.409  -54.520 1.00 31.86  ? 175 ASP B CG  1 
ATOM   5545 O OD1 . ASP B 1 178 ? 25.454  -2.694  -55.560 1.00 31.02  ? 175 ASP B OD1 1 
ATOM   5546 O OD2 . ASP B 1 178 ? 26.031  -1.279  -53.987 1.00 32.81  ? 175 ASP B OD2 1 
ATOM   5547 N N   . GLN B 1 179 ? 27.518  -6.110  -52.466 1.00 26.62  ? 176 GLN B N   1 
ATOM   5548 C CA  . GLN B 1 179 ? 28.404  -7.075  -51.830 1.00 24.52  ? 176 GLN B CA  1 
ATOM   5549 C C   . GLN B 1 179 ? 28.302  -8.454  -52.476 1.00 25.99  ? 176 GLN B C   1 
ATOM   5550 O O   . GLN B 1 179 ? 29.316  -9.107  -52.736 1.00 28.85  ? 176 GLN B O   1 
ATOM   5551 C CB  . GLN B 1 179 ? 28.089  -7.185  -50.335 1.00 24.75  ? 176 GLN B CB  1 
ATOM   5552 C CG  . GLN B 1 179 ? 28.273  -5.901  -49.557 1.00 25.75  ? 176 GLN B CG  1 
ATOM   5553 C CD  . GLN B 1 179 ? 27.717  -6.019  -48.156 1.00 30.97  ? 176 GLN B CD  1 
ATOM   5554 O OE1 . GLN B 1 179 ? 27.347  -7.110  -47.724 1.00 30.64  ? 176 GLN B OE1 1 
ATOM   5555 N NE2 . GLN B 1 179 ? 27.642  -4.902  -47.446 1.00 26.29  ? 176 GLN B NE2 1 
ATOM   5556 N N   . ARG B 1 180 ? 27.076  -8.899  -52.731 1.00 25.86  ? 177 ARG B N   1 
ATOM   5557 C CA  . ARG B 1 180 ? 26.861  -10.227 -53.304 1.00 28.72  ? 177 ARG B CA  1 
ATOM   5558 C C   . ARG B 1 180 ? 27.481  -10.331 -54.698 1.00 31.66  ? 177 ARG B C   1 
ATOM   5559 O O   . ARG B 1 180 ? 28.068  -11.357 -55.062 1.00 28.99  ? 177 ARG B O   1 
ATOM   5560 C CB  . ARG B 1 180 ? 25.366  -10.552 -53.365 1.00 30.59  ? 177 ARG B CB  1 
ATOM   5561 C CG  . ARG B 1 180 ? 25.032  -11.802 -54.159 1.00 37.61  ? 177 ARG B CG  1 
ATOM   5562 C CD  . ARG B 1 180 ? 23.539  -12.074 -54.160 1.00 36.79  ? 177 ARG B CD  1 
ATOM   5563 N NE  . ARG B 1 180 ? 23.090  -12.499 -52.838 1.00 38.85  ? 177 ARG B NE  1 
ATOM   5564 C CZ  . ARG B 1 180 ? 21.817  -12.551 -52.457 1.00 41.95  ? 177 ARG B CZ  1 
ATOM   5565 N NH1 . ARG B 1 180 ? 20.858  -12.198 -53.304 1.00 37.46  ? 177 ARG B NH1 1 
ATOM   5566 N NH2 . ARG B 1 180 ? 21.506  -12.955 -51.224 1.00 36.52  ? 177 ARG B NH2 1 
ATOM   5567 N N   . LEU B 1 181 ? 27.354  -9.261  -55.471 1.00 30.13  ? 178 LEU B N   1 
ATOM   5568 C CA  . LEU B 1 181 ? 27.898  -9.253  -56.824 1.00 32.47  ? 178 LEU B CA  1 
ATOM   5569 C C   . LEU B 1 181 ? 29.420  -9.353  -56.749 1.00 31.11  ? 178 LEU B C   1 
ATOM   5570 O O   . LEU B 1 181 ? 30.047  -10.039 -57.567 1.00 32.55  ? 178 LEU B O   1 
ATOM   5571 C CB  . LEU B 1 181 ? 27.459  -7.999  -57.588 1.00 26.79  ? 178 LEU B CB  1 
ATOM   5572 C CG  . LEU B 1 181 ? 27.962  -7.921  -59.037 1.00 33.33  ? 178 LEU B CG  1 
ATOM   5573 C CD1 . LEU B 1 181 ? 27.510  -9.140  -59.834 1.00 31.33  ? 178 LEU B CD1 1 
ATOM   5574 C CD2 . LEU B 1 181 ? 27.494  -6.635  -59.707 1.00 32.76  ? 178 LEU B CD2 1 
ATOM   5575 N N   . ALA B 1 182 ? 30.012  -8.696  -55.752 1.00 29.71  ? 179 ALA B N   1 
ATOM   5576 C CA  . ALA B 1 182 ? 31.457  -8.822  -55.560 1.00 30.32  ? 179 ALA B CA  1 
ATOM   5577 C C   . ALA B 1 182 ? 31.834  -10.249 -55.151 1.00 32.10  ? 179 ALA B C   1 
ATOM   5578 O O   . ALA B 1 182 ? 32.893  -10.764 -55.541 1.00 32.86  ? 179 ALA B O   1 
ATOM   5579 C CB  . ALA B 1 182 ? 31.953  -7.824  -54.530 1.00 29.20  ? 179 ALA B CB  1 
ATOM   5580 N N   . LEU B 1 183 ? 30.969  -10.885 -54.361 1.00 34.14  ? 180 LEU B N   1 
ATOM   5581 C CA  . LEU B 1 183 ? 31.189  -12.275 -53.979 1.00 30.73  ? 180 LEU B CA  1 
ATOM   5582 C C   . LEU B 1 183 ? 31.198  -13.175 -55.222 1.00 31.77  ? 180 LEU B C   1 
ATOM   5583 O O   . LEU B 1 183 ? 32.038  -14.095 -55.336 1.00 35.17  ? 180 LEU B O   1 
ATOM   5584 C CB  . LEU B 1 183 ? 30.117  -12.763 -52.998 1.00 27.50  ? 180 LEU B CB  1 
ATOM   5585 C CG  . LEU B 1 183 ? 30.029  -12.105 -51.616 1.00 33.72  ? 180 LEU B CG  1 
ATOM   5586 C CD1 . LEU B 1 183 ? 29.274  -13.014 -50.657 1.00 27.93  ? 180 LEU B CD1 1 
ATOM   5587 C CD2 . LEU B 1 183 ? 31.409  -11.773 -51.083 1.00 28.05  ? 180 LEU B CD2 1 
ATOM   5588 N N   . GLN B 1 184 ? 30.263  -12.922 -56.149 0.87 34.31  ? 181 GLN B N   1 
ATOM   5589 C CA  . GLN B 1 184 ? 30.097  -13.867 -57.268 0.87 35.15  ? 181 GLN B CA  1 
ATOM   5590 C C   . GLN B 1 184 ? 31.264  -13.596 -58.199 0.87 32.41  ? 181 GLN B C   1 
ATOM   5591 O O   . GLN B 1 184 ? 31.707  -14.496 -58.927 0.87 37.33  ? 181 GLN B O   1 
ATOM   5592 C CB  . GLN B 1 184 ? 28.802  -13.748 -58.087 0.87 40.98  ? 181 GLN B CB  1 
ATOM   5593 C CG  . GLN B 1 184 ? 27.834  -12.694 -57.777 0.87 41.46  ? 181 GLN B CG  1 
ATOM   5594 C CD  . GLN B 1 184 ? 26.400  -13.151 -57.918 0.87 45.79  ? 181 GLN B CD  1 
ATOM   5595 O OE1 . GLN B 1 184 ? 25.547  -12.669 -57.182 0.87 59.04  ? 181 GLN B OE1 1 
ATOM   5596 N NE2 . GLN B 1 184 ? 26.168  -14.264 -58.644 0.87 65.89  ? 181 GLN B NE2 1 
ATOM   5597 N N   . TRP B 1 185 ? 31.745  -12.346 -58.189 1.00 35.29  ? 182 TRP B N   1 
ATOM   5598 C CA  . TRP B 1 185 ? 32.927  -11.955 -58.971 1.00 35.39  ? 182 TRP B CA  1 
ATOM   5599 C C   . TRP B 1 185 ? 34.129  -12.736 -58.496 1.00 37.27  ? 182 TRP B C   1 
ATOM   5600 O O   . TRP B 1 185 ? 34.920  -13.215 -59.309 1.00 33.19  ? 182 TRP B O   1 
ATOM   5601 C CB  . TRP B 1 185 ? 33.232  -10.452 -58.856 1.00 34.11  ? 182 TRP B CB  1 
ATOM   5602 C CG  . TRP B 1 185 ? 34.426  -9.967  -59.720 1.00 33.01  ? 182 TRP B CG  1 
ATOM   5603 C CD1 . TRP B 1 185 ? 34.353  -9.379  -60.958 1.00 38.75  ? 182 TRP B CD1 1 
ATOM   5604 C CD2 . TRP B 1 185 ? 35.835  -10.020 -59.394 1.00 34.14  ? 182 TRP B CD2 1 
ATOM   5605 N NE1 . TRP B 1 185 ? 35.615  -9.074  -61.419 1.00 36.16  ? 182 TRP B NE1 1 
ATOM   5606 C CE2 . TRP B 1 185 ? 36.539  -9.455  -60.483 1.00 36.42  ? 182 TRP B CE2 1 
ATOM   5607 C CE3 . TRP B 1 185 ? 36.565  -10.490 -58.294 1.00 37.71  ? 182 TRP B CE3 1 
ATOM   5608 C CZ2 . TRP B 1 185 ? 37.934  -9.349  -60.501 1.00 35.53  ? 182 TRP B CZ2 1 
ATOM   5609 C CZ3 . TRP B 1 185 ? 37.957  -10.383 -58.317 1.00 35.69  ? 182 TRP B CZ3 1 
ATOM   5610 C CH2 . TRP B 1 185 ? 38.622  -9.816  -59.415 1.00 38.74  ? 182 TRP B CH2 1 
ATOM   5611 N N   . VAL B 1 186 ? 34.279  -12.832 -57.176 1.00 33.10  ? 183 VAL B N   1 
ATOM   5612 C CA  . VAL B 1 186 ? 35.368  -13.619 -56.599 1.00 31.17  ? 183 VAL B CA  1 
ATOM   5613 C C   . VAL B 1 186 ? 35.250  -15.080 -57.008 1.00 31.16  ? 183 VAL B C   1 
ATOM   5614 O O   . VAL B 1 186 ? 36.239  -15.702 -57.406 1.00 33.79  ? 183 VAL B O   1 
ATOM   5615 C CB  . VAL B 1 186 ? 35.400  -13.514 -55.056 1.00 31.12  ? 183 VAL B CB  1 
ATOM   5616 C CG1 . VAL B 1 186 ? 36.259  -14.626 -54.456 1.00 30.78  ? 183 VAL B CG1 1 
ATOM   5617 C CG2 . VAL B 1 186 ? 35.924  -12.159 -54.639 1.00 29.65  ? 183 VAL B CG2 1 
ATOM   5618 N N   . GLN B 1 187 ? 34.039  -15.625 -56.928 1.00 32.56  ? 184 GLN B N   1 
ATOM   5619 C CA  . GLN B 1 187 ? 33.811  -16.990 -57.400 1.00 33.20  ? 184 GLN B CA  1 
ATOM   5620 C C   . GLN B 1 187 ? 34.258  -17.186 -58.853 1.00 38.96  ? 184 GLN B C   1 
ATOM   5621 O O   . GLN B 1 187 ? 34.853  -18.213 -59.195 1.00 37.48  ? 184 GLN B O   1 
ATOM   5622 C CB  . GLN B 1 187 ? 32.335  -17.363 -57.269 1.00 36.13  ? 184 GLN B CB  1 
ATOM   5623 C CG  . GLN B 1 187 ? 31.921  -17.728 -55.861 1.00 42.87  ? 184 GLN B CG  1 
ATOM   5624 C CD  . GLN B 1 187 ? 32.722  -18.893 -55.318 1.00 41.92  ? 184 GLN B CD  1 
ATOM   5625 O OE1 . GLN B 1 187 ? 32.592  -20.024 -55.789 1.00 44.03  ? 184 GLN B OE1 1 
ATOM   5626 N NE2 . GLN B 1 187 ? 33.568  -18.620 -54.332 1.00 41.08  ? 184 GLN B NE2 1 
ATOM   5627 N N   . GLU B 1 188 ? 33.982  -16.201 -59.702 1.00 35.57  ? 185 GLU B N   1 
ATOM   5628 C CA  . GLU B 1 188 ? 34.274  -16.351 -61.131 1.00 42.31  ? 185 GLU B CA  1 
ATOM   5629 C C   . GLU B 1 188 ? 35.737  -16.084 -61.491 1.00 39.33  ? 185 GLU B C   1 
ATOM   5630 O O   . GLU B 1 188 ? 36.253  -16.647 -62.458 1.00 43.10  ? 185 GLU B O   1 
ATOM   5631 C CB  . GLU B 1 188 ? 33.378  -15.423 -61.959 1.00 41.56  ? 185 GLU B CB  1 
ATOM   5632 C CG  . GLU B 1 188 ? 31.899  -15.755 -61.891 1.00 48.98  ? 185 GLU B CG  1 
ATOM   5633 C CD  . GLU B 1 188 ? 31.045  -14.787 -62.691 1.00 59.24  ? 185 GLU B CD  1 
ATOM   5634 O OE1 . GLU B 1 188 ? 31.617  -13.950 -63.423 1.00 62.03  ? 185 GLU B OE1 1 
ATOM   5635 O OE2 . GLU B 1 188 ? 29.801  -14.862 -62.584 1.00 56.58  ? 185 GLU B OE2 1 
ATOM   5636 N N   . ASN B 1 189 ? 36.407  -15.244 -60.710 1.00 36.37  ? 186 ASN B N   1 
ATOM   5637 C CA  . ASN B 1 189 ? 37.689  -14.694 -61.137 1.00 34.74  ? 186 ASN B CA  1 
ATOM   5638 C C   . ASN B 1 189 ? 38.893  -14.883 -60.220 1.00 38.11  ? 186 ASN B C   1 
ATOM   5639 O O   . ASN B 1 189 ? 40.023  -14.681 -60.659 1.00 35.21  ? 186 ASN B O   1 
ATOM   5640 C CB  . ASN B 1 189 ? 37.527  -13.193 -61.389 1.00 36.03  ? 186 ASN B CB  1 
ATOM   5641 C CG  . ASN B 1 189 ? 36.546  -12.894 -62.502 1.00 40.53  ? 186 ASN B CG  1 
ATOM   5642 O OD1 . ASN B 1 189 ? 36.817  -13.167 -63.673 1.00 37.30  ? 186 ASN B OD1 1 
ATOM   5643 N ND2 . ASN B 1 189 ? 35.396  -12.335 -62.143 1.00 36.60  ? 186 ASN B ND2 1 
ATOM   5644 N N   . ILE B 1 190 ? 38.677  -15.248 -58.957 1.00 36.97  ? 187 ILE B N   1 
ATOM   5645 C CA  . ILE B 1 190 ? 39.776  -15.183 -57.992 1.00 36.26  ? 187 ILE B CA  1 
ATOM   5646 C C   . ILE B 1 190 ? 40.883  -16.207 -58.269 1.00 33.02  ? 187 ILE B C   1 
ATOM   5647 O O   . ILE B 1 190 ? 42.036  -15.991 -57.894 1.00 36.28  ? 187 ILE B O   1 
ATOM   5648 C CB  . ILE B 1 190 ? 39.269  -15.357 -56.533 1.00 33.03  ? 187 ILE B CB  1 
ATOM   5649 C CG1 . ILE B 1 190 ? 40.256  -14.725 -55.552 1.00 33.85  ? 187 ILE B CG1 1 
ATOM   5650 C CG2 . ILE B 1 190 ? 39.014  -16.828 -56.208 1.00 34.56  ? 187 ILE B CG2 1 
ATOM   5651 C CD1 . ILE B 1 190 ? 40.428  -13.229 -55.738 1.00 34.78  ? 187 ILE B CD1 1 
ATOM   5652 N N   . ALA B 1 191 ? 40.546  -17.305 -58.938 1.00 34.87  ? 188 ALA B N   1 
ATOM   5653 C CA  . ALA B 1 191 ? 41.540  -18.325 -59.269 1.00 39.46  ? 188 ALA B CA  1 
ATOM   5654 C C   . ALA B 1 191 ? 42.682  -17.763 -60.127 1.00 40.92  ? 188 ALA B C   1 
ATOM   5655 O O   . ALA B 1 191 ? 43.810  -18.248 -60.063 1.00 42.02  ? 188 ALA B O   1 
ATOM   5656 C CB  . ALA B 1 191 ? 40.880  -19.492 -59.974 1.00 39.00  ? 188 ALA B CB  1 
ATOM   5657 N N   . ALA B 1 192 ? 42.390  -16.731 -60.913 1.00 37.39  ? 189 ALA B N   1 
ATOM   5658 C CA  . ALA B 1 192 ? 43.401  -16.104 -61.760 1.00 38.69  ? 189 ALA B CA  1 
ATOM   5659 C C   . ALA B 1 192 ? 44.455  -15.374 -60.931 1.00 41.47  ? 189 ALA B C   1 
ATOM   5660 O O   . ALA B 1 192 ? 45.543  -15.066 -61.420 1.00 39.19  ? 189 ALA B O   1 
ATOM   5661 C CB  . ALA B 1 192 ? 42.746  -15.147 -62.743 1.00 38.55  ? 189 ALA B CB  1 
ATOM   5662 N N   . PHE B 1 193 ? 44.122  -15.093 -59.675 1.00 39.21  ? 190 PHE B N   1 
ATOM   5663 C CA  . PHE B 1 193 ? 45.038  -14.424 -58.762 1.00 40.91  ? 190 PHE B CA  1 
ATOM   5664 C C   . PHE B 1 193 ? 45.691  -15.432 -57.815 1.00 45.71  ? 190 PHE B C   1 
ATOM   5665 O O   . PHE B 1 193 ? 46.513  -15.069 -56.971 1.00 46.84  ? 190 PHE B O   1 
ATOM   5666 C CB  . PHE B 1 193 ? 44.307  -13.347 -57.949 1.00 41.88  ? 190 PHE B CB  1 
ATOM   5667 C CG  . PHE B 1 193 ? 43.641  -12.287 -58.787 1.00 37.94  ? 190 PHE B CG  1 
ATOM   5668 C CD1 . PHE B 1 193 ? 42.397  -12.510 -59.355 1.00 36.05  ? 190 PHE B CD1 1 
ATOM   5669 C CD2 . PHE B 1 193 ? 44.246  -11.056 -58.978 1.00 40.26  ? 190 PHE B CD2 1 
ATOM   5670 C CE1 . PHE B 1 193 ? 41.777  -11.532 -60.119 1.00 37.25  ? 190 PHE B CE1 1 
ATOM   5671 C CE2 . PHE B 1 193 ? 43.633  -10.072 -59.739 1.00 41.58  ? 190 PHE B CE2 1 
ATOM   5672 C CZ  . PHE B 1 193 ? 42.397  -10.313 -60.311 1.00 35.26  ? 190 PHE B CZ  1 
ATOM   5673 N N   . GLY B 1 194 ? 45.311  -16.698 -57.950 1.00 44.49  ? 191 GLY B N   1 
ATOM   5674 C CA  . GLY B 1 194 ? 45.851  -17.750 -57.108 1.00 43.59  ? 191 GLY B CA  1 
ATOM   5675 C C   . GLY B 1 194 ? 44.958  -18.070 -55.923 1.00 47.22  ? 191 GLY B C   1 
ATOM   5676 O O   . GLY B 1 194 ? 45.342  -18.826 -55.028 1.00 49.02  ? 191 GLY B O   1 
ATOM   5677 N N   . GLY B 1 195 ? 43.761  -17.493 -55.915 1.00 43.09  ? 192 GLY B N   1 
ATOM   5678 C CA  . GLY B 1 195 ? 42.817  -17.711 -54.833 1.00 40.88  ? 192 GLY B CA  1 
ATOM   5679 C C   . GLY B 1 195 ? 41.976  -18.952 -55.049 1.00 41.71  ? 192 GLY B C   1 
ATOM   5680 O O   . GLY B 1 195 ? 41.715  -19.352 -56.186 1.00 38.83  ? 192 GLY B O   1 
ATOM   5681 N N   . ASP B 1 196 ? 41.552  -19.563 -53.949 1.00 37.99  ? 193 ASP B N   1 
ATOM   5682 C CA  . ASP B 1 196 ? 40.719  -20.760 -53.991 1.00 42.06  ? 193 ASP B CA  1 
ATOM   5683 C C   . ASP B 1 196 ? 39.253  -20.384 -53.815 1.00 41.01  ? 193 ASP B C   1 
ATOM   5684 O O   . ASP B 1 196 ? 38.831  -20.046 -52.707 1.00 41.92  ? 193 ASP B O   1 
ATOM   5685 C CB  . ASP B 1 196 ? 41.152  -21.750 -52.898 1.00 43.67  ? 193 ASP B CB  1 
ATOM   5686 C CG  . ASP B 1 196 ? 40.427  -23.089 -52.981 1.00 45.01  ? 193 ASP B CG  1 
ATOM   5687 O OD1 . ASP B 1 196 ? 39.420  -23.210 -53.714 1.00 46.35  ? 193 ASP B OD1 1 
ATOM   5688 O OD2 . ASP B 1 196 ? 40.870  -24.034 -52.296 1.00 51.96  ? 193 ASP B OD2 1 
ATOM   5689 N N   . PRO B 1 197 ? 38.468  -20.463 -54.901 1.00 40.04  ? 194 PRO B N   1 
ATOM   5690 C CA  . PRO B 1 197 ? 37.040  -20.134 -54.847 1.00 38.97  ? 194 PRO B CA  1 
ATOM   5691 C C   . PRO B 1 197 ? 36.244  -21.113 -53.984 1.00 38.31  ? 194 PRO B C   1 
ATOM   5692 O O   . PRO B 1 197 ? 35.097  -20.825 -53.642 1.00 37.85  ? 194 PRO B O   1 
ATOM   5693 C CB  . PRO B 1 197 ? 36.604  -20.226 -56.313 1.00 36.38  ? 194 PRO B CB  1 
ATOM   5694 C CG  . PRO B 1 197 ? 37.563  -21.174 -56.923 1.00 36.64  ? 194 PRO B CG  1 
ATOM   5695 C CD  . PRO B 1 197 ? 38.871  -20.934 -56.239 1.00 37.17  ? 194 PRO B CD  1 
ATOM   5696 N N   . MET B 1 198 ? 36.839  -22.255 -53.649 1.00 39.80  ? 195 MET B N   1 
ATOM   5697 C CA  . MET B 1 198 ? 36.177  -23.226 -52.778 1.00 42.25  ? 195 MET B CA  1 
ATOM   5698 C C   . MET B 1 198 ? 36.572  -23.050 -51.314 1.00 40.25  ? 195 MET B C   1 
ATOM   5699 O O   . MET B 1 198 ? 36.131  -23.808 -50.447 1.00 40.26  ? 195 MET B O   1 
ATOM   5700 C CB  . MET B 1 198 ? 36.480  -24.651 -53.235 1.00 38.83  ? 195 MET B CB  1 
ATOM   5701 C CG  . MET B 1 198 ? 35.744  -25.033 -54.517 1.00 46.31  ? 195 MET B CG  1 
ATOM   5702 S SD  . MET B 1 198 ? 35.945  -26.773 -54.927 1.00 66.39  ? 195 MET B SD  1 
ATOM   5703 C CE  . MET B 1 198 ? 37.732  -26.891 -54.986 1.00 53.53  ? 195 MET B CE  1 
ATOM   5704 N N   . SER B 1 199 ? 37.402  -22.051 -51.039 1.00 38.01  ? 196 SER B N   1 
ATOM   5705 C CA  . SER B 1 199 ? 37.698  -21.686 -49.659 1.00 40.19  ? 196 SER B CA  1 
ATOM   5706 C C   . SER B 1 199 ? 37.602  -20.177 -49.492 1.00 34.91  ? 196 SER B C   1 
ATOM   5707 O O   . SER B 1 199 ? 38.609  -19.472 -49.539 1.00 35.30  ? 196 SER B O   1 
ATOM   5708 C CB  . SER B 1 199 ? 39.080  -22.182 -49.231 1.00 39.51  ? 196 SER B CB  1 
ATOM   5709 O OG  . SER B 1 199 ? 39.280  -21.951 -47.841 1.00 39.70  ? 196 SER B OG  1 
ATOM   5710 N N   . VAL B 1 200 ? 36.379  -19.693 -49.307 1.00 32.39  ? 197 VAL B N   1 
ATOM   5711 C CA  . VAL B 1 200 ? 36.132  -18.268 -49.158 1.00 32.31  ? 197 VAL B CA  1 
ATOM   5712 C C   . VAL B 1 200 ? 35.541  -17.951 -47.785 1.00 32.29  ? 197 VAL B C   1 
ATOM   5713 O O   . VAL B 1 200 ? 34.532  -18.527 -47.378 1.00 31.07  ? 197 VAL B O   1 
ATOM   5714 C CB  . VAL B 1 200 ? 35.182  -17.742 -50.261 1.00 33.80  ? 197 VAL B CB  1 
ATOM   5715 C CG1 . VAL B 1 200 ? 34.852  -16.287 -50.025 1.00 28.91  ? 197 VAL B CG1 1 
ATOM   5716 C CG2 . VAL B 1 200 ? 35.810  -17.929 -51.641 1.00 34.23  ? 197 VAL B CG2 1 
ATOM   5717 N N   . THR B 1 201 ? 36.182  -17.022 -47.087 1.00 30.42  ? 198 THR B N   1 
ATOM   5718 C CA  . THR B 1 201 ? 35.753  -16.601 -45.762 1.00 31.67  ? 198 THR B CA  1 
ATOM   5719 C C   . THR B 1 201 ? 35.388  -15.127 -45.759 1.00 31.37  ? 198 THR B C   1 
ATOM   5720 O O   . THR B 1 201 ? 36.219  -14.284 -46.069 1.00 32.52  ? 198 THR B O   1 
ATOM   5721 C CB  . THR B 1 201 ? 36.858  -16.851 -44.722 1.00 30.77  ? 198 THR B CB  1 
ATOM   5722 O OG1 . THR B 1 201 ? 37.158  -18.249 -44.681 1.00 32.62  ? 198 THR B OG1 1 
ATOM   5723 C CG2 . THR B 1 201 ? 36.441  -16.351 -43.330 1.00 32.50  ? 198 THR B CG2 1 
ATOM   5724 N N   . LEU B 1 202 ? 34.145  -14.819 -45.410 1.00 30.10  ? 199 LEU B N   1 
ATOM   5725 C CA  . LEU B 1 202 ? 33.737  -13.432 -45.221 1.00 28.61  ? 199 LEU B CA  1 
ATOM   5726 C C   . LEU B 1 202 ? 34.119  -12.952 -43.830 1.00 34.46  ? 199 LEU B C   1 
ATOM   5727 O O   . LEU B 1 202 ? 33.966  -13.686 -42.854 1.00 29.93  ? 199 LEU B O   1 
ATOM   5728 C CB  . LEU B 1 202 ? 32.229  -13.274 -45.411 1.00 28.54  ? 199 LEU B CB  1 
ATOM   5729 C CG  . LEU B 1 202 ? 31.589  -13.936 -46.629 1.00 32.48  ? 199 LEU B CG  1 
ATOM   5730 C CD1 . LEU B 1 202 ? 30.104  -13.599 -46.677 1.00 29.02  ? 199 LEU B CD1 1 
ATOM   5731 C CD2 . LEU B 1 202 ? 32.299  -13.516 -47.921 1.00 30.88  ? 199 LEU B CD2 1 
ATOM   5732 N N   . PHE B 1 203 ? 34.602  -11.720 -43.724 1.00 30.96  ? 200 PHE B N   1 
ATOM   5733 C CA  . PHE B 1 203 ? 34.763  -11.122 -42.395 1.00 33.56  ? 200 PHE B CA  1 
ATOM   5734 C C   . PHE B 1 203 ? 34.531  -9.627  -42.500 1.00 36.18  ? 200 PHE B C   1 
ATOM   5735 O O   . PHE B 1 203 ? 34.785  -9.002  -43.538 1.00 34.49  ? 200 PHE B O   1 
ATOM   5736 C CB  . PHE B 1 203 ? 36.135  -11.478 -41.776 1.00 33.08  ? 200 PHE B CB  1 
ATOM   5737 C CG  . PHE B 1 203 ? 37.326  -10.937 -42.515 1.00 38.69  ? 200 PHE B CG  1 
ATOM   5738 C CD1 . PHE B 1 203 ? 38.176  -10.002 -41.932 1.00 38.26  ? 200 PHE B CD1 1 
ATOM   5739 C CD2 . PHE B 1 203 ? 37.554  -11.311 -43.826 1.00 35.66  ? 200 PHE B CD2 1 
ATOM   5740 C CE1 . PHE B 1 203 ? 39.272  -9.514  -42.642 1.00 45.26  ? 200 PHE B CE1 1 
ATOM   5741 C CE2 . PHE B 1 203 ? 38.613  -10.819 -44.525 1.00 35.49  ? 200 PHE B CE2 1 
ATOM   5742 C CZ  . PHE B 1 203 ? 39.474  -9.920  -43.947 1.00 31.41  ? 200 PHE B CZ  1 
ATOM   5743 N N   . GLY B 1 204 ? 33.953  -9.079  -41.444 1.00 27.00  ? 201 GLY B N   1 
ATOM   5744 C CA  . GLY B 1 204 ? 33.589  -7.680  -41.409 1.00 28.84  ? 201 GLY B CA  1 
ATOM   5745 C C   . GLY B 1 204 ? 33.395  -7.232  -39.980 1.00 35.20  ? 201 GLY B C   1 
ATOM   5746 O O   . GLY B 1 204 ? 33.291  -8.059  -39.071 1.00 30.95  ? 201 GLY B O   1 
ATOM   5747 N N   . GLU B 1 205 ? 33.347  -5.922  -39.782 1.00 34.26  ? 202 GLU B N   1 
ATOM   5748 C CA  . GLU B 1 205 ? 33.195  -5.368  -38.448 1.00 31.84  ? 202 GLU B CA  1 
ATOM   5749 C C   . GLU B 1 205 ? 31.993  -4.429  -38.411 1.00 36.33  ? 202 GLU B C   1 
ATOM   5750 O O   . GLU B 1 205 ? 31.745  -3.697  -39.369 1.00 32.11  ? 202 GLU B O   1 
ATOM   5751 C CB  . GLU B 1 205 ? 34.475  -4.645  -38.024 1.00 33.66  ? 202 GLU B CB  1 
ATOM   5752 C CG  . GLU B 1 205 ? 34.476  -4.145  -36.585 1.00 33.60  ? 202 GLU B CG  1 
ATOM   5753 C CD  . GLU B 1 205 ? 33.961  -2.725  -36.459 1.00 37.85  ? 202 GLU B CD  1 
ATOM   5754 O OE1 . GLU B 1 205 ? 33.735  -2.073  -37.507 1.00 35.60  ? 202 GLU B OE1 1 
ATOM   5755 O OE2 . GLU B 1 205 ? 33.783  -2.259  -35.313 1.00 36.41  ? 202 GLU B OE2 1 
ATOM   5756 N N   . SER B 1 206 ? 31.245  -4.472  -37.308 1.00 33.35  ? 203 SER B N   1 
ATOM   5757 C CA  . SER B 1 206 ? 30.038  -3.661  -37.135 1.00 32.18  ? 203 SER B CA  1 
ATOM   5758 C C   . SER B 1 206 ? 29.037  -3.864  -38.285 1.00 30.28  ? 203 SER B C   1 
ATOM   5759 O O   . SER B 1 206 ? 28.588  -4.984  -38.522 1.00 32.83  ? 203 SER B O   1 
ATOM   5760 C CB  . SER B 1 206 ? 30.415  -2.192  -37.001 1.00 36.39  ? 203 SER B CB  1 
ATOM   5761 O OG  . SER B 1 206 ? 29.438  -1.481  -36.264 1.00 37.07  ? 203 SER B OG  1 
ATOM   5762 N N   . ALA B 1 207 ? 28.695  -2.796  -39.007 1.00 32.64  ? 204 ALA B N   1 
ATOM   5763 C CA  . ALA B 1 207 ? 27.754  -2.917  -40.130 1.00 30.32  ? 204 ALA B CA  1 
ATOM   5764 C C   . ALA B 1 207 ? 28.229  -3.962  -41.140 1.00 28.58  ? 204 ALA B C   1 
ATOM   5765 O O   . ALA B 1 207 ? 27.422  -4.655  -41.763 1.00 30.16  ? 204 ALA B O   1 
ATOM   5766 C CB  . ALA B 1 207 ? 27.552  -1.565  -40.819 1.00 34.47  ? 204 ALA B CB  1 
ATOM   5767 N N   . GLY B 1 208 ? 29.545  -4.081  -41.287 1.00 28.87  ? 205 GLY B N   1 
ATOM   5768 C CA  . GLY B 1 208 ? 30.126  -5.130  -42.104 1.00 27.67  ? 205 GLY B CA  1 
ATOM   5769 C C   . GLY B 1 208 ? 29.826  -6.513  -41.556 1.00 27.79  ? 205 GLY B C   1 
ATOM   5770 O O   . GLY B 1 208 ? 29.542  -7.446  -42.314 1.00 26.68  ? 205 GLY B O   1 
ATOM   5771 N N   . ALA B 1 209 ? 29.893  -6.653  -40.232 1.00 28.23  ? 206 ALA B N   1 
ATOM   5772 C CA  . ALA B 1 209 ? 29.579  -7.921  -39.591 1.00 27.57  ? 206 ALA B CA  1 
ATOM   5773 C C   . ALA B 1 209 ? 28.107  -8.243  -39.796 1.00 26.30  ? 206 ALA B C   1 
ATOM   5774 O O   . ALA B 1 209 ? 27.750  -9.378  -40.109 1.00 30.26  ? 206 ALA B O   1 
ATOM   5775 C CB  . ALA B 1 209 ? 29.923  -7.879  -38.078 1.00 26.48  ? 206 ALA B CB  1 
ATOM   5776 N N   . ALA B 1 210 ? 27.252  -7.242  -39.611 1.00 25.29  ? 207 ALA B N   1 
ATOM   5777 C CA  . ALA B 1 210 ? 25.822  -7.418  -39.839 1.00 27.87  ? 207 ALA B CA  1 
ATOM   5778 C C   . ALA B 1 210 ? 25.565  -7.876  -41.280 1.00 30.98  ? 207 ALA B C   1 
ATOM   5779 O O   . ALA B 1 210 ? 24.711  -8.738  -41.530 1.00 28.43  ? 207 ALA B O   1 
ATOM   5780 C CB  . ALA B 1 210 ? 25.076  -6.131  -39.546 1.00 28.82  ? 207 ALA B CB  1 
ATOM   5781 N N   . SER B 1 211 ? 26.323  -7.304  -42.216 1.00 27.64  ? 208 SER B N   1 
ATOM   5782 C CA  . SER B 1 211 ? 26.239  -7.685  -43.631 1.00 28.41  ? 208 SER B CA  1 
ATOM   5783 C C   . SER B 1 211 ? 26.591  -9.150  -43.835 1.00 28.76  ? 208 SER B C   1 
ATOM   5784 O O   . SER B 1 211 ? 25.864  -9.891  -44.510 1.00 29.18  ? 208 SER B O   1 
ATOM   5785 C CB  . SER B 1 211 ? 27.170  -6.815  -44.488 1.00 25.68  ? 208 SER B CB  1 
ATOM   5786 O OG  . SER B 1 211 ? 26.772  -5.460  -44.469 1.00 26.61  ? 208 SER B OG  1 
ATOM   5787 N N   . VAL B 1 212 ? 27.724  -9.555  -43.265 1.00 29.38  ? 209 VAL B N   1 
ATOM   5788 C CA  . VAL B 1 212 ? 28.137  -10.957 -43.282 1.00 32.60  ? 209 VAL B CA  1 
ATOM   5789 C C   . VAL B 1 212 ? 27.011  -11.863 -42.760 1.00 31.64  ? 209 VAL B C   1 
ATOM   5790 O O   . VAL B 1 212 ? 26.679  -12.900 -43.362 1.00 31.81  ? 209 VAL B O   1 
ATOM   5791 C CB  . VAL B 1 212 ? 29.411  -11.176 -42.433 1.00 34.33  ? 209 VAL B CB  1 
ATOM   5792 C CG1 . VAL B 1 212 ? 29.735  -12.652 -42.333 1.00 34.06  ? 209 VAL B CG1 1 
ATOM   5793 C CG2 . VAL B 1 212 ? 30.580  -10.410 -43.021 1.00 31.89  ? 209 VAL B CG2 1 
ATOM   5794 N N   . GLY B 1 213 ? 26.415  -11.452 -41.646 1.00 33.05  ? 210 GLY B N   1 
ATOM   5795 C CA  . GLY B 1 213 ? 25.297  -12.179 -41.073 1.00 32.27  ? 210 GLY B CA  1 
ATOM   5796 C C   . GLY B 1 213 ? 24.151  -12.316 -42.063 1.00 33.37  ? 210 GLY B C   1 
ATOM   5797 O O   . GLY B 1 213 ? 23.538  -13.375 -42.189 1.00 33.80  ? 210 GLY B O   1 
ATOM   5798 N N   . MET B 1 214 ? 23.858  -11.246 -42.787 1.00 31.68  ? 211 MET B N   1 
ATOM   5799 C CA  . MET B 1 214 ? 22.742  -11.301 -43.717 1.00 34.01  ? 211 MET B CA  1 
ATOM   5800 C C   . MET B 1 214 ? 23.050  -12.159 -44.940 1.00 31.92  ? 211 MET B C   1 
ATOM   5801 O O   . MET B 1 214 ? 22.142  -12.759 -45.506 1.00 32.05  ? 211 MET B O   1 
ATOM   5802 C CB  . MET B 1 214 ? 22.325  -9.890  -44.113 1.00 35.39  ? 211 MET B CB  1 
ATOM   5803 C CG  . MET B 1 214 ? 21.600  -9.209  -42.956 1.00 30.36  ? 211 MET B CG  1 
ATOM   5804 S SD  . MET B 1 214 ? 21.480  -7.449  -43.199 1.00 48.54  ? 211 MET B SD  1 
ATOM   5805 C CE  . MET B 1 214 ? 21.466  -6.905  -41.495 1.00 35.26  ? 211 MET B CE  1 
ATOM   5806 N N   . HIS B 1 215 ? 24.319  -12.254 -45.329 1.00 30.84  ? 212 HIS B N   1 
ATOM   5807 C CA  . HIS B 1 215 ? 24.684  -13.221 -46.362 1.00 31.84  ? 212 HIS B CA  1 
ATOM   5808 C C   . HIS B 1 215 ? 24.504  -14.643 -45.852 1.00 33.16  ? 212 HIS B C   1 
ATOM   5809 O O   . HIS B 1 215 ? 24.082  -15.524 -46.600 1.00 32.94  ? 212 HIS B O   1 
ATOM   5810 C CB  . HIS B 1 215 ? 26.117  -13.000 -46.846 1.00 31.52  ? 212 HIS B CB  1 
ATOM   5811 C CG  . HIS B 1 215 ? 26.290  -11.724 -47.600 1.00 30.72  ? 212 HIS B CG  1 
ATOM   5812 N ND1 . HIS B 1 215 ? 25.754  -11.524 -48.856 1.00 29.27  ? 212 HIS B ND1 1 
ATOM   5813 C CD2 . HIS B 1 215 ? 26.905  -10.563 -47.267 1.00 27.70  ? 212 HIS B CD2 1 
ATOM   5814 C CE1 . HIS B 1 215 ? 26.042  -10.306 -49.266 1.00 28.91  ? 212 HIS B CE1 1 
ATOM   5815 N NE2 . HIS B 1 215 ? 26.735  -9.696  -48.321 1.00 28.98  ? 212 HIS B NE2 1 
ATOM   5816 N N   . ILE B 1 216 ? 24.822  -14.868 -44.580 1.00 33.04  ? 213 ILE B N   1 
ATOM   5817 C CA  . ILE B 1 216 ? 24.547  -16.164 -43.969 1.00 31.69  ? 213 ILE B CA  1 
ATOM   5818 C C   . ILE B 1 216 ? 23.055  -16.496 -44.049 1.00 31.11  ? 213 ILE B C   1 
ATOM   5819 O O   . ILE B 1 216 ? 22.672  -17.646 -44.269 1.00 33.09  ? 213 ILE B O   1 
ATOM   5820 C CB  . ILE B 1 216 ? 25.006  -16.197 -42.491 1.00 32.40  ? 213 ILE B CB  1 
ATOM   5821 C CG1 . ILE B 1 216 ? 26.534  -16.189 -42.404 1.00 27.61  ? 213 ILE B CG1 1 
ATOM   5822 C CG2 . ILE B 1 216 ? 24.421  -17.408 -41.761 1.00 34.08  ? 213 ILE B CG2 1 
ATOM   5823 C CD1 . ILE B 1 216 ? 27.060  -16.073 -40.978 1.00 34.21  ? 213 ILE B CD1 1 
ATOM   5824 N N   . LEU B 1 217 ? 22.215  -15.478 -43.898 1.00 28.87  ? 214 LEU B N   1 
ATOM   5825 C CA  . LEU B 1 217 ? 20.774  -15.693 -43.817 1.00 32.80  ? 214 LEU B CA  1 
ATOM   5826 C C   . LEU B 1 217 ? 20.049  -15.549 -45.152 1.00 33.49  ? 214 LEU B C   1 
ATOM   5827 O O   . LEU B 1 217 ? 18.825  -15.676 -45.207 1.00 34.21  ? 214 LEU B O   1 
ATOM   5828 C CB  . LEU B 1 217 ? 20.156  -14.725 -42.810 1.00 31.59  ? 214 LEU B CB  1 
ATOM   5829 C CG  . LEU B 1 217 ? 20.681  -14.816 -41.375 1.00 32.61  ? 214 LEU B CG  1 
ATOM   5830 C CD1 . LEU B 1 217 ? 20.004  -13.766 -40.523 1.00 32.41  ? 214 LEU B CD1 1 
ATOM   5831 C CD2 . LEU B 1 217 ? 20.469  -16.211 -40.809 1.00 32.24  ? 214 LEU B CD2 1 
ATOM   5832 N N   . SER B 1 218 ? 20.794  -15.277 -46.219 1.00 36.62  ? 215 SER B N   1 
ATOM   5833 C CA  . SER B 1 218 ? 20.197  -15.144 -47.548 1.00 35.33  ? 215 SER B CA  1 
ATOM   5834 C C   . SER B 1 218 ? 20.704  -16.248 -48.470 1.00 37.22  ? 215 SER B C   1 
ATOM   5835 O O   . SER B 1 218 ? 21.884  -16.283 -48.818 1.00 36.61  ? 215 SER B O   1 
ATOM   5836 C CB  . SER B 1 218 ? 20.502  -13.772 -48.146 1.00 35.56  ? 215 SER B CB  1 
ATOM   5837 O OG  . SER B 1 218 ? 19.680  -13.514 -49.272 1.00 35.45  ? 215 SER B OG  1 
ATOM   5838 N N   . LEU B 1 219 ? 19.799  -17.139 -48.861 1.00 34.67  ? 216 LEU B N   1 
ATOM   5839 C CA  . LEU B 1 219 ? 20.159  -18.352 -49.590 1.00 40.00  ? 216 LEU B CA  1 
ATOM   5840 C C   . LEU B 1 219 ? 21.035  -18.138 -50.842 1.00 38.51  ? 216 LEU B C   1 
ATOM   5841 O O   . LEU B 1 219 ? 21.997  -18.875 -51.035 1.00 39.49  ? 216 LEU B O   1 
ATOM   5842 C CB  . LEU B 1 219 ? 18.891  -19.115 -49.981 1.00 44.98  ? 216 LEU B CB  1 
ATOM   5843 C CG  . LEU B 1 219 ? 19.064  -20.630 -50.092 1.00 49.93  ? 216 LEU B CG  1 
ATOM   5844 C CD1 . LEU B 1 219 ? 18.809  -21.283 -48.740 1.00 49.59  ? 216 LEU B CD1 1 
ATOM   5845 C CD2 . LEU B 1 219 ? 18.159  -21.218 -51.173 1.00 53.27  ? 216 LEU B CD2 1 
ATOM   5846 N N   . PRO B 1 220 ? 20.723  -17.135 -51.687 1.00 37.17  ? 217 PRO B N   1 
ATOM   5847 C CA  . PRO B 1 220 ? 21.597  -16.994 -52.864 1.00 37.29  ? 217 PRO B CA  1 
ATOM   5848 C C   . PRO B 1 220 ? 23.049  -16.635 -52.511 1.00 39.96  ? 217 PRO B C   1 
ATOM   5849 O O   . PRO B 1 220 ? 23.955  -16.950 -53.279 1.00 36.20  ? 217 PRO B O   1 
ATOM   5850 C CB  . PRO B 1 220 ? 20.933  -15.862 -53.663 1.00 38.25  ? 217 PRO B CB  1 
ATOM   5851 C CG  . PRO B 1 220 ? 19.503  -15.875 -53.224 1.00 37.75  ? 217 PRO B CG  1 
ATOM   5852 C CD  . PRO B 1 220 ? 19.566  -16.223 -51.758 1.00 36.16  ? 217 PRO B CD  1 
ATOM   5853 N N   . SER B 1 221 ? 23.275  -16.005 -51.360 1.00 36.09  ? 218 SER B N   1 
ATOM   5854 C CA  . SER B 1 221 ? 24.639  -15.670 -50.961 1.00 34.56  ? 218 SER B CA  1 
ATOM   5855 C C   . SER B 1 221 ? 25.415  -16.908 -50.516 1.00 33.32  ? 218 SER B C   1 
ATOM   5856 O O   . SER B 1 221 ? 26.645  -16.924 -50.556 1.00 33.14  ? 218 SER B O   1 
ATOM   5857 C CB  . SER B 1 221 ? 24.640  -14.628 -49.838 1.00 33.87  ? 218 SER B CB  1 
ATOM   5858 O OG  . SER B 1 221 ? 24.290  -13.340 -50.322 1.00 32.92  ? 218 SER B OG  1 
ATOM   5859 N N   . ARG B 1 222 ? 24.698  -17.951 -50.108 1.00 35.81  ? 219 ARG B N   1 
ATOM   5860 C CA  . ARG B 1 222 ? 25.326  -19.062 -49.391 1.00 39.72  ? 219 ARG B CA  1 
ATOM   5861 C C   . ARG B 1 222 ? 26.231  -19.928 -50.259 1.00 38.93  ? 219 ARG B C   1 
ATOM   5862 O O   . ARG B 1 222 ? 27.124  -20.595 -49.745 1.00 38.50  ? 219 ARG B O   1 
ATOM   5863 C CB  . ARG B 1 222 ? 24.263  -19.943 -48.729 1.00 38.06  ? 219 ARG B CB  1 
ATOM   5864 C CG  . ARG B 1 222 ? 23.646  -19.336 -47.482 1.00 37.99  ? 219 ARG B CG  1 
ATOM   5865 C CD  . ARG B 1 222 ? 24.685  -19.120 -46.380 1.00 39.76  ? 219 ARG B CD  1 
ATOM   5866 N NE  . ARG B 1 222 ? 25.232  -20.378 -45.877 1.00 44.26  ? 219 ARG B NE  1 
ATOM   5867 C CZ  . ARG B 1 222 ? 24.651  -21.125 -44.944 1.00 45.19  ? 219 ARG B CZ  1 
ATOM   5868 N NH1 . ARG B 1 222 ? 23.502  -20.740 -44.403 1.00 46.74  ? 219 ARG B NH1 1 
ATOM   5869 N NH2 . ARG B 1 222 ? 25.219  -22.257 -44.549 1.00 48.56  ? 219 ARG B NH2 1 
ATOM   5870 N N   . SER B 1 223 ? 26.019  -19.921 -51.570 1.00 36.55  ? 220 SER B N   1 
ATOM   5871 C CA  . SER B 1 223 ? 26.881  -20.702 -52.443 1.00 36.73  ? 220 SER B CA  1 
ATOM   5872 C C   . SER B 1 223 ? 28.172  -19.948 -52.748 1.00 38.05  ? 220 SER B C   1 
ATOM   5873 O O   . SER B 1 223 ? 29.031  -20.448 -53.472 1.00 40.26  ? 220 SER B O   1 
ATOM   5874 C CB  . SER B 1 223 ? 26.160  -21.054 -53.747 1.00 41.76  ? 220 SER B CB  1 
ATOM   5875 O OG  . SER B 1 223 ? 25.769  -19.882 -54.437 1.00 41.35  ? 220 SER B OG  1 
ATOM   5876 N N   . LEU B 1 224 ? 28.312  -18.750 -52.188 1.00 33.57  ? 221 LEU B N   1 
ATOM   5877 C CA  . LEU B 1 224 ? 29.424  -17.875 -52.551 1.00 34.82  ? 221 LEU B CA  1 
ATOM   5878 C C   . LEU B 1 224 ? 30.482  -17.771 -51.458 1.00 36.28  ? 221 LEU B C   1 
ATOM   5879 O O   . LEU B 1 224 ? 31.469  -17.051 -51.611 1.00 36.31  ? 221 LEU B O   1 
ATOM   5880 C CB  . LEU B 1 224 ? 28.905  -16.475 -52.899 1.00 32.93  ? 221 LEU B CB  1 
ATOM   5881 C CG  . LEU B 1 224 ? 27.774  -16.372 -53.925 1.00 34.82  ? 221 LEU B CG  1 
ATOM   5882 C CD1 . LEU B 1 224 ? 27.309  -14.922 -54.088 1.00 29.09  ? 221 LEU B CD1 1 
ATOM   5883 C CD2 . LEU B 1 224 ? 28.189  -16.968 -55.282 1.00 37.27  ? 221 LEU B CD2 1 
ATOM   5884 N N   . PHE B 1 225 ? 30.277  -18.479 -50.351 1.00 34.35  ? 222 PHE B N   1 
ATOM   5885 C CA  . PHE B 1 225 ? 31.259  -18.482 -49.276 1.00 35.37  ? 222 PHE B CA  1 
ATOM   5886 C C   . PHE B 1 225 ? 31.065  -19.691 -48.366 1.00 39.41  ? 222 PHE B C   1 
ATOM   5887 O O   . PHE B 1 225 ? 30.020  -20.344 -48.389 1.00 36.28  ? 222 PHE B O   1 
ATOM   5888 C CB  . PHE B 1 225 ? 31.186  -17.182 -48.467 1.00 31.28  ? 222 PHE B CB  1 
ATOM   5889 C CG  . PHE B 1 225 ? 29.953  -17.056 -47.618 1.00 36.63  ? 222 PHE B CG  1 
ATOM   5890 C CD1 . PHE B 1 225 ? 28.740  -16.696 -48.180 1.00 34.52  ? 222 PHE B CD1 1 
ATOM   5891 C CD2 . PHE B 1 225 ? 30.014  -17.285 -46.248 1.00 34.62  ? 222 PHE B CD2 1 
ATOM   5892 C CE1 . PHE B 1 225 ? 27.604  -16.574 -47.398 1.00 34.35  ? 222 PHE B CE1 1 
ATOM   5893 C CE2 . PHE B 1 225 ? 28.882  -17.169 -45.458 1.00 32.20  ? 222 PHE B CE2 1 
ATOM   5894 C CZ  . PHE B 1 225 ? 27.676  -16.810 -46.028 1.00 34.67  ? 222 PHE B CZ  1 
ATOM   5895 N N   . HIS B 1 226 ? 32.078  -19.985 -47.560 1.00 35.67  ? 223 HIS B N   1 
ATOM   5896 C CA  . HIS B 1 226 ? 32.061  -21.207 -46.768 1.00 38.01  ? 223 HIS B CA  1 
ATOM   5897 C C   . HIS B 1 226 ? 32.156  -20.934 -45.281 1.00 32.96  ? 223 HIS B C   1 
ATOM   5898 O O   . HIS B 1 226 ? 31.658  -21.717 -44.483 1.00 36.71  ? 223 HIS B O   1 
ATOM   5899 C CB  . HIS B 1 226 ? 33.197  -22.125 -47.207 1.00 36.28  ? 223 HIS B CB  1 
ATOM   5900 C CG  . HIS B 1 226 ? 33.255  -22.316 -48.687 1.00 39.68  ? 223 HIS B CG  1 
ATOM   5901 N ND1 . HIS B 1 226 ? 33.833  -21.390 -49.532 1.00 40.84  ? 223 HIS B ND1 1 
ATOM   5902 C CD2 . HIS B 1 226 ? 32.774  -23.299 -49.480 1.00 40.41  ? 223 HIS B CD2 1 
ATOM   5903 C CE1 . HIS B 1 226 ? 33.714  -21.803 -50.779 1.00 40.40  ? 223 HIS B CE1 1 
ATOM   5904 N NE2 . HIS B 1 226 ? 33.078  -22.964 -50.776 1.00 41.50  ? 223 HIS B NE2 1 
ATOM   5905 N N   . ARG B 1 227 ? 32.794  -19.827 -44.918 1.00 34.06  ? 224 ARG B N   1 
ATOM   5906 C CA  . ARG B 1 227 ? 32.965  -19.465 -43.509 1.00 35.53  ? 224 ARG B CA  1 
ATOM   5907 C C   . ARG B 1 227 ? 32.778  -17.975 -43.294 1.00 34.28  ? 224 ARG B C   1 
ATOM   5908 O O   . ARG B 1 227 ? 32.851  -17.192 -44.241 1.00 32.51  ? 224 ARG B O   1 
ATOM   5909 C CB  . ARG B 1 227 ? 34.345  -19.886 -43.019 1.00 33.42  ? 224 ARG B CB  1 
ATOM   5910 C CG  . ARG B 1 227 ? 34.487  -21.365 -42.866 1.00 41.55  ? 224 ARG B CG  1 
ATOM   5911 C CD  . ARG B 1 227 ? 35.915  -21.759 -42.599 1.00 37.28  ? 224 ARG B CD  1 
ATOM   5912 N NE  . ARG B 1 227 ? 36.712  -21.790 -43.808 1.00 45.14  ? 224 ARG B NE  1 
ATOM   5913 C CZ  . ARG B 1 227 ? 36.613  -22.731 -44.740 1.00 46.67  ? 224 ARG B CZ  1 
ATOM   5914 N NH1 . ARG B 1 227 ? 35.741  -23.721 -44.601 1.00 48.42  ? 224 ARG B NH1 1 
ATOM   5915 N NH2 . ARG B 1 227 ? 37.382  -22.674 -45.818 1.00 51.01  ? 224 ARG B NH2 1 
ATOM   5916 N N   . ALA B 1 228 ? 32.574  -17.580 -42.041 1.00 32.98  ? 225 ALA B N   1 
ATOM   5917 C CA  . ALA B 1 228 ? 32.256  -16.194 -41.735 1.00 29.87  ? 225 ALA B CA  1 
ATOM   5918 C C   . ALA B 1 228 ? 32.813  -15.726 -40.393 1.00 35.92  ? 225 ALA B C   1 
ATOM   5919 O O   . ALA B 1 228 ? 32.837  -16.477 -39.411 1.00 32.04  ? 225 ALA B O   1 
ATOM   5920 C CB  . ALA B 1 228 ? 30.755  -15.996 -41.765 1.00 33.17  ? 225 ALA B CB  1 
ATOM   5921 N N   . VAL B 1 229 ? 33.248  -14.470 -40.362 1.00 32.89  ? 226 VAL B N   1 
ATOM   5922 C CA  . VAL B 1 229 ? 33.683  -13.827 -39.133 1.00 29.31  ? 226 VAL B CA  1 
ATOM   5923 C C   . VAL B 1 229 ? 32.851  -12.576 -38.894 1.00 33.91  ? 226 VAL B C   1 
ATOM   5924 O O   . VAL B 1 229 ? 32.778  -11.704 -39.755 1.00 30.41  ? 226 VAL B O   1 
ATOM   5925 C CB  . VAL B 1 229 ? 35.170  -13.444 -39.180 1.00 29.71  ? 226 VAL B CB  1 
ATOM   5926 C CG1 . VAL B 1 229 ? 35.630  -12.914 -37.818 1.00 32.24  ? 226 VAL B CG1 1 
ATOM   5927 C CG2 . VAL B 1 229 ? 36.011  -14.625 -39.629 1.00 29.34  ? 226 VAL B CG2 1 
ATOM   5928 N N   . LEU B 1 230 ? 32.211  -12.493 -37.733 1.00 31.10  ? 227 LEU B N   1 
ATOM   5929 C CA  . LEU B 1 230 ? 31.402  -11.327 -37.394 1.00 29.92  ? 227 LEU B CA  1 
ATOM   5930 C C   . LEU B 1 230 ? 32.020  -10.600 -36.220 1.00 31.30  ? 227 LEU B C   1 
ATOM   5931 O O   . LEU B 1 230 ? 31.933  -11.061 -35.076 1.00 27.88  ? 227 LEU B O   1 
ATOM   5932 C CB  . LEU B 1 230 ? 29.959  -11.722 -37.066 1.00 29.44  ? 227 LEU B CB  1 
ATOM   5933 C CG  . LEU B 1 230 ? 29.088  -12.208 -38.229 1.00 31.99  ? 227 LEU B CG  1 
ATOM   5934 C CD1 . LEU B 1 230 ? 29.332  -13.679 -38.531 1.00 26.47  ? 227 LEU B CD1 1 
ATOM   5935 C CD2 . LEU B 1 230 ? 27.617  -11.946 -37.923 1.00 30.58  ? 227 LEU B CD2 1 
ATOM   5936 N N   . GLN B 1 231 ? 32.648  -9.465  -36.507 1.00 28.71  ? 228 GLN B N   1 
ATOM   5937 C CA  . GLN B 1 231 ? 33.311  -8.665  -35.484 1.00 32.00  ? 228 GLN B CA  1 
ATOM   5938 C C   . GLN B 1 231 ? 32.426  -7.508  -35.021 1.00 35.18  ? 228 GLN B C   1 
ATOM   5939 O O   . GLN B 1 231 ? 32.147  -6.595  -35.790 1.00 29.80  ? 228 GLN B O   1 
ATOM   5940 C CB  . GLN B 1 231 ? 34.646  -8.135  -36.014 1.00 31.10  ? 228 GLN B CB  1 
ATOM   5941 C CG  . GLN B 1 231 ? 35.541  -9.215  -36.608 1.00 31.36  ? 228 GLN B CG  1 
ATOM   5942 C CD  . GLN B 1 231 ? 36.777  -8.658  -37.300 1.00 35.02  ? 228 GLN B CD  1 
ATOM   5943 O OE1 . GLN B 1 231 ? 37.421  -9.347  -38.097 1.00 34.67  ? 228 GLN B OE1 1 
ATOM   5944 N NE2 . GLN B 1 231 ? 37.116  -7.410  -36.997 1.00 34.36  ? 228 GLN B NE2 1 
ATOM   5945 N N   . SER B 1 232 ? 31.982  -7.562  -33.764 1.00 30.40  ? 229 SER B N   1 
ATOM   5946 C CA  . SER B 1 232 ? 31.182  -6.492  -33.157 1.00 28.88  ? 229 SER B CA  1 
ATOM   5947 C C   . SER B 1 232 ? 29.943  -6.091  -33.966 1.00 33.49  ? 229 SER B C   1 
ATOM   5948 O O   . SER B 1 232 ? 29.646  -4.905  -34.107 1.00 34.01  ? 229 SER B O   1 
ATOM   5949 C CB  . SER B 1 232 ? 32.049  -5.250  -32.925 1.00 34.58  ? 229 SER B CB  1 
ATOM   5950 O OG  . SER B 1 232 ? 33.231  -5.558  -32.204 1.00 33.99  ? 229 SER B OG  1 
ATOM   5951 N N   . GLY B 1 233 ? 29.223  -7.072  -34.499 1.00 30.71  ? 230 GLY B N   1 
ATOM   5952 C CA  . GLY B 1 233 ? 27.990  -6.787  -35.212 1.00 30.90  ? 230 GLY B CA  1 
ATOM   5953 C C   . GLY B 1 233 ? 27.241  -8.042  -35.613 1.00 30.64  ? 230 GLY B C   1 
ATOM   5954 O O   . GLY B 1 233 ? 27.830  -9.117  -35.708 1.00 27.73  ? 230 GLY B O   1 
ATOM   5955 N N   . THR B 1 234 ? 25.939  -7.902  -35.849 1.00 29.25  ? 231 THR B N   1 
ATOM   5956 C CA  . THR B 1 234 ? 25.051  -9.037  -36.082 1.00 28.69  ? 231 THR B CA  1 
ATOM   5957 C C   . THR B 1 234 ? 23.881  -8.623  -36.959 1.00 29.18  ? 231 THR B C   1 
ATOM   5958 O O   . THR B 1 234 ? 23.478  -7.462  -36.934 1.00 31.37  ? 231 THR B O   1 
ATOM   5959 C CB  . THR B 1 234 ? 24.461  -9.593  -34.757 1.00 31.03  ? 231 THR B CB  1 
ATOM   5960 O OG1 . THR B 1 234 ? 23.739  -8.548  -34.095 1.00 30.79  ? 231 THR B OG1 1 
ATOM   5961 C CG2 . THR B 1 234 ? 25.539  -10.131 -33.821 1.00 30.99  ? 231 THR B CG2 1 
ATOM   5962 N N   . PRO B 1 235 ? 23.307  -9.573  -37.712 1.00 31.33  ? 232 PRO B N   1 
ATOM   5963 C CA  . PRO B 1 235 ? 22.118  -9.258  -38.513 1.00 31.88  ? 232 PRO B CA  1 
ATOM   5964 C C   . PRO B 1 235 ? 20.886  -9.062  -37.633 1.00 34.59  ? 232 PRO B C   1 
ATOM   5965 O O   . PRO B 1 235 ? 20.010  -8.255  -37.950 1.00 32.34  ? 232 PRO B O   1 
ATOM   5966 C CB  . PRO B 1 235 ? 21.965  -10.485 -39.414 1.00 30.69  ? 232 PRO B CB  1 
ATOM   5967 C CG  . PRO B 1 235 ? 22.592  -11.597 -38.631 1.00 32.66  ? 232 PRO B CG  1 
ATOM   5968 C CD  . PRO B 1 235 ? 23.739  -10.972 -37.887 1.00 30.21  ? 232 PRO B CD  1 
ATOM   5969 N N   . ASN B 1 236 ? 20.821  -9.813  -36.540 1.00 34.23  ? 233 ASN B N   1 
ATOM   5970 C CA  . ASN B 1 236 ? 19.809  -9.588  -35.519 1.00 32.39  ? 233 ASN B CA  1 
ATOM   5971 C C   . ASN B 1 236 ? 20.182  -8.378  -34.687 1.00 37.49  ? 233 ASN B C   1 
ATOM   5972 O O   . ASN B 1 236 ? 21.302  -7.873  -34.776 1.00 35.88  ? 233 ASN B O   1 
ATOM   5973 C CB  . ASN B 1 236 ? 19.661  -10.812 -34.615 1.00 35.57  ? 233 ASN B CB  1 
ATOM   5974 C CG  . ASN B 1 236 ? 20.989  -11.280 -34.059 1.00 36.52  ? 233 ASN B CG  1 
ATOM   5975 O OD1 . ASN B 1 236 ? 21.916  -11.576 -34.813 1.00 36.00  ? 233 ASN B OD1 1 
ATOM   5976 N ND2 . ASN B 1 236 ? 21.096  -11.332 -32.733 1.00 32.27  ? 233 ASN B ND2 1 
ATOM   5977 N N   . GLY B 1 237 ? 19.251  -7.922  -33.859 1.00 38.69  ? 234 GLY B N   1 
ATOM   5978 C CA  . GLY B 1 237 ? 19.511  -6.775  -33.016 1.00 37.92  ? 234 GLY B CA  1 
ATOM   5979 C C   . GLY B 1 237 ? 18.670  -5.587  -33.433 1.00 38.09  ? 234 GLY B C   1 
ATOM   5980 O O   . GLY B 1 237 ? 17.900  -5.669  -34.391 1.00 38.88  ? 234 GLY B O   1 
ATOM   5981 N N   . PRO B 1 238 ? 18.827  -4.467  -32.720 1.00 34.13  ? 235 PRO B N   1 
ATOM   5982 C CA  . PRO B 1 238 ? 17.929  -3.318  -32.858 1.00 38.26  ? 235 PRO B CA  1 
ATOM   5983 C C   . PRO B 1 238 ? 18.284  -2.323  -33.966 1.00 35.54  ? 235 PRO B C   1 
ATOM   5984 O O   . PRO B 1 238 ? 17.446  -1.470  -34.251 1.00 37.60  ? 235 PRO B O   1 
ATOM   5985 C CB  . PRO B 1 238 ? 18.047  -2.636  -31.492 1.00 34.76  ? 235 PRO B CB  1 
ATOM   5986 C CG  . PRO B 1 238 ? 19.446  -2.920  -31.073 1.00 36.51  ? 235 PRO B CG  1 
ATOM   5987 C CD  . PRO B 1 238 ? 19.789  -4.286  -31.617 1.00 37.83  ? 235 PRO B CD  1 
ATOM   5988 N N   . TRP B 1 239 ? 19.472  -2.407  -34.563 1.00 34.97  ? 236 TRP B N   1 
ATOM   5989 C CA  . TRP B 1 239 ? 19.903  -1.372  -35.511 1.00 36.28  ? 236 TRP B CA  1 
ATOM   5990 C C   . TRP B 1 239 ? 20.187  -1.857  -36.939 1.00 35.59  ? 236 TRP B C   1 
ATOM   5991 O O   . TRP B 1 239 ? 20.231  -1.046  -37.866 1.00 37.44  ? 236 TRP B O   1 
ATOM   5992 C CB  . TRP B 1 239 ? 21.155  -0.663  -34.980 1.00 33.97  ? 236 TRP B CB  1 
ATOM   5993 C CG  . TRP B 1 239 ? 22.322  -1.579  -34.723 1.00 36.80  ? 236 TRP B CG  1 
ATOM   5994 C CD1 . TRP B 1 239 ? 22.666  -2.160  -33.532 1.00 36.20  ? 236 TRP B CD1 1 
ATOM   5995 C CD2 . TRP B 1 239 ? 23.300  -2.017  -35.678 1.00 35.84  ? 236 TRP B CD2 1 
ATOM   5996 N NE1 . TRP B 1 239 ? 23.795  -2.931  -33.689 1.00 35.87  ? 236 TRP B NE1 1 
ATOM   5997 C CE2 . TRP B 1 239 ? 24.202  -2.861  -34.997 1.00 37.21  ? 236 TRP B CE2 1 
ATOM   5998 C CE3 . TRP B 1 239 ? 23.499  -1.778  -37.043 1.00 37.14  ? 236 TRP B CE3 1 
ATOM   5999 C CZ2 . TRP B 1 239 ? 25.285  -3.465  -35.634 1.00 35.48  ? 236 TRP B CZ2 1 
ATOM   6000 C CZ3 . TRP B 1 239 ? 24.575  -2.380  -37.674 1.00 32.62  ? 236 TRP B CZ3 1 
ATOM   6001 C CH2 . TRP B 1 239 ? 25.452  -3.214  -36.972 1.00 34.55  ? 236 TRP B CH2 1 
ATOM   6002 N N   . ALA B 1 240 ? 20.381  -3.159  -37.124 1.00 34.86  ? 237 ALA B N   1 
ATOM   6003 C CA  . ALA B 1 240 ? 20.863  -3.664  -38.414 1.00 36.32  ? 237 ALA B CA  1 
ATOM   6004 C C   . ALA B 1 240 ? 19.780  -3.770  -39.487 1.00 37.53  ? 237 ALA B C   1 
ATOM   6005 O O   . ALA B 1 240 ? 20.090  -3.816  -40.679 1.00 37.18  ? 237 ALA B O   1 
ATOM   6006 C CB  . ALA B 1 240 ? 21.534  -5.014  -38.230 1.00 33.52  ? 237 ALA B CB  1 
ATOM   6007 N N   . THR B 1 241 ? 18.517  -3.828  -39.075 1.00 36.04  ? 238 THR B N   1 
ATOM   6008 C CA  . THR B 1 241 ? 17.419  -3.946  -40.031 1.00 36.14  ? 238 THR B CA  1 
ATOM   6009 C C   . THR B 1 241 ? 16.240  -3.058  -39.668 1.00 40.12  ? 238 THR B C   1 
ATOM   6010 O O   . THR B 1 241 ? 16.068  -2.679  -38.513 1.00 38.22  ? 238 THR B O   1 
ATOM   6011 C CB  . THR B 1 241 ? 16.891  -5.397  -40.146 1.00 38.51  ? 238 THR B CB  1 
ATOM   6012 O OG1 . THR B 1 241 ? 16.344  -5.813  -38.888 1.00 38.02  ? 238 THR B OG1 1 
ATOM   6013 C CG2 . THR B 1 241 ? 17.989  -6.357  -40.569 1.00 35.22  ? 238 THR B CG2 1 
ATOM   6014 N N   . VAL B 1 242 ? 15.426  -2.729  -40.667 1.00 34.42  ? 239 VAL B N   1 
ATOM   6015 C CA  . VAL B 1 242 ? 14.135  -2.104  -40.416 1.00 38.29  ? 239 VAL B CA  1 
ATOM   6016 C C   . VAL B 1 242 ? 13.050  -2.900  -41.117 1.00 40.45  ? 239 VAL B C   1 
ATOM   6017 O O   . VAL B 1 242 ? 13.336  -3.692  -42.017 1.00 41.09  ? 239 VAL B O   1 
ATOM   6018 C CB  . VAL B 1 242 ? 14.084  -0.637  -40.895 1.00 39.35  ? 239 VAL B CB  1 
ATOM   6019 C CG1 . VAL B 1 242 ? 14.943  0.245   -40.002 1.00 38.17  ? 239 VAL B CG1 1 
ATOM   6020 C CG2 . VAL B 1 242 ? 14.499  -0.524  -42.368 1.00 38.67  ? 239 VAL B CG2 1 
ATOM   6021 N N   . SER B 1 243 ? 11.805  -2.696  -40.699 1.00 41.22  ? 240 SER B N   1 
ATOM   6022 C CA  . SER B 1 243 ? 10.661  -3.289  -41.387 1.00 41.39  ? 240 SER B CA  1 
ATOM   6023 C C   . SER B 1 243 ? 10.409  -2.591  -42.724 1.00 40.88  ? 240 SER B C   1 
ATOM   6024 O O   . SER B 1 243 ? 10.919  -1.497  -42.963 1.00 41.78  ? 240 SER B O   1 
ATOM   6025 C CB  . SER B 1 243 ? 9.407   -3.205  -40.518 1.00 40.08  ? 240 SER B CB  1 
ATOM   6026 O OG  . SER B 1 243 ? 9.034   -1.854  -40.319 1.00 41.72  ? 240 SER B OG  1 
ATOM   6027 N N   . ALA B 1 244 ? 9.611   -3.222  -43.582 1.00 39.08  ? 241 ALA B N   1 
ATOM   6028 C CA  . ALA B 1 244 ? 9.242   -2.629  -44.867 1.00 43.28  ? 241 ALA B CA  1 
ATOM   6029 C C   . ALA B 1 244 ? 8.462   -1.333  -44.673 1.00 45.37  ? 241 ALA B C   1 
ATOM   6030 O O   . ALA B 1 244 ? 8.660   -0.359  -45.403 1.00 44.06  ? 241 ALA B O   1 
ATOM   6031 C CB  . ALA B 1 244 ? 8.432   -3.613  -45.690 1.00 39.59  ? 241 ALA B CB  1 
ATOM   6032 N N   . GLY B 1 245 ? 7.580   -1.326  -43.677 1.00 44.92  ? 242 GLY B N   1 
ATOM   6033 C CA  . GLY B 1 245 ? 6.775   -0.156  -43.378 1.00 41.84  ? 242 GLY B CA  1 
ATOM   6034 C C   . GLY B 1 245 ? 7.609   1.025   -42.923 1.00 40.20  ? 242 GLY B C   1 
ATOM   6035 O O   . GLY B 1 245 ? 7.365   2.162   -43.328 1.00 45.37  ? 242 GLY B O   1 
ATOM   6036 N N   . GLU B 1 246 ? 8.604   0.760   -42.083 1.00 40.37  ? 243 GLU B N   1 
ATOM   6037 C CA  . GLU B 1 246 ? 9.458   1.823   -41.569 1.00 43.38  ? 243 GLU B CA  1 
ATOM   6038 C C   . GLU B 1 246 ? 10.419  2.334   -42.646 1.00 43.12  ? 243 GLU B C   1 
ATOM   6039 O O   . GLU B 1 246 ? 10.715  3.531   -42.713 1.00 42.31  ? 243 GLU B O   1 
ATOM   6040 C CB  . GLU B 1 246 ? 10.235  1.337   -40.338 1.00 41.43  ? 243 GLU B CB  1 
ATOM   6041 C CG  . GLU B 1 246 ? 11.220  2.350   -39.756 1.00 44.13  ? 243 GLU B CG  1 
ATOM   6042 C CD  . GLU B 1 246 ? 10.554  3.606   -39.208 1.00 44.80  ? 243 GLU B CD  1 
ATOM   6043 O OE1 . GLU B 1 246 ? 9.308   3.661   -39.139 1.00 47.37  ? 243 GLU B OE1 1 
ATOM   6044 O OE2 . GLU B 1 246 ? 11.288  4.548   -38.846 1.00 44.03  ? 243 GLU B OE2 1 
ATOM   6045 N N   . ALA B 1 247 ? 10.902  1.426   -43.487 1.00 43.53  ? 244 ALA B N   1 
ATOM   6046 C CA  . ALA B 1 247 ? 11.753  1.811   -44.605 1.00 39.81  ? 244 ALA B CA  1 
ATOM   6047 C C   . ALA B 1 247 ? 10.971  2.714   -45.551 1.00 40.16  ? 244 ALA B C   1 
ATOM   6048 O O   . ALA B 1 247 ? 11.467  3.758   -45.976 1.00 41.90  ? 244 ALA B O   1 
ATOM   6049 C CB  . ALA B 1 247 ? 12.274  0.581   -45.335 1.00 38.50  ? 244 ALA B CB  1 
ATOM   6050 N N   . ARG B 1 248 ? 9.741   2.315   -45.866 1.00 41.78  ? 245 ARG B N   1 
ATOM   6051 C CA  . ARG B 1 248 ? 8.880   3.123   -46.722 1.00 40.79  ? 245 ARG B CA  1 
ATOM   6052 C C   . ARG B 1 248 ? 8.607   4.480   -46.090 1.00 43.60  ? 245 ARG B C   1 
ATOM   6053 O O   . ARG B 1 248 ? 8.624   5.508   -46.773 1.00 45.25  ? 245 ARG B O   1 
ATOM   6054 C CB  . ARG B 1 248 ? 7.560   2.402   -47.010 1.00 44.93  ? 245 ARG B CB  1 
ATOM   6055 C CG  . ARG B 1 248 ? 6.541   3.262   -47.749 1.00 46.30  ? 245 ARG B CG  1 
ATOM   6056 C CD  . ARG B 1 248 ? 5.379   2.436   -48.286 1.00 43.35  ? 245 ARG B CD  1 
ATOM   6057 N NE  . ARG B 1 248 ? 5.791   1.538   -49.361 1.00 46.17  ? 245 ARG B NE  1 
ATOM   6058 C CZ  . ARG B 1 248 ? 5.872   1.894   -50.640 1.00 49.27  ? 245 ARG B CZ  1 
ATOM   6059 N NH1 . ARG B 1 248 ? 6.256   1.012   -51.555 1.00 47.38  ? 245 ARG B NH1 1 
ATOM   6060 N NH2 . ARG B 1 248 ? 5.572   3.133   -51.005 1.00 47.93  ? 245 ARG B NH2 1 
ATOM   6061 N N   . ARG B 1 249 ? 8.365   4.485   -44.781 1.00 42.97  ? 246 ARG B N   1 
ATOM   6062 C CA  . ARG B 1 249 ? 8.117   5.732   -44.076 1.00 43.20  ? 246 ARG B CA  1 
ATOM   6063 C C   . ARG B 1 249 ? 9.307   6.679   -44.224 1.00 43.07  ? 246 ARG B C   1 
ATOM   6064 O O   . ARG B 1 249 ? 9.143   7.848   -44.591 1.00 44.69  ? 246 ARG B O   1 
ATOM   6065 C CB  . ARG B 1 249 ? 7.827   5.475   -42.593 1.00 43.70  ? 246 ARG B CB  1 
ATOM   6066 C CG  . ARG B 1 249 ? 7.466   6.732   -41.826 1.00 43.11  ? 246 ARG B CG  1 
ATOM   6067 C CD  . ARG B 1 249 ? 7.861   6.647   -40.355 1.00 46.30  ? 246 ARG B CD  1 
ATOM   6068 N NE  . ARG B 1 249 ? 8.312   7.951   -39.883 1.00 50.56  ? 246 ARG B NE  1 
ATOM   6069 C CZ  . ARG B 1 249 ? 9.517   8.192   -39.379 1.00 52.58  ? 246 ARG B CZ  1 
ATOM   6070 N NH1 . ARG B 1 249 ? 10.394  7.205   -39.249 1.00 44.22  ? 246 ARG B NH1 1 
ATOM   6071 N NH2 . ARG B 1 249 ? 9.838   9.421   -38.989 1.00 58.16  ? 246 ARG B NH2 1 
ATOM   6072 N N   . ARG B 1 250 ? 10.503  6.160   -43.959 1.00 36.73  ? 247 ARG B N   1 
ATOM   6073 C CA  . ARG B 1 250 ? 11.721  6.967   -43.994 1.00 41.31  ? 247 ARG B CA  1 
ATOM   6074 C C   . ARG B 1 250 ? 12.042  7.461   -45.407 1.00 40.02  ? 247 ARG B C   1 
ATOM   6075 O O   . ARG B 1 250 ? 12.496  8.593   -45.592 1.00 40.94  ? 247 ARG B O   1 
ATOM   6076 C CB  . ARG B 1 250 ? 12.903  6.171   -43.430 1.00 40.25  ? 247 ARG B CB  1 
ATOM   6077 C CG  . ARG B 1 250 ? 12.777  5.826   -41.939 1.00 39.67  ? 247 ARG B CG  1 
ATOM   6078 C CD  . ARG B 1 250 ? 13.978  5.024   -41.457 1.00 40.97  ? 247 ARG B CD  1 
ATOM   6079 N NE  . ARG B 1 250 ? 13.820  4.551   -40.081 1.00 42.00  ? 247 ARG B NE  1 
ATOM   6080 C CZ  . ARG B 1 250 ? 14.769  3.926   -39.391 1.00 42.72  ? 247 ARG B CZ  1 
ATOM   6081 N NH1 . ARG B 1 250 ? 15.955  3.706   -39.944 1.00 35.18  ? 247 ARG B NH1 1 
ATOM   6082 N NH2 . ARG B 1 250 ? 14.537  3.528   -38.140 1.00 38.99  ? 247 ARG B NH2 1 
ATOM   6083 N N   . ALA B 1 251 ? 11.809  6.608   -46.398 1.00 39.97  ? 248 ALA B N   1 
ATOM   6084 C CA  . ALA B 1 251 ? 12.043  6.982   -47.787 1.00 42.15  ? 248 ALA B CA  1 
ATOM   6085 C C   . ALA B 1 251 ? 11.099  8.106   -48.191 1.00 45.28  ? 248 ALA B C   1 
ATOM   6086 O O   . ALA B 1 251 ? 11.511  9.091   -48.808 1.00 45.04  ? 248 ALA B O   1 
ATOM   6087 C CB  . ALA B 1 251 ? 11.869  5.779   -48.702 1.00 37.55  ? 248 ALA B CB  1 
ATOM   6088 N N   . THR B 1 252 ? 9.829   7.960   -47.826 1.00 46.27  ? 249 THR B N   1 
ATOM   6089 C CA  . THR B 1 252 ? 8.823   8.954   -48.178 1.00 47.05  ? 249 THR B CA  1 
ATOM   6090 C C   . THR B 1 252 ? 9.110   10.289  -47.488 1.00 48.23  ? 249 THR B C   1 
ATOM   6091 O O   . THR B 1 252 ? 8.935   11.359  -48.081 1.00 47.91  ? 249 THR B O   1 
ATOM   6092 C CB  . THR B 1 252 ? 7.413   8.465   -47.813 1.00 44.91  ? 249 THR B CB  1 
ATOM   6093 O OG1 . THR B 1 252 ? 7.237   7.129   -48.300 1.00 44.57  ? 249 THR B OG1 1 
ATOM   6094 C CG2 . THR B 1 252 ? 6.356   9.367   -48.434 1.00 49.83  ? 249 THR B CG2 1 
ATOM   6095 N N   . LEU B 1 253 ? 9.573   10.227  -46.243 1.00 44.39  ? 250 LEU B N   1 
ATOM   6096 C CA  . LEU B 1 253 ? 9.919   11.445  -45.522 1.00 45.76  ? 250 LEU B CA  1 
ATOM   6097 C C   . LEU B 1 253 ? 11.148  12.124  -46.129 1.00 44.72  ? 250 LEU B C   1 
ATOM   6098 O O   . LEU B 1 253 ? 11.194  13.353  -46.238 1.00 44.16  ? 250 LEU B O   1 
ATOM   6099 C CB  . LEU B 1 253 ? 10.155  11.154  -44.037 1.00 43.35  ? 250 LEU B CB  1 
ATOM   6100 C CG  . LEU B 1 253 ? 10.595  12.353  -43.192 1.00 46.74  ? 250 LEU B CG  1 
ATOM   6101 C CD1 . LEU B 1 253 ? 9.653   13.535  -43.393 1.00 44.42  ? 250 LEU B CD1 1 
ATOM   6102 C CD2 . LEU B 1 253 ? 10.691  11.980  -41.710 1.00 45.28  ? 250 LEU B CD2 1 
ATOM   6103 N N   . LEU B 1 254 ? 12.145  11.334  -46.519 1.00 44.16  ? 251 LEU B N   1 
ATOM   6104 C CA  . LEU B 1 254 ? 13.329  11.908  -47.152 1.00 45.43  ? 251 LEU B CA  1 
ATOM   6105 C C   . LEU B 1 254 ? 12.935  12.583  -48.459 1.00 42.73  ? 251 LEU B C   1 
ATOM   6106 O O   . LEU B 1 254 ? 13.396  13.683  -48.760 1.00 45.97  ? 251 LEU B O   1 
ATOM   6107 C CB  . LEU B 1 254 ? 14.404  10.855  -47.419 1.00 38.68  ? 251 LEU B CB  1 
ATOM   6108 C CG  . LEU B 1 254 ? 15.607  11.501  -48.117 1.00 43.94  ? 251 LEU B CG  1 
ATOM   6109 C CD1 . LEU B 1 254 ? 16.603  12.031  -47.103 1.00 44.91  ? 251 LEU B CD1 1 
ATOM   6110 C CD2 . LEU B 1 254 ? 16.274  10.572  -49.122 1.00 47.15  ? 251 LEU B CD2 1 
ATOM   6111 N N   . ALA B 1 255 ? 12.079  11.909  -49.222 1.00 44.07  ? 252 ALA B N   1 
ATOM   6112 C CA  . ALA B 1 255 ? 11.553  12.450  -50.471 1.00 46.59  ? 252 ALA B CA  1 
ATOM   6113 C C   . ALA B 1 255 ? 10.888  13.793  -50.221 1.00 49.88  ? 252 ALA B C   1 
ATOM   6114 O O   . ALA B 1 255 ? 11.156  14.769  -50.922 1.00 50.35  ? 252 ALA B O   1 
ATOM   6115 C CB  . ALA B 1 255 ? 10.569  11.478  -51.105 1.00 44.25  ? 252 ALA B CB  1 
ATOM   6116 N N   . ARG B 1 256 ? 10.028  13.834  -49.207 1.00 48.52  ? 253 ARG B N   1 
ATOM   6117 C CA  . ARG B 1 256 ? 9.358   15.069  -48.816 1.00 48.79  ? 253 ARG B CA  1 
ATOM   6118 C C   . ARG B 1 256 ? 10.361  16.180  -48.501 1.00 48.42  ? 253 ARG B C   1 
ATOM   6119 O O   . ARG B 1 256 ? 10.204  17.314  -48.956 1.00 48.01  ? 253 ARG B O   1 
ATOM   6120 C CB  . ARG B 1 256 ? 8.450   14.822  -47.606 1.00 51.72  ? 253 ARG B CB  1 
ATOM   6121 C CG  . ARG B 1 256 ? 7.691   16.050  -47.137 1.00 57.92  ? 253 ARG B CG  1 
ATOM   6122 C CD  . ARG B 1 256 ? 6.817   15.738  -45.929 1.00 66.61  ? 253 ARG B CD  1 
ATOM   6123 N NE  . ARG B 1 256 ? 6.091   16.916  -45.462 1.00 73.02  ? 253 ARG B NE  1 
ATOM   6124 C CZ  . ARG B 1 256 ? 6.577   17.804  -44.602 1.00 77.94  ? 253 ARG B CZ  1 
ATOM   6125 N NH1 . ARG B 1 256 ? 7.798   17.650  -44.105 1.00 75.34  ? 253 ARG B NH1 1 
ATOM   6126 N NH2 . ARG B 1 256 ? 5.841   18.846  -44.236 1.00 82.55  ? 253 ARG B NH2 1 
ATOM   6127 N N   . LEU B 1 257 ? 11.397  15.848  -47.735 1.00 46.37  ? 254 LEU B N   1 
ATOM   6128 C CA  . LEU B 1 257 ? 12.387  16.841  -47.321 1.00 44.23  ? 254 LEU B CA  1 
ATOM   6129 C C   . LEU B 1 257 ? 13.180  17.444  -48.490 1.00 47.37  ? 254 LEU B C   1 
ATOM   6130 O O   . LEU B 1 257 ? 13.697  18.554  -48.376 1.00 44.22  ? 254 LEU B O   1 
ATOM   6131 C CB  . LEU B 1 257 ? 13.356  16.231  -46.301 1.00 45.23  ? 254 LEU B CB  1 
ATOM   6132 C CG  . LEU B 1 257 ? 12.770  15.843  -44.936 1.00 46.37  ? 254 LEU B CG  1 
ATOM   6133 C CD1 . LEU B 1 257 ? 13.824  15.196  -44.049 1.00 41.98  ? 254 LEU B CD1 1 
ATOM   6134 C CD2 . LEU B 1 257 ? 12.158  17.049  -44.242 1.00 44.29  ? 254 LEU B CD2 1 
ATOM   6135 N N   . VAL B 1 258 ? 13.285  16.726  -49.607 1.00 46.02  ? 255 VAL B N   1 
ATOM   6136 C CA  . VAL B 1 258 ? 14.000  17.266  -50.767 1.00 48.93  ? 255 VAL B CA  1 
ATOM   6137 C C   . VAL B 1 258 ? 13.055  17.689  -51.890 1.00 51.10  ? 255 VAL B C   1 
ATOM   6138 O O   . VAL B 1 258 ? 13.482  17.878  -53.031 1.00 53.30  ? 255 VAL B O   1 
ATOM   6139 C CB  . VAL B 1 258 ? 15.026  16.257  -51.340 1.00 47.81  ? 255 VAL B CB  1 
ATOM   6140 C CG1 . VAL B 1 258 ? 16.177  16.049  -50.363 1.00 45.11  ? 255 VAL B CG1 1 
ATOM   6141 C CG2 . VAL B 1 258 ? 14.354  14.938  -51.698 1.00 43.65  ? 255 VAL B CG2 1 
ATOM   6142 N N   . GLY B 1 259 ? 11.774  17.834  -51.566 1.00 50.92  ? 256 GLY B N   1 
ATOM   6143 C CA  . GLY B 1 259 ? 10.800  18.358  -52.508 1.00 53.77  ? 256 GLY B CA  1 
ATOM   6144 C C   . GLY B 1 259 ? 10.218  17.353  -53.485 1.00 58.24  ? 256 GLY B C   1 
ATOM   6145 O O   . GLY B 1 259 ? 9.789   17.722  -54.579 1.00 59.87  ? 256 GLY B O   1 
ATOM   6146 N N   . CYS B 1 260 ? 10.194  16.084  -53.093 1.00 56.09  ? 257 CYS B N   1 
ATOM   6147 C CA  . CYS B 1 260 ? 9.638   15.034  -53.940 1.00 59.23  ? 257 CYS B CA  1 
ATOM   6148 C C   . CYS B 1 260 ? 8.397   14.415  -53.298 1.00 64.63  ? 257 CYS B C   1 
ATOM   6149 O O   . CYS B 1 260 ? 8.418   14.092  -52.111 1.00 62.56  ? 257 CYS B O   1 
ATOM   6150 C CB  . CYS B 1 260 ? 10.690  13.960  -54.221 1.00 53.26  ? 257 CYS B CB  1 
ATOM   6151 S SG  . CYS B 1 260 ? 12.117  14.559  -55.155 1.00 55.74  ? 257 CYS B SG  1 
ATOM   6152 N N   . PRO B 1 261 ? 7.306   14.236  -54.070 1.00 75.03  ? 258 PRO B N   1 
ATOM   6153 C CA  . PRO B 1 261 ? 7.013   14.501  -55.490 1.00 78.21  ? 258 PRO B CA  1 
ATOM   6154 C C   . PRO B 1 261 ? 7.395   15.903  -55.978 1.00 76.68  ? 258 PRO B C   1 
ATOM   6155 O O   . PRO B 1 261 ? 6.560   16.613  -56.542 1.00 82.02  ? 258 PRO B O   1 
ATOM   6156 C CB  . PRO B 1 261 ? 5.487   14.320  -55.573 1.00 83.89  ? 258 PRO B CB  1 
ATOM   6157 C CG  . PRO B 1 261 ? 5.010   14.113  -54.148 1.00 82.53  ? 258 PRO B CG  1 
ATOM   6158 C CD  . PRO B 1 261 ? 6.175   13.562  -53.417 1.00 75.36  ? 258 PRO B CD  1 
ATOM   6159 N N   . ASN B 1 268 ? 2.292   7.292   -55.711 1.00 72.17  ? 265 ASN B N   1 
ATOM   6160 C CA  . ASN B 1 268 ? 2.941   6.550   -56.786 1.00 68.74  ? 265 ASN B CA  1 
ATOM   6161 C C   . ASN B 1 268 ? 4.454   6.467   -56.591 1.00 66.03  ? 265 ASN B C   1 
ATOM   6162 O O   . ASN B 1 268 ? 5.139   7.489   -56.542 1.00 64.45  ? 265 ASN B O   1 
ATOM   6163 C CB  . ASN B 1 268 ? 2.621   7.189   -58.138 1.00 74.12  ? 265 ASN B CB  1 
ATOM   6164 C CG  . ASN B 1 268 ? 3.420   6.583   -59.275 1.00 70.53  ? 265 ASN B CG  1 
ATOM   6165 O OD1 . ASN B 1 268 ? 4.477   7.094   -59.644 1.00 72.49  ? 265 ASN B OD1 1 
ATOM   6166 N ND2 . ASN B 1 268 ? 2.918   5.489   -59.837 1.00 70.52  ? 265 ASN B ND2 1 
ATOM   6167 N N   . ASP B 1 269 ? 4.967   5.244   -56.487 1.00 61.50  ? 266 ASP B N   1 
ATOM   6168 C CA  . ASP B 1 269 ? 6.388   5.021   -56.236 1.00 57.90  ? 266 ASP B CA  1 
ATOM   6169 C C   . ASP B 1 269 ? 7.274   5.481   -57.397 1.00 55.99  ? 266 ASP B C   1 
ATOM   6170 O O   . ASP B 1 269 ? 8.321   6.096   -57.180 1.00 52.75  ? 266 ASP B O   1 
ATOM   6171 C CB  . ASP B 1 269 ? 6.652   3.540   -55.946 1.00 51.74  ? 266 ASP B CB  1 
ATOM   6172 C CG  . ASP B 1 269 ? 6.213   3.127   -54.551 1.00 53.02  ? 266 ASP B CG  1 
ATOM   6173 O OD1 . ASP B 1 269 ? 5.969   4.020   -53.709 1.00 52.05  ? 266 ASP B OD1 1 
ATOM   6174 O OD2 . ASP B 1 269 ? 6.120   1.907   -54.296 1.00 49.38  ? 266 ASP B OD2 1 
ATOM   6175 N N   . THR B 1 270 ? 6.850   5.184   -58.622 1.00 56.57  ? 267 THR B N   1 
ATOM   6176 C CA  . THR B 1 270 ? 7.652   5.472   -59.811 1.00 54.29  ? 267 THR B CA  1 
ATOM   6177 C C   . THR B 1 270 ? 8.063   6.941   -59.923 1.00 53.18  ? 267 THR B C   1 
ATOM   6178 O O   . THR B 1 270 ? 9.240   7.248   -60.127 1.00 53.02  ? 267 THR B O   1 
ATOM   6179 C CB  . THR B 1 270 ? 6.899   5.066   -61.091 1.00 57.62  ? 267 THR B CB  1 
ATOM   6180 O OG1 . THR B 1 270 ? 6.646   3.655   -61.065 1.00 57.56  ? 267 THR B OG1 1 
ATOM   6181 C CG2 . THR B 1 270 ? 7.716   5.411   -62.335 1.00 53.32  ? 267 THR B CG2 1 
ATOM   6182 N N   . GLU B 1 271 ? 7.103   7.846   -59.772 1.00 55.58  ? 268 GLU B N   1 
ATOM   6183 C CA  . GLU B 1 271 ? 7.382   9.267   -59.941 1.00 57.41  ? 268 GLU B CA  1 
ATOM   6184 C C   . GLU B 1 271 ? 8.196   9.814   -58.764 1.00 54.27  ? 268 GLU B C   1 
ATOM   6185 O O   . GLU B 1 271 ? 9.059   10.685  -58.941 1.00 50.66  ? 268 GLU B O   1 
ATOM   6186 C CB  . GLU B 1 271 ? 6.072   10.051  -60.136 1.00 65.34  ? 268 GLU B CB  1 
ATOM   6187 C CG  . GLU B 1 271 ? 5.395   10.563  -58.869 1.00 72.37  ? 268 GLU B CG  1 
ATOM   6188 C CD  . GLU B 1 271 ? 4.049   11.222  -59.147 1.00 82.31  ? 268 GLU B CD  1 
ATOM   6189 O OE1 . GLU B 1 271 ? 3.064   10.491  -59.389 1.00 83.54  ? 268 GLU B OE1 1 
ATOM   6190 O OE2 . GLU B 1 271 ? 3.978   12.470  -59.129 1.00 85.81  ? 268 GLU B OE2 1 
ATOM   6191 N N   . LEU B 1 272 ? 7.948   9.277   -57.571 1.00 55.53  ? 269 LEU B N   1 
ATOM   6192 C CA  . LEU B 1 272 ? 8.699   9.667   -56.385 1.00 49.21  ? 269 LEU B CA  1 
ATOM   6193 C C   . LEU B 1 272 ? 10.173  9.330   -56.580 1.00 45.65  ? 269 LEU B C   1 
ATOM   6194 O O   . LEU B 1 272 ? 11.060  10.158  -56.337 1.00 44.25  ? 269 LEU B O   1 
ATOM   6195 C CB  . LEU B 1 272 ? 8.136   8.967   -55.140 1.00 53.05  ? 269 LEU B CB  1 
ATOM   6196 C CG  . LEU B 1 272 ? 8.639   9.378   -53.754 1.00 55.26  ? 269 LEU B CG  1 
ATOM   6197 C CD1 . LEU B 1 272 ? 7.564   9.125   -52.711 1.00 60.90  ? 269 LEU B CD1 1 
ATOM   6198 C CD2 . LEU B 1 272 ? 9.906   8.627   -53.376 1.00 54.58  ? 269 LEU B CD2 1 
ATOM   6199 N N   . ILE B 1 273 ? 10.423  8.106   -57.031 1.00 45.37  ? 270 ILE B N   1 
ATOM   6200 C CA  . ILE B 1 273 ? 11.786  7.637   -57.235 1.00 47.54  ? 270 ILE B CA  1 
ATOM   6201 C C   . ILE B 1 273 ? 12.455  8.392   -58.379 1.00 45.24  ? 270 ILE B C   1 
ATOM   6202 O O   . ILE B 1 273 ? 13.630  8.734   -58.288 1.00 44.44  ? 270 ILE B O   1 
ATOM   6203 C CB  . ILE B 1 273 ? 11.821  6.125   -57.510 1.00 47.16  ? 270 ILE B CB  1 
ATOM   6204 C CG1 . ILE B 1 273 ? 11.278  5.371   -56.298 1.00 50.12  ? 270 ILE B CG1 1 
ATOM   6205 C CG2 . ILE B 1 273 ? 13.238  5.666   -57.793 1.00 46.56  ? 270 ILE B CG2 1 
ATOM   6206 C CD1 . ILE B 1 273 ? 10.950  3.924   -56.556 1.00 49.41  ? 270 ILE B CD1 1 
ATOM   6207 N N   . ALA B 1 274 ? 11.706  8.663   -59.445 1.00 45.66  ? 271 ALA B N   1 
ATOM   6208 C CA  . ALA B 1 274 ? 12.225  9.468   -60.555 1.00 39.87  ? 271 ALA B CA  1 
ATOM   6209 C C   . ALA B 1 274 ? 12.727  10.832  -60.067 1.00 41.65  ? 271 ALA B C   1 
ATOM   6210 O O   . ALA B 1 274 ? 13.861  11.266  -60.383 1.00 41.42  ? 271 ALA B O   1 
ATOM   6211 C CB  . ALA B 1 274 ? 11.153  9.647   -61.616 1.00 45.99  ? 271 ALA B CB  1 
ATOM   6212 N N   . CYS B 1 275 ? 11.887  11.495  -59.272 1.00 42.42  ? 272 CYS B N   1 
ATOM   6213 C CA  . CYS B 1 275 ? 12.252  12.788  -58.709 1.00 40.71  ? 272 CYS B CA  1 
ATOM   6214 C C   . CYS B 1 275 ? 13.484  12.666  -57.814 1.00 43.22  ? 272 CYS B C   1 
ATOM   6215 O O   . CYS B 1 275 ? 14.377  13.513  -57.867 1.00 40.75  ? 272 CYS B O   1 
ATOM   6216 C CB  . CYS B 1 275 ? 11.087  13.392  -57.924 1.00 47.28  ? 272 CYS B CB  1 
ATOM   6217 S SG  . CYS B 1 275 ? 11.511  14.936  -57.077 1.00 58.88  ? 272 CYS B SG  1 
ATOM   6218 N N   . LEU B 1 276 ? 13.536  11.614  -57.000 1.00 43.80  ? 273 LEU B N   1 
ATOM   6219 C CA  . LEU B 1 276 ? 14.715  11.380  -56.167 1.00 42.45  ? 273 LEU B CA  1 
ATOM   6220 C C   . LEU B 1 276 ? 15.979  11.211  -57.018 1.00 40.01  ? 273 LEU B C   1 
ATOM   6221 O O   . LEU B 1 276 ? 17.049  11.705  -56.663 1.00 39.42  ? 273 LEU B O   1 
ATOM   6222 C CB  . LEU B 1 276 ? 14.516  10.153  -55.274 1.00 41.93  ? 273 LEU B CB  1 
ATOM   6223 C CG  . LEU B 1 276 ? 13.685  10.353  -54.002 1.00 40.50  ? 273 LEU B CG  1 
ATOM   6224 C CD1 . LEU B 1 276 ? 13.608  9.053   -53.232 1.00 39.79  ? 273 LEU B CD1 1 
ATOM   6225 C CD2 . LEU B 1 276 ? 14.273  11.453  -53.135 1.00 38.92  ? 273 LEU B CD2 1 
ATOM   6226 N N   . ARG B 1 277 ? 15.850  10.523  -58.146 1.00 38.83  ? 274 ARG B N   1 
ATOM   6227 C CA  . ARG B 1 277 ? 16.983  10.322  -59.040 1.00 41.86  ? 274 ARG B CA  1 
ATOM   6228 C C   . ARG B 1 277 ? 17.413  11.627  -59.707 1.00 42.68  ? 274 ARG B C   1 
ATOM   6229 O O   . ARG B 1 277 ? 18.541  11.730  -60.195 1.00 40.59  ? 274 ARG B O   1 
ATOM   6230 C CB  . ARG B 1 277 ? 16.658  9.269   -60.106 1.00 41.53  ? 274 ARG B CB  1 
ATOM   6231 C CG  . ARG B 1 277 ? 16.591  7.849   -59.564 1.00 39.20  ? 274 ARG B CG  1 
ATOM   6232 C CD  . ARG B 1 277 ? 16.582  6.831   -60.690 1.00 39.30  ? 274 ARG B CD  1 
ATOM   6233 N NE  . ARG B 1 277 ? 15.538  7.131   -61.660 1.00 45.94  ? 274 ARG B NE  1 
ATOM   6234 C CZ  . ARG B 1 277 ? 14.423  6.425   -61.803 1.00 46.25  ? 274 ARG B CZ  1 
ATOM   6235 N NH1 . ARG B 1 277 ? 14.210  5.357   -61.048 1.00 44.58  ? 274 ARG B NH1 1 
ATOM   6236 N NH2 . ARG B 1 277 ? 13.527  6.781   -62.713 1.00 45.08  ? 274 ARG B NH2 1 
ATOM   6237 N N   . THR B 1 278 ? 16.532  12.626  -59.734 1.00 41.48  ? 275 THR B N   1 
ATOM   6238 C CA  . THR B 1 278 ? 16.960  13.935  -60.251 1.00 40.49  ? 275 THR B CA  1 
ATOM   6239 C C   . THR B 1 278 ? 17.830  14.744  -59.279 1.00 42.02  ? 275 THR B C   1 
ATOM   6240 O O   . THR B 1 278 ? 18.516  15.678  -59.693 1.00 39.91  ? 275 THR B O   1 
ATOM   6241 C CB  . THR B 1 278 ? 15.764  14.827  -60.637 1.00 41.37  ? 275 THR B CB  1 
ATOM   6242 O OG1 . THR B 1 278 ? 15.070  15.242  -59.452 1.00 44.22  ? 275 THR B OG1 1 
ATOM   6243 C CG2 . THR B 1 278 ? 14.818  14.087  -61.567 1.00 40.59  ? 275 THR B CG2 1 
ATOM   6244 N N   . ARG B 1 279 ? 17.802  14.404  -57.993 1.00 38.01  ? 276 ARG B N   1 
ATOM   6245 C CA  . ARG B 1 279 ? 18.489  15.213  -56.988 1.00 39.54  ? 276 ARG B CA  1 
ATOM   6246 C C   . ARG B 1 279 ? 19.987  14.934  -56.899 1.00 35.03  ? 276 ARG B C   1 
ATOM   6247 O O   . ARG B 1 279 ? 20.413  13.780  -56.932 1.00 42.65  ? 276 ARG B O   1 
ATOM   6248 C CB  . ARG B 1 279 ? 17.856  14.998  -55.605 1.00 41.42  ? 276 ARG B CB  1 
ATOM   6249 C CG  . ARG B 1 279 ? 16.413  15.460  -55.503 1.00 45.40  ? 276 ARG B CG  1 
ATOM   6250 C CD  . ARG B 1 279 ? 16.293  16.977  -55.593 1.00 49.96  ? 276 ARG B CD  1 
ATOM   6251 N NE  . ARG B 1 279 ? 14.922  17.421  -55.359 1.00 52.88  ? 276 ARG B NE  1 
ATOM   6252 C CZ  . ARG B 1 279 ? 14.059  17.737  -56.319 1.00 54.38  ? 276 ARG B CZ  1 
ATOM   6253 N NH1 . ARG B 1 279 ? 14.424  17.670  -57.592 1.00 52.46  ? 276 ARG B NH1 1 
ATOM   6254 N NH2 . ARG B 1 279 ? 12.829  18.125  -56.006 1.00 53.18  ? 276 ARG B NH2 1 
ATOM   6255 N N   . PRO B 1 280 ? 20.790  15.999  -56.757 1.00 33.11  ? 277 PRO B N   1 
ATOM   6256 C CA  . PRO B 1 280 ? 22.227  15.874  -56.495 1.00 37.37  ? 277 PRO B CA  1 
ATOM   6257 C C   . PRO B 1 280 ? 22.482  15.065  -55.220 1.00 39.59  ? 277 PRO B C   1 
ATOM   6258 O O   . PRO B 1 280 ? 21.712  15.183  -54.266 1.00 38.56  ? 277 PRO B O   1 
ATOM   6259 C CB  . PRO B 1 280 ? 22.686  17.328  -56.325 1.00 37.10  ? 277 PRO B CB  1 
ATOM   6260 C CG  . PRO B 1 280 ? 21.650  18.144  -57.010 1.00 39.42  ? 277 PRO B CG  1 
ATOM   6261 C CD  . PRO B 1 280 ? 20.360  17.406  -56.815 1.00 37.75  ? 277 PRO B CD  1 
ATOM   6262 N N   . ALA B 1 281 ? 23.547  14.269  -55.211 1.00 34.02  ? 278 ALA B N   1 
ATOM   6263 C CA  . ALA B 1 281 ? 23.819  13.330  -54.123 1.00 38.85  ? 278 ALA B CA  1 
ATOM   6264 C C   . ALA B 1 281 ? 23.869  14.004  -52.745 1.00 36.22  ? 278 ALA B C   1 
ATOM   6265 O O   . ALA B 1 281 ? 23.363  13.460  -51.741 1.00 39.13  ? 278 ALA B O   1 
ATOM   6266 C CB  . ALA B 1 281 ? 25.129  12.592  -54.396 1.00 30.61  ? 278 ALA B CB  1 
ATOM   6267 N N   . GLN B 1 282 ? 24.464  15.193  -52.702 1.00 35.28  ? 279 GLN B N   1 
ATOM   6268 C CA  . GLN B 1 282 ? 24.656  15.891  -51.436 1.00 38.11  ? 279 GLN B CA  1 
ATOM   6269 C C   . GLN B 1 282 ? 23.345  16.418  -50.858 1.00 43.00  ? 279 GLN B C   1 
ATOM   6270 O O   . GLN B 1 282 ? 23.264  16.661  -49.663 1.00 41.14  ? 279 GLN B O   1 
ATOM   6271 C CB  . GLN B 1 282 ? 25.661  17.036  -51.586 1.00 38.44  ? 279 GLN B CB  1 
ATOM   6272 C CG  . GLN B 1 282 ? 26.153  17.609  -50.242 1.00 38.55  ? 279 GLN B CG  1 
ATOM   6273 C CD  . GLN B 1 282 ? 26.746  16.547  -49.330 1.00 41.70  ? 279 GLN B CD  1 
ATOM   6274 O OE1 . GLN B 1 282 ? 27.509  15.691  -49.771 1.00 39.46  ? 279 GLN B OE1 1 
ATOM   6275 N NE2 . GLN B 1 282 ? 26.391  16.598  -48.049 1.00 38.80  ? 279 GLN B NE2 1 
ATOM   6276 N N   . ASP B 1 283 ? 22.324  16.606  -51.687 1.00 40.56  ? 280 ASP B N   1 
ATOM   6277 C CA  . ASP B 1 283 ? 21.001  16.941  -51.162 1.00 45.00  ? 280 ASP B CA  1 
ATOM   6278 C C   . ASP B 1 283 ? 20.522  15.815  -50.240 1.00 43.07  ? 280 ASP B C   1 
ATOM   6279 O O   . ASP B 1 283 ? 20.191  16.025  -49.051 1.00 44.73  ? 280 ASP B O   1 
ATOM   6280 C CB  . ASP B 1 283 ? 19.995  17.156  -52.299 1.00 42.43  ? 280 ASP B CB  1 
ATOM   6281 C CG  . ASP B 1 283 ? 20.119  18.526  -52.951 1.00 53.50  ? 280 ASP B CG  1 
ATOM   6282 O OD1 . ASP B 1 283 ? 21.180  19.173  -52.811 1.00 54.25  ? 280 ASP B OD1 1 
ATOM   6283 O OD2 . ASP B 1 283 ? 19.151  18.952  -53.617 1.00 56.36  ? 280 ASP B OD2 1 
ATOM   6284 N N   . LEU B 1 284 ? 20.506  14.610  -50.808 1.00 41.65  ? 281 LEU B N   1 
ATOM   6285 C CA  . LEU B 1 284 ? 20.073  13.420  -50.089 1.00 45.51  ? 281 LEU B CA  1 
ATOM   6286 C C   . LEU B 1 284 ? 20.896  13.228  -48.821 1.00 44.00  ? 281 LEU B C   1 
ATOM   6287 O O   . LEU B 1 284 ? 20.337  13.001  -47.739 1.00 41.57  ? 281 LEU B O   1 
ATOM   6288 C CB  . LEU B 1 284 ? 20.178  12.182  -50.977 1.00 39.44  ? 281 LEU B CB  1 
ATOM   6289 C CG  . LEU B 1 284 ? 19.538  12.239  -52.367 1.00 41.25  ? 281 LEU B CG  1 
ATOM   6290 C CD1 . LEU B 1 284 ? 19.560  10.856  -53.003 1.00 35.99  ? 281 LEU B CD1 1 
ATOM   6291 C CD2 . LEU B 1 284 ? 18.121  12.791  -52.315 1.00 40.97  ? 281 LEU B CD2 1 
ATOM   6292 N N   . VAL B 1 285 ? 22.220  13.328  -48.952 1.00 41.66  ? 282 VAL B N   1 
ATOM   6293 C CA  . VAL B 1 285 ? 23.087  13.219  -47.777 1.00 42.35  ? 282 VAL B CA  1 
ATOM   6294 C C   . VAL B 1 285 ? 22.731  14.276  -46.725 1.00 46.16  ? 282 VAL B C   1 
ATOM   6295 O O   . VAL B 1 285 ? 22.641  13.976  -45.531 1.00 42.77  ? 282 VAL B O   1 
ATOM   6296 C CB  . VAL B 1 285 ? 24.578  13.348  -48.154 1.00 41.23  ? 282 VAL B CB  1 
ATOM   6297 C CG1 . VAL B 1 285 ? 25.431  13.559  -46.912 1.00 37.81  ? 282 VAL B CG1 1 
ATOM   6298 C CG2 . VAL B 1 285 ? 25.042  12.114  -48.917 1.00 38.69  ? 282 VAL B CG2 1 
ATOM   6299 N N   . ASP B 1 286 ? 22.499  15.503  -47.184 1.00 42.24  ? 283 ASP B N   1 
ATOM   6300 C CA  . ASP B 1 286 ? 22.153  16.618  -46.307 1.00 45.22  ? 283 ASP B CA  1 
ATOM   6301 C C   . ASP B 1 286 ? 20.879  16.354  -45.518 1.00 44.73  ? 283 ASP B C   1 
ATOM   6302 O O   . ASP B 1 286 ? 20.689  16.926  -44.447 1.00 45.79  ? 283 ASP B O   1 
ATOM   6303 C CB  . ASP B 1 286 ? 21.980  17.920  -47.104 1.00 42.88  ? 283 ASP B CB  1 
ATOM   6304 C CG  . ASP B 1 286 ? 23.302  18.586  -47.445 1.00 41.00  ? 283 ASP B CG  1 
ATOM   6305 O OD1 . ASP B 1 286 ? 24.357  18.105  -46.983 1.00 44.66  ? 283 ASP B OD1 1 
ATOM   6306 O OD2 . ASP B 1 286 ? 23.282  19.599  -48.173 1.00 47.40  ? 283 ASP B OD2 1 
ATOM   6307 N N   . HIS B 1 287 ? 19.996  15.509  -46.042 1.00 44.85  ? 284 HIS B N   1 
ATOM   6308 C CA  . HIS B 1 287 ? 18.742  15.269  -45.326 1.00 43.00  ? 284 HIS B CA  1 
ATOM   6309 C C   . HIS B 1 287 ? 18.566  13.872  -44.721 1.00 47.21  ? 284 HIS B C   1 
ATOM   6310 O O   . HIS B 1 287 ? 17.549  13.610  -44.080 1.00 46.57  ? 284 HIS B O   1 
ATOM   6311 C CB  . HIS B 1 287 ? 17.558  15.562  -46.246 1.00 46.91  ? 284 HIS B CB  1 
ATOM   6312 C CG  . HIS B 1 287 ? 17.379  17.018  -46.544 1.00 53.12  ? 284 HIS B CG  1 
ATOM   6313 N ND1 . HIS B 1 287 ? 16.630  17.853  -45.743 1.00 53.06  ? 284 HIS B ND1 1 
ATOM   6314 C CD2 . HIS B 1 287 ? 17.866  17.790  -47.543 1.00 46.82  ? 284 HIS B CD2 1 
ATOM   6315 C CE1 . HIS B 1 287 ? 16.656  19.077  -46.241 1.00 52.52  ? 284 HIS B CE1 1 
ATOM   6316 N NE2 . HIS B 1 287 ? 17.399  19.066  -47.333 1.00 54.86  ? 284 HIS B NE2 1 
ATOM   6317 N N   . GLU B 1 288 ? 19.537  12.982  -44.899 1.00 44.52  ? 285 GLU B N   1 
ATOM   6318 C CA  . GLU B 1 288 ? 19.337  11.599  -44.467 1.00 45.34  ? 285 GLU B CA  1 
ATOM   6319 C C   . GLU B 1 288 ? 19.234  11.431  -42.939 1.00 43.25  ? 285 GLU B C   1 
ATOM   6320 O O   . GLU B 1 288 ? 18.617  10.481  -42.466 1.00 39.18  ? 285 GLU B O   1 
ATOM   6321 C CB  . GLU B 1 288 ? 20.448  10.700  -45.017 1.00 44.13  ? 285 GLU B CB  1 
ATOM   6322 C CG  . GLU B 1 288 ? 21.814  10.877  -44.378 1.00 43.98  ? 285 GLU B CG  1 
ATOM   6323 C CD  . GLU B 1 288 ? 22.834  9.888   -44.923 1.00 50.11  ? 285 GLU B CD  1 
ATOM   6324 O OE1 . GLU B 1 288 ? 24.042  10.202  -44.906 1.00 55.13  ? 285 GLU B OE1 1 
ATOM   6325 O OE2 . GLU B 1 288 ? 22.427  8.798   -45.378 1.00 45.53  ? 285 GLU B OE2 1 
ATOM   6326 N N   . TRP B 1 289 ? 19.811  12.351  -42.171 1.00 45.28  ? 286 TRP B N   1 
ATOM   6327 C CA  . TRP B 1 289 ? 19.799  12.218  -40.711 1.00 50.52  ? 286 TRP B CA  1 
ATOM   6328 C C   . TRP B 1 289 ? 18.555  12.793  -40.047 1.00 48.27  ? 286 TRP B C   1 
ATOM   6329 O O   . TRP B 1 289 ? 18.460  12.817  -38.823 1.00 55.75  ? 286 TRP B O   1 
ATOM   6330 C CB  . TRP B 1 289 ? 21.043  12.872  -40.108 1.00 46.09  ? 286 TRP B CB  1 
ATOM   6331 C CG  . TRP B 1 289 ? 22.267  12.072  -40.362 1.00 52.98  ? 286 TRP B CG  1 
ATOM   6332 C CD1 . TRP B 1 289 ? 23.305  12.392  -41.190 1.00 56.40  ? 286 TRP B CD1 1 
ATOM   6333 C CD2 . TRP B 1 289 ? 22.566  10.783  -39.820 1.00 53.37  ? 286 TRP B CD2 1 
ATOM   6334 N NE1 . TRP B 1 289 ? 24.243  11.387  -41.179 1.00 55.66  ? 286 TRP B NE1 1 
ATOM   6335 C CE2 . TRP B 1 289 ? 23.812  10.388  -40.346 1.00 55.17  ? 286 TRP B CE2 1 
ATOM   6336 C CE3 . TRP B 1 289 ? 21.904  9.926   -38.933 1.00 53.53  ? 286 TRP B CE3 1 
ATOM   6337 C CZ2 . TRP B 1 289 ? 24.412  9.175   -40.012 1.00 55.24  ? 286 TRP B CZ2 1 
ATOM   6338 C CZ3 . TRP B 1 289 ? 22.500  8.724   -38.601 1.00 53.46  ? 286 TRP B CZ3 1 
ATOM   6339 C CH2 . TRP B 1 289 ? 23.741  8.358   -39.140 1.00 55.77  ? 286 TRP B CH2 1 
ATOM   6340 N N   . HIS B 1 290 ? 17.597  13.242  -40.845 1.00 47.81  ? 287 HIS B N   1 
ATOM   6341 C CA  . HIS B 1 290 ? 16.413  13.891  -40.298 1.00 47.93  ? 287 HIS B CA  1 
ATOM   6342 C C   . HIS B 1 290 ? 15.175  13.003  -40.358 1.00 47.61  ? 287 HIS B C   1 
ATOM   6343 O O   . HIS B 1 290 ? 14.062  13.479  -40.141 1.00 51.93  ? 287 HIS B O   1 
ATOM   6344 C CB  . HIS B 1 290 ? 16.140  15.205  -41.040 1.00 49.23  ? 287 HIS B CB  1 
ATOM   6345 C CG  . HIS B 1 290 ? 17.257  16.198  -40.950 1.00 53.80  ? 287 HIS B CG  1 
ATOM   6346 N ND1 . HIS B 1 290 ? 18.113  16.263  -39.870 1.00 57.11  ? 287 HIS B ND1 1 
ATOM   6347 C CD2 . HIS B 1 290 ? 17.660  17.167  -41.805 1.00 56.17  ? 287 HIS B CD2 1 
ATOM   6348 C CE1 . HIS B 1 290 ? 18.993  17.227  -40.064 1.00 57.62  ? 287 HIS B CE1 1 
ATOM   6349 N NE2 . HIS B 1 290 ? 18.742  17.792  -41.233 1.00 59.61  ? 287 HIS B NE2 1 
ATOM   6350 N N   . VAL B 1 291 ? 15.356  11.717  -40.649 1.00 43.46  ? 288 VAL B N   1 
ATOM   6351 C CA  . VAL B 1 291 ? 14.209  10.820  -40.782 1.00 45.18  ? 288 VAL B CA  1 
ATOM   6352 C C   . VAL B 1 291 ? 14.108  9.760   -39.674 1.00 46.62  ? 288 VAL B C   1 
ATOM   6353 O O   . VAL B 1 291 ? 13.167  8.963   -39.665 1.00 45.56  ? 288 VAL B O   1 
ATOM   6354 C CB  . VAL B 1 291 ? 14.221  10.097  -42.143 1.00 43.16  ? 288 VAL B CB  1 
ATOM   6355 C CG1 . VAL B 1 291 ? 14.323  11.109  -43.283 1.00 44.65  ? 288 VAL B CG1 1 
ATOM   6356 C CG2 . VAL B 1 291 ? 15.363  9.101   -42.204 1.00 43.12  ? 288 VAL B CG2 1 
ATOM   6357 N N   . LEU B 1 292 ? 15.067  9.743   -38.752 1.00 46.02  ? 289 LEU B N   1 
ATOM   6358 C CA  . LEU B 1 292 ? 15.000  8.828   -37.608 1.00 51.71  ? 289 LEU B CA  1 
ATOM   6359 C C   . LEU B 1 292 ? 13.773  9.134   -36.746 1.00 51.79  ? 289 LEU B C   1 
ATOM   6360 O O   . LEU B 1 292 ? 13.453  10.299  -36.516 1.00 51.19  ? 289 LEU B O   1 
ATOM   6361 C CB  . LEU B 1 292 ? 16.273  8.918   -36.759 1.00 51.02  ? 289 LEU B CB  1 
ATOM   6362 C CG  . LEU B 1 292 ? 17.543  8.256   -37.300 1.00 49.68  ? 289 LEU B CG  1 
ATOM   6363 C CD1 . LEU B 1 292 ? 18.690  8.419   -36.306 1.00 48.42  ? 289 LEU B CD1 1 
ATOM   6364 C CD2 . LEU B 1 292 ? 17.297  6.786   -37.607 1.00 45.07  ? 289 LEU B CD2 1 
ATOM   6365 N N   . PRO B 1 293 ? 13.085  8.086   -36.264 1.00 53.49  ? 290 PRO B N   1 
ATOM   6366 C CA  . PRO B 1 293 ? 11.830  8.269   -35.520 1.00 53.36  ? 290 PRO B CA  1 
ATOM   6367 C C   . PRO B 1 293 ? 11.999  8.931   -34.144 1.00 53.02  ? 290 PRO B C   1 
ATOM   6368 O O   . PRO B 1 293 ? 11.105  9.666   -33.725 1.00 55.47  ? 290 PRO B O   1 
ATOM   6369 C CB  . PRO B 1 293 ? 11.299  6.837   -35.375 1.00 52.39  ? 290 PRO B CB  1 
ATOM   6370 C CG  . PRO B 1 293 ? 12.508  5.976   -35.457 1.00 52.80  ? 290 PRO B CG  1 
ATOM   6371 C CD  . PRO B 1 293 ? 13.434  6.663   -36.419 1.00 49.97  ? 290 PRO B CD  1 
ATOM   6372 N N   . GLN B 1 294 ? 13.106  8.676   -33.453 1.00 48.90  ? 291 GLN B N   1 
ATOM   6373 C CA  . GLN B 1 294 ? 13.343  9.308   -32.155 1.00 54.87  ? 291 GLN B CA  1 
ATOM   6374 C C   . GLN B 1 294 ? 14.760  9.850   -32.053 1.00 54.75  ? 291 GLN B C   1 
ATOM   6375 O O   . GLN B 1 294 ? 15.608  9.568   -32.902 1.00 52.57  ? 291 GLN B O   1 
ATOM   6376 C CB  . GLN B 1 294 ? 13.107  8.326   -30.995 1.00 52.13  ? 291 GLN B CB  1 
ATOM   6377 C CG  . GLN B 1 294 ? 11.876  7.446   -31.111 1.00 51.45  ? 291 GLN B CG  1 
ATOM   6378 C CD  . GLN B 1 294 ? 12.177  6.118   -31.783 1.00 55.30  ? 291 GLN B CD  1 
ATOM   6379 O OE1 . GLN B 1 294 ? 13.332  5.811   -32.087 1.00 56.85  ? 291 GLN B OE1 1 
ATOM   6380 N NE2 . GLN B 1 294 ? 11.137  5.324   -32.023 1.00 56.68  ? 291 GLN B NE2 1 
ATOM   6381 N N   . GLU B 1 295 ? 15.006  10.631  -31.005 1.00 50.20  ? 292 GLU B N   1 
ATOM   6382 C CA  . GLU B 1 295 ? 16.364  10.975  -30.613 1.00 54.55  ? 292 GLU B CA  1 
ATOM   6383 C C   . GLU B 1 295 ? 17.050  9.694   -30.155 1.00 54.35  ? 292 GLU B C   1 
ATOM   6384 O O   . GLU B 1 295 ? 16.518  8.970   -29.310 1.00 55.19  ? 292 GLU B O   1 
ATOM   6385 C CB  . GLU B 1 295 ? 16.371  12.025  -29.497 1.00 53.34  ? 292 GLU B CB  1 
ATOM   6386 C CG  . GLU B 1 295 ? 17.745  12.609  -29.198 1.00 59.26  ? 292 GLU B CG  1 
ATOM   6387 C CD  . GLU B 1 295 ? 17.744  13.526  -27.984 1.00 69.21  ? 292 GLU B CD  1 
ATOM   6388 O OE1 . GLU B 1 295 ? 16.675  13.690  -27.357 1.00 65.41  ? 292 GLU B OE1 1 
ATOM   6389 O OE2 . GLU B 1 295 ? 18.816  14.082  -27.655 1.00 69.91  ? 292 GLU B OE2 1 
ATOM   6390 N N   . SER B 1 296 ? 18.221  9.406   -30.713 1.00 50.48  ? 293 SER B N   1 
ATOM   6391 C CA  . SER B 1 296 ? 18.883  8.138   -30.431 1.00 50.76  ? 293 SER B CA  1 
ATOM   6392 C C   . SER B 1 296 ? 20.370  8.152   -30.774 1.00 50.09  ? 293 SER B C   1 
ATOM   6393 O O   . SER B 1 296 ? 20.859  9.068   -31.440 1.00 54.36  ? 293 SER B O   1 
ATOM   6394 C CB  . SER B 1 296 ? 18.187  7.010   -31.199 1.00 51.03  ? 293 SER B CB  1 
ATOM   6395 O OG  . SER B 1 296 ? 18.078  7.326   -32.579 1.00 50.45  ? 293 SER B OG  1 
ATOM   6396 N N   . ILE B 1 297 ? 21.084  7.138   -30.295 1.00 44.79  ? 294 ILE B N   1 
ATOM   6397 C CA  . ILE B 1 297 ? 22.427  6.843   -30.783 1.00 45.99  ? 294 ILE B CA  1 
ATOM   6398 C C   . ILE B 1 297 ? 22.469  5.381   -31.221 1.00 44.47  ? 294 ILE B C   1 
ATOM   6399 O O   . ILE B 1 297 ? 21.574  4.604   -30.887 1.00 42.63  ? 294 ILE B O   1 
ATOM   6400 C CB  . ILE B 1 297 ? 23.520  7.117   -29.729 1.00 51.22  ? 294 ILE B CB  1 
ATOM   6401 C CG1 . ILE B 1 297 ? 23.255  6.328   -28.443 1.00 43.66  ? 294 ILE B CG1 1 
ATOM   6402 C CG2 . ILE B 1 297 ? 23.623  8.611   -29.439 1.00 50.68  ? 294 ILE B CG2 1 
ATOM   6403 C CD1 . ILE B 1 297 ? 24.404  6.386   -27.465 1.00 42.90  ? 294 ILE B CD1 1 
ATOM   6404 N N   . PHE B 1 298 ? 23.502  5.019   -31.976 1.00 45.19  ? 295 PHE B N   1 
ATOM   6405 C CA  . PHE B 1 298 ? 23.603  3.699   -32.598 1.00 44.51  ? 295 PHE B CA  1 
ATOM   6406 C C   . PHE B 1 298 ? 22.339  3.371   -33.406 1.00 39.11  ? 295 PHE B C   1 
ATOM   6407 O O   . PHE B 1 298 ? 21.892  2.226   -33.431 1.00 39.51  ? 295 PHE B O   1 
ATOM   6408 C CB  . PHE B 1 298 ? 23.849  2.589   -31.557 1.00 44.20  ? 295 PHE B CB  1 
ATOM   6409 C CG  . PHE B 1 298 ? 24.784  1.500   -32.039 1.00 46.13  ? 295 PHE B CG  1 
ATOM   6410 C CD1 . PHE B 1 298 ? 25.925  1.157   -31.318 1.00 42.23  ? 295 PHE B CD1 1 
ATOM   6411 C CD2 . PHE B 1 298 ? 24.562  0.882   -33.265 1.00 37.93  ? 295 PHE B CD2 1 
ATOM   6412 C CE1 . PHE B 1 298 ? 26.784  0.164   -31.785 1.00 43.73  ? 295 PHE B CE1 1 
ATOM   6413 C CE2 . PHE B 1 298 ? 25.411  -0.089  -33.735 1.00 39.66  ? 295 PHE B CE2 1 
ATOM   6414 C CZ  . PHE B 1 298 ? 26.522  -0.457  -32.998 1.00 37.68  ? 295 PHE B CZ  1 
ATOM   6415 N N   . ARG B 1 299 ? 21.749  4.378   -34.044 1.00 40.82  ? 296 ARG B N   1 
ATOM   6416 C CA  . ARG B 1 299 ? 20.628  4.156   -34.959 1.00 37.62  ? 296 ARG B CA  1 
ATOM   6417 C C   . ARG B 1 299 ? 20.900  4.872   -36.275 1.00 41.46  ? 296 ARG B C   1 
ATOM   6418 O O   . ARG B 1 299 ? 21.324  6.029   -36.289 1.00 39.33  ? 296 ARG B O   1 
ATOM   6419 C CB  . ARG B 1 299 ? 19.306  4.638   -34.355 1.00 41.18  ? 296 ARG B CB  1 
ATOM   6420 C CG  . ARG B 1 299 ? 18.863  3.887   -33.100 1.00 41.96  ? 296 ARG B CG  1 
ATOM   6421 C CD  . ARG B 1 299 ? 18.479  2.433   -33.390 1.00 42.66  ? 296 ARG B CD  1 
ATOM   6422 N NE  . ARG B 1 299 ? 17.998  1.764   -32.179 1.00 43.35  ? 296 ARG B NE  1 
ATOM   6423 C CZ  . ARG B 1 299 ? 18.781  1.125   -31.314 1.00 43.91  ? 296 ARG B CZ  1 
ATOM   6424 N NH1 . ARG B 1 299 ? 20.088  1.057   -31.530 1.00 39.93  ? 296 ARG B NH1 1 
ATOM   6425 N NH2 . ARG B 1 299 ? 18.259  0.556   -30.233 1.00 41.54  ? 296 ARG B NH2 1 
ATOM   6426 N N   . PHE B 1 300 ? 20.659  4.180   -37.381 1.00 37.67  ? 297 PHE B N   1 
ATOM   6427 C CA  . PHE B 1 300 ? 21.014  4.708   -38.690 1.00 41.84  ? 297 PHE B CA  1 
ATOM   6428 C C   . PHE B 1 300 ? 19.801  4.684   -39.614 1.00 38.33  ? 297 PHE B C   1 
ATOM   6429 O O   . PHE B 1 300 ? 18.999  3.748   -39.588 1.00 36.24  ? 297 PHE B O   1 
ATOM   6430 C CB  . PHE B 1 300 ? 22.185  3.912   -39.270 1.00 37.95  ? 297 PHE B CB  1 
ATOM   6431 C CG  . PHE B 1 300 ? 23.195  3.488   -38.225 1.00 41.61  ? 297 PHE B CG  1 
ATOM   6432 C CD1 . PHE B 1 300 ? 24.029  4.421   -37.625 1.00 39.12  ? 297 PHE B CD1 1 
ATOM   6433 C CD2 . PHE B 1 300 ? 23.295  2.162   -37.832 1.00 37.30  ? 297 PHE B CD2 1 
ATOM   6434 C CE1 . PHE B 1 300 ? 24.950  4.037   -36.653 1.00 41.45  ? 297 PHE B CE1 1 
ATOM   6435 C CE2 . PHE B 1 300 ? 24.215  1.771   -36.861 1.00 41.49  ? 297 PHE B CE2 1 
ATOM   6436 C CZ  . PHE B 1 300 ? 25.043  2.712   -36.275 1.00 40.99  ? 297 PHE B CZ  1 
ATOM   6437 N N   . SER B 1 301 ? 19.671  5.727   -40.424 1.00 41.27  ? 298 SER B N   1 
ATOM   6438 C CA  . SER B 1 301 ? 18.444  5.967   -41.171 1.00 39.16  ? 298 SER B CA  1 
ATOM   6439 C C   . SER B 1 301 ? 18.155  4.934   -42.259 1.00 37.51  ? 298 SER B C   1 
ATOM   6440 O O   . SER B 1 301 ? 17.025  4.459   -42.379 1.00 37.06  ? 298 SER B O   1 
ATOM   6441 C CB  . SER B 1 301 ? 18.487  7.362   -41.791 1.00 42.14  ? 298 SER B CB  1 
ATOM   6442 O OG  . SER B 1 301 ? 18.622  8.351   -40.786 1.00 42.51  ? 298 SER B OG  1 
ATOM   6443 N N   . PHE B 1 302 ? 19.162  4.583   -43.051 1.00 34.34  ? 299 PHE B N   1 
ATOM   6444 C CA  . PHE B 1 302 ? 18.927  3.683   -44.175 1.00 32.28  ? 299 PHE B CA  1 
ATOM   6445 C C   . PHE B 1 302 ? 19.796  2.441   -44.090 1.00 30.17  ? 299 PHE B C   1 
ATOM   6446 O O   . PHE B 1 302 ? 21.011  2.483   -44.277 1.00 32.08  ? 299 PHE B O   1 
ATOM   6447 C CB  . PHE B 1 302 ? 19.126  4.439   -45.495 1.00 35.04  ? 299 PHE B CB  1 
ATOM   6448 C CG  . PHE B 1 302 ? 18.140  5.552   -45.676 1.00 33.06  ? 299 PHE B CG  1 
ATOM   6449 C CD1 . PHE B 1 302 ? 16.879  5.295   -46.184 1.00 34.45  ? 299 PHE B CD1 1 
ATOM   6450 C CD2 . PHE B 1 302 ? 18.445  6.840   -45.273 1.00 32.17  ? 299 PHE B CD2 1 
ATOM   6451 C CE1 . PHE B 1 302 ? 15.953  6.308   -46.322 1.00 35.13  ? 299 PHE B CE1 1 
ATOM   6452 C CE2 . PHE B 1 302 ? 17.519  7.862   -45.408 1.00 34.06  ? 299 PHE B CE2 1 
ATOM   6453 C CZ  . PHE B 1 302 ? 16.273  7.593   -45.933 1.00 36.05  ? 299 PHE B CZ  1 
ATOM   6454 N N   . VAL B 1 303 ? 19.134  1.331   -43.782 1.00 32.09  ? 300 VAL B N   1 
ATOM   6455 C CA  . VAL B 1 303 ? 19.782  0.077   -43.437 1.00 29.22  ? 300 VAL B CA  1 
ATOM   6456 C C   . VAL B 1 303 ? 19.048  -1.045  -44.157 1.00 31.16  ? 300 VAL B C   1 
ATOM   6457 O O   . VAL B 1 303 ? 18.008  -0.798  -44.767 1.00 31.85  ? 300 VAL B O   1 
ATOM   6458 C CB  . VAL B 1 303 ? 19.771  -0.152  -41.897 1.00 32.45  ? 300 VAL B CB  1 
ATOM   6459 C CG1 . VAL B 1 303 ? 20.566  0.934   -41.192 1.00 31.22  ? 300 VAL B CG1 1 
ATOM   6460 C CG2 . VAL B 1 303 ? 18.346  -0.199  -41.371 1.00 30.93  ? 300 VAL B CG2 1 
ATOM   6461 N N   . PRO B 1 304 ? 19.584  -2.277  -44.111 1.00 30.83  ? 301 PRO B N   1 
ATOM   6462 C CA  . PRO B 1 304 ? 18.852  -3.377  -44.744 1.00 32.22  ? 301 PRO B CA  1 
ATOM   6463 C C   . PRO B 1 304 ? 17.391  -3.481  -44.307 1.00 36.20  ? 301 PRO B C   1 
ATOM   6464 O O   . PRO B 1 304 ? 17.063  -3.255  -43.139 1.00 35.32  ? 301 PRO B O   1 
ATOM   6465 C CB  . PRO B 1 304 ? 19.639  -4.607  -44.302 1.00 31.43  ? 301 PRO B CB  1 
ATOM   6466 C CG  . PRO B 1 304 ? 21.037  -4.108  -44.177 1.00 31.68  ? 301 PRO B CG  1 
ATOM   6467 C CD  . PRO B 1 304 ? 20.940  -2.690  -43.697 1.00 30.11  ? 301 PRO B CD  1 
ATOM   6468 N N   . VAL B 1 305 ? 16.523  -3.817  -45.253 1.00 33.50  ? 302 VAL B N   1 
ATOM   6469 C CA  . VAL B 1 305 ? 15.093  -3.893  -44.991 1.00 35.90  ? 302 VAL B CA  1 
ATOM   6470 C C   . VAL B 1 305 ? 14.625  -5.341  -45.068 1.00 34.15  ? 302 VAL B C   1 
ATOM   6471 O O   . VAL B 1 305 ? 15.087  -6.101  -45.915 1.00 35.37  ? 302 VAL B O   1 
ATOM   6472 C CB  . VAL B 1 305 ? 14.286  -3.022  -45.987 1.00 36.99  ? 302 VAL B CB  1 
ATOM   6473 C CG1 . VAL B 1 305 ? 14.559  -3.444  -47.439 1.00 35.34  ? 302 VAL B CG1 1 
ATOM   6474 C CG2 . VAL B 1 305 ? 12.798  -3.083  -45.676 1.00 38.47  ? 302 VAL B CG2 1 
ATOM   6475 N N   . VAL B 1 306 ? 13.743  -5.733  -44.151 1.00 37.53  ? 303 VAL B N   1 
ATOM   6476 C CA  . VAL B 1 306 ? 13.097  -7.034  -44.236 1.00 35.32  ? 303 VAL B CA  1 
ATOM   6477 C C   . VAL B 1 306 ? 12.105  -6.982  -45.394 1.00 40.89  ? 303 VAL B C   1 
ATOM   6478 O O   . VAL B 1 306 ? 10.967  -6.536  -45.238 1.00 39.73  ? 303 VAL B O   1 
ATOM   6479 C CB  . VAL B 1 306 ? 12.383  -7.422  -42.925 1.00 39.57  ? 303 VAL B CB  1 
ATOM   6480 C CG1 . VAL B 1 306 ? 11.775  -8.809  -43.050 1.00 37.70  ? 303 VAL B CG1 1 
ATOM   6481 C CG2 . VAL B 1 306 ? 13.355  -7.368  -41.750 1.00 37.68  ? 303 VAL B CG2 1 
ATOM   6482 N N   . ASP B 1 307 ? 12.555  -7.429  -46.561 1.00 40.26  ? 304 ASP B N   1 
ATOM   6483 C CA  . ASP B 1 307 ? 11.817  -7.232  -47.803 1.00 40.11  ? 304 ASP B CA  1 
ATOM   6484 C C   . ASP B 1 307 ? 11.049  -8.468  -48.251 1.00 41.24  ? 304 ASP B C   1 
ATOM   6485 O O   . ASP B 1 307 ? 10.227  -8.392  -49.160 1.00 46.08  ? 304 ASP B O   1 
ATOM   6486 C CB  . ASP B 1 307 ? 12.780  -6.800  -48.911 1.00 39.72  ? 304 ASP B CB  1 
ATOM   6487 C CG  . ASP B 1 307 ? 13.926  -7.777  -49.096 1.00 42.46  ? 304 ASP B CG  1 
ATOM   6488 O OD1 . ASP B 1 307 ? 14.064  -8.706  -48.264 1.00 40.37  ? 304 ASP B OD1 1 
ATOM   6489 O OD2 . ASP B 1 307 ? 14.696  -7.610  -50.066 1.00 43.81  ? 304 ASP B OD2 1 
ATOM   6490 N N   . GLY B 1 308 ? 11.321  -9.605  -47.619 1.00 43.33  ? 305 GLY B N   1 
ATOM   6491 C CA  . GLY B 1 308 ? 10.718  -10.859 -48.034 1.00 42.78  ? 305 GLY B CA  1 
ATOM   6492 C C   . GLY B 1 308 ? 11.396  -11.406 -49.278 1.00 43.37  ? 305 GLY B C   1 
ATOM   6493 O O   . GLY B 1 308 ? 10.897  -12.334 -49.915 1.00 46.52  ? 305 GLY B O   1 
ATOM   6494 N N   . ASP B 1 309 ? 12.538  -10.822 -49.626 1.00 41.87  ? 306 ASP B N   1 
ATOM   6495 C CA  . ASP B 1 309 ? 13.296  -11.248 -50.797 1.00 42.04  ? 306 ASP B CA  1 
ATOM   6496 C C   . ASP B 1 309 ? 14.725  -11.612 -50.396 1.00 41.28  ? 306 ASP B C   1 
ATOM   6497 O O   . ASP B 1 309 ? 15.022  -12.784 -50.162 1.00 43.90  ? 306 ASP B O   1 
ATOM   6498 C CB  . ASP B 1 309 ? 13.291  -10.157 -51.867 1.00 39.12  ? 306 ASP B CB  1 
ATOM   6499 C CG  . ASP B 1 309 ? 13.974  -10.595 -53.153 1.00 42.37  ? 306 ASP B CG  1 
ATOM   6500 O OD1 . ASP B 1 309 ? 14.185  -11.812 -53.344 1.00 44.42  ? 306 ASP B OD1 1 
ATOM   6501 O OD2 . ASP B 1 309 ? 14.293  -9.718  -53.977 1.00 45.41  ? 306 ASP B OD2 1 
ATOM   6502 N N   . PHE B 1 310 ? 15.606  -10.617 -50.321 1.00 35.81  ? 307 PHE B N   1 
ATOM   6503 C CA  . PHE B 1 310 ? 16.942  -10.842 -49.777 1.00 39.12  ? 307 PHE B CA  1 
ATOM   6504 C C   . PHE B 1 310 ? 16.816  -11.434 -48.370 1.00 38.43  ? 307 PHE B C   1 
ATOM   6505 O O   . PHE B 1 310 ? 17.419  -12.461 -48.055 1.00 37.49  ? 307 PHE B O   1 
ATOM   6506 C CB  . PHE B 1 310 ? 17.750  -9.543  -49.739 1.00 38.00  ? 307 PHE B CB  1 
ATOM   6507 C CG  . PHE B 1 310 ? 19.224  -9.751  -49.522 1.00 37.79  ? 307 PHE B CG  1 
ATOM   6508 C CD1 . PHE B 1 310 ? 19.723  -10.052 -48.262 1.00 35.69  ? 307 PHE B CD1 1 
ATOM   6509 C CD2 . PHE B 1 310 ? 20.112  -9.645  -50.578 1.00 34.56  ? 307 PHE B CD2 1 
ATOM   6510 C CE1 . PHE B 1 310 ? 21.076  -10.246 -48.065 1.00 35.24  ? 307 PHE B CE1 1 
ATOM   6511 C CE2 . PHE B 1 310 ? 21.467  -9.834  -50.386 1.00 34.63  ? 307 PHE B CE2 1 
ATOM   6512 C CZ  . PHE B 1 310 ? 21.951  -10.137 -49.133 1.00 33.32  ? 307 PHE B CZ  1 
ATOM   6513 N N   . LEU B 1 311 ? 16.019  -10.772 -47.538 1.00 34.82  ? 308 LEU B N   1 
ATOM   6514 C CA  . LEU B 1 311 ? 15.676  -11.290 -46.217 1.00 40.42  ? 308 LEU B CA  1 
ATOM   6515 C C   . LEU B 1 311 ? 14.249  -11.821 -46.245 1.00 41.64  ? 308 LEU B C   1 
ATOM   6516 O O   . LEU B 1 311 ? 13.295  -11.045 -46.234 1.00 42.04  ? 308 LEU B O   1 
ATOM   6517 C CB  . LEU B 1 311 ? 15.824  -10.203 -45.151 1.00 35.59  ? 308 LEU B CB  1 
ATOM   6518 C CG  . LEU B 1 311 ? 17.233  -9.641  -44.965 1.00 37.11  ? 308 LEU B CG  1 
ATOM   6519 C CD1 . LEU B 1 311 ? 17.240  -8.516  -43.931 1.00 36.24  ? 308 LEU B CD1 1 
ATOM   6520 C CD2 . LEU B 1 311 ? 18.203  -10.749 -44.582 1.00 35.50  ? 308 LEU B CD2 1 
ATOM   6521 N N   . SER B 1 312 ? 14.104  -13.142 -46.290 1.00 38.87  ? 309 SER B N   1 
ATOM   6522 C CA  . SER B 1 312 ? 12.783  -13.755 -46.417 1.00 44.66  ? 309 SER B CA  1 
ATOM   6523 C C   . SER B 1 312 ? 11.935  -13.536 -45.167 1.00 45.21  ? 309 SER B C   1 
ATOM   6524 O O   . SER B 1 312 ? 10.713  -13.677 -45.199 1.00 49.17  ? 309 SER B O   1 
ATOM   6525 C CB  . SER B 1 312 ? 12.914  -15.251 -46.712 1.00 44.43  ? 309 SER B CB  1 
ATOM   6526 O OG  . SER B 1 312 ? 13.551  -15.929 -45.644 1.00 47.54  ? 309 SER B OG  1 
ATOM   6527 N N   . ASP B 1 313 ? 12.594  -13.182 -44.069 1.00 41.77  ? 310 ASP B N   1 
ATOM   6528 C CA  . ASP B 1 313 ? 11.923  -12.914 -42.807 1.00 42.41  ? 310 ASP B CA  1 
ATOM   6529 C C   . ASP B 1 313 ? 12.852  -12.044 -41.971 1.00 41.30  ? 310 ASP B C   1 
ATOM   6530 O O   . ASP B 1 313 ? 13.935  -11.684 -42.431 1.00 42.91  ? 310 ASP B O   1 
ATOM   6531 C CB  . ASP B 1 313 ? 11.586  -14.221 -42.082 1.00 44.42  ? 310 ASP B CB  1 
ATOM   6532 C CG  . ASP B 1 313 ? 10.421  -14.079 -41.119 1.00 46.57  ? 310 ASP B CG  1 
ATOM   6533 O OD1 . ASP B 1 313 ? 10.164  -12.956 -40.636 1.00 45.24  ? 310 ASP B OD1 1 
ATOM   6534 O OD2 . ASP B 1 313 ? 9.760   -15.101 -40.846 1.00 53.03  ? 310 ASP B OD2 1 
ATOM   6535 N N   . THR B 1 314 ? 12.441  -11.696 -40.757 1.00 38.96  ? 311 THR B N   1 
ATOM   6536 C CA  . THR B 1 314 ? 13.338  -10.994 -39.848 1.00 38.82  ? 311 THR B CA  1 
ATOM   6537 C C   . THR B 1 314 ? 14.546  -11.879 -39.558 1.00 38.87  ? 311 THR B C   1 
ATOM   6538 O O   . THR B 1 314 ? 14.436  -13.102 -39.575 1.00 38.93  ? 311 THR B O   1 
ATOM   6539 C CB  . THR B 1 314 ? 12.650  -10.630 -38.518 1.00 43.55  ? 311 THR B CB  1 
ATOM   6540 O OG1 . THR B 1 314 ? 12.350  -11.831 -37.799 1.00 42.73  ? 311 THR B OG1 1 
ATOM   6541 C CG2 . THR B 1 314 ? 11.367  -9.842  -38.759 1.00 41.91  ? 311 THR B CG2 1 
ATOM   6542 N N   . PRO B 1 315 ? 15.710  -11.265 -39.306 1.00 37.05  ? 312 PRO B N   1 
ATOM   6543 C CA  . PRO B 1 315 ? 16.902  -12.030 -38.921 1.00 37.06  ? 312 PRO B CA  1 
ATOM   6544 C C   . PRO B 1 315 ? 16.692  -12.865 -37.646 1.00 41.97  ? 312 PRO B C   1 
ATOM   6545 O O   . PRO B 1 315 ? 17.259  -13.949 -37.527 1.00 38.82  ? 312 PRO B O   1 
ATOM   6546 C CB  . PRO B 1 315 ? 17.954  -10.943 -38.688 1.00 33.66  ? 312 PRO B CB  1 
ATOM   6547 C CG  . PRO B 1 315 ? 17.495  -9.792  -39.536 1.00 41.62  ? 312 PRO B CG  1 
ATOM   6548 C CD  . PRO B 1 315 ? 15.999  -9.830  -39.475 1.00 37.23  ? 312 PRO B CD  1 
ATOM   6549 N N   . GLU B 1 316 ? 15.892  -12.368 -36.709 1.00 37.65  ? 313 GLU B N   1 
ATOM   6550 C CA  . GLU B 1 316 ? 15.615  -13.127 -35.488 1.00 44.20  ? 313 GLU B CA  1 
ATOM   6551 C C   . GLU B 1 316 ? 14.945  -14.463 -35.817 1.00 46.27  ? 313 GLU B C   1 
ATOM   6552 O O   . GLU B 1 316 ? 15.398  -15.526 -35.380 1.00 48.35  ? 313 GLU B O   1 
ATOM   6553 C CB  . GLU B 1 316 ? 14.742  -12.315 -34.534 1.00 45.79  ? 313 GLU B CB  1 
ATOM   6554 C CG  . GLU B 1 316 ? 14.250  -13.114 -33.336 1.00 55.45  ? 313 GLU B CG  1 
ATOM   6555 C CD  . GLU B 1 316 ? 13.682  -12.237 -32.239 1.00 64.25  ? 313 GLU B CD  1 
ATOM   6556 O OE1 . GLU B 1 316 ? 12.441  -12.103 -32.162 1.00 71.84  ? 313 GLU B OE1 1 
ATOM   6557 O OE2 . GLU B 1 316 ? 14.479  -11.685 -31.450 1.00 67.12  ? 313 GLU B OE2 1 
ATOM   6558 N N   . ALA B 1 317 ? 13.883  -14.400 -36.613 1.00 41.97  ? 314 ALA B N   1 
ATOM   6559 C CA  . ALA B 1 317 ? 13.178  -15.598 -37.054 1.00 45.60  ? 314 ALA B CA  1 
ATOM   6560 C C   . ALA B 1 317 ? 14.093  -16.548 -37.825 1.00 50.24  ? 314 ALA B C   1 
ATOM   6561 O O   . ALA B 1 317 ? 14.063  -17.763 -37.612 1.00 51.76  ? 314 ALA B O   1 
ATOM   6562 C CB  . ALA B 1 317 ? 11.981  -15.216 -37.910 1.00 48.18  ? 314 ALA B CB  1 
ATOM   6563 N N   . LEU B 1 318 ? 14.909  -15.989 -38.716 1.00 42.65  ? 315 LEU B N   1 
ATOM   6564 C CA  . LEU B 1 318 ? 15.783  -16.797 -39.556 1.00 44.38  ? 315 LEU B CA  1 
ATOM   6565 C C   . LEU B 1 318 ? 16.885  -17.491 -38.758 1.00 42.75  ? 315 LEU B C   1 
ATOM   6566 O O   . LEU B 1 318 ? 17.217  -18.642 -39.042 1.00 45.30  ? 315 LEU B O   1 
ATOM   6567 C CB  . LEU B 1 318 ? 16.398  -15.943 -40.673 1.00 43.36  ? 315 LEU B CB  1 
ATOM   6568 C CG  . LEU B 1 318 ? 15.411  -15.427 -41.722 1.00 43.03  ? 315 LEU B CG  1 
ATOM   6569 C CD1 . LEU B 1 318 ? 16.129  -14.678 -42.844 1.00 43.31  ? 315 LEU B CD1 1 
ATOM   6570 C CD2 . LEU B 1 318 ? 14.586  -16.575 -42.289 1.00 48.98  ? 315 LEU B CD2 1 
ATOM   6571 N N   . ILE B 1 319 ? 17.459  -16.813 -37.767 1.00 42.45  ? 316 ILE B N   1 
ATOM   6572 C CA  . ILE B 1 319 ? 18.462  -17.474 -36.941 1.00 47.15  ? 316 ILE B CA  1 
ATOM   6573 C C   . ILE B 1 319 ? 17.776  -18.484 -36.024 1.00 49.43  ? 316 ILE B C   1 
ATOM   6574 O O   . ILE B 1 319 ? 18.394  -19.468 -35.621 1.00 51.29  ? 316 ILE B O   1 
ATOM   6575 C CB  . ILE B 1 319 ? 19.317  -16.486 -36.085 1.00 45.46  ? 316 ILE B CB  1 
ATOM   6576 C CG1 . ILE B 1 319 ? 18.506  -15.874 -34.940 1.00 45.18  ? 316 ILE B CG1 1 
ATOM   6577 C CG2 . ILE B 1 319 ? 19.955  -15.410 -36.952 1.00 39.58  ? 316 ILE B CG2 1 
ATOM   6578 C CD1 . ILE B 1 319 ? 19.309  -14.920 -34.069 1.00 42.12  ? 316 ILE B CD1 1 
ATOM   6579 N N   . ASN B 1 320 ? 16.501  -18.253 -35.709 1.00 49.82  ? 317 ASN B N   1 
ATOM   6580 C CA  . ASN B 1 320 ? 15.760  -19.187 -34.856 1.00 53.96  ? 317 ASN B CA  1 
ATOM   6581 C C   . ASN B 1 320 ? 15.369  -20.484 -35.566 1.00 55.23  ? 317 ASN B C   1 
ATOM   6582 O O   . ASN B 1 320 ? 15.333  -21.547 -34.946 1.00 54.10  ? 317 ASN B O   1 
ATOM   6583 C CB  . ASN B 1 320 ? 14.499  -18.529 -34.290 1.00 49.31  ? 317 ASN B CB  1 
ATOM   6584 C CG  . ASN B 1 320 ? 14.806  -17.512 -33.212 1.00 51.67  ? 317 ASN B CG  1 
ATOM   6585 O OD1 . ASN B 1 320 ? 15.910  -17.482 -32.670 1.00 56.26  ? 317 ASN B OD1 1 
ATOM   6586 N ND2 . ASN B 1 320 ? 13.825  -16.676 -32.886 1.00 52.02  ? 317 ASN B ND2 1 
ATOM   6587 N N   . THR B 1 321 ? 15.075  -20.402 -36.860 1.00 51.95  ? 318 THR B N   1 
ATOM   6588 C CA  . THR B 1 321 ? 14.574  -21.569 -37.580 1.00 54.05  ? 318 THR B CA  1 
ATOM   6589 C C   . THR B 1 321 ? 15.581  -22.133 -38.576 1.00 55.14  ? 318 THR B C   1 
ATOM   6590 O O   . THR B 1 321 ? 15.340  -23.172 -39.189 1.00 58.65  ? 318 THR B O   1 
ATOM   6591 C CB  . THR B 1 321 ? 13.272  -21.242 -38.335 1.00 54.78  ? 318 THR B CB  1 
ATOM   6592 O OG1 . THR B 1 321 ? 13.558  -20.361 -39.428 1.00 54.30  ? 318 THR B OG1 1 
ATOM   6593 C CG2 . THR B 1 321 ? 12.266  -20.583 -37.403 1.00 55.61  ? 318 THR B CG2 1 
ATOM   6594 N N   . GLY B 1 322 ? 16.710  -21.452 -38.732 1.00 52.40  ? 319 GLY B N   1 
ATOM   6595 C CA  . GLY B 1 322 ? 17.698  -21.852 -39.715 1.00 50.04  ? 319 GLY B CA  1 
ATOM   6596 C C   . GLY B 1 322 ? 18.444  -23.127 -39.373 1.00 52.18  ? 319 GLY B C   1 
ATOM   6597 O O   . GLY B 1 322 ? 18.620  -23.466 -38.203 1.00 51.18  ? 319 GLY B O   1 
ATOM   6598 N N   . ASP B 1 323 ? 18.876  -23.836 -40.410 1.00 52.75  ? 320 ASP B N   1 
ATOM   6599 C CA  . ASP B 1 323 ? 19.746  -24.996 -40.262 1.00 56.26  ? 320 ASP B CA  1 
ATOM   6600 C C   . ASP B 1 323 ? 21.164  -24.599 -40.673 1.00 55.75  ? 320 ASP B C   1 
ATOM   6601 O O   . ASP B 1 323 ? 21.414  -24.288 -41.838 1.00 54.92  ? 320 ASP B O   1 
ATOM   6602 C CB  . ASP B 1 323 ? 19.229  -26.166 -41.108 1.00 61.88  ? 320 ASP B CB  1 
ATOM   6603 C CG  . ASP B 1 323 ? 20.203  -27.332 -41.169 1.00 62.77  ? 320 ASP B CG  1 
ATOM   6604 O OD1 . ASP B 1 323 ? 21.004  -27.507 -40.228 1.00 64.66  ? 320 ASP B OD1 1 
ATOM   6605 O OD2 . ASP B 1 323 ? 20.163  -28.081 -42.167 1.00 69.63  ? 320 ASP B OD2 1 
ATOM   6606 N N   . PHE B 1 324 ? 22.088  -24.607 -39.717 1.00 50.65  ? 321 PHE B N   1 
ATOM   6607 C CA  . PHE B 1 324 ? 23.436  -24.094 -39.959 1.00 49.83  ? 321 PHE B CA  1 
ATOM   6608 C C   . PHE B 1 324 ? 24.518  -25.162 -39.814 1.00 46.90  ? 321 PHE B C   1 
ATOM   6609 O O   . PHE B 1 324 ? 25.664  -24.848 -39.495 1.00 46.54  ? 321 PHE B O   1 
ATOM   6610 C CB  . PHE B 1 324 ? 23.736  -22.936 -39.001 1.00 47.15  ? 321 PHE B CB  1 
ATOM   6611 C CG  . PHE B 1 324 ? 22.764  -21.796 -39.101 1.00 45.69  ? 321 PHE B CG  1 
ATOM   6612 C CD1 . PHE B 1 324 ? 22.787  -20.944 -40.194 1.00 43.55  ? 321 PHE B CD1 1 
ATOM   6613 C CD2 . PHE B 1 324 ? 21.832  -21.571 -38.102 1.00 46.83  ? 321 PHE B CD2 1 
ATOM   6614 C CE1 . PHE B 1 324 ? 21.894  -19.892 -40.289 1.00 43.27  ? 321 PHE B CE1 1 
ATOM   6615 C CE2 . PHE B 1 324 ? 20.937  -20.518 -38.191 1.00 48.43  ? 321 PHE B CE2 1 
ATOM   6616 C CZ  . PHE B 1 324 ? 20.968  -19.679 -39.288 1.00 43.49  ? 321 PHE B CZ  1 
ATOM   6617 N N   . GLN B 1 325 ? 24.158  -26.414 -40.071 1.00 50.38  ? 322 GLN B N   1 
ATOM   6618 C CA  . GLN B 1 325 ? 25.031  -27.545 -39.758 1.00 55.44  ? 322 GLN B CA  1 
ATOM   6619 C C   . GLN B 1 325 ? 26.401  -27.519 -40.448 1.00 55.63  ? 322 GLN B C   1 
ATOM   6620 O O   . GLN B 1 325 ? 27.384  -27.999 -39.881 1.00 62.96  ? 322 GLN B O   1 
ATOM   6621 C CB  . GLN B 1 325 ? 24.315  -28.857 -40.093 1.00 57.31  ? 322 GLN B CB  1 
ATOM   6622 C CG  . GLN B 1 325 ? 23.929  -29.006 -41.555 1.00 67.00  ? 322 GLN B CG  1 
ATOM   6623 C CD  . GLN B 1 325 ? 22.947  -30.139 -41.783 1.00 73.76  ? 322 GLN B CD  1 
ATOM   6624 O OE1 . GLN B 1 325 ? 22.405  -30.707 -40.833 1.00 73.49  ? 322 GLN B OE1 1 
ATOM   6625 N NE2 . GLN B 1 325 ? 22.711  -30.474 -43.049 1.00 74.71  ? 322 GLN B NE2 1 
ATOM   6626 N N   . ASP B 1 326 ? 26.481  -26.954 -41.648 1.00 49.38  ? 323 ASP B N   1 
ATOM   6627 C CA  . ASP B 1 326 ? 27.738  -26.974 -42.396 1.00 55.56  ? 323 ASP B CA  1 
ATOM   6628 C C   . ASP B 1 326 ? 28.462  -25.628 -42.407 1.00 50.60  ? 323 ASP B C   1 
ATOM   6629 O O   . ASP B 1 326 ? 29.241  -25.341 -43.314 1.00 50.28  ? 323 ASP B O   1 
ATOM   6630 C CB  . ASP B 1 326 ? 27.488  -27.435 -43.835 1.00 60.67  ? 323 ASP B CB  1 
ATOM   6631 C CG  . ASP B 1 326 ? 27.014  -28.877 -43.910 1.00 69.90  ? 323 ASP B CG  1 
ATOM   6632 O OD1 . ASP B 1 326 ? 27.765  -29.774 -43.465 1.00 72.59  ? 323 ASP B OD1 1 
ATOM   6633 O OD2 . ASP B 1 326 ? 25.896  -29.113 -44.417 1.00 72.74  ? 323 ASP B OD2 1 
ATOM   6634 N N   . LEU B 1 327 ? 28.216  -24.816 -41.386 1.00 47.42  ? 324 LEU B N   1 
ATOM   6635 C CA  . LEU B 1 327 ? 28.809  -23.488 -41.299 1.00 44.85  ? 324 LEU B CA  1 
ATOM   6636 C C   . LEU B 1 327 ? 29.764  -23.362 -40.110 1.00 40.12  ? 324 LEU B C   1 
ATOM   6637 O O   . LEU B 1 327 ? 29.454  -23.812 -39.007 1.00 42.11  ? 324 LEU B O   1 
ATOM   6638 C CB  . LEU B 1 327 ? 27.702  -22.436 -41.195 1.00 45.82  ? 324 LEU B CB  1 
ATOM   6639 C CG  . LEU B 1 327 ? 28.075  -20.957 -41.263 1.00 43.03  ? 324 LEU B CG  1 
ATOM   6640 C CD1 . LEU B 1 327 ? 28.613  -20.608 -42.640 1.00 43.77  ? 324 LEU B CD1 1 
ATOM   6641 C CD2 . LEU B 1 327 ? 26.861  -20.106 -40.920 1.00 45.27  ? 324 LEU B CD2 1 
ATOM   6642 N N   . GLN B 1 328 ? 30.926  -22.761 -40.340 1.00 35.29  ? 325 GLN B N   1 
ATOM   6643 C CA  . GLN B 1 328 ? 31.808  -22.378 -39.247 1.00 34.84  ? 325 GLN B CA  1 
ATOM   6644 C C   . GLN B 1 328 ? 31.838  -20.864 -39.131 1.00 37.93  ? 325 GLN B C   1 
ATOM   6645 O O   . GLN B 1 328 ? 31.938  -20.146 -40.133 1.00 31.22  ? 325 GLN B O   1 
ATOM   6646 C CB  . GLN B 1 328 ? 33.222  -22.921 -39.435 1.00 37.50  ? 325 GLN B CB  1 
ATOM   6647 C CG  . GLN B 1 328 ? 33.293  -24.423 -39.612 1.00 39.57  ? 325 GLN B CG  1 
ATOM   6648 C CD  . GLN B 1 328 ? 33.268  -24.827 -41.065 1.00 42.27  ? 325 GLN B CD  1 
ATOM   6649 O OE1 . GLN B 1 328 ? 33.949  -24.224 -41.892 1.00 43.57  ? 325 GLN B OE1 1 
ATOM   6650 N NE2 . GLN B 1 328 ? 32.475  -25.841 -41.389 1.00 43.07  ? 325 GLN B NE2 1 
ATOM   6651 N N   . VAL B 1 329 ? 31.740  -20.389 -37.894 1.00 31.89  ? 326 VAL B N   1 
ATOM   6652 C CA  . VAL B 1 329 ? 31.604  -18.972 -37.616 1.00 29.63  ? 326 VAL B CA  1 
ATOM   6653 C C   . VAL B 1 329 ? 32.512  -18.521 -36.472 1.00 35.36  ? 326 VAL B C   1 
ATOM   6654 O O   . VAL B 1 329 ? 32.575  -19.159 -35.416 1.00 36.78  ? 326 VAL B O   1 
ATOM   6655 C CB  . VAL B 1 329 ? 30.142  -18.621 -37.265 1.00 34.76  ? 326 VAL B CB  1 
ATOM   6656 C CG1 . VAL B 1 329 ? 30.024  -17.173 -36.884 1.00 35.51  ? 326 VAL B CG1 1 
ATOM   6657 C CG2 . VAL B 1 329 ? 29.215  -18.935 -38.428 1.00 37.83  ? 326 VAL B CG2 1 
ATOM   6658 N N   . LEU B 1 330 ? 33.216  -17.417 -36.693 1.00 31.93  ? 327 LEU B N   1 
ATOM   6659 C CA  . LEU B 1 330 ? 33.990  -16.758 -35.647 1.00 31.64  ? 327 LEU B CA  1 
ATOM   6660 C C   . LEU B 1 330 ? 33.323  -15.428 -35.304 1.00 32.74  ? 327 LEU B C   1 
ATOM   6661 O O   . LEU B 1 330 ? 33.120  -14.597 -36.181 1.00 31.90  ? 327 LEU B O   1 
ATOM   6662 C CB  . LEU B 1 330 ? 35.434  -16.552 -36.112 1.00 31.56  ? 327 LEU B CB  1 
ATOM   6663 C CG  . LEU B 1 330 ? 36.417  -15.759 -35.251 1.00 34.52  ? 327 LEU B CG  1 
ATOM   6664 C CD1 . LEU B 1 330 ? 36.612  -16.436 -33.906 1.00 32.68  ? 327 LEU B CD1 1 
ATOM   6665 C CD2 . LEU B 1 330 ? 37.746  -15.620 -35.995 1.00 34.19  ? 327 LEU B CD2 1 
ATOM   6666 N N   . VAL B 1 331 ? 32.952  -15.237 -34.038 1.00 31.48  ? 328 VAL B N   1 
ATOM   6667 C CA  . VAL B 1 331 ? 32.274  -14.015 -33.598 1.00 27.80  ? 328 VAL B CA  1 
ATOM   6668 C C   . VAL B 1 331 ? 32.906  -13.429 -32.342 1.00 32.60  ? 328 VAL B C   1 
ATOM   6669 O O   . VAL B 1 331 ? 33.447  -14.152 -31.508 1.00 30.77  ? 328 VAL B O   1 
ATOM   6670 C CB  . VAL B 1 331 ? 30.772  -14.242 -33.285 1.00 28.11  ? 328 VAL B CB  1 
ATOM   6671 C CG1 . VAL B 1 331 ? 30.024  -14.689 -34.503 1.00 34.50  ? 328 VAL B CG1 1 
ATOM   6672 C CG2 . VAL B 1 331 ? 30.601  -15.250 -32.135 1.00 35.08  ? 328 VAL B CG2 1 
ATOM   6673 N N   . GLY B 1 332 ? 32.825  -12.116 -32.186 1.00 30.95  ? 329 GLY B N   1 
ATOM   6674 C CA  . GLY B 1 332 ? 33.342  -11.522 -30.968 1.00 31.86  ? 329 GLY B CA  1 
ATOM   6675 C C   . GLY B 1 332 ? 33.017  -10.060 -30.804 1.00 32.92  ? 329 GLY B C   1 
ATOM   6676 O O   . GLY B 1 332 ? 32.352  -9.453  -31.646 1.00 30.41  ? 329 GLY B O   1 
ATOM   6677 N N   . VAL B 1 333 ? 33.483  -9.503  -29.695 1.00 30.19  ? 330 VAL B N   1 
ATOM   6678 C CA  . VAL B 1 333 ? 33.242  -8.115  -29.354 1.00 30.37  ? 330 VAL B CA  1 
ATOM   6679 C C   . VAL B 1 333 ? 34.518  -7.504  -28.797 1.00 31.83  ? 330 VAL B C   1 
ATOM   6680 O O   . VAL B 1 333 ? 35.467  -8.221  -28.478 1.00 31.38  ? 330 VAL B O   1 
ATOM   6681 C CB  . VAL B 1 333 ? 32.104  -7.973  -28.316 1.00 32.60  ? 330 VAL B CB  1 
ATOM   6682 C CG1 . VAL B 1 333 ? 30.804  -8.546  -28.865 1.00 30.38  ? 330 VAL B CG1 1 
ATOM   6683 C CG2 . VAL B 1 333 ? 32.485  -8.655  -26.992 1.00 30.62  ? 330 VAL B CG2 1 
ATOM   6684 N N   . VAL B 1 334 ? 34.552  -6.180  -28.702 1.00 31.44  ? 331 VAL B N   1 
ATOM   6685 C CA  . VAL B 1 334 ? 35.632  -5.510  -27.995 1.00 32.94  ? 331 VAL B CA  1 
ATOM   6686 C C   . VAL B 1 334 ? 35.138  -5.178  -26.589 1.00 33.78  ? 331 VAL B C   1 
ATOM   6687 O O   . VAL B 1 334 ? 33.952  -5.323  -26.292 1.00 33.01  ? 331 VAL B O   1 
ATOM   6688 C CB  . VAL B 1 334 ? 36.108  -4.229  -28.714 1.00 33.39  ? 331 VAL B CB  1 
ATOM   6689 C CG1 . VAL B 1 334 ? 36.591  -4.554  -30.137 1.00 31.82  ? 331 VAL B CG1 1 
ATOM   6690 C CG2 . VAL B 1 334 ? 35.004  -3.180  -28.740 1.00 32.63  ? 331 VAL B CG2 1 
ATOM   6691 N N   . LYS B 1 335 ? 36.047  -4.729  -25.733 1.00 36.14  ? 332 LYS B N   1 
ATOM   6692 C CA  . LYS B 1 335 ? 35.748  -4.532  -24.315 1.00 33.34  ? 332 LYS B CA  1 
ATOM   6693 C C   . LYS B 1 335 ? 34.740  -3.408  -24.062 1.00 36.31  ? 332 LYS B C   1 
ATOM   6694 O O   . LYS B 1 335 ? 33.889  -3.520  -23.180 1.00 35.58  ? 332 LYS B O   1 
ATOM   6695 C CB  . LYS B 1 335 ? 37.047  -4.262  -23.554 1.00 36.75  ? 332 LYS B CB  1 
ATOM   6696 C CG  . LYS B 1 335 ? 36.918  -4.291  -22.034 1.00 39.62  ? 332 LYS B CG  1 
ATOM   6697 C CD  . LYS B 1 335 ? 38.294  -4.291  -21.386 1.00 39.13  ? 332 LYS B CD  1 
ATOM   6698 C CE  . LYS B 1 335 ? 38.488  -3.093  -20.469 1.00 54.72  ? 332 LYS B CE  1 
ATOM   6699 N NZ  . LYS B 1 335 ? 38.520  -1.805  -21.221 1.00 46.24  ? 332 LYS B NZ  1 
ATOM   6700 N N   . ASP B 1 336 ? 34.823  -2.329  -24.837 1.00 37.65  ? 333 ASP B N   1 
ATOM   6701 C CA  . ASP B 1 336 ? 33.932  -1.188  -24.630 1.00 35.94  ? 333 ASP B CA  1 
ATOM   6702 C C   . ASP B 1 336 ? 33.175  -0.787  -25.897 1.00 38.30  ? 333 ASP B C   1 
ATOM   6703 O O   . ASP B 1 336 ? 33.425  0.275   -26.473 1.00 35.30  ? 333 ASP B O   1 
ATOM   6704 C CB  . ASP B 1 336 ? 34.727  0.001   -24.094 1.00 34.66  ? 333 ASP B CB  1 
ATOM   6705 C CG  . ASP B 1 336 ? 35.466  -0.332  -22.815 1.00 39.86  ? 333 ASP B CG  1 
ATOM   6706 O OD1 . ASP B 1 336 ? 34.861  -0.193  -21.731 1.00 38.06  ? 333 ASP B OD1 1 
ATOM   6707 O OD2 . ASP B 1 336 ? 36.643  -0.746  -22.895 1.00 40.62  ? 333 ASP B OD2 1 
ATOM   6708 N N   . GLU B 1 337 ? 32.230  -1.632  -26.300 1.00 34.62  ? 334 GLU B N   1 
ATOM   6709 C CA  . GLU B 1 337 ? 31.464  -1.428  -27.525 1.00 40.40  ? 334 GLU B CA  1 
ATOM   6710 C C   . GLU B 1 337 ? 30.716  -0.097  -27.552 1.00 39.77  ? 334 GLU B C   1 
ATOM   6711 O O   . GLU B 1 337 ? 30.595  0.530   -28.601 1.00 37.65  ? 334 GLU B O   1 
ATOM   6712 C CB  . GLU B 1 337 ? 30.468  -2.576  -27.717 1.00 35.70  ? 334 GLU B CB  1 
ATOM   6713 C CG  . GLU B 1 337 ? 31.113  -3.918  -28.022 1.00 30.53  ? 334 GLU B CG  1 
ATOM   6714 C CD  . GLU B 1 337 ? 31.653  -4.007  -29.443 1.00 37.05  ? 334 GLU B CD  1 
ATOM   6715 O OE1 . GLU B 1 337 ? 31.381  -3.090  -30.255 1.00 35.92  ? 334 GLU B OE1 1 
ATOM   6716 O OE2 . GLU B 1 337 ? 32.353  -4.998  -29.746 1.00 35.40  ? 334 GLU B OE2 1 
ATOM   6717 N N   . GLY B 1 338 ? 30.235  0.343   -26.394 1.00 33.34  ? 335 GLY B N   1 
ATOM   6718 C CA  . GLY B 1 338 ? 29.337  1.484   -26.341 1.00 36.58  ? 335 GLY B CA  1 
ATOM   6719 C C   . GLY B 1 338 ? 29.965  2.860   -26.217 1.00 38.54  ? 335 GLY B C   1 
ATOM   6720 O O   . GLY B 1 338 ? 29.297  3.868   -26.448 1.00 40.32  ? 335 GLY B O   1 
ATOM   6721 N N   . SER B 1 339 ? 31.246  2.908   -25.868 1.00 36.14  ? 336 SER B N   1 
ATOM   6722 C CA  . SER B 1 339 ? 31.878  4.155   -25.444 1.00 40.85  ? 336 SER B CA  1 
ATOM   6723 C C   . SER B 1 339 ? 31.908  5.232   -26.538 1.00 44.62  ? 336 SER B C   1 
ATOM   6724 O O   . SER B 1 339 ? 31.549  6.382   -26.291 1.00 45.05  ? 336 SER B O   1 
ATOM   6725 C CB  . SER B 1 339 ? 33.301  3.874   -24.951 1.00 39.28  ? 336 SER B CB  1 
ATOM   6726 O OG  . SER B 1 339 ? 34.131  3.435   -26.013 1.00 41.55  ? 336 SER B OG  1 
ATOM   6727 N N   . TYR B 1 340 ? 32.330  4.847   -27.738 1.00 44.48  ? 337 TYR B N   1 
ATOM   6728 C CA  . TYR B 1 340 ? 32.489  5.776   -28.860 1.00 49.65  ? 337 TYR B CA  1 
ATOM   6729 C C   . TYR B 1 340 ? 31.209  6.548   -29.162 1.00 49.31  ? 337 TYR B C   1 
ATOM   6730 O O   . TYR B 1 340 ? 31.249  7.734   -29.495 1.00 55.50  ? 337 TYR B O   1 
ATOM   6731 C CB  . TYR B 1 340 ? 32.959  5.001   -30.105 1.00 50.95  ? 337 TYR B CB  1 
ATOM   6732 C CG  . TYR B 1 340 ? 32.930  5.743   -31.431 1.00 53.45  ? 337 TYR B CG  1 
ATOM   6733 C CD1 . TYR B 1 340 ? 34.109  6.199   -32.010 1.00 56.39  ? 337 TYR B CD1 1 
ATOM   6734 C CD2 . TYR B 1 340 ? 31.744  5.915   -32.147 1.00 61.99  ? 337 TYR B CD2 1 
ATOM   6735 C CE1 . TYR B 1 340 ? 34.107  6.853   -33.241 1.00 59.72  ? 337 TYR B CE1 1 
ATOM   6736 C CE2 . TYR B 1 340 ? 31.731  6.568   -33.378 1.00 60.01  ? 337 TYR B CE2 1 
ATOM   6737 C CZ  . TYR B 1 340 ? 32.918  7.034   -33.920 1.00 67.19  ? 337 TYR B CZ  1 
ATOM   6738 O OH  . TYR B 1 340 ? 32.914  7.679   -35.143 1.00 66.38  ? 337 TYR B OH  1 
ATOM   6739 N N   . PHE B 1 341 ? 30.076  5.875   -29.038 1.00 47.23  ? 338 PHE B N   1 
ATOM   6740 C CA  . PHE B 1 341 ? 28.813  6.441   -29.476 1.00 45.61  ? 338 PHE B CA  1 
ATOM   6741 C C   . PHE B 1 341 ? 28.215  7.470   -28.521 1.00 49.08  ? 338 PHE B C   1 
ATOM   6742 O O   . PHE B 1 341 ? 27.345  8.256   -28.908 1.00 48.68  ? 338 PHE B O   1 
ATOM   6743 C CB  . PHE B 1 341 ? 27.833  5.305   -29.711 1.00 45.60  ? 338 PHE B CB  1 
ATOM   6744 C CG  . PHE B 1 341 ? 28.270  4.360   -30.794 1.00 52.53  ? 338 PHE B CG  1 
ATOM   6745 C CD1 . PHE B 1 341 ? 27.856  4.561   -32.097 1.00 49.18  ? 338 PHE B CD1 1 
ATOM   6746 C CD2 . PHE B 1 341 ? 29.110  3.289   -30.517 1.00 50.57  ? 338 PHE B CD2 1 
ATOM   6747 C CE1 . PHE B 1 341 ? 28.252  3.707   -33.110 1.00 49.44  ? 338 PHE B CE1 1 
ATOM   6748 C CE2 . PHE B 1 341 ? 29.515  2.430   -31.525 1.00 48.48  ? 338 PHE B CE2 1 
ATOM   6749 C CZ  . PHE B 1 341 ? 29.078  2.636   -32.824 1.00 50.39  ? 338 PHE B CZ  1 
ATOM   6750 N N   . LEU B 1 342 ? 28.684  7.466   -27.280 1.00 44.72  ? 339 LEU B N   1 
ATOM   6751 C CA  . LEU B 1 342 ? 28.186  8.396   -26.273 1.00 46.63  ? 339 LEU B CA  1 
ATOM   6752 C C   . LEU B 1 342 ? 28.456  9.861   -26.633 1.00 47.90  ? 339 LEU B C   1 
ATOM   6753 O O   . LEU B 1 342 ? 27.605  10.722  -26.413 1.00 50.83  ? 339 LEU B O   1 
ATOM   6754 C CB  . LEU B 1 342 ? 28.798  8.065   -24.912 1.00 41.23  ? 339 LEU B CB  1 
ATOM   6755 C CG  . LEU B 1 342 ? 28.521  6.627   -24.470 1.00 41.28  ? 339 LEU B CG  1 
ATOM   6756 C CD1 . LEU B 1 342 ? 29.101  6.367   -23.089 1.00 40.98  ? 339 LEU B CD1 1 
ATOM   6757 C CD2 . LEU B 1 342 ? 27.022  6.339   -24.502 1.00 35.87  ? 339 LEU B CD2 1 
ATOM   6758 N N   . VAL B 1 343 ? 29.626  10.142  -27.200 1.00 50.69  ? 340 VAL B N   1 
ATOM   6759 C CA  . VAL B 1 343 ? 29.976  11.517  -27.562 1.00 52.11  ? 340 VAL B CA  1 
ATOM   6760 C C   . VAL B 1 343 ? 29.243  12.020  -28.805 1.00 50.81  ? 340 VAL B C   1 
ATOM   6761 O O   . VAL B 1 343 ? 29.400  13.175  -29.195 1.00 50.25  ? 340 VAL B O   1 
ATOM   6762 C CB  . VAL B 1 343 ? 31.487  11.672  -27.802 1.00 52.00  ? 340 VAL B CB  1 
ATOM   6763 C CG1 . VAL B 1 343 ? 32.250  11.323  -26.544 1.00 55.74  ? 340 VAL B CG1 1 
ATOM   6764 C CG2 . VAL B 1 343 ? 31.936  10.804  -28.964 1.00 50.22  ? 340 VAL B CG2 1 
ATOM   6765 N N   . TYR B 1 344 ? 28.445  11.156  -29.422 1.00 49.67  ? 341 TYR B N   1 
ATOM   6766 C CA  . TYR B 1 344 ? 27.708  11.533  -30.620 1.00 52.48  ? 341 TYR B CA  1 
ATOM   6767 C C   . TYR B 1 344 ? 26.219  11.750  -30.359 1.00 54.06  ? 341 TYR B C   1 
ATOM   6768 O O   . TYR B 1 344 ? 25.392  11.490  -31.233 1.00 53.52  ? 341 TYR B O   1 
ATOM   6769 C CB  . TYR B 1 344 ? 27.885  10.472  -31.712 1.00 52.65  ? 341 TYR B CB  1 
ATOM   6770 C CG  . TYR B 1 344 ? 29.173  10.591  -32.496 1.00 53.40  ? 341 TYR B CG  1 
ATOM   6771 C CD1 . TYR B 1 344 ? 30.337  9.980   -32.050 1.00 50.67  ? 341 TYR B CD1 1 
ATOM   6772 C CD2 . TYR B 1 344 ? 29.223  11.309  -33.687 1.00 53.12  ? 341 TYR B CD2 1 
ATOM   6773 C CE1 . TYR B 1 344 ? 31.518  10.082  -32.762 1.00 55.62  ? 341 TYR B CE1 1 
ATOM   6774 C CE2 . TYR B 1 344 ? 30.400  11.417  -34.410 1.00 51.18  ? 341 TYR B CE2 1 
ATOM   6775 C CZ  . TYR B 1 344 ? 31.545  10.801  -33.943 1.00 57.60  ? 341 TYR B CZ  1 
ATOM   6776 O OH  . TYR B 1 344 ? 32.725  10.901  -34.648 1.00 52.35  ? 341 TYR B OH  1 
ATOM   6777 N N   . GLY B 1 345 ? 25.869  12.221  -29.167 1.00 56.01  ? 342 GLY B N   1 
ATOM   6778 C CA  . GLY B 1 345 ? 24.480  12.555  -28.901 1.00 56.00  ? 342 GLY B CA  1 
ATOM   6779 C C   . GLY B 1 345 ? 23.978  12.463  -27.472 1.00 55.77  ? 342 GLY B C   1 
ATOM   6780 O O   . GLY B 1 345 ? 22.857  12.884  -27.190 1.00 59.22  ? 342 GLY B O   1 
ATOM   6781 N N   . VAL B 1 346 ? 24.778  11.914  -26.566 1.00 53.87  ? 343 VAL B N   1 
ATOM   6782 C CA  . VAL B 1 346 ? 24.351  11.830  -25.171 1.00 53.20  ? 343 VAL B CA  1 
ATOM   6783 C C   . VAL B 1 346 ? 24.898  13.006  -24.370 1.00 50.01  ? 343 VAL B C   1 
ATOM   6784 O O   . VAL B 1 346 ? 26.113  13.146  -24.219 1.00 47.21  ? 343 VAL B O   1 
ATOM   6785 C CB  . VAL B 1 346 ? 24.792  10.513  -24.509 1.00 53.30  ? 343 VAL B CB  1 
ATOM   6786 C CG1 . VAL B 1 346 ? 24.324  10.471  -23.062 1.00 51.79  ? 343 VAL B CG1 1 
ATOM   6787 C CG2 . VAL B 1 346 ? 24.241  9.326   -25.279 1.00 54.22  ? 343 VAL B CG2 1 
ATOM   6788 N N   . PRO B 1 347 ? 23.995  13.862  -23.862 1.00 54.73  ? 344 PRO B N   1 
ATOM   6789 C CA  . PRO B 1 347 ? 24.359  15.047  -23.077 1.00 55.38  ? 344 PRO B CA  1 
ATOM   6790 C C   . PRO B 1 347 ? 25.300  14.698  -21.932 1.00 54.33  ? 344 PRO B C   1 
ATOM   6791 O O   . PRO B 1 347 ? 25.028  13.758  -21.186 1.00 55.59  ? 344 PRO B O   1 
ATOM   6792 C CB  . PRO B 1 347 ? 23.013  15.546  -22.543 1.00 52.90  ? 344 PRO B CB  1 
ATOM   6793 C CG  . PRO B 1 347 ? 22.008  15.029  -23.513 1.00 52.94  ? 344 PRO B CG  1 
ATOM   6794 C CD  . PRO B 1 347 ? 22.535  13.709  -23.985 1.00 51.81  ? 344 PRO B CD  1 
ATOM   6795 N N   . GLY B 1 348 ? 26.401  15.434  -21.815 1.00 55.79  ? 345 GLY B N   1 
ATOM   6796 C CA  . GLY B 1 348 ? 27.353  15.223  -20.740 1.00 52.28  ? 345 GLY B CA  1 
ATOM   6797 C C   . GLY B 1 348 ? 28.588  14.454  -21.168 1.00 55.20  ? 345 GLY B C   1 
ATOM   6798 O O   . GLY B 1 348 ? 29.519  14.276  -20.382 1.00 52.69  ? 345 GLY B O   1 
ATOM   6799 N N   . PHE B 1 349 ? 28.608  13.998  -22.417 1.00 52.09  ? 346 PHE B N   1 
ATOM   6800 C CA  . PHE B 1 349 ? 29.735  13.208  -22.905 1.00 54.15  ? 346 PHE B CA  1 
ATOM   6801 C C   . PHE B 1 349 ? 30.559  13.947  -23.953 1.00 55.43  ? 346 PHE B C   1 
ATOM   6802 O O   . PHE B 1 349 ? 30.018  14.584  -24.858 1.00 56.75  ? 346 PHE B O   1 
ATOM   6803 C CB  . PHE B 1 349 ? 29.247  11.872  -23.473 1.00 53.58  ? 346 PHE B CB  1 
ATOM   6804 C CG  . PHE B 1 349 ? 28.832  10.885  -22.421 1.00 45.34  ? 346 PHE B CG  1 
ATOM   6805 C CD1 . PHE B 1 349 ? 27.545  10.897  -21.912 1.00 49.11  ? 346 PHE B CD1 1 
ATOM   6806 C CD2 . PHE B 1 349 ? 29.729  9.949   -21.937 1.00 46.75  ? 346 PHE B CD2 1 
ATOM   6807 C CE1 . PHE B 1 349 ? 27.158  9.990   -20.940 1.00 47.38  ? 346 PHE B CE1 1 
ATOM   6808 C CE2 . PHE B 1 349 ? 29.349  9.044   -20.964 1.00 46.25  ? 346 PHE B CE2 1 
ATOM   6809 C CZ  . PHE B 1 349 ? 28.061  9.063   -20.467 1.00 42.98  ? 346 PHE B CZ  1 
ATOM   6810 N N   . SER B 1 350 ? 31.877  13.848  -23.819 1.00 55.76  ? 347 SER B N   1 
ATOM   6811 C CA  . SER B 1 350 ? 32.806  14.494  -24.736 1.00 55.54  ? 347 SER B CA  1 
ATOM   6812 C C   . SER B 1 350 ? 34.150  13.779  -24.721 1.00 55.15  ? 347 SER B C   1 
ATOM   6813 O O   . SER B 1 350 ? 34.532  13.181  -23.714 1.00 52.10  ? 347 SER B O   1 
ATOM   6814 C CB  . SER B 1 350 ? 32.989  15.968  -24.370 1.00 56.53  ? 347 SER B CB  1 
ATOM   6815 O OG  . SER B 1 350 ? 34.167  16.492  -24.958 1.00 57.60  ? 347 SER B OG  1 
ATOM   6816 N N   . LYS B 1 351 ? 34.867  13.845  -25.837 1.00 50.47  ? 348 LYS B N   1 
ATOM   6817 C CA  . LYS B 1 351 ? 36.178  13.215  -25.942 1.00 51.19  ? 348 LYS B CA  1 
ATOM   6818 C C   . LYS B 1 351 ? 37.252  14.041  -25.241 1.00 50.79  ? 348 LYS B C   1 
ATOM   6819 O O   . LYS B 1 351 ? 38.369  13.568  -25.025 1.00 50.49  ? 348 LYS B O   1 
ATOM   6820 C CB  . LYS B 1 351 ? 36.566  13.014  -27.410 1.00 51.83  ? 348 LYS B CB  1 
ATOM   6821 C CG  . LYS B 1 351 ? 37.239  14.227  -28.041 1.00 52.50  ? 348 LYS B CG  1 
ATOM   6822 C CD  . LYS B 1 351 ? 37.798  13.903  -29.421 1.00 54.72  ? 348 LYS B CD  1 
ATOM   6823 C CE  . LYS B 1 351 ? 38.650  15.045  -29.957 1.00 55.48  ? 348 LYS B CE  1 
ATOM   6824 N NZ  . LYS B 1 351 ? 39.869  15.272  -29.127 1.00 53.19  ? 348 LYS B NZ  1 
ATOM   6825 N N   . ASP B 1 352 ? 36.910  15.276  -24.886 1.00 52.65  ? 349 ASP B N   1 
ATOM   6826 C CA  . ASP B 1 352 ? 37.901  16.222  -24.381 1.00 55.28  ? 349 ASP B CA  1 
ATOM   6827 C C   . ASP B 1 352 ? 37.922  16.346  -22.854 1.00 54.85  ? 349 ASP B C   1 
ATOM   6828 O O   . ASP B 1 352 ? 38.797  17.011  -22.299 1.00 56.17  ? 349 ASP B O   1 
ATOM   6829 C CB  . ASP B 1 352 ? 37.672  17.594  -25.018 1.00 52.56  ? 349 ASP B CB  1 
ATOM   6830 C CG  . ASP B 1 352 ? 37.842  17.565  -26.529 1.00 56.61  ? 349 ASP B CG  1 
ATOM   6831 O OD1 . ASP B 1 352 ? 38.819  16.947  -27.005 1.00 54.30  ? 349 ASP B OD1 1 
ATOM   6832 O OD2 . ASP B 1 352 ? 36.994  18.146  -27.240 1.00 52.66  ? 349 ASP B OD2 1 
ATOM   6833 N N   . ASN B 1 353 ? 36.965  15.716  -22.178 1.00 53.45  ? 350 ASN B N   1 
ATOM   6834 C CA  . ASN B 1 353 ? 37.036  15.590  -20.721 1.00 53.26  ? 350 ASN B CA  1 
ATOM   6835 C C   . ASN B 1 353 ? 36.672  14.171  -20.282 1.00 54.61  ? 350 ASN B C   1 
ATOM   6836 O O   . ASN B 1 353 ? 36.514  13.279  -21.117 1.00 48.43  ? 350 ASN B O   1 
ATOM   6837 C CB  . ASN B 1 353 ? 36.150  16.638  -20.026 1.00 46.98  ? 350 ASN B CB  1 
ATOM   6838 C CG  . ASN B 1 353 ? 34.680  16.528  -20.397 1.00 52.53  ? 350 ASN B CG  1 
ATOM   6839 O OD1 . ASN B 1 353 ? 34.124  15.437  -20.497 1.00 57.56  ? 350 ASN B OD1 1 
ATOM   6840 N ND2 . ASN B 1 353 ? 34.038  17.675  -20.592 1.00 56.69  ? 350 ASN B ND2 1 
ATOM   6841 N N   . GLU B 1 354 ? 36.539  13.960  -18.976 1.00 52.51  ? 351 GLU B N   1 
ATOM   6842 C CA  . GLU B 1 354 ? 36.348  12.612  -18.453 1.00 52.21  ? 351 GLU B CA  1 
ATOM   6843 C C   . GLU B 1 354 ? 34.881  12.188  -18.425 1.00 51.83  ? 351 GLU B C   1 
ATOM   6844 O O   . GLU B 1 354 ? 34.557  11.099  -17.948 1.00 51.72  ? 351 GLU B O   1 
ATOM   6845 C CB  . GLU B 1 354 ? 36.961  12.499  -17.056 1.00 57.05  ? 351 GLU B CB  1 
ATOM   6846 C CG  . GLU B 1 354 ? 38.478  12.383  -17.075 1.00 63.81  ? 351 GLU B CG  1 
ATOM   6847 C CD  . GLU B 1 354 ? 39.091  12.412  -15.688 1.00 74.55  ? 351 GLU B CD  1 
ATOM   6848 O OE1 . GLU B 1 354 ? 38.497  13.041  -14.786 1.00 71.31  ? 351 GLU B OE1 1 
ATOM   6849 O OE2 . GLU B 1 354 ? 40.165  11.802  -15.500 1.00 79.01  ? 351 GLU B OE2 1 
ATOM   6850 N N   . SER B 1 355 ? 34.007  13.054  -18.934 1.00 48.89  ? 352 SER B N   1 
ATOM   6851 C CA  . SER B 1 355 ? 32.590  12.738  -19.133 1.00 50.94  ? 352 SER B CA  1 
ATOM   6852 C C   . SER B 1 355 ? 31.888  12.204  -17.884 1.00 50.69  ? 352 SER B C   1 
ATOM   6853 O O   . SER B 1 355 ? 30.984  11.372  -17.972 1.00 47.50  ? 352 SER B O   1 
ATOM   6854 C CB  . SER B 1 355 ? 32.437  11.732  -20.275 1.00 47.26  ? 352 SER B CB  1 
ATOM   6855 O OG  . SER B 1 355 ? 32.867  12.301  -21.499 1.00 50.74  ? 352 SER B OG  1 
ATOM   6856 N N   . LEU B 1 356 ? 32.306  12.691  -16.724 1.00 50.55  ? 353 LEU B N   1 
ATOM   6857 C CA  . LEU B 1 356 ? 31.675  12.313  -15.471 1.00 48.40  ? 353 LEU B CA  1 
ATOM   6858 C C   . LEU B 1 356 ? 30.275  12.921  -15.386 1.00 53.83  ? 353 LEU B C   1 
ATOM   6859 O O   . LEU B 1 356 ? 30.124  14.114  -15.132 1.00 60.62  ? 353 LEU B O   1 
ATOM   6860 C CB  . LEU B 1 356 ? 32.544  12.759  -14.297 1.00 47.85  ? 353 LEU B CB  1 
ATOM   6861 C CG  . LEU B 1 356 ? 33.990  12.261  -14.395 1.00 50.05  ? 353 LEU B CG  1 
ATOM   6862 C CD1 . LEU B 1 356 ? 34.870  12.912  -13.340 1.00 55.70  ? 353 LEU B CD1 1 
ATOM   6863 C CD2 . LEU B 1 356 ? 34.047  10.746  -14.280 1.00 47.72  ? 353 LEU B CD2 1 
ATOM   6864 N N   . ILE B 1 357 ? 29.255  12.095  -15.604 1.00 50.02  ? 354 ILE B N   1 
ATOM   6865 C CA  . ILE B 1 357 ? 27.877  12.576  -15.671 1.00 48.03  ? 354 ILE B CA  1 
ATOM   6866 C C   . ILE B 1 357 ? 27.101  12.426  -14.362 1.00 50.82  ? 354 ILE B C   1 
ATOM   6867 O O   . ILE B 1 357 ? 27.539  11.742  -13.436 1.00 51.95  ? 354 ILE B O   1 
ATOM   6868 C CB  . ILE B 1 357 ? 27.091  11.843  -16.771 1.00 49.39  ? 354 ILE B CB  1 
ATOM   6869 C CG1 . ILE B 1 357 ? 27.149  10.331  -16.543 1.00 46.18  ? 354 ILE B CG1 1 
ATOM   6870 C CG2 . ILE B 1 357 ? 27.647  12.196  -18.142 1.00 48.61  ? 354 ILE B CG2 1 
ATOM   6871 C CD1 . ILE B 1 357 ? 26.088  9.555   -17.294 1.00 44.27  ? 354 ILE B CD1 1 
ATOM   6872 N N   . SER B 1 358 ? 25.937  13.068  -14.305 1.00 49.50  ? 355 SER B N   1 
ATOM   6873 C CA  . SER B 1 358 ? 25.053  12.974  -13.150 1.00 49.55  ? 355 SER B CA  1 
ATOM   6874 C C   . SER B 1 358 ? 24.020  11.873  -13.345 1.00 52.11  ? 355 SER B C   1 
ATOM   6875 O O   . SER B 1 358 ? 23.878  11.331  -14.442 1.00 44.78  ? 355 SER B O   1 
ATOM   6876 C CB  . SER B 1 358 ? 24.347  14.304  -12.901 1.00 49.00  ? 355 SER B CB  1 
ATOM   6877 O OG  . SER B 1 358 ? 23.330  14.523  -13.861 1.00 51.90  ? 355 SER B OG  1 
ATOM   6878 N N   . ARG B 1 359 ? 23.292  11.551  -12.279 1.00 44.36  ? 356 ARG B N   1 
ATOM   6879 C CA  . ARG B 1 359 ? 22.293  10.490  -12.330 0.94 50.17  ? 356 ARG B CA  1 
ATOM   6880 C C   . ARG B 1 359 ? 21.146  10.835  -13.283 1.00 47.96  ? 356 ARG B C   1 
ATOM   6881 O O   . ARG B 1 359 ? 20.679  9.982   -14.052 1.00 49.77  ? 356 ARG B O   1 
ATOM   6882 C CB  . ARG B 1 359 ? 21.750  10.199  -10.929 1.00 47.09  ? 356 ARG B CB  1 
ATOM   6883 C CG  . ARG B 1 359 ? 20.662  9.148   -10.921 1.00 47.11  ? 356 ARG B CG  1 
ATOM   6884 C CD  . ARG B 1 359 ? 20.775  8.207   -9.736  1.00 52.95  ? 356 ARG B CD  1 
ATOM   6885 N NE  . ARG B 1 359 ? 19.916  7.046   -9.940  0.82 52.50  ? 356 ARG B NE  1 
ATOM   6886 C CZ  . ARG B 1 359 ? 20.353  5.848   -10.313 0.83 46.86  ? 356 ARG B CZ  1 
ATOM   6887 N NH1 . ARG B 1 359 ? 21.650  5.636   -10.500 1.00 46.60  ? 356 ARG B NH1 1 
ATOM   6888 N NH2 . ARG B 1 359 ? 19.491  4.857   -10.484 1.00 44.80  ? 356 ARG B NH2 1 
ATOM   6889 N N   . ALA B 1 360 ? 20.698  12.086  -13.232 1.00 44.78  ? 357 ALA B N   1 
ATOM   6890 C CA  . ALA B 1 360 ? 19.677  12.572  -14.158 1.00 49.81  ? 357 ALA B CA  1 
ATOM   6891 C C   . ALA B 1 360 ? 20.118  12.372  -15.611 1.00 44.24  ? 357 ALA B C   1 
ATOM   6892 O O   . ALA B 1 360 ? 19.329  11.944  -16.468 1.00 44.97  ? 357 ALA B O   1 
ATOM   6893 C CB  . ALA B 1 360 ? 19.377  14.036  -13.894 1.00 48.08  ? 357 ALA B CB  1 
ATOM   6894 N N   . GLN B 1 361 ? 21.387  12.680  -15.872 1.00 44.43  ? 358 GLN B N   1 
ATOM   6895 C CA  . GLN B 1 361 ? 21.963  12.518  -17.206 1.00 47.25  ? 358 GLN B CA  1 
ATOM   6896 C C   . GLN B 1 361 ? 22.026  11.047  -17.593 1.00 46.49  ? 358 GLN B C   1 
ATOM   6897 O O   . GLN B 1 361 ? 21.914  10.707  -18.766 1.00 50.05  ? 358 GLN B O   1 
ATOM   6898 C CB  . GLN B 1 361 ? 23.361  13.136  -17.276 1.00 45.64  ? 358 GLN B CB  1 
ATOM   6899 C CG  . GLN B 1 361 ? 23.368  14.659  -17.301 1.00 47.72  ? 358 GLN B CG  1 
ATOM   6900 C CD  . GLN B 1 361 ? 24.770  15.237  -17.381 1.00 51.11  ? 358 GLN B CD  1 
ATOM   6901 O OE1 . GLN B 1 361 ? 25.650  14.881  -16.596 1.00 48.45  ? 358 GLN B OE1 1 
ATOM   6902 N NE2 . GLN B 1 361 ? 24.987  16.129  -18.342 1.00 58.55  ? 358 GLN B NE2 1 
ATOM   6903 N N   . PHE B 1 362 ? 22.213  10.177  -16.605 1.00 44.12  ? 359 PHE B N   1 
ATOM   6904 C CA  . PHE B 1 362 ? 22.214  8.745   -16.860 1.00 42.72  ? 359 PHE B CA  1 
ATOM   6905 C C   . PHE B 1 362 ? 20.835  8.286   -17.309 1.00 46.36  ? 359 PHE B C   1 
ATOM   6906 O O   . PHE B 1 362 ? 20.714  7.570   -18.304 1.00 45.31  ? 359 PHE B O   1 
ATOM   6907 C CB  . PHE B 1 362 ? 22.660  7.962   -15.623 1.00 42.20  ? 359 PHE B CB  1 
ATOM   6908 C CG  . PHE B 1 362 ? 22.573  6.467   -15.787 1.00 44.97  ? 359 PHE B CG  1 
ATOM   6909 C CD1 . PHE B 1 362 ? 23.204  5.833   -16.847 1.00 44.27  ? 359 PHE B CD1 1 
ATOM   6910 C CD2 . PHE B 1 362 ? 21.871  5.695   -14.873 1.00 47.31  ? 359 PHE B CD2 1 
ATOM   6911 C CE1 . PHE B 1 362 ? 23.126  4.459   -16.998 1.00 43.68  ? 359 PHE B CE1 1 
ATOM   6912 C CE2 . PHE B 1 362 ? 21.793  4.319   -15.015 1.00 44.05  ? 359 PHE B CE2 1 
ATOM   6913 C CZ  . PHE B 1 362 ? 22.421  3.700   -16.080 1.00 45.11  ? 359 PHE B CZ  1 
ATOM   6914 N N   . LEU B 1 363 ? 19.795  8.701   -16.589 1.00 45.19  ? 360 LEU B N   1 
ATOM   6915 C CA  . LEU B 1 363 ? 18.432  8.326   -16.975 1.00 44.55  ? 360 LEU B CA  1 
ATOM   6916 C C   . LEU B 1 363 ? 18.084  8.834   -18.384 1.00 44.42  ? 360 LEU B C   1 
ATOM   6917 O O   . LEU B 1 363 ? 17.583  8.070   -19.239 1.00 47.86  ? 360 LEU B O   1 
ATOM   6918 C CB  . LEU B 1 363 ? 17.414  8.847   -15.950 1.00 41.73  ? 360 LEU B CB  1 
ATOM   6919 C CG  . LEU B 1 363 ? 17.139  7.973   -14.712 1.00 54.77  ? 360 LEU B CG  1 
ATOM   6920 C CD1 . LEU B 1 363 ? 18.378  7.769   -13.839 1.00 49.11  ? 360 LEU B CD1 1 
ATOM   6921 C CD2 . LEU B 1 363 ? 15.992  8.536   -13.874 1.00 50.28  ? 360 LEU B CD2 1 
ATOM   6922 N N   . ALA B 1 364 ? 18.360  10.114  -18.634 1.00 42.76  ? 361 ALA B N   1 
ATOM   6923 C CA  . ALA B 1 364 ? 18.104  10.682  -19.965 1.00 46.26  ? 361 ALA B CA  1 
ATOM   6924 C C   . ALA B 1 364 ? 18.860  9.905   -21.045 1.00 45.19  ? 361 ALA B C   1 
ATOM   6925 O O   . ALA B 1 364 ? 18.304  9.546   -22.098 1.00 50.41  ? 361 ALA B O   1 
ATOM   6926 C CB  . ALA B 1 364 ? 18.490  12.151  -20.001 1.00 43.47  ? 361 ALA B CB  1 
ATOM   6927 N N   . GLY B 1 365 ? 20.130  9.639   -20.759 1.00 45.21  ? 362 GLY B N   1 
ATOM   6928 C CA  . GLY B 1 365 ? 20.986  8.876   -21.644 1.00 46.06  ? 362 GLY B CA  1 
ATOM   6929 C C   . GLY B 1 365 ? 20.406  7.518   -21.973 1.00 46.17  ? 362 GLY B C   1 
ATOM   6930 O O   . GLY B 1 365 ? 20.479  7.070   -23.115 1.00 43.39  ? 362 GLY B O   1 
ATOM   6931 N N   . VAL B 1 366 ? 19.832  6.859   -20.971 1.00 44.72  ? 363 VAL B N   1 
ATOM   6932 C CA  . VAL B 1 366 ? 19.183  5.573   -21.187 1.00 43.02  ? 363 VAL B CA  1 
ATOM   6933 C C   . VAL B 1 366 ? 18.012  5.746   -22.146 1.00 44.83  ? 363 VAL B C   1 
ATOM   6934 O O   . VAL B 1 366 ? 17.791  4.904   -23.025 1.00 40.56  ? 363 VAL B O   1 
ATOM   6935 C CB  . VAL B 1 366 ? 18.700  4.939   -19.859 1.00 43.03  ? 363 VAL B CB  1 
ATOM   6936 C CG1 . VAL B 1 366 ? 17.716  3.808   -20.121 1.00 39.55  ? 363 VAL B CG1 1 
ATOM   6937 C CG2 . VAL B 1 366 ? 19.888  4.429   -19.060 1.00 37.28  ? 363 VAL B CG2 1 
ATOM   6938 N N   . ARG B 1 367 ? 17.272  6.843   -22.000 1.00 44.14  ? 364 ARG B N   1 
ATOM   6939 C CA  . ARG B 1 367 ? 16.159  7.075   -22.923 1.00 41.66  ? 364 ARG B CA  1 
ATOM   6940 C C   . ARG B 1 367 ? 16.664  7.245   -24.356 1.00 46.57  ? 364 ARG B C   1 
ATOM   6941 O O   . ARG B 1 367 ? 16.000  6.827   -25.306 1.00 44.24  ? 364 ARG B O   1 
ATOM   6942 C CB  . ARG B 1 367 ? 15.331  8.296   -22.513 1.00 48.64  ? 364 ARG B CB  1 
ATOM   6943 C CG  . ARG B 1 367 ? 14.756  8.228   -21.098 1.00 47.17  ? 364 ARG B CG  1 
ATOM   6944 C CD  . ARG B 1 367 ? 14.278  6.826   -20.737 1.00 45.74  ? 364 ARG B CD  1 
ATOM   6945 N NE  . ARG B 1 367 ? 13.191  6.330   -21.581 1.00 45.89  ? 364 ARG B NE  1 
ATOM   6946 C CZ  . ARG B 1 367 ? 11.904  6.359   -21.245 1.00 51.34  ? 364 ARG B CZ  1 
ATOM   6947 N NH1 . ARG B 1 367 ? 11.526  6.876   -20.081 1.00 51.20  ? 364 ARG B NH1 1 
ATOM   6948 N NH2 . ARG B 1 367 ? 10.990  5.873   -22.074 1.00 50.70  ? 364 ARG B NH2 1 
ATOM   6949 N N   . ILE B 1 368 ? 17.840  7.845   -24.513 1.00 44.73  ? 365 ILE B N   1 
ATOM   6950 C CA  . ILE B 1 368 ? 18.403  8.023   -25.854 1.00 48.69  ? 365 ILE B CA  1 
ATOM   6951 C C   . ILE B 1 368 ? 18.984  6.719   -26.431 1.00 47.46  ? 365 ILE B C   1 
ATOM   6952 O O   . ILE B 1 368 ? 18.859  6.445   -27.627 1.00 46.89  ? 365 ILE B O   1 
ATOM   6953 C CB  . ILE B 1 368 ? 19.492  9.120   -25.851 1.00 49.61  ? 365 ILE B CB  1 
ATOM   6954 C CG1 . ILE B 1 368 ? 18.889  10.460  -25.423 1.00 50.42  ? 365 ILE B CG1 1 
ATOM   6955 C CG2 . ILE B 1 368 ? 20.135  9.261   -27.222 1.00 49.40  ? 365 ILE B CG2 1 
ATOM   6956 C CD1 . ILE B 1 368 ? 19.911  11.559  -25.249 1.00 47.81  ? 365 ILE B CD1 1 
ATOM   6957 N N   . GLY B 1 369 ? 19.598  5.910   -25.572 1.00 41.69  ? 366 GLY B N   1 
ATOM   6958 C CA  . GLY B 1 369 ? 20.281  4.698   -25.988 1.00 37.50  ? 366 GLY B CA  1 
ATOM   6959 C C   . GLY B 1 369 ? 19.349  3.523   -26.196 1.00 42.73  ? 366 GLY B C   1 
ATOM   6960 O O   . GLY B 1 369 ? 19.678  2.568   -26.904 1.00 44.77  ? 366 GLY B O   1 
ATOM   6961 N N   . VAL B 1 370 ? 18.179  3.585   -25.573 1.00 39.13  ? 367 VAL B N   1 
ATOM   6962 C CA  . VAL B 1 370 ? 17.165  2.556   -25.756 1.00 40.38  ? 367 VAL B CA  1 
ATOM   6963 C C   . VAL B 1 370 ? 15.845  3.222   -26.127 1.00 42.56  ? 367 VAL B C   1 
ATOM   6964 O O   . VAL B 1 370 ? 14.911  3.240   -25.332 1.00 38.50  ? 367 VAL B O   1 
ATOM   6965 C CB  . VAL B 1 370 ? 16.980  1.693   -24.482 1.00 41.21  ? 367 VAL B CB  1 
ATOM   6966 C CG1 . VAL B 1 370 ? 16.316  0.367   -24.829 1.00 36.74  ? 367 VAL B CG1 1 
ATOM   6967 C CG2 . VAL B 1 370 ? 18.318  1.452   -23.795 1.00 35.96  ? 367 VAL B CG2 1 
ATOM   6968 N N   . PRO B 1 371 ? 15.763  3.770   -27.351 1.00 41.92  ? 368 PRO B N   1 
ATOM   6969 C CA  . PRO B 1 371 ? 14.627  4.605   -27.757 1.00 39.87  ? 368 PRO B CA  1 
ATOM   6970 C C   . PRO B 1 371 ? 13.298  3.856   -27.809 1.00 41.29  ? 368 PRO B C   1 
ATOM   6971 O O   . PRO B 1 371 ? 12.247  4.490   -27.743 1.00 47.63  ? 368 PRO B O   1 
ATOM   6972 C CB  . PRO B 1 371 ? 15.033  5.087   -29.156 1.00 45.55  ? 368 PRO B CB  1 
ATOM   6973 C CG  . PRO B 1 371 ? 15.968  4.045   -29.654 1.00 42.90  ? 368 PRO B CG  1 
ATOM   6974 C CD  . PRO B 1 371 ? 16.727  3.577   -28.449 1.00 46.00  ? 368 PRO B CD  1 
ATOM   6975 N N   . GLN B 1 372 ? 13.339  2.534   -27.921 1.00 39.35  ? 369 GLN B N   1 
ATOM   6976 C CA  . GLN B 1 372 ? 12.108  1.752   -27.968 1.00 44.35  ? 369 GLN B CA  1 
ATOM   6977 C C   . GLN B 1 372 ? 11.594  1.410   -26.572 1.00 48.45  ? 369 GLN B C   1 
ATOM   6978 O O   . GLN B 1 372 ? 10.530  0.807   -26.423 1.00 46.10  ? 369 GLN B O   1 
ATOM   6979 C CB  . GLN B 1 372 ? 12.320  0.466   -28.767 1.00 49.38  ? 369 GLN B CB  1 
ATOM   6980 C CG  . GLN B 1 372 ? 12.594  0.706   -30.237 1.00 51.49  ? 369 GLN B CG  1 
ATOM   6981 C CD  . GLN B 1 372 ? 11.567  1.623   -30.870 1.00 55.82  ? 369 GLN B CD  1 
ATOM   6982 O OE1 . GLN B 1 372 ? 11.916  2.630   -31.489 1.00 62.27  ? 369 GLN B OE1 1 
ATOM   6983 N NE2 . GLN B 1 372 ? 10.290  1.280   -30.719 1.00 57.32  ? 369 GLN B NE2 1 
ATOM   6984 N N   . ALA B 1 373 ? 12.350  1.800   -25.552 1.00 41.45  ? 370 ALA B N   1 
ATOM   6985 C CA  . ALA B 1 373 ? 12.009  1.429   -24.182 1.00 46.12  ? 370 ALA B CA  1 
ATOM   6986 C C   . ALA B 1 373 ? 10.774  2.159   -23.682 1.00 45.27  ? 370 ALA B C   1 
ATOM   6987 O O   . ALA B 1 373 ? 10.697  3.385   -23.753 1.00 47.24  ? 370 ALA B O   1 
ATOM   6988 C CB  . ALA B 1 373 ? 13.181  1.701   -23.252 1.00 42.44  ? 370 ALA B CB  1 
ATOM   6989 N N   . SER B 1 374 ? 9.808   1.397   -23.180 1.00 48.01  ? 371 SER B N   1 
ATOM   6990 C CA  . SER B 1 374 ? 8.728   1.969   -22.385 1.00 48.32  ? 371 SER B CA  1 
ATOM   6991 C C   . SER B 1 374 ? 9.325   2.517   -21.095 1.00 46.77  ? 371 SER B C   1 
ATOM   6992 O O   . SER B 1 374 ? 10.490  2.256   -20.789 1.00 46.44  ? 371 SER B O   1 
ATOM   6993 C CB  . SER B 1 374 ? 7.653   0.924   -22.078 1.00 48.54  ? 371 SER B CB  1 
ATOM   6994 O OG  . SER B 1 374 ? 8.137   -0.056  -21.171 1.00 47.20  ? 371 SER B OG  1 
ATOM   6995 N N   . ASP B 1 375 ? 8.539   3.274   -20.336 1.00 49.57  ? 372 ASP B N   1 
ATOM   6996 C CA  . ASP B 1 375 ? 9.025   3.812   -19.069 1.00 50.74  ? 372 ASP B CA  1 
ATOM   6997 C C   . ASP B 1 375 ? 9.443   2.687   -18.123 1.00 45.67  ? 372 ASP B C   1 
ATOM   6998 O O   . ASP B 1 375 ? 10.458  2.794   -17.427 1.00 45.80  ? 372 ASP B O   1 
ATOM   6999 C CB  . ASP B 1 375 ? 7.964   4.698   -18.412 1.00 54.33  ? 372 ASP B CB  1 
ATOM   7000 C CG  . ASP B 1 375 ? 7.779   6.022   -19.138 1.00 59.33  ? 372 ASP B CG  1 
ATOM   7001 O OD1 . ASP B 1 375 ? 8.593   6.332   -20.037 1.00 55.58  ? 372 ASP B OD1 1 
ATOM   7002 O OD2 . ASP B 1 375 ? 6.825   6.757   -18.803 1.00 63.46  ? 372 ASP B OD2 1 
ATOM   7003 N N   . LEU B 1 376 ? 8.677   1.600   -18.121 1.00 43.72  ? 373 LEU B N   1 
ATOM   7004 C CA  . LEU B 1 376 ? 8.994   0.452   -17.275 1.00 46.94  ? 373 LEU B CA  1 
ATOM   7005 C C   . LEU B 1 376 ? 10.310  -0.202  -17.687 1.00 44.47  ? 373 LEU B C   1 
ATOM   7006 O O   . LEU B 1 376 ? 11.138  -0.535  -16.839 1.00 41.84  ? 373 LEU B O   1 
ATOM   7007 C CB  . LEU B 1 376 ? 7.869   -0.584  -17.316 1.00 44.27  ? 373 LEU B CB  1 
ATOM   7008 C CG  . LEU B 1 376 ? 8.083   -1.756  -16.354 1.00 45.74  ? 373 LEU B CG  1 
ATOM   7009 C CD1 . LEU B 1 376 ? 8.180   -1.253  -14.917 1.00 42.76  ? 373 LEU B CD1 1 
ATOM   7010 C CD2 . LEU B 1 376 ? 6.982   -2.795  -16.492 1.00 43.28  ? 373 LEU B CD2 1 
ATOM   7011 N N   . ALA B 1 377 ? 10.493  -0.384  -18.993 1.00 43.95  ? 374 ALA B N   1 
ATOM   7012 C CA  . ALA B 1 377 ? 11.704  -0.995  -19.532 1.00 40.46  ? 374 ALA B CA  1 
ATOM   7013 C C   . ALA B 1 377 ? 12.934  -0.161  -19.194 1.00 38.23  ? 374 ALA B C   1 
ATOM   7014 O O   . ALA B 1 377 ? 13.970  -0.691  -18.778 1.00 38.85  ? 374 ALA B O   1 
ATOM   7015 C CB  . ALA B 1 377 ? 11.581  -1.171  -21.051 1.00 43.77  ? 374 ALA B CB  1 
ATOM   7016 N N   . ALA B 1 378 ? 12.814  1.150   -19.386 1.00 38.93  ? 375 ALA B N   1 
ATOM   7017 C CA  . ALA B 1 378 ? 13.904  2.065   -19.080 1.00 40.81  ? 375 ALA B CA  1 
ATOM   7018 C C   . ALA B 1 378 ? 14.218  2.032   -17.584 1.00 39.94  ? 375 ALA B C   1 
ATOM   7019 O O   . ALA B 1 378 ? 15.387  2.041   -17.186 1.00 39.41  ? 375 ALA B O   1 
ATOM   7020 C CB  . ALA B 1 378 ? 13.558  3.476   -19.528 1.00 41.64  ? 375 ALA B CB  1 
ATOM   7021 N N   . GLU B 1 379 ? 13.180  1.978   -16.755 1.00 40.40  ? 376 GLU B N   1 
ATOM   7022 C CA  . GLU B 1 379 ? 13.411  1.891   -15.312 1.00 42.80  ? 376 GLU B CA  1 
ATOM   7023 C C   . GLU B 1 379 ? 14.128  0.593   -14.963 1.00 42.19  ? 376 GLU B C   1 
ATOM   7024 O O   . GLU B 1 379 ? 14.981  0.567   -14.077 1.00 40.15  ? 376 GLU B O   1 
ATOM   7025 C CB  . GLU B 1 379 ? 12.108  1.987   -14.523 1.00 43.94  ? 376 GLU B CB  1 
ATOM   7026 C CG  . GLU B 1 379 ? 12.360  2.055   -13.024 1.00 55.81  ? 376 GLU B CG  1 
ATOM   7027 C CD  . GLU B 1 379 ? 11.098  1.959   -12.199 1.00 59.31  ? 376 GLU B CD  1 
ATOM   7028 O OE1 . GLU B 1 379 ? 10.019  2.322   -12.714 1.00 65.23  ? 376 GLU B OE1 1 
ATOM   7029 O OE2 . GLU B 1 379 ? 11.193  1.522   -11.031 1.00 54.62  ? 376 GLU B OE2 1 
ATOM   7030 N N   . ALA B 1 380 ? 13.792  -0.481  -15.673 1.00 39.09  ? 377 ALA B N   1 
ATOM   7031 C CA  . ALA B 1 380 ? 14.428  -1.772  -15.437 1.00 37.06  ? 377 ALA B CA  1 
ATOM   7032 C C   . ALA B 1 380 ? 15.901  -1.737  -15.828 1.00 39.12  ? 377 ALA B C   1 
ATOM   7033 O O   . ALA B 1 380 ? 16.747  -2.348  -15.162 1.00 35.24  ? 377 ALA B O   1 
ATOM   7034 C CB  . ALA B 1 380 ? 13.703  -2.864  -16.199 1.00 40.47  ? 377 ALA B CB  1 
ATOM   7035 N N   . VAL B 1 381 ? 16.203  -1.026  -16.913 1.00 36.33  ? 378 VAL B N   1 
ATOM   7036 C CA  . VAL B 1 381 ? 17.579  -0.876  -17.370 1.00 35.60  ? 378 VAL B CA  1 
ATOM   7037 C C   . VAL B 1 381 ? 18.393  -0.074  -16.360 1.00 33.70  ? 378 VAL B C   1 
ATOM   7038 O O   . VAL B 1 381 ? 19.507  -0.462  -15.990 1.00 38.00  ? 378 VAL B O   1 
ATOM   7039 C CB  . VAL B 1 381 ? 17.649  -0.186  -18.756 1.00 36.13  ? 378 VAL B CB  1 
ATOM   7040 C CG1 . VAL B 1 381 ? 19.090  0.113   -19.131 1.00 34.52  ? 378 VAL B CG1 1 
ATOM   7041 C CG2 . VAL B 1 381 ? 16.993  -1.061  -19.816 1.00 34.96  ? 378 VAL B CG2 1 
ATOM   7042 N N   . VAL B 1 382 ? 17.830  1.049   -15.925 1.00 37.50  ? 379 VAL B N   1 
ATOM   7043 C CA  . VAL B 1 382 ? 18.433  1.872   -14.878 1.00 38.25  ? 379 VAL B CA  1 
ATOM   7044 C C   . VAL B 1 382 ? 18.693  1.052   -13.610 1.00 38.35  ? 379 VAL B C   1 
ATOM   7045 O O   . VAL B 1 382 ? 19.766  1.134   -13.010 1.00 38.12  ? 379 VAL B O   1 
ATOM   7046 C CB  . VAL B 1 382 ? 17.532  3.080   -14.536 1.00 43.47  ? 379 VAL B CB  1 
ATOM   7047 C CG1 . VAL B 1 382 ? 17.994  3.769   -13.248 1.00 42.68  ? 379 VAL B CG1 1 
ATOM   7048 C CG2 . VAL B 1 382 ? 17.485  4.056   -15.703 1.00 40.60  ? 379 VAL B CG2 1 
ATOM   7049 N N   . LEU B 1 383 ? 17.710  0.247   -13.224 1.00 38.01  ? 380 LEU B N   1 
ATOM   7050 C CA  . LEU B 1 383 ? 17.812  -0.588  -12.027 1.00 40.63  ? 380 LEU B CA  1 
ATOM   7051 C C   . LEU B 1 383 ? 18.963  -1.573  -12.172 1.00 41.52  ? 380 LEU B C   1 
ATOM   7052 O O   . LEU B 1 383 ? 19.790  -1.716  -11.271 1.00 34.39  ? 380 LEU B O   1 
ATOM   7053 C CB  . LEU B 1 383 ? 16.489  -1.327  -11.781 1.00 41.24  ? 380 LEU B CB  1 
ATOM   7054 C CG  . LEU B 1 383 ? 16.240  -2.172  -10.522 1.00 46.51  ? 380 LEU B CG  1 
ATOM   7055 C CD1 . LEU B 1 383 ? 16.824  -3.582  -10.638 1.00 39.33  ? 380 LEU B CD1 1 
ATOM   7056 C CD2 . LEU B 1 383 ? 16.746  -1.472  -9.264  1.00 39.82  ? 380 LEU B CD2 1 
ATOM   7057 N N   . HIS B 1 384 ? 19.022  -2.236  -13.324 1.00 39.12  ? 381 HIS B N   1 
ATOM   7058 C CA  . HIS B 1 384 ? 20.032  -3.261  -13.555 1.00 37.52  ? 381 HIS B CA  1 
ATOM   7059 C C   . HIS B 1 384 ? 21.450  -2.697  -13.632 1.00 36.18  ? 381 HIS B C   1 
ATOM   7060 O O   . HIS B 1 384 ? 22.394  -3.328  -13.154 1.00 37.07  ? 381 HIS B O   1 
ATOM   7061 C CB  . HIS B 1 384 ? 19.722  -4.036  -14.840 1.00 36.12  ? 381 HIS B CB  1 
ATOM   7062 C CG  . HIS B 1 384 ? 20.689  -5.144  -15.121 1.00 37.62  ? 381 HIS B CG  1 
ATOM   7063 N ND1 . HIS B 1 384 ? 20.557  -6.404  -14.577 1.00 41.63  ? 381 HIS B ND1 1 
ATOM   7064 C CD2 . HIS B 1 384 ? 21.809  -5.180  -15.883 1.00 38.87  ? 381 HIS B CD2 1 
ATOM   7065 C CE1 . HIS B 1 384 ? 21.550  -7.169  -14.993 1.00 38.87  ? 381 HIS B CE1 1 
ATOM   7066 N NE2 . HIS B 1 384 ? 22.325  -6.451  -15.788 1.00 39.59  ? 381 HIS B NE2 1 
ATOM   7067 N N   . TYR B 1 385 ? 21.609  -1.518  -14.230 1.00 34.15  ? 382 TYR B N   1 
ATOM   7068 C CA  . TYR B 1 385 ? 22.956  -0.979  -14.439 1.00 34.66  ? 382 TYR B CA  1 
ATOM   7069 C C   . TYR B 1 385 ? 23.435  -0.014  -13.349 1.00 37.82  ? 382 TYR B C   1 
ATOM   7070 O O   . TYR B 1 385 ? 24.615  0.333   -13.302 1.00 39.53  ? 382 TYR B O   1 
ATOM   7071 C CB  . TYR B 1 385 ? 23.041  -0.294  -15.802 1.00 38.05  ? 382 TYR B CB  1 
ATOM   7072 C CG  . TYR B 1 385 ? 23.197  -1.274  -16.948 1.00 31.25  ? 382 TYR B CG  1 
ATOM   7073 C CD1 . TYR B 1 385 ? 22.087  -1.846  -17.555 1.00 33.77  ? 382 TYR B CD1 1 
ATOM   7074 C CD2 . TYR B 1 385 ? 24.458  -1.641  -17.408 1.00 31.92  ? 382 TYR B CD2 1 
ATOM   7075 C CE1 . TYR B 1 385 ? 22.226  -2.749  -18.611 1.00 36.09  ? 382 TYR B CE1 1 
ATOM   7076 C CE2 . TYR B 1 385 ? 24.608  -2.544  -18.462 1.00 34.25  ? 382 TYR B CE2 1 
ATOM   7077 C CZ  . TYR B 1 385 ? 23.489  -3.092  -19.057 1.00 33.59  ? 382 TYR B CZ  1 
ATOM   7078 O OH  . TYR B 1 385 ? 23.634  -3.986  -20.102 1.00 35.14  ? 382 TYR B OH  1 
ATOM   7079 N N   . THR B 1 386 ? 22.533  0.419   -12.478 1.00 36.55  ? 383 THR B N   1 
ATOM   7080 C CA  . THR B 1 386 ? 22.944  1.214   -11.319 1.00 37.79  ? 383 THR B CA  1 
ATOM   7081 C C   . THR B 1 386 ? 23.775  0.376   -10.355 1.00 37.16  ? 383 THR B C   1 
ATOM   7082 O O   . THR B 1 386 ? 23.422  -0.761  -10.056 1.00 35.20  ? 383 THR B O   1 
ATOM   7083 C CB  . THR B 1 386 ? 21.733  1.784   -10.563 1.00 39.42  ? 383 THR B CB  1 
ATOM   7084 O OG1 . THR B 1 386 ? 21.042  2.714   -11.401 1.00 38.04  ? 383 THR B OG1 1 
ATOM   7085 C CG2 . THR B 1 386 ? 22.171  2.488   -9.271  1.00 38.42  ? 383 THR B CG2 1 
ATOM   7086 N N   . ASP B 1 387 ? 24.892  0.929   -9.893  1.00 39.86  ? 384 ASP B N   1 
ATOM   7087 C CA  . ASP B 1 387 ? 25.619  0.346   -8.776  1.00 44.30  ? 384 ASP B CA  1 
ATOM   7088 C C   . ASP B 1 387 ? 25.003  0.921   -7.504  1.00 46.09  ? 384 ASP B C   1 
ATOM   7089 O O   . ASP B 1 387 ? 25.274  2.059   -7.126  1.00 41.47  ? 384 ASP B O   1 
ATOM   7090 C CB  . ASP B 1 387 ? 27.119  0.648   -8.862  1.00 46.39  ? 384 ASP B CB  1 
ATOM   7091 C CG  . ASP B 1 387 ? 27.932  -0.048  -7.772  1.00 51.46  ? 384 ASP B CG  1 
ATOM   7092 O OD1 . ASP B 1 387 ? 27.367  -0.416  -6.720  1.00 51.69  ? 384 ASP B OD1 1 
ATOM   7093 O OD2 . ASP B 1 387 ? 29.151  -0.230  -7.971  1.00 53.90  ? 384 ASP B OD2 1 
ATOM   7094 N N   . TRP B 1 388 ? 24.165  0.129   -6.850  1.00 42.13  ? 385 TRP B N   1 
ATOM   7095 C CA  . TRP B 1 388 ? 23.357  0.637   -5.751  1.00 44.71  ? 385 TRP B CA  1 
ATOM   7096 C C   . TRP B 1 388 ? 24.170  0.886   -4.487  1.00 43.49  ? 385 TRP B C   1 
ATOM   7097 O O   . TRP B 1 388 ? 23.656  1.423   -3.511  1.00 46.99  ? 385 TRP B O   1 
ATOM   7098 C CB  . TRP B 1 388 ? 22.199  -0.320  -5.488  1.00 38.64  ? 385 TRP B CB  1 
ATOM   7099 C CG  . TRP B 1 388 ? 21.218  -0.239  -6.599  1.00 41.47  ? 385 TRP B CG  1 
ATOM   7100 C CD1 . TRP B 1 388 ? 21.048  -1.132  -7.622  1.00 37.71  ? 385 TRP B CD1 1 
ATOM   7101 C CD2 . TRP B 1 388 ? 20.309  0.834   -6.847  1.00 42.05  ? 385 TRP B CD2 1 
ATOM   7102 N NE1 . TRP B 1 388 ? 20.061  -0.693  -8.472  1.00 39.18  ? 385 TRP B NE1 1 
ATOM   7103 C CE2 . TRP B 1 388 ? 19.594  0.514   -8.021  1.00 42.45  ? 385 TRP B CE2 1 
ATOM   7104 C CE3 . TRP B 1 388 ? 20.023  2.034   -6.186  1.00 42.15  ? 385 TRP B CE3 1 
ATOM   7105 C CZ2 . TRP B 1 388 ? 18.611  1.352   -8.548  1.00 41.96  ? 385 TRP B CZ2 1 
ATOM   7106 C CZ3 . TRP B 1 388 ? 19.044  2.862   -6.709  1.00 42.75  ? 385 TRP B CZ3 1 
ATOM   7107 C CH2 . TRP B 1 388 ? 18.350  2.517   -7.879  1.00 44.54  ? 385 TRP B CH2 1 
ATOM   7108 N N   . LEU B 1 389 ? 25.445  0.515   -4.524  1.00 45.37  ? 386 LEU B N   1 
ATOM   7109 C CA  . LEU B 1 389 ? 26.380  0.887   -3.472  1.00 46.96  ? 386 LEU B CA  1 
ATOM   7110 C C   . LEU B 1 389 ? 26.955  2.279   -3.753  1.00 51.78  ? 386 LEU B C   1 
ATOM   7111 O O   . LEU B 1 389 ? 27.372  2.984   -2.836  1.00 47.01  ? 386 LEU B O   1 
ATOM   7112 C CB  . LEU B 1 389 ? 27.497  -0.152  -3.360  1.00 49.03  ? 386 LEU B CB  1 
ATOM   7113 C CG  . LEU B 1 389 ? 28.454  -0.049  -2.172  1.00 52.29  ? 386 LEU B CG  1 
ATOM   7114 C CD1 . LEU B 1 389 ? 27.676  -0.031  -0.864  1.00 49.08  ? 386 LEU B CD1 1 
ATOM   7115 C CD2 . LEU B 1 389 ? 29.451  -1.200  -2.199  1.00 53.92  ? 386 LEU B CD2 1 
ATOM   7116 N N   . HIS B 1 390 ? 26.973  2.668   -5.029  1.00 47.99  ? 387 HIS B N   1 
ATOM   7117 C CA  . HIS B 1 390 ? 27.423  4.002   -5.429  1.00 46.36  ? 387 HIS B CA  1 
ATOM   7118 C C   . HIS B 1 390 ? 26.496  4.606   -6.481  1.00 47.39  ? 387 HIS B C   1 
ATOM   7119 O O   . HIS B 1 390 ? 26.923  4.849   -7.609  1.00 50.25  ? 387 HIS B O   1 
ATOM   7120 C CB  . HIS B 1 390 ? 28.847  3.955   -5.994  1.00 51.07  ? 387 HIS B CB  1 
ATOM   7121 C CG  . HIS B 1 390 ? 29.834  3.248   -5.117  1.00 51.78  ? 387 HIS B CG  1 
ATOM   7122 N ND1 . HIS B 1 390 ? 30.348  2.010   -5.428  1.00 53.62  ? 387 HIS B ND1 1 
ATOM   7123 C CD2 . HIS B 1 390 ? 30.406  3.616   -3.946  1.00 55.40  ? 387 HIS B CD2 1 
ATOM   7124 C CE1 . HIS B 1 390 ? 31.196  1.639   -4.481  1.00 55.02  ? 387 HIS B CE1 1 
ATOM   7125 N NE2 . HIS B 1 390 ? 31.248  2.593   -3.573  1.00 57.69  ? 387 HIS B NE2 1 
ATOM   7126 N N   . PRO B 1 391 ? 25.226  4.855   -6.123  1.00 46.16  ? 388 PRO B N   1 
ATOM   7127 C CA  . PRO B 1 391 ? 24.216  5.199   -7.138  1.00 45.09  ? 388 PRO B CA  1 
ATOM   7128 C C   . PRO B 1 391 ? 24.405  6.569   -7.786  1.00 49.19  ? 388 PRO B C   1 
ATOM   7129 O O   . PRO B 1 391 ? 23.744  6.869   -8.785  1.00 48.61  ? 388 PRO B O   1 
ATOM   7130 C CB  . PRO B 1 391 ? 22.907  5.168   -6.347  1.00 46.75  ? 388 PRO B CB  1 
ATOM   7131 C CG  . PRO B 1 391 ? 23.315  5.503   -4.946  1.00 44.62  ? 388 PRO B CG  1 
ATOM   7132 C CD  . PRO B 1 391 ? 24.670  4.876   -4.757  1.00 45.73  ? 388 PRO B CD  1 
ATOM   7133 N N   . GLU B 1 392 ? 25.296  7.382   -7.232  1.00 48.33  ? 389 GLU B N   1 
ATOM   7134 C CA  . GLU B 1 392 ? 25.461  8.755   -7.695  1.00 50.90  ? 389 GLU B CA  1 
ATOM   7135 C C   . GLU B 1 392 ? 26.852  9.010   -8.260  1.00 46.28  ? 389 GLU B C   1 
ATOM   7136 O O   . GLU B 1 392 ? 27.106  10.073  -8.827  1.00 49.34  ? 389 GLU B O   1 
ATOM   7137 C CB  . GLU B 1 392 ? 25.187  9.741   -6.554  1.00 51.72  ? 389 GLU B CB  1 
ATOM   7138 C CG  . GLU B 1 392 ? 23.895  9.482   -5.795  1.00 58.64  ? 389 GLU B CG  1 
ATOM   7139 C CD  . GLU B 1 392 ? 22.768  10.418  -6.197  1.00 65.64  ? 389 GLU B CD  1 
ATOM   7140 O OE1 . GLU B 1 392 ? 22.130  10.990  -5.287  1.00 71.86  ? 389 GLU B OE1 1 
ATOM   7141 O OE2 . GLU B 1 392 ? 22.517  10.580  -7.411  1.00 59.18  ? 389 GLU B OE2 1 
ATOM   7142 N N   . ASP B 1 393 ? 27.751  8.044   -8.096  1.00 43.63  ? 390 ASP B N   1 
ATOM   7143 C CA  . ASP B 1 393 ? 29.132  8.211   -8.543  1.00 46.14  ? 390 ASP B CA  1 
ATOM   7144 C C   . ASP B 1 393 ? 29.217  8.381   -10.059 1.00 50.50  ? 390 ASP B C   1 
ATOM   7145 O O   . ASP B 1 393 ? 28.844  7.480   -10.813 1.00 47.40  ? 390 ASP B O   1 
ATOM   7146 C CB  . ASP B 1 393 ? 29.992  7.029   -8.103  1.00 47.66  ? 390 ASP B CB  1 
ATOM   7147 C CG  . ASP B 1 393 ? 31.451  7.209   -8.471  1.00 53.43  ? 390 ASP B CG  1 
ATOM   7148 O OD1 . ASP B 1 393 ? 32.112  8.077   -7.864  1.00 58.93  ? 390 ASP B OD1 1 
ATOM   7149 O OD2 . ASP B 1 393 ? 31.939  6.487   -9.365  1.00 50.24  ? 390 ASP B OD2 1 
ATOM   7150 N N   . PRO B 1 394 ? 29.718  9.544   -10.503 1.00 51.44  ? 391 PRO B N   1 
ATOM   7151 C CA  . PRO B 1 394 ? 29.762  9.934   -11.919 1.00 47.62  ? 391 PRO B CA  1 
ATOM   7152 C C   . PRO B 1 394 ? 30.533  8.943   -12.787 1.00 43.89  ? 391 PRO B C   1 
ATOM   7153 O O   . PRO B 1 394 ? 30.087  8.633   -13.891 1.00 46.14  ? 391 PRO B O   1 
ATOM   7154 C CB  . PRO B 1 394 ? 30.467  11.296  -11.887 1.00 49.63  ? 391 PRO B CB  1 
ATOM   7155 C CG  . PRO B 1 394 ? 30.282  11.796  -10.491 1.00 50.18  ? 391 PRO B CG  1 
ATOM   7156 C CD  . PRO B 1 394 ? 30.313  10.571  -9.631  1.00 49.85  ? 391 PRO B CD  1 
ATOM   7157 N N   . THR B 1 395 ? 31.667  8.458   -12.292 1.00 42.44  ? 392 THR B N   1 
ATOM   7158 C CA  . THR B 1 395 ? 32.457  7.461   -13.008 1.00 46.37  ? 392 THR B CA  1 
ATOM   7159 C C   . THR B 1 395 ? 31.642  6.191   -13.279 1.00 48.95  ? 392 THR B C   1 
ATOM   7160 O O   . THR B 1 395 ? 31.559  5.717   -14.425 1.00 43.56  ? 392 THR B O   1 
ATOM   7161 C CB  . THR B 1 395 ? 33.733  7.104   -12.224 1.00 45.99  ? 392 THR B CB  1 
ATOM   7162 O OG1 . THR B 1 395 ? 34.502  8.293   -12.005 1.00 47.26  ? 392 THR B OG1 1 
ATOM   7163 C CG2 . THR B 1 395 ? 34.575  6.100   -12.990 1.00 44.81  ? 392 THR B CG2 1 
ATOM   7164 N N   . HIS B 1 396 ? 31.031  5.656   -12.222 1.00 45.63  ? 393 HIS B N   1 
ATOM   7165 C CA  . HIS B 1 396 ? 30.166  4.486   -12.341 1.00 45.83  ? 393 HIS B CA  1 
ATOM   7166 C C   . HIS B 1 396 ? 29.036  4.718   -13.341 1.00 42.68  ? 393 HIS B C   1 
ATOM   7167 O O   . HIS B 1 396 ? 28.744  3.853   -14.161 1.00 40.50  ? 393 HIS B O   1 
ATOM   7168 C CB  . HIS B 1 396 ? 29.570  4.106   -10.982 1.00 47.66  ? 393 HIS B CB  1 
ATOM   7169 C CG  . HIS B 1 396 ? 30.509  3.346   -10.096 1.00 52.50  ? 393 HIS B CG  1 
ATOM   7170 N ND1 . HIS B 1 396 ? 31.462  3.963   -9.314  1.00 52.12  ? 393 HIS B ND1 1 
ATOM   7171 C CD2 . HIS B 1 396 ? 30.636  2.017   -9.868  1.00 53.63  ? 393 HIS B CD2 1 
ATOM   7172 C CE1 . HIS B 1 396 ? 32.138  3.046   -8.644  1.00 52.58  ? 393 HIS B CE1 1 
ATOM   7173 N NE2 . HIS B 1 396 ? 31.657  1.858   -8.960  1.00 51.86  ? 393 HIS B NE2 1 
ATOM   7174 N N   . LEU B 1 397 ? 28.410  5.888   -13.267 1.00 40.10  ? 394 LEU B N   1 
ATOM   7175 C CA  . LEU B 1 397 ? 27.278  6.217   -14.130 1.00 42.03  ? 394 LEU B CA  1 
ATOM   7176 C C   . LEU B 1 397 ? 27.683  6.293   -15.606 1.00 42.52  ? 394 LEU B C   1 
ATOM   7177 O O   . LEU B 1 397 ? 26.962  5.817   -16.487 1.00 41.18  ? 394 LEU B O   1 
ATOM   7178 C CB  . LEU B 1 397 ? 26.647  7.539   -13.684 1.00 42.83  ? 394 LEU B CB  1 
ATOM   7179 C CG  . LEU B 1 397 ? 25.963  7.493   -12.315 1.00 46.90  ? 394 LEU B CG  1 
ATOM   7180 C CD1 . LEU B 1 397 ? 25.659  8.896   -11.801 1.00 47.14  ? 394 LEU B CD1 1 
ATOM   7181 C CD2 . LEU B 1 397 ? 24.695  6.654   -12.388 1.00 41.29  ? 394 LEU B CD2 1 
ATOM   7182 N N   . ARG B 1 398 ? 28.844  6.889   -15.856 1.00 40.32  ? 395 ARG B N   1 
ATOM   7183 C CA  . ARG B 1 398 ? 29.398  7.008   -17.200 1.00 43.36  ? 395 ARG B CA  1 
ATOM   7184 C C   . ARG B 1 398 ? 29.681  5.626   -17.797 1.00 43.78  ? 395 ARG B C   1 
ATOM   7185 O O   . ARG B 1 398 ? 29.197  5.283   -18.896 1.00 38.82  ? 395 ARG B O   1 
ATOM   7186 C CB  . ARG B 1 398 ? 30.672  7.860   -17.157 1.00 43.07  ? 395 ARG B CB  1 
ATOM   7187 C CG  . ARG B 1 398 ? 31.438  7.947   -18.466 1.00 42.95  ? 395 ARG B CG  1 
ATOM   7188 C CD  . ARG B 1 398 ? 32.794  7.283   -18.320 1.00 47.86  ? 395 ARG B CD  1 
ATOM   7189 N NE  . ARG B 1 398 ? 33.790  8.187   -17.763 1.00 47.51  ? 395 ARG B NE  1 
ATOM   7190 C CZ  . ARG B 1 398 ? 34.842  7.800   -17.048 1.00 45.16  ? 395 ARG B CZ  1 
ATOM   7191 N NH1 . ARG B 1 398 ? 35.039  6.518   -16.779 1.00 40.47  ? 395 ARG B NH1 1 
ATOM   7192 N NH2 . ARG B 1 398 ? 35.698  8.704   -16.594 1.00 52.81  ? 395 ARG B NH2 1 
ATOM   7193 N N   . ASP B 1 399 ? 30.442  4.826   -17.051 1.00 42.46  ? 396 ASP B N   1 
ATOM   7194 C CA  . ASP B 1 399 ? 30.762  3.467   -17.481 1.00 42.50  ? 396 ASP B CA  1 
ATOM   7195 C C   . ASP B 1 399 ? 29.500  2.626   -17.690 1.00 40.59  ? 396 ASP B C   1 
ATOM   7196 O O   . ASP B 1 399 ? 29.438  1.777   -18.590 1.00 38.45  ? 396 ASP B O   1 
ATOM   7197 C CB  . ASP B 1 399 ? 31.689  2.801   -16.463 1.00 46.54  ? 396 ASP B CB  1 
ATOM   7198 C CG  . ASP B 1 399 ? 33.059  3.450   -16.421 1.00 48.58  ? 396 ASP B CG  1 
ATOM   7199 O OD1 . ASP B 1 399 ? 33.361  4.240   -17.341 1.00 47.47  ? 396 ASP B OD1 1 
ATOM   7200 O OD2 . ASP B 1 399 ? 33.833  3.169   -15.482 1.00 47.00  ? 396 ASP B OD2 1 
ATOM   7201 N N   . ALA B 1 400 ? 28.492  2.885   -16.866 1.00 37.89  ? 397 ALA B N   1 
ATOM   7202 C CA  . ALA B 1 400 ? 27.218  2.188   -16.965 1.00 39.99  ? 397 ALA B CA  1 
ATOM   7203 C C   . ALA B 1 400 ? 26.492  2.554   -18.252 1.00 41.34  ? 397 ALA B C   1 
ATOM   7204 O O   . ALA B 1 400 ? 25.896  1.696   -18.892 1.00 38.56  ? 397 ALA B O   1 
ATOM   7205 C CB  . ALA B 1 400 ? 26.346  2.500   -15.769 1.00 38.34  ? 397 ALA B CB  1 
ATOM   7206 N N   . MET B 1 401 ? 26.525  3.837   -18.606 1.00 38.42  ? 398 MET B N   1 
ATOM   7207 C CA  . MET B 1 401 ? 25.892  4.321   -19.828 1.00 39.27  ? 398 MET B CA  1 
ATOM   7208 C C   . MET B 1 401 ? 26.527  3.633   -21.037 1.00 37.01  ? 398 MET B C   1 
ATOM   7209 O O   . MET B 1 401 ? 25.830  3.111   -21.938 1.00 38.33  ? 398 MET B O   1 
ATOM   7210 C CB  . MET B 1 401 ? 26.036  5.842   -19.927 1.00 42.85  ? 398 MET B CB  1 
ATOM   7211 C CG  . MET B 1 401 ? 25.240  6.500   -21.039 1.00 42.90  ? 398 MET B CG  1 
ATOM   7212 S SD  . MET B 1 401 ? 23.457  6.469   -20.774 1.00 44.16  ? 398 MET B SD  1 
ATOM   7213 C CE  . MET B 1 401 ? 22.981  5.100   -21.832 1.00 38.61  ? 398 MET B CE  1 
ATOM   7214 N N   . SER B 1 402 ? 27.859  3.618   -21.026 1.00 36.16  ? 399 SER B N   1 
ATOM   7215 C CA  . SER B 1 402 ? 28.617  2.905   -22.048 1.00 38.46  ? 399 SER B CA  1 
ATOM   7216 C C   . SER B 1 402 ? 28.180  1.443   -22.152 1.00 38.92  ? 399 SER B C   1 
ATOM   7217 O O   . SER B 1 402 ? 27.901  0.943   -23.249 1.00 33.99  ? 399 SER B O   1 
ATOM   7218 C CB  . SER B 1 402 ? 30.116  2.981   -21.756 1.00 38.96  ? 399 SER B CB  1 
ATOM   7219 O OG  . SER B 1 402 ? 30.854  2.282   -22.745 1.00 42.43  ? 399 SER B OG  1 
ATOM   7220 N N   . ALA B 1 403 ? 28.112  0.765   -21.009 1.00 35.48  ? 400 ALA B N   1 
ATOM   7221 C CA  . ALA B 1 403 ? 27.728  -0.645  -20.978 1.00 35.33  ? 400 ALA B CA  1 
ATOM   7222 C C   . ALA B 1 403 ? 26.308  -0.868  -21.491 1.00 34.22  ? 400 ALA B C   1 
ATOM   7223 O O   . ALA B 1 403 ? 26.046  -1.848  -22.176 1.00 32.91  ? 400 ALA B O   1 
ATOM   7224 C CB  . ALA B 1 403 ? 27.870  -1.208  -19.557 1.00 31.85  ? 400 ALA B CB  1 
ATOM   7225 N N   . VAL B 1 404 ? 25.389  0.032   -21.158 1.00 31.63  ? 401 VAL B N   1 
ATOM   7226 C CA  . VAL B 1 404 ? 24.020  -0.083  -21.646 1.00 30.39  ? 401 VAL B CA  1 
ATOM   7227 C C   . VAL B 1 404 ? 23.999  -0.058  -23.174 1.00 35.90  ? 401 VAL B C   1 
ATOM   7228 O O   . VAL B 1 404 ? 23.376  -0.920  -23.814 1.00 31.99  ? 401 VAL B O   1 
ATOM   7229 C CB  . VAL B 1 404 ? 23.116  1.047   -21.119 1.00 32.96  ? 401 VAL B CB  1 
ATOM   7230 C CG1 . VAL B 1 404 ? 21.804  1.084   -21.899 1.00 32.18  ? 401 VAL B CG1 1 
ATOM   7231 C CG2 . VAL B 1 404 ? 22.856  0.882   -19.620 1.00 39.74  ? 401 VAL B CG2 1 
ATOM   7232 N N   . VAL B 1 405 ? 24.688  0.920   -23.759 1.00 34.97  ? 402 VAL B N   1 
ATOM   7233 C CA  . VAL B 1 405 ? 24.688  1.020   -25.229 1.00 33.72  ? 402 VAL B CA  1 
ATOM   7234 C C   . VAL B 1 405 ? 25.384  -0.176  -25.897 1.00 33.44  ? 402 VAL B C   1 
ATOM   7235 O O   . VAL B 1 405 ? 24.843  -0.792  -26.834 1.00 36.32  ? 402 VAL B O   1 
ATOM   7236 C CB  . VAL B 1 405 ? 25.345  2.331   -25.692 1.00 35.61  ? 402 VAL B CB  1 
ATOM   7237 C CG1 . VAL B 1 405 ? 25.441  2.384   -27.224 1.00 38.79  ? 402 VAL B CG1 1 
ATOM   7238 C CG2 . VAL B 1 405 ? 24.559  3.519   -25.153 1.00 35.20  ? 402 VAL B CG2 1 
ATOM   7239 N N   . GLY B 1 406 ? 26.570  -0.516  -25.401 1.00 35.34  ? 403 GLY B N   1 
ATOM   7240 C CA  . GLY B 1 406 ? 27.330  -1.633  -25.938 1.00 32.91  ? 403 GLY B CA  1 
ATOM   7241 C C   . GLY B 1 406 ? 26.640  -2.984  -25.829 1.00 37.47  ? 403 GLY B C   1 
ATOM   7242 O O   . GLY B 1 406 ? 26.681  -3.784  -26.766 1.00 30.28  ? 403 GLY B O   1 
ATOM   7243 N N   . ASP B 1 407 ? 26.008  -3.242  -24.685 1.00 28.40  ? 404 ASP B N   1 
ATOM   7244 C CA  . ASP B 1 407 ? 25.303  -4.500  -24.454 1.00 31.12  ? 404 ASP B CA  1 
ATOM   7245 C C   . ASP B 1 407 ? 24.026  -4.583  -25.276 1.00 29.96  ? 404 ASP B C   1 
ATOM   7246 O O   . ASP B 1 407 ? 23.733  -5.615  -25.879 1.00 31.66  ? 404 ASP B O   1 
ATOM   7247 C CB  . ASP B 1 407 ? 24.951  -4.675  -22.968 1.00 29.85  ? 404 ASP B CB  1 
ATOM   7248 C CG  . ASP B 1 407 ? 26.171  -4.830  -22.082 1.00 36.66  ? 404 ASP B CG  1 
ATOM   7249 O OD1 . ASP B 1 407 ? 27.247  -5.202  -22.591 1.00 38.38  ? 404 ASP B OD1 1 
ATOM   7250 O OD2 . ASP B 1 407 ? 26.041  -4.590  -20.859 1.00 37.81  ? 404 ASP B OD2 1 
ATOM   7251 N N   . HIS B 1 408 ? 23.252  -3.501  -25.279 1.00 31.74  ? 405 HIS B N   1 
ATOM   7252 C CA  . HIS B 1 408 ? 22.012  -3.482  -26.046 1.00 30.87  ? 405 HIS B CA  1 
ATOM   7253 C C   . HIS B 1 408 ? 22.264  -3.658  -27.548 1.00 35.01  ? 405 HIS B C   1 
ATOM   7254 O O   . HIS B 1 408 ? 21.523  -4.375  -28.230 1.00 29.36  ? 405 HIS B O   1 
ATOM   7255 C CB  . HIS B 1 408 ? 21.261  -2.177  -25.805 1.00 34.42  ? 405 HIS B CB  1 
ATOM   7256 C CG  . HIS B 1 408 ? 19.968  -2.071  -26.554 1.00 34.16  ? 405 HIS B CG  1 
ATOM   7257 N ND1 . HIS B 1 408 ? 19.097  -3.130  -26.691 1.00 34.09  ? 405 HIS B ND1 1 
ATOM   7258 C CD2 . HIS B 1 408 ? 19.390  -1.024  -27.186 1.00 35.14  ? 405 HIS B CD2 1 
ATOM   7259 C CE1 . HIS B 1 408 ? 18.039  -2.742  -27.376 1.00 36.02  ? 405 HIS B CE1 1 
ATOM   7260 N NE2 . HIS B 1 408 ? 18.192  -1.466  -27.692 1.00 38.77  ? 405 HIS B NE2 1 
ATOM   7261 N N   . ASN B 1 409 ? 23.309  -3.016  -28.063 1.00 31.77  ? 406 ASN B N   1 
ATOM   7262 C CA  . ASN B 1 409 ? 23.501  -3.008  -29.517 1.00 33.45  ? 406 ASN B CA  1 
ATOM   7263 C C   . ASN B 1 409 ? 24.456  -4.055  -30.069 1.00 33.35  ? 406 ASN B C   1 
ATOM   7264 O O   . ASN B 1 409 ? 24.332  -4.450  -31.233 1.00 33.88  ? 406 ASN B O   1 
ATOM   7265 C CB  . ASN B 1 409 ? 23.963  -1.624  -29.974 1.00 30.44  ? 406 ASN B CB  1 
ATOM   7266 C CG  . ASN B 1 409 ? 22.887  -0.577  -29.805 1.00 33.84  ? 406 ASN B CG  1 
ATOM   7267 O OD1 . ASN B 1 409 ? 21.838  -0.655  -30.438 1.00 35.53  ? 406 ASN B OD1 1 
ATOM   7268 N ND2 . ASN B 1 409 ? 23.136  0.408   -28.949 1.00 35.63  ? 406 ASN B ND2 1 
ATOM   7269 N N   . VAL B 1 410 ? 25.408  -4.512  -29.261 1.00 29.46  ? 407 VAL B N   1 
ATOM   7270 C CA  . VAL B 1 410 ? 26.408  -5.445  -29.775 1.00 28.58  ? 407 VAL B CA  1 
ATOM   7271 C C   . VAL B 1 410 ? 26.571  -6.729  -28.953 1.00 31.70  ? 407 VAL B C   1 
ATOM   7272 O O   . VAL B 1 410 ? 26.360  -7.826  -29.471 1.00 30.84  ? 407 VAL B O   1 
ATOM   7273 C CB  . VAL B 1 410 ? 27.792  -4.776  -29.887 1.00 32.31  ? 407 VAL B CB  1 
ATOM   7274 C CG1 . VAL B 1 410 ? 28.775  -5.743  -30.516 1.00 32.30  ? 407 VAL B CG1 1 
ATOM   7275 C CG2 . VAL B 1 410 ? 27.711  -3.493  -30.724 1.00 34.34  ? 407 VAL B CG2 1 
ATOM   7276 N N   . VAL B 1 411 ? 26.959  -6.598  -27.686 1.00 28.97  ? 408 VAL B N   1 
ATOM   7277 C CA  . VAL B 1 411 ? 27.352  -7.769  -26.900 1.00 28.76  ? 408 VAL B CA  1 
ATOM   7278 C C   . VAL B 1 411 ? 26.250  -8.822  -26.802 1.00 28.08  ? 408 VAL B C   1 
ATOM   7279 O O   . VAL B 1 411 ? 26.474  -9.995  -27.101 1.00 31.79  ? 408 VAL B O   1 
ATOM   7280 C CB  . VAL B 1 411 ? 27.783  -7.373  -25.476 1.00 30.24  ? 408 VAL B CB  1 
ATOM   7281 C CG1 . VAL B 1 411 ? 28.133  -8.618  -24.669 1.00 30.94  ? 408 VAL B CG1 1 
ATOM   7282 C CG2 . VAL B 1 411 ? 28.972  -6.422  -25.531 1.00 31.06  ? 408 VAL B CG2 1 
ATOM   7283 N N   . CYS B 1 412 ? 25.055  -8.406  -26.404 1.00 26.60  ? 409 CYS B N   1 
ATOM   7284 C CA  . CYS B 1 412 ? 23.965  -9.356  -26.226 1.00 29.53  ? 409 CYS B CA  1 
ATOM   7285 C C   . CYS B 1 412 ? 23.367  -9.855  -27.556 1.00 31.34  ? 409 CYS B C   1 
ATOM   7286 O O   . CYS B 1 412 ? 22.981  -11.022 -27.645 1.00 31.67  ? 409 CYS B O   1 
ATOM   7287 C CB  . CYS B 1 412 ? 22.887  -8.746  -25.330 1.00 29.15  ? 409 CYS B CB  1 
ATOM   7288 S SG  . CYS B 1 412 ? 23.515  -8.431  -23.635 1.00 33.12  ? 409 CYS B SG  1 
ATOM   7289 N N   . PRO B 1 413 ? 23.278  -8.988  -28.586 1.00 29.73  ? 410 PRO B N   1 
ATOM   7290 C CA  . PRO B 1 413 ? 22.939  -9.595  -29.882 1.00 29.48  ? 410 PRO B CA  1 
ATOM   7291 C C   . PRO B 1 413 ? 23.965  -10.643 -30.325 1.00 28.00  ? 410 PRO B C   1 
ATOM   7292 O O   . PRO B 1 413 ? 23.576  -11.689 -30.847 1.00 31.46  ? 410 PRO B O   1 
ATOM   7293 C CB  . PRO B 1 413 ? 22.920  -8.394  -30.833 1.00 31.80  ? 410 PRO B CB  1 
ATOM   7294 C CG  . PRO B 1 413 ? 22.489  -7.265  -29.965 1.00 31.80  ? 410 PRO B CG  1 
ATOM   7295 C CD  . PRO B 1 413 ? 23.159  -7.519  -28.627 1.00 27.97  ? 410 PRO B CD  1 
ATOM   7296 N N   . VAL B 1 414 ? 25.250  -10.378 -30.107 1.00 27.93  ? 411 VAL B N   1 
ATOM   7297 C CA  . VAL B 1 414 ? 26.283  -11.369 -30.416 1.00 30.12  ? 411 VAL B CA  1 
ATOM   7298 C C   . VAL B 1 414 ? 26.084  -12.659 -29.614 1.00 32.38  ? 411 VAL B C   1 
ATOM   7299 O O   . VAL B 1 414 ? 26.181  -13.756 -30.167 1.00 30.64  ? 411 VAL B O   1 
ATOM   7300 C CB  . VAL B 1 414 ? 27.703  -10.813 -30.158 1.00 31.79  ? 411 VAL B CB  1 
ATOM   7301 C CG1 . VAL B 1 414 ? 28.707  -11.939 -30.053 1.00 31.37  ? 411 VAL B CG1 1 
ATOM   7302 C CG2 . VAL B 1 414 ? 28.116  -9.855  -31.277 1.00 29.27  ? 411 VAL B CG2 1 
ATOM   7303 N N   . ALA B 1 415 ? 25.793  -12.530 -28.317 1.00 28.54  ? 412 ALA B N   1 
ATOM   7304 C CA  . ALA B 1 415 ? 25.560  -13.700 -27.475 1.00 30.67  ? 412 ALA B CA  1 
ATOM   7305 C C   . ALA B 1 415 ? 24.383  -14.517 -28.006 1.00 31.01  ? 412 ALA B C   1 
ATOM   7306 O O   . ALA B 1 415 ? 24.457  -15.750 -28.110 1.00 31.50  ? 412 ALA B O   1 
ATOM   7307 C CB  . ALA B 1 415 ? 25.316  -13.278 -26.001 1.00 31.76  ? 412 ALA B CB  1 
ATOM   7308 N N   . GLN B 1 416 ? 23.308  -13.823 -28.373 1.00 29.90  ? 413 GLN B N   1 
ATOM   7309 C CA  . GLN B 1 416 ? 22.126  -14.494 -28.891 1.00 33.97  ? 413 GLN B CA  1 
ATOM   7310 C C   . GLN B 1 416 ? 22.437  -15.228 -30.196 1.00 35.06  ? 413 GLN B C   1 
ATOM   7311 O O   . GLN B 1 416 ? 22.071  -16.393 -30.367 1.00 32.79  ? 413 GLN B O   1 
ATOM   7312 C CB  . GLN B 1 416 ? 20.989  -13.497 -29.112 1.00 36.47  ? 413 GLN B CB  1 
ATOM   7313 C CG  . GLN B 1 416 ? 19.648  -14.170 -29.350 1.00 42.90  ? 413 GLN B CG  1 
ATOM   7314 C CD  . GLN B 1 416 ? 18.557  -13.190 -29.715 1.00 52.72  ? 413 GLN B CD  1 
ATOM   7315 O OE1 . GLN B 1 416 ? 18.748  -12.302 -30.552 1.00 54.02  ? 413 GLN B OE1 1 
ATOM   7316 N NE2 . GLN B 1 416 ? 17.403  -13.334 -29.074 1.00 57.19  ? 413 GLN B NE2 1 
ATOM   7317 N N   . LEU B 1 417 ? 23.120  -14.540 -31.107 1.00 34.05  ? 414 LEU B N   1 
ATOM   7318 C CA  . LEU B 1 417 ? 23.466  -15.126 -32.399 1.00 33.74  ? 414 LEU B CA  1 
ATOM   7319 C C   . LEU B 1 417 ? 24.336  -16.359 -32.226 1.00 31.37  ? 414 LEU B C   1 
ATOM   7320 O O   . LEU B 1 417 ? 24.058  -17.406 -32.804 1.00 31.83  ? 414 LEU B O   1 
ATOM   7321 C CB  . LEU B 1 417 ? 24.188  -14.111 -33.289 1.00 28.85  ? 414 LEU B CB  1 
ATOM   7322 C CG  . LEU B 1 417 ? 24.636  -14.703 -34.634 1.00 34.25  ? 414 LEU B CG  1 
ATOM   7323 C CD1 . LEU B 1 417 ? 23.432  -15.065 -35.494 1.00 29.85  ? 414 LEU B CD1 1 
ATOM   7324 C CD2 . LEU B 1 417 ? 25.586  -13.767 -35.380 1.00 30.22  ? 414 LEU B CD2 1 
ATOM   7325 N N   . ALA B 1 418 ? 25.388  -16.229 -31.424 1.00 31.75  ? 415 ALA B N   1 
ATOM   7326 C CA  . ALA B 1 418 ? 26.316  -17.331 -31.206 1.00 32.83  ? 415 ALA B CA  1 
ATOM   7327 C C   . ALA B 1 418 ? 25.581  -18.532 -30.616 1.00 35.92  ? 415 ALA B C   1 
ATOM   7328 O O   . ALA B 1 418 ? 25.797  -19.675 -31.035 1.00 34.43  ? 415 ALA B O   1 
ATOM   7329 C CB  . ALA B 1 418 ? 27.454  -16.896 -30.300 1.00 33.84  ? 415 ALA B CB  1 
ATOM   7330 N N   . GLY B 1 419 ? 24.700  -18.257 -29.656 1.00 36.57  ? 416 GLY B N   1 
ATOM   7331 C CA  . GLY B 1 419 ? 23.888  -19.296 -29.046 1.00 37.10  ? 416 GLY B CA  1 
ATOM   7332 C C   . GLY B 1 419 ? 22.993  -20.020 -30.040 1.00 38.91  ? 416 GLY B C   1 
ATOM   7333 O O   . GLY B 1 419 ? 22.975  -21.255 -30.081 1.00 39.69  ? 416 GLY B O   1 
ATOM   7334 N N   . ARG B 1 420 ? 22.251  -19.259 -30.844 1.00 36.26  ? 417 ARG B N   1 
ATOM   7335 C CA  . ARG B 1 420 ? 21.365  -19.857 -31.845 1.00 43.70  ? 417 ARG B CA  1 
ATOM   7336 C C   . ARG B 1 420 ? 22.140  -20.668 -32.880 1.00 39.18  ? 417 ARG B C   1 
ATOM   7337 O O   . ARG B 1 420 ? 21.762  -21.798 -33.192 1.00 42.15  ? 417 ARG B O   1 
ATOM   7338 C CB  . ARG B 1 420 ? 20.529  -18.791 -32.560 1.00 41.47  ? 417 ARG B CB  1 
ATOM   7339 C CG  . ARG B 1 420 ? 19.679  -17.926 -31.638 1.00 46.27  ? 417 ARG B CG  1 
ATOM   7340 C CD  . ARG B 1 420 ? 18.804  -18.762 -30.720 1.00 48.43  ? 417 ARG B CD  1 
ATOM   7341 N NE  . ARG B 1 420 ? 17.950  -19.690 -31.453 1.00 55.80  ? 417 ARG B NE  1 
ATOM   7342 C CZ  . ARG B 1 420 ? 16.725  -20.041 -31.071 1.00 59.77  ? 417 ARG B CZ  1 
ATOM   7343 N NH1 . ARG B 1 420 ? 16.202  -19.528 -29.963 1.00 60.08  ? 417 ARG B NH1 1 
ATOM   7344 N NH2 . ARG B 1 420 ? 16.021  -20.899 -31.802 1.00 58.41  ? 417 ARG B NH2 1 
ATOM   7345 N N   . LEU B 1 421 ? 23.211  -20.087 -33.416 1.00 37.51  ? 418 LEU B N   1 
ATOM   7346 C CA  . LEU B 1 421 ? 24.029  -20.771 -34.417 1.00 39.76  ? 418 LEU B CA  1 
ATOM   7347 C C   . LEU B 1 421 ? 24.578  -22.080 -33.871 1.00 42.01  ? 418 LEU B C   1 
ATOM   7348 O O   . LEU B 1 421 ? 24.515  -23.111 -34.542 1.00 46.89  ? 418 LEU B O   1 
ATOM   7349 C CB  . LEU B 1 421 ? 25.185  -19.887 -34.882 1.00 37.59  ? 418 LEU B CB  1 
ATOM   7350 C CG  . LEU B 1 421 ? 24.838  -18.638 -35.693 1.00 36.03  ? 418 LEU B CG  1 
ATOM   7351 C CD1 . LEU B 1 421 ? 26.101  -17.845 -35.971 1.00 33.79  ? 418 LEU B CD1 1 
ATOM   7352 C CD2 . LEU B 1 421 ? 24.121  -19.013 -36.983 1.00 38.61  ? 418 LEU B CD2 1 
ATOM   7353 N N   . ALA B 1 422 ? 25.118  -22.026 -32.657 1.00 38.93  ? 419 ALA B N   1 
ATOM   7354 C CA  . ALA B 1 422 ? 25.657  -23.212 -32.006 1.00 42.05  ? 419 ALA B CA  1 
ATOM   7355 C C   . ALA B 1 422 ? 24.580  -24.279 -31.842 1.00 44.70  ? 419 ALA B C   1 
ATOM   7356 O O   . ALA B 1 422 ? 24.787  -25.437 -32.199 1.00 46.60  ? 419 ALA B O   1 
ATOM   7357 C CB  . ALA B 1 422 ? 26.255  -22.851 -30.650 1.00 39.75  ? 419 ALA B CB  1 
ATOM   7358 N N   . ALA B 1 423 ? 23.429  -23.874 -31.312 1.00 45.01  ? 420 ALA B N   1 
ATOM   7359 C CA  . ALA B 1 423 ? 22.339  -24.805 -31.033 1.00 44.60  ? 420 ALA B CA  1 
ATOM   7360 C C   . ALA B 1 423 ? 21.805  -25.478 -32.294 1.00 48.82  ? 420 ALA B C   1 
ATOM   7361 O O   . ALA B 1 423 ? 21.221  -26.559 -32.230 1.00 49.43  ? 420 ALA B O   1 
ATOM   7362 C CB  . ALA B 1 423 ? 21.208  -24.086 -30.314 1.00 42.62  ? 420 ALA B CB  1 
ATOM   7363 N N   . GLN B 1 424 ? 22.004  -24.844 -33.442 1.00 48.93  ? 421 GLN B N   1 
ATOM   7364 C CA  . GLN B 1 424 ? 21.426  -25.364 -34.670 1.00 48.29  ? 421 GLN B CA  1 
ATOM   7365 C C   . GLN B 1 424 ? 22.478  -25.789 -35.693 1.00 48.52  ? 421 GLN B C   1 
ATOM   7366 O O   . GLN B 1 424 ? 22.285  -25.639 -36.900 1.00 50.24  ? 421 GLN B O   1 
ATOM   7367 C CB  . GLN B 1 424 ? 20.464  -24.331 -35.257 1.00 48.58  ? 421 GLN B CB  1 
ATOM   7368 C CG  . GLN B 1 424 ? 19.194  -24.210 -34.420 1.00 51.10  ? 421 GLN B CG  1 
ATOM   7369 C CD  . GLN B 1 424 ? 18.700  -22.787 -34.288 1.00 56.59  ? 421 GLN B CD  1 
ATOM   7370 O OE1 . GLN B 1 424 ? 18.265  -22.365 -33.213 1.00 57.56  ? 421 GLN B OE1 1 
ATOM   7371 N NE2 . GLN B 1 424 ? 18.755  -22.038 -35.381 1.00 52.07  ? 421 GLN B NE2 1 
ATOM   7372 N N   . GLY B 1 425 ? 23.588  -26.328 -35.198 1.00 45.64  ? 422 GLY B N   1 
ATOM   7373 C CA  . GLY B 1 425 ? 24.505  -27.078 -36.037 1.00 48.90  ? 422 GLY B CA  1 
ATOM   7374 C C   . GLY B 1 425 ? 25.815  -26.433 -36.442 1.00 47.49  ? 422 GLY B C   1 
ATOM   7375 O O   . GLY B 1 425 ? 26.699  -27.112 -36.962 1.00 48.95  ? 422 GLY B O   1 
ATOM   7376 N N   . ALA B 1 426 ? 25.952  -25.132 -36.215 1.00 45.76  ? 423 ALA B N   1 
ATOM   7377 C CA  . ALA B 1 426 ? 27.153  -24.425 -36.647 1.00 42.38  ? 423 ALA B CA  1 
ATOM   7378 C C   . ALA B 1 426 ? 28.321  -24.653 -35.691 1.00 39.04  ? 423 ALA B C   1 
ATOM   7379 O O   . ALA B 1 426 ? 28.128  -24.836 -34.492 1.00 38.52  ? 423 ALA B O   1 
ATOM   7380 C CB  . ALA B 1 426 ? 26.868  -22.934 -36.788 1.00 40.21  ? 423 ALA B CB  1 
ATOM   7381 N N   . ARG B 1 427 ? 29.531  -24.665 -36.240 1.00 36.83  ? 424 ARG B N   1 
ATOM   7382 C CA  . ARG B 1 427 ? 30.741  -24.623 -35.432 1.00 33.28  ? 424 ARG B CA  1 
ATOM   7383 C C   . ARG B 1 427 ? 31.069  -23.165 -35.142 1.00 36.41  ? 424 ARG B C   1 
ATOM   7384 O O   . ARG B 1 427 ? 31.310  -22.383 -36.060 1.00 34.97  ? 424 ARG B O   1 
ATOM   7385 C CB  . ARG B 1 427 ? 31.903  -25.316 -36.146 1.00 37.63  ? 424 ARG B CB  1 
ATOM   7386 C CG  . ARG B 1 427 ? 33.257  -25.117 -35.475 1.00 41.22  ? 424 ARG B CG  1 
ATOM   7387 C CD  . ARG B 1 427 ? 34.312  -26.043 -36.070 1.00 44.58  ? 424 ARG B CD  1 
ATOM   7388 N NE  . ARG B 1 427 ? 34.041  -27.447 -35.763 1.00 49.52  ? 424 ARG B NE  1 
ATOM   7389 C CZ  . ARG B 1 427 ? 34.430  -28.053 -34.645 1.00 52.06  ? 424 ARG B CZ  1 
ATOM   7390 N NH1 . ARG B 1 427 ? 35.108  -27.378 -33.728 1.00 47.60  ? 424 ARG B NH1 1 
ATOM   7391 N NH2 . ARG B 1 427 ? 34.141  -29.331 -34.443 1.00 55.51  ? 424 ARG B NH2 1 
ATOM   7392 N N   . VAL B 1 428 ? 31.057  -22.795 -33.864 1.00 31.62  ? 425 VAL B N   1 
ATOM   7393 C CA  . VAL B 1 428 ? 31.191  -21.397 -33.477 1.00 30.38  ? 425 VAL B CA  1 
ATOM   7394 C C   . VAL B 1 428 ? 32.365  -21.169 -32.533 1.00 34.97  ? 425 VAL B C   1 
ATOM   7395 O O   . VAL B 1 428 ? 32.543  -21.906 -31.559 1.00 32.63  ? 425 VAL B O   1 
ATOM   7396 C CB  . VAL B 1 428 ? 29.906  -20.887 -32.793 1.00 33.79  ? 425 VAL B CB  1 
ATOM   7397 C CG1 . VAL B 1 428 ? 30.022  -19.408 -32.450 1.00 33.64  ? 425 VAL B CG1 1 
ATOM   7398 C CG2 . VAL B 1 428 ? 28.694  -21.156 -33.664 1.00 33.27  ? 425 VAL B CG2 1 
ATOM   7399 N N   . TYR B 1 429 ? 33.162  -20.146 -32.830 1.00 29.85  ? 426 TYR B N   1 
ATOM   7400 C CA  . TYR B 1 429 ? 34.213  -19.690 -31.927 1.00 31.57  ? 426 TYR B CA  1 
ATOM   7401 C C   . TYR B 1 429 ? 33.958  -18.243 -31.536 1.00 35.39  ? 426 TYR B C   1 
ATOM   7402 O O   . TYR B 1 429 ? 33.570  -17.427 -32.375 1.00 29.98  ? 426 TYR B O   1 
ATOM   7403 C CB  . TYR B 1 429 ? 35.592  -19.826 -32.565 1.00 28.31  ? 426 TYR B CB  1 
ATOM   7404 C CG  . TYR B 1 429 ? 35.987  -21.250 -32.865 1.00 31.55  ? 426 TYR B CG  1 
ATOM   7405 C CD1 . TYR B 1 429 ? 36.604  -22.038 -31.899 1.00 33.54  ? 426 TYR B CD1 1 
ATOM   7406 C CD2 . TYR B 1 429 ? 35.750  -21.808 -34.118 1.00 34.01  ? 426 TYR B CD2 1 
ATOM   7407 C CE1 . TYR B 1 429 ? 36.968  -23.344 -32.167 1.00 32.14  ? 426 TYR B CE1 1 
ATOM   7408 C CE2 . TYR B 1 429 ? 36.112  -23.112 -34.398 1.00 33.73  ? 426 TYR B CE2 1 
ATOM   7409 C CZ  . TYR B 1 429 ? 36.721  -23.876 -33.419 1.00 36.36  ? 426 TYR B CZ  1 
ATOM   7410 O OH  . TYR B 1 429 ? 37.084  -25.173 -33.698 1.00 34.38  ? 426 TYR B OH  1 
ATOM   7411 N N   . ALA B 1 430 ? 34.172  -17.925 -30.262 1.00 29.70  ? 427 ALA B N   1 
ATOM   7412 C CA  . ALA B 1 430 ? 33.869  -16.589 -29.765 1.00 30.73  ? 427 ALA B CA  1 
ATOM   7413 C C   . ALA B 1 430 ? 35.021  -15.961 -28.981 1.00 34.27  ? 427 ALA B C   1 
ATOM   7414 O O   . ALA B 1 430 ? 35.773  -16.652 -28.289 1.00 33.86  ? 427 ALA B O   1 
ATOM   7415 C CB  . ALA B 1 430 ? 32.614  -16.628 -28.910 1.00 31.56  ? 427 ALA B CB  1 
ATOM   7416 N N   . TYR B 1 431 ? 35.150  -14.641 -29.095 1.00 30.56  ? 428 TYR B N   1 
ATOM   7417 C CA  . TYR B 1 431 ? 36.216  -13.913 -28.411 1.00 31.97  ? 428 TYR B CA  1 
ATOM   7418 C C   . TYR B 1 431 ? 35.713  -12.620 -27.781 1.00 31.79  ? 428 TYR B C   1 
ATOM   7419 O O   . TYR B 1 431 ? 34.645  -12.118 -28.127 1.00 30.59  ? 428 TYR B O   1 
ATOM   7420 C CB  . TYR B 1 431 ? 37.360  -13.595 -29.387 1.00 36.52  ? 428 TYR B CB  1 
ATOM   7421 C CG  . TYR B 1 431 ? 36.984  -12.597 -30.472 1.00 30.72  ? 428 TYR B CG  1 
ATOM   7422 C CD1 . TYR B 1 431 ? 37.068  -11.227 -30.243 1.00 32.83  ? 428 TYR B CD1 1 
ATOM   7423 C CD2 . TYR B 1 431 ? 36.539  -13.025 -31.719 1.00 33.40  ? 428 TYR B CD2 1 
ATOM   7424 C CE1 . TYR B 1 431 ? 36.718  -10.309 -31.221 1.00 31.94  ? 428 TYR B CE1 1 
ATOM   7425 C CE2 . TYR B 1 431 ? 36.193  -12.108 -32.714 1.00 31.20  ? 428 TYR B CE2 1 
ATOM   7426 C CZ  . TYR B 1 431 ? 36.284  -10.752 -32.452 1.00 34.53  ? 428 TYR B CZ  1 
ATOM   7427 O OH  . TYR B 1 431 ? 35.936  -9.826  -33.411 1.00 30.80  ? 428 TYR B OH  1 
ATOM   7428 N N   . ILE B 1 432 ? 36.492  -12.094 -26.842 1.00 30.58  ? 429 ILE B N   1 
ATOM   7429 C CA  . ILE B 1 432 ? 36.362  -10.712 -26.423 1.00 28.01  ? 429 ILE B CA  1 
ATOM   7430 C C   . ILE B 1 432 ? 37.749  -10.097 -26.573 1.00 34.52  ? 429 ILE B C   1 
ATOM   7431 O O   . ILE B 1 432 ? 38.745  -10.677 -26.140 1.00 35.63  ? 429 ILE B O   1 
ATOM   7432 C CB  . ILE B 1 432 ? 35.816  -10.560 -24.972 1.00 36.41  ? 429 ILE B CB  1 
ATOM   7433 C CG1 . ILE B 1 432 ? 35.690  -9.077  -24.609 1.00 32.80  ? 429 ILE B CG1 1 
ATOM   7434 C CG2 . ILE B 1 432 ? 36.687  -11.307 -23.958 1.00 34.56  ? 429 ILE B CG2 1 
ATOM   7435 C CD1 . ILE B 1 432 ? 34.961  -8.820  -23.311 1.00 42.44  ? 429 ILE B CD1 1 
ATOM   7436 N N   . PHE B 1 433 ? 37.814  -8.951  -27.243 1.00 33.16  ? 430 PHE B N   1 
ATOM   7437 C CA  . PHE B 1 433 ? 39.079  -8.294  -27.554 1.00 31.98  ? 430 PHE B CA  1 
ATOM   7438 C C   . PHE B 1 433 ? 39.335  -7.205  -26.518 1.00 34.88  ? 430 PHE B C   1 
ATOM   7439 O O   . PHE B 1 433 ? 38.533  -6.282  -26.384 1.00 34.73  ? 430 PHE B O   1 
ATOM   7440 C CB  . PHE B 1 433 ? 39.036  -7.713  -28.977 1.00 35.75  ? 430 PHE B CB  1 
ATOM   7441 C CG  . PHE B 1 433 ? 40.320  -7.063  -29.413 1.00 36.12  ? 430 PHE B CG  1 
ATOM   7442 C CD1 . PHE B 1 433 ? 40.556  -5.720  -29.158 1.00 38.36  ? 430 PHE B CD1 1 
ATOM   7443 C CD2 . PHE B 1 433 ? 41.287  -7.793  -30.081 1.00 32.18  ? 430 PHE B CD2 1 
ATOM   7444 C CE1 . PHE B 1 433 ? 41.737  -5.120  -29.558 1.00 35.97  ? 430 PHE B CE1 1 
ATOM   7445 C CE2 . PHE B 1 433 ? 42.470  -7.199  -30.482 1.00 36.62  ? 430 PHE B CE2 1 
ATOM   7446 C CZ  . PHE B 1 433 ? 42.695  -5.860  -30.220 1.00 34.92  ? 430 PHE B CZ  1 
ATOM   7447 N N   . GLU B 1 434 ? 40.444  -7.307  -25.783 1.00 35.74  ? 431 GLU B N   1 
ATOM   7448 C CA  . GLU B 1 434 ? 40.642  -6.456  -24.607 1.00 39.16  ? 431 GLU B CA  1 
ATOM   7449 C C   . GLU B 1 434 ? 41.888  -5.570  -24.615 1.00 42.88  ? 431 GLU B C   1 
ATOM   7450 O O   . GLU B 1 434 ? 42.153  -4.879  -23.631 1.00 40.35  ? 431 GLU B O   1 
ATOM   7451 C CB  . GLU B 1 434 ? 40.680  -7.323  -23.342 1.00 35.36  ? 431 GLU B CB  1 
ATOM   7452 C CG  . GLU B 1 434 ? 39.346  -7.925  -22.974 1.00 35.88  ? 431 GLU B CG  1 
ATOM   7453 C CD  . GLU B 1 434 ? 39.407  -8.734  -21.693 1.00 42.27  ? 431 GLU B CD  1 
ATOM   7454 O OE1 . GLU B 1 434 ? 40.452  -9.373  -21.430 1.00 40.63  ? 431 GLU B OE1 1 
ATOM   7455 O OE2 . GLU B 1 434 ? 38.410  -8.718  -20.944 1.00 39.44  ? 431 GLU B OE2 1 
ATOM   7456 N N   . HIS B 1 435 ? 42.656  -5.578  -25.698 1.00 40.82  ? 432 HIS B N   1 
ATOM   7457 C CA  . HIS B 1 435 ? 43.849  -4.737  -25.740 1.00 42.19  ? 432 HIS B CA  1 
ATOM   7458 C C   . HIS B 1 435 ? 43.562  -3.347  -26.299 1.00 44.72  ? 432 HIS B C   1 
ATOM   7459 O O   . HIS B 1 435 ? 43.006  -3.203  -27.391 1.00 40.61  ? 432 HIS B O   1 
ATOM   7460 C CB  . HIS B 1 435 ? 44.961  -5.387  -26.565 1.00 41.47  ? 432 HIS B CB  1 
ATOM   7461 C CG  . HIS B 1 435 ? 46.203  -4.556  -26.646 1.00 44.80  ? 432 HIS B CG  1 
ATOM   7462 N ND1 . HIS B 1 435 ? 46.969  -4.252  -25.539 1.00 46.26  ? 432 HIS B ND1 1 
ATOM   7463 C CD2 . HIS B 1 435 ? 46.799  -3.938  -27.693 1.00 44.58  ? 432 HIS B CD2 1 
ATOM   7464 C CE1 . HIS B 1 435 ? 47.989  -3.498  -25.904 1.00 43.54  ? 432 HIS B CE1 1 
ATOM   7465 N NE2 . HIS B 1 435 ? 47.909  -3.291  -27.206 1.00 45.90  ? 432 HIS B NE2 1 
ATOM   7466 N N   . ARG B 1 436 ? 43.951  -2.324  -25.545 1.00 41.19  ? 433 ARG B N   1 
ATOM   7467 C CA  . ARG B 1 436 ? 43.861  -0.954  -26.029 1.00 40.89  ? 433 ARG B CA  1 
ATOM   7468 C C   . ARG B 1 436 ? 45.129  -0.587  -26.790 1.00 43.39  ? 433 ARG B C   1 
ATOM   7469 O O   . ARG B 1 436 ? 46.234  -0.728  -26.269 1.00 40.43  ? 433 ARG B O   1 
ATOM   7470 C CB  . ARG B 1 436 ? 43.634  0.023   -24.876 1.00 42.96  ? 433 ARG B CB  1 
ATOM   7471 C CG  . ARG B 1 436 ? 43.537  1.467   -25.333 1.00 45.15  ? 433 ARG B CG  1 
ATOM   7472 C CD  . ARG B 1 436 ? 43.290  2.424   -24.177 1.00 43.41  ? 433 ARG B CD  1 
ATOM   7473 N NE  . ARG B 1 436 ? 43.623  3.801   -24.542 1.00 45.00  ? 433 ARG B NE  1 
ATOM   7474 C CZ  . ARG B 1 436 ? 42.732  4.746   -24.829 1.00 44.91  ? 433 ARG B CZ  1 
ATOM   7475 N NH1 . ARG B 1 436 ? 41.432  4.479   -24.791 1.00 41.87  ? 433 ARG B NH1 1 
ATOM   7476 N NH2 . ARG B 1 436 ? 43.143  5.966   -25.151 1.00 43.96  ? 433 ARG B NH2 1 
ATOM   7477 N N   . ALA B 1 437 ? 44.967  -0.143  -28.034 1.00 41.82  ? 434 ALA B N   1 
ATOM   7478 C CA  . ALA B 1 437 ? 46.101  0.273   -28.850 1.00 42.85  ? 434 ALA B CA  1 
ATOM   7479 C C   . ALA B 1 437 ? 46.899  1.369   -28.147 1.00 43.64  ? 434 ALA B C   1 
ATOM   7480 O O   . ALA B 1 437 ? 46.329  2.326   -27.622 1.00 43.36  ? 434 ALA B O   1 
ATOM   7481 C CB  . ALA B 1 437 ? 45.627  0.754   -30.225 1.00 41.23  ? 434 ALA B CB  1 
ATOM   7482 N N   . SER B 1 438 ? 48.218  1.215   -28.129 1.00 43.69  ? 435 SER B N   1 
ATOM   7483 C CA  . SER B 1 438 ? 49.094  2.216   -27.534 1.00 46.79  ? 435 SER B CA  1 
ATOM   7484 C C   . SER B 1 438 ? 49.018  3.536   -28.300 1.00 50.97  ? 435 SER B C   1 
ATOM   7485 O O   . SER B 1 438 ? 49.358  4.591   -27.767 1.00 50.27  ? 435 SER B O   1 
ATOM   7486 C CB  . SER B 1 438 ? 50.535  1.708   -27.501 1.00 45.89  ? 435 SER B CB  1 
ATOM   7487 O OG  . SER B 1 438 ? 51.009  1.452   -28.811 1.00 50.81  ? 435 SER B OG  1 
ATOM   7488 N N   . THR B 1 439 ? 48.559  3.468   -29.547 1.00 46.07  ? 436 THR B N   1 
ATOM   7489 C CA  . THR B 1 439 ? 48.495  4.639   -30.415 1.00 49.81  ? 436 THR B CA  1 
ATOM   7490 C C   . THR B 1 439 ? 47.115  5.294   -30.448 1.00 50.14  ? 436 THR B C   1 
ATOM   7491 O O   . THR B 1 439 ? 46.911  6.268   -31.172 1.00 48.26  ? 436 THR B O   1 
ATOM   7492 C CB  . THR B 1 439 ? 48.882  4.281   -31.862 1.00 45.83  ? 436 THR B CB  1 
ATOM   7493 O OG1 . THR B 1 439 ? 47.937  3.342   -32.387 1.00 46.61  ? 436 THR B OG1 1 
ATOM   7494 C CG2 . THR B 1 439 ? 50.275  3.670   -31.912 1.00 49.13  ? 436 THR B CG2 1 
ATOM   7495 N N   . LEU B 1 440 ? 46.173  4.759   -29.674 1.00 46.37  ? 437 LEU B N   1 
ATOM   7496 C CA  . LEU B 1 440 ? 44.807  5.286   -29.655 1.00 47.51  ? 437 LEU B CA  1 
ATOM   7497 C C   . LEU B 1 440 ? 44.763  6.755   -29.236 1.00 48.41  ? 437 LEU B C   1 
ATOM   7498 O O   . LEU B 1 440 ? 45.418  7.151   -28.273 1.00 46.42  ? 437 LEU B O   1 
ATOM   7499 C CB  . LEU B 1 440 ? 43.923  4.453   -28.721 1.00 45.33  ? 437 LEU B CB  1 
ATOM   7500 C CG  . LEU B 1 440 ? 42.814  3.651   -29.412 1.00 47.81  ? 437 LEU B CG  1 
ATOM   7501 C CD1 . LEU B 1 440 ? 42.145  2.703   -28.432 1.00 45.52  ? 437 LEU B CD1 1 
ATOM   7502 C CD2 . LEU B 1 440 ? 41.782  4.577   -30.044 1.00 40.28  ? 437 LEU B CD2 1 
ATOM   7503 N N   . THR B 1 441 ? 43.982  7.555   -29.958 1.00 45.88  ? 438 THR B N   1 
ATOM   7504 C CA  . THR B 1 441 ? 43.906  8.991   -29.697 1.00 44.87  ? 438 THR B CA  1 
ATOM   7505 C C   . THR B 1 441 ? 42.607  9.379   -28.991 1.00 42.65  ? 438 THR B C   1 
ATOM   7506 O O   . THR B 1 441 ? 42.448  10.516  -28.547 1.00 44.73  ? 438 THR B O   1 
ATOM   7507 C CB  . THR B 1 441 ? 44.039  9.808   -31.004 1.00 46.14  ? 438 THR B CB  1 
ATOM   7508 O OG1 . THR B 1 441 ? 42.952  9.498   -31.882 1.00 44.75  ? 438 THR B OG1 1 
ATOM   7509 C CG2 . THR B 1 441 ? 45.351  9.488   -31.701 1.00 42.07  ? 438 THR B CG2 1 
ATOM   7510 N N   . TRP B 1 442 ? 41.674  8.439   -28.895 1.00 43.57  ? 439 TRP B N   1 
ATOM   7511 C CA  . TRP B 1 442 ? 40.492  8.642   -28.066 1.00 43.02  ? 439 TRP B CA  1 
ATOM   7512 C C   . TRP B 1 442 ? 40.912  8.613   -26.593 1.00 40.63  ? 439 TRP B C   1 
ATOM   7513 O O   . TRP B 1 442 ? 41.930  8.010   -26.256 1.00 41.48  ? 439 TRP B O   1 
ATOM   7514 C CB  . TRP B 1 442 ? 39.433  7.577   -28.361 1.00 43.25  ? 439 TRP B CB  1 
ATOM   7515 C CG  . TRP B 1 442 ? 38.848  7.680   -29.741 1.00 39.65  ? 439 TRP B CG  1 
ATOM   7516 C CD1 . TRP B 1 442 ? 39.202  6.949   -30.839 1.00 43.48  ? 439 TRP B CD1 1 
ATOM   7517 C CD2 . TRP B 1 442 ? 37.807  8.567   -30.168 1.00 39.80  ? 439 TRP B CD2 1 
ATOM   7518 N NE1 . TRP B 1 442 ? 38.446  7.328   -31.925 1.00 41.57  ? 439 TRP B NE1 1 
ATOM   7519 C CE2 . TRP B 1 442 ? 37.582  8.319   -31.540 1.00 42.19  ? 439 TRP B CE2 1 
ATOM   7520 C CE3 . TRP B 1 442 ? 37.046  9.550   -29.527 1.00 41.72  ? 439 TRP B CE3 1 
ATOM   7521 C CZ2 . TRP B 1 442 ? 36.627  9.015   -32.278 1.00 40.72  ? 439 TRP B CZ2 1 
ATOM   7522 C CZ3 . TRP B 1 442 ? 36.096  10.241  -30.263 1.00 47.78  ? 439 TRP B CZ3 1 
ATOM   7523 C CH2 . TRP B 1 442 ? 35.895  9.968   -31.626 1.00 46.80  ? 439 TRP B CH2 1 
ATOM   7524 N N   . PRO B 1 443 ? 40.143  9.278   -25.714 1.00 40.47  ? 440 PRO B N   1 
ATOM   7525 C CA  . PRO B 1 443 ? 40.508  9.330   -24.290 1.00 44.18  ? 440 PRO B CA  1 
ATOM   7526 C C   . PRO B 1 443 ? 40.482  7.964   -23.602 1.00 44.41  ? 440 PRO B C   1 
ATOM   7527 O O   . PRO B 1 443 ? 39.783  7.056   -24.050 1.00 40.33  ? 440 PRO B O   1 
ATOM   7528 C CB  . PRO B 1 443 ? 39.446  10.260  -23.689 1.00 42.10  ? 440 PRO B CB  1 
ATOM   7529 C CG  . PRO B 1 443 ? 38.303  10.204  -24.636 1.00 43.37  ? 440 PRO B CG  1 
ATOM   7530 C CD  . PRO B 1 443 ? 38.922  10.051  -25.995 1.00 40.54  ? 440 PRO B CD  1 
ATOM   7531 N N   . LEU B 1 444 ? 41.244  7.840   -22.517 1.00 44.15  ? 441 LEU B N   1 
ATOM   7532 C CA  . LEU B 1 444 ? 41.376  6.588   -21.773 1.00 44.27  ? 441 LEU B CA  1 
ATOM   7533 C C   . LEU B 1 444 ? 40.058  6.014   -21.256 1.00 41.90  ? 441 LEU B C   1 
ATOM   7534 O O   . LEU B 1 444 ? 39.902  4.796   -21.192 1.00 41.49  ? 441 LEU B O   1 
ATOM   7535 C CB  . LEU B 1 444 ? 42.328  6.777   -20.587 1.00 46.23  ? 441 LEU B CB  1 
ATOM   7536 C CG  . LEU B 1 444 ? 43.832  6.762   -20.866 1.00 47.65  ? 441 LEU B CG  1 
ATOM   7537 C CD1 . LEU B 1 444 ? 44.605  7.165   -19.615 1.00 52.45  ? 441 LEU B CD1 1 
ATOM   7538 C CD2 . LEU B 1 444 ? 44.277  5.392   -21.353 1.00 48.75  ? 441 LEU B CD2 1 
ATOM   7539 N N   . TRP B 1 445 ? 39.117  6.874   -20.877 1.00 41.15  ? 442 TRP B N   1 
ATOM   7540 C CA  . TRP B 1 445 ? 37.864  6.381   -20.311 1.00 42.72  ? 442 TRP B CA  1 
ATOM   7541 C C   . TRP B 1 445 ? 37.053  5.571   -21.320 1.00 43.44  ? 442 TRP B C   1 
ATOM   7542 O O   . TRP B 1 445 ? 36.230  4.741   -20.933 1.00 41.45  ? 442 TRP B O   1 
ATOM   7543 C CB  . TRP B 1 445 ? 37.014  7.530   -19.757 1.00 40.59  ? 442 TRP B CB  1 
ATOM   7544 C CG  . TRP B 1 445 ? 36.430  8.491   -20.761 1.00 46.81  ? 442 TRP B CG  1 
ATOM   7545 C CD1 . TRP B 1 445 ? 36.919  9.720   -21.095 1.00 45.47  ? 442 TRP B CD1 1 
ATOM   7546 C CD2 . TRP B 1 445 ? 35.221  8.323   -21.520 1.00 46.59  ? 442 TRP B CD2 1 
ATOM   7547 N NE1 . TRP B 1 445 ? 36.102  10.319  -22.023 1.00 46.55  ? 442 TRP B NE1 1 
ATOM   7548 C CE2 . TRP B 1 445 ? 35.054  9.483   -22.301 1.00 47.36  ? 442 TRP B CE2 1 
ATOM   7549 C CE3 . TRP B 1 445 ? 34.270  7.301   -21.618 1.00 45.22  ? 442 TRP B CE3 1 
ATOM   7550 C CZ2 . TRP B 1 445 ? 33.977  9.649   -23.172 1.00 49.37  ? 442 TRP B CZ2 1 
ATOM   7551 C CZ3 . TRP B 1 445 ? 33.202  7.468   -22.482 1.00 44.58  ? 442 TRP B CZ3 1 
ATOM   7552 C CH2 . TRP B 1 445 ? 33.065  8.633   -23.248 1.00 47.16  ? 442 TRP B CH2 1 
ATOM   7553 N N   . MET B 1 446 ? 37.295  5.803   -22.607 1.00 41.48  ? 443 MET B N   1 
ATOM   7554 C CA  . MET B 1 446 ? 36.596  5.070   -23.657 1.00 39.70  ? 443 MET B CA  1 
ATOM   7555 C C   . MET B 1 446 ? 37.089  3.631   -23.769 1.00 38.62  ? 443 MET B C   1 
ATOM   7556 O O   . MET B 1 446 ? 36.451  2.800   -24.416 1.00 43.03  ? 443 MET B O   1 
ATOM   7557 C CB  . MET B 1 446 ? 36.753  5.780   -25.004 1.00 40.16  ? 443 MET B CB  1 
ATOM   7558 C CG  . MET B 1 446 ? 35.905  7.032   -25.155 1.00 39.42  ? 443 MET B CG  1 
ATOM   7559 S SD  . MET B 1 446 ? 36.011  7.679   -26.833 1.00 45.10  ? 443 MET B SD  1 
ATOM   7560 C CE  . MET B 1 446 ? 34.860  9.037   -26.745 1.00 42.80  ? 443 MET B CE  1 
ATOM   7561 N N   . GLY B 1 447 ? 38.230  3.344   -23.150 1.00 40.03  ? 444 GLY B N   1 
ATOM   7562 C CA  . GLY B 1 447 ? 38.762  1.991   -23.103 1.00 40.27  ? 444 GLY B CA  1 
ATOM   7563 C C   . GLY B 1 447 ? 39.117  1.446   -24.474 1.00 44.46  ? 444 GLY B C   1 
ATOM   7564 O O   . GLY B 1 447 ? 39.794  2.114   -25.257 1.00 42.24  ? 444 GLY B O   1 
ATOM   7565 N N   . VAL B 1 448 ? 38.664  0.227   -24.762 1.00 41.80  ? 445 VAL B N   1 
ATOM   7566 C CA  . VAL B 1 448 ? 38.846  -0.372  -26.082 1.00 40.90  ? 445 VAL B CA  1 
ATOM   7567 C C   . VAL B 1 448 ? 37.595  -0.146  -26.917 1.00 39.71  ? 445 VAL B C   1 
ATOM   7568 O O   . VAL B 1 448 ? 36.652  -0.938  -26.865 1.00 36.07  ? 445 VAL B O   1 
ATOM   7569 C CB  . VAL B 1 448 ? 39.140  -1.882  -25.997 1.00 41.72  ? 445 VAL B CB  1 
ATOM   7570 C CG1 . VAL B 1 448 ? 39.503  -2.431  -27.376 1.00 39.45  ? 445 VAL B CG1 1 
ATOM   7571 C CG2 . VAL B 1 448 ? 40.251  -2.152  -24.993 1.00 40.28  ? 445 VAL B CG2 1 
ATOM   7572 N N   . PRO B 1 449 ? 37.577  0.940   -27.699 1.00 41.21  ? 446 PRO B N   1 
ATOM   7573 C CA  . PRO B 1 449 ? 36.320  1.285   -28.355 1.00 39.31  ? 446 PRO B CA  1 
ATOM   7574 C C   . PRO B 1 449 ? 36.056  0.458   -29.604 1.00 35.06  ? 446 PRO B C   1 
ATOM   7575 O O   . PRO B 1 449 ? 36.934  -0.219  -30.136 1.00 33.91  ? 446 PRO B O   1 
ATOM   7576 C CB  . PRO B 1 449 ? 36.500  2.770   -28.712 1.00 37.72  ? 446 PRO B CB  1 
ATOM   7577 C CG  . PRO B 1 449 ? 37.941  3.120   -28.354 1.00 41.56  ? 446 PRO B CG  1 
ATOM   7578 C CD  . PRO B 1 449 ? 38.664  1.830   -28.126 1.00 42.47  ? 446 PRO B CD  1 
ATOM   7579 N N   . HIS B 1 450 ? 34.800  0.508   -30.013 1.00 36.31  ? 447 HIS B N   1 
ATOM   7580 C CA  . HIS B 1 450 ? 34.295  -0.047  -31.252 1.00 36.81  ? 447 HIS B CA  1 
ATOM   7581 C C   . HIS B 1 450 ? 35.245  0.153   -32.445 1.00 41.08  ? 447 HIS B C   1 
ATOM   7582 O O   . HIS B 1 450 ? 35.523  1.282   -32.839 1.00 38.37  ? 447 HIS B O   1 
ATOM   7583 C CB  . HIS B 1 450 ? 32.943  0.612   -31.524 1.00 43.46  ? 447 HIS B CB  1 
ATOM   7584 C CG  . HIS B 1 450 ? 32.122  -0.066  -32.571 1.00 42.85  ? 447 HIS B CG  1 
ATOM   7585 N ND1 . HIS B 1 450 ? 31.509  -1.282  -32.363 1.00 41.51  ? 447 HIS B ND1 1 
ATOM   7586 C CD2 . HIS B 1 450 ? 31.784  0.320   -33.822 1.00 39.99  ? 447 HIS B CD2 1 
ATOM   7587 C CE1 . HIS B 1 450 ? 30.839  -1.626  -33.449 1.00 40.45  ? 447 HIS B CE1 1 
ATOM   7588 N NE2 . HIS B 1 450 ? 30.990  -0.668  -34.350 1.00 46.16  ? 447 HIS B NE2 1 
ATOM   7589 N N   . GLY B 1 451 ? 35.756  -0.942  -32.997 1.00 39.24  ? 448 GLY B N   1 
ATOM   7590 C CA  . GLY B 1 451 ? 36.524  -0.882  -34.229 1.00 40.33  ? 448 GLY B CA  1 
ATOM   7591 C C   . GLY B 1 451 ? 38.035  -0.877  -34.088 1.00 38.71  ? 448 GLY B C   1 
ATOM   7592 O O   . GLY B 1 451 ? 38.748  -0.908  -35.091 1.00 34.68  ? 448 GLY B O   1 
ATOM   7593 N N   . TYR B 1 452 ? 38.541  -0.856  -32.858 1.00 37.35  ? 449 TYR B N   1 
ATOM   7594 C CA  . TYR B 1 452 ? 39.984  -0.707  -32.677 1.00 38.62  ? 449 TYR B CA  1 
ATOM   7595 C C   . TYR B 1 452 ? 40.702  -2.034  -32.472 1.00 35.35  ? 449 TYR B C   1 
ATOM   7596 O O   . TYR B 1 452 ? 41.843  -2.077  -32.017 1.00 36.29  ? 449 TYR B O   1 
ATOM   7597 C CB  . TYR B 1 452 ? 40.271  0.277   -31.539 1.00 34.69  ? 449 TYR B CB  1 
ATOM   7598 C CG  . TYR B 1 452 ? 40.076  1.684   -32.047 1.00 38.48  ? 449 TYR B CG  1 
ATOM   7599 C CD1 . TYR B 1 452 ? 41.080  2.325   -32.764 1.00 40.80  ? 449 TYR B CD1 1 
ATOM   7600 C CD2 . TYR B 1 452 ? 38.863  2.341   -31.888 1.00 37.49  ? 449 TYR B CD2 1 
ATOM   7601 C CE1 . TYR B 1 452 ? 40.897  3.598   -33.276 1.00 40.98  ? 449 TYR B CE1 1 
ATOM   7602 C CE2 . TYR B 1 452 ? 38.671  3.616   -32.393 1.00 38.82  ? 449 TYR B CE2 1 
ATOM   7603 C CZ  . TYR B 1 452 ? 39.692  4.238   -33.087 1.00 41.29  ? 449 TYR B CZ  1 
ATOM   7604 O OH  . TYR B 1 452 ? 39.508  5.503   -33.600 1.00 43.05  ? 449 TYR B OH  1 
ATOM   7605 N N   . GLU B 1 453 ? 40.033  -3.113  -32.863 1.00 33.30  ? 450 GLU B N   1 
ATOM   7606 C CA  . GLU B 1 453 ? 40.687  -4.406  -33.006 1.00 36.69  ? 450 GLU B CA  1 
ATOM   7607 C C   . GLU B 1 453 ? 41.120  -4.620  -34.461 1.00 34.48  ? 450 GLU B C   1 
ATOM   7608 O O   . GLU B 1 453 ? 42.003  -5.431  -34.744 1.00 35.72  ? 450 GLU B O   1 
ATOM   7609 C CB  . GLU B 1 453 ? 39.753  -5.539  -32.565 1.00 35.88  ? 450 GLU B CB  1 
ATOM   7610 C CG  . GLU B 1 453 ? 38.804  -6.048  -33.664 1.00 36.06  ? 450 GLU B CG  1 
ATOM   7611 C CD  . GLU B 1 453 ? 37.592  -5.150  -33.899 1.00 35.61  ? 450 GLU B CD  1 
ATOM   7612 O OE1 . GLU B 1 453 ? 37.619  -3.960  -33.519 1.00 36.62  ? 450 GLU B OE1 1 
ATOM   7613 O OE2 . GLU B 1 453 ? 36.597  -5.648  -34.466 1.00 35.39  ? 450 GLU B OE2 1 
ATOM   7614 N N   . ILE B 1 454 ? 40.493  -3.892  -35.380 1.00 33.27  ? 451 ILE B N   1 
ATOM   7615 C CA  . ILE B 1 454 ? 40.706  -4.133  -36.807 1.00 33.47  ? 451 ILE B CA  1 
ATOM   7616 C C   . ILE B 1 454 ? 42.174  -3.975  -37.191 1.00 29.59  ? 451 ILE B C   1 
ATOM   7617 O O   . ILE B 1 454 ? 42.733  -4.829  -37.870 1.00 32.94  ? 451 ILE B O   1 
ATOM   7618 C CB  . ILE B 1 454 ? 39.843  -3.189  -37.675 1.00 36.29  ? 451 ILE B CB  1 
ATOM   7619 C CG1 . ILE B 1 454 ? 38.364  -3.343  -37.314 1.00 35.04  ? 451 ILE B CG1 1 
ATOM   7620 C CG2 . ILE B 1 454 ? 40.077  -3.459  -39.164 1.00 33.47  ? 451 ILE B CG2 1 
ATOM   7621 C CD1 . ILE B 1 454 ? 37.444  -2.421  -38.075 1.00 33.92  ? 451 ILE B CD1 1 
ATOM   7622 N N   . GLU B 1 455 ? 42.805  -2.901  -36.726 1.00 34.12  ? 452 GLU B N   1 
ATOM   7623 C CA  . GLU B 1 455 ? 44.191  -2.625  -37.098 1.00 35.21  ? 452 GLU B CA  1 
ATOM   7624 C C   . GLU B 1 455 ? 45.147  -3.748  -36.679 1.00 36.37  ? 452 GLU B C   1 
ATOM   7625 O O   . GLU B 1 455 ? 46.200  -3.929  -37.288 1.00 38.04  ? 452 GLU B O   1 
ATOM   7626 C CB  . GLU B 1 455 ? 44.643  -1.285  -36.504 1.00 38.08  ? 452 GLU B CB  1 
ATOM   7627 C CG  . GLU B 1 455 ? 44.545  -1.180  -34.985 1.00 38.64  ? 452 GLU B CG  1 
ATOM   7628 C CD  . GLU B 1 455 ? 44.443  0.262   -34.510 1.00 46.50  ? 452 GLU B CD  1 
ATOM   7629 O OE1 . GLU B 1 455 ? 45.079  0.610   -33.494 1.00 47.82  ? 452 GLU B OE1 1 
ATOM   7630 O OE2 . GLU B 1 455 ? 43.719  1.052   -35.152 1.00 46.72  ? 452 GLU B OE2 1 
ATOM   7631 N N   . PHE B 1 456 ? 44.771  -4.507  -35.651 1.00 37.26  ? 453 PHE B N   1 
ATOM   7632 C CA  . PHE B 1 456 ? 45.591  -5.626  -35.195 1.00 35.03  ? 453 PHE B CA  1 
ATOM   7633 C C   . PHE B 1 456 ? 45.336  -6.869  -36.037 1.00 35.17  ? 453 PHE B C   1 
ATOM   7634 O O   . PHE B 1 456 ? 46.265  -7.614  -36.350 1.00 35.10  ? 453 PHE B O   1 
ATOM   7635 C CB  . PHE B 1 456 ? 45.330  -5.909  -33.710 1.00 37.99  ? 453 PHE B CB  1 
ATOM   7636 C CG  . PHE B 1 456 ? 45.838  -4.824  -32.805 1.00 37.75  ? 453 PHE B CG  1 
ATOM   7637 C CD1 . PHE B 1 456 ? 47.152  -4.831  -32.371 1.00 40.08  ? 453 PHE B CD1 1 
ATOM   7638 C CD2 . PHE B 1 456 ? 45.017  -3.776  -32.428 1.00 35.28  ? 453 PHE B CD2 1 
ATOM   7639 C CE1 . PHE B 1 456 ? 47.632  -3.824  -31.562 1.00 36.56  ? 453 PHE B CE1 1 
ATOM   7640 C CE2 . PHE B 1 456 ? 45.491  -2.764  -31.619 1.00 38.23  ? 453 PHE B CE2 1 
ATOM   7641 C CZ  . PHE B 1 456 ? 46.800  -2.790  -31.184 1.00 43.35  ? 453 PHE B CZ  1 
ATOM   7642 N N   . ILE B 1 457 ? 44.076  -7.081  -36.408 1.00 34.97  ? 454 ILE B N   1 
ATOM   7643 C CA  . ILE B 1 457 ? 43.708  -8.193  -37.278 1.00 34.59  ? 454 ILE B CA  1 
ATOM   7644 C C   . ILE B 1 457 ? 44.377  -8.047  -38.645 1.00 37.56  ? 454 ILE B C   1 
ATOM   7645 O O   . ILE B 1 457 ? 44.863  -9.022  -39.214 1.00 35.63  ? 454 ILE B O   1 
ATOM   7646 C CB  . ILE B 1 457 ? 42.172  -8.290  -37.469 1.00 36.67  ? 454 ILE B CB  1 
ATOM   7647 C CG1 . ILE B 1 457 ? 41.471  -8.543  -36.129 1.00 36.71  ? 454 ILE B CG1 1 
ATOM   7648 C CG2 . ILE B 1 457 ? 41.817  -9.385  -38.467 1.00 36.81  ? 454 ILE B CG2 1 
ATOM   7649 C CD1 . ILE B 1 457 ? 42.006  -9.737  -35.396 1.00 37.21  ? 454 ILE B CD1 1 
ATOM   7650 N N   . PHE B 1 458 ? 44.413  -6.824  -39.163 1.00 37.13  ? 455 PHE B N   1 
ATOM   7651 C CA  . PHE B 1 458 ? 44.998  -6.588  -40.483 1.00 38.82  ? 455 PHE B CA  1 
ATOM   7652 C C   . PHE B 1 458 ? 46.521  -6.496  -40.425 1.00 40.80  ? 455 PHE B C   1 
ATOM   7653 O O   . PHE B 1 458 ? 47.190  -6.474  -41.456 1.00 37.73  ? 455 PHE B O   1 
ATOM   7654 C CB  . PHE B 1 458 ? 44.410  -5.325  -41.105 1.00 37.79  ? 455 PHE B CB  1 
ATOM   7655 C CG  . PHE B 1 458 ? 43.168  -5.577  -41.915 1.00 37.72  ? 455 PHE B CG  1 
ATOM   7656 C CD1 . PHE B 1 458 ? 41.928  -5.662  -41.302 1.00 37.67  ? 455 PHE B CD1 1 
ATOM   7657 C CD2 . PHE B 1 458 ? 43.244  -5.734  -43.292 1.00 37.30  ? 455 PHE B CD2 1 
ATOM   7658 C CE1 . PHE B 1 458 ? 40.786  -5.893  -42.046 1.00 36.49  ? 455 PHE B CE1 1 
ATOM   7659 C CE2 . PHE B 1 458 ? 42.107  -5.972  -44.041 1.00 34.60  ? 455 PHE B CE2 1 
ATOM   7660 C CZ  . PHE B 1 458 ? 40.876  -6.051  -43.420 1.00 34.70  ? 455 PHE B CZ  1 
ATOM   7661 N N   . GLY B 1 459 ? 47.068  -6.450  -39.215 1.00 37.57  ? 456 GLY B N   1 
ATOM   7662 C CA  . GLY B 1 459 ? 48.505  -6.530  -39.037 1.00 37.38  ? 456 GLY B CA  1 
ATOM   7663 C C   . GLY B 1 459 ? 49.272  -5.235  -39.228 1.00 40.36  ? 456 GLY B C   1 
ATOM   7664 O O   . GLY B 1 459 ? 50.465  -5.261  -39.527 1.00 42.11  ? 456 GLY B O   1 
ATOM   7665 N N   . LEU B 1 460 ? 48.598  -4.104  -39.046 1.00 39.31  ? 457 LEU B N   1 
ATOM   7666 C CA  . LEU B 1 460 ? 49.250  -2.797  -39.129 1.00 42.12  ? 457 LEU B CA  1 
ATOM   7667 C C   . LEU B 1 460 ? 50.436  -2.593  -38.161 1.00 47.71  ? 457 LEU B C   1 
ATOM   7668 O O   . LEU B 1 460 ? 51.400  -1.914  -38.521 1.00 44.64  ? 457 LEU B O   1 
ATOM   7669 C CB  . LEU B 1 460 ? 48.220  -1.681  -38.912 1.00 41.78  ? 457 LEU B CB  1 
ATOM   7670 C CG  . LEU B 1 460 ? 47.569  -1.115  -40.182 1.00 42.18  ? 457 LEU B CG  1 
ATOM   7671 C CD1 . LEU B 1 460 ? 46.721  -2.161  -40.901 1.00 39.40  ? 457 LEU B CD1 1 
ATOM   7672 C CD2 . LEU B 1 460 ? 46.743  0.124   -39.873 1.00 38.15  ? 457 LEU B CD2 1 
ATOM   7673 N N   . PRO B 1 461 ? 50.376  -3.156  -36.933 1.00 46.78  ? 458 PRO B N   1 
ATOM   7674 C CA  . PRO B 1 461 ? 51.553  -3.009  -36.062 1.00 48.30  ? 458 PRO B CA  1 
ATOM   7675 C C   . PRO B 1 461 ? 52.856  -3.584  -36.624 1.00 49.67  ? 458 PRO B C   1 
ATOM   7676 O O   . PRO B 1 461 ? 53.916  -3.302  -36.070 1.00 53.78  ? 458 PRO B O   1 
ATOM   7677 C CB  . PRO B 1 461 ? 51.137  -3.766  -34.796 1.00 47.24  ? 458 PRO B CB  1 
ATOM   7678 C CG  . PRO B 1 461 ? 49.677  -3.562  -34.729 1.00 44.42  ? 458 PRO B CG  1 
ATOM   7679 C CD  . PRO B 1 461 ? 49.205  -3.623  -36.166 1.00 43.05  ? 458 PRO B CD  1 
ATOM   7680 N N   . LEU B 1 462 ? 52.782  -4.360  -37.700 1.00 43.85  ? 459 LEU B N   1 
ATOM   7681 C CA  . LEU B 1 462 ? 53.981  -4.897  -38.336 1.00 48.80  ? 459 LEU B CA  1 
ATOM   7682 C C   . LEU B 1 462 ? 54.727  -3.819  -39.126 1.00 54.07  ? 459 LEU B C   1 
ATOM   7683 O O   . LEU B 1 462 ? 55.853  -4.034  -39.573 1.00 52.92  ? 459 LEU B O   1 
ATOM   7684 C CB  . LEU B 1 462 ? 53.629  -6.070  -39.252 1.00 48.22  ? 459 LEU B CB  1 
ATOM   7685 C CG  . LEU B 1 462 ? 53.599  -7.470  -38.632 1.00 47.79  ? 459 LEU B CG  1 
ATOM   7686 C CD1 . LEU B 1 462 ? 52.609  -7.563  -37.487 1.00 52.89  ? 459 LEU B CD1 1 
ATOM   7687 C CD2 . LEU B 1 462 ? 53.268  -8.498  -39.690 1.00 46.37  ? 459 LEU B CD2 1 
ATOM   7688 N N   . ASP B 1 463 ? 54.088  -2.666  -39.295 1.00 53.00  ? 460 ASP B N   1 
ATOM   7689 C CA  . ASP B 1 463 ? 54.717  -1.512  -39.927 1.00 58.15  ? 460 ASP B CA  1 
ATOM   7690 C C   . ASP B 1 463 ? 55.341  -0.639  -38.847 1.00 57.38  ? 460 ASP B C   1 
ATOM   7691 O O   . ASP B 1 463 ? 54.628  0.063   -38.132 1.00 58.34  ? 460 ASP B O   1 
ATOM   7692 C CB  . ASP B 1 463 ? 53.693  -0.714  -40.745 1.00 57.63  ? 460 ASP B CB  1 
ATOM   7693 C CG  . ASP B 1 463 ? 54.321  0.424   -41.541 1.00 62.37  ? 460 ASP B CG  1 
ATOM   7694 O OD1 . ASP B 1 463 ? 55.520  0.717   -41.351 1.00 65.64  ? 460 ASP B OD1 1 
ATOM   7695 O OD2 . ASP B 1 463 ? 53.603  1.034   -42.362 1.00 60.48  ? 460 ASP B OD2 1 
ATOM   7696 N N   . PRO B 1 464 ? 56.679  -0.668  -38.740 1.00 61.79  ? 461 PRO B N   1 
ATOM   7697 C CA  . PRO B 1 464 ? 57.410  0.041   -37.684 1.00 62.43  ? 461 PRO B CA  1 
ATOM   7698 C C   . PRO B 1 464 ? 57.138  1.546   -37.691 1.00 65.96  ? 461 PRO B C   1 
ATOM   7699 O O   . PRO B 1 464 ? 57.144  2.175   -36.632 1.00 64.70  ? 461 PRO B O   1 
ATOM   7700 C CB  . PRO B 1 464 ? 58.877  -0.257  -38.014 1.00 63.57  ? 461 PRO B CB  1 
ATOM   7701 C CG  . PRO B 1 464 ? 58.882  -0.546  -39.475 1.00 63.23  ? 461 PRO B CG  1 
ATOM   7702 C CD  . PRO B 1 464 ? 57.590  -1.261  -39.734 1.00 64.97  ? 461 PRO B CD  1 
ATOM   7703 N N   . SER B 1 465 ? 56.877  2.104   -38.870 1.00 63.01  ? 462 SER B N   1 
ATOM   7704 C CA  . SER B 1 465 ? 56.635  3.536   -39.007 1.00 61.28  ? 462 SER B CA  1 
ATOM   7705 C C   . SER B 1 465 ? 55.323  3.993   -38.361 1.00 66.13  ? 462 SER B C   1 
ATOM   7706 O O   . SER B 1 465 ? 55.107  5.191   -38.186 1.00 69.50  ? 462 SER B O   1 
ATOM   7707 C CB  . SER B 1 465 ? 56.636  3.933   -40.482 1.00 65.70  ? 462 SER B CB  1 
ATOM   7708 O OG  . SER B 1 465 ? 55.428  3.546   -41.111 1.00 66.07  ? 462 SER B OG  1 
ATOM   7709 N N   . LEU B 1 466 ? 54.455  3.051   -37.999 1.00 65.96  ? 463 LEU B N   1 
ATOM   7710 C CA  . LEU B 1 466 ? 53.161  3.387   -37.389 1.00 62.88  ? 463 LEU B CA  1 
ATOM   7711 C C   . LEU B 1 466 ? 53.289  3.450   -35.853 1.00 63.37  ? 463 LEU B C   1 
ATOM   7712 O O   . LEU B 1 466 ? 52.318  3.639   -35.111 1.00 64.12  ? 463 LEU B O   1 
ATOM   7713 C CB  . LEU B 1 466 ? 52.109  2.367   -37.795 1.00 57.95  ? 463 LEU B CB  1 
ATOM   7714 C CG  . LEU B 1 466 ? 51.704  2.460   -39.260 1.00 58.71  ? 463 LEU B CG  1 
ATOM   7715 C CD1 . LEU B 1 466 ? 50.571  1.500   -39.626 1.00 52.74  ? 463 LEU B CD1 1 
ATOM   7716 C CD2 . LEU B 1 466 ? 51.305  3.892   -39.582 1.00 57.71  ? 463 LEU B CD2 1 
ATOM   7717 N N   . ASN B 1 467 ? 54.536  3.325   -35.418 1.00 63.39  ? 464 ASN B N   1 
ATOM   7718 C CA  . ASN B 1 467 ? 55.048  3.161   -34.037 1.00 62.88  ? 464 ASN B CA  1 
ATOM   7719 C C   . ASN B 1 467 ? 54.109  2.509   -33.009 1.00 62.01  ? 464 ASN B C   1 
ATOM   7720 O O   . ASN B 1 467 ? 53.681  3.157   -32.044 1.00 62.20  ? 464 ASN B O   1 
ATOM   7721 C CB  . ASN B 1 467 ? 55.546  4.503   -33.443 1.00 66.06  ? 464 ASN B CB  1 
ATOM   7722 C CG  . ASN B 1 467 ? 56.170  5.432   -34.491 1.00 73.18  ? 464 ASN B CG  1 
ATOM   7723 O OD1 . ASN B 1 467 ? 57.115  6.200   -34.194 1.00 77.30  ? 464 ASN B OD1 1 
ATOM   7724 N ND2 . ASN B 1 467 ? 55.461  5.577   -35.632 1.00 75.68  ? 464 ASN B ND2 1 
ATOM   7725 N N   . TYR B 1 468 ? 53.766  1.243   -33.242 1.00 59.97  ? 465 TYR B N   1 
ATOM   7726 C CA  . TYR B 1 468 ? 53.207  0.375   -32.204 1.00 52.56  ? 465 TYR B CA  1 
ATOM   7727 C C   . TYR B 1 468 ? 54.358  -0.216  -31.397 1.00 53.19  ? 465 TYR B C   1 
ATOM   7728 O O   . TYR B 1 468 ? 55.510  -0.129  -31.818 1.00 52.89  ? 465 TYR B O   1 
ATOM   7729 C CB  . TYR B 1 468 ? 52.369  -0.761  -32.804 1.00 52.08  ? 465 TYR B CB  1 
ATOM   7730 C CG  . TYR B 1 468 ? 51.072  -0.339  -33.455 1.00 50.37  ? 465 TYR B CG  1 
ATOM   7731 C CD1 . TYR B 1 468 ? 51.040  0.070   -34.783 1.00 51.83  ? 465 TYR B CD1 1 
ATOM   7732 C CD2 . TYR B 1 468 ? 49.872  -0.391  -32.756 1.00 48.34  ? 465 TYR B CD2 1 
ATOM   7733 C CE1 . TYR B 1 468 ? 49.853  0.438   -35.389 1.00 48.79  ? 465 TYR B CE1 1 
ATOM   7734 C CE2 . TYR B 1 468 ? 48.680  -0.023  -33.353 1.00 46.19  ? 465 TYR B CE2 1 
ATOM   7735 C CZ  . TYR B 1 468 ? 48.676  0.391   -34.667 1.00 48.37  ? 465 TYR B CZ  1 
ATOM   7736 O OH  . TYR B 1 468 ? 47.486  0.753   -35.257 1.00 45.21  ? 465 TYR B OH  1 
ATOM   7737 N N   . THR B 1 469 ? 54.054  -0.838  -30.259 1.00 51.61  ? 466 THR B N   1 
ATOM   7738 C CA  . THR B 1 469 ? 55.085  -1.476  -29.438 1.00 53.56  ? 466 THR B CA  1 
ATOM   7739 C C   . THR B 1 469 ? 55.448  -2.862  -29.976 1.00 54.13  ? 466 THR B C   1 
ATOM   7740 O O   . THR B 1 469 ? 54.726  -3.422  -30.801 1.00 50.38  ? 466 THR B O   1 
ATOM   7741 C CB  . THR B 1 469 ? 54.640  -1.612  -27.970 1.00 53.65  ? 466 THR B CB  1 
ATOM   7742 O OG1 . THR B 1 469 ? 53.610  -2.602  -27.868 1.00 54.29  ? 466 THR B OG1 1 
ATOM   7743 C CG2 . THR B 1 469 ? 54.120  -0.286  -27.433 1.00 48.80  ? 466 THR B CG2 1 
ATOM   7744 N N   . THR B 1 470 ? 56.562  -3.411  -29.498 1.00 54.41  ? 467 THR B N   1 
ATOM   7745 C CA  . THR B 1 470 ? 57.012  -4.746  -29.899 1.00 58.58  ? 467 THR B CA  1 
ATOM   7746 C C   . THR B 1 470 ? 55.975  -5.817  -29.561 1.00 53.92  ? 467 THR B C   1 
ATOM   7747 O O   . THR B 1 470 ? 55.648  -6.693  -30.382 1.00 55.94  ? 467 THR B O   1 
ATOM   7748 C CB  . THR B 1 470 ? 58.346  -5.112  -29.214 1.00 60.67  ? 467 THR B CB  1 
ATOM   7749 O OG1 . THR B 1 470 ? 59.344  -4.145  -29.558 1.00 63.23  ? 467 THR B OG1 1 
ATOM   7750 C CG2 . THR B 1 470 ? 58.813  -6.499  -29.639 1.00 58.61  ? 467 THR B CG2 1 
ATOM   7751 N N   . GLU B 1 471 ? 55.458  -5.732  -28.341 1.00 53.89  ? 468 GLU B N   1 
ATOM   7752 C CA  . GLU B 1 471 ? 54.459  -6.673  -27.865 1.00 55.59  ? 468 GLU B CA  1 
ATOM   7753 C C   . GLU B 1 471 ? 53.214  -6.608  -28.738 1.00 48.83  ? 468 GLU B C   1 
ATOM   7754 O O   . GLU B 1 471 ? 52.594  -7.627  -29.013 1.00 47.89  ? 468 GLU B O   1 
ATOM   7755 C CB  . GLU B 1 471 ? 54.099  -6.394  -26.404 1.00 52.65  ? 468 GLU B CB  1 
ATOM   7756 C CG  . GLU B 1 471 ? 55.273  -6.497  -25.432 1.00 61.18  ? 468 GLU B CG  1 
ATOM   7757 C CD  . GLU B 1 471 ? 56.161  -5.262  -25.445 1.00 68.20  ? 468 GLU B CD  1 
ATOM   7758 O OE1 . GLU B 1 471 ? 55.641  -4.149  -25.681 1.00 64.56  ? 468 GLU B OE1 1 
ATOM   7759 O OE2 . GLU B 1 471 ? 57.383  -5.408  -25.227 1.00 73.44  ? 468 GLU B OE2 1 
ATOM   7760 N N   . GLU B 1 472 ? 52.862  -5.405  -29.181 1.00 51.07  ? 469 GLU B N   1 
ATOM   7761 C CA  . GLU B 1 472 ? 51.703  -5.224  -30.048 1.00 50.78  ? 469 GLU B CA  1 
ATOM   7762 C C   . GLU B 1 472 ? 51.925  -5.851  -31.422 1.00 49.15  ? 469 GLU B C   1 
ATOM   7763 O O   . GLU B 1 472 ? 50.984  -6.332  -32.052 1.00 50.64  ? 469 GLU B O   1 
ATOM   7764 C CB  . GLU B 1 472 ? 51.364  -3.738  -30.180 1.00 48.93  ? 469 GLU B CB  1 
ATOM   7765 C CG  . GLU B 1 472 ? 50.594  -3.201  -28.984 1.00 44.98  ? 469 GLU B CG  1 
ATOM   7766 C CD  . GLU B 1 472 ? 50.323  -1.715  -29.067 1.00 47.53  ? 469 GLU B CD  1 
ATOM   7767 O OE1 . GLU B 1 472 ? 51.148  -0.992  -29.662 1.00 49.18  ? 469 GLU B OE1 1 
ATOM   7768 O OE2 . GLU B 1 472 ? 49.283  -1.268  -28.534 1.00 46.11  ? 469 GLU B OE2 1 
ATOM   7769 N N   . ARG B 1 473 ? 53.173  -5.858  -31.879 1.00 52.48  ? 470 ARG B N   1 
ATOM   7770 C CA  . ARG B 1 473 ? 53.519  -6.521  -33.130 1.00 49.65  ? 470 ARG B CA  1 
ATOM   7771 C C   . ARG B 1 473 ? 53.351  -8.033  -32.993 1.00 51.74  ? 470 ARG B C   1 
ATOM   7772 O O   . ARG B 1 473 ? 52.759  -8.698  -33.861 1.00 48.00  ? 470 ARG B O   1 
ATOM   7773 C CB  . ARG B 1 473 ? 54.951  -6.177  -33.544 1.00 56.41  ? 470 ARG B CB  1 
ATOM   7774 C CG  . ARG B 1 473 ? 55.496  -7.046  -34.668 1.00 58.87  ? 470 ARG B CG  1 
ATOM   7775 C CD  . ARG B 1 473 ? 56.966  -6.760  -34.934 1.00 68.80  ? 470 ARG B CD  1 
ATOM   7776 N NE  . ARG B 1 473 ? 57.708  -7.984  -35.226 1.00 73.10  ? 470 ARG B NE  1 
ATOM   7777 C CZ  . ARG B 1 473 ? 58.266  -8.758  -34.299 1.00 73.62  ? 470 ARG B CZ  1 
ATOM   7778 N NH1 . ARG B 1 473 ? 58.921  -9.855  -34.653 1.00 79.15  ? 470 ARG B NH1 1 
ATOM   7779 N NH2 . ARG B 1 473 ? 58.170  -8.433  -33.016 1.00 70.54  ? 470 ARG B NH2 1 
ATOM   7780 N N   . ILE B 1 474 ? 53.872  -8.573  -31.894 1.00 48.90  ? 471 ILE B N   1 
ATOM   7781 C CA  . ILE B 1 474 ? 53.733  -10.001 -31.618 1.00 47.99  ? 471 ILE B CA  1 
ATOM   7782 C C   . ILE B 1 474 ? 52.251  -10.390 -31.524 1.00 42.24  ? 471 ILE B C   1 
ATOM   7783 O O   . ILE B 1 474 ? 51.815  -11.421 -32.061 1.00 44.93  ? 471 ILE B O   1 
ATOM   7784 C CB  . ILE B 1 474 ? 54.477  -10.380 -30.319 1.00 51.96  ? 471 ILE B CB  1 
ATOM   7785 C CG1 . ILE B 1 474 ? 55.975  -10.106 -30.482 1.00 53.80  ? 471 ILE B CG1 1 
ATOM   7786 C CG2 . ILE B 1 474 ? 54.235  -11.837 -29.959 1.00 45.09  ? 471 ILE B CG2 1 
ATOM   7787 C CD1 . ILE B 1 474 ? 56.779  -10.281 -29.214 1.00 57.46  ? 471 ILE B CD1 1 
ATOM   7788 N N   . PHE B 1 475 ? 51.485  -9.532  -30.858 1.00 42.49  ? 472 PHE B N   1 
ATOM   7789 C CA  . PHE B 1 475 ? 50.043  -9.690  -30.695 1.00 42.27  ? 472 PHE B CA  1 
ATOM   7790 C C   . PHE B 1 475 ? 49.330  -9.731  -32.046 1.00 43.54  ? 472 PHE B C   1 
ATOM   7791 O O   . PHE B 1 475 ? 48.497  -10.612 -32.308 1.00 41.82  ? 472 PHE B O   1 
ATOM   7792 C CB  . PHE B 1 475 ? 49.503  -8.545  -29.833 1.00 41.64  ? 472 PHE B CB  1 
ATOM   7793 C CG  . PHE B 1 475 ? 48.042  -8.654  -29.508 1.00 42.07  ? 472 PHE B CG  1 
ATOM   7794 C CD1 . PHE B 1 475 ? 47.497  -9.856  -29.086 1.00 38.71  ? 472 PHE B CD1 1 
ATOM   7795 C CD2 . PHE B 1 475 ? 47.217  -7.544  -29.600 1.00 40.90  ? 472 PHE B CD2 1 
ATOM   7796 C CE1 . PHE B 1 475 ? 46.152  -9.953  -28.782 1.00 37.47  ? 472 PHE B CE1 1 
ATOM   7797 C CE2 . PHE B 1 475 ? 45.872  -7.633  -29.293 1.00 39.59  ? 472 PHE B CE2 1 
ATOM   7798 C CZ  . PHE B 1 475 ? 45.340  -8.841  -28.882 1.00 37.27  ? 472 PHE B CZ  1 
ATOM   7799 N N   . ALA B 1 476 ? 49.677  -8.772  -32.901 1.00 44.45  ? 473 ALA B N   1 
ATOM   7800 C CA  . ALA B 1 476 ? 49.120  -8.698  -34.241 1.00 42.80  ? 473 ALA B CA  1 
ATOM   7801 C C   . ALA B 1 476 ? 49.401  -9.985  -34.996 1.00 43.46  ? 473 ALA B C   1 
ATOM   7802 O O   . ALA B 1 476 ? 48.514  -10.528 -35.649 1.00 43.83  ? 473 ALA B O   1 
ATOM   7803 C CB  . ALA B 1 476 ? 49.688  -7.503  -34.992 1.00 44.36  ? 473 ALA B CB  1 
ATOM   7804 N N   . GLN B 1 477 ? 50.629  -10.487 -34.891 1.00 43.70  ? 474 GLN B N   1 
ATOM   7805 C CA  . GLN B 1 477 ? 50.974  -11.731 -35.575 1.00 43.42  ? 474 GLN B CA  1 
ATOM   7806 C C   . GLN B 1 477 ? 50.118  -12.891 -35.068 1.00 43.56  ? 474 GLN B C   1 
ATOM   7807 O O   . GLN B 1 477 ? 49.646  -13.722 -35.860 1.00 39.90  ? 474 GLN B O   1 
ATOM   7808 C CB  . GLN B 1 477 ? 52.462  -12.044 -35.409 1.00 47.59  ? 474 GLN B CB  1 
ATOM   7809 C CG  . GLN B 1 477 ? 53.369  -11.104 -36.193 1.00 48.79  ? 474 GLN B CG  1 
ATOM   7810 C CD  . GLN B 1 477 ? 54.827  -11.227 -35.798 1.00 57.75  ? 474 GLN B CD  1 
ATOM   7811 O OE1 . GLN B 1 477 ? 55.195  -10.981 -34.647 1.00 62.16  ? 474 GLN B OE1 1 
ATOM   7812 N NE2 . GLN B 1 477 ? 55.667  -11.608 -36.753 1.00 59.65  ? 474 GLN B NE2 1 
ATOM   7813 N N   . ARG B 1 478 ? 49.902  -12.933 -33.752 1.00 40.33  ? 475 ARG B N   1 
ATOM   7814 C CA  . ARG B 1 478 ? 49.005  -13.934 -33.177 1.00 43.05  ? 475 ARG B CA  1 
ATOM   7815 C C   . ARG B 1 478 ? 47.610  -13.872 -33.807 1.00 39.57  ? 475 ARG B C   1 
ATOM   7816 O O   . ARG B 1 478 ? 47.079  -14.890 -34.258 1.00 39.76  ? 475 ARG B O   1 
ATOM   7817 C CB  . ARG B 1 478 ? 48.894  -13.760 -31.658 1.00 39.42  ? 475 ARG B CB  1 
ATOM   7818 C CG  . ARG B 1 478 ? 50.031  -14.388 -30.872 1.00 46.55  ? 475 ARG B CG  1 
ATOM   7819 C CD  . ARG B 1 478 ? 49.851  -14.165 -29.373 1.00 41.36  ? 475 ARG B CD  1 
ATOM   7820 N NE  . ARG B 1 478 ? 48.577  -14.699 -28.904 1.00 38.14  ? 475 ARG B NE  1 
ATOM   7821 C CZ  . ARG B 1 478 ? 47.816  -14.124 -27.979 1.00 40.72  ? 475 ARG B CZ  1 
ATOM   7822 N NH1 . ARG B 1 478 ? 48.201  -12.987 -27.410 1.00 39.75  ? 475 ARG B NH1 1 
ATOM   7823 N NH2 . ARG B 1 478 ? 46.670  -14.688 -27.620 1.00 42.33  ? 475 ARG B NH2 1 
ATOM   7824 N N   . LEU B 1 479 ? 47.026  -12.677 -33.843 1.00 38.21  ? 476 LEU B N   1 
ATOM   7825 C CA  . LEU B 1 479 ? 45.665  -12.520 -34.358 1.00 39.42  ? 476 LEU B CA  1 
ATOM   7826 C C   . LEU B 1 479 ? 45.555  -12.844 -35.853 1.00 37.52  ? 476 LEU B C   1 
ATOM   7827 O O   . LEU B 1 479 ? 44.584  -13.469 -36.291 1.00 38.00  ? 476 LEU B O   1 
ATOM   7828 C CB  . LEU B 1 479 ? 45.158  -11.103 -34.085 1.00 39.53  ? 476 LEU B CB  1 
ATOM   7829 C CG  . LEU B 1 479 ? 44.990  -10.753 -32.603 1.00 40.87  ? 476 LEU B CG  1 
ATOM   7830 C CD1 . LEU B 1 479 ? 44.348  -9.390  -32.443 1.00 40.35  ? 476 LEU B CD1 1 
ATOM   7831 C CD2 . LEU B 1 479 ? 44.163  -11.807 -31.899 1.00 38.75  ? 476 LEU B CD2 1 
ATOM   7832 N N   . MET B 1 480 ? 46.550  -12.426 -36.630 1.00 40.32  ? 477 MET B N   1 
ATOM   7833 C CA  . MET B 1 480 ? 46.599  -12.763 -38.052 1.00 40.67  ? 477 MET B CA  1 
ATOM   7834 C C   . MET B 1 480 ? 46.621  -14.277 -38.218 1.00 41.05  ? 477 MET B C   1 
ATOM   7835 O O   . MET B 1 480 ? 45.952  -14.833 -39.107 1.00 37.50  ? 477 MET B O   1 
ATOM   7836 C CB  . MET B 1 480 ? 47.823  -12.136 -38.720 1.00 38.39  ? 477 MET B CB  1 
ATOM   7837 C CG  . MET B 1 480 ? 47.874  -10.618 -38.633 1.00 40.91  ? 477 MET B CG  1 
ATOM   7838 S SD  . MET B 1 480 ? 49.469  -9.961  -39.161 1.00 49.22  ? 477 MET B SD  1 
ATOM   7839 C CE  . MET B 1 480 ? 49.444  -10.405 -40.894 1.00 36.54  ? 477 MET B CE  1 
ATOM   7840 N N   . LYS B 1 481 ? 47.372  -14.946 -37.343 1.00 39.09  ? 478 LYS B N   1 
ATOM   7841 C CA  . LYS B 1 481 ? 47.407  -16.406 -37.371 1.00 40.14  ? 478 LYS B CA  1 
ATOM   7842 C C   . LYS B 1 481 ? 46.045  -17.018 -37.028 1.00 39.63  ? 478 LYS B C   1 
ATOM   7843 O O   . LYS B 1 481 ? 45.610  -17.946 -37.699 1.00 40.33  ? 478 LYS B O   1 
ATOM   7844 C CB  . LYS B 1 481 ? 48.483  -16.945 -36.425 1.00 46.62  ? 478 LYS B CB  1 
ATOM   7845 C CG  . LYS B 1 481 ? 49.634  -17.640 -37.143 1.00 53.71  ? 478 LYS B CG  1 
ATOM   7846 C CD  . LYS B 1 481 ? 49.169  -18.921 -37.831 1.00 59.42  ? 478 LYS B CD  1 
ATOM   7847 C CE  . LYS B 1 481 ? 50.213  -19.438 -38.813 1.00 61.63  ? 478 LYS B CE  1 
ATOM   7848 N NZ  . LYS B 1 481 ? 49.793  -20.719 -39.454 1.00 73.29  ? 478 LYS B NZ  1 
ATOM   7849 N N   . TYR B 1 482 ? 45.375  -16.507 -35.994 1.00 40.97  ? 479 TYR B N   1 
ATOM   7850 C CA  . TYR B 1 482 ? 44.042  -17.007 -35.628 1.00 37.51  ? 479 TYR B CA  1 
ATOM   7851 C C   . TYR B 1 482 ? 43.054  -16.876 -36.790 1.00 37.24  ? 479 TYR B C   1 
ATOM   7852 O O   . TYR B 1 482 ? 42.362  -17.833 -37.163 1.00 38.06  ? 479 TYR B O   1 
ATOM   7853 C CB  . TYR B 1 482 ? 43.478  -16.252 -34.420 1.00 32.48  ? 479 TYR B CB  1 
ATOM   7854 C CG  . TYR B 1 482 ? 44.165  -16.511 -33.094 1.00 40.73  ? 479 TYR B CG  1 
ATOM   7855 C CD1 . TYR B 1 482 ? 44.625  -17.779 -32.748 1.00 39.82  ? 479 TYR B CD1 1 
ATOM   7856 C CD2 . TYR B 1 482 ? 44.339  -15.481 -32.181 1.00 38.18  ? 479 TYR B CD2 1 
ATOM   7857 C CE1 . TYR B 1 482 ? 45.248  -18.004 -31.517 1.00 39.92  ? 479 TYR B CE1 1 
ATOM   7858 C CE2 . TYR B 1 482 ? 44.959  -15.692 -30.960 1.00 39.76  ? 479 TYR B CE2 1 
ATOM   7859 C CZ  . TYR B 1 482 ? 45.411  -16.951 -30.632 1.00 40.39  ? 479 TYR B CZ  1 
ATOM   7860 O OH  . TYR B 1 482 ? 46.025  -17.139 -29.410 1.00 42.59  ? 479 TYR B OH  1 
ATOM   7861 N N   . TRP B 1 483 ? 42.988  -15.673 -37.347 1.00 36.69  ? 480 TRP B N   1 
ATOM   7862 C CA  . TRP B 1 483 ? 42.043  -15.380 -38.422 1.00 36.13  ? 480 TRP B CA  1 
ATOM   7863 C C   . TRP B 1 483 ? 42.324  -16.194 -39.691 1.00 34.82  ? 480 TRP B C   1 
ATOM   7864 O O   . TRP B 1 483 ? 41.391  -16.710 -40.319 1.00 33.16  ? 480 TRP B O   1 
ATOM   7865 C CB  . TRP B 1 483 ? 42.054  -13.878 -38.729 1.00 33.71  ? 480 TRP B CB  1 
ATOM   7866 C CG  . TRP B 1 483 ? 40.908  -13.105 -38.113 1.00 32.45  ? 480 TRP B CG  1 
ATOM   7867 C CD1 . TRP B 1 483 ? 39.947  -12.394 -38.782 1.00 34.27  ? 480 TRP B CD1 1 
ATOM   7868 C CD2 . TRP B 1 483 ? 40.605  -12.963 -36.713 1.00 35.98  ? 480 TRP B CD2 1 
ATOM   7869 N NE1 . TRP B 1 483 ? 39.073  -11.819 -37.888 1.00 34.88  ? 480 TRP B NE1 1 
ATOM   7870 C CE2 . TRP B 1 483 ? 39.453  -12.156 -36.613 1.00 34.46  ? 480 TRP B CE2 1 
ATOM   7871 C CE3 . TRP B 1 483 ? 41.194  -13.446 -35.537 1.00 35.32  ? 480 TRP B CE3 1 
ATOM   7872 C CZ2 . TRP B 1 483 ? 38.878  -11.817 -35.387 1.00 33.92  ? 480 TRP B CZ2 1 
ATOM   7873 C CZ3 . TRP B 1 483 ? 40.621  -13.105 -34.315 1.00 37.09  ? 480 TRP B CZ3 1 
ATOM   7874 C CH2 . TRP B 1 483 ? 39.477  -12.298 -34.252 1.00 35.70  ? 480 TRP B CH2 1 
ATOM   7875 N N   . THR B 1 484 ? 43.592  -16.345 -40.069 1.00 34.28  ? 481 THR B N   1 
ATOM   7876 C CA  . THR B 1 484 ? 43.876  -17.098 -41.292 1.00 34.73  ? 481 THR B CA  1 
ATOM   7877 C C   . THR B 1 484 ? 43.807  -18.610 -41.071 1.00 36.06  ? 481 THR B C   1 
ATOM   7878 O O   . THR B 1 484 ? 43.519  -19.366 -42.005 1.00 31.90  ? 481 THR B O   1 
ATOM   7879 C CB  . THR B 1 484 ? 45.242  -16.718 -41.891 1.00 39.06  ? 481 THR B CB  1 
ATOM   7880 O OG1 . THR B 1 484 ? 46.264  -16.858 -40.899 1.00 42.75  ? 481 THR B OG1 1 
ATOM   7881 C CG2 . THR B 1 484 ? 45.214  -15.276 -42.371 1.00 34.75  ? 481 THR B CG2 1 
ATOM   7882 N N   . ASN B 1 485 ? 44.056  -19.054 -39.839 1.00 36.00  ? 482 ASN B N   1 
ATOM   7883 C CA  . ASN B 1 485 ? 43.811  -20.447 -39.478 1.00 35.58  ? 482 ASN B CA  1 
ATOM   7884 C C   . ASN B 1 485 ? 42.334  -20.748 -39.627 1.00 32.26  ? 482 ASN B C   1 
ATOM   7885 O O   . ASN B 1 485 ? 41.951  -21.789 -40.163 1.00 35.01  ? 482 ASN B O   1 
ATOM   7886 C CB  . ASN B 1 485 ? 44.256  -20.757 -38.039 1.00 38.63  ? 482 ASN B CB  1 
ATOM   7887 C CG  . ASN B 1 485 ? 45.758  -20.942 -37.913 1.00 43.77  ? 482 ASN B CG  1 
ATOM   7888 O OD1 . ASN B 1 485 ? 46.441  -21.273 -38.880 1.00 44.90  ? 482 ASN B OD1 1 
ATOM   7889 N ND2 . ASN B 1 485 ? 46.278  -20.737 -36.706 1.00 51.54  ? 482 ASN B ND2 1 
ATOM   7890 N N   . PHE B 1 486 ? 41.506  -19.827 -39.145 1.00 28.63  ? 483 PHE B N   1 
ATOM   7891 C CA  . PHE B 1 486 ? 40.067  -20.004 -39.252 1.00 31.77  ? 483 PHE B CA  1 
ATOM   7892 C C   . PHE B 1 486 ? 39.628  -20.009 -40.713 1.00 33.67  ? 483 PHE B C   1 
ATOM   7893 O O   . PHE B 1 486 ? 38.795  -20.821 -41.114 1.00 33.76  ? 483 PHE B O   1 
ATOM   7894 C CB  . PHE B 1 486 ? 39.310  -18.913 -38.495 1.00 32.81  ? 483 PHE B CB  1 
ATOM   7895 C CG  . PHE B 1 486 ? 37.821  -18.991 -38.678 1.00 38.04  ? 483 PHE B CG  1 
ATOM   7896 C CD1 . PHE B 1 486 ? 37.068  -19.892 -37.940 1.00 33.17  ? 483 PHE B CD1 1 
ATOM   7897 C CD2 . PHE B 1 486 ? 37.177  -18.188 -39.610 1.00 33.18  ? 483 PHE B CD2 1 
ATOM   7898 C CE1 . PHE B 1 486 ? 35.699  -19.980 -38.114 1.00 33.33  ? 483 PHE B CE1 1 
ATOM   7899 C CE2 . PHE B 1 486 ? 35.809  -18.269 -39.787 1.00 33.66  ? 483 PHE B CE2 1 
ATOM   7900 C CZ  . PHE B 1 486 ? 35.068  -19.165 -39.041 1.00 34.05  ? 483 PHE B CZ  1 
ATOM   7901 N N   . ALA B 1 487 ? 40.184  -19.093 -41.499 1.00 32.98  ? 484 ALA B N   1 
ATOM   7902 C CA  . ALA B 1 487 ? 39.869  -19.037 -42.924 1.00 33.42  ? 484 ALA B CA  1 
ATOM   7903 C C   . ALA B 1 487 ? 40.227  -20.354 -43.600 1.00 35.53  ? 484 ALA B C   1 
ATOM   7904 O O   . ALA B 1 487 ? 39.490  -20.854 -44.447 1.00 35.87  ? 484 ALA B O   1 
ATOM   7905 C CB  . ALA B 1 487 ? 40.605  -17.886 -43.587 1.00 28.91  ? 484 ALA B CB  1 
ATOM   7906 N N   . ARG B 1 488 ? 41.357  -20.923 -43.195 1.00 35.36  ? 485 ARG B N   1 
ATOM   7907 C CA  . ARG B 1 488 ? 41.899  -22.094 -43.868 1.00 37.38  ? 485 ARG B CA  1 
ATOM   7908 C C   . ARG B 1 488 ? 41.177  -23.386 -43.486 1.00 38.70  ? 485 ARG B C   1 
ATOM   7909 O O   . ARG B 1 488 ? 40.951  -24.245 -44.340 1.00 37.13  ? 485 ARG B O   1 
ATOM   7910 C CB  . ARG B 1 488 ? 43.396  -22.218 -43.568 1.00 37.60  ? 485 ARG B CB  1 
ATOM   7911 C CG  . ARG B 1 488 ? 44.122  -23.213 -44.452 1.00 49.59  ? 485 ARG B CG  1 
ATOM   7912 C CD  . ARG B 1 488 ? 45.622  -22.949 -44.478 1.00 54.01  ? 485 ARG B CD  1 
ATOM   7913 N NE  . ARG B 1 488 ? 46.164  -23.098 -45.828 1.00 66.76  ? 485 ARG B NE  1 
ATOM   7914 C CZ  . ARG B 1 488 ? 46.823  -22.146 -46.481 1.00 62.74  ? 485 ARG B CZ  1 
ATOM   7915 N NH1 . ARG B 1 488 ? 47.274  -22.373 -47.707 1.00 64.42  ? 485 ARG B NH1 1 
ATOM   7916 N NH2 . ARG B 1 488 ? 47.039  -20.968 -45.907 1.00 64.47  ? 485 ARG B NH2 1 
ATOM   7917 N N   . THR B 1 489 ? 40.810  -23.518 -42.211 1.00 37.77  ? 486 THR B N   1 
ATOM   7918 C CA  . THR B 1 489 ? 40.306  -24.789 -41.688 1.00 40.47  ? 486 THR B CA  1 
ATOM   7919 C C   . THR B 1 489 ? 38.944  -24.707 -40.995 1.00 40.36  ? 486 THR B C   1 
ATOM   7920 O O   . THR B 1 489 ? 38.331  -25.732 -40.693 1.00 40.42  ? 486 THR B O   1 
ATOM   7921 C CB  . THR B 1 489 ? 41.300  -25.398 -40.671 1.00 38.80  ? 486 THR B CB  1 
ATOM   7922 O OG1 . THR B 1 489 ? 41.374  -24.559 -39.513 1.00 37.06  ? 486 THR B OG1 1 
ATOM   7923 C CG2 . THR B 1 489 ? 42.685  -25.530 -41.284 1.00 42.50  ? 486 THR B CG2 1 
ATOM   7924 N N   . GLY B 1 490 ? 38.473  -23.496 -40.728 1.00 35.95  ? 487 GLY B N   1 
ATOM   7925 C CA  . GLY B 1 490 ? 37.261  -23.337 -39.948 1.00 36.51  ? 487 GLY B CA  1 
ATOM   7926 C C   . GLY B 1 490 ? 37.543  -23.471 -38.465 1.00 34.36  ? 487 GLY B C   1 
ATOM   7927 O O   . GLY B 1 490 ? 36.634  -23.691 -37.669 1.00 37.42  ? 487 GLY B O   1 
ATOM   7928 N N   . ASP B 1 491 ? 38.813  -23.318 -38.103 1.00 36.72  ? 488 ASP B N   1 
ATOM   7929 C CA  . ASP B 1 491 ? 39.269  -23.475 -36.721 1.00 34.77  ? 488 ASP B CA  1 
ATOM   7930 C C   . ASP B 1 491 ? 40.438  -22.522 -36.481 1.00 35.15  ? 488 ASP B C   1 
ATOM   7931 O O   . ASP B 1 491 ? 41.456  -22.609 -37.172 1.00 35.55  ? 488 ASP B O   1 
ATOM   7932 C CB  . ASP B 1 491 ? 39.680  -24.930 -36.478 1.00 34.10  ? 488 ASP B CB  1 
ATOM   7933 C CG  . ASP B 1 491 ? 39.950  -25.250 -35.016 1.00 36.48  ? 488 ASP B CG  1 
ATOM   7934 O OD1 . ASP B 1 491 ? 40.289  -24.347 -34.220 1.00 35.05  ? 488 ASP B OD1 1 
ATOM   7935 O OD2 . ASP B 1 491 ? 39.831  -26.443 -34.678 1.00 35.05  ? 488 ASP B OD2 1 
ATOM   7936 N N   . PRO B 1 492 ? 40.302  -21.606 -35.507 1.00 35.39  ? 489 PRO B N   1 
ATOM   7937 C CA  . PRO B 1 492 ? 41.374  -20.634 -35.275 1.00 35.00  ? 489 PRO B CA  1 
ATOM   7938 C C   . PRO B 1 492 ? 42.613  -21.257 -34.643 1.00 36.63  ? 489 PRO B C   1 
ATOM   7939 O O   . PRO B 1 492 ? 43.683  -20.655 -34.698 1.00 38.21  ? 489 PRO B O   1 
ATOM   7940 C CB  . PRO B 1 492 ? 40.730  -19.621 -34.325 1.00 33.98  ? 489 PRO B CB  1 
ATOM   7941 C CG  . PRO B 1 492 ? 39.691  -20.398 -33.609 1.00 35.87  ? 489 PRO B CG  1 
ATOM   7942 C CD  . PRO B 1 492 ? 39.159  -21.389 -34.602 1.00 32.40  ? 489 PRO B CD  1 
ATOM   7943 N N   . ASN B 1 493 ? 42.470  -22.435 -34.044 1.00 39.72  ? 490 ASN B N   1 
ATOM   7944 C CA  . ASN B 1 493 ? 43.611  -23.100 -33.425 1.00 40.88  ? 490 ASN B CA  1 
ATOM   7945 C C   . ASN B 1 493 ? 44.630  -23.522 -34.468 1.00 49.41  ? 490 ASN B C   1 
ATOM   7946 O O   . ASN B 1 493 ? 44.285  -23.790 -35.615 1.00 47.81  ? 490 ASN B O   1 
ATOM   7947 C CB  . ASN B 1 493 ? 43.163  -24.313 -32.613 1.00 40.60  ? 490 ASN B CB  1 
ATOM   7948 C CG  . ASN B 1 493 ? 42.320  -23.928 -31.425 1.00 34.72  ? 490 ASN B CG  1 
ATOM   7949 O OD1 . ASN B 1 493 ? 42.823  -23.363 -30.458 1.00 37.06  ? 490 ASN B OD1 1 
ATOM   7950 N ND2 . ASN B 1 493 ? 41.027  -24.226 -31.492 1.00 32.39  ? 490 ASN B ND2 1 
ATOM   7951 N N   . ASP B 1 494 ? 45.889  -23.566 -34.059 1.00 54.31  ? 491 ASP B N   1 
ATOM   7952 C CA  . ASP B 1 494 ? 46.971  -23.955 -34.944 1.00 61.07  ? 491 ASP B CA  1 
ATOM   7953 C C   . ASP B 1 494 ? 46.849  -25.442 -35.286 1.00 69.42  ? 491 ASP B C   1 
ATOM   7954 O O   . ASP B 1 494 ? 46.915  -26.283 -34.393 1.00 72.78  ? 491 ASP B O   1 
ATOM   7955 C CB  . ASP B 1 494 ? 48.313  -23.648 -34.278 1.00 70.76  ? 491 ASP B CB  1 
ATOM   7956 C CG  . ASP B 1 494 ? 49.346  -23.115 -35.251 1.00 77.92  ? 491 ASP B CG  1 
ATOM   7957 O OD1 . ASP B 1 494 ? 49.299  -23.482 -36.444 1.00 81.43  ? 491 ASP B OD1 1 
ATOM   7958 O OD2 . ASP B 1 494 ? 50.209  -22.324 -34.815 1.00 81.55  ? 491 ASP B OD2 1 
ATOM   7959 N N   . PRO B 1 495 ? 46.666  -25.771 -36.581 1.00 74.19  ? 492 PRO B N   1 
ATOM   7960 C CA  . PRO B 1 495 ? 46.464  -27.157 -37.040 1.00 74.56  ? 492 PRO B CA  1 
ATOM   7961 C C   . PRO B 1 495 ? 47.570  -28.096 -36.557 1.00 78.07  ? 492 PRO B C   1 
ATOM   7962 O O   . PRO B 1 495 ? 47.382  -29.309 -36.465 1.00 72.68  ? 492 PRO B O   1 
ATOM   7963 C CB  . PRO B 1 495 ? 46.472  -27.031 -38.571 1.00 75.49  ? 492 PRO B CB  1 
ATOM   7964 C CG  . PRO B 1 495 ? 47.096  -25.697 -38.857 1.00 72.22  ? 492 PRO B CG  1 
ATOM   7965 C CD  . PRO B 1 495 ? 46.707  -24.824 -37.708 1.00 68.87  ? 492 PRO B CD  1 
ATOM   7966 N N   . ARG B 1 496 ? 48.731  -27.509 -36.289 1.00 92.04  ? 493 ARG B N   1 
ATOM   7967 C CA  . ARG B 1 496 ? 49.790  -28.116 -35.493 1.00 94.08  ? 493 ARG B CA  1 
ATOM   7968 C C   . ARG B 1 496 ? 50.327  -26.979 -34.637 1.00 94.00  ? 493 ARG B C   1 
ATOM   7969 O O   . ARG B 1 496 ? 50.344  -25.841 -35.090 1.00 88.88  ? 493 ARG B O   1 
ATOM   7970 C CB  . ARG B 1 496 ? 50.894  -28.711 -36.364 1.00 94.19  ? 493 ARG B CB  1 
ATOM   7971 C CG  . ARG B 1 496 ? 50.461  -29.055 -37.774 1.00 89.35  ? 493 ARG B CG  1 
ATOM   7972 C CD  . ARG B 1 496 ? 51.419  -30.034 -38.394 1.00 84.77  ? 493 ARG B CD  1 
ATOM   7973 N NE  . ARG B 1 496 ? 50.861  -31.376 -38.348 1.00 79.62  ? 493 ARG B NE  1 
ATOM   7974 C CZ  . ARG B 1 496 ? 51.587  -32.482 -38.411 1.00 73.88  ? 493 ARG B CZ  1 
ATOM   7975 N NH1 . ARG B 1 496 ? 52.905  -32.403 -38.523 1.00 69.37  ? 493 ARG B NH1 1 
ATOM   7976 N NH2 . ARG B 1 496 ? 50.997  -33.663 -38.350 1.00 69.55  ? 493 ARG B NH2 1 
ATOM   7977 N N   . ASP B 1 497 ? 50.764  -27.254 -33.414 1.00 90.14  ? 494 ASP B N   1 
ATOM   7978 C CA  . ASP B 1 497 ? 51.195  -26.162 -32.546 1.00 91.29  ? 494 ASP B CA  1 
ATOM   7979 C C   . ASP B 1 497 ? 52.713  -26.010 -32.505 1.00 94.77  ? 494 ASP B C   1 
ATOM   7980 O O   . ASP B 1 497 ? 53.236  -24.901 -32.635 1.00 93.85  ? 494 ASP B O   1 
ATOM   7981 C CB  . ASP B 1 497 ? 50.647  -26.354 -31.130 1.00 92.06  ? 494 ASP B CB  1 
ATOM   7982 C CG  . ASP B 1 497 ? 49.195  -26.788 -31.123 1.00 83.07  ? 494 ASP B CG  1 
ATOM   7983 O OD1 . ASP B 1 497 ? 48.555  -26.738 -32.193 1.00 83.99  ? 494 ASP B OD1 1 
ATOM   7984 O OD2 . ASP B 1 497 ? 48.686  -27.156 -30.044 1.00 71.42  ? 494 ASP B OD2 1 
ATOM   7985 N N   . SER B 1 500 ? 50.231  -22.167 -25.239 1.00 103.72 ? 497 SER B N   1 
ATOM   7986 C CA  . SER B 1 500 ? 49.238  -22.308 -26.297 1.00 95.34  ? 497 SER B CA  1 
ATOM   7987 C C   . SER B 1 500 ? 47.981  -23.047 -25.829 1.00 77.51  ? 497 SER B C   1 
ATOM   7988 O O   . SER B 1 500 ? 47.711  -24.155 -26.290 1.00 81.14  ? 497 SER B O   1 
ATOM   7989 C CB  . SER B 1 500 ? 49.848  -23.041 -27.497 1.00 91.52  ? 497 SER B CB  1 
ATOM   7990 O OG  . SER B 1 500 ? 50.743  -24.058 -27.079 1.00 95.89  ? 497 SER B OG  1 
ATOM   7991 N N   . PRO B 1 501 ? 47.212  -22.444 -24.904 1.00 68.04  ? 498 PRO B N   1 
ATOM   7992 C CA  . PRO B 1 501 ? 45.942  -23.065 -24.509 1.00 61.41  ? 498 PRO B CA  1 
ATOM   7993 C C   . PRO B 1 501 ? 44.958  -23.053 -25.674 1.00 52.63  ? 498 PRO B C   1 
ATOM   7994 O O   . PRO B 1 501 ? 44.849  -22.042 -26.368 1.00 50.83  ? 498 PRO B O   1 
ATOM   7995 C CB  . PRO B 1 501 ? 45.449  -22.177 -23.359 1.00 53.46  ? 498 PRO B CB  1 
ATOM   7996 C CG  . PRO B 1 501 ? 46.651  -21.407 -22.917 1.00 56.35  ? 498 PRO B CG  1 
ATOM   7997 C CD  . PRO B 1 501 ? 47.468  -21.208 -24.149 1.00 63.62  ? 498 PRO B CD  1 
ATOM   7998 N N   . GLN B 1 502 ? 44.261  -24.163 -25.885 1.00 49.53  ? 499 GLN B N   1 
ATOM   7999 C CA  . GLN B 1 502 ? 43.370  -24.292 -27.028 1.00 50.24  ? 499 GLN B CA  1 
ATOM   8000 C C   . GLN B 1 502 ? 42.143  -23.392 -26.909 1.00 44.19  ? 499 GLN B C   1 
ATOM   8001 O O   . GLN B 1 502 ? 41.648  -23.119 -25.815 1.00 38.70  ? 499 GLN B O   1 
ATOM   8002 C CB  . GLN B 1 502 ? 42.936  -25.750 -27.208 1.00 50.03  ? 499 GLN B CB  1 
ATOM   8003 C CG  . GLN B 1 502 ? 44.064  -26.696 -27.621 1.00 49.30  ? 499 GLN B CG  1 
ATOM   8004 C CD  . GLN B 1 502 ? 44.584  -26.429 -29.025 1.00 52.22  ? 499 GLN B CD  1 
ATOM   8005 O OE1 . GLN B 1 502 ? 43.915  -26.725 -30.017 1.00 50.74  ? 499 GLN B OE1 1 
ATOM   8006 N NE2 . GLN B 1 502 ? 45.788  -25.873 -29.114 1.00 57.93  ? 499 GLN B NE2 1 
ATOM   8007 N N   . TRP B 1 503 ? 41.668  -22.930 -28.058 1.00 37.53  ? 500 TRP B N   1 
ATOM   8008 C CA  . TRP B 1 503 ? 40.465  -22.120 -28.145 1.00 31.60  ? 500 TRP B CA  1 
ATOM   8009 C C   . TRP B 1 503 ? 39.283  -23.063 -28.368 1.00 34.22  ? 500 TRP B C   1 
ATOM   8010 O O   . TRP B 1 503 ? 39.139  -23.636 -29.450 1.00 36.17  ? 500 TRP B O   1 
ATOM   8011 C CB  . TRP B 1 503 ? 40.621  -21.099 -29.284 1.00 35.30  ? 500 TRP B CB  1 
ATOM   8012 C CG  . TRP B 1 503 ? 39.529  -20.084 -29.471 1.00 30.94  ? 500 TRP B CG  1 
ATOM   8013 C CD1 . TRP B 1 503 ? 38.251  -20.133 -28.992 1.00 33.68  ? 500 TRP B CD1 1 
ATOM   8014 C CD2 . TRP B 1 503 ? 39.631  -18.862 -30.212 1.00 31.75  ? 500 TRP B CD2 1 
ATOM   8015 N NE1 . TRP B 1 503 ? 37.554  -19.012 -29.386 1.00 32.48  ? 500 TRP B NE1 1 
ATOM   8016 C CE2 . TRP B 1 503 ? 38.379  -18.221 -30.142 1.00 33.69  ? 500 TRP B CE2 1 
ATOM   8017 C CE3 . TRP B 1 503 ? 40.663  -18.250 -30.932 1.00 33.06  ? 500 TRP B CE3 1 
ATOM   8018 C CZ2 . TRP B 1 503 ? 38.132  -16.994 -30.762 1.00 31.93  ? 500 TRP B CZ2 1 
ATOM   8019 C CZ3 . TRP B 1 503 ? 40.417  -17.035 -31.543 1.00 33.10  ? 500 TRP B CZ3 1 
ATOM   8020 C CH2 . TRP B 1 503 ? 39.162  -16.420 -31.453 1.00 33.94  ? 500 TRP B CH2 1 
ATOM   8021 N N   . PRO B 1 504 ? 38.442  -23.249 -27.340 1.00 34.14  ? 501 PRO B N   1 
ATOM   8022 C CA  . PRO B 1 504 ? 37.340  -24.205 -27.481 1.00 32.86  ? 501 PRO B CA  1 
ATOM   8023 C C   . PRO B 1 504 ? 36.160  -23.612 -28.242 1.00 33.63  ? 501 PRO B C   1 
ATOM   8024 O O   . PRO B 1 504 ? 35.932  -22.404 -28.165 1.00 33.69  ? 501 PRO B O   1 
ATOM   8025 C CB  . PRO B 1 504 ? 36.954  -24.510 -26.030 1.00 34.61  ? 501 PRO B CB  1 
ATOM   8026 C CG  . PRO B 1 504 ? 37.285  -23.254 -25.297 1.00 36.29  ? 501 PRO B CG  1 
ATOM   8027 C CD  . PRO B 1 504 ? 38.492  -22.657 -25.987 1.00 34.80  ? 501 PRO B CD  1 
ATOM   8028 N N   . PRO B 1 505 ? 35.424  -24.451 -28.983 1.00 33.63  ? 502 PRO B N   1 
ATOM   8029 C CA  . PRO B 1 505 ? 34.212  -23.973 -29.649 1.00 34.00  ? 502 PRO B CA  1 
ATOM   8030 C C   . PRO B 1 505 ? 33.202  -23.447 -28.641 1.00 37.43  ? 502 PRO B C   1 
ATOM   8031 O O   . PRO B 1 505 ? 33.131  -23.944 -27.511 1.00 34.43  ? 502 PRO B O   1 
ATOM   8032 C CB  . PRO B 1 505 ? 33.681  -25.224 -30.360 1.00 34.97  ? 502 PRO B CB  1 
ATOM   8033 C CG  . PRO B 1 505 ? 34.883  -26.071 -30.566 1.00 37.47  ? 502 PRO B CG  1 
ATOM   8034 C CD  . PRO B 1 505 ? 35.737  -25.843 -29.344 1.00 33.05  ? 502 PRO B CD  1 
ATOM   8035 N N   . TYR B 1 506 ? 32.438  -22.441 -29.048 1.00 33.80  ? 503 TYR B N   1 
ATOM   8036 C CA  . TYR B 1 506 ? 31.369  -21.904 -28.221 1.00 35.42  ? 503 TYR B CA  1 
ATOM   8037 C C   . TYR B 1 506 ? 30.157  -22.825 -28.315 1.00 38.73  ? 503 TYR B C   1 
ATOM   8038 O O   . TYR B 1 506 ? 29.726  -23.181 -29.410 1.00 34.02  ? 503 TYR B O   1 
ATOM   8039 C CB  . TYR B 1 506 ? 31.007  -20.479 -28.657 1.00 30.43  ? 503 TYR B CB  1 
ATOM   8040 C CG  . TYR B 1 506 ? 29.915  -19.845 -27.828 1.00 32.33  ? 503 TYR B CG  1 
ATOM   8041 C CD1 . TYR B 1 506 ? 28.575  -20.027 -28.150 1.00 33.92  ? 503 TYR B CD1 1 
ATOM   8042 C CD2 . TYR B 1 506 ? 30.223  -19.066 -26.720 1.00 32.11  ? 503 TYR B CD2 1 
ATOM   8043 C CE1 . TYR B 1 506 ? 27.574  -19.455 -27.390 1.00 34.26  ? 503 TYR B CE1 1 
ATOM   8044 C CE2 . TYR B 1 506 ? 29.231  -18.489 -25.954 1.00 34.64  ? 503 TYR B CE2 1 
ATOM   8045 C CZ  . TYR B 1 506 ? 27.909  -18.687 -26.290 1.00 36.66  ? 503 TYR B CZ  1 
ATOM   8046 O OH  . TYR B 1 506 ? 26.920  -18.111 -25.526 1.00 36.08  ? 503 TYR B OH  1 
ATOM   8047 N N   . THR B 1 507 ? 29.625  -23.224 -27.163 1.00 33.66  ? 504 THR B N   1 
ATOM   8048 C CA  . THR B 1 507 ? 28.435  -24.067 -27.113 1.00 37.65  ? 504 THR B CA  1 
ATOM   8049 C C   . THR B 1 507 ? 27.409  -23.449 -26.168 1.00 37.32  ? 504 THR B C   1 
ATOM   8050 O O   . THR B 1 507 ? 27.762  -22.644 -25.312 1.00 35.28  ? 504 THR B O   1 
ATOM   8051 C CB  . THR B 1 507 ? 28.769  -25.500 -26.649 1.00 39.45  ? 504 THR B CB  1 
ATOM   8052 O OG1 . THR B 1 507 ? 29.302  -25.463 -25.317 1.00 37.55  ? 504 THR B OG1 1 
ATOM   8053 C CG2 . THR B 1 507 ? 29.790  -26.136 -27.580 1.00 34.86  ? 504 THR B CG2 1 
ATOM   8054 N N   . THR B 1 508 ? 26.142  -23.818 -26.316 1.00 37.06  ? 505 THR B N   1 
ATOM   8055 C CA  . THR B 1 508 ? 25.103  -23.245 -25.466 1.00 38.75  ? 505 THR B CA  1 
ATOM   8056 C C   . THR B 1 508 ? 25.227  -23.751 -24.030 1.00 43.74  ? 505 THR B C   1 
ATOM   8057 O O   . THR B 1 508 ? 24.859  -23.055 -23.079 1.00 42.79  ? 505 THR B O   1 
ATOM   8058 C CB  . THR B 1 508 ? 23.696  -23.567 -25.993 1.00 44.21  ? 505 THR B CB  1 
ATOM   8059 O OG1 . THR B 1 508 ? 23.522  -24.987 -26.048 1.00 46.63  ? 505 THR B OG1 1 
ATOM   8060 C CG2 . THR B 1 508 ? 23.500  -22.984 -27.391 1.00 41.61  ? 505 THR B CG2 1 
ATOM   8061 N N   . ALA B 1 509 ? 25.763  -24.956 -23.877 1.00 41.61  ? 506 ALA B N   1 
ATOM   8062 C CA  . ALA B 1 509 ? 25.884  -25.563 -22.556 1.00 47.13  ? 506 ALA B CA  1 
ATOM   8063 C C   . ALA B 1 509 ? 27.025  -24.947 -21.747 1.00 46.02  ? 506 ALA B C   1 
ATOM   8064 O O   . ALA B 1 509 ? 26.840  -24.575 -20.589 1.00 49.14  ? 506 ALA B O   1 
ATOM   8065 C CB  . ALA B 1 509 ? 26.076  -27.066 -22.687 1.00 42.71  ? 506 ALA B CB  1 
ATOM   8066 N N   . ALA B 1 510 ? 28.200  -24.833 -22.362 1.00 43.04  ? 507 ALA B N   1 
ATOM   8067 C CA  . ALA B 1 510 ? 29.390  -24.365 -21.655 1.00 39.29  ? 507 ALA B CA  1 
ATOM   8068 C C   . ALA B 1 510 ? 29.689  -22.884 -21.893 1.00 38.70  ? 507 ALA B C   1 
ATOM   8069 O O   . ALA B 1 510 ? 30.356  -22.252 -21.079 1.00 34.22  ? 507 ALA B O   1 
ATOM   8070 C CB  . ALA B 1 510 ? 30.593  -25.209 -22.050 1.00 38.65  ? 507 ALA B CB  1 
ATOM   8071 N N   . GLN B 1 511 ? 29.220  -22.348 -23.020 1.00 32.59  ? 508 GLN B N   1 
ATOM   8072 C CA  . GLN B 1 511 ? 29.344  -20.921 -23.333 1.00 33.59  ? 508 GLN B CA  1 
ATOM   8073 C C   . GLN B 1 511 ? 30.777  -20.394 -23.239 1.00 30.60  ? 508 GLN B C   1 
ATOM   8074 O O   . GLN B 1 511 ? 31.004  -19.276 -22.787 1.00 31.73  ? 508 GLN B O   1 
ATOM   8075 C CB  . GLN B 1 511 ? 28.430  -20.097 -22.418 1.00 32.93  ? 508 GLN B CB  1 
ATOM   8076 C CG  . GLN B 1 511 ? 26.960  -20.504 -22.474 1.00 36.29  ? 508 GLN B CG  1 
ATOM   8077 C CD  . GLN B 1 511 ? 26.092  -19.752 -21.472 1.00 41.61  ? 508 GLN B CD  1 
ATOM   8078 O OE1 . GLN B 1 511 ? 26.216  -18.535 -21.305 1.00 36.76  ? 508 GLN B OE1 1 
ATOM   8079 N NE2 . GLN B 1 511 ? 25.210  -20.480 -20.794 1.00 40.03  ? 508 GLN B NE2 1 
ATOM   8080 N N   . GLN B 1 512 ? 31.737  -21.198 -23.683 1.00 29.43  ? 509 GLN B N   1 
ATOM   8081 C CA  . GLN B 1 512 ? 33.143  -20.805 -23.631 1.00 30.22  ? 509 GLN B CA  1 
ATOM   8082 C C   . GLN B 1 512 ? 33.543  -19.818 -24.731 1.00 34.33  ? 509 GLN B C   1 
ATOM   8083 O O   . GLN B 1 512 ? 33.142  -19.966 -25.883 1.00 30.40  ? 509 GLN B O   1 
ATOM   8084 C CB  . GLN B 1 512 ? 34.031  -22.045 -23.711 1.00 30.77  ? 509 GLN B CB  1 
ATOM   8085 C CG  . GLN B 1 512 ? 33.938  -22.933 -22.473 1.00 32.85  ? 509 GLN B CG  1 
ATOM   8086 C CD  . GLN B 1 512 ? 34.651  -24.250 -22.653 1.00 35.56  ? 509 GLN B CD  1 
ATOM   8087 O OE1 . GLN B 1 512 ? 35.694  -24.496 -22.046 1.00 42.06  ? 509 GLN B OE1 1 
ATOM   8088 N NE2 . GLN B 1 512 ? 34.086  -25.110 -23.483 1.00 31.17  ? 509 GLN B NE2 1 
ATOM   8089 N N   . TYR B 1 513 ? 34.338  -18.820 -24.355 1.00 32.58  ? 510 TYR B N   1 
ATOM   8090 C CA  . TYR B 1 513 ? 34.929  -17.867 -25.297 1.00 33.88  ? 510 TYR B CA  1 
ATOM   8091 C C   . TYR B 1 513 ? 36.318  -17.498 -24.785 1.00 37.03  ? 510 TYR B C   1 
ATOM   8092 O O   . TYR B 1 513 ? 36.642  -17.785 -23.638 1.00 34.06  ? 510 TYR B O   1 
ATOM   8093 C CB  . TYR B 1 513 ? 34.052  -16.621 -25.451 1.00 29.94  ? 510 TYR B CB  1 
ATOM   8094 C CG  . TYR B 1 513 ? 33.895  -15.806 -24.185 1.00 36.55  ? 510 TYR B CG  1 
ATOM   8095 C CD1 . TYR B 1 513 ? 33.043  -16.223 -23.166 1.00 34.47  ? 510 TYR B CD1 1 
ATOM   8096 C CD2 . TYR B 1 513 ? 34.589  -14.613 -24.011 1.00 32.61  ? 510 TYR B CD2 1 
ATOM   8097 C CE1 . TYR B 1 513 ? 32.896  -15.479 -22.009 1.00 35.97  ? 510 TYR B CE1 1 
ATOM   8098 C CE2 . TYR B 1 513 ? 34.446  -13.863 -22.860 1.00 37.93  ? 510 TYR B CE2 1 
ATOM   8099 C CZ  . TYR B 1 513 ? 33.600  -14.303 -21.859 1.00 37.71  ? 510 TYR B CZ  1 
ATOM   8100 O OH  . TYR B 1 513 ? 33.453  -13.558 -20.711 1.00 37.46  ? 510 TYR B OH  1 
ATOM   8101 N N   . VAL B 1 514 ? 37.148  -16.874 -25.612 1.00 30.73  ? 511 VAL B N   1 
ATOM   8102 C CA  . VAL B 1 514 ? 38.495  -16.528 -25.163 1.00 31.79  ? 511 VAL B CA  1 
ATOM   8103 C C   . VAL B 1 514 ? 38.726  -15.027 -25.091 1.00 36.90  ? 511 VAL B C   1 
ATOM   8104 O O   . VAL B 1 514 ? 38.076  -14.246 -25.790 1.00 35.94  ? 511 VAL B O   1 
ATOM   8105 C CB  . VAL B 1 514 ? 39.585  -17.138 -26.067 1.00 34.55  ? 511 VAL B CB  1 
ATOM   8106 C CG1 . VAL B 1 514 ? 39.478  -18.654 -26.086 1.00 31.54  ? 511 VAL B CG1 1 
ATOM   8107 C CG2 . VAL B 1 514 ? 39.508  -16.555 -27.479 1.00 32.66  ? 511 VAL B CG2 1 
ATOM   8108 N N   . SER B 1 515 ? 39.656  -14.627 -24.231 1.00 34.08  ? 512 SER B N   1 
ATOM   8109 C CA  . SER B 1 515 ? 40.074  -13.233 -24.178 1.00 35.12  ? 512 SER B CA  1 
ATOM   8110 C C   . SER B 1 515 ? 41.261  -13.016 -25.108 1.00 37.06  ? 512 SER B C   1 
ATOM   8111 O O   . SER B 1 515 ? 42.240  -13.767 -25.068 1.00 33.55  ? 512 SER B O   1 
ATOM   8112 C CB  . SER B 1 515 ? 40.438  -12.825 -22.748 1.00 33.90  ? 512 SER B CB  1 
ATOM   8113 O OG  . SER B 1 515 ? 41.553  -13.571 -22.288 1.00 37.95  ? 512 SER B OG  1 
ATOM   8114 N N   . LEU B 1 516 ? 41.163  -11.998 -25.958 1.00 35.31  ? 513 LEU B N   1 
ATOM   8115 C CA  . LEU B 1 516 ? 42.266  -11.634 -26.839 1.00 34.35  ? 513 LEU B CA  1 
ATOM   8116 C C   . LEU B 1 516 ? 42.980  -10.401 -26.297 1.00 33.97  ? 513 LEU B C   1 
ATOM   8117 O O   . LEU B 1 516 ? 42.439  -9.296  -26.326 1.00 36.17  ? 513 LEU B O   1 
ATOM   8118 C CB  . LEU B 1 516 ? 41.768  -11.379 -28.273 1.00 32.25  ? 513 LEU B CB  1 
ATOM   8119 C CG  . LEU B 1 516 ? 41.128  -12.558 -29.011 1.00 34.00  ? 513 LEU B CG  1 
ATOM   8120 C CD1 . LEU B 1 516 ? 40.733  -12.174 -30.447 1.00 34.06  ? 513 LEU B CD1 1 
ATOM   8121 C CD2 . LEU B 1 516 ? 42.059  -13.757 -29.028 1.00 33.19  ? 513 LEU B CD2 1 
ATOM   8122 N N   . ASN B 1 517 ? 44.186  -10.605 -25.778 1.00 38.91  ? 514 ASN B N   1 
ATOM   8123 C CA  . ASN B 1 517 ? 45.021  -9.511  -25.297 1.00 36.07  ? 514 ASN B CA  1 
ATOM   8124 C C   . ASN B 1 517 ? 46.490  -9.920  -25.313 1.00 39.26  ? 514 ASN B C   1 
ATOM   8125 O O   . ASN B 1 517 ? 46.842  -10.950 -25.888 1.00 39.39  ? 514 ASN B O   1 
ATOM   8126 C CB  . ASN B 1 517 ? 44.588  -9.064  -23.894 1.00 39.35  ? 514 ASN B CB  1 
ATOM   8127 C CG  . ASN B 1 517 ? 44.530  -10.211 -22.893 1.00 38.12  ? 514 ASN B CG  1 
ATOM   8128 O OD1 . ASN B 1 517 ? 45.371  -11.110 -22.904 1.00 39.83  ? 514 ASN B OD1 1 
ATOM   8129 N ND2 . ASN B 1 517 ? 43.527  -10.181 -22.022 1.00 37.61  ? 514 ASN B ND2 1 
ATOM   8130 N N   . LEU B 1 518 ? 47.345  -9.115  -24.690 1.00 40.47  ? 515 LEU B N   1 
ATOM   8131 C CA  . LEU B 1 518 ? 48.786  -9.367  -24.719 1.00 43.03  ? 515 LEU B CA  1 
ATOM   8132 C C   . LEU B 1 518 ? 49.155  -10.666 -24.004 1.00 42.79  ? 515 LEU B C   1 
ATOM   8133 O O   . LEU B 1 518 ? 50.153  -11.306 -24.332 1.00 45.38  ? 515 LEU B O   1 
ATOM   8134 C CB  . LEU B 1 518 ? 49.545  -8.194  -24.096 1.00 41.59  ? 515 LEU B CB  1 
ATOM   8135 C CG  . LEU B 1 518 ? 49.422  -6.865  -24.844 1.00 48.46  ? 515 LEU B CG  1 
ATOM   8136 C CD1 . LEU B 1 518 ? 50.260  -5.776  -24.175 1.00 47.89  ? 515 LEU B CD1 1 
ATOM   8137 C CD2 . LEU B 1 518 ? 49.809  -7.038  -26.307 1.00 42.26  ? 515 LEU B CD2 1 
ATOM   8138 N N   . LYS B 1 519 ? 48.345  -11.047 -23.024 1.00 42.48  ? 516 LYS B N   1 
ATOM   8139 C CA  . LYS B 1 519 ? 48.550  -12.294 -22.302 1.00 43.92  ? 516 LYS B CA  1 
ATOM   8140 C C   . LYS B 1 519 ? 48.039  -13.454 -23.148 1.00 47.90  ? 516 LYS B C   1 
ATOM   8141 O O   . LYS B 1 519 ? 47.182  -13.253 -24.009 1.00 43.44  ? 516 LYS B O   1 
ATOM   8142 C CB  . LYS B 1 519 ? 47.842  -12.239 -20.950 1.00 45.36  ? 516 LYS B CB  1 
ATOM   8143 C CG  . LYS B 1 519 ? 48.301  -11.076 -20.085 1.00 46.21  ? 516 LYS B CG  1 
ATOM   8144 C CD  . LYS B 1 519 ? 47.382  -10.854 -18.897 1.00 54.46  ? 516 LYS B CD  1 
ATOM   8145 C CE  . LYS B 1 519 ? 47.366  -12.057 -17.970 1.00 62.85  ? 516 LYS B CE  1 
ATOM   8146 N NZ  . LYS B 1 519 ? 46.607  -11.783 -16.713 1.00 68.07  ? 516 LYS B NZ  1 
ATOM   8147 N N   . PRO B 1 520 ? 48.571  -14.669 -22.924 1.00 47.31  ? 517 PRO B N   1 
ATOM   8148 C CA  . PRO B 1 520 ? 48.107  -15.837 -23.682 1.00 45.37  ? 517 PRO B CA  1 
ATOM   8149 C C   . PRO B 1 520 ? 46.606  -16.059 -23.529 1.00 43.94  ? 517 PRO B C   1 
ATOM   8150 O O   . PRO B 1 520 ? 46.021  -15.556 -22.567 1.00 43.06  ? 517 PRO B O   1 
ATOM   8151 C CB  . PRO B 1 520 ? 48.895  -16.998 -23.063 1.00 48.24  ? 517 PRO B CB  1 
ATOM   8152 C CG  . PRO B 1 520 ? 50.100  -16.361 -22.461 1.00 50.54  ? 517 PRO B CG  1 
ATOM   8153 C CD  . PRO B 1 520 ? 49.648  -15.017 -21.980 1.00 48.59  ? 517 PRO B CD  1 
ATOM   8154 N N   . LEU B 1 521 ? 46.006  -16.788 -24.470 1.00 40.57  ? 518 LEU B N   1 
ATOM   8155 C CA  . LEU B 1 521 ? 44.572  -17.084 -24.450 1.00 40.62  ? 518 LEU B CA  1 
ATOM   8156 C C   . LEU B 1 521 ? 44.073  -17.525 -23.084 1.00 41.54  ? 518 LEU B C   1 
ATOM   8157 O O   . LEU B 1 521 ? 44.625  -18.436 -22.486 1.00 37.10  ? 518 LEU B O   1 
ATOM   8158 C CB  . LEU B 1 521 ? 44.228  -18.182 -25.459 1.00 41.22  ? 518 LEU B CB  1 
ATOM   8159 C CG  . LEU B 1 521 ? 44.076  -17.844 -26.935 1.00 42.41  ? 518 LEU B CG  1 
ATOM   8160 C CD1 . LEU B 1 521 ? 43.426  -19.018 -27.651 1.00 41.10  ? 518 LEU B CD1 1 
ATOM   8161 C CD2 . LEU B 1 521 ? 43.267  -16.570 -27.113 1.00 40.01  ? 518 LEU B CD2 1 
ATOM   8162 N N   . GLU B 1 522 ? 43.022  -16.871 -22.609 1.00 38.79  ? 519 GLU B N   1 
ATOM   8163 C CA  . GLU B 1 522 ? 42.334  -17.301 -21.407 1.00 40.56  ? 519 GLU B CA  1 
ATOM   8164 C C   . GLU B 1 522 ? 40.907  -17.679 -21.770 1.00 43.22  ? 519 GLU B C   1 
ATOM   8165 O O   . GLU B 1 522 ? 40.215  -16.929 -22.472 1.00 38.81  ? 519 GLU B O   1 
ATOM   8166 C CB  . GLU B 1 522 ? 42.348  -16.205 -20.341 1.00 39.87  ? 519 GLU B CB  1 
ATOM   8167 C CG  . GLU B 1 522 ? 41.403  -16.466 -19.182 1.00 48.11  ? 519 GLU B CG  1 
ATOM   8168 C CD  . GLU B 1 522 ? 41.420  -15.352 -18.149 1.00 50.14  ? 519 GLU B CD  1 
ATOM   8169 O OE1 . GLU B 1 522 ? 42.485  -15.126 -17.531 1.00 60.25  ? 519 GLU B OE1 1 
ATOM   8170 O OE2 . GLU B 1 522 ? 40.370  -14.700 -17.960 1.00 45.68  ? 519 GLU B OE2 1 
ATOM   8171 N N   . VAL B 1 523 ? 40.480  -18.849 -21.307 1.00 37.75  ? 520 VAL B N   1 
ATOM   8172 C CA  . VAL B 1 523 ? 39.127  -19.320 -21.556 1.00 38.20  ? 520 VAL B CA  1 
ATOM   8173 C C   . VAL B 1 523 ? 38.181  -18.852 -20.458 1.00 38.06  ? 520 VAL B C   1 
ATOM   8174 O O   . VAL B 1 523 ? 38.432  -19.062 -19.274 1.00 39.12  ? 520 VAL B O   1 
ATOM   8175 C CB  . VAL B 1 523 ? 39.063  -20.854 -21.654 1.00 37.36  ? 520 VAL B CB  1 
ATOM   8176 C CG1 . VAL B 1 523 ? 37.638  -21.307 -21.935 1.00 34.94  ? 520 VAL B CG1 1 
ATOM   8177 C CG2 . VAL B 1 523 ? 40.006  -21.356 -22.727 1.00 36.15  ? 520 VAL B CG2 1 
ATOM   8178 N N   . ARG B 1 524 ? 37.097  -18.209 -20.868 1.00 33.83  ? 521 ARG B N   1 
ATOM   8179 C CA  . ARG B 1 524 ? 36.062  -17.750 -19.960 1.00 34.63  ? 521 ARG B CA  1 
ATOM   8180 C C   . ARG B 1 524 ? 34.742  -18.386 -20.354 1.00 34.50  ? 521 ARG B C   1 
ATOM   8181 O O   . ARG B 1 524 ? 34.613  -18.940 -21.450 1.00 34.12  ? 521 ARG B O   1 
ATOM   8182 C CB  . ARG B 1 524 ? 35.966  -16.225 -19.985 1.00 37.82  ? 521 ARG B CB  1 
ATOM   8183 C CG  . ARG B 1 524 ? 37.296  -15.544 -19.709 1.00 41.00  ? 521 ARG B CG  1 
ATOM   8184 C CD  . ARG B 1 524 ? 37.196  -14.030 -19.733 1.00 42.03  ? 521 ARG B CD  1 
ATOM   8185 N NE  . ARG B 1 524 ? 38.513  -13.415 -19.578 1.00 42.70  ? 521 ARG B NE  1 
ATOM   8186 C CZ  . ARG B 1 524 ? 38.754  -12.115 -19.707 1.00 38.91  ? 521 ARG B CZ  1 
ATOM   8187 N NH1 . ARG B 1 524 ? 37.766  -11.282 -20.004 1.00 37.76  ? 521 ARG B NH1 1 
ATOM   8188 N NH2 . ARG B 1 524 ? 39.987  -11.651 -19.552 1.00 34.01  ? 521 ARG B NH2 1 
ATOM   8189 N N   . ARG B 1 525 ? 33.760  -18.317 -19.463 1.00 32.83  ? 522 ARG B N   1 
ATOM   8190 C CA  . ARG B 1 525 ? 32.469  -18.939 -19.733 1.00 34.02  ? 522 ARG B CA  1 
ATOM   8191 C C   . ARG B 1 525 ? 31.324  -17.979 -19.451 1.00 36.32  ? 522 ARG B C   1 
ATOM   8192 O O   . ARG B 1 525 ? 31.291  -17.320 -18.414 1.00 37.88  ? 522 ARG B O   1 
ATOM   8193 C CB  . ARG B 1 525 ? 32.315  -20.228 -18.914 1.00 37.76  ? 522 ARG B CB  1 
ATOM   8194 C CG  . ARG B 1 525 ? 33.228  -21.352 -19.392 1.00 36.11  ? 522 ARG B CG  1 
ATOM   8195 C CD  . ARG B 1 525 ? 33.180  -22.588 -18.501 1.00 37.85  ? 522 ARG B CD  1 
ATOM   8196 N NE  . ARG B 1 525 ? 31.872  -23.238 -18.490 1.00 38.93  ? 522 ARG B NE  1 
ATOM   8197 C CZ  . ARG B 1 525 ? 31.634  -24.412 -17.910 1.00 42.04  ? 522 ARG B CZ  1 
ATOM   8198 N NH1 . ARG B 1 525 ? 32.622  -25.067 -17.313 1.00 36.75  ? 522 ARG B NH1 1 
ATOM   8199 N NH2 . ARG B 1 525 ? 30.415  -24.938 -17.934 1.00 39.01  ? 522 ARG B NH2 1 
ATOM   8200 N N   . GLY B 1 526 ? 30.386  -17.897 -20.389 1.00 34.46  ? 523 GLY B N   1 
ATOM   8201 C CA  . GLY B 1 526 ? 29.262  -16.992 -20.255 1.00 35.24  ? 523 GLY B CA  1 
ATOM   8202 C C   . GLY B 1 526 ? 29.608  -15.586 -20.708 1.00 40.96  ? 523 GLY B C   1 
ATOM   8203 O O   . GLY B 1 526 ? 30.397  -14.883 -20.073 1.00 41.33  ? 523 GLY B O   1 
ATOM   8204 N N   . LEU B 1 527 ? 29.017  -15.176 -21.823 1.00 36.84  ? 524 LEU B N   1 
ATOM   8205 C CA  . LEU B 1 527 ? 29.244  -13.840 -22.352 1.00 34.34  ? 524 LEU B CA  1 
ATOM   8206 C C   . LEU B 1 527 ? 28.214  -12.866 -21.776 1.00 37.29  ? 524 LEU B C   1 
ATOM   8207 O O   . LEU B 1 527 ? 27.108  -12.747 -22.304 1.00 36.73  ? 524 LEU B O   1 
ATOM   8208 C CB  . LEU B 1 527 ? 29.183  -13.862 -23.885 1.00 34.98  ? 524 LEU B CB  1 
ATOM   8209 C CG  . LEU B 1 527 ? 29.703  -12.607 -24.580 1.00 40.30  ? 524 LEU B CG  1 
ATOM   8210 C CD1 . LEU B 1 527 ? 31.058  -12.212 -24.012 1.00 42.63  ? 524 LEU B CD1 1 
ATOM   8211 C CD2 . LEU B 1 527 ? 29.783  -12.813 -26.094 1.00 38.13  ? 524 LEU B CD2 1 
ATOM   8212 N N   . ARG B 1 528 ? 28.586  -12.184 -20.690 1.00 37.41  ? 525 ARG B N   1 
ATOM   8213 C CA  . ARG B 1 528 ? 27.670  -11.310 -19.949 1.00 39.25  ? 525 ARG B CA  1 
ATOM   8214 C C   . ARG B 1 528 ? 26.325  -12.004 -19.716 1.00 38.26  ? 525 ARG B C   1 
ATOM   8215 O O   . ARG B 1 528 ? 25.264  -11.449 -20.015 1.00 33.63  ? 525 ARG B O   1 
ATOM   8216 C CB  . ARG B 1 528 ? 27.466  -9.985  -20.690 1.00 40.99  ? 525 ARG B CB  1 
ATOM   8217 C CG  . ARG B 1 528 ? 28.752  -9.208  -20.967 1.00 43.52  ? 525 ARG B CG  1 
ATOM   8218 C CD  . ARG B 1 528 ? 28.684  -7.801  -20.385 1.00 49.79  ? 525 ARG B CD  1 
ATOM   8219 N NE  . ARG B 1 528 ? 29.513  -6.836  -21.112 1.00 53.12  ? 525 ARG B NE  1 
ATOM   8220 C CZ  . ARG B 1 528 ? 30.826  -6.702  -20.955 1.00 57.33  ? 525 ARG B CZ  1 
ATOM   8221 N NH1 . ARG B 1 528 ? 31.477  -7.481  -20.100 1.00 60.71  ? 525 ARG B NH1 1 
ATOM   8222 N NH2 . ARG B 1 528 ? 31.492  -5.791  -21.654 1.00 54.15  ? 525 ARG B NH2 1 
ATOM   8223 N N   . ALA B 1 529 ? 26.391  -13.219 -19.176 1.00 39.42  ? 526 ALA B N   1 
ATOM   8224 C CA  . ALA B 1 529 ? 25.260  -14.147 -19.157 1.00 35.96  ? 526 ALA B CA  1 
ATOM   8225 C C   . ALA B 1 529 ? 24.014  -13.612 -18.454 1.00 35.19  ? 526 ALA B C   1 
ATOM   8226 O O   . ALA B 1 529 ? 22.906  -13.728 -18.984 1.00 32.94  ? 526 ALA B O   1 
ATOM   8227 C CB  . ALA B 1 529 ? 25.688  -15.466 -18.519 1.00 38.47  ? 526 ALA B CB  1 
ATOM   8228 N N   . GLN B 1 530 ? 24.182  -13.043 -17.260 1.00 35.09  ? 527 GLN B N   1 
ATOM   8229 C CA  . GLN B 1 530 ? 23.040  -12.513 -16.519 1.00 33.70  ? 527 GLN B CA  1 
ATOM   8230 C C   . GLN B 1 530 ? 22.431  -11.327 -17.258 1.00 31.51  ? 527 GLN B C   1 
ATOM   8231 O O   . GLN B 1 530 ? 21.211  -11.241 -17.461 1.00 31.10  ? 527 GLN B O   1 
ATOM   8232 C CB  . GLN B 1 530 ? 23.450  -12.083 -15.101 1.00 35.53  ? 527 GLN B CB  1 
ATOM   8233 C CG  . GLN B 1 530 ? 24.061  -13.190 -14.253 1.00 36.58  ? 527 GLN B CG  1 
ATOM   8234 C CD  . GLN B 1 530 ? 23.137  -14.382 -14.100 1.00 37.01  ? 527 GLN B CD  1 
ATOM   8235 O OE1 . GLN B 1 530 ? 23.418  -15.465 -14.617 1.00 35.82  ? 527 GLN B OE1 1 
ATOM   8236 N NE2 . GLN B 1 530 ? 22.023  -14.189 -13.393 1.00 36.50  ? 527 GLN B NE2 1 
ATOM   8237 N N   . THR B 1 531 ? 23.302  -10.407 -17.649 1.00 31.48  ? 528 THR B N   1 
ATOM   8238 C CA  . THR B 1 531 ? 22.886  -9.173  -18.297 1.00 34.51  ? 528 THR B CA  1 
ATOM   8239 C C   . THR B 1 531 ? 22.268  -9.438  -19.677 1.00 33.20  ? 528 THR B C   1 
ATOM   8240 O O   . THR B 1 531 ? 21.273  -8.813  -20.061 1.00 34.34  ? 528 THR B O   1 
ATOM   8241 C CB  . THR B 1 531 ? 24.076  -8.202  -18.421 1.00 37.61  ? 528 THR B CB  1 
ATOM   8242 O OG1 . THR B 1 531 ? 24.443  -7.733  -17.116 1.00 37.97  ? 528 THR B OG1 1 
ATOM   8243 C CG2 . THR B 1 531 ? 23.711  -7.011  -19.281 1.00 36.61  ? 528 THR B CG2 1 
ATOM   8244 N N   . CYS B 1 532 ? 22.838  -10.380 -20.416 1.00 31.65  ? 529 CYS B N   1 
ATOM   8245 C CA  . CYS B 1 532 ? 22.289  -10.683 -21.733 1.00 35.01  ? 529 CYS B CA  1 
ATOM   8246 C C   . CYS B 1 532 ? 21.043  -11.548 -21.615 1.00 36.40  ? 529 CYS B C   1 
ATOM   8247 O O   . CYS B 1 532 ? 20.223  -11.568 -22.520 1.00 30.85  ? 529 CYS B O   1 
ATOM   8248 C CB  . CYS B 1 532 ? 23.340  -11.342 -22.624 1.00 31.78  ? 529 CYS B CB  1 
ATOM   8249 S SG  . CYS B 1 532 ? 24.557  -10.128 -23.199 1.00 37.64  ? 529 CYS B SG  1 
ATOM   8250 N N   . ALA B 1 533 ? 20.882  -12.246 -20.490 1.00 33.75  ? 530 ALA B N   1 
ATOM   8251 C CA  . ALA B 1 533 ? 19.603  -12.891 -20.225 1.00 30.59  ? 530 ALA B CA  1 
ATOM   8252 C C   . ALA B 1 533 ? 18.557  -11.802 -20.013 1.00 34.41  ? 530 ALA B C   1 
ATOM   8253 O O   . ALA B 1 533 ? 17.414  -11.925 -20.460 1.00 34.27  ? 530 ALA B O   1 
ATOM   8254 C CB  . ALA B 1 533 ? 19.688  -13.810 -19.009 1.00 38.20  ? 530 ALA B CB  1 
ATOM   8255 N N   . PHE B 1 534 ? 18.965  -10.733 -19.332 1.00 32.52  ? 531 PHE B N   1 
ATOM   8256 C CA  . PHE B 1 534 ? 18.089  -9.581  -19.097 1.00 34.54  ? 531 PHE B CA  1 
ATOM   8257 C C   . PHE B 1 534 ? 17.654  -8.940  -20.426 1.00 37.04  ? 531 PHE B C   1 
ATOM   8258 O O   . PHE B 1 534 ? 16.463  -8.697  -20.659 1.00 34.84  ? 531 PHE B O   1 
ATOM   8259 C CB  . PHE B 1 534 ? 18.801  -8.566  -18.184 1.00 30.50  ? 531 PHE B CB  1 
ATOM   8260 C CG  . PHE B 1 534 ? 18.142  -7.215  -18.118 1.00 34.31  ? 531 PHE B CG  1 
ATOM   8261 C CD1 . PHE B 1 534 ? 17.081  -6.983  -17.263 1.00 39.68  ? 531 PHE B CD1 1 
ATOM   8262 C CD2 . PHE B 1 534 ? 18.609  -6.165  -18.900 1.00 40.03  ? 531 PHE B CD2 1 
ATOM   8263 C CE1 . PHE B 1 534 ? 16.482  -5.735  -17.192 1.00 39.19  ? 531 PHE B CE1 1 
ATOM   8264 C CE2 . PHE B 1 534 ? 18.014  -4.914  -18.837 1.00 41.88  ? 531 PHE B CE2 1 
ATOM   8265 C CZ  . PHE B 1 534 ? 16.950  -4.699  -17.979 1.00 38.02  ? 531 PHE B CZ  1 
ATOM   8266 N N   . TRP B 1 535 ? 18.609  -8.685  -21.313 1.00 36.45  ? 532 TRP B N   1 
ATOM   8267 C CA  . TRP B 1 535 ? 18.254  -8.083  -22.602 1.00 37.14  ? 532 TRP B CA  1 
ATOM   8268 C C   . TRP B 1 535 ? 17.478  -9.024  -23.536 1.00 39.11  ? 532 TRP B C   1 
ATOM   8269 O O   . TRP B 1 535 ? 16.501  -8.610  -24.159 1.00 38.62  ? 532 TRP B O   1 
ATOM   8270 C CB  . TRP B 1 535 ? 19.509  -7.579  -23.315 1.00 36.91  ? 532 TRP B CB  1 
ATOM   8271 C CG  . TRP B 1 535 ? 20.095  -6.349  -22.696 1.00 37.15  ? 532 TRP B CG  1 
ATOM   8272 C CD1 . TRP B 1 535 ? 21.187  -6.282  -21.883 1.00 34.48  ? 532 TRP B CD1 1 
ATOM   8273 C CD2 . TRP B 1 535 ? 19.620  -5.005  -22.840 1.00 37.25  ? 532 TRP B CD2 1 
ATOM   8274 N NE1 . TRP B 1 535 ? 21.424  -4.981  -21.512 1.00 33.95  ? 532 TRP B NE1 1 
ATOM   8275 C CE2 . TRP B 1 535 ? 20.476  -4.176  -22.088 1.00 34.73  ? 532 TRP B CE2 1 
ATOM   8276 C CE3 . TRP B 1 535 ? 18.556  -4.421  -23.537 1.00 36.08  ? 532 TRP B CE3 1 
ATOM   8277 C CZ2 . TRP B 1 535 ? 20.301  -2.793  -22.008 1.00 32.66  ? 532 TRP B CZ2 1 
ATOM   8278 C CZ3 . TRP B 1 535 ? 18.381  -3.050  -23.453 1.00 36.34  ? 532 TRP B CZ3 1 
ATOM   8279 C CH2 . TRP B 1 535 ? 19.248  -2.252  -22.693 1.00 34.15  ? 532 TRP B CH2 1 
ATOM   8280 N N   . ASN B 1 536 ? 17.894  -10.284 -23.619 1.00 37.11  ? 533 ASN B N   1 
ATOM   8281 C CA  . ASN B 1 536 ? 17.370  -11.193 -24.643 1.00 40.01  ? 533 ASN B CA  1 
ATOM   8282 C C   . ASN B 1 536 ? 16.116  -11.972 -24.245 1.00 42.77  ? 533 ASN B C   1 
ATOM   8283 O O   . ASN B 1 536 ? 15.344  -12.384 -25.109 1.00 36.31  ? 533 ASN B O   1 
ATOM   8284 C CB  . ASN B 1 536 ? 18.458  -12.186 -25.065 1.00 37.96  ? 533 ASN B CB  1 
ATOM   8285 C CG  . ASN B 1 536 ? 19.651  -11.501 -25.702 1.00 40.49  ? 533 ASN B CG  1 
ATOM   8286 O OD1 . ASN B 1 536 ? 19.555  -10.353 -26.131 1.00 39.39  ? 533 ASN B OD1 1 
ATOM   8287 N ND2 . ASN B 1 536 ? 20.779  -12.201 -25.769 1.00 35.46  ? 533 ASN B ND2 1 
ATOM   8288 N N   . ARG B 1 537 ? 15.912  -12.176 -22.947 1.00 38.63  ? 534 ARG B N   1 
ATOM   8289 C CA  . ARG B 1 537 ? 14.777  -12.971 -22.488 1.00 41.47  ? 534 ARG B CA  1 
ATOM   8290 C C   . ARG B 1 537 ? 13.693  -12.128 -21.828 1.00 42.64  ? 534 ARG B C   1 
ATOM   8291 O O   . ARG B 1 537 ? 12.510  -12.306 -22.109 1.00 44.98  ? 534 ARG B O   1 
ATOM   8292 C CB  . ARG B 1 537 ? 15.248  -14.056 -21.518 1.00 41.77  ? 534 ARG B CB  1 
ATOM   8293 C CG  . ARG B 1 537 ? 16.090  -15.131 -22.181 1.00 43.84  ? 534 ARG B CG  1 
ATOM   8294 C CD  . ARG B 1 537 ? 16.701  -16.074 -21.164 1.00 40.07  ? 534 ARG B CD  1 
ATOM   8295 N NE  . ARG B 1 537 ? 17.746  -16.902 -21.762 1.00 43.45  ? 534 ARG B NE  1 
ATOM   8296 C CZ  . ARG B 1 537 ? 17.561  -18.145 -22.199 1.00 45.07  ? 534 ARG B CZ  1 
ATOM   8297 N NH1 . ARG B 1 537 ? 16.368  -18.717 -22.100 1.00 43.62  ? 534 ARG B NH1 1 
ATOM   8298 N NH2 . ARG B 1 537 ? 18.574  -18.818 -22.728 1.00 49.48  ? 534 ARG B NH2 1 
ATOM   8299 N N   . PHE B 1 538 ? 14.093  -11.210 -20.955 1.00 40.27  ? 535 PHE B N   1 
ATOM   8300 C CA  . PHE B 1 538 ? 13.116  -10.464 -20.169 1.00 41.64  ? 535 PHE B CA  1 
ATOM   8301 C C   . PHE B 1 538 ? 12.596  -9.219  -20.881 1.00 39.56  ? 535 PHE B C   1 
ATOM   8302 O O   . PHE B 1 538 ? 11.393  -9.068  -21.095 1.00 40.93  ? 535 PHE B O   1 
ATOM   8303 C CB  . PHE B 1 538 ? 13.716  -10.066 -18.820 1.00 37.72  ? 535 PHE B CB  1 
ATOM   8304 C CG  . PHE B 1 538 ? 12.780  -9.266  -17.960 1.00 41.62  ? 535 PHE B CG  1 
ATOM   8305 C CD1 . PHE B 1 538 ? 11.669  -9.864  -17.385 1.00 39.83  ? 535 PHE B CD1 1 
ATOM   8306 C CD2 . PHE B 1 538 ? 13.008  -7.921  -17.727 1.00 41.04  ? 535 PHE B CD2 1 
ATOM   8307 C CE1 . PHE B 1 538 ? 10.798  -9.134  -16.599 1.00 36.52  ? 535 PHE B CE1 1 
ATOM   8308 C CE2 . PHE B 1 538 ? 12.144  -7.185  -16.935 1.00 41.30  ? 535 PHE B CE2 1 
ATOM   8309 C CZ  . PHE B 1 538 ? 11.038  -7.793  -16.371 1.00 37.90  ? 535 PHE B CZ  1 
ATOM   8310 N N   . LEU B 1 539 ? 13.509  -8.332  -21.251 1.00 35.06  ? 536 LEU B N   1 
ATOM   8311 C CA  . LEU B 1 539 ? 13.135  -7.017  -21.768 1.00 41.37  ? 536 LEU B CA  1 
ATOM   8312 C C   . LEU B 1 539 ? 12.379  -6.908  -23.116 1.00 43.49  ? 536 LEU B C   1 
ATOM   8313 O O   . LEU B 1 539 ? 11.693  -5.910  -23.323 1.00 46.48  ? 536 LEU B O   1 
ATOM   8314 C CB  . LEU B 1 539 ? 14.394  -6.154  -21.871 1.00 40.82  ? 536 LEU B CB  1 
ATOM   8315 C CG  . LEU B 1 539 ? 14.167  -4.682  -21.531 1.00 44.94  ? 536 LEU B CG  1 
ATOM   8316 C CD1 . LEU B 1 539 ? 13.667  -4.543  -20.092 1.00 38.39  ? 536 LEU B CD1 1 
ATOM   8317 C CD2 . LEU B 1 539 ? 15.434  -3.878  -21.748 1.00 44.24  ? 536 LEU B CD2 1 
ATOM   8318 N N   . PRO B 1 540 ? 12.509  -7.889  -24.039 1.00 43.86  ? 537 PRO B N   1 
ATOM   8319 C CA  . PRO B 1 540 ? 11.905  -7.616  -25.359 1.00 46.90  ? 537 PRO B CA  1 
ATOM   8320 C C   . PRO B 1 540 ? 10.399  -7.322  -25.362 1.00 48.37  ? 537 PRO B C   1 
ATOM   8321 O O   . PRO B 1 540 ? 9.952   -6.543  -26.203 1.00 49.81  ? 537 PRO B O   1 
ATOM   8322 C CB  . PRO B 1 540 ? 12.193  -8.900  -26.140 1.00 47.53  ? 537 PRO B CB  1 
ATOM   8323 C CG  . PRO B 1 540 ? 13.454  -9.396  -25.560 1.00 46.57  ? 537 PRO B CG  1 
ATOM   8324 C CD  . PRO B 1 540 ? 13.339  -9.108  -24.082 1.00 39.48  ? 537 PRO B CD  1 
ATOM   8325 N N   . LYS B 1 541 ? 9.643   -7.915  -24.442 1.00 52.38  ? 538 LYS B N   1 
ATOM   8326 C CA  . LYS B 1 541 ? 8.212   -7.629  -24.315 1.00 54.44  ? 538 LYS B CA  1 
ATOM   8327 C C   . LYS B 1 541 ? 7.935   -6.152  -24.057 1.00 53.89  ? 538 LYS B C   1 
ATOM   8328 O O   . LYS B 1 541 ? 6.917   -5.615  -24.494 1.00 58.78  ? 538 LYS B O   1 
ATOM   8329 C CB  . LYS B 1 541 ? 7.594   -8.426  -23.165 1.00 58.82  ? 538 LYS B CB  1 
ATOM   8330 C CG  . LYS B 1 541 ? 8.435   -9.559  -22.652 1.00 54.78  ? 538 LYS B CG  1 
ATOM   8331 C CD  . LYS B 1 541 ? 7.856   -10.083 -21.359 1.00 51.40  ? 538 LYS B CD  1 
ATOM   8332 C CE  . LYS B 1 541 ? 8.761   -11.123 -20.761 1.00 48.65  ? 538 LYS B CE  1 
ATOM   8333 N NZ  . LYS B 1 541 ? 8.912   -12.312 -21.642 1.00 55.69  ? 538 LYS B NZ  1 
ATOM   8334 N N   . LEU B 1 542 ? 8.840   -5.511  -23.326 1.00 49.73  ? 539 LEU B N   1 
ATOM   8335 C CA  . LEU B 1 542 ? 8.600   -4.176  -22.788 1.00 54.00  ? 539 LEU B CA  1 
ATOM   8336 C C   . LEU B 1 542 ? 9.134   -3.055  -23.673 1.00 50.12  ? 539 LEU B C   1 
ATOM   8337 O O   . LEU B 1 542 ? 9.018   -1.881  -23.326 1.00 49.12  ? 539 LEU B O   1 
ATOM   8338 C CB  . LEU B 1 542 ? 9.217   -4.060  -21.391 1.00 47.54  ? 539 LEU B CB  1 
ATOM   8339 C CG  . LEU B 1 542 ? 8.846   -5.165  -20.403 1.00 49.36  ? 539 LEU B CG  1 
ATOM   8340 C CD1 . LEU B 1 542 ? 9.418   -4.866  -19.018 1.00 41.49  ? 539 LEU B CD1 1 
ATOM   8341 C CD2 . LEU B 1 542 ? 7.339   -5.334  -20.344 1.00 52.68  ? 539 LEU B CD2 1 
ATOM   8342 N N   . LEU B 1 543 ? 9.721   -3.413  -24.810 1.00 56.06  ? 540 LEU B N   1 
ATOM   8343 C CA  . LEU B 1 543 ? 10.224  -2.408  -25.741 1.00 55.11  ? 540 LEU B CA  1 
ATOM   8344 C C   . LEU B 1 543 ? 9.122   -1.936  -26.686 1.00 58.86  ? 540 LEU B C   1 
ATOM   8345 O O   . LEU B 1 543 ? 8.724   -2.655  -27.602 1.00 61.47  ? 540 LEU B O   1 
ATOM   8346 C CB  . LEU B 1 543 ? 11.410  -2.956  -26.541 1.00 56.00  ? 540 LEU B CB  1 
ATOM   8347 C CG  . LEU B 1 543 ? 12.640  -3.388  -25.735 1.00 56.77  ? 540 LEU B CG  1 
ATOM   8348 C CD1 . LEU B 1 543 ? 13.843  -3.576  -26.649 1.00 56.28  ? 540 LEU B CD1 1 
ATOM   8349 C CD2 . LEU B 1 543 ? 12.953  -2.393  -24.625 1.00 51.63  ? 540 LEU B CD2 1 
HETATM 8350 O O   . HOH C 2 .   ? -16.399 -15.961 4.650   1.00 50.33  ? 601 HOH A O   1 
HETATM 8351 O O   . HOH C 2 .   ? -1.068  -16.709 1.413   1.00 50.59  ? 602 HOH A O   1 
HETATM 8352 O O   . HOH C 2 .   ? 8.631   2.835   -8.543  1.00 62.98  ? 603 HOH A O   1 
HETATM 8353 O O   . HOH C 2 .   ? 26.322  -28.132 12.136  1.00 40.74  ? 604 HOH A O   1 
HETATM 8354 O O   . HOH C 2 .   ? 30.222  -12.258 27.579  1.00 46.20  ? 605 HOH A O   1 
HETATM 8355 O O   . HOH C 2 .   ? 7.274   -17.911 50.647  1.00 41.57  ? 606 HOH A O   1 
HETATM 8356 O O   . HOH C 2 .   ? 9.717   -24.043 35.437  1.00 47.50  ? 607 HOH A O   1 
HETATM 8357 O O   . HOH C 2 .   ? 20.858  -3.294  0.575   1.00 36.56  ? 608 HOH A O   1 
HETATM 8358 O O   . HOH C 2 .   ? 8.480   -16.062 12.985  1.00 40.46  ? 609 HOH A O   1 
HETATM 8359 O O   . HOH C 2 .   ? -1.612  -21.237 16.649  1.00 31.82  ? 610 HOH A O   1 
HETATM 8360 O O   . HOH C 2 .   ? 10.604  -26.580 23.354  1.00 37.36  ? 611 HOH A O   1 
HETATM 8361 O O   . HOH C 2 .   ? 20.841  -15.944 28.871  1.00 32.69  ? 612 HOH A O   1 
HETATM 8362 O O   . HOH C 2 .   ? 18.583  4.885   28.559  1.00 46.34  ? 613 HOH A O   1 
HETATM 8363 O O   . HOH C 2 .   ? 11.356  -5.597  0.947   1.00 37.15  ? 614 HOH A O   1 
HETATM 8364 O O   . HOH C 2 .   ? 1.088   -9.811  48.421  1.00 42.56  ? 615 HOH A O   1 
HETATM 8365 O O   . HOH C 2 .   ? 23.377  -14.976 2.856   1.00 49.94  ? 616 HOH A O   1 
HETATM 8366 O O   . HOH C 2 .   ? 7.245   -16.300 0.922   1.00 36.76  ? 617 HOH A O   1 
HETATM 8367 O O   . HOH C 2 .   ? -7.053  -2.055  16.978  1.00 39.33  ? 618 HOH A O   1 
HETATM 8368 O O   . HOH C 2 .   ? 21.320  8.389   10.872  1.00 46.78  ? 619 HOH A O   1 
HETATM 8369 O O   . HOH C 2 .   ? 13.536  -23.353 29.839  1.00 38.05  ? 620 HOH A O   1 
HETATM 8370 O O   . HOH C 2 .   ? 29.121  -29.767 19.175  1.00 46.46  ? 621 HOH A O   1 
HETATM 8371 O O   . HOH C 2 .   ? 10.298  -31.284 -12.461 1.00 43.54  ? 622 HOH A O   1 
HETATM 8372 O O   . HOH C 2 .   ? -2.158  -13.518 33.958  1.00 28.89  ? 623 HOH A O   1 
HETATM 8373 O O   . HOH C 2 .   ? -2.304  0.612   24.363  1.00 48.00  ? 624 HOH A O   1 
HETATM 8374 O O   . HOH C 2 .   ? 1.994   -12.262 0.247   1.00 50.40  ? 625 HOH A O   1 
HETATM 8375 O O   . HOH C 2 .   ? 22.003  2.458   30.008  1.00 40.57  ? 626 HOH A O   1 
HETATM 8376 O O   . HOH C 2 .   ? 33.908  -12.292 10.796  1.00 46.17  ? 627 HOH A O   1 
HETATM 8377 O O   . HOH C 2 .   ? 30.556  -15.361 35.019  1.00 42.06  ? 628 HOH A O   1 
HETATM 8378 O O   . HOH C 2 .   ? 9.412   -18.780 19.953  1.00 29.16  ? 629 HOH A O   1 
HETATM 8379 O O   . HOH C 2 .   ? 20.083  -21.209 1.532   1.00 40.35  ? 630 HOH A O   1 
HETATM 8380 O O   . HOH C 2 .   ? 14.854  -9.892  48.440  1.00 35.11  ? 631 HOH A O   1 
HETATM 8381 O O   . HOH C 2 .   ? 22.613  -1.767  1.927   1.00 43.53  ? 632 HOH A O   1 
HETATM 8382 O O   . HOH C 2 .   ? 19.465  -12.433 13.175  1.00 30.03  ? 633 HOH A O   1 
HETATM 8383 O O   . HOH C 2 .   ? 9.050   -6.428  -3.256  1.00 44.01  ? 634 HOH A O   1 
HETATM 8384 O O   . HOH C 2 .   ? 20.724  -34.388 4.013   1.00 56.08  ? 635 HOH A O   1 
HETATM 8385 O O   . HOH C 2 .   ? 26.289  -11.666 37.748  1.00 41.71  ? 636 HOH A O   1 
HETATM 8386 O O   . HOH C 2 .   ? -9.588  -22.368 26.763  1.00 39.40  ? 637 HOH A O   1 
HETATM 8387 O O   . HOH C 2 .   ? 1.447   3.960   14.694  1.00 39.45  ? 638 HOH A O   1 
HETATM 8388 O O   . HOH C 2 .   ? 6.674   -12.808 52.829  1.00 34.30  ? 639 HOH A O   1 
HETATM 8389 O O   . HOH C 2 .   ? 20.448  -13.458 -2.921  1.00 41.60  ? 640 HOH A O   1 
HETATM 8390 O O   . HOH C 2 .   ? -2.166  -27.336 19.780  1.00 40.01  ? 641 HOH A O   1 
HETATM 8391 O O   . HOH C 2 .   ? 15.439  -21.549 57.593  1.00 42.25  ? 642 HOH A O   1 
HETATM 8392 O O   . HOH C 2 .   ? 28.842  7.011   5.915   1.00 53.91  ? 643 HOH A O   1 
HETATM 8393 O O   . HOH C 2 .   ? 21.176  1.680   34.049  1.00 43.02  ? 644 HOH A O   1 
HETATM 8394 O O   . HOH C 2 .   ? 12.821  -15.913 28.087  1.00 31.60  ? 645 HOH A O   1 
HETATM 8395 O O   . HOH C 2 .   ? 11.119  -9.105  7.797   1.00 32.19  ? 646 HOH A O   1 
HETATM 8396 O O   . HOH C 2 .   ? 34.941  -7.056  17.977  1.00 58.33  ? 647 HOH A O   1 
HETATM 8397 O O   . HOH C 2 .   ? -0.499  -29.838 32.054  1.00 33.54  ? 648 HOH A O   1 
HETATM 8398 O O   . HOH C 2 .   ? 3.576   -18.808 47.959  1.00 43.89  ? 649 HOH A O   1 
HETATM 8399 O O   . HOH C 2 .   ? 16.986  -15.552 13.005  1.00 33.29  ? 650 HOH A O   1 
HETATM 8400 O O   . HOH C 2 .   ? -20.554 -22.339 8.880   1.00 48.40  ? 651 HOH A O   1 
HETATM 8401 O O   . HOH C 2 .   ? 16.019  -0.357  0.129   1.00 41.90  ? 652 HOH A O   1 
HETATM 8402 O O   . HOH C 2 .   ? 4.239   -5.376  6.888   1.00 33.70  ? 653 HOH A O   1 
HETATM 8403 O O   . HOH C 2 .   ? 6.791   -24.994 -13.082 1.00 43.42  ? 654 HOH A O   1 
HETATM 8404 O O   . HOH C 2 .   ? 0.773   -19.150 -4.647  1.00 47.73  ? 655 HOH A O   1 
HETATM 8405 O O   . HOH C 2 .   ? 2.098   -17.744 38.467  1.00 33.07  ? 656 HOH A O   1 
HETATM 8406 O O   . HOH C 2 .   ? 0.079   8.113   10.589  1.00 47.99  ? 657 HOH A O   1 
HETATM 8407 O O   . HOH C 2 .   ? 20.464  -16.042 51.227  1.00 40.47  ? 658 HOH A O   1 
HETATM 8408 O O   . HOH C 2 .   ? 34.754  1.258   8.744   1.00 53.23  ? 659 HOH A O   1 
HETATM 8409 O O   . HOH C 2 .   ? 27.840  -10.441 3.156   1.00 43.73  ? 660 HOH A O   1 
HETATM 8410 O O   . HOH C 2 .   ? 4.147   -24.484 18.702  1.00 39.66  ? 661 HOH A O   1 
HETATM 8411 O O   . HOH C 2 .   ? -3.335  -15.135 32.004  1.00 29.74  ? 662 HOH A O   1 
HETATM 8412 O O   . HOH C 2 .   ? -7.158  -9.551  30.343  1.00 38.27  ? 663 HOH A O   1 
HETATM 8413 O O   . HOH C 2 .   ? 21.985  -25.809 17.389  1.00 39.39  ? 664 HOH A O   1 
HETATM 8414 O O   . HOH C 2 .   ? 7.398   -21.828 16.622  1.00 38.98  ? 665 HOH A O   1 
HETATM 8415 O O   . HOH C 2 .   ? 17.573  -19.845 47.790  1.00 35.40  ? 666 HOH A O   1 
HETATM 8416 O O   . HOH C 2 .   ? 35.530  -18.397 18.802  1.00 53.68  ? 667 HOH A O   1 
HETATM 8417 O O   . HOH C 2 .   ? 16.368  -5.283  44.156  1.00 43.02  ? 668 HOH A O   1 
HETATM 8418 O O   . HOH C 2 .   ? 28.203  -26.233 25.419  1.00 45.26  ? 669 HOH A O   1 
HETATM 8419 O O   . HOH C 2 .   ? -1.260  -6.793  47.106  1.00 40.56  ? 670 HOH A O   1 
HETATM 8420 O O   . HOH C 2 .   ? 12.850  -14.008 -18.861 1.00 40.04  ? 671 HOH A O   1 
HETATM 8421 O O   . HOH C 2 .   ? 18.906  -1.481  28.080  1.00 33.19  ? 672 HOH A O   1 
HETATM 8422 O O   . HOH C 2 .   ? -12.985 -4.082  8.317   1.00 42.40  ? 673 HOH A O   1 
HETATM 8423 O O   . HOH C 2 .   ? 11.492  4.986   22.178  1.00 41.11  ? 674 HOH A O   1 
HETATM 8424 O O   . HOH C 2 .   ? 20.968  -19.787 -0.948  1.00 35.28  ? 675 HOH A O   1 
HETATM 8425 O O   . HOH C 2 .   ? -0.849  4.327   18.174  1.00 45.83  ? 676 HOH A O   1 
HETATM 8426 O O   . HOH C 2 .   ? -2.461  -18.216 37.777  1.00 47.79  ? 677 HOH A O   1 
HETATM 8427 O O   . HOH C 2 .   ? 8.077   -16.032 59.187  1.00 41.94  ? 678 HOH A O   1 
HETATM 8428 O O   . HOH C 2 .   ? -19.844 -20.406 2.381   1.00 55.97  ? 679 HOH A O   1 
HETATM 8429 O O   . HOH C 2 .   ? 26.568  -1.527  10.780  1.00 37.52  ? 680 HOH A O   1 
HETATM 8430 O O   . HOH C 2 .   ? 28.470  -6.882  0.920   1.00 42.69  ? 681 HOH A O   1 
HETATM 8431 O O   . HOH C 2 .   ? 19.795  5.378   32.817  1.00 44.28  ? 682 HOH A O   1 
HETATM 8432 O O   . HOH C 2 .   ? -5.002  -10.330 11.722  1.00 31.91  ? 683 HOH A O   1 
HETATM 8433 O O   . HOH C 2 .   ? 24.171  -29.797 -8.890  1.00 36.32  ? 684 HOH A O   1 
HETATM 8434 O O   . HOH C 2 .   ? 13.015  -19.974 46.296  1.00 35.38  ? 685 HOH A O   1 
HETATM 8435 O O   . HOH C 2 .   ? 23.330  4.947   11.619  1.00 44.51  ? 686 HOH A O   1 
HETATM 8436 O O   . HOH C 2 .   ? 7.605   -31.502 -7.836  1.00 51.21  ? 687 HOH A O   1 
HETATM 8437 O O   . HOH C 2 .   ? 6.290   -14.281 58.717  1.00 41.71  ? 688 HOH A O   1 
HETATM 8438 O O   . HOH C 2 .   ? -13.966 -17.397 24.939  1.00 39.21  ? 689 HOH A O   1 
HETATM 8439 O O   . HOH C 2 .   ? -11.993 -1.172  16.958  1.00 47.17  ? 690 HOH A O   1 
HETATM 8440 O O   . HOH C 2 .   ? 14.321  -24.585 23.268  1.00 37.93  ? 691 HOH A O   1 
HETATM 8441 O O   . HOH C 2 .   ? 5.589   -19.307 39.034  1.00 38.03  ? 692 HOH A O   1 
HETATM 8442 O O   . HOH C 2 .   ? -18.363 -3.739  14.461  1.00 51.38  ? 693 HOH A O   1 
HETATM 8443 O O   . HOH C 2 .   ? 1.537   -7.955  38.148  1.00 39.83  ? 694 HOH A O   1 
HETATM 8444 O O   . HOH C 2 .   ? 36.172  -9.163  16.408  1.00 53.75  ? 695 HOH A O   1 
HETATM 8445 O O   . HOH C 2 .   ? 26.633  -15.126 39.991  1.00 39.72  ? 696 HOH A O   1 
HETATM 8446 O O   . HOH C 2 .   ? 22.600  -5.477  -11.148 1.00 43.70  ? 697 HOH A O   1 
HETATM 8447 O O   . HOH C 2 .   ? 13.305  -19.447 28.898  1.00 33.46  ? 698 HOH A O   1 
HETATM 8448 O O   . HOH C 2 .   ? -5.183  -16.559 25.545  1.00 33.20  ? 699 HOH A O   1 
HETATM 8449 O O   . HOH C 2 .   ? 26.832  -14.188 44.237  1.00 52.15  ? 700 HOH A O   1 
HETATM 8450 O O   . HOH C 2 .   ? -7.723  -13.721 23.168  1.00 31.31  ? 701 HOH A O   1 
HETATM 8451 O O   . HOH C 2 .   ? -5.438  -19.596 16.770  1.00 34.84  ? 702 HOH A O   1 
HETATM 8452 O O   . HOH C 2 .   ? -4.852  -17.357 36.694  1.00 39.16  ? 703 HOH A O   1 
HETATM 8453 O O   . HOH C 2 .   ? -6.219  -9.228  18.104  1.00 42.96  ? 704 HOH A O   1 
HETATM 8454 O O   . HOH C 2 .   ? -0.453  -12.623 4.879   1.00 38.50  ? 705 HOH A O   1 
HETATM 8455 O O   . HOH C 2 .   ? -13.179 -7.785  4.014   1.00 47.97  ? 706 HOH A O   1 
HETATM 8456 O O   . HOH C 2 .   ? 32.707  -11.993 13.674  1.00 45.02  ? 707 HOH A O   1 
HETATM 8457 O O   . HOH C 2 .   ? -8.793  -8.669  1.314   1.00 42.79  ? 708 HOH A O   1 
HETATM 8458 O O   . HOH C 2 .   ? 8.096   -0.428  -7.299  1.00 54.22  ? 709 HOH A O   1 
HETATM 8459 O O   . HOH C 2 .   ? 9.608   -0.928  29.853  1.00 30.59  ? 710 HOH A O   1 
HETATM 8460 O O   . HOH C 2 .   ? -19.700 -9.735  11.121  1.00 55.23  ? 711 HOH A O   1 
HETATM 8461 O O   . HOH C 2 .   ? -0.168  -4.594  46.141  1.00 39.89  ? 712 HOH A O   1 
HETATM 8462 O O   . HOH C 2 .   ? 24.934  -5.240  32.773  1.00 47.26  ? 713 HOH A O   1 
HETATM 8463 O O   . HOH C 2 .   ? 23.931  -21.477 13.972  1.00 37.06  ? 714 HOH A O   1 
HETATM 8464 O O   . HOH C 2 .   ? -4.597  -8.394  14.527  1.00 29.61  ? 715 HOH A O   1 
HETATM 8465 O O   . HOH C 2 .   ? 0.659   -10.059 4.761   1.00 36.08  ? 716 HOH A O   1 
HETATM 8466 O O   . HOH C 2 .   ? 4.589   0.567   42.080  1.00 32.72  ? 717 HOH A O   1 
HETATM 8467 O O   . HOH C 2 .   ? 25.688  -5.796  -1.765  1.00 41.04  ? 718 HOH A O   1 
HETATM 8468 O O   . HOH C 2 .   ? -1.834  -2.798  26.338  1.00 34.61  ? 719 HOH A O   1 
HETATM 8469 O O   . HOH C 2 .   ? 15.548  -28.581 -14.811 1.00 44.81  ? 720 HOH A O   1 
HETATM 8470 O O   . HOH C 2 .   ? 7.838   -14.995 51.840  1.00 36.39  ? 721 HOH A O   1 
HETATM 8471 O O   . HOH C 2 .   ? 12.931  -15.210 -16.379 1.00 39.64  ? 722 HOH A O   1 
HETATM 8472 O O   . HOH C 2 .   ? 8.932   -13.052 24.827  1.00 28.62  ? 723 HOH A O   1 
HETATM 8473 O O   . HOH C 2 .   ? 6.116   -17.974 32.748  1.00 29.39  ? 724 HOH A O   1 
HETATM 8474 O O   . HOH C 2 .   ? -2.558  -17.873 21.930  1.00 31.09  ? 725 HOH A O   1 
HETATM 8475 O O   . HOH C 2 .   ? -10.107 -2.143  15.130  1.00 41.81  ? 726 HOH A O   1 
HETATM 8476 O O   . HOH C 2 .   ? 22.463  -26.031 -16.480 1.00 44.70  ? 727 HOH A O   1 
HETATM 8477 O O   . HOH C 2 .   ? 12.151  -16.061 18.322  1.00 30.51  ? 728 HOH A O   1 
HETATM 8478 O O   . HOH C 2 .   ? -11.878 -18.572 26.473  1.00 39.71  ? 729 HOH A O   1 
HETATM 8479 O O   . HOH C 2 .   ? -8.952  -8.559  18.548  1.00 34.34  ? 730 HOH A O   1 
HETATM 8480 O O   . HOH C 2 .   ? 12.937  -19.891 -17.375 1.00 48.08  ? 731 HOH A O   1 
HETATM 8481 O O   . HOH C 2 .   ? 19.635  -1.799  -2.281  1.00 38.87  ? 732 HOH A O   1 
HETATM 8482 O O   . HOH C 2 .   ? 8.823   -21.325 19.072  1.00 28.11  ? 733 HOH A O   1 
HETATM 8483 O O   . HOH C 2 .   ? 6.255   -1.486  42.085  1.00 33.70  ? 734 HOH A O   1 
HETATM 8484 O O   . HOH C 2 .   ? 19.053  -20.791 18.404  1.00 33.01  ? 735 HOH A O   1 
HETATM 8485 O O   . HOH C 2 .   ? 9.544   -3.181  46.029  1.00 33.92  ? 736 HOH A O   1 
HETATM 8486 O O   . HOH C 2 .   ? 24.501  -19.333 2.097   1.00 46.14  ? 737 HOH A O   1 
HETATM 8487 O O   . HOH C 2 .   ? 13.419  6.172   21.397  1.00 55.40  ? 738 HOH A O   1 
HETATM 8488 O O   . HOH C 2 .   ? 19.646  -15.247 4.084   1.00 36.07  ? 739 HOH A O   1 
HETATM 8489 O O   . HOH C 2 .   ? -3.368  -20.014 18.386  1.00 32.16  ? 740 HOH A O   1 
HETATM 8490 O O   . HOH C 2 .   ? 9.316   4.207   36.226  1.00 44.49  ? 741 HOH A O   1 
HETATM 8491 O O   . HOH C 2 .   ? 25.013  -30.483 -4.275  1.00 42.48  ? 742 HOH A O   1 
HETATM 8492 O O   . HOH C 2 .   ? -7.640  -15.883 24.771  1.00 32.05  ? 743 HOH A O   1 
HETATM 8493 O O   . HOH C 2 .   ? 1.510   -13.345 7.006   1.00 34.29  ? 744 HOH A O   1 
HETATM 8494 O O   . HOH C 2 .   ? 2.678   -15.729 -7.849  1.00 42.41  ? 745 HOH A O   1 
HETATM 8495 O O   . HOH C 2 .   ? 13.230  -5.295  46.268  1.00 30.14  ? 746 HOH A O   1 
HETATM 8496 O O   . HOH C 2 .   ? 33.273  -24.570 16.359  1.00 47.55  ? 747 HOH A O   1 
HETATM 8497 O O   . HOH C 2 .   ? -5.867  -1.314  6.733   1.00 36.93  ? 748 HOH A O   1 
HETATM 8498 O O   . HOH C 2 .   ? 27.564  -18.296 33.913  1.00 40.58  ? 749 HOH A O   1 
HETATM 8499 O O   . HOH C 2 .   ? 0.239   -5.163  34.775  1.00 38.54  ? 750 HOH A O   1 
HETATM 8500 O O   . HOH C 2 .   ? 3.135   -18.442 24.697  1.00 32.01  ? 751 HOH A O   1 
HETATM 8501 O O   . HOH C 2 .   ? -6.345  -2.735  19.258  1.00 37.67  ? 752 HOH A O   1 
HETATM 8502 O O   . HOH C 2 .   ? 8.229   -27.000 -6.453  1.00 41.05  ? 753 HOH A O   1 
HETATM 8503 O O   . HOH C 2 .   ? 5.513   -20.321 29.225  1.00 34.01  ? 754 HOH A O   1 
HETATM 8504 O O   . HOH C 2 .   ? 16.199  -20.202 33.795  1.00 45.80  ? 755 HOH A O   1 
HETATM 8505 O O   . HOH C 2 .   ? 15.822  -20.722 45.723  1.00 39.69  ? 756 HOH A O   1 
HETATM 8506 O O   . HOH C 2 .   ? 2.231   -9.734  1.038   1.00 42.33  ? 757 HOH A O   1 
HETATM 8507 O O   . HOH C 2 .   ? -14.324 -14.433 4.227   1.00 40.85  ? 758 HOH A O   1 
HETATM 8508 O O   . HOH C 2 .   ? 5.038   -15.460 17.345  1.00 27.13  ? 759 HOH A O   1 
HETATM 8509 O O   . HOH C 2 .   ? -4.833  -0.372  19.795  1.00 43.47  ? 760 HOH A O   1 
HETATM 8510 O O   . HOH C 2 .   ? -5.318  -21.307 3.075   1.00 55.77  ? 761 HOH A O   1 
HETATM 8511 O O   . HOH C 2 .   ? -7.409  -22.474 28.173  1.00 38.53  ? 762 HOH A O   1 
HETATM 8512 O O   . HOH C 2 .   ? 20.317  -23.852 0.538   1.00 41.80  ? 763 HOH A O   1 
HETATM 8513 O O   . HOH C 2 .   ? 0.478   -3.445  5.438   1.00 49.33  ? 764 HOH A O   1 
HETATM 8514 O O   . HOH C 2 .   ? 12.525  -25.621 25.463  1.00 39.78  ? 765 HOH A O   1 
HETATM 8515 O O   . HOH C 2 .   ? 15.964  -20.739 7.184   1.00 37.51  ? 766 HOH A O   1 
HETATM 8516 O O   . HOH C 2 .   ? 2.201   -2.732  37.597  1.00 36.75  ? 767 HOH A O   1 
HETATM 8517 O O   . HOH C 2 .   ? 18.730  -23.083 28.526  1.00 43.08  ? 768 HOH A O   1 
HETATM 8518 O O   . HOH C 2 .   ? 13.192  -18.666 48.770  1.00 33.47  ? 769 HOH A O   1 
HETATM 8519 O O   . HOH C 2 .   ? 11.594  5.417   32.750  1.00 44.23  ? 770 HOH A O   1 
HETATM 8520 O O   . HOH C 2 .   ? 28.284  -19.586 -12.069 1.00 52.39  ? 771 HOH A O   1 
HETATM 8521 O O   . HOH C 2 .   ? -12.841 -13.840 32.155  1.00 47.59  ? 772 HOH A O   1 
HETATM 8522 O O   . HOH C 2 .   ? 5.546   -21.198 6.047   1.00 39.65  ? 773 HOH A O   1 
HETATM 8523 O O   . HOH C 2 .   ? 21.104  -11.700 -11.861 1.00 43.39  ? 774 HOH A O   1 
HETATM 8524 O O   . HOH C 2 .   ? -8.422  -9.639  27.652  1.00 41.59  ? 775 HOH A O   1 
HETATM 8525 O O   . HOH C 2 .   ? 1.700   0.915   35.366  1.00 39.90  ? 776 HOH A O   1 
HETATM 8526 O O   . HOH C 2 .   ? 19.171  -5.372  45.171  1.00 44.95  ? 777 HOH A O   1 
HETATM 8527 O O   . HOH C 2 .   ? 2.299   -6.112  39.650  1.00 26.00  ? 778 HOH A O   1 
HETATM 8528 O O   . HOH C 2 .   ? 19.144  -34.591 7.434   1.00 51.72  ? 779 HOH A O   1 
HETATM 8529 O O   . HOH C 2 .   ? 18.455  6.264   25.789  1.00 55.81  ? 780 HOH A O   1 
HETATM 8530 O O   . HOH C 2 .   ? 25.549  -16.765 46.580  1.00 48.14  ? 781 HOH A O   1 
HETATM 8531 O O   . HOH C 2 .   ? -20.512 -15.834 23.744  1.00 43.06  ? 782 HOH A O   1 
HETATM 8532 O O   . HOH C 2 .   ? 17.485  -0.420  -2.463  1.00 41.73  ? 783 HOH A O   1 
HETATM 8533 O O   . HOH C 2 .   ? -8.466  -11.422 11.485  1.00 32.05  ? 784 HOH A O   1 
HETATM 8534 O O   . HOH C 2 .   ? -11.389 -23.936 25.131  1.00 44.15  ? 785 HOH A O   1 
HETATM 8535 O O   . HOH C 2 .   ? -1.055  -28.725 26.830  1.00 35.27  ? 786 HOH A O   1 
HETATM 8536 O O   . HOH C 2 .   ? 7.409   -18.959 -12.015 1.00 44.11  ? 787 HOH A O   1 
HETATM 8537 O O   . HOH C 2 .   ? 7.019   -8.664  6.921   1.00 31.82  ? 788 HOH A O   1 
HETATM 8538 O O   . HOH C 2 .   ? 10.607  0.410   37.806  1.00 32.85  ? 789 HOH A O   1 
HETATM 8539 O O   . HOH C 2 .   ? 6.915   4.906   31.849  1.00 48.52  ? 790 HOH A O   1 
HETATM 8540 O O   . HOH C 2 .   ? -19.146 -4.219  17.316  1.00 60.26  ? 791 HOH A O   1 
HETATM 8541 O O   . HOH C 2 .   ? 25.638  -0.754  33.325  1.00 52.60  ? 792 HOH A O   1 
HETATM 8542 O O   . HOH C 2 .   ? 1.137   -16.593 50.842  1.00 39.13  ? 793 HOH A O   1 
HETATM 8543 O O   . HOH C 2 .   ? 6.070   -3.121  3.754   1.00 40.50  ? 794 HOH A O   1 
HETATM 8544 O O   . HOH C 2 .   ? 2.877   -27.036 32.396  1.00 45.29  ? 795 HOH A O   1 
HETATM 8545 O O   . HOH C 2 .   ? -16.080 -14.692 31.010  1.00 49.23  ? 796 HOH A O   1 
HETATM 8546 O O   . HOH C 2 .   ? 10.871  -5.372  47.139  1.00 34.52  ? 797 HOH A O   1 
HETATM 8547 O O   . HOH C 2 .   ? 13.620  -33.096 -9.266  1.00 43.35  ? 798 HOH A O   1 
HETATM 8548 O O   . HOH C 2 .   ? -8.631  -2.536  4.027   1.00 43.58  ? 799 HOH A O   1 
HETATM 8549 O O   . HOH C 2 .   ? 32.298  -13.435 28.960  1.00 51.09  ? 800 HOH A O   1 
HETATM 8550 O O   . HOH C 2 .   ? 21.331  -19.645 -20.778 1.00 47.45  ? 801 HOH A O   1 
HETATM 8551 O O   . HOH C 2 .   ? 22.984  -33.032 6.084   1.00 48.18  ? 802 HOH A O   1 
HETATM 8552 O O   . HOH C 2 .   ? -1.815  -4.706  40.389  1.00 39.71  ? 803 HOH A O   1 
HETATM 8553 O O   . HOH C 2 .   ? -7.443  -5.145  1.299   1.00 49.20  ? 804 HOH A O   1 
HETATM 8554 O O   . HOH C 2 .   ? 3.282   -23.408 -7.681  1.00 42.05  ? 805 HOH A O   1 
HETATM 8555 O O   . HOH C 2 .   ? -3.146  -14.433 36.285  1.00 37.86  ? 806 HOH A O   1 
HETATM 8556 O O   . HOH C 2 .   ? -3.192  -7.470  3.523   1.00 35.50  ? 807 HOH A O   1 
HETATM 8557 O O   . HOH C 2 .   ? -7.724  -11.468 18.921  1.00 38.19  ? 808 HOH A O   1 
HETATM 8558 O O   . HOH C 2 .   ? 6.324   -22.639 21.630  1.00 33.49  ? 809 HOH A O   1 
HETATM 8559 O O   . HOH C 2 .   ? 18.602  -28.361 15.986  1.00 40.36  ? 810 HOH A O   1 
HETATM 8560 O O   . HOH C 2 .   ? 18.124  -15.003 1.863   1.00 34.51  ? 811 HOH A O   1 
HETATM 8561 O O   . HOH C 2 .   ? 10.002  -3.604  2.936   1.00 43.71  ? 812 HOH A O   1 
HETATM 8562 O O   . HOH C 2 .   ? 22.802  7.542   6.895   1.00 51.21  ? 813 HOH A O   1 
HETATM 8563 O O   . HOH C 2 .   ? 2.332   -3.498  46.477  1.00 37.74  ? 814 HOH A O   1 
HETATM 8564 O O   . HOH C 2 .   ? 12.635  -14.216 53.195  1.00 40.57  ? 815 HOH A O   1 
HETATM 8565 O O   . HOH C 2 .   ? 24.432  -14.647 48.462  1.00 45.30  ? 816 HOH A O   1 
HETATM 8566 O O   . HOH C 2 .   ? -9.680  -26.584 23.552  1.00 37.14  ? 817 HOH A O   1 
HETATM 8567 O O   . HOH C 2 .   ? 12.196  -22.704 -17.720 1.00 47.32  ? 818 HOH A O   1 
HETATM 8568 O O   . HOH C 2 .   ? 18.883  -10.183 46.308  1.00 37.02  ? 819 HOH A O   1 
HETATM 8569 O O   . HOH C 2 .   ? 32.024  -5.695  1.185   1.00 46.83  ? 820 HOH A O   1 
HETATM 8570 O O   . HOH C 2 .   ? 18.306  -17.928 2.292   1.00 37.75  ? 821 HOH A O   1 
HETATM 8571 O O   . HOH C 2 .   ? -6.183  -11.952 9.865   1.00 31.24  ? 822 HOH A O   1 
HETATM 8572 O O   . HOH C 2 .   ? 26.382  -23.230 6.646   1.00 41.20  ? 823 HOH A O   1 
HETATM 8573 O O   . HOH C 2 .   ? 1.438   3.730   27.022  1.00 52.01  ? 824 HOH A O   1 
HETATM 8574 O O   . HOH C 2 .   ? 6.819   -17.952 29.872  1.00 30.48  ? 825 HOH A O   1 
HETATM 8575 O O   . HOH C 2 .   ? 32.347  -8.301  22.198  1.00 45.94  ? 826 HOH A O   1 
HETATM 8576 O O   . HOH C 2 .   ? 35.835  -27.942 21.468  1.00 56.16  ? 827 HOH A O   1 
HETATM 8577 O O   . HOH C 2 .   ? 13.753  -20.414 50.862  1.00 39.53  ? 828 HOH A O   1 
HETATM 8578 O O   . HOH C 2 .   ? 12.548  -28.830 -15.390 1.00 41.78  ? 829 HOH A O   1 
HETATM 8579 O O   . HOH C 2 .   ? -1.831  -28.515 17.439  1.00 43.21  ? 830 HOH A O   1 
HETATM 8580 O O   . HOH C 2 .   ? 24.844  8.521   5.120   1.00 52.31  ? 831 HOH A O   1 
HETATM 8581 O O   . HOH C 2 .   ? 35.091  -16.089 18.264  1.00 46.83  ? 832 HOH A O   1 
HETATM 8582 O O   . HOH C 2 .   ? 11.829  6.756   25.797  1.00 48.91  ? 833 HOH A O   1 
HETATM 8583 O O   . HOH C 2 .   ? 36.224  -16.224 29.252  1.00 65.50  ? 834 HOH A O   1 
HETATM 8584 O O   . HOH C 2 .   ? 34.235  -0.317  4.838   1.00 53.68  ? 835 HOH A O   1 
HETATM 8585 O O   . HOH C 2 .   ? 26.851  -26.528 -8.318  1.00 51.44  ? 836 HOH A O   1 
HETATM 8586 O O   . HOH C 2 .   ? -4.190  -18.178 24.010  1.00 32.92  ? 837 HOH A O   1 
HETATM 8587 O O   . HOH C 2 .   ? 0.812   5.543   16.894  1.00 38.54  ? 838 HOH A O   1 
HETATM 8588 O O   . HOH C 2 .   ? 3.892   -2.128  5.287   1.00 47.00  ? 839 HOH A O   1 
HETATM 8589 O O   . HOH C 2 .   ? 24.279  -24.128 34.566  1.00 52.61  ? 840 HOH A O   1 
HETATM 8590 O O   . HOH C 2 .   ? 1.706   -10.324 -15.576 1.00 47.97  ? 841 HOH A O   1 
HETATM 8591 O O   . HOH C 2 .   ? 4.382   -11.869 -2.389  1.00 30.48  ? 842 HOH A O   1 
HETATM 8592 O O   . HOH C 2 .   ? 31.054  -3.943  -1.439  1.00 55.41  ? 843 HOH A O   1 
HETATM 8593 O O   . HOH C 2 .   ? 5.414   -22.794 -12.302 1.00 42.12  ? 844 HOH A O   1 
HETATM 8594 O O   . HOH C 2 .   ? 6.436   -24.603 16.847  1.00 43.18  ? 845 HOH A O   1 
HETATM 8595 O O   . HOH C 2 .   ? 17.665  -34.733 -3.527  1.00 46.83  ? 846 HOH A O   1 
HETATM 8596 O O   . HOH C 2 .   ? 0.672   -8.264  51.195  1.00 53.22  ? 847 HOH A O   1 
HETATM 8597 O O   . HOH C 2 .   ? 12.378  -23.099 54.840  1.00 47.73  ? 848 HOH A O   1 
HETATM 8598 O O   . HOH C 2 .   ? 21.496  -20.120 -9.153  1.00 46.47  ? 849 HOH A O   1 
HETATM 8599 O O   . HOH C 2 .   ? 2.480   -18.334 50.833  1.00 42.02  ? 850 HOH A O   1 
HETATM 8600 O O   . HOH C 2 .   ? 6.827   -6.109  1.172   1.00 49.65  ? 851 HOH A O   1 
HETATM 8601 O O   . HOH C 2 .   ? -5.100  -1.766  42.201  1.00 42.51  ? 852 HOH A O   1 
HETATM 8602 O O   . HOH C 2 .   ? -16.504 -26.592 14.604  1.00 48.90  ? 853 HOH A O   1 
HETATM 8603 O O   . HOH C 2 .   ? 7.862   -19.580 46.352  1.00 49.62  ? 854 HOH A O   1 
HETATM 8604 O O   . HOH C 2 .   ? -5.462  -3.493  38.559  1.00 50.30  ? 855 HOH A O   1 
HETATM 8605 O O   . HOH C 2 .   ? 1.555   -2.698  34.851  1.00 43.57  ? 856 HOH A O   1 
HETATM 8606 O O   . HOH C 2 .   ? 5.745   -2.077  44.719  1.00 31.83  ? 857 HOH A O   1 
HETATM 8607 O O   . HOH C 2 .   ? -0.494  -13.817 2.289   1.00 50.10  ? 858 HOH A O   1 
HETATM 8608 O O   . HOH C 2 .   ? 11.503  -27.147 -17.009 1.00 42.93  ? 859 HOH A O   1 
HETATM 8609 O O   . HOH C 2 .   ? 14.552  -21.299 30.494  1.00 40.68  ? 860 HOH A O   1 
HETATM 8610 O O   . HOH C 2 .   ? 5.667   -27.205 -12.679 1.00 46.74  ? 861 HOH A O   1 
HETATM 8611 O O   . HOH C 2 .   ? 29.915  -18.727 32.510  1.00 51.85  ? 862 HOH A O   1 
HETATM 8612 O O   . HOH C 2 .   ? -3.065  -2.452  40.376  1.00 47.73  ? 863 HOH A O   1 
HETATM 8613 O O   . HOH C 2 .   ? 11.369  -31.068 -15.119 1.00 51.58  ? 864 HOH A O   1 
HETATM 8614 O O   . HOH C 2 .   ? -4.609  -2.438  26.343  1.00 50.48  ? 865 HOH A O   1 
HETATM 8615 O O   . HOH C 2 .   ? 16.788  -25.667 23.007  1.00 49.02  ? 866 HOH A O   1 
HETATM 8616 O O   . HOH C 2 .   ? 3.923   -9.053  -1.168  1.00 42.65  ? 867 HOH A O   1 
HETATM 8617 O O   . HOH C 2 .   ? -1.493  -9.286  2.993   1.00 38.72  ? 868 HOH A O   1 
HETATM 8618 O O   . HOH C 2 .   ? 5.996   -7.434  -0.984  1.00 43.73  ? 869 HOH A O   1 
HETATM 8619 O O   . HOH C 2 .   ? 11.078  5.753   35.354  1.00 44.32  ? 870 HOH A O   1 
HETATM 8620 O O   . HOH C 2 .   ? -7.910  -0.163  5.569   1.00 51.81  ? 871 HOH A O   1 
HETATM 8621 O O   . HOH C 2 .   ? -0.812  -16.610 39.302  1.00 44.15  ? 872 HOH A O   1 
HETATM 8622 O O   . HOH C 2 .   ? 10.224  -20.984 47.068  1.00 46.15  ? 873 HOH A O   1 
HETATM 8623 O O   . HOH C 2 .   ? 7.935   -24.968 -15.779 1.00 47.68  ? 874 HOH A O   1 
HETATM 8624 O O   . HOH C 2 .   ? 6.401   -19.067 48.012  1.00 46.22  ? 875 HOH A O   1 
HETATM 8625 O O   . HOH C 2 .   ? 34.595  -3.642  1.450   1.00 55.66  ? 876 HOH A O   1 
HETATM 8626 O O   . HOH C 2 .   ? 6.548   -5.339  -2.424  1.00 50.13  ? 877 HOH A O   1 
HETATM 8627 O O   . HOH C 2 .   ? 8.008   -3.134  -0.740  1.00 53.85  ? 878 HOH A O   1 
HETATM 8628 O O   . HOH C 2 .   ? -3.530  -1.001  5.145   1.00 42.34  ? 879 HOH A O   1 
HETATM 8629 O O   . HOH C 2 .   ? 13.731  5.797   37.326  1.00 45.34  ? 880 HOH A O   1 
HETATM 8630 O O   . HOH D 2 .   ? 18.978  -10.034 -30.899 1.00 43.41  ? 601 HOH B O   1 
HETATM 8631 O O   . HOH D 2 .   ? 25.540  -16.377 -14.595 1.00 43.25  ? 602 HOH B O   1 
HETATM 8632 O O   . HOH D 2 .   ? 46.834  -19.225 -28.675 1.00 44.36  ? 603 HOH B O   1 
HETATM 8633 O O   . HOH D 2 .   ? 16.445  -11.477 -27.935 1.00 53.15  ? 604 HOH B O   1 
HETATM 8634 O O   . HOH D 2 .   ? 13.319  -7.544  -54.015 1.00 46.71  ? 605 HOH B O   1 
HETATM 8635 O O   . HOH D 2 .   ? 43.712  6.400   -55.652 1.00 43.10  ? 606 HOH B O   1 
HETATM 8636 O O   . HOH D 2 .   ? 43.324  -24.812 -37.550 1.00 49.68  ? 607 HOH B O   1 
HETATM 8637 O O   . HOH D 2 .   ? 37.632  -7.748  -72.760 1.00 41.73  ? 608 HOH B O   1 
HETATM 8638 O O   . HOH D 2 .   ? 7.124   2.630   -39.042 1.00 48.95  ? 609 HOH B O   1 
HETATM 8639 O O   . HOH D 2 .   ? 45.922  3.765   -25.365 1.00 46.04  ? 610 HOH B O   1 
HETATM 8640 O O   . HOH D 2 .   ? 34.911  -18.905 -63.719 1.00 57.05  ? 611 HOH B O   1 
HETATM 8641 O O   . HOH D 2 .   ? 14.366  -6.238  -52.097 1.00 46.44  ? 612 HOH B O   1 
HETATM 8642 O O   . HOH D 2 .   ? 13.238  0.736   -9.880  1.00 48.71  ? 613 HOH B O   1 
HETATM 8643 O O   . HOH D 2 .   ? 20.012  -8.629  -27.857 1.00 39.37  ? 614 HOH B O   1 
HETATM 8644 O O   . HOH D 2 .   ? 46.457  0.408   -69.148 1.00 50.75  ? 615 HOH B O   1 
HETATM 8645 O O   . HOH D 2 .   ? 32.113  -0.028  -61.614 1.00 28.19  ? 616 HOH B O   1 
HETATM 8646 O O   . HOH D 2 .   ? 32.959  -11.909 -63.984 1.00 49.98  ? 617 HOH B O   1 
HETATM 8647 O O   . HOH D 2 .   ? 44.715  -14.622 -18.563 1.00 56.33  ? 618 HOH B O   1 
HETATM 8648 O O   . HOH D 2 .   ? 25.853  8.812   -45.956 1.00 33.09  ? 619 HOH B O   1 
HETATM 8649 O O   . HOH D 2 .   ? 47.663  -18.646 -46.693 1.00 55.95  ? 620 HOH B O   1 
HETATM 8650 O O   . HOH D 2 .   ? 33.435  -9.085  -20.066 1.00 44.96  ? 621 HOH B O   1 
HETATM 8651 O O   . HOH D 2 .   ? 33.017  2.314   -13.243 1.00 49.89  ? 622 HOH B O   1 
HETATM 8652 O O   . HOH D 2 .   ? 42.922  -0.336  -47.540 1.00 37.75  ? 623 HOH B O   1 
HETATM 8653 O O   . HOH D 2 .   ? 32.700  -2.238  -70.945 1.00 37.36  ? 624 HOH B O   1 
HETATM 8654 O O   . HOH D 2 .   ? 47.490  2.480   -37.123 1.00 45.84  ? 625 HOH B O   1 
HETATM 8655 O O   . HOH D 2 .   ? 32.207  9.112   -44.019 1.00 40.05  ? 626 HOH B O   1 
HETATM 8656 O O   . HOH D 2 .   ? 33.080  1.616   -21.449 1.00 41.31  ? 627 HOH B O   1 
HETATM 8657 O O   . HOH D 2 .   ? 44.279  -13.684 -22.414 1.00 40.20  ? 628 HOH B O   1 
HETATM 8658 O O   . HOH D 2 .   ? 34.752  -3.602  -33.347 1.00 33.77  ? 629 HOH B O   1 
HETATM 8659 O O   . HOH D 2 .   ? 43.295  -15.654 -66.393 1.00 46.77  ? 630 HOH B O   1 
HETATM 8660 O O   . HOH D 2 .   ? 35.024  14.525  -37.162 1.00 52.91  ? 631 HOH B O   1 
HETATM 8661 O O   . HOH D 2 .   ? 45.991  -13.067 -70.970 1.00 55.43  ? 632 HOH B O   1 
HETATM 8662 O O   . HOH D 2 .   ? 25.030  -1.313  -61.806 1.00 31.92  ? 633 HOH B O   1 
HETATM 8663 O O   . HOH D 2 .   ? 40.671  -23.929 -46.910 1.00 41.42  ? 634 HOH B O   1 
HETATM 8664 O O   . HOH D 2 .   ? 20.783  -11.868 -55.873 1.00 44.86  ? 635 HOH B O   1 
HETATM 8665 O O   . HOH D 2 .   ? 22.187  3.944   -55.774 1.00 31.91  ? 636 HOH B O   1 
HETATM 8666 O O   . HOH D 2 .   ? 17.215  6.102   -10.532 1.00 52.99  ? 637 HOH B O   1 
HETATM 8667 O O   . HOH D 2 .   ? 40.802  -6.482  -72.042 1.00 35.20  ? 638 HOH B O   1 
HETATM 8668 O O   . HOH D 2 .   ? 21.450  2.541   -28.805 1.00 40.44  ? 639 HOH B O   1 
HETATM 8669 O O   . HOH D 2 .   ? 39.399  1.980   -62.015 1.00 41.11  ? 640 HOH B O   1 
HETATM 8670 O O   . HOH D 2 .   ? 18.165  -6.631  -37.082 1.00 37.34  ? 641 HOH B O   1 
HETATM 8671 O O   . HOH D 2 .   ? 28.314  -23.540 -18.599 1.00 47.12  ? 642 HOH B O   1 
HETATM 8672 O O   . HOH D 2 .   ? 40.511  -3.248  -47.936 1.00 38.97  ? 643 HOH B O   1 
HETATM 8673 O O   . HOH D 2 .   ? 36.087  -7.572  -20.527 1.00 50.97  ? 644 HOH B O   1 
HETATM 8674 O O   . HOH D 2 .   ? 24.068  5.684   -56.750 1.00 35.58  ? 645 HOH B O   1 
HETATM 8675 O O   . HOH D 2 .   ? 52.511  -9.559  -27.235 1.00 47.28  ? 646 HOH B O   1 
HETATM 8676 O O   . HOH D 2 .   ? 26.911  -16.788 -23.141 1.00 36.81  ? 647 HOH B O   1 
HETATM 8677 O O   . HOH D 2 .   ? 26.442  11.871  -58.446 1.00 40.72  ? 648 HOH B O   1 
HETATM 8678 O O   . HOH D 2 .   ? 20.285  9.555   -60.312 1.00 41.49  ? 649 HOH B O   1 
HETATM 8679 O O   . HOH D 2 .   ? 30.798  -8.399  -62.350 1.00 37.36  ? 650 HOH B O   1 
HETATM 8680 O O   . HOH D 2 .   ? 7.044   9.360   -44.106 1.00 42.90  ? 651 HOH B O   1 
HETATM 8681 O O   . HOH D 2 .   ? 53.019  3.028   -29.496 1.00 56.26  ? 652 HOH B O   1 
HETATM 8682 O O   . HOH D 2 .   ? 24.399  -17.583 -26.214 1.00 41.15  ? 653 HOH B O   1 
HETATM 8683 O O   . HOH D 2 .   ? 25.410  -14.704 -22.828 1.00 33.67  ? 654 HOH B O   1 
HETATM 8684 O O   . HOH D 2 .   ? 47.069  -20.171 -43.386 1.00 58.38  ? 655 HOH B O   1 
HETATM 8685 O O   . HOH D 2 .   ? 15.049  -20.489 -41.609 1.00 54.84  ? 656 HOH B O   1 
HETATM 8686 O O   . HOH D 2 .   ? 35.391  -7.364  -32.611 1.00 30.88  ? 657 HOH B O   1 
HETATM 8687 O O   . HOH D 2 .   ? 32.968  -15.824 -53.414 1.00 32.94  ? 658 HOH B O   1 
HETATM 8688 O O   . HOH D 2 .   ? 23.043  2.714   -69.555 1.00 44.61  ? 659 HOH B O   1 
HETATM 8689 O O   . HOH D 2 .   ? 31.644  0.415   -19.158 1.00 37.83  ? 660 HOH B O   1 
HETATM 8690 O O   . HOH D 2 .   ? 27.576  -20.762 -47.065 1.00 43.77  ? 661 HOH B O   1 
HETATM 8691 O O   . HOH D 2 .   ? 36.640  -24.632 -47.973 1.00 46.56  ? 662 HOH B O   1 
HETATM 8692 O O   . HOH D 2 .   ? 15.005  8.462   -27.150 1.00 49.27  ? 663 HOH B O   1 
HETATM 8693 O O   . HOH D 2 .   ? 29.197  0.407   -38.121 1.00 37.79  ? 664 HOH B O   1 
HETATM 8694 O O   . HOH D 2 .   ? 10.307  -4.696  -54.962 1.00 51.79  ? 665 HOH B O   1 
HETATM 8695 O O   . HOH D 2 .   ? 29.010  -27.680 -23.873 1.00 48.19  ? 666 HOH B O   1 
HETATM 8696 O O   . HOH D 2 .   ? 38.906  -18.820 -46.606 1.00 36.25  ? 667 HOH B O   1 
HETATM 8697 O O   . HOH D 2 .   ? 27.814  1.836   -67.870 1.00 34.03  ? 668 HOH B O   1 
HETATM 8698 O O   . HOH D 2 .   ? 39.131  0.462   -55.203 1.00 31.95  ? 669 HOH B O   1 
HETATM 8699 O O   . HOH D 2 .   ? 15.651  3.786   -59.428 1.00 44.52  ? 670 HOH B O   1 
HETATM 8700 O O   . HOH D 2 .   ? 36.506  2.991   -15.394 1.00 48.11  ? 671 HOH B O   1 
HETATM 8701 O O   . HOH D 2 .   ? 47.682  -26.389 -24.806 1.00 57.91  ? 672 HOH B O   1 
HETATM 8702 O O   . HOH D 2 .   ? 32.474  -14.607 -18.398 1.00 40.98  ? 673 HOH B O   1 
HETATM 8703 O O   . HOH D 2 .   ? 13.960  -6.819  -38.174 1.00 46.40  ? 674 HOH B O   1 
HETATM 8704 O O   . HOH D 2 .   ? 25.740  -6.125  -67.370 1.00 40.53  ? 675 HOH B O   1 
HETATM 8705 O O   . HOH D 2 .   ? 22.223  -0.339  -60.463 1.00 37.92  ? 676 HOH B O   1 
HETATM 8706 O O   . HOH D 2 .   ? 31.045  2.169   -60.253 1.00 29.50  ? 677 HOH B O   1 
HETATM 8707 O O   . HOH D 2 .   ? 34.725  -19.994 -28.248 1.00 31.25  ? 678 HOH B O   1 
HETATM 8708 O O   . HOH D 2 .   ? 16.539  0.345   -53.491 1.00 35.41  ? 679 HOH B O   1 
HETATM 8709 O O   . HOH D 2 .   ? 30.075  -24.586 -31.694 1.00 32.53  ? 680 HOH B O   1 
HETATM 8710 O O   . HOH D 2 .   ? 16.254  1.164   -45.407 1.00 34.58  ? 681 HOH B O   1 
HETATM 8711 O O   . HOH D 2 .   ? 45.199  3.123   -32.479 1.00 44.61  ? 682 HOH B O   1 
HETATM 8712 O O   . HOH D 2 .   ? 35.320  -24.811 -17.183 1.00 44.21  ? 683 HOH B O   1 
HETATM 8713 O O   . HOH D 2 .   ? 36.454  -23.787 -19.538 1.00 43.48  ? 684 HOH B O   1 
HETATM 8714 O O   . HOH D 2 .   ? 52.517  -16.113 -62.331 1.00 68.50  ? 685 HOH B O   1 
HETATM 8715 O O   . HOH D 2 .   ? 34.051  12.075  -57.816 1.00 37.83  ? 686 HOH B O   1 
HETATM 8716 O O   . HOH D 2 .   ? 23.901  -23.167 -20.536 1.00 47.28  ? 687 HOH B O   1 
HETATM 8717 O O   . HOH D 2 .   ? 30.939  -0.419  -68.040 1.00 36.09  ? 688 HOH B O   1 
HETATM 8718 O O   . HOH D 2 .   ? 9.247   -6.167  -43.156 1.00 41.91  ? 689 HOH B O   1 
HETATM 8719 O O   . HOH D 2 .   ? 15.305  1.491   -31.851 1.00 51.29  ? 690 HOH B O   1 
HETATM 8720 O O   . HOH D 2 .   ? 27.135  -7.284  -17.158 1.00 51.23  ? 691 HOH B O   1 
HETATM 8721 O O   . HOH D 2 .   ? 34.673  -1.671  -40.363 1.00 32.83  ? 692 HOH B O   1 
HETATM 8722 O O   . HOH D 2 .   ? 45.094  2.891   -47.771 1.00 40.05  ? 693 HOH B O   1 
HETATM 8723 O O   . HOH D 2 .   ? 44.920  -13.606 -25.619 1.00 36.11  ? 694 HOH B O   1 
HETATM 8724 O O   . HOH D 2 .   ? 16.493  -6.161  -53.347 1.00 43.31  ? 695 HOH B O   1 
HETATM 8725 O O   . HOH D 2 .   ? 27.621  -5.044  -18.662 1.00 42.20  ? 696 HOH B O   1 
HETATM 8726 O O   . HOH D 2 .   ? 42.638  -1.370  -29.402 1.00 37.89  ? 697 HOH B O   1 
HETATM 8727 O O   . HOH D 2 .   ? 33.650  4.039   -20.068 1.00 48.32  ? 698 HOH B O   1 
HETATM 8728 O O   . HOH D 2 .   ? 18.547  -0.407  -51.425 1.00 39.13  ? 699 HOH B O   1 
HETATM 8729 O O   . HOH D 2 .   ? 11.752  -17.720 -44.576 1.00 56.59  ? 700 HOH B O   1 
HETATM 8730 O O   . HOH D 2 .   ? 32.425  -17.802 -15.950 1.00 46.06  ? 701 HOH B O   1 
HETATM 8731 O O   . HOH D 2 .   ? 41.389  -24.638 -23.527 1.00 43.23  ? 702 HOH B O   1 
HETATM 8732 O O   . HOH D 2 .   ? 47.900  -7.304  -73.914 1.00 64.14  ? 703 HOH B O   1 
HETATM 8733 O O   . HOH D 2 .   ? 34.826  -11.295 -19.925 1.00 36.88  ? 704 HOH B O   1 
HETATM 8734 O O   . HOH D 2 .   ? 6.172   -0.931  -48.182 1.00 47.91  ? 705 HOH B O   1 
HETATM 8735 O O   . HOH D 2 .   ? 15.358  2.012   -11.751 1.00 49.61  ? 706 HOH B O   1 
HETATM 8736 O O   . HOH D 2 .   ? 34.567  1.797   -42.733 1.00 33.28  ? 707 HOH B O   1 
HETATM 8737 O O   . HOH D 2 .   ? 42.579  1.445   -60.410 1.00 44.29  ? 708 HOH B O   1 
HETATM 8738 O O   . HOH D 2 .   ? 29.283  14.204  -48.148 1.00 41.07  ? 709 HOH B O   1 
HETATM 8739 O O   . HOH D 2 .   ? 46.593  -15.843 -19.868 1.00 50.51  ? 710 HOH B O   1 
HETATM 8740 O O   . HOH D 2 .   ? 23.736  -8.782  -56.657 1.00 38.60  ? 711 HOH B O   1 
HETATM 8741 O O   . HOH D 2 .   ? 14.060  3.526   -46.936 1.00 36.55  ? 712 HOH B O   1 
HETATM 8742 O O   . HOH D 2 .   ? 25.110  -6.262  -33.316 1.00 28.83  ? 713 HOH B O   1 
HETATM 8743 O O   . HOH D 2 .   ? 15.749  6.348   -33.739 1.00 48.92  ? 714 HOH B O   1 
HETATM 8744 O O   . HOH D 2 .   ? 22.555  -15.361 -21.210 1.00 36.06  ? 715 HOH B O   1 
HETATM 8745 O O   . HOH D 2 .   ? 17.086  -16.530 -48.704 1.00 44.73  ? 716 HOH B O   1 
HETATM 8746 O O   . HOH D 2 .   ? 19.296  -3.231  -62.066 1.00 45.49  ? 717 HOH B O   1 
HETATM 8747 O O   . HOH D 2 .   ? 31.159  -12.939 -65.985 1.00 63.10  ? 718 HOH B O   1 
HETATM 8748 O O   . HOH D 2 .   ? 19.903  -15.307 -22.536 1.00 47.45  ? 719 HOH B O   1 
HETATM 8749 O O   . HOH D 2 .   ? 34.653  9.582   -38.489 1.00 51.60  ? 720 HOH B O   1 
HETATM 8750 O O   . HOH D 2 .   ? 19.467  1.652   -37.493 1.00 40.86  ? 721 HOH B O   1 
HETATM 8751 O O   . HOH D 2 .   ? 34.959  14.036  -52.652 1.00 39.86  ? 722 HOH B O   1 
HETATM 8752 O O   . HOH D 2 .   ? 47.711  -17.766 -26.469 1.00 49.34  ? 723 HOH B O   1 
HETATM 8753 O O   . HOH D 2 .   ? 32.538  5.654   -40.634 1.00 38.62  ? 724 HOH B O   1 
HETATM 8754 O O   . HOH D 2 .   ? 16.438  -14.687 -46.458 1.00 44.15  ? 725 HOH B O   1 
HETATM 8755 O O   . HOH D 2 .   ? 41.474  -0.566  -35.918 1.00 36.45  ? 726 HOH B O   1 
HETATM 8756 O O   . HOH D 2 .   ? 42.371  4.264   -41.754 1.00 42.20  ? 727 HOH B O   1 
HETATM 8757 O O   . HOH D 2 .   ? 34.815  -3.905  -47.828 1.00 31.15  ? 728 HOH B O   1 
HETATM 8758 O O   . HOH D 2 .   ? 41.613  -5.715  -76.076 1.00 47.50  ? 729 HOH B O   1 
HETATM 8759 O O   . HOH D 2 .   ? 22.360  -25.747 -23.595 1.00 47.39  ? 730 HOH B O   1 
HETATM 8760 O O   . HOH D 2 .   ? 41.157  2.267   -63.926 1.00 41.13  ? 731 HOH B O   1 
HETATM 8761 O O   . HOH D 2 .   ? 34.519  4.289   -42.049 1.00 37.17  ? 732 HOH B O   1 
HETATM 8762 O O   . HOH D 2 .   ? 44.620  7.057   -46.525 1.00 51.45  ? 733 HOH B O   1 
HETATM 8763 O O   . HOH D 2 .   ? 47.961  0.618   -43.761 1.00 53.84  ? 734 HOH B O   1 
HETATM 8764 O O   . HOH D 2 .   ? 51.219  -3.963  -69.672 1.00 57.59  ? 735 HOH B O   1 
HETATM 8765 O O   . HOH D 2 .   ? 31.681  -23.960 -24.961 1.00 34.25  ? 736 HOH B O   1 
HETATM 8766 O O   . HOH D 2 .   ? 34.728  -21.000 -59.722 1.00 48.24  ? 737 HOH B O   1 
HETATM 8767 O O   . HOH D 2 .   ? 21.468  7.592   -33.922 1.00 49.15  ? 738 HOH B O   1 
HETATM 8768 O O   . HOH D 2 .   ? 31.011  -11.688 -19.282 1.00 53.92  ? 739 HOH B O   1 
HETATM 8769 O O   . HOH D 2 .   ? 26.702  5.354   -51.423 1.00 31.15  ? 740 HOH B O   1 
HETATM 8770 O O   . HOH D 2 .   ? 5.954   1.621   -18.958 1.00 49.11  ? 741 HOH B O   1 
HETATM 8771 O O   . HOH D 2 .   ? 21.308  9.968   -34.111 1.00 55.78  ? 742 HOH B O   1 
HETATM 8772 O O   . HOH D 2 .   ? 16.696  -9.192  -33.747 1.00 41.25  ? 743 HOH B O   1 
HETATM 8773 O O   . HOH D 2 .   ? 34.882  -7.173  -63.833 1.00 35.54  ? 744 HOH B O   1 
HETATM 8774 O O   . HOH D 2 .   ? 14.539  10.787  -63.120 1.00 43.68  ? 745 HOH B O   1 
HETATM 8775 O O   . HOH D 2 .   ? 35.655  -9.662  -64.845 1.00 34.74  ? 746 HOH B O   1 
HETATM 8776 O O   . HOH D 2 .   ? 9.545   -5.848  -50.282 1.00 44.91  ? 747 HOH B O   1 
HETATM 8777 O O   . HOH D 2 .   ? 28.644  0.728   -43.655 1.00 30.88  ? 748 HOH B O   1 
HETATM 8778 O O   . HOH D 2 .   ? 6.173   -3.309  -42.158 1.00 48.01  ? 749 HOH B O   1 
HETATM 8779 O O   . HOH D 2 .   ? 39.351  -11.971 -70.714 1.00 45.24  ? 750 HOH B O   1 
HETATM 8780 O O   . HOH D 2 .   ? 37.742  3.394   -52.221 1.00 36.25  ? 751 HOH B O   1 
HETATM 8781 O O   . HOH D 2 .   ? 17.247  -1.302  -47.775 1.00 36.00  ? 752 HOH B O   1 
HETATM 8782 O O   . HOH D 2 .   ? 42.556  5.759   -44.080 1.00 44.78  ? 753 HOH B O   1 
HETATM 8783 O O   . HOH D 2 .   ? 21.369  -5.000  -34.997 1.00 33.53  ? 754 HOH B O   1 
HETATM 8784 O O   . HOH D 2 .   ? 16.091  -0.489  -36.638 1.00 38.83  ? 755 HOH B O   1 
HETATM 8785 O O   . HOH D 2 .   ? 32.807  3.222   -50.166 1.00 34.37  ? 756 HOH B O   1 
HETATM 8786 O O   . HOH D 2 .   ? 33.456  -26.716 -26.737 1.00 36.76  ? 757 HOH B O   1 
HETATM 8787 O O   . HOH D 2 .   ? 22.916  9.083   -59.869 1.00 39.03  ? 758 HOH B O   1 
HETATM 8788 O O   . HOH D 2 .   ? 48.646  -0.302  -71.649 1.00 58.61  ? 759 HOH B O   1 
HETATM 8789 O O   . HOH D 2 .   ? 43.186  6.770   -32.892 1.00 44.90  ? 760 HOH B O   1 
HETATM 8790 O O   . HOH D 2 .   ? 24.928  7.291   -33.127 1.00 47.27  ? 761 HOH B O   1 
HETATM 8791 O O   . HOH D 2 .   ? 45.221  -0.681  -72.763 1.00 41.59  ? 762 HOH B O   1 
HETATM 8792 O O   . HOH D 2 .   ? 16.800  2.104   -36.961 1.00 41.94  ? 763 HOH B O   1 
HETATM 8793 O O   . HOH D 2 .   ? 43.054  -23.406 -50.445 1.00 50.64  ? 764 HOH B O   1 
HETATM 8794 O O   . HOH D 2 .   ? 30.149  -19.913 -57.416 1.00 52.26  ? 765 HOH B O   1 
HETATM 8795 O O   . HOH D 2 .   ? 40.943  -0.204  -21.678 1.00 46.84  ? 766 HOH B O   1 
HETATM 8796 O O   . HOH D 2 .   ? 10.977  -4.718  -52.343 1.00 45.87  ? 767 HOH B O   1 
HETATM 8797 O O   . HOH D 2 .   ? 11.640  -1.146  -38.205 1.00 42.54  ? 768 HOH B O   1 
HETATM 8798 O O   . HOH D 2 .   ? 20.817  7.352   -66.620 1.00 39.90  ? 769 HOH B O   1 
HETATM 8799 O O   . HOH D 2 .   ? 28.967  -14.078 -17.616 1.00 43.32  ? 770 HOH B O   1 
HETATM 8800 O O   . HOH D 2 .   ? 33.319  1.186   -63.960 1.00 35.62  ? 771 HOH B O   1 
HETATM 8801 O O   . HOH D 2 .   ? 45.927  4.330   -54.366 1.00 45.62  ? 772 HOH B O   1 
HETATM 8802 O O   . HOH D 2 .   ? 42.487  10.377  -21.617 1.00 45.40  ? 773 HOH B O   1 
HETATM 8803 O O   . HOH D 2 .   ? 40.949  7.723   -43.625 1.00 45.49  ? 774 HOH B O   1 
HETATM 8804 O O   . HOH D 2 .   ? 14.985  -1.120  -32.626 1.00 40.16  ? 775 HOH B O   1 
HETATM 8805 O O   . HOH D 2 .   ? 40.589  10.552  -54.999 1.00 48.64  ? 776 HOH B O   1 
HETATM 8806 O O   . HOH D 2 .   ? 25.654  3.783   -10.261 1.00 44.11  ? 777 HOH B O   1 
HETATM 8807 O O   . HOH D 2 .   ? 37.806  -18.336 -59.579 1.00 38.42  ? 778 HOH B O   1 
HETATM 8808 O O   . HOH D 2 .   ? 26.410  4.939   -55.616 1.00 38.53  ? 779 HOH B O   1 
HETATM 8809 O O   . HOH D 2 .   ? 45.243  -3.001  -22.932 1.00 48.10  ? 780 HOH B O   1 
HETATM 8810 O O   . HOH D 2 .   ? 32.842  8.875   -41.167 1.00 49.74  ? 781 HOH B O   1 
HETATM 8811 O O   . HOH D 2 .   ? 50.877  -11.647 -27.464 1.00 49.52  ? 782 HOH B O   1 
HETATM 8812 O O   . HOH D 2 .   ? 42.880  1.750   -67.918 1.00 38.76  ? 783 HOH B O   1 
HETATM 8813 O O   . HOH D 2 .   ? 25.096  14.361  -57.775 1.00 33.24  ? 784 HOH B O   1 
HETATM 8814 O O   . HOH D 2 .   ? 23.212  4.770   -66.061 1.00 43.35  ? 785 HOH B O   1 
HETATM 8815 O O   . HOH D 2 .   ? 42.864  -12.495 -19.770 1.00 46.28  ? 786 HOH B O   1 
HETATM 8816 O O   . HOH D 2 .   ? 17.183  18.251  -58.888 1.00 49.61  ? 787 HOH B O   1 
HETATM 8817 O O   . HOH D 2 .   ? 25.824  -25.824 -28.538 1.00 41.32  ? 788 HOH B O   1 
HETATM 8818 O O   . HOH D 2 .   ? 31.272  -1.463  -6.225  1.00 57.71  ? 789 HOH B O   1 
HETATM 8819 O O   . HOH D 2 .   ? 54.745  -2.005  -59.667 1.00 47.10  ? 790 HOH B O   1 
HETATM 8820 O O   . HOH D 2 .   ? 6.675   0.468   -58.735 1.00 54.23  ? 791 HOH B O   1 
HETATM 8821 O O   . HOH D 2 .   ? 42.203  -20.785 -19.740 1.00 43.01  ? 792 HOH B O   1 
HETATM 8822 O O   . HOH D 2 .   ? 34.918  6.354   -45.343 1.00 40.69  ? 793 HOH B O   1 
HETATM 8823 O O   . HOH D 2 .   ? 28.310  -2.895  -74.438 1.00 31.70  ? 794 HOH B O   1 
HETATM 8824 O O   . HOH D 2 .   ? 5.718   3.895   -21.362 1.00 55.83  ? 795 HOH B O   1 
HETATM 8825 O O   . HOH D 2 .   ? 58.273  -1.470  -27.838 1.00 55.38  ? 796 HOH B O   1 
HETATM 8826 O O   . HOH D 2 .   ? 44.977  13.338  -33.554 1.00 49.75  ? 797 HOH B O   1 
HETATM 8827 O O   . HOH D 2 .   ? 34.581  -17.225 -16.694 1.00 37.17  ? 798 HOH B O   1 
HETATM 8828 O O   . HOH D 2 .   ? 35.660  -0.159  -68.748 1.00 28.45  ? 799 HOH B O   1 
HETATM 8829 O O   . HOH D 2 .   ? 23.489  -15.725 -56.095 1.00 48.82  ? 800 HOH B O   1 
HETATM 8830 O O   . HOH D 2 .   ? 39.970  9.746   -20.009 1.00 47.26  ? 801 HOH B O   1 
HETATM 8831 O O   . HOH D 2 .   ? 38.122  0.915   -52.422 1.00 36.36  ? 802 HOH B O   1 
HETATM 8832 O O   . HOH D 2 .   ? 48.026  -17.574 -32.975 1.00 45.00  ? 803 HOH B O   1 
HETATM 8833 O O   . HOH D 2 .   ? 15.606  0.187   -28.309 1.00 34.67  ? 804 HOH B O   1 
HETATM 8834 O O   . HOH D 2 .   ? 28.723  15.278  -45.541 1.00 44.18  ? 805 HOH B O   1 
HETATM 8835 O O   . HOH D 2 .   ? 20.728  -15.314 -25.318 1.00 42.87  ? 806 HOH B O   1 
HETATM 8836 O O   . HOH D 2 .   ? 14.882  3.169   -44.313 1.00 36.62  ? 807 HOH B O   1 
HETATM 8837 O O   . HOH D 2 .   ? 25.810  -27.296 -26.018 1.00 49.22  ? 808 HOH B O   1 
HETATM 8838 O O   . HOH D 2 .   ? 37.636  -27.062 -21.898 1.00 47.74  ? 809 HOH B O   1 
HETATM 8839 O O   . HOH D 2 .   ? 28.132  1.359   -12.181 1.00 47.97  ? 810 HOH B O   1 
HETATM 8840 O O   . HOH D 2 .   ? 36.309  -17.895 -67.050 1.00 63.02  ? 811 HOH B O   1 
HETATM 8841 O O   . HOH D 2 .   ? 41.194  4.051   -59.727 1.00 46.70  ? 812 HOH B O   1 
HETATM 8842 O O   . HOH D 2 .   ? 27.222  -12.552 -15.997 1.00 44.39  ? 813 HOH B O   1 
HETATM 8843 O O   . HOH D 2 .   ? 53.322  -14.359 -32.658 1.00 52.22  ? 814 HOH B O   1 
HETATM 8844 O O   . HOH D 2 .   ? 55.317  9.019   -35.363 1.00 67.62  ? 815 HOH B O   1 
HETATM 8845 O O   . HOH D 2 .   ? 15.466  3.502   -34.782 1.00 40.68  ? 816 HOH B O   1 
HETATM 8846 O O   . HOH D 2 .   ? 26.707  -10.469 -16.625 1.00 37.62  ? 817 HOH B O   1 
HETATM 8847 O O   . HOH D 2 .   ? 45.501  0.266   -48.211 1.00 44.19  ? 818 HOH B O   1 
HETATM 8848 O O   . HOH D 2 .   ? 42.625  -8.004  -74.371 1.00 55.63  ? 819 HOH B O   1 
HETATM 8849 O O   . HOH D 2 .   ? 20.311  -9.870  -13.367 1.00 49.15  ? 820 HOH B O   1 
HETATM 8850 O O   . HOH D 2 .   ? 16.162  -19.438 -25.860 1.00 57.95  ? 821 HOH B O   1 
HETATM 8851 O O   . HOH D 2 .   ? 21.544  -22.146 -21.377 1.00 58.13  ? 822 HOH B O   1 
HETATM 8852 O O   . HOH D 2 .   ? 15.976  -6.860  -56.062 1.00 49.83  ? 823 HOH B O   1 
HETATM 8853 O O   . HOH D 2 .   ? 39.290  -2.845  -78.859 1.00 46.70  ? 824 HOH B O   1 
HETATM 8854 O O   . HOH D 2 .   ? 32.097  1.672   -66.510 1.00 31.70  ? 825 HOH B O   1 
HETATM 8855 O O   . HOH D 2 .   ? 28.590  -11.992 -65.337 1.00 55.23  ? 826 HOH B O   1 
HETATM 8856 O O   . HOH D 2 .   ? 12.873  12.748  -64.078 1.00 45.58  ? 827 HOH B O   1 
HETATM 8857 O O   . HOH D 2 .   ? 45.992  4.484   -68.019 1.00 49.23  ? 828 HOH B O   1 
HETATM 8858 O O   . HOH D 2 .   ? 29.677  -9.553  -16.917 1.00 56.18  ? 829 HOH B O   1 
HETATM 8859 O O   . HOH D 2 .   ? 36.011  0.825   -65.171 1.00 39.24  ? 830 HOH B O   1 
HETATM 8860 O O   . HOH D 2 .   ? 16.912  -16.434 -26.243 1.00 48.76  ? 831 HOH B O   1 
HETATM 8861 O O   . HOH D 2 .   ? 13.438  -0.149  -36.272 1.00 40.28  ? 832 HOH B O   1 
HETATM 8862 O O   . HOH D 2 .   ? 13.093  -19.928 -43.887 1.00 63.50  ? 833 HOH B O   1 
HETATM 8863 O O   . HOH D 2 .   ? 42.913  -24.657 -48.346 1.00 50.20  ? 834 HOH B O   1 
HETATM 8864 O O   . HOH D 2 .   ? 44.060  -16.628 -68.507 1.00 52.93  ? 835 HOH B O   1 
HETATM 8865 O O   . HOH D 2 .   ? 14.060  -5.932  -57.596 1.00 49.93  ? 836 HOH B O   1 
HETATM 8866 O O   . HOH D 2 .   ? 41.977  -23.399 -20.501 1.00 47.22  ? 837 HOH B O   1 
HETATM 8867 O O   . HOH D 2 .   ? 26.053  -3.896  -74.344 1.00 39.78  ? 838 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   -2  -2  ASP ASP A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   MET 3   0   0   MET MET A . n 
A 1 4   GLU 4   1   1   GLU GLU A . n 
A 1 5   GLY 5   2   2   GLY GLY A . n 
A 1 6   ARG 6   3   3   ARG ARG A . n 
A 1 7   GLU 7   4   4   GLU GLU A . n 
A 1 8   ASP 8   5   5   ASP ASP A . n 
A 1 9   PRO 9   6   6   PRO PRO A . n 
A 1 10  GLN 10  7   7   GLN GLN A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  LEU 12  9   9   LEU LEU A . n 
A 1 13  VAL 13  10  10  VAL VAL A . n 
A 1 14  ARG 14  11  11  ARG ARG A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ARG 16  13  13  ARG ARG A . n 
A 1 17  GLY 17  14  14  GLY GLY A . n 
A 1 18  GLY 18  15  15  GLY GLY A . n 
A 1 19  GLN 19  16  16  GLN GLN A . n 
A 1 20  LEU 20  17  17  LEU LEU A . n 
A 1 21  ARG 21  18  18  ARG ARG A . n 
A 1 22  GLY 22  19  19  GLY GLY A . n 
A 1 23  ILE 23  20  20  ILE ILE A . n 
A 1 24  ARG 24  21  21  ARG ARG A . n 
A 1 25  LEU 25  22  22  LEU LEU A . n 
A 1 26  LYS 26  23  23  LYS LYS A . n 
A 1 27  ALA 27  24  24  ALA ALA A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  GLY 29  26  26  GLY GLY A . n 
A 1 30  GLY 30  27  27  GLY GLY A . n 
A 1 31  PRO 31  28  28  PRO PRO A . n 
A 1 32  VAL 32  29  29  VAL VAL A . n 
A 1 33  SER 33  30  30  SER SER A . n 
A 1 34  ALA 34  31  31  ALA ALA A . n 
A 1 35  PHE 35  32  32  PHE PHE A . n 
A 1 36  LEU 36  33  33  LEU LEU A . n 
A 1 37  GLY 37  34  34  GLY GLY A . n 
A 1 38  ILE 38  35  35  ILE ILE A . n 
A 1 39  PRO 39  36  36  PRO PRO A . n 
A 1 40  PHE 40  37  37  PHE PHE A . n 
A 1 41  ALA 41  38  38  ALA ALA A . n 
A 1 42  GLU 42  39  39  GLU GLU A . n 
A 1 43  PRO 43  40  40  PRO PRO A . n 
A 1 44  PRO 44  41  41  PRO PRO A . n 
A 1 45  VAL 45  42  42  VAL VAL A . n 
A 1 46  GLY 46  43  43  GLY GLY A . n 
A 1 47  SER 47  44  44  SER SER A . n 
A 1 48  ARG 48  45  45  ARG ARG A . n 
A 1 49  ARG 49  46  46  ARG ARG A . n 
A 1 50  PHE 50  47  47  PHE PHE A . n 
A 1 51  MET 51  48  48  MET MET A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLU 54  51  51  GLU GLU A . n 
A 1 55  PRO 55  52  52  PRO PRO A . n 
A 1 56  LYS 56  53  53  LYS LYS A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  PRO 58  55  55  PRO PRO A . n 
A 1 59  TRP 59  56  56  TRP TRP A . n 
A 1 60  SER 60  57  57  SER SER A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  LEU 63  60  60  LEU LEU A . n 
A 1 64  ASP 64  61  61  ASP ASP A . n 
A 1 65  ALA 65  62  62  ALA ALA A . n 
A 1 66  THR 66  63  63  THR THR A . n 
A 1 67  THR 67  64  64  THR THR A . n 
A 1 68  PHE 68  65  65  PHE PHE A . n 
A 1 69  GLN 69  66  66  GLN GLN A . n 
A 1 70  ASN 70  67  67  ASN ASN A . n 
A 1 71  VAL 71  68  68  VAL VAL A . n 
A 1 72  CYS 72  69  69  CYS CYS A . n 
A 1 73  TYR 73  70  70  TYR TYR A . n 
A 1 74  GLN 74  71  71  GLN GLN A . n 
A 1 75  TYR 75  72  72  TYR TYR A . n 
A 1 76  VAL 76  73  73  VAL VAL A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  THR 78  75  75  THR THR A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  TYR 80  77  77  TYR TYR A . n 
A 1 81  PRO 81  78  78  PRO PRO A . n 
A 1 82  GLY 82  79  79  GLY GLY A . n 
A 1 83  PHE 83  80  80  PHE PHE A . n 
A 1 84  GLU 84  81  81  GLU GLU A . n 
A 1 85  GLY 85  82  82  GLY GLY A . n 
A 1 86  THR 86  83  83  THR THR A . n 
A 1 87  GLU 87  84  84  GLU GLU A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  TRP 89  86  86  TRP TRP A . n 
A 1 90  ASN 90  87  87  ASN ASN A . n 
A 1 91  PRO 91  88  88  PRO PRO A . n 
A 1 92  ASN 92  89  89  ASN ASN A . n 
A 1 93  ARG 93  90  90  ARG ARG A . n 
A 1 94  GLU 94  91  91  GLU GLU A . n 
A 1 95  LEU 95  92  92  LEU LEU A . n 
A 1 96  SER 96  93  93  SER SER A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ASP 98  95  95  ASP ASP A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 LEU 100 97  97  LEU LEU A . n 
A 1 101 TYR 101 98  98  TYR TYR A . n 
A 1 102 LEU 102 99  99  LEU LEU A . n 
A 1 103 ASN 103 100 100 ASN ASN A . n 
A 1 104 VAL 104 101 101 VAL VAL A . n 
A 1 105 TRP 105 102 102 TRP TRP A . n 
A 1 106 THR 106 103 103 THR THR A . n 
A 1 107 PRO 107 104 104 PRO PRO A . n 
A 1 108 TYR 108 105 105 TYR TYR A . n 
A 1 109 PRO 109 106 106 PRO PRO A . n 
A 1 110 ARG 110 107 107 ARG ARG A . n 
A 1 111 PRO 111 108 108 PRO PRO A . n 
A 1 112 ALA 112 109 109 ALA ALA A . n 
A 1 113 SER 113 110 110 SER SER A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 THR 115 112 112 THR THR A . n 
A 1 116 PRO 116 113 113 PRO PRO A . n 
A 1 117 VAL 117 114 114 VAL VAL A . n 
A 1 118 LEU 118 115 115 LEU LEU A . n 
A 1 119 ILE 119 116 116 ILE ILE A . n 
A 1 120 TRP 120 117 117 TRP TRP A . n 
A 1 121 ILE 121 118 118 ILE ILE A . n 
A 1 122 TYR 122 119 119 TYR TYR A . n 
A 1 123 GLY 123 120 120 GLY GLY A . n 
A 1 124 GLY 124 121 121 GLY GLY A . n 
A 1 125 GLY 125 122 122 GLY GLY A . n 
A 1 126 PHE 126 123 123 PHE PHE A . n 
A 1 127 TYR 127 124 124 TYR TYR A . n 
A 1 128 SER 128 125 125 SER SER A . n 
A 1 129 GLY 129 126 126 GLY GLY A . n 
A 1 130 ALA 130 127 127 ALA ALA A . n 
A 1 131 ALA 131 128 128 ALA ALA A . n 
A 1 132 SER 132 129 129 SER SER A . n 
A 1 133 LEU 133 130 130 LEU LEU A . n 
A 1 134 ASP 134 131 131 ASP ASP A . n 
A 1 135 VAL 135 132 132 VAL VAL A . n 
A 1 136 TYR 136 133 133 TYR TYR A . n 
A 1 137 ASP 137 134 134 ASP ASP A . n 
A 1 138 GLY 138 135 135 GLY GLY A . n 
A 1 139 ARG 139 136 136 ARG ARG A . n 
A 1 140 PHE 140 137 137 PHE PHE A . n 
A 1 141 LEU 141 138 138 LEU LEU A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 GLN 143 140 140 GLN GLN A . n 
A 1 144 VAL 144 141 141 VAL VAL A . n 
A 1 145 GLU 145 142 142 GLU GLU A . n 
A 1 146 GLY 146 143 143 GLY GLY A . n 
A 1 147 ALA 147 144 144 ALA ALA A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 LEU 149 146 146 LEU LEU A . n 
A 1 150 VAL 150 147 147 VAL VAL A . n 
A 1 151 SER 151 148 148 SER SER A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 ASN 153 150 150 ASN ASN A . n 
A 1 154 TYR 154 151 151 TYR TYR A . n 
A 1 155 ARG 155 152 152 ARG ARG A . n 
A 1 156 VAL 156 153 153 VAL VAL A . n 
A 1 157 GLY 157 154 154 GLY GLY A . n 
A 1 158 THR 158 155 155 THR THR A . n 
A 1 159 PHE 159 156 156 PHE PHE A . n 
A 1 160 GLY 160 157 157 GLY GLY A . n 
A 1 161 PHE 161 158 158 PHE PHE A . n 
A 1 162 LEU 162 159 159 LEU LEU A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 LEU 164 161 161 LEU LEU A . n 
A 1 165 PRO 165 162 162 PRO PRO A . n 
A 1 166 GLY 166 163 163 GLY GLY A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ARG 168 165 165 ARG ARG A . n 
A 1 169 GLU 169 166 166 GLU GLU A . n 
A 1 170 ALA 170 167 167 ALA ALA A . n 
A 1 171 PRO 171 168 168 PRO PRO A . n 
A 1 172 GLY 172 169 169 GLY GLY A . n 
A 1 173 ASN 173 170 170 ASN ASN A . n 
A 1 174 VAL 174 171 171 VAL VAL A . n 
A 1 175 GLY 175 172 172 GLY GLY A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 LEU 177 174 174 LEU LEU A . n 
A 1 178 ASP 178 175 175 ASP ASP A . n 
A 1 179 GLN 179 176 176 GLN GLN A . n 
A 1 180 ARG 180 177 177 ARG ARG A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 ALA 182 179 179 ALA ALA A . n 
A 1 183 LEU 183 180 180 LEU LEU A . n 
A 1 184 GLN 184 181 181 GLN GLN A . n 
A 1 185 TRP 185 182 182 TRP TRP A . n 
A 1 186 VAL 186 183 183 VAL VAL A . n 
A 1 187 GLN 187 184 184 GLN GLN A . n 
A 1 188 GLU 188 185 185 GLU GLU A . n 
A 1 189 ASN 189 186 186 ASN ASN A . n 
A 1 190 ILE 190 187 187 ILE ILE A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 GLY 194 191 191 GLY GLY A . n 
A 1 195 GLY 195 192 192 GLY GLY A . n 
A 1 196 ASP 196 193 193 ASP ASP A . n 
A 1 197 PRO 197 194 194 PRO PRO A . n 
A 1 198 MET 198 195 195 MET MET A . n 
A 1 199 SER 199 196 196 SER SER A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 THR 201 198 198 THR THR A . n 
A 1 202 LEU 202 199 199 LEU LEU A . n 
A 1 203 PHE 203 200 200 PHE PHE A . n 
A 1 204 GLY 204 201 201 GLY GLY A . n 
A 1 205 GLU 205 202 202 GLU GLU A . n 
A 1 206 SER 206 203 203 SER SER A . n 
A 1 207 ALA 207 204 204 ALA ALA A . n 
A 1 208 GLY 208 205 205 GLY GLY A . n 
A 1 209 ALA 209 206 206 ALA ALA A . n 
A 1 210 ALA 210 207 207 ALA ALA A . n 
A 1 211 SER 211 208 208 SER SER A . n 
A 1 212 VAL 212 209 209 VAL VAL A . n 
A 1 213 GLY 213 210 210 GLY GLY A . n 
A 1 214 MET 214 211 211 MET MET A . n 
A 1 215 HIS 215 212 212 HIS HIS A . n 
A 1 216 ILE 216 213 213 ILE ILE A . n 
A 1 217 LEU 217 214 214 LEU LEU A . n 
A 1 218 SER 218 215 215 SER SER A . n 
A 1 219 LEU 219 216 216 LEU LEU A . n 
A 1 220 PRO 220 217 217 PRO PRO A . n 
A 1 221 SER 221 218 218 SER SER A . n 
A 1 222 ARG 222 219 219 ARG ARG A . n 
A 1 223 SER 223 220 220 SER SER A . n 
A 1 224 LEU 224 221 221 LEU LEU A . n 
A 1 225 PHE 225 222 222 PHE PHE A . n 
A 1 226 HIS 226 223 223 HIS HIS A . n 
A 1 227 ARG 227 224 224 ARG ARG A . n 
A 1 228 ALA 228 225 225 ALA ALA A . n 
A 1 229 VAL 229 226 226 VAL VAL A . n 
A 1 230 LEU 230 227 227 LEU LEU A . n 
A 1 231 GLN 231 228 228 GLN GLN A . n 
A 1 232 SER 232 229 229 SER SER A . n 
A 1 233 GLY 233 230 230 GLY GLY A . n 
A 1 234 THR 234 231 231 THR THR A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 GLY 237 234 234 GLY GLY A . n 
A 1 238 PRO 238 235 235 PRO PRO A . n 
A 1 239 TRP 239 236 236 TRP TRP A . n 
A 1 240 ALA 240 237 237 ALA ALA A . n 
A 1 241 THR 241 238 238 THR THR A . n 
A 1 242 VAL 242 239 239 VAL VAL A . n 
A 1 243 SER 243 240 240 SER SER A . n 
A 1 244 ALA 244 241 241 ALA ALA A . n 
A 1 245 GLY 245 242 242 GLY GLY A . n 
A 1 246 GLU 246 243 243 GLU GLU A . n 
A 1 247 ALA 247 244 244 ALA ALA A . n 
A 1 248 ARG 248 245 245 ARG ARG A . n 
A 1 249 ARG 249 246 246 ARG ARG A . n 
A 1 250 ARG 250 247 247 ARG ARG A . n 
A 1 251 ALA 251 248 248 ALA ALA A . n 
A 1 252 THR 252 249 249 THR THR A . n 
A 1 253 LEU 253 250 250 LEU LEU A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LEU 257 254 254 LEU LEU A . n 
A 1 258 VAL 258 255 255 VAL VAL A . n 
A 1 259 GLY 259 256 256 GLY GLY A . n 
A 1 260 CYS 260 257 257 CYS CYS A . n 
A 1 261 PRO 261 258 258 PRO PRO A . n 
A 1 262 PRO 262 259 ?   ?   ?   A . n 
A 1 263 GLY 263 260 ?   ?   ?   A . n 
A 1 264 GLY 264 261 ?   ?   ?   A . n 
A 1 265 ALA 265 262 ?   ?   ?   A . n 
A 1 266 GLY 266 263 ?   ?   ?   A . n 
A 1 267 GLY 267 264 ?   ?   ?   A . n 
A 1 268 ASN 268 265 265 ASN ASN A . n 
A 1 269 ASP 269 266 266 ASP ASP A . n 
A 1 270 THR 270 267 267 THR THR A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 ILE 273 270 270 ILE ILE A . n 
A 1 274 ALA 274 271 271 ALA ALA A . n 
A 1 275 CYS 275 272 272 CYS CYS A . n 
A 1 276 LEU 276 273 273 LEU LEU A . n 
A 1 277 ARG 277 274 274 ARG ARG A . n 
A 1 278 THR 278 275 275 THR THR A . n 
A 1 279 ARG 279 276 276 ARG ARG A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 ALA 281 278 278 ALA ALA A . n 
A 1 282 GLN 282 279 279 GLN GLN A . n 
A 1 283 ASP 283 280 280 ASP ASP A . n 
A 1 284 LEU 284 281 281 LEU LEU A . n 
A 1 285 VAL 285 282 282 VAL VAL A . n 
A 1 286 ASP 286 283 283 ASP ASP A . n 
A 1 287 HIS 287 284 284 HIS HIS A . n 
A 1 288 GLU 288 285 285 GLU GLU A . n 
A 1 289 TRP 289 286 286 TRP TRP A . n 
A 1 290 HIS 290 287 287 HIS HIS A . n 
A 1 291 VAL 291 288 288 VAL VAL A . n 
A 1 292 LEU 292 289 289 LEU LEU A . n 
A 1 293 PRO 293 290 290 PRO PRO A . n 
A 1 294 GLN 294 291 291 GLN GLN A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 ILE 297 294 294 ILE ILE A . n 
A 1 298 PHE 298 295 295 PHE PHE A . n 
A 1 299 ARG 299 296 296 ARG ARG A . n 
A 1 300 PHE 300 297 297 PHE PHE A . n 
A 1 301 SER 301 298 298 SER SER A . n 
A 1 302 PHE 302 299 299 PHE PHE A . n 
A 1 303 VAL 303 300 300 VAL VAL A . n 
A 1 304 PRO 304 301 301 PRO PRO A . n 
A 1 305 VAL 305 302 302 VAL VAL A . n 
A 1 306 VAL 306 303 303 VAL VAL A . n 
A 1 307 ASP 307 304 304 ASP ASP A . n 
A 1 308 GLY 308 305 305 GLY GLY A . n 
A 1 309 ASP 309 306 306 ASP ASP A . n 
A 1 310 PHE 310 307 307 PHE PHE A . n 
A 1 311 LEU 311 308 308 LEU LEU A . n 
A 1 312 SER 312 309 309 SER SER A . n 
A 1 313 ASP 313 310 310 ASP ASP A . n 
A 1 314 THR 314 311 311 THR THR A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 GLU 316 313 313 GLU GLU A . n 
A 1 317 ALA 317 314 314 ALA ALA A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 ILE 319 316 316 ILE ILE A . n 
A 1 320 ASN 320 317 317 ASN ASN A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 GLY 322 319 319 GLY GLY A . n 
A 1 323 ASP 323 320 320 ASP ASP A . n 
A 1 324 PHE 324 321 321 PHE PHE A . n 
A 1 325 GLN 325 322 322 GLN GLN A . n 
A 1 326 ASP 326 323 323 ASP ASP A . n 
A 1 327 LEU 327 324 324 LEU LEU A . n 
A 1 328 GLN 328 325 325 GLN GLN A . n 
A 1 329 VAL 329 326 326 VAL VAL A . n 
A 1 330 LEU 330 327 327 LEU LEU A . n 
A 1 331 VAL 331 328 328 VAL VAL A . n 
A 1 332 GLY 332 329 329 GLY GLY A . n 
A 1 333 VAL 333 330 330 VAL VAL A . n 
A 1 334 VAL 334 331 331 VAL VAL A . n 
A 1 335 LYS 335 332 332 LYS LYS A . n 
A 1 336 ASP 336 333 333 ASP ASP A . n 
A 1 337 GLU 337 334 334 GLU GLU A . n 
A 1 338 GLY 338 335 335 GLY GLY A . n 
A 1 339 SER 339 336 336 SER SER A . n 
A 1 340 TYR 340 337 337 TYR TYR A . n 
A 1 341 PHE 341 338 338 PHE PHE A . n 
A 1 342 LEU 342 339 339 LEU LEU A . n 
A 1 343 VAL 343 340 340 VAL VAL A . n 
A 1 344 TYR 344 341 341 TYR TYR A . n 
A 1 345 GLY 345 342 342 GLY GLY A . n 
A 1 346 VAL 346 343 343 VAL VAL A . n 
A 1 347 PRO 347 344 344 PRO PRO A . n 
A 1 348 GLY 348 345 345 GLY GLY A . n 
A 1 349 PHE 349 346 346 PHE PHE A . n 
A 1 350 SER 350 347 347 SER SER A . n 
A 1 351 LYS 351 348 348 LYS LYS A . n 
A 1 352 ASP 352 349 349 ASP ASP A . n 
A 1 353 ASN 353 350 350 ASN ASN A . n 
A 1 354 GLU 354 351 351 GLU GLU A . n 
A 1 355 SER 355 352 352 SER SER A . n 
A 1 356 LEU 356 353 353 LEU LEU A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 SER 358 355 355 SER SER A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ALA 360 357 357 ALA ALA A . n 
A 1 361 GLN 361 358 358 GLN GLN A . n 
A 1 362 PHE 362 359 359 PHE PHE A . n 
A 1 363 LEU 363 360 360 LEU LEU A . n 
A 1 364 ALA 364 361 361 ALA ALA A . n 
A 1 365 GLY 365 362 362 GLY GLY A . n 
A 1 366 VAL 366 363 363 VAL VAL A . n 
A 1 367 ARG 367 364 364 ARG ARG A . n 
A 1 368 ILE 368 365 365 ILE ILE A . n 
A 1 369 GLY 369 366 366 GLY GLY A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 PRO 371 368 368 PRO PRO A . n 
A 1 372 GLN 372 369 369 GLN GLN A . n 
A 1 373 ALA 373 370 370 ALA ALA A . n 
A 1 374 SER 374 371 371 SER SER A . n 
A 1 375 ASP 375 372 372 ASP ASP A . n 
A 1 376 LEU 376 373 373 LEU LEU A . n 
A 1 377 ALA 377 374 374 ALA ALA A . n 
A 1 378 ALA 378 375 375 ALA ALA A . n 
A 1 379 GLU 379 376 376 GLU GLU A . n 
A 1 380 ALA 380 377 377 ALA ALA A . n 
A 1 381 VAL 381 378 378 VAL VAL A . n 
A 1 382 VAL 382 379 379 VAL VAL A . n 
A 1 383 LEU 383 380 380 LEU LEU A . n 
A 1 384 HIS 384 381 381 HIS HIS A . n 
A 1 385 TYR 385 382 382 TYR TYR A . n 
A 1 386 THR 386 383 383 THR THR A . n 
A 1 387 ASP 387 384 384 ASP ASP A . n 
A 1 388 TRP 388 385 385 TRP TRP A . n 
A 1 389 LEU 389 386 386 LEU LEU A . n 
A 1 390 HIS 390 387 387 HIS HIS A . n 
A 1 391 PRO 391 388 388 PRO PRO A . n 
A 1 392 GLU 392 389 389 GLU GLU A . n 
A 1 393 ASP 393 390 390 ASP ASP A . n 
A 1 394 PRO 394 391 391 PRO PRO A . n 
A 1 395 THR 395 392 392 THR THR A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LEU 397 394 394 LEU LEU A . n 
A 1 398 ARG 398 395 395 ARG ARG A . n 
A 1 399 ASP 399 396 396 ASP ASP A . n 
A 1 400 ALA 400 397 397 ALA ALA A . n 
A 1 401 MET 401 398 398 MET MET A . n 
A 1 402 SER 402 399 399 SER SER A . n 
A 1 403 ALA 403 400 400 ALA ALA A . n 
A 1 404 VAL 404 401 401 VAL VAL A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 GLY 406 403 403 GLY GLY A . n 
A 1 407 ASP 407 404 404 ASP ASP A . n 
A 1 408 HIS 408 405 405 HIS HIS A . n 
A 1 409 ASN 409 406 406 ASN ASN A . n 
A 1 410 VAL 410 407 407 VAL VAL A . n 
A 1 411 VAL 411 408 408 VAL VAL A . n 
A 1 412 CYS 412 409 409 CYS CYS A . n 
A 1 413 PRO 413 410 410 PRO PRO A . n 
A 1 414 VAL 414 411 411 VAL VAL A . n 
A 1 415 ALA 415 412 412 ALA ALA A . n 
A 1 416 GLN 416 413 413 GLN GLN A . n 
A 1 417 LEU 417 414 414 LEU LEU A . n 
A 1 418 ALA 418 415 415 ALA ALA A . n 
A 1 419 GLY 419 416 416 GLY GLY A . n 
A 1 420 ARG 420 417 417 ARG ARG A . n 
A 1 421 LEU 421 418 418 LEU LEU A . n 
A 1 422 ALA 422 419 419 ALA ALA A . n 
A 1 423 ALA 423 420 420 ALA ALA A . n 
A 1 424 GLN 424 421 421 GLN GLN A . n 
A 1 425 GLY 425 422 422 GLY GLY A . n 
A 1 426 ALA 426 423 423 ALA ALA A . n 
A 1 427 ARG 427 424 424 ARG ARG A . n 
A 1 428 VAL 428 425 425 VAL VAL A . n 
A 1 429 TYR 429 426 426 TYR TYR A . n 
A 1 430 ALA 430 427 427 ALA ALA A . n 
A 1 431 TYR 431 428 428 TYR TYR A . n 
A 1 432 ILE 432 429 429 ILE ILE A . n 
A 1 433 PHE 433 430 430 PHE PHE A . n 
A 1 434 GLU 434 431 431 GLU GLU A . n 
A 1 435 HIS 435 432 432 HIS HIS A . n 
A 1 436 ARG 436 433 433 ARG ARG A . n 
A 1 437 ALA 437 434 434 ALA ALA A . n 
A 1 438 SER 438 435 435 SER SER A . n 
A 1 439 THR 439 436 436 THR THR A . n 
A 1 440 LEU 440 437 437 LEU LEU A . n 
A 1 441 THR 441 438 438 THR THR A . n 
A 1 442 TRP 442 439 439 TRP TRP A . n 
A 1 443 PRO 443 440 440 PRO PRO A . n 
A 1 444 LEU 444 441 441 LEU LEU A . n 
A 1 445 TRP 445 442 442 TRP TRP A . n 
A 1 446 MET 446 443 443 MET MET A . n 
A 1 447 GLY 447 444 444 GLY GLY A . n 
A 1 448 VAL 448 445 445 VAL VAL A . n 
A 1 449 PRO 449 446 446 PRO PRO A . n 
A 1 450 HIS 450 447 447 HIS HIS A . n 
A 1 451 GLY 451 448 448 GLY GLY A . n 
A 1 452 TYR 452 449 449 TYR TYR A . n 
A 1 453 GLU 453 450 450 GLU GLU A . n 
A 1 454 ILE 454 451 451 ILE ILE A . n 
A 1 455 GLU 455 452 452 GLU GLU A . n 
A 1 456 PHE 456 453 453 PHE PHE A . n 
A 1 457 ILE 457 454 454 ILE ILE A . n 
A 1 458 PHE 458 455 455 PHE PHE A . n 
A 1 459 GLY 459 456 456 GLY GLY A . n 
A 1 460 LEU 460 457 457 LEU LEU A . n 
A 1 461 PRO 461 458 458 PRO PRO A . n 
A 1 462 LEU 462 459 459 LEU LEU A . n 
A 1 463 ASP 463 460 460 ASP ASP A . n 
A 1 464 PRO 464 461 461 PRO PRO A . n 
A 1 465 SER 465 462 462 SER SER A . n 
A 1 466 LEU 466 463 463 LEU LEU A . n 
A 1 467 ASN 467 464 464 ASN ASN A . n 
A 1 468 TYR 468 465 465 TYR TYR A . n 
A 1 469 THR 469 466 466 THR THR A . n 
A 1 470 THR 470 467 467 THR THR A . n 
A 1 471 GLU 471 468 468 GLU GLU A . n 
A 1 472 GLU 472 469 469 GLU GLU A . n 
A 1 473 ARG 473 470 470 ARG ARG A . n 
A 1 474 ILE 474 471 471 ILE ILE A . n 
A 1 475 PHE 475 472 472 PHE PHE A . n 
A 1 476 ALA 476 473 473 ALA ALA A . n 
A 1 477 GLN 477 474 474 GLN GLN A . n 
A 1 478 ARG 478 475 475 ARG ARG A . n 
A 1 479 LEU 479 476 476 LEU LEU A . n 
A 1 480 MET 480 477 477 MET MET A . n 
A 1 481 LYS 481 478 478 LYS LYS A . n 
A 1 482 TYR 482 479 479 TYR TYR A . n 
A 1 483 TRP 483 480 480 TRP TRP A . n 
A 1 484 THR 484 481 481 THR THR A . n 
A 1 485 ASN 485 482 482 ASN ASN A . n 
A 1 486 PHE 486 483 483 PHE PHE A . n 
A 1 487 ALA 487 484 484 ALA ALA A . n 
A 1 488 ARG 488 485 485 ARG ARG A . n 
A 1 489 THR 489 486 486 THR THR A . n 
A 1 490 GLY 490 487 487 GLY GLY A . n 
A 1 491 ASP 491 488 488 ASP ASP A . n 
A 1 492 PRO 492 489 489 PRO PRO A . n 
A 1 493 ASN 493 490 490 ASN ASN A . n 
A 1 494 ASP 494 491 491 ASP ASP A . n 
A 1 495 PRO 495 492 492 PRO PRO A . n 
A 1 496 ARG 496 493 493 ARG ARG A . n 
A 1 497 ASP 497 494 494 ASP ASP A . n 
A 1 498 SER 498 495 495 SER SER A . n 
A 1 499 LYS 499 496 496 LYS LYS A . n 
A 1 500 SER 500 497 497 SER SER A . n 
A 1 501 PRO 501 498 498 PRO PRO A . n 
A 1 502 GLN 502 499 499 GLN GLN A . n 
A 1 503 TRP 503 500 500 TRP TRP A . n 
A 1 504 PRO 504 501 501 PRO PRO A . n 
A 1 505 PRO 505 502 502 PRO PRO A . n 
A 1 506 TYR 506 503 503 TYR TYR A . n 
A 1 507 THR 507 504 504 THR THR A . n 
A 1 508 THR 508 505 505 THR THR A . n 
A 1 509 ALA 509 506 506 ALA ALA A . n 
A 1 510 ALA 510 507 507 ALA ALA A . n 
A 1 511 GLN 511 508 508 GLN GLN A . n 
A 1 512 GLN 512 509 509 GLN GLN A . n 
A 1 513 TYR 513 510 510 TYR TYR A . n 
A 1 514 VAL 514 511 511 VAL VAL A . n 
A 1 515 SER 515 512 512 SER SER A . n 
A 1 516 LEU 516 513 513 LEU LEU A . n 
A 1 517 ASN 517 514 514 ASN ASN A . n 
A 1 518 LEU 518 515 515 LEU LEU A . n 
A 1 519 LYS 519 516 516 LYS LYS A . n 
A 1 520 PRO 520 517 517 PRO PRO A . n 
A 1 521 LEU 521 518 518 LEU LEU A . n 
A 1 522 GLU 522 519 519 GLU GLU A . n 
A 1 523 VAL 523 520 520 VAL VAL A . n 
A 1 524 ARG 524 521 521 ARG ARG A . n 
A 1 525 ARG 525 522 522 ARG ARG A . n 
A 1 526 GLY 526 523 523 GLY GLY A . n 
A 1 527 LEU 527 524 524 LEU LEU A . n 
A 1 528 ARG 528 525 525 ARG ARG A . n 
A 1 529 ALA 529 526 526 ALA ALA A . n 
A 1 530 GLN 530 527 527 GLN GLN A . n 
A 1 531 THR 531 528 528 THR THR A . n 
A 1 532 CYS 532 529 529 CYS CYS A . n 
A 1 533 ALA 533 530 530 ALA ALA A . n 
A 1 534 PHE 534 531 531 PHE PHE A . n 
A 1 535 TRP 535 532 532 TRP TRP A . n 
A 1 536 ASN 536 533 533 ASN ASN A . n 
A 1 537 ARG 537 534 534 ARG ARG A . n 
A 1 538 PHE 538 535 535 PHE PHE A . n 
A 1 539 LEU 539 536 536 LEU LEU A . n 
A 1 540 PRO 540 537 537 PRO PRO A . n 
A 1 541 LYS 541 538 538 LYS LYS A . n 
A 1 542 LEU 542 539 539 LEU LEU A . n 
A 1 543 LEU 543 540 540 LEU LEU A . n 
A 1 544 SER 544 541 541 SER SER A . n 
A 1 545 ALA 545 542 542 ALA ALA A . n 
B 1 1   ASP 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   MET 3   0   ?   ?   ?   B . n 
B 1 4   GLU 4   1   ?   ?   ?   B . n 
B 1 5   GLY 5   2   ?   ?   ?   B . n 
B 1 6   ARG 6   3   ?   ?   ?   B . n 
B 1 7   GLU 7   4   4   GLU GLU B . n 
B 1 8   ASP 8   5   5   ASP ASP B . n 
B 1 9   PRO 9   6   6   PRO PRO B . n 
B 1 10  GLN 10  7   7   GLN GLN B . n 
B 1 11  LEU 11  8   8   LEU LEU B . n 
B 1 12  LEU 12  9   9   LEU LEU B . n 
B 1 13  VAL 13  10  10  VAL VAL B . n 
B 1 14  ARG 14  11  11  ARG ARG B . n 
B 1 15  VAL 15  12  12  VAL VAL B . n 
B 1 16  ARG 16  13  13  ARG ARG B . n 
B 1 17  GLY 17  14  14  GLY GLY B . n 
B 1 18  GLY 18  15  15  GLY GLY B . n 
B 1 19  GLN 19  16  16  GLN GLN B . n 
B 1 20  LEU 20  17  17  LEU LEU B . n 
B 1 21  ARG 21  18  18  ARG ARG B . n 
B 1 22  GLY 22  19  19  GLY GLY B . n 
B 1 23  ILE 23  20  20  ILE ILE B . n 
B 1 24  ARG 24  21  21  ARG ARG B . n 
B 1 25  LEU 25  22  22  LEU LEU B . n 
B 1 26  LYS 26  23  23  LYS LYS B . n 
B 1 27  ALA 27  24  24  ALA ALA B . n 
B 1 28  PRO 28  25  25  PRO PRO B . n 
B 1 29  GLY 29  26  26  GLY GLY B . n 
B 1 30  GLY 30  27  27  GLY GLY B . n 
B 1 31  PRO 31  28  28  PRO PRO B . n 
B 1 32  VAL 32  29  29  VAL VAL B . n 
B 1 33  SER 33  30  30  SER SER B . n 
B 1 34  ALA 34  31  31  ALA ALA B . n 
B 1 35  PHE 35  32  32  PHE PHE B . n 
B 1 36  LEU 36  33  33  LEU LEU B . n 
B 1 37  GLY 37  34  34  GLY GLY B . n 
B 1 38  ILE 38  35  35  ILE ILE B . n 
B 1 39  PRO 39  36  36  PRO PRO B . n 
B 1 40  PHE 40  37  37  PHE PHE B . n 
B 1 41  ALA 41  38  38  ALA ALA B . n 
B 1 42  GLU 42  39  39  GLU GLU B . n 
B 1 43  PRO 43  40  40  PRO PRO B . n 
B 1 44  PRO 44  41  41  PRO PRO B . n 
B 1 45  VAL 45  42  42  VAL VAL B . n 
B 1 46  GLY 46  43  43  GLY GLY B . n 
B 1 47  SER 47  44  44  SER SER B . n 
B 1 48  ARG 48  45  45  ARG ARG B . n 
B 1 49  ARG 49  46  46  ARG ARG B . n 
B 1 50  PHE 50  47  47  PHE PHE B . n 
B 1 51  MET 51  48  48  MET MET B . n 
B 1 52  PRO 52  49  49  PRO PRO B . n 
B 1 53  PRO 53  50  50  PRO PRO B . n 
B 1 54  GLU 54  51  51  GLU GLU B . n 
B 1 55  PRO 55  52  52  PRO PRO B . n 
B 1 56  LYS 56  53  53  LYS LYS B . n 
B 1 57  ARG 57  54  54  ARG ARG B . n 
B 1 58  PRO 58  55  55  PRO PRO B . n 
B 1 59  TRP 59  56  56  TRP TRP B . n 
B 1 60  SER 60  57  57  SER SER B . n 
B 1 61  GLY 61  58  58  GLY GLY B . n 
B 1 62  VAL 62  59  59  VAL VAL B . n 
B 1 63  LEU 63  60  60  LEU LEU B . n 
B 1 64  ASP 64  61  61  ASP ASP B . n 
B 1 65  ALA 65  62  62  ALA ALA B . n 
B 1 66  THR 66  63  63  THR THR B . n 
B 1 67  THR 67  64  64  THR THR B . n 
B 1 68  PHE 68  65  65  PHE PHE B . n 
B 1 69  GLN 69  66  66  GLN GLN B . n 
B 1 70  ASN 70  67  67  ASN ASN B . n 
B 1 71  VAL 71  68  68  VAL VAL B . n 
B 1 72  CYS 72  69  69  CYS CYS B . n 
B 1 73  TYR 73  70  70  TYR TYR B . n 
B 1 74  GLN 74  71  71  GLN GLN B . n 
B 1 75  TYR 75  72  72  TYR TYR B . n 
B 1 76  VAL 76  73  73  VAL VAL B . n 
B 1 77  ASP 77  74  74  ASP ASP B . n 
B 1 78  THR 78  75  75  THR THR B . n 
B 1 79  LEU 79  76  76  LEU LEU B . n 
B 1 80  TYR 80  77  77  TYR TYR B . n 
B 1 81  PRO 81  78  78  PRO PRO B . n 
B 1 82  GLY 82  79  79  GLY GLY B . n 
B 1 83  PHE 83  80  80  PHE PHE B . n 
B 1 84  GLU 84  81  81  GLU GLU B . n 
B 1 85  GLY 85  82  82  GLY GLY B . n 
B 1 86  THR 86  83  83  THR THR B . n 
B 1 87  GLU 87  84  84  GLU GLU B . n 
B 1 88  MET 88  85  85  MET MET B . n 
B 1 89  TRP 89  86  86  TRP TRP B . n 
B 1 90  ASN 90  87  87  ASN ASN B . n 
B 1 91  PRO 91  88  88  PRO PRO B . n 
B 1 92  ASN 92  89  89  ASN ASN B . n 
B 1 93  ARG 93  90  90  ARG ARG B . n 
B 1 94  GLU 94  91  91  GLU GLU B . n 
B 1 95  LEU 95  92  92  LEU LEU B . n 
B 1 96  SER 96  93  93  SER SER B . n 
B 1 97  GLU 97  94  94  GLU GLU B . n 
B 1 98  ASP 98  95  95  ASP ASP B . n 
B 1 99  CYS 99  96  96  CYS CYS B . n 
B 1 100 LEU 100 97  97  LEU LEU B . n 
B 1 101 TYR 101 98  98  TYR TYR B . n 
B 1 102 LEU 102 99  99  LEU LEU B . n 
B 1 103 ASN 103 100 100 ASN ASN B . n 
B 1 104 VAL 104 101 101 VAL VAL B . n 
B 1 105 TRP 105 102 102 TRP TRP B . n 
B 1 106 THR 106 103 103 THR THR B . n 
B 1 107 PRO 107 104 104 PRO PRO B . n 
B 1 108 TYR 108 105 105 TYR TYR B . n 
B 1 109 PRO 109 106 106 PRO PRO B . n 
B 1 110 ARG 110 107 107 ARG ARG B . n 
B 1 111 PRO 111 108 108 PRO PRO B . n 
B 1 112 ALA 112 109 109 ALA ALA B . n 
B 1 113 SER 113 110 110 SER SER B . n 
B 1 114 PRO 114 111 111 PRO PRO B . n 
B 1 115 THR 115 112 112 THR THR B . n 
B 1 116 PRO 116 113 113 PRO PRO B . n 
B 1 117 VAL 117 114 114 VAL VAL B . n 
B 1 118 LEU 118 115 115 LEU LEU B . n 
B 1 119 ILE 119 116 116 ILE ILE B . n 
B 1 120 TRP 120 117 117 TRP TRP B . n 
B 1 121 ILE 121 118 118 ILE ILE B . n 
B 1 122 TYR 122 119 119 TYR TYR B . n 
B 1 123 GLY 123 120 120 GLY GLY B . n 
B 1 124 GLY 124 121 121 GLY GLY B . n 
B 1 125 GLY 125 122 122 GLY GLY B . n 
B 1 126 PHE 126 123 123 PHE PHE B . n 
B 1 127 TYR 127 124 124 TYR TYR B . n 
B 1 128 SER 128 125 125 SER SER B . n 
B 1 129 GLY 129 126 126 GLY GLY B . n 
B 1 130 ALA 130 127 127 ALA ALA B . n 
B 1 131 ALA 131 128 128 ALA ALA B . n 
B 1 132 SER 132 129 129 SER SER B . n 
B 1 133 LEU 133 130 130 LEU LEU B . n 
B 1 134 ASP 134 131 131 ASP ASP B . n 
B 1 135 VAL 135 132 132 VAL VAL B . n 
B 1 136 TYR 136 133 133 TYR TYR B . n 
B 1 137 ASP 137 134 134 ASP ASP B . n 
B 1 138 GLY 138 135 135 GLY GLY B . n 
B 1 139 ARG 139 136 136 ARG ARG B . n 
B 1 140 PHE 140 137 137 PHE PHE B . n 
B 1 141 LEU 141 138 138 LEU LEU B . n 
B 1 142 ALA 142 139 139 ALA ALA B . n 
B 1 143 GLN 143 140 140 GLN GLN B . n 
B 1 144 VAL 144 141 141 VAL VAL B . n 
B 1 145 GLU 145 142 142 GLU GLU B . n 
B 1 146 GLY 146 143 143 GLY GLY B . n 
B 1 147 ALA 147 144 144 ALA ALA B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 LEU 149 146 146 LEU LEU B . n 
B 1 150 VAL 150 147 147 VAL VAL B . n 
B 1 151 SER 151 148 148 SER SER B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 ASN 153 150 150 ASN ASN B . n 
B 1 154 TYR 154 151 151 TYR TYR B . n 
B 1 155 ARG 155 152 152 ARG ARG B . n 
B 1 156 VAL 156 153 153 VAL VAL B . n 
B 1 157 GLY 157 154 154 GLY GLY B . n 
B 1 158 THR 158 155 155 THR THR B . n 
B 1 159 PHE 159 156 156 PHE PHE B . n 
B 1 160 GLY 160 157 157 GLY GLY B . n 
B 1 161 PHE 161 158 158 PHE PHE B . n 
B 1 162 LEU 162 159 159 LEU LEU B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 LEU 164 161 161 LEU LEU B . n 
B 1 165 PRO 165 162 162 PRO PRO B . n 
B 1 166 GLY 166 163 163 GLY GLY B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ARG 168 165 165 ARG ARG B . n 
B 1 169 GLU 169 166 166 GLU GLU B . n 
B 1 170 ALA 170 167 167 ALA ALA B . n 
B 1 171 PRO 171 168 168 PRO PRO B . n 
B 1 172 GLY 172 169 169 GLY GLY B . n 
B 1 173 ASN 173 170 170 ASN ASN B . n 
B 1 174 VAL 174 171 171 VAL VAL B . n 
B 1 175 GLY 175 172 172 GLY GLY B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 LEU 177 174 174 LEU LEU B . n 
B 1 178 ASP 178 175 175 ASP ASP B . n 
B 1 179 GLN 179 176 176 GLN GLN B . n 
B 1 180 ARG 180 177 177 ARG ARG B . n 
B 1 181 LEU 181 178 178 LEU LEU B . n 
B 1 182 ALA 182 179 179 ALA ALA B . n 
B 1 183 LEU 183 180 180 LEU LEU B . n 
B 1 184 GLN 184 181 181 GLN GLN B . n 
B 1 185 TRP 185 182 182 TRP TRP B . n 
B 1 186 VAL 186 183 183 VAL VAL B . n 
B 1 187 GLN 187 184 184 GLN GLN B . n 
B 1 188 GLU 188 185 185 GLU GLU B . n 
B 1 189 ASN 189 186 186 ASN ASN B . n 
B 1 190 ILE 190 187 187 ILE ILE B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 GLY 194 191 191 GLY GLY B . n 
B 1 195 GLY 195 192 192 GLY GLY B . n 
B 1 196 ASP 196 193 193 ASP ASP B . n 
B 1 197 PRO 197 194 194 PRO PRO B . n 
B 1 198 MET 198 195 195 MET MET B . n 
B 1 199 SER 199 196 196 SER SER B . n 
B 1 200 VAL 200 197 197 VAL VAL B . n 
B 1 201 THR 201 198 198 THR THR B . n 
B 1 202 LEU 202 199 199 LEU LEU B . n 
B 1 203 PHE 203 200 200 PHE PHE B . n 
B 1 204 GLY 204 201 201 GLY GLY B . n 
B 1 205 GLU 205 202 202 GLU GLU B . n 
B 1 206 SER 206 203 203 SER SER B . n 
B 1 207 ALA 207 204 204 ALA ALA B . n 
B 1 208 GLY 208 205 205 GLY GLY B . n 
B 1 209 ALA 209 206 206 ALA ALA B . n 
B 1 210 ALA 210 207 207 ALA ALA B . n 
B 1 211 SER 211 208 208 SER SER B . n 
B 1 212 VAL 212 209 209 VAL VAL B . n 
B 1 213 GLY 213 210 210 GLY GLY B . n 
B 1 214 MET 214 211 211 MET MET B . n 
B 1 215 HIS 215 212 212 HIS HIS B . n 
B 1 216 ILE 216 213 213 ILE ILE B . n 
B 1 217 LEU 217 214 214 LEU LEU B . n 
B 1 218 SER 218 215 215 SER SER B . n 
B 1 219 LEU 219 216 216 LEU LEU B . n 
B 1 220 PRO 220 217 217 PRO PRO B . n 
B 1 221 SER 221 218 218 SER SER B . n 
B 1 222 ARG 222 219 219 ARG ARG B . n 
B 1 223 SER 223 220 220 SER SER B . n 
B 1 224 LEU 224 221 221 LEU LEU B . n 
B 1 225 PHE 225 222 222 PHE PHE B . n 
B 1 226 HIS 226 223 223 HIS HIS B . n 
B 1 227 ARG 227 224 224 ARG ARG B . n 
B 1 228 ALA 228 225 225 ALA ALA B . n 
B 1 229 VAL 229 226 226 VAL VAL B . n 
B 1 230 LEU 230 227 227 LEU LEU B . n 
B 1 231 GLN 231 228 228 GLN GLN B . n 
B 1 232 SER 232 229 229 SER SER B . n 
B 1 233 GLY 233 230 230 GLY GLY B . n 
B 1 234 THR 234 231 231 THR THR B . n 
B 1 235 PRO 235 232 232 PRO PRO B . n 
B 1 236 ASN 236 233 233 ASN ASN B . n 
B 1 237 GLY 237 234 234 GLY GLY B . n 
B 1 238 PRO 238 235 235 PRO PRO B . n 
B 1 239 TRP 239 236 236 TRP TRP B . n 
B 1 240 ALA 240 237 237 ALA ALA B . n 
B 1 241 THR 241 238 238 THR THR B . n 
B 1 242 VAL 242 239 239 VAL VAL B . n 
B 1 243 SER 243 240 240 SER SER B . n 
B 1 244 ALA 244 241 241 ALA ALA B . n 
B 1 245 GLY 245 242 242 GLY GLY B . n 
B 1 246 GLU 246 243 243 GLU GLU B . n 
B 1 247 ALA 247 244 244 ALA ALA B . n 
B 1 248 ARG 248 245 245 ARG ARG B . n 
B 1 249 ARG 249 246 246 ARG ARG B . n 
B 1 250 ARG 250 247 247 ARG ARG B . n 
B 1 251 ALA 251 248 248 ALA ALA B . n 
B 1 252 THR 252 249 249 THR THR B . n 
B 1 253 LEU 253 250 250 LEU LEU B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 ARG 256 253 253 ARG ARG B . n 
B 1 257 LEU 257 254 254 LEU LEU B . n 
B 1 258 VAL 258 255 255 VAL VAL B . n 
B 1 259 GLY 259 256 256 GLY GLY B . n 
B 1 260 CYS 260 257 257 CYS CYS B . n 
B 1 261 PRO 261 258 258 PRO PRO B . n 
B 1 262 PRO 262 259 ?   ?   ?   B . n 
B 1 263 GLY 263 260 ?   ?   ?   B . n 
B 1 264 GLY 264 261 ?   ?   ?   B . n 
B 1 265 ALA 265 262 ?   ?   ?   B . n 
B 1 266 GLY 266 263 ?   ?   ?   B . n 
B 1 267 GLY 267 264 ?   ?   ?   B . n 
B 1 268 ASN 268 265 265 ASN ASN B . n 
B 1 269 ASP 269 266 266 ASP ASP B . n 
B 1 270 THR 270 267 267 THR THR B . n 
B 1 271 GLU 271 268 268 GLU GLU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 ILE 273 270 270 ILE ILE B . n 
B 1 274 ALA 274 271 271 ALA ALA B . n 
B 1 275 CYS 275 272 272 CYS CYS B . n 
B 1 276 LEU 276 273 273 LEU LEU B . n 
B 1 277 ARG 277 274 274 ARG ARG B . n 
B 1 278 THR 278 275 275 THR THR B . n 
B 1 279 ARG 279 276 276 ARG ARG B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 ALA 281 278 278 ALA ALA B . n 
B 1 282 GLN 282 279 279 GLN GLN B . n 
B 1 283 ASP 283 280 280 ASP ASP B . n 
B 1 284 LEU 284 281 281 LEU LEU B . n 
B 1 285 VAL 285 282 282 VAL VAL B . n 
B 1 286 ASP 286 283 283 ASP ASP B . n 
B 1 287 HIS 287 284 284 HIS HIS B . n 
B 1 288 GLU 288 285 285 GLU GLU B . n 
B 1 289 TRP 289 286 286 TRP TRP B . n 
B 1 290 HIS 290 287 287 HIS HIS B . n 
B 1 291 VAL 291 288 288 VAL VAL B . n 
B 1 292 LEU 292 289 289 LEU LEU B . n 
B 1 293 PRO 293 290 290 PRO PRO B . n 
B 1 294 GLN 294 291 291 GLN GLN B . n 
B 1 295 GLU 295 292 292 GLU GLU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 ILE 297 294 294 ILE ILE B . n 
B 1 298 PHE 298 295 295 PHE PHE B . n 
B 1 299 ARG 299 296 296 ARG ARG B . n 
B 1 300 PHE 300 297 297 PHE PHE B . n 
B 1 301 SER 301 298 298 SER SER B . n 
B 1 302 PHE 302 299 299 PHE PHE B . n 
B 1 303 VAL 303 300 300 VAL VAL B . n 
B 1 304 PRO 304 301 301 PRO PRO B . n 
B 1 305 VAL 305 302 302 VAL VAL B . n 
B 1 306 VAL 306 303 303 VAL VAL B . n 
B 1 307 ASP 307 304 304 ASP ASP B . n 
B 1 308 GLY 308 305 305 GLY GLY B . n 
B 1 309 ASP 309 306 306 ASP ASP B . n 
B 1 310 PHE 310 307 307 PHE PHE B . n 
B 1 311 LEU 311 308 308 LEU LEU B . n 
B 1 312 SER 312 309 309 SER SER B . n 
B 1 313 ASP 313 310 310 ASP ASP B . n 
B 1 314 THR 314 311 311 THR THR B . n 
B 1 315 PRO 315 312 312 PRO PRO B . n 
B 1 316 GLU 316 313 313 GLU GLU B . n 
B 1 317 ALA 317 314 314 ALA ALA B . n 
B 1 318 LEU 318 315 315 LEU LEU B . n 
B 1 319 ILE 319 316 316 ILE ILE B . n 
B 1 320 ASN 320 317 317 ASN ASN B . n 
B 1 321 THR 321 318 318 THR THR B . n 
B 1 322 GLY 322 319 319 GLY GLY B . n 
B 1 323 ASP 323 320 320 ASP ASP B . n 
B 1 324 PHE 324 321 321 PHE PHE B . n 
B 1 325 GLN 325 322 322 GLN GLN B . n 
B 1 326 ASP 326 323 323 ASP ASP B . n 
B 1 327 LEU 327 324 324 LEU LEU B . n 
B 1 328 GLN 328 325 325 GLN GLN B . n 
B 1 329 VAL 329 326 326 VAL VAL B . n 
B 1 330 LEU 330 327 327 LEU LEU B . n 
B 1 331 VAL 331 328 328 VAL VAL B . n 
B 1 332 GLY 332 329 329 GLY GLY B . n 
B 1 333 VAL 333 330 330 VAL VAL B . n 
B 1 334 VAL 334 331 331 VAL VAL B . n 
B 1 335 LYS 335 332 332 LYS LYS B . n 
B 1 336 ASP 336 333 333 ASP ASP B . n 
B 1 337 GLU 337 334 334 GLU GLU B . n 
B 1 338 GLY 338 335 335 GLY GLY B . n 
B 1 339 SER 339 336 336 SER SER B . n 
B 1 340 TYR 340 337 337 TYR TYR B . n 
B 1 341 PHE 341 338 338 PHE PHE B . n 
B 1 342 LEU 342 339 339 LEU LEU B . n 
B 1 343 VAL 343 340 340 VAL VAL B . n 
B 1 344 TYR 344 341 341 TYR TYR B . n 
B 1 345 GLY 345 342 342 GLY GLY B . n 
B 1 346 VAL 346 343 343 VAL VAL B . n 
B 1 347 PRO 347 344 344 PRO PRO B . n 
B 1 348 GLY 348 345 345 GLY GLY B . n 
B 1 349 PHE 349 346 346 PHE PHE B . n 
B 1 350 SER 350 347 347 SER SER B . n 
B 1 351 LYS 351 348 348 LYS LYS B . n 
B 1 352 ASP 352 349 349 ASP ASP B . n 
B 1 353 ASN 353 350 350 ASN ASN B . n 
B 1 354 GLU 354 351 351 GLU GLU B . n 
B 1 355 SER 355 352 352 SER SER B . n 
B 1 356 LEU 356 353 353 LEU LEU B . n 
B 1 357 ILE 357 354 354 ILE ILE B . n 
B 1 358 SER 358 355 355 SER SER B . n 
B 1 359 ARG 359 356 356 ARG ARG B . n 
B 1 360 ALA 360 357 357 ALA ALA B . n 
B 1 361 GLN 361 358 358 GLN GLN B . n 
B 1 362 PHE 362 359 359 PHE PHE B . n 
B 1 363 LEU 363 360 360 LEU LEU B . n 
B 1 364 ALA 364 361 361 ALA ALA B . n 
B 1 365 GLY 365 362 362 GLY GLY B . n 
B 1 366 VAL 366 363 363 VAL VAL B . n 
B 1 367 ARG 367 364 364 ARG ARG B . n 
B 1 368 ILE 368 365 365 ILE ILE B . n 
B 1 369 GLY 369 366 366 GLY GLY B . n 
B 1 370 VAL 370 367 367 VAL VAL B . n 
B 1 371 PRO 371 368 368 PRO PRO B . n 
B 1 372 GLN 372 369 369 GLN GLN B . n 
B 1 373 ALA 373 370 370 ALA ALA B . n 
B 1 374 SER 374 371 371 SER SER B . n 
B 1 375 ASP 375 372 372 ASP ASP B . n 
B 1 376 LEU 376 373 373 LEU LEU B . n 
B 1 377 ALA 377 374 374 ALA ALA B . n 
B 1 378 ALA 378 375 375 ALA ALA B . n 
B 1 379 GLU 379 376 376 GLU GLU B . n 
B 1 380 ALA 380 377 377 ALA ALA B . n 
B 1 381 VAL 381 378 378 VAL VAL B . n 
B 1 382 VAL 382 379 379 VAL VAL B . n 
B 1 383 LEU 383 380 380 LEU LEU B . n 
B 1 384 HIS 384 381 381 HIS HIS B . n 
B 1 385 TYR 385 382 382 TYR TYR B . n 
B 1 386 THR 386 383 383 THR THR B . n 
B 1 387 ASP 387 384 384 ASP ASP B . n 
B 1 388 TRP 388 385 385 TRP TRP B . n 
B 1 389 LEU 389 386 386 LEU LEU B . n 
B 1 390 HIS 390 387 387 HIS HIS B . n 
B 1 391 PRO 391 388 388 PRO PRO B . n 
B 1 392 GLU 392 389 389 GLU GLU B . n 
B 1 393 ASP 393 390 390 ASP ASP B . n 
B 1 394 PRO 394 391 391 PRO PRO B . n 
B 1 395 THR 395 392 392 THR THR B . n 
B 1 396 HIS 396 393 393 HIS HIS B . n 
B 1 397 LEU 397 394 394 LEU LEU B . n 
B 1 398 ARG 398 395 395 ARG ARG B . n 
B 1 399 ASP 399 396 396 ASP ASP B . n 
B 1 400 ALA 400 397 397 ALA ALA B . n 
B 1 401 MET 401 398 398 MET MET B . n 
B 1 402 SER 402 399 399 SER SER B . n 
B 1 403 ALA 403 400 400 ALA ALA B . n 
B 1 404 VAL 404 401 401 VAL VAL B . n 
B 1 405 VAL 405 402 402 VAL VAL B . n 
B 1 406 GLY 406 403 403 GLY GLY B . n 
B 1 407 ASP 407 404 404 ASP ASP B . n 
B 1 408 HIS 408 405 405 HIS HIS B . n 
B 1 409 ASN 409 406 406 ASN ASN B . n 
B 1 410 VAL 410 407 407 VAL VAL B . n 
B 1 411 VAL 411 408 408 VAL VAL B . n 
B 1 412 CYS 412 409 409 CYS CYS B . n 
B 1 413 PRO 413 410 410 PRO PRO B . n 
B 1 414 VAL 414 411 411 VAL VAL B . n 
B 1 415 ALA 415 412 412 ALA ALA B . n 
B 1 416 GLN 416 413 413 GLN GLN B . n 
B 1 417 LEU 417 414 414 LEU LEU B . n 
B 1 418 ALA 418 415 415 ALA ALA B . n 
B 1 419 GLY 419 416 416 GLY GLY B . n 
B 1 420 ARG 420 417 417 ARG ARG B . n 
B 1 421 LEU 421 418 418 LEU LEU B . n 
B 1 422 ALA 422 419 419 ALA ALA B . n 
B 1 423 ALA 423 420 420 ALA ALA B . n 
B 1 424 GLN 424 421 421 GLN GLN B . n 
B 1 425 GLY 425 422 422 GLY GLY B . n 
B 1 426 ALA 426 423 423 ALA ALA B . n 
B 1 427 ARG 427 424 424 ARG ARG B . n 
B 1 428 VAL 428 425 425 VAL VAL B . n 
B 1 429 TYR 429 426 426 TYR TYR B . n 
B 1 430 ALA 430 427 427 ALA ALA B . n 
B 1 431 TYR 431 428 428 TYR TYR B . n 
B 1 432 ILE 432 429 429 ILE ILE B . n 
B 1 433 PHE 433 430 430 PHE PHE B . n 
B 1 434 GLU 434 431 431 GLU GLU B . n 
B 1 435 HIS 435 432 432 HIS HIS B . n 
B 1 436 ARG 436 433 433 ARG ARG B . n 
B 1 437 ALA 437 434 434 ALA ALA B . n 
B 1 438 SER 438 435 435 SER SER B . n 
B 1 439 THR 439 436 436 THR THR B . n 
B 1 440 LEU 440 437 437 LEU LEU B . n 
B 1 441 THR 441 438 438 THR THR B . n 
B 1 442 TRP 442 439 439 TRP TRP B . n 
B 1 443 PRO 443 440 440 PRO PRO B . n 
B 1 444 LEU 444 441 441 LEU LEU B . n 
B 1 445 TRP 445 442 442 TRP TRP B . n 
B 1 446 MET 446 443 443 MET MET B . n 
B 1 447 GLY 447 444 444 GLY GLY B . n 
B 1 448 VAL 448 445 445 VAL VAL B . n 
B 1 449 PRO 449 446 446 PRO PRO B . n 
B 1 450 HIS 450 447 447 HIS HIS B . n 
B 1 451 GLY 451 448 448 GLY GLY B . n 
B 1 452 TYR 452 449 449 TYR TYR B . n 
B 1 453 GLU 453 450 450 GLU GLU B . n 
B 1 454 ILE 454 451 451 ILE ILE B . n 
B 1 455 GLU 455 452 452 GLU GLU B . n 
B 1 456 PHE 456 453 453 PHE PHE B . n 
B 1 457 ILE 457 454 454 ILE ILE B . n 
B 1 458 PHE 458 455 455 PHE PHE B . n 
B 1 459 GLY 459 456 456 GLY GLY B . n 
B 1 460 LEU 460 457 457 LEU LEU B . n 
B 1 461 PRO 461 458 458 PRO PRO B . n 
B 1 462 LEU 462 459 459 LEU LEU B . n 
B 1 463 ASP 463 460 460 ASP ASP B . n 
B 1 464 PRO 464 461 461 PRO PRO B . n 
B 1 465 SER 465 462 462 SER SER B . n 
B 1 466 LEU 466 463 463 LEU LEU B . n 
B 1 467 ASN 467 464 464 ASN ASN B . n 
B 1 468 TYR 468 465 465 TYR TYR B . n 
B 1 469 THR 469 466 466 THR THR B . n 
B 1 470 THR 470 467 467 THR THR B . n 
B 1 471 GLU 471 468 468 GLU GLU B . n 
B 1 472 GLU 472 469 469 GLU GLU B . n 
B 1 473 ARG 473 470 470 ARG ARG B . n 
B 1 474 ILE 474 471 471 ILE ILE B . n 
B 1 475 PHE 475 472 472 PHE PHE B . n 
B 1 476 ALA 476 473 473 ALA ALA B . n 
B 1 477 GLN 477 474 474 GLN GLN B . n 
B 1 478 ARG 478 475 475 ARG ARG B . n 
B 1 479 LEU 479 476 476 LEU LEU B . n 
B 1 480 MET 480 477 477 MET MET B . n 
B 1 481 LYS 481 478 478 LYS LYS B . n 
B 1 482 TYR 482 479 479 TYR TYR B . n 
B 1 483 TRP 483 480 480 TRP TRP B . n 
B 1 484 THR 484 481 481 THR THR B . n 
B 1 485 ASN 485 482 482 ASN ASN B . n 
B 1 486 PHE 486 483 483 PHE PHE B . n 
B 1 487 ALA 487 484 484 ALA ALA B . n 
B 1 488 ARG 488 485 485 ARG ARG B . n 
B 1 489 THR 489 486 486 THR THR B . n 
B 1 490 GLY 490 487 487 GLY GLY B . n 
B 1 491 ASP 491 488 488 ASP ASP B . n 
B 1 492 PRO 492 489 489 PRO PRO B . n 
B 1 493 ASN 493 490 490 ASN ASN B . n 
B 1 494 ASP 494 491 491 ASP ASP B . n 
B 1 495 PRO 495 492 492 PRO PRO B . n 
B 1 496 ARG 496 493 493 ARG ARG B . n 
B 1 497 ASP 497 494 494 ASP ASP B . n 
B 1 498 SER 498 495 ?   ?   ?   B . n 
B 1 499 LYS 499 496 ?   ?   ?   B . n 
B 1 500 SER 500 497 497 SER SER B . n 
B 1 501 PRO 501 498 498 PRO PRO B . n 
B 1 502 GLN 502 499 499 GLN GLN B . n 
B 1 503 TRP 503 500 500 TRP TRP B . n 
B 1 504 PRO 504 501 501 PRO PRO B . n 
B 1 505 PRO 505 502 502 PRO PRO B . n 
B 1 506 TYR 506 503 503 TYR TYR B . n 
B 1 507 THR 507 504 504 THR THR B . n 
B 1 508 THR 508 505 505 THR THR B . n 
B 1 509 ALA 509 506 506 ALA ALA B . n 
B 1 510 ALA 510 507 507 ALA ALA B . n 
B 1 511 GLN 511 508 508 GLN GLN B . n 
B 1 512 GLN 512 509 509 GLN GLN B . n 
B 1 513 TYR 513 510 510 TYR TYR B . n 
B 1 514 VAL 514 511 511 VAL VAL B . n 
B 1 515 SER 515 512 512 SER SER B . n 
B 1 516 LEU 516 513 513 LEU LEU B . n 
B 1 517 ASN 517 514 514 ASN ASN B . n 
B 1 518 LEU 518 515 515 LEU LEU B . n 
B 1 519 LYS 519 516 516 LYS LYS B . n 
B 1 520 PRO 520 517 517 PRO PRO B . n 
B 1 521 LEU 521 518 518 LEU LEU B . n 
B 1 522 GLU 522 519 519 GLU GLU B . n 
B 1 523 VAL 523 520 520 VAL VAL B . n 
B 1 524 ARG 524 521 521 ARG ARG B . n 
B 1 525 ARG 525 522 522 ARG ARG B . n 
B 1 526 GLY 526 523 523 GLY GLY B . n 
B 1 527 LEU 527 524 524 LEU LEU B . n 
B 1 528 ARG 528 525 525 ARG ARG B . n 
B 1 529 ALA 529 526 526 ALA ALA B . n 
B 1 530 GLN 530 527 527 GLN GLN B . n 
B 1 531 THR 531 528 528 THR THR B . n 
B 1 532 CYS 532 529 529 CYS CYS B . n 
B 1 533 ALA 533 530 530 ALA ALA B . n 
B 1 534 PHE 534 531 531 PHE PHE B . n 
B 1 535 TRP 535 532 532 TRP TRP B . n 
B 1 536 ASN 536 533 533 ASN ASN B . n 
B 1 537 ARG 537 534 534 ARG ARG B . n 
B 1 538 PHE 538 535 535 PHE PHE B . n 
B 1 539 LEU 539 536 536 LEU LEU B . n 
B 1 540 PRO 540 537 537 PRO PRO B . n 
B 1 541 LYS 541 538 538 LYS LYS B . n 
B 1 542 LEU 542 539 539 LEU LEU B . n 
B 1 543 LEU 543 540 540 LEU LEU B . n 
B 1 544 SER 544 541 ?   ?   ?   B . n 
B 1 545 ALA 545 542 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   601 551 HOH HOH A . 
C 2 HOH 2   602 439 HOH HOH A . 
C 2 HOH 3   603 540 HOH HOH A . 
C 2 HOH 4   604 105 HOH HOH A . 
C 2 HOH 5   605 556 HOH HOH A . 
C 2 HOH 6   606 582 HOH HOH A . 
C 2 HOH 7   607 443 HOH HOH A . 
C 2 HOH 8   608 216 HOH HOH A . 
C 2 HOH 9   609 397 HOH HOH A . 
C 2 HOH 10  610 38  HOH HOH A . 
C 2 HOH 11  611 472 HOH HOH A . 
C 2 HOH 12  612 102 HOH HOH A . 
C 2 HOH 13  613 468 HOH HOH A . 
C 2 HOH 14  614 318 HOH HOH A . 
C 2 HOH 15  615 224 HOH HOH A . 
C 2 HOH 16  616 543 HOH HOH A . 
C 2 HOH 17  617 108 HOH HOH A . 
C 2 HOH 18  618 229 HOH HOH A . 
C 2 HOH 19  619 475 HOH HOH A . 
C 2 HOH 20  620 418 HOH HOH A . 
C 2 HOH 21  621 456 HOH HOH A . 
C 2 HOH 22  622 529 HOH HOH A . 
C 2 HOH 23  623 10  HOH HOH A . 
C 2 HOH 24  624 330 HOH HOH A . 
C 2 HOH 25  625 522 HOH HOH A . 
C 2 HOH 26  626 467 HOH HOH A . 
C 2 HOH 27  627 575 HOH HOH A . 
C 2 HOH 28  628 188 HOH HOH A . 
C 2 HOH 29  629 20  HOH HOH A . 
C 2 HOH 30  630 203 HOH HOH A . 
C 2 HOH 31  631 49  HOH HOH A . 
C 2 HOH 32  632 255 HOH HOH A . 
C 2 HOH 33  633 29  HOH HOH A . 
C 2 HOH 34  634 434 HOH HOH A . 
C 2 HOH 35  635 516 HOH HOH A . 
C 2 HOH 36  636 337 HOH HOH A . 
C 2 HOH 37  637 155 HOH HOH A . 
C 2 HOH 38  638 112 HOH HOH A . 
C 2 HOH 39  639 84  HOH HOH A . 
C 2 HOH 40  640 157 HOH HOH A . 
C 2 HOH 41  641 71  HOH HOH A . 
C 2 HOH 42  642 258 HOH HOH A . 
C 2 HOH 43  643 478 HOH HOH A . 
C 2 HOH 44  644 466 HOH HOH A . 
C 2 HOH 45  645 42  HOH HOH A . 
C 2 HOH 46  646 244 HOH HOH A . 
C 2 HOH 47  647 554 HOH HOH A . 
C 2 HOH 48  648 3   HOH HOH A . 
C 2 HOH 49  649 302 HOH HOH A . 
C 2 HOH 50  650 40  HOH HOH A . 
C 2 HOH 51  651 552 HOH HOH A . 
C 2 HOH 52  652 131 HOH HOH A . 
C 2 HOH 53  653 250 HOH HOH A . 
C 2 HOH 54  654 65  HOH HOH A . 
C 2 HOH 55  655 256 HOH HOH A . 
C 2 HOH 56  656 64  HOH HOH A . 
C 2 HOH 57  657 315 HOH HOH A . 
C 2 HOH 58  658 145 HOH HOH A . 
C 2 HOH 59  659 479 HOH HOH A . 
C 2 HOH 60  660 140 HOH HOH A . 
C 2 HOH 61  661 146 HOH HOH A . 
C 2 HOH 62  662 128 HOH HOH A . 
C 2 HOH 63  663 122 HOH HOH A . 
C 2 HOH 64  664 272 HOH HOH A . 
C 2 HOH 65  665 124 HOH HOH A . 
C 2 HOH 66  666 462 HOH HOH A . 
C 2 HOH 67  667 553 HOH HOH A . 
C 2 HOH 68  668 299 HOH HOH A . 
C 2 HOH 69  669 186 HOH HOH A . 
C 2 HOH 70  670 295 HOH HOH A . 
C 2 HOH 71  671 202 HOH HOH A . 
C 2 HOH 72  672 129 HOH HOH A . 
C 2 HOH 73  673 138 HOH HOH A . 
C 2 HOH 74  674 248 HOH HOH A . 
C 2 HOH 75  675 23  HOH HOH A . 
C 2 HOH 76  676 449 HOH HOH A . 
C 2 HOH 77  677 159 HOH HOH A . 
C 2 HOH 78  678 279 HOH HOH A . 
C 2 HOH 79  679 276 HOH HOH A . 
C 2 HOH 80  680 121 HOH HOH A . 
C 2 HOH 81  681 184 HOH HOH A . 
C 2 HOH 82  682 465 HOH HOH A . 
C 2 HOH 83  683 201 HOH HOH A . 
C 2 HOH 84  684 126 HOH HOH A . 
C 2 HOH 85  685 259 HOH HOH A . 
C 2 HOH 86  686 474 HOH HOH A . 
C 2 HOH 87  687 531 HOH HOH A . 
C 2 HOH 88  688 301 HOH HOH A . 
C 2 HOH 89  689 139 HOH HOH A . 
C 2 HOH 90  690 269 HOH HOH A . 
C 2 HOH 91  691 55  HOH HOH A . 
C 2 HOH 92  692 67  HOH HOH A . 
C 2 HOH 93  693 198 HOH HOH A . 
C 2 HOH 94  694 600 HOH HOH A . 
C 2 HOH 95  695 334 HOH HOH A . 
C 2 HOH 96  696 312 HOH HOH A . 
C 2 HOH 97  697 268 HOH HOH A . 
C 2 HOH 98  698 119 HOH HOH A . 
C 2 HOH 99  699 27  HOH HOH A . 
C 2 HOH 100 700 262 HOH HOH A . 
C 2 HOH 101 701 21  HOH HOH A . 
C 2 HOH 102 702 25  HOH HOH A . 
C 2 HOH 103 703 217 HOH HOH A . 
C 2 HOH 104 704 528 HOH HOH A . 
C 2 HOH 105 705 136 HOH HOH A . 
C 2 HOH 106 706 494 HOH HOH A . 
C 2 HOH 107 707 327 HOH HOH A . 
C 2 HOH 108 708 331 HOH HOH A . 
C 2 HOH 109 709 523 HOH HOH A . 
C 2 HOH 110 710 97  HOH HOH A . 
C 2 HOH 111 711 493 HOH HOH A . 
C 2 HOH 112 712 297 HOH HOH A . 
C 2 HOH 113 713 230 HOH HOH A . 
C 2 HOH 114 714 107 HOH HOH A . 
C 2 HOH 115 715 16  HOH HOH A . 
C 2 HOH 116 716 114 HOH HOH A . 
C 2 HOH 117 717 407 HOH HOH A . 
C 2 HOH 118 718 335 HOH HOH A . 
C 2 HOH 119 719 101 HOH HOH A . 
C 2 HOH 120 720 206 HOH HOH A . 
C 2 HOH 121 721 174 HOH HOH A . 
C 2 HOH 122 722 291 HOH HOH A . 
C 2 HOH 123 723 8   HOH HOH A . 
C 2 HOH 124 724 28  HOH HOH A . 
C 2 HOH 125 725 6   HOH HOH A . 
C 2 HOH 126 726 86  HOH HOH A . 
C 2 HOH 127 727 144 HOH HOH A . 
C 2 HOH 128 728 242 HOH HOH A . 
C 2 HOH 129 729 223 HOH HOH A . 
C 2 HOH 130 730 214 HOH HOH A . 
C 2 HOH 131 731 83  HOH HOH A . 
C 2 HOH 132 732 491 HOH HOH A . 
C 2 HOH 133 733 45  HOH HOH A . 
C 2 HOH 134 734 68  HOH HOH A . 
C 2 HOH 135 735 116 HOH HOH A . 
C 2 HOH 136 736 584 HOH HOH A . 
C 2 HOH 137 737 310 HOH HOH A . 
C 2 HOH 138 738 74  HOH HOH A . 
C 2 HOH 139 739 24  HOH HOH A . 
C 2 HOH 140 740 36  HOH HOH A . 
C 2 HOH 141 741 464 HOH HOH A . 
C 2 HOH 142 742 293 HOH HOH A . 
C 2 HOH 143 743 50  HOH HOH A . 
C 2 HOH 144 744 33  HOH HOH A . 
C 2 HOH 145 745 521 HOH HOH A . 
C 2 HOH 146 746 47  HOH HOH A . 
C 2 HOH 147 747 238 HOH HOH A . 
C 2 HOH 148 748 69  HOH HOH A . 
C 2 HOH 149 749 104 HOH HOH A . 
C 2 HOH 150 750 212 HOH HOH A . 
C 2 HOH 151 751 53  HOH HOH A . 
C 2 HOH 152 752 82  HOH HOH A . 
C 2 HOH 153 753 90  HOH HOH A . 
C 2 HOH 154 754 173 HOH HOH A . 
C 2 HOH 155 755 451 HOH HOH A . 
C 2 HOH 156 756 127 HOH HOH A . 
C 2 HOH 157 757 81  HOH HOH A . 
C 2 HOH 158 758 286 HOH HOH A . 
C 2 HOH 159 759 9   HOH HOH A . 
C 2 HOH 160 760 448 HOH HOH A . 
C 2 HOH 161 761 461 HOH HOH A . 
C 2 HOH 162 762 424 HOH HOH A . 
C 2 HOH 163 763 266 HOH HOH A . 
C 2 HOH 164 764 205 HOH HOH A . 
C 2 HOH 165 765 94  HOH HOH A . 
C 2 HOH 166 766 270 HOH HOH A . 
C 2 HOH 167 767 130 HOH HOH A . 
C 2 HOH 168 768 304 HOH HOH A . 
C 2 HOH 169 769 60  HOH HOH A . 
C 2 HOH 170 770 594 HOH HOH A . 
C 2 HOH 171 771 179 HOH HOH A . 
C 2 HOH 172 772 298 HOH HOH A . 
C 2 HOH 173 773 44  HOH HOH A . 
C 2 HOH 174 774 277 HOH HOH A . 
C 2 HOH 175 775 450 HOH HOH A . 
C 2 HOH 176 776 78  HOH HOH A . 
C 2 HOH 177 777 294 HOH HOH A . 
C 2 HOH 178 778 4   HOH HOH A . 
C 2 HOH 179 779 517 HOH HOH A . 
C 2 HOH 180 780 226 HOH HOH A . 
C 2 HOH 181 781 386 HOH HOH A . 
C 2 HOH 182 782 526 HOH HOH A . 
C 2 HOH 183 783 538 HOH HOH A . 
C 2 HOH 184 784 17  HOH HOH A . 
C 2 HOH 185 785 109 HOH HOH A . 
C 2 HOH 186 786 18  HOH HOH A . 
C 2 HOH 187 787 182 HOH HOH A . 
C 2 HOH 188 788 39  HOH HOH A . 
C 2 HOH 189 789 113 HOH HOH A . 
C 2 HOH 190 790 263 HOH HOH A . 
C 2 HOH 191 791 75  HOH HOH A . 
C 2 HOH 192 792 237 HOH HOH A . 
C 2 HOH 193 793 132 HOH HOH A . 
C 2 HOH 194 794 197 HOH HOH A . 
C 2 HOH 195 795 442 HOH HOH A . 
C 2 HOH 196 796 193 HOH HOH A . 
C 2 HOH 197 797 79  HOH HOH A . 
C 2 HOH 198 798 215 HOH HOH A . 
C 2 HOH 199 799 307 HOH HOH A . 
C 2 HOH 200 800 599 HOH HOH A . 
C 2 HOH 201 801 190 HOH HOH A . 
C 2 HOH 202 802 176 HOH HOH A . 
C 2 HOH 203 803 220 HOH HOH A . 
C 2 HOH 204 804 154 HOH HOH A . 
C 2 HOH 205 805 199 HOH HOH A . 
C 2 HOH 206 806 252 HOH HOH A . 
C 2 HOH 207 807 31  HOH HOH A . 
C 2 HOH 208 808 437 HOH HOH A . 
C 2 HOH 209 809 358 HOH HOH A . 
C 2 HOH 210 810 95  HOH HOH A . 
C 2 HOH 211 811 13  HOH HOH A . 
C 2 HOH 212 812 150 HOH HOH A . 
C 2 HOH 213 813 476 HOH HOH A . 
C 2 HOH 214 814 80  HOH HOH A . 
C 2 HOH 215 815 515 HOH HOH A . 
C 2 HOH 216 816 463 HOH HOH A . 
C 2 HOH 217 817 22  HOH HOH A . 
C 2 HOH 218 818 410 HOH HOH A . 
C 2 HOH 219 819 395 HOH HOH A . 
C 2 HOH 220 820 192 HOH HOH A . 
C 2 HOH 221 821 59  HOH HOH A . 
C 2 HOH 222 822 62  HOH HOH A . 
C 2 HOH 223 823 183 HOH HOH A . 
C 2 HOH 224 824 261 HOH HOH A . 
C 2 HOH 225 825 41  HOH HOH A . 
C 2 HOH 226 826 555 HOH HOH A . 
C 2 HOH 227 827 149 HOH HOH A . 
C 2 HOH 228 828 111 HOH HOH A . 
C 2 HOH 229 829 46  HOH HOH A . 
C 2 HOH 230 830 195 HOH HOH A . 
C 2 HOH 231 831 477 HOH HOH A . 
C 2 HOH 232 832 288 HOH HOH A . 
C 2 HOH 233 833 588 HOH HOH A . 
C 2 HOH 234 834 227 HOH HOH A . 
C 2 HOH 235 835 480 HOH HOH A . 
C 2 HOH 236 836 235 HOH HOH A . 
C 2 HOH 237 837 141 HOH HOH A . 
C 2 HOH 238 838 123 HOH HOH A . 
C 2 HOH 239 839 306 HOH HOH A . 
C 2 HOH 240 840 455 HOH HOH A . 
C 2 HOH 241 841 185 HOH HOH A . 
C 2 HOH 242 842 1   HOH HOH A . 
C 2 HOH 243 843 425 HOH HOH A . 
C 2 HOH 244 844 520 HOH HOH A . 
C 2 HOH 245 845 401 HOH HOH A . 
C 2 HOH 246 846 382 HOH HOH A . 
C 2 HOH 247 847 12  HOH HOH A . 
C 2 HOH 248 848 546 HOH HOH A . 
C 2 HOH 249 849 63  HOH HOH A . 
C 2 HOH 250 850 601 HOH HOH A . 
C 2 HOH 251 851 433 HOH HOH A . 
C 2 HOH 252 852 231 HOH HOH A . 
C 2 HOH 253 853 163 HOH HOH A . 
C 2 HOH 254 854 559 HOH HOH A . 
C 2 HOH 255 855 482 HOH HOH A . 
C 2 HOH 256 856 222 HOH HOH A . 
C 2 HOH 257 857 405 HOH HOH A . 
C 2 HOH 258 858 440 HOH HOH A . 
C 2 HOH 259 859 409 HOH HOH A . 
C 2 HOH 260 860 471 HOH HOH A . 
C 2 HOH 261 861 415 HOH HOH A . 
C 2 HOH 262 862 454 HOH HOH A . 
C 2 HOH 263 863 380 HOH HOH A . 
C 2 HOH 264 864 530 HOH HOH A . 
C 2 HOH 265 865 447 HOH HOH A . 
C 2 HOH 266 866 473 HOH HOH A . 
C 2 HOH 267 867 88  HOH HOH A . 
C 2 HOH 268 868 438 HOH HOH A . 
C 2 HOH 269 869 432 HOH HOH A . 
C 2 HOH 270 870 389 HOH HOH A . 
C 2 HOH 271 871 445 HOH HOH A . 
C 2 HOH 272 872 178 HOH HOH A . 
C 2 HOH 273 873 547 HOH HOH A . 
C 2 HOH 274 874 416 HOH HOH A . 
C 2 HOH 275 875 383 HOH HOH A . 
C 2 HOH 276 876 481 HOH HOH A . 
C 2 HOH 277 877 524 HOH HOH A . 
C 2 HOH 278 878 595 HOH HOH A . 
C 2 HOH 279 879 444 HOH HOH A . 
C 2 HOH 280 880 431 HOH HOH A . 
D 2 HOH 1   601 504 HOH HOH B . 
D 2 HOH 2   602 518 HOH HOH B . 
D 2 HOH 3   603 426 HOH HOH B . 
D 2 HOH 4   604 597 HOH HOH B . 
D 2 HOH 5   605 484 HOH HOH B . 
D 2 HOH 6   606 191 HOH HOH B . 
D 2 HOH 7   607 470 HOH HOH B . 
D 2 HOH 8   608 271 HOH HOH B . 
D 2 HOH 9   609 240 HOH HOH B . 
D 2 HOH 10  610 497 HOH HOH B . 
D 2 HOH 11  611 578 HOH HOH B . 
D 2 HOH 12  612 340 HOH HOH B . 
D 2 HOH 13  613 539 HOH HOH B . 
D 2 HOH 14  614 241 HOH HOH B . 
D 2 HOH 15  615 535 HOH HOH B . 
D 2 HOH 16  616 35  HOH HOH B . 
D 2 HOH 17  617 300 HOH HOH B . 
D 2 HOH 18  618 548 HOH HOH B . 
D 2 HOH 19  619 564 HOH HOH B . 
D 2 HOH 20  620 533 HOH HOH B . 
D 2 HOH 21  621 419 HOH HOH B . 
D 2 HOH 22  622 459 HOH HOH B . 
D 2 HOH 23  623 26  HOH HOH B . 
D 2 HOH 24  624 585 HOH HOH B . 
D 2 HOH 25  625 194 HOH HOH B . 
D 2 HOH 26  626 565 HOH HOH B . 
D 2 HOH 27  627 421 HOH HOH B . 
D 2 HOH 28  628 254 HOH HOH B . 
D 2 HOH 29  629 30  HOH HOH B . 
D 2 HOH 30  630 257 HOH HOH B . 
D 2 HOH 31  631 568 HOH HOH B . 
D 2 HOH 32  632 436 HOH HOH B . 
D 2 HOH 33  633 99  HOH HOH B . 
D 2 HOH 34  634 117 HOH HOH B . 
D 2 HOH 35  635 61  HOH HOH B . 
D 2 HOH 36  636 573 HOH HOH B . 
D 2 HOH 37  637 542 HOH HOH B . 
D 2 HOH 38  638 34  HOH HOH B . 
D 2 HOH 39  639 502 HOH HOH B . 
D 2 HOH 40  640 346 HOH HOH B . 
D 2 HOH 41  641 110 HOH HOH B . 
D 2 HOH 42  642 586 HOH HOH B . 
D 2 HOH 43  643 115 HOH HOH B . 
D 2 HOH 44  644 514 HOH HOH B . 
D 2 HOH 45  645 572 HOH HOH B . 
D 2 HOH 46  646 285 HOH HOH B . 
D 2 HOH 47  647 76  HOH HOH B . 
D 2 HOH 48  648 219 HOH HOH B . 
D 2 HOH 49  649 570 HOH HOH B . 
D 2 HOH 50  650 251 HOH HOH B . 
D 2 HOH 51  651 328 HOH HOH B . 
D 2 HOH 52  652 303 HOH HOH B . 
D 2 HOH 53  653 510 HOH HOH B . 
D 2 HOH 54  654 87  HOH HOH B . 
D 2 HOH 55  655 532 HOH HOH B . 
D 2 HOH 56  656 489 HOH HOH B . 
D 2 HOH 57  657 77  HOH HOH B . 
D 2 HOH 58  658 66  HOH HOH B . 
D 2 HOH 59  659 602 HOH HOH B . 
D 2 HOH 60  660 143 HOH HOH B . 
D 2 HOH 61  661 58  HOH HOH B . 
D 2 HOH 62  662 469 HOH HOH B . 
D 2 HOH 63  663 495 HOH HOH B . 
D 2 HOH 64  664 37  HOH HOH B . 
D 2 HOH 65  665 576 HOH HOH B . 
D 2 HOH 66  666 587 HOH HOH B . 
D 2 HOH 67  667 329 HOH HOH B . 
D 2 HOH 68  668 583 HOH HOH B . 
D 2 HOH 69  669 51  HOH HOH B . 
D 2 HOH 70  670 569 HOH HOH B . 
D 2 HOH 71  671 460 HOH HOH B . 
D 2 HOH 72  672 166 HOH HOH B . 
D 2 HOH 73  673 341 HOH HOH B . 
D 2 HOH 74  674 177 HOH HOH B . 
D 2 HOH 75  675 260 HOH HOH B . 
D 2 HOH 76  676 333 HOH HOH B . 
D 2 HOH 77  677 402 HOH HOH B . 
D 2 HOH 78  678 171 HOH HOH B . 
D 2 HOH 79  679 96  HOH HOH B . 
D 2 HOH 80  680 5   HOH HOH B . 
D 2 HOH 81  681 52  HOH HOH B . 
D 2 HOH 82  682 423 HOH HOH B . 
D 2 HOH 83  683 239 HOH HOH B . 
D 2 HOH 84  684 492 HOH HOH B . 
D 2 HOH 85  685 196 HOH HOH B . 
D 2 HOH 86  686 289 HOH HOH B . 
D 2 HOH 87  687 422 HOH HOH B . 
D 2 HOH 88  688 48  HOH HOH B . 
D 2 HOH 89  689 509 HOH HOH B . 
D 2 HOH 90  690 265 HOH HOH B . 
D 2 HOH 91  691 513 HOH HOH B . 
D 2 HOH 92  692 11  HOH HOH B . 
D 2 HOH 93  693 175 HOH HOH B . 
D 2 HOH 94  694 103 HOH HOH B . 
D 2 HOH 95  695 125 HOH HOH B . 
D 2 HOH 96  696 207 HOH HOH B . 
D 2 HOH 97  697 148 HOH HOH B . 
D 2 HOH 98  698 498 HOH HOH B . 
D 2 HOH 99  699 577 HOH HOH B . 
D 2 HOH 100 700 180 HOH HOH B . 
D 2 HOH 101 701 603 HOH HOH B . 
D 2 HOH 102 702 208 HOH HOH B . 
D 2 HOH 103 703 561 HOH HOH B . 
D 2 HOH 104 704 106 HOH HOH B . 
D 2 HOH 105 705 236 HOH HOH B . 
D 2 HOH 106 706 541 HOH HOH B . 
D 2 HOH 107 707 398 HOH HOH B . 
D 2 HOH 108 708 246 HOH HOH B . 
D 2 HOH 109 709 566 HOH HOH B . 
D 2 HOH 110 710 273 HOH HOH B . 
D 2 HOH 111 711 253 HOH HOH B . 
D 2 HOH 112 712 283 HOH HOH B . 
D 2 HOH 113 713 19  HOH HOH B . 
D 2 HOH 114 714 309 HOH HOH B . 
D 2 HOH 115 715 210 HOH HOH B . 
D 2 HOH 116 716 488 HOH HOH B . 
D 2 HOH 117 717 181 HOH HOH B . 
D 2 HOH 118 718 557 HOH HOH B . 
D 2 HOH 119 719 598 HOH HOH B . 
D 2 HOH 120 720 591 HOH HOH B . 
D 2 HOH 121 721 137 HOH HOH B . 
D 2 HOH 122 722 387 HOH HOH B . 
D 2 HOH 123 723 452 HOH HOH B . 
D 2 HOH 124 724 400 HOH HOH B . 
D 2 HOH 125 725 370 HOH HOH B . 
D 2 HOH 126 726 120 HOH HOH B . 
D 2 HOH 127 727 165 HOH HOH B . 
D 2 HOH 128 728 32  HOH HOH B . 
D 2 HOH 129 729 435 HOH HOH B . 
D 2 HOH 130 730 161 HOH HOH B . 
D 2 HOH 131 731 133 HOH HOH B . 
D 2 HOH 132 732 399 HOH HOH B . 
D 2 HOH 133 733 135 HOH HOH B . 
D 2 HOH 134 734 218 HOH HOH B . 
D 2 HOH 135 735 545 HOH HOH B . 
D 2 HOH 136 736 249 HOH HOH B . 
D 2 HOH 137 737 170 HOH HOH B . 
D 2 HOH 138 738 503 HOH HOH B . 
D 2 HOH 139 739 172 HOH HOH B . 
D 2 HOH 140 740 563 HOH HOH B . 
D 2 HOH 141 741 284 HOH HOH B . 
D 2 HOH 142 742 596 HOH HOH B . 
D 2 HOH 143 743 245 HOH HOH B . 
D 2 HOH 144 744 14  HOH HOH B . 
D 2 HOH 145 745 247 HOH HOH B . 
D 2 HOH 146 746 43  HOH HOH B . 
D 2 HOH 147 747 487 HOH HOH B . 
D 2 HOH 148 748 446 HOH HOH B . 
D 2 HOH 149 749 167 HOH HOH B . 
D 2 HOH 150 750 189 HOH HOH B . 
D 2 HOH 151 751 413 HOH HOH B . 
D 2 HOH 152 752 93  HOH HOH B . 
D 2 HOH 153 753 57  HOH HOH B . 
D 2 HOH 154 754 290 HOH HOH B . 
D 2 HOH 155 755 152 HOH HOH B . 
D 2 HOH 156 756 574 HOH HOH B . 
D 2 HOH 157 757 134 HOH HOH B . 
D 2 HOH 158 758 571 HOH HOH B . 
D 2 HOH 159 759 536 HOH HOH B . 
D 2 HOH 160 760 54  HOH HOH B . 
D 2 HOH 161 761 605 HOH HOH B . 
D 2 HOH 162 762 213 HOH HOH B . 
D 2 HOH 163 763 233 HOH HOH B . 
D 2 HOH 164 764 534 HOH HOH B . 
D 2 HOH 165 765 356 HOH HOH B . 
D 2 HOH 166 766 496 HOH HOH B . 
D 2 HOH 167 767 232 HOH HOH B . 
D 2 HOH 168 768 91  HOH HOH B . 
D 2 HOH 169 769 390 HOH HOH B . 
D 2 HOH 170 770 221 HOH HOH B . 
D 2 HOH 171 771 403 HOH HOH B . 
D 2 HOH 172 772 89  HOH HOH B . 
D 2 HOH 173 773 311 HOH HOH B . 
D 2 HOH 174 774 592 HOH HOH B . 
D 2 HOH 175 775 287 HOH HOH B . 
D 2 HOH 176 776 296 HOH HOH B . 
D 2 HOH 177 777 500 HOH HOH B . 
D 2 HOH 178 778 345 HOH HOH B . 
D 2 HOH 179 779 562 HOH HOH B . 
D 2 HOH 180 780 164 HOH HOH B . 
D 2 HOH 181 781 430 HOH HOH B . 
D 2 HOH 182 782 453 HOH HOH B . 
D 2 HOH 183 783 73  HOH HOH B . 
D 2 HOH 184 784 234 HOH HOH B . 
D 2 HOH 185 785 411 HOH HOH B . 
D 2 HOH 186 786 162 HOH HOH B . 
D 2 HOH 187 787 264 HOH HOH B . 
D 2 HOH 188 788 100 HOH HOH B . 
D 2 HOH 189 789 458 HOH HOH B . 
D 2 HOH 190 790 544 HOH HOH B . 
D 2 HOH 191 791 490 HOH HOH B . 
D 2 HOH 192 792 56  HOH HOH B . 
D 2 HOH 193 793 604 HOH HOH B . 
D 2 HOH 194 794 85  HOH HOH B . 
D 2 HOH 195 795 589 HOH HOH B . 
D 2 HOH 196 796 187 HOH HOH B . 
D 2 HOH 197 797 142 HOH HOH B . 
D 2 HOH 198 798 160 HOH HOH B . 
D 2 HOH 199 799 406 HOH HOH B . 
D 2 HOH 200 800 549 HOH HOH B . 
D 2 HOH 201 801 243 HOH HOH B . 
D 2 HOH 202 802 412 HOH HOH B . 
D 2 HOH 203 803 339 HOH HOH B . 
D 2 HOH 204 804 2   HOH HOH B . 
D 2 HOH 205 805 567 HOH HOH B . 
D 2 HOH 206 806 98  HOH HOH B . 
D 2 HOH 207 807 118 HOH HOH B . 
D 2 HOH 208 808 274 HOH HOH B . 
D 2 HOH 209 809 441 HOH HOH B . 
D 2 HOH 210 810 499 HOH HOH B . 
D 2 HOH 211 811 593 HOH HOH B . 
D 2 HOH 212 812 525 HOH HOH B . 
D 2 HOH 213 813 511 HOH HOH B . 
D 2 HOH 214 814 550 HOH HOH B . 
D 2 HOH 215 815 527 HOH HOH B . 
D 2 HOH 216 816 151 HOH HOH B . 
D 2 HOH 217 817 512 HOH HOH B . 
D 2 HOH 218 818 384 HOH HOH B . 
D 2 HOH 219 819 15  HOH HOH B . 
D 2 HOH 220 820 519 HOH HOH B . 
D 2 HOH 221 821 507 HOH HOH B . 
D 2 HOH 222 822 508 HOH HOH B . 
D 2 HOH 223 823 485 HOH HOH B . 
D 2 HOH 224 824 483 HOH HOH B . 
D 2 HOH 225 825 404 HOH HOH B . 
D 2 HOH 226 826 558 HOH HOH B . 
D 2 HOH 227 827 580 HOH HOH B . 
D 2 HOH 228 828 537 HOH HOH B . 
D 2 HOH 229 829 457 HOH HOH B . 
D 2 HOH 230 830 408 HOH HOH B . 
D 2 HOH 231 831 506 HOH HOH B . 
D 2 HOH 232 832 396 HOH HOH B . 
D 2 HOH 233 833 560 HOH HOH B . 
D 2 HOH 234 834 420 HOH HOH B . 
D 2 HOH 235 835 336 HOH HOH B . 
D 2 HOH 236 836 486 HOH HOH B . 
D 2 HOH 237 837 414 HOH HOH B . 
D 2 HOH 238 838 417 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1880  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  38730 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-10-21 
2 'Structure model' 1 1 2015-11-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Source and taxonomy' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1685 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     5 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        6 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        7 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    THR 
_pdbx_validate_symm_contact.auth_seq_id_1     63 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NH2 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    ARG 
_pdbx_validate_symm_contact.auth_seq_id_2     493 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_445 
_pdbx_validate_symm_contact.dist              2.05 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 74.41   -6.33   
2  1 SER A 203 ? ? 59.60   -120.14 
3  1 ASP A 306 ? ? -127.79 -85.69  
4  1 VAL A 407 ? ? -130.54 -58.60  
5  1 HIS A 447 ? ? -38.49  117.20  
6  1 ASP A 494 ? ? -111.39 73.67   
7  1 SER A 541 ? ? -161.24 99.24   
8  1 PHE B 47  ? ? 74.64   -4.54   
9  1 SER B 203 ? ? 54.49   -120.49 
10 1 ASP B 306 ? ? -124.20 -84.73  
11 1 VAL B 407 ? ? -127.68 -61.07  
12 1 HIS B 447 ? ? -39.78  115.87  
13 1 ASN B 464 ? ? 26.76   63.91   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 259 ? A PRO 262 
2  1 Y 1 A GLY 260 ? A GLY 263 
3  1 Y 1 A GLY 261 ? A GLY 264 
4  1 Y 1 A ALA 262 ? A ALA 265 
5  1 Y 1 A GLY 263 ? A GLY 266 
6  1 Y 1 A GLY 264 ? A GLY 267 
7  1 Y 1 B ASP -2  ? B ASP 1   
8  1 Y 1 B PRO -1  ? B PRO 2   
9  1 Y 1 B MET 0   ? B MET 3   
10 1 Y 1 B GLU 1   ? B GLU 4   
11 1 Y 1 B GLY 2   ? B GLY 5   
12 1 Y 1 B ARG 3   ? B ARG 6   
13 1 Y 1 B PRO 259 ? B PRO 262 
14 1 Y 1 B GLY 260 ? B GLY 263 
15 1 Y 1 B GLY 261 ? B GLY 264 
16 1 Y 1 B ALA 262 ? B ALA 265 
17 1 Y 1 B GLY 263 ? B GLY 266 
18 1 Y 1 B GLY 264 ? B GLY 267 
19 1 Y 1 B SER 495 ? B SER 498 
20 1 Y 1 B LYS 496 ? B LYS 499 
21 1 Y 1 B SER 541 ? B SER 544 
22 1 Y 1 B ALA 542 ? B ALA 545 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#