data_5E1M
# 
_entry.id   5E1M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5E1M         
WWPDB D_1000214177 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5E1D unspecified 
PDB . 5E2A unspecified 
PDB . 5E1O unspecified 
PDB . 5E2B unspecified 
PDB . 5E1B unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5E1M 
_pdbx_database_status.recvd_initial_deposition_date   2015-09-29 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dong, C.'                             1 
'Tempel, W.'                           2 
'Bountra, C.'                          3 
'Arrowsmith, C.H.'                     4 
'Edwards, A.M.'                        5 
'Min, J.'                              6 
'Structural Genomics Consortium (SGC)' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_id_ASTM           GEDEEP 
_citation.journal_id_CSD            2056 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            29 
_citation.language                  ? 
_citation.page_first                2343 
_citation.page_last                 2348 
_citation.title                     'Structural basis for substrate recognition by the human N-terminal methyltransferase 1.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1101/gad.270611.115 
_citation.pdbx_database_id_PubMed   26543161 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dong, C.'    1 
primary 'Mao, Y.'     2 
primary 'Tempel, W.'  3 
primary 'Qin, S.'     4 
primary 'Li, L.'      5 
primary 'Loppnau, P.' 6 
primary 'Huang, R.'   7 
primary 'Min, J.'     8 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5E1M 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     107.406 
_cell.length_a_esd                 ? 
_cell.length_b                     107.406 
_cell.length_b_esd                 ? 
_cell.length_c                     205.604 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5E1M 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'N-terminal Xaa-Pro-Lys N-methyltransferase 1' 27320.074 2   2.1.1.244 ? ? ? 
2 polymer     syn RCC1                                           682.854   2   ?         ? ? ? 
3 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                      384.411   2   ?         ? ? ? 
4 non-polymer syn GLYCEROL                                       92.094    3   ?         ? ? ? 
5 non-polymer syn 'UNKNOWN ATOM OR ION'                          ?         43  ?         ? ? ? 
6 water       nat water                                          18.015    417 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Alpha N-terminal protein methyltransferase 1A,Methyltransferase-like protein 11A,N-terminal RCC1 methyltransferase,X-Pro-Lys N-terminal protein methyltransferase 1A,NTM1A
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSSHHHHHHSSGLVPRGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGT
SCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLT
DQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFAL
R
;
;MGSSHHHHHHSSGLVPRGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGT
SCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLT
DQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFAL
R
;
A,B ? 
2 'polypeptide(L)' no no PPKRIA PPKRIA D,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  THR n 
1 21  SER n 
1 22  GLU n 
1 23  VAL n 
1 24  ILE n 
1 25  GLU n 
1 26  ASP n 
1 27  GLU n 
1 28  LYS n 
1 29  GLN n 
1 30  PHE n 
1 31  TYR n 
1 32  SER n 
1 33  LYS n 
1 34  ALA n 
1 35  LYS n 
1 36  THR n 
1 37  TYR n 
1 38  TRP n 
1 39  LYS n 
1 40  GLN n 
1 41  ILE n 
1 42  PRO n 
1 43  PRO n 
1 44  THR n 
1 45  VAL n 
1 46  ASP n 
1 47  GLY n 
1 48  MET n 
1 49  LEU n 
1 50  GLY n 
1 51  GLY n 
1 52  TYR n 
1 53  GLY n 
1 54  HIS n 
1 55  ILE n 
1 56  SER n 
1 57  SER n 
1 58  ILE n 
1 59  ASP n 
1 60  ILE n 
1 61  ASN n 
1 62  SER n 
1 63  SER n 
1 64  ARG n 
1 65  LYS n 
1 66  PHE n 
1 67  LEU n 
1 68  GLN n 
1 69  ARG n 
1 70  PHE n 
1 71  LEU n 
1 72  ARG n 
1 73  GLU n 
1 74  GLY n 
1 75  PRO n 
1 76  ASN n 
1 77  LYS n 
1 78  THR n 
1 79  GLY n 
1 80  THR n 
1 81  SER n 
1 82  CYS n 
1 83  ALA n 
1 84  LEU n 
1 85  ASP n 
1 86  CYS n 
1 87  GLY n 
1 88  ALA n 
1 89  GLY n 
1 90  ILE n 
1 91  GLY n 
1 92  ARG n 
1 93  ILE n 
1 94  THR n 
1 95  LYS n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 PRO n 
1 101 LEU n 
1 102 PHE n 
1 103 ARG n 
1 104 GLU n 
1 105 VAL n 
1 106 ASP n 
1 107 MET n 
1 108 VAL n 
1 109 ASP n 
1 110 ILE n 
1 111 THR n 
1 112 GLU n 
1 113 ASP n 
1 114 PHE n 
1 115 LEU n 
1 116 VAL n 
1 117 GLN n 
1 118 ALA n 
1 119 LYS n 
1 120 THR n 
1 121 TYR n 
1 122 LEU n 
1 123 GLY n 
1 124 GLU n 
1 125 GLU n 
1 126 GLY n 
1 127 LYS n 
1 128 ARG n 
1 129 VAL n 
1 130 ARG n 
1 131 ASN n 
1 132 TYR n 
1 133 PHE n 
1 134 CYS n 
1 135 CYS n 
1 136 GLY n 
1 137 LEU n 
1 138 GLN n 
1 139 ASP n 
1 140 PHE n 
1 141 THR n 
1 142 PRO n 
1 143 GLU n 
1 144 PRO n 
1 145 ASP n 
1 146 SER n 
1 147 TYR n 
1 148 ASP n 
1 149 VAL n 
1 150 ILE n 
1 151 TRP n 
1 152 ILE n 
1 153 GLN n 
1 154 TRP n 
1 155 VAL n 
1 156 ILE n 
1 157 GLY n 
1 158 HIS n 
1 159 LEU n 
1 160 THR n 
1 161 ASP n 
1 162 GLN n 
1 163 HIS n 
1 164 LEU n 
1 165 ALA n 
1 166 GLU n 
1 167 PHE n 
1 168 LEU n 
1 169 ARG n 
1 170 ARG n 
1 171 CYS n 
1 172 LYS n 
1 173 GLY n 
1 174 SER n 
1 175 LEU n 
1 176 ARG n 
1 177 PRO n 
1 178 ASN n 
1 179 GLY n 
1 180 ILE n 
1 181 ILE n 
1 182 VAL n 
1 183 ILE n 
1 184 LYS n 
1 185 ASP n 
1 186 ASN n 
1 187 MET n 
1 188 ALA n 
1 189 GLN n 
1 190 GLU n 
1 191 GLY n 
1 192 VAL n 
1 193 ILE n 
1 194 LEU n 
1 195 ASP n 
1 196 ASP n 
1 197 VAL n 
1 198 ASP n 
1 199 SER n 
1 200 SER n 
1 201 VAL n 
1 202 CYS n 
1 203 ARG n 
1 204 ASP n 
1 205 LEU n 
1 206 ASP n 
1 207 VAL n 
1 208 VAL n 
1 209 ARG n 
1 210 ARG n 
1 211 ILE n 
1 212 ILE n 
1 213 CYS n 
1 214 SER n 
1 215 ALA n 
1 216 GLY n 
1 217 LEU n 
1 218 SER n 
1 219 LEU n 
1 220 LEU n 
1 221 ALA n 
1 222 GLU n 
1 223 GLU n 
1 224 ARG n 
1 225 GLN n 
1 226 GLU n 
1 227 ASN n 
1 228 LEU n 
1 229 PRO n 
1 230 ASP n 
1 231 GLU n 
1 232 ILE n 
1 233 TYR n 
1 234 HIS n 
1 235 VAL n 
1 236 TYR n 
1 237 SER n 
1 238 PHE n 
1 239 ALA n 
1 240 LEU n 
1 241 ARG n 
2 1   PRO n 
2 2   PRO n 
2 3   LYS n 
2 4   ARG n 
2 5   ILE n 
2 6   ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   241 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NTMT1, C9orf32, METTL11A, NRMT, NRMT1, AD-003' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V3R' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       6 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'synthetic peptide' 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
NTM1A_HUMAN UNP ? 1 1 ? ? Q9BV86 ? 
;TSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLL
PLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPNG
IIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR
;
2 ? 
5E1M        PDB ? 2 2 ? ? 5E1M   ? ? 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5E1M A 20 ? 241 ? Q9BV86 2 ? 223 ? 2 223 
2 1 5E1M B 20 ? 241 ? Q9BV86 2 ? 223 ? 2 223 
3 2 5E1M D 1  ? 6   ? 5E1M   1 ? 6   ? 1 6   
4 2 5E1M E 1  ? 6   ? 5E1M   1 ? 6   ? 1 6   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5E1M MET A 1  ? UNP Q9BV86 ? ? 'expression tag' -17 1  
1 5E1M GLY A 2  ? UNP Q9BV86 ? ? 'expression tag' -16 2  
1 5E1M SER A 3  ? UNP Q9BV86 ? ? 'expression tag' -15 3  
1 5E1M SER A 4  ? UNP Q9BV86 ? ? 'expression tag' -14 4  
1 5E1M HIS A 5  ? UNP Q9BV86 ? ? 'expression tag' -13 5  
1 5E1M HIS A 6  ? UNP Q9BV86 ? ? 'expression tag' -12 6  
1 5E1M HIS A 7  ? UNP Q9BV86 ? ? 'expression tag' -11 7  
1 5E1M HIS A 8  ? UNP Q9BV86 ? ? 'expression tag' -10 8  
1 5E1M HIS A 9  ? UNP Q9BV86 ? ? 'expression tag' -9  9  
1 5E1M HIS A 10 ? UNP Q9BV86 ? ? 'expression tag' -8  10 
1 5E1M SER A 11 ? UNP Q9BV86 ? ? 'expression tag' -7  11 
1 5E1M SER A 12 ? UNP Q9BV86 ? ? 'expression tag' -6  12 
1 5E1M GLY A 13 ? UNP Q9BV86 ? ? 'expression tag' -5  13 
1 5E1M LEU A 14 ? UNP Q9BV86 ? ? 'expression tag' -4  14 
1 5E1M VAL A 15 ? UNP Q9BV86 ? ? 'expression tag' -3  15 
1 5E1M PRO A 16 ? UNP Q9BV86 ? ? 'expression tag' -2  16 
1 5E1M ARG A 17 ? UNP Q9BV86 ? ? 'expression tag' -1  17 
1 5E1M GLY A 18 ? UNP Q9BV86 ? ? 'expression tag' 0   18 
1 5E1M SER A 19 ? UNP Q9BV86 ? ? 'expression tag' 1   19 
2 5E1M MET B 1  ? UNP Q9BV86 ? ? 'expression tag' -17 20 
2 5E1M GLY B 2  ? UNP Q9BV86 ? ? 'expression tag' -16 21 
2 5E1M SER B 3  ? UNP Q9BV86 ? ? 'expression tag' -15 22 
2 5E1M SER B 4  ? UNP Q9BV86 ? ? 'expression tag' -14 23 
2 5E1M HIS B 5  ? UNP Q9BV86 ? ? 'expression tag' -13 24 
2 5E1M HIS B 6  ? UNP Q9BV86 ? ? 'expression tag' -12 25 
2 5E1M HIS B 7  ? UNP Q9BV86 ? ? 'expression tag' -11 26 
2 5E1M HIS B 8  ? UNP Q9BV86 ? ? 'expression tag' -10 27 
2 5E1M HIS B 9  ? UNP Q9BV86 ? ? 'expression tag' -9  28 
2 5E1M HIS B 10 ? UNP Q9BV86 ? ? 'expression tag' -8  29 
2 5E1M SER B 11 ? UNP Q9BV86 ? ? 'expression tag' -7  30 
2 5E1M SER B 12 ? UNP Q9BV86 ? ? 'expression tag' -6  31 
2 5E1M GLY B 13 ? UNP Q9BV86 ? ? 'expression tag' -5  32 
2 5E1M LEU B 14 ? UNP Q9BV86 ? ? 'expression tag' -4  33 
2 5E1M VAL B 15 ? UNP Q9BV86 ? ? 'expression tag' -3  34 
2 5E1M PRO B 16 ? UNP Q9BV86 ? ? 'expression tag' -2  35 
2 5E1M ARG B 17 ? UNP Q9BV86 ? ? 'expression tag' -1  36 
2 5E1M GLY B 18 ? UNP Q9BV86 ? ? 'expression tag' 0   37 
2 5E1M SER B 19 ? UNP Q9BV86 ? ? 'expression tag' 1   38 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                  ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                  ?                               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                  'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                 ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ?                               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ?                               'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ?                               'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                    ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                 ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                  ?                               'C9 H11 N O3'     181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'     ?                               ?                 ?       
VAL 'L-peptide linking' y VALINE                    ?                               'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5E1M 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.06 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.76 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '26% PEG3350, 16% tacsimate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN A200' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-22 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5E1M 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.750 
_reflns.d_resolution_low                 29.680 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       71201 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  20.600 
_reflns.pdbx_Rmerge_I_obs                0.108 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            27.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.111 
_reflns.pdbx_Rpim_I_all                  0.024 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         1466692 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.750 1.780  ? 4.300  78475 ? ? 3848 ? 99.900 ? ? ? ? 0.942 ? ? ? ? ? ? ? ? 20.400 ? ? ? ? 0.966 0.210 0 1 1 0.910 ? 
9.090 29.680 ? 82.700 9256  ? ? 617  ? 97.200 ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 15.000 ? ? ? ? 0.032 0.008 0 2 1 1.000 ? 
# 
_refine.aniso_B[1][1]                            -0.0000 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][2]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            0.0100 
_refine.B_iso_max                                59.350 
_refine.B_iso_mean                               18.3740 
_refine.B_iso_min                                7.730 
_refine.correlation_coeff_Fo_to_Fc               0.9600 
_refine.correlation_coeff_Fo_to_Fc_free          0.9440 
_refine.details                                  
'Coot was used for interactive model building. Molprobity was used for geometry validation.' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5E1M 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.7500 
_refine.ls_d_res_low                             29.68 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     68505 
_refine.ls_number_reflns_R_free                  2625 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9000 
_refine.ls_percent_reflns_R_free                 3.7000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1621 
_refine.ls_R_factor_R_free                       0.1882 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1611 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      0.1683 
_refine.ls_wR_factor_R_work                      0.1449 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'isomorphous crystal structure of same protein.' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            'THIN SHELLS (SFTOOLS)' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.0830 
_refine.pdbx_overall_ESU_R_Free                  0.0840 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             3.0010 
_refine.overall_SU_ML                            0.0540 
_refine.overall_SU_R_Cruickshank_DPI             0.0828 
_refine.overall_SU_R_free                        0.0837 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.8978 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.7500 
_refine_hist.d_res_low                        29.68 
_refine_hist.pdbx_number_atoms_ligand         113 
_refine_hist.number_atoms_solvent             417 
_refine_hist.number_atoms_total               4174 
_refine_hist.pdbx_number_residues_total       465 
_refine_hist.pdbx_B_iso_mean_ligand           18.08 
_refine_hist.pdbx_B_iso_mean_solvent          26.02 
_refine_hist.pdbx_number_atoms_protein        3644 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.017  0.019  3942 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  3734 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.758  1.989  5363 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.061  3.000  8624 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.244  5.000  502  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 36.978 23.446 177  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 11.332 15.000 684  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 17.895 15.000 37   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.115  0.200  601  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.010  0.021  4446 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  899  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 0.548  0.819  1917 ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 0.540  0.817  1916 ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 0.907  1.220  2401 ? r_mcangle_it           ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.7500 
_refine_ls_shell.d_res_low                        1.7950 
_refine_ls_shell.number_reflns_all                5160 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             4 
_refine_ls_shell.number_reflns_R_work             5156 
_refine_ls_shell.percent_reflns_obs               99.7500 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2220 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2110 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5E1M 
_struct.title                        'Crystal structure of NTMT1 in complex with PPKRIA peptide' 
_struct.pdbx_descriptor              'N-terminal Xaa-Pro-Lys N-methyltransferase 1 (E.C.2.1.1.244), RCC1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5E1M 
_struct_keywords.text            'Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 4 ? 
H  N N 5 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 3 ? 
EA N N 4 ? 
FA N N 5 ? 
GA N N 5 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 5 ? 
KA N N 5 ? 
LA N N 5 ? 
MA N N 5 ? 
NA N N 5 ? 
OA N N 5 ? 
PA N N 5 ? 
QA N N 5 ? 
RA N N 5 ? 
SA N N 5 ? 
TA N N 5 ? 
UA N N 5 ? 
VA N N 5 ? 
WA N N 5 ? 
XA N N 5 ? 
YA N N 5 ? 
ZA N N 5 ? 
AB N N 6 ? 
BB N N 6 ? 
CB N N 6 ? 
DB N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 19  ? VAL A 23  ? SER A 1   VAL A 5   5 ? 5  
HELX_P HELX_P2  AA2 ASP A 26  ? GLN A 40  ? ASP A 8   GLN A 22  1 ? 15 
HELX_P HELX_P3  AA3 THR A 44  ? LEU A 49  ? THR A 26  LEU A 31  1 ? 6  
HELX_P HELX_P4  AA4 TYR A 52  ? HIS A 54  ? TYR A 34  HIS A 36  5 ? 3  
HELX_P HELX_P5  AA5 ILE A 55  ? ARG A 69  ? ILE A 37  ARG A 51  1 ? 15 
HELX_P HELX_P6  AA6 PHE A 70  ? ARG A 72  ? PHE A 52  ARG A 54  5 ? 3  
HELX_P HELX_P7  AA7 GLY A 91  ? LEU A 97  ? GLY A 73  LEU A 79  1 ? 7  
HELX_P HELX_P8  AA8 THR A 111 ? LEU A 122 ? THR A 93  LEU A 104 1 ? 12 
HELX_P HELX_P9  AA9 GLY A 123 ? LYS A 127 ? GLY A 105 LYS A 109 5 ? 5  
HELX_P HELX_P10 AB1 GLY A 136 ? PHE A 140 ? GLY A 118 PHE A 122 5 ? 5  
HELX_P HELX_P11 AB2 VAL A 155 ? LEU A 159 ? VAL A 137 LEU A 141 5 ? 5  
HELX_P HELX_P12 AB3 THR A 160 ? SER A 174 ? THR A 142 SER A 156 1 ? 15 
HELX_P HELX_P13 AB4 LEU A 205 ? ALA A 215 ? LEU A 187 ALA A 197 1 ? 11 
HELX_P HELX_P14 AB5 SER B 19  ? ILE B 24  ? SER B 1   ILE B 6   1 ? 6  
HELX_P HELX_P15 AB6 ASP B 26  ? GLN B 40  ? ASP B 8   GLN B 22  1 ? 15 
HELX_P HELX_P16 AB7 THR B 44  ? LEU B 49  ? THR B 26  LEU B 31  1 ? 6  
HELX_P HELX_P17 AB8 TYR B 52  ? HIS B 54  ? TYR B 34  HIS B 36  5 ? 3  
HELX_P HELX_P18 AB9 ILE B 55  ? GLU B 73  ? ILE B 37  GLU B 55  1 ? 19 
HELX_P HELX_P19 AC1 GLY B 91  ? LEU B 97  ? GLY B 73  LEU B 79  1 ? 7  
HELX_P HELX_P20 AC2 THR B 111 ? LEU B 122 ? THR B 93  LEU B 104 1 ? 12 
HELX_P HELX_P21 AC3 GLY B 123 ? LYS B 127 ? GLY B 105 LYS B 109 5 ? 5  
HELX_P HELX_P22 AC4 GLY B 136 ? PHE B 140 ? GLY B 118 PHE B 122 5 ? 5  
HELX_P HELX_P23 AC5 VAL B 155 ? LEU B 159 ? VAL B 137 LEU B 141 5 ? 5  
HELX_P HELX_P24 AC6 THR B 160 ? SER B 174 ? THR B 142 SER B 156 1 ? 15 
HELX_P HELX_P25 AC7 ASP B 204 ? ALA B 215 ? ASP B 186 ALA B 197 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 74 B . ? GLY 56 B PRO 75 B ? PRO 57 B 1 -7.72 
2 GLY 74 B . ? GLY 56 B PRO 75 B ? PRO 57 B 1 14.90 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 7 ? 
AA3 ? 7 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 129 ? CYS A 134 ? VAL A 111 CYS A 116 
AA1 2 GLU A 104 ? ASP A 109 ? GLU A 86  ASP A 91  
AA1 3 CYS A 82  ? CYS A 86  ? CYS A 64  CYS A 68  
AA1 4 TYR A 147 ? GLN A 153 ? TYR A 129 GLN A 135 
AA1 5 LEU A 175 ? ALA A 188 ? LEU A 157 ALA A 170 
AA1 6 SER A 200 ? ASP A 204 ? SER A 182 ASP A 186 
AA1 7 VAL A 192 ? ASP A 195 ? VAL A 174 ASP A 177 
AA2 1 VAL A 129 ? CYS A 134 ? VAL A 111 CYS A 116 
AA2 2 GLU A 104 ? ASP A 109 ? GLU A 86  ASP A 91  
AA2 3 CYS A 82  ? CYS A 86  ? CYS A 64  CYS A 68  
AA2 4 TYR A 147 ? GLN A 153 ? TYR A 129 GLN A 135 
AA2 5 LEU A 175 ? ALA A 188 ? LEU A 157 ALA A 170 
AA2 6 HIS A 234 ? ARG A 241 ? HIS A 216 ARG A 223 
AA2 7 SER A 218 ? ARG A 224 ? SER A 200 ARG A 206 
AA3 1 VAL B 129 ? CYS B 134 ? VAL B 111 CYS B 116 
AA3 2 GLU B 104 ? ASP B 109 ? GLU B 86  ASP B 91  
AA3 3 CYS B 82  ? CYS B 86  ? CYS B 64  CYS B 68  
AA3 4 TYR B 147 ? GLN B 153 ? TYR B 129 GLN B 135 
AA3 5 LEU B 175 ? MET B 187 ? LEU B 157 MET B 169 
AA3 6 HIS B 234 ? ARG B 241 ? HIS B 216 ARG B 223 
AA3 7 SER B 218 ? ARG B 224 ? SER B 200 ARG B 206 
AA4 1 VAL B 192 ? ASP B 195 ? VAL B 174 ASP B 177 
AA4 2 SER B 200 ? ARG B 203 ? SER B 182 ARG B 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 133 ? O PHE A 115 N MET A 107 ? N MET A 89  
AA1 2 3 O ASP A 106 ? O ASP A 88  N ASP A 85  ? N ASP A 67  
AA1 3 4 N CYS A 86  ? N CYS A 68  O TRP A 151 ? O TRP A 133 
AA1 4 5 N ILE A 152 ? N ILE A 134 O VAL A 182 ? O VAL A 164 
AA1 5 6 N ALA A 188 ? N ALA A 170 O ARG A 203 ? O ARG A 185 
AA1 6 7 O SER A 200 ? O SER A 182 N ASP A 195 ? N ASP A 177 
AA2 1 2 O PHE A 133 ? O PHE A 115 N MET A 107 ? N MET A 89  
AA2 2 3 O ASP A 106 ? O ASP A 88  N ASP A 85  ? N ASP A 67  
AA2 3 4 N CYS A 86  ? N CYS A 68  O TRP A 151 ? O TRP A 133 
AA2 4 5 N ILE A 152 ? N ILE A 134 O VAL A 182 ? O VAL A 164 
AA2 5 6 N ILE A 181 ? N ILE A 163 O LEU A 240 ? O LEU A 222 
AA2 6 7 O ALA A 239 ? O ALA A 221 N LEU A 220 ? N LEU A 202 
AA3 1 2 O PHE B 133 ? O PHE B 115 N MET B 107 ? N MET B 89  
AA3 2 3 O ASP B 106 ? O ASP B 88  N ASP B 85  ? N ASP B 67  
AA3 3 4 N CYS B 86  ? N CYS B 68  O TRP B 151 ? O TRP B 133 
AA3 4 5 N ILE B 152 ? N ILE B 134 O VAL B 182 ? O VAL B 164 
AA3 5 6 N ILE B 181 ? N ILE B 163 O LEU B 240 ? O LEU B 222 
AA3 6 7 O ALA B 239 ? O ALA B 221 N LEU B 220 ? N LEU B 202 
AA4 1 2 N ASP B 195 ? N ASP B 177 O SER B 200 ? O SER B 182 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SAH 301 ? 20 'binding site for residue SAH A 301' 
AC2 Software A GOL 302 ? 11 'binding site for residue GOL A 302' 
AC3 Software A GOL 303 ? 6  'binding site for residue GOL A 303' 
AC4 Software B SAH 301 ? 20 'binding site for residue SAH B 301' 
AC5 Software B GOL 302 ? 12 'binding site for residue GOL B 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 TRP A  38  ? TRP A 20  . ? 1_555 ? 
2  AC1 20 MET A  48  ? MET A 30  . ? 1_555 ? 
3  AC1 20 GLY A  87  ? GLY A 69  . ? 1_555 ? 
4  AC1 20 GLY A  89  ? GLY A 71  . ? 1_555 ? 
5  AC1 20 ARG A  92  ? ARG A 74  . ? 1_555 ? 
6  AC1 20 ILE A  93  ? ILE A 75  . ? 1_555 ? 
7  AC1 20 ASP A  109 ? ASP A 91  . ? 1_555 ? 
8  AC1 20 ILE A  110 ? ILE A 92  . ? 1_555 ? 
9  AC1 20 THR A  111 ? THR A 93  . ? 1_555 ? 
10 AC1 20 PHE A  114 ? PHE A 96  . ? 1_555 ? 
11 AC1 20 GLY A  136 ? GLY A 118 . ? 1_555 ? 
12 AC1 20 LEU A  137 ? LEU A 119 . ? 1_555 ? 
13 AC1 20 GLN A  138 ? GLN A 120 . ? 1_555 ? 
14 AC1 20 GLN A  153 ? GLN A 135 . ? 1_555 ? 
15 AC1 20 TRP A  154 ? TRP A 136 . ? 1_555 ? 
16 AC1 20 VAL A  155 ? VAL A 137 . ? 1_555 ? 
17 AC1 20 HIS A  158 ? HIS A 140 . ? 1_555 ? 
18 AC1 20 HOH AB .   ? HOH A 434 . ? 1_555 ? 
19 AC1 20 HOH AB .   ? HOH A 498 . ? 1_555 ? 
20 AC1 20 HOH AB .   ? HOH A 514 . ? 1_555 ? 
21 AC2 11 TRP A  154 ? TRP A 136 . ? 1_555 ? 
22 AC2 11 VAL A  155 ? VAL A 137 . ? 1_555 ? 
23 AC2 11 ILE A  156 ? ILE A 138 . ? 1_555 ? 
24 AC2 11 GLY A  157 ? GLY A 139 . ? 1_555 ? 
25 AC2 11 ASP A  185 ? ASP A 167 . ? 1_555 ? 
26 AC2 11 ASN A  186 ? ASN A 168 . ? 1_555 ? 
27 AC2 11 SER A  200 ? SER A 182 . ? 1_555 ? 
28 AC2 11 VAL A  201 ? VAL A 183 . ? 1_555 ? 
29 AC2 11 HOH AB .   ? HOH A 448 . ? 1_555 ? 
30 AC2 11 HOH AB .   ? HOH A 450 . ? 1_555 ? 
31 AC2 11 PRO C  1   ? PRO D 1   . ? 1_555 ? 
32 AC3 6  GLU A  104 ? GLU A 86  . ? 1_555 ? 
33 AC3 6  ARG A  130 ? ARG A 112 . ? 1_555 ? 
34 AC3 6  HOH AB .   ? HOH A 460 . ? 1_555 ? 
35 AC3 6  HOH AB .   ? HOH A 503 . ? 1_555 ? 
36 AC3 6  HOH AB .   ? HOH A 512 . ? 1_555 ? 
37 AC3 6  ARG B  64  ? ARG B 46  . ? 8_665 ? 
38 AC4 20 TRP B  38  ? TRP B 20  . ? 1_555 ? 
39 AC4 20 MET B  48  ? MET B 30  . ? 1_555 ? 
40 AC4 20 GLY B  87  ? GLY B 69  . ? 1_555 ? 
41 AC4 20 GLY B  89  ? GLY B 71  . ? 1_555 ? 
42 AC4 20 ARG B  92  ? ARG B 74  . ? 1_555 ? 
43 AC4 20 ILE B  93  ? ILE B 75  . ? 1_555 ? 
44 AC4 20 ASP B  109 ? ASP B 91  . ? 1_555 ? 
45 AC4 20 ILE B  110 ? ILE B 92  . ? 1_555 ? 
46 AC4 20 THR B  111 ? THR B 93  . ? 1_555 ? 
47 AC4 20 PHE B  114 ? PHE B 96  . ? 1_555 ? 
48 AC4 20 CYS B  135 ? CYS B 117 . ? 1_555 ? 
49 AC4 20 GLY B  136 ? GLY B 118 . ? 1_555 ? 
50 AC4 20 LEU B  137 ? LEU B 119 . ? 1_555 ? 
51 AC4 20 GLN B  138 ? GLN B 120 . ? 1_555 ? 
52 AC4 20 GLN B  153 ? GLN B 135 . ? 1_555 ? 
53 AC4 20 TRP B  154 ? TRP B 136 . ? 1_555 ? 
54 AC4 20 VAL B  155 ? VAL B 137 . ? 1_555 ? 
55 AC4 20 HIS B  158 ? HIS B 140 . ? 1_555 ? 
56 AC4 20 HOH BB .   ? HOH B 415 . ? 1_555 ? 
57 AC4 20 HOH BB .   ? HOH B 486 . ? 1_555 ? 
58 AC5 12 TRP B  154 ? TRP B 136 . ? 1_555 ? 
59 AC5 12 VAL B  155 ? VAL B 137 . ? 1_555 ? 
60 AC5 12 ILE B  156 ? ILE B 138 . ? 1_555 ? 
61 AC5 12 GLY B  157 ? GLY B 139 . ? 1_555 ? 
62 AC5 12 ASP B  185 ? ASP B 167 . ? 1_555 ? 
63 AC5 12 ASN B  186 ? ASN B 168 . ? 1_555 ? 
64 AC5 12 SER B  200 ? SER B 182 . ? 1_555 ? 
65 AC5 12 VAL B  201 ? VAL B 183 . ? 1_555 ? 
66 AC5 12 CYS B  202 ? CYS B 184 . ? 1_555 ? 
67 AC5 12 HOH BB .   ? HOH B 419 . ? 1_555 ? 
68 AC5 12 HOH BB .   ? HOH B 423 . ? 1_555 ? 
69 AC5 12 PRO D  1   ? PRO E 1   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5E1M 
_atom_sites.fract_transf_matrix[1][1]   0.009310 
_atom_sites.fract_transf_matrix[1][2]   0.005375 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010751 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004864 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . VAL A  1 15  ? -0.594  20.025 -35.782 1.00 43.09 ? -3  VAL A N     1 
ATOM   2    C CA    . VAL A  1 15  ? 0.842   19.789 -35.447 1.00 40.26 ? -3  VAL A CA    1 
ATOM   3    C C     . VAL A  1 15  ? 1.363   20.904 -34.476 1.00 37.62 ? -3  VAL A C     1 
ATOM   4    O O     . VAL A  1 15  ? 1.293   22.110 -34.800 1.00 38.52 ? -3  VAL A O     1 
ATOM   5    C CB    . VAL A  1 15  ? 1.693   19.674 -36.731 1.00 40.41 ? -3  VAL A CB    1 
ATOM   6    N N     . PRO A  1 16  ? 1.834   20.525 -33.267 1.00 33.74 ? -2  PRO A N     1 
ATOM   7    C CA    . PRO A  1 16  ? 2.477   21.478 -32.370 1.00 30.77 ? -2  PRO A CA    1 
ATOM   8    C C     . PRO A  1 16  ? 3.765   22.006 -32.950 1.00 27.15 ? -2  PRO A C     1 
ATOM   9    O O     . PRO A  1 16  ? 4.473   21.269 -33.635 1.00 27.07 ? -2  PRO A O     1 
ATOM   10   C CB    . PRO A  1 16  ? 2.862   20.639 -31.114 1.00 30.69 ? -2  PRO A CB    1 
ATOM   11   C CG    . PRO A  1 16  ? 2.047   19.404 -31.209 1.00 33.27 ? -2  PRO A CG    1 
ATOM   12   C CD    . PRO A  1 16  ? 1.652   19.212 -32.636 1.00 34.77 ? -2  PRO A CD    1 
ATOM   13   N N     . ARG A  1 17  ? 4.088   23.245 -32.597 1.00 23.89 ? -1  ARG A N     1 
ATOM   14   C CA    . ARG A  1 17  ? 5.364   23.821 -32.984 1.00 21.97 ? -1  ARG A CA    1 
ATOM   15   C C     . ARG A  1 17  ? 6.445   23.237 -32.090 1.00 20.64 ? -1  ARG A C     1 
ATOM   16   O O     . ARG A  1 17  ? 6.201   22.999 -30.892 1.00 20.04 ? -1  ARG A O     1 
ATOM   17   C CB    . ARG A  1 17  ? 5.311   25.337 -32.887 1.00 21.49 ? -1  ARG A CB    1 
ATOM   18   C CG    . ARG A  1 17  ? 4.556   26.047 -34.020 1.00 22.60 ? -1  ARG A CG    1 
ATOM   19   C CD    . ARG A  1 17  ? 3.063   25.979 -33.927 1.00 24.13 ? -1  ARG A CD    1 
ATOM   20   N NE    . ARG A  1 17  ? 2.379   26.695 -34.996 1.00 24.72 ? -1  ARG A NE    1 
ATOM   21   C CZ    . ARG A  1 17  ? 1.860   27.923 -34.881 1.00 24.25 ? -1  ARG A CZ    1 
ATOM   22   N NH1   . ARG A  1 17  ? 1.880   28.586 -33.713 1.00 22.88 ? -1  ARG A NH1   1 
ATOM   23   N NH2   . ARG A  1 17  ? 1.284   28.467 -35.931 1.00 25.00 ? -1  ARG A NH2   1 
ATOM   24   N N     . GLY A  1 18  ? 7.637   22.979 -32.627 1.00 19.09 ? 0   GLY A N     1 
ATOM   25   C CA    . GLY A  1 18  ? 8.738   22.449 -31.797 1.00 18.37 ? 0   GLY A CA    1 
ATOM   26   C C     . GLY A  1 18  ? 9.913   23.337 -31.647 1.00 17.17 ? 0   GLY A C     1 
ATOM   27   O O     . GLY A  1 18  ? 10.849  23.038 -30.906 1.00 17.90 ? 0   GLY A O     1 
ATOM   28   N N     . SER A  1 19  ? 9.913   24.492 -32.299 1.00 16.22 ? 1   SER A N     1 
ATOM   29   C CA    . SER A  1 19  ? 10.978  25.418 -32.105 1.00 15.85 ? 1   SER A CA    1 
ATOM   30   C C     . SER A  1 19  ? 10.571  26.884 -32.228 1.00 14.33 ? 1   SER A C     1 
ATOM   31   O O     . SER A  1 19  ? 9.586   27.189 -32.872 1.00 14.08 ? 1   SER A O     1 
ATOM   32   C CB    . SER A  1 19  ? 12.099  25.126 -33.057 1.00 17.40 ? 1   SER A CB    1 
ATOM   33   O OG    . SER A  1 19  ? 11.805  25.432 -34.341 1.00 19.61 ? 1   SER A OG    1 
ATOM   34   N N     . THR A  1 20  ? 11.387  27.743 -31.621 1.00 12.86 ? 2   THR A N     1 
ATOM   35   C CA    . THR A  1 20  ? 11.108  29.183 -31.699 1.00 12.06 ? 2   THR A CA    1 
ATOM   36   C C     . THR A  1 20  ? 11.121  29.684 -33.133 1.00 12.71 ? 2   THR A C     1 
ATOM   37   O O     . THR A  1 20  ? 10.418  30.637 -33.438 1.00 12.36 ? 2   THR A O     1 
ATOM   38   C CB    . THR A  1 20  ? 12.069  30.009 -30.822 1.00 11.09 ? 2   THR A CB    1 
ATOM   39   O OG1   . THR A  1 20  ? 13.463  29.694 -31.170 1.00 10.46 ? 2   THR A OG1   1 
ATOM   40   C CG2   . THR A  1 20  ? 11.749  29.821 -29.385 1.00 10.86 ? 2   THR A CG2   1 
ATOM   41   N N     . SER A  1 21  ? 11.906  29.042 -34.029 1.00 13.05 ? 3   SER A N     1 
ATOM   42   C CA    . SER A  1 21  ? 11.883  29.450 -35.427 1.00 14.29 ? 3   SER A CA    1 
ATOM   43   C C     . SER A  1 21  ? 10.534  29.274 -36.137 1.00 14.81 ? 3   SER A C     1 
ATOM   44   O O     . SER A  1 21  ? 10.355  29.736 -37.257 1.00 16.26 ? 3   SER A O     1 
ATOM   45   C CB    . SER A  1 21  ? 12.990  28.688 -36.251 1.00 15.02 ? 3   SER A CB    1 
ATOM   46   O OG    . SER A  1 21  ? 12.826  27.258 -36.211 1.00 16.07 ? 3   SER A OG    1 
ATOM   47   N N     . GLU A  1 22  ? 9.610   28.503 -35.557 1.00 14.51 ? 4   GLU A N     1 
ATOM   48   C CA    . GLU A  1 22  ? 8.245   28.396 -36.077 1.00 15.37 ? 4   GLU A CA    1 
ATOM   49   C C     . GLU A  1 22  ? 7.317   29.493 -35.540 1.00 15.19 ? 4   GLU A C     1 
ATOM   50   O O     . GLU A  1 22  ? 6.186   29.681 -36.086 1.00 15.98 ? 4   GLU A O     1 
ATOM   51   C CB    . GLU A  1 22  ? 7.668   27.034 -35.703 1.00 16.13 ? 4   GLU A CB    1 
ATOM   52   C CG    . GLU A  1 22  ? 8.401   25.857 -36.310 1.00 16.79 ? 4   GLU A CG    1 
ATOM   53   C CD    . GLU A  1 22  ? 7.852   24.509 -35.848 1.00 17.84 ? 4   GLU A CD    1 
ATOM   54   O OE1   . GLU A  1 22  ? 8.516   23.947 -34.987 1.00 18.70 ? 4   GLU A OE1   1 
ATOM   55   O OE2   . GLU A  1 22  ? 6.780   24.157 -36.287 1.00 19.57 ? 4   GLU A OE2   1 
ATOM   56   N N     . VAL A  1 23  ? 7.718   30.181 -34.491 1.00 14.07 ? 5   VAL A N     1 
ATOM   57   C CA    . VAL A  1 23  ? 6.778   31.111 -33.842 1.00 14.30 ? 5   VAL A CA    1 
ATOM   58   C C     . VAL A  1 23  ? 7.245   32.563 -33.792 1.00 13.78 ? 5   VAL A C     1 
ATOM   59   O O     . VAL A  1 23  ? 6.412   33.456 -33.552 1.00 13.97 ? 5   VAL A O     1 
ATOM   60   C CB    . VAL A  1 23  ? 6.266   30.701 -32.439 1.00 14.47 ? 5   VAL A CB    1 
ATOM   61   C CG1   . VAL A  1 23  ? 5.635   29.295 -32.529 1.00 15.56 ? 5   VAL A CG1   1 
ATOM   62   C CG2   . VAL A  1 23  ? 7.309   30.800 -31.412 1.00 13.49 ? 5   VAL A CG2   1 
ATOM   63   N N     . ILE A  1 24  ? 8.547   32.813 -34.008 1.00 12.85 ? 6   ILE A N     1 
ATOM   64   C CA    . ILE A  1 24  ? 9.055   34.184 -33.942 1.00 12.68 ? 6   ILE A CA    1 
ATOM   65   C C     . ILE A  1 24  ? 9.167   34.786 -35.312 1.00 13.51 ? 6   ILE A C     1 
ATOM   66   O O     . ILE A  1 24  ? 9.973   34.315 -36.139 1.00 13.20 ? 6   ILE A O     1 
ATOM   67   C CB    . ILE A  1 24  ? 10.439  34.205 -33.212 1.00 11.64 ? 6   ILE A CB    1 
ATOM   68   C CG1   . ILE A  1 24  ? 10.282  33.750 -31.745 1.00 11.01 ? 6   ILE A CG1   1 
ATOM   69   C CG2   . ILE A  1 24  ? 11.024  35.630 -33.246 1.00 11.69 ? 6   ILE A CG2   1 
ATOM   70   C CD1   . ILE A  1 24  ? 11.556  33.729 -30.950 1.00 10.16 ? 6   ILE A CD1   1 
ATOM   71   N N     . GLU A  1 25  ? 8.389   35.833 -35.599 1.00 14.40 ? 7   GLU A N     1 
ATOM   72   C CA    . GLU A  1 25  ? 8.385   36.411 -36.932 1.00 15.88 ? 7   GLU A CA    1 
ATOM   73   C C     . GLU A  1 25  ? 9.692   37.155 -37.215 1.00 15.33 ? 7   GLU A C     1 
ATOM   74   O O     . GLU A  1 25  ? 10.139  37.205 -38.351 1.00 15.12 ? 7   GLU A O     1 
ATOM   75   C CB    . GLU A  1 25  ? 7.205   37.420 -37.015 1.00 17.94 ? 7   GLU A CB    1 
ATOM   76   C CG    . GLU A  1 25  ? 7.063   38.088 -38.340 1.00 20.64 ? 7   GLU A CG    1 
ATOM   77   C CD    . GLU A  1 25  ? 5.711   38.820 -38.445 1.00 23.66 ? 7   GLU A CD    1 
ATOM   78   O OE1   . GLU A  1 25  ? 5.470   39.377 -39.463 1.00 28.06 ? 7   GLU A OE1   1 
ATOM   79   O OE2   . GLU A  1 25  ? 4.862   38.750 -37.545 1.00 24.93 ? 7   GLU A OE2   1 
ATOM   80   N N     . ASP A  1 26  ? 10.203  37.844 -36.198 1.00 14.90 ? 8   ASP A N     1 
ATOM   81   C CA    . ASP A  1 26  ? 11.307  38.793 -36.397 1.00 15.55 ? 8   ASP A CA    1 
ATOM   82   C C     . ASP A  1 26  ? 12.093  38.821 -35.117 1.00 15.06 ? 8   ASP A C     1 
ATOM   83   O O     . ASP A  1 26  ? 11.600  39.326 -34.062 1.00 15.01 ? 8   ASP A O     1 
ATOM   84   C CB    . ASP A  1 26  ? 10.671  40.159 -36.752 1.00 16.97 ? 8   ASP A CB    1 
ATOM   85   C CG    . ASP A  1 26  ? 11.667  41.276 -36.890 1.00 17.48 ? 8   ASP A CG    1 
ATOM   86   O OD1   . ASP A  1 26  ? 12.631  41.349 -36.139 1.00 17.45 ? 8   ASP A OD1   1 
ATOM   87   O OD2   . ASP A  1 26  ? 11.310  42.176 -37.680 1.00 19.62 ? 8   ASP A OD2   1 
ATOM   88   N N     . GLU A  1 27  ? 13.277  38.251 -35.153 1.00 14.87 ? 9   GLU A N     1 
ATOM   89   C CA    . GLU A  1 27  ? 14.035  38.074 -33.924 1.00 15.33 ? 9   GLU A CA    1 
ATOM   90   C C     . GLU A  1 27  ? 14.369  39.432 -33.248 1.00 14.80 ? 9   GLU A C     1 
ATOM   91   O O     . GLU A  1 27  ? 14.312  39.555 -32.023 1.00 14.02 ? 9   GLU A O     1 
ATOM   92   C CB    . GLU A  1 27  ? 15.292  37.355 -34.209 1.00 16.54 ? 9   GLU A CB    1 
ATOM   93   C CG    . GLU A  1 27  ? 16.056  37.102 -32.947 1.00 18.04 ? 9   GLU A CG    1 
ATOM   94   C CD    . GLU A  1 27  ? 17.287  36.339 -33.178 1.00 19.62 ? 9   GLU A CD    1 
ATOM   95   O OE1   . GLU A  1 27  ? 17.275  35.248 -33.801 1.00 22.22 ? 9   GLU A OE1   1 
ATOM   96   O OE2   . GLU A  1 27  ? 18.307  36.930 -32.712 1.00 22.01 ? 9   GLU A OE2   1 
ATOM   97   N N     . LYS A  1 28  ? 14.748  40.417 -34.057 1.00 15.93 ? 10  LYS A N     1 
ATOM   98   C CA    . LYS A  1 28  ? 15.104  41.737 -33.433 1.00 16.40 ? 10  LYS A CA    1 
ATOM   99   C C     . LYS A  1 28  ? 13.915  42.316 -32.710 1.00 16.60 ? 10  LYS A C     1 
ATOM   100  O O     . LYS A  1 28  ? 14.062  42.794 -31.566 1.00 16.72 ? 10  LYS A O     1 
ATOM   101  C CB    . LYS A  1 28  ? 15.552  42.757 -34.489 1.00 18.12 ? 10  LYS A CB    1 
ATOM   102  C CG    . LYS A  1 28  ? 16.886  42.303 -34.997 1.00 19.30 ? 10  LYS A CG    1 
ATOM   103  N N     . GLN A  1 29  ? 12.746  42.177 -33.282 1.00 16.87 ? 11  GLN A N     1 
ATOM   104  C CA    . GLN A  1 29  ? 11.507  42.667 -32.633 1.00 17.69 ? 11  GLN A CA    1 
ATOM   105  C C     . GLN A  1 29  ? 11.099  41.838 -31.412 1.00 16.16 ? 11  GLN A C     1 
ATOM   106  O O     . GLN A  1 29  ? 10.595  42.382 -30.429 1.00 15.41 ? 11  GLN A O     1 
ATOM   107  C CB    . GLN A  1 29  ? 10.361  42.781 -33.625 1.00 20.48 ? 11  GLN A CB    1 
ATOM   108  C CG    . GLN A  1 29  ? 10.472  43.986 -34.559 1.00 24.00 ? 11  GLN A CG    1 
ATOM   109  C CD    . GLN A  1 29  ? 9.355   44.048 -35.565 1.00 28.40 ? 11  GLN A CD    1 
ATOM   110  O OE1   . GLN A  1 29  ? 8.393   43.297 -35.475 1.00 34.45 ? 11  GLN A OE1   1 
ATOM   111  N NE2   . GLN A  1 29  ? 9.459   44.945 -36.537 1.00 31.47 ? 11  GLN A NE2   1 
ATOM   112  N N     . PHE A  1 30  ? 11.363  40.538 -31.462 1.00 14.66 ? 12  PHE A N     1 
ATOM   113  C CA    . PHE A  1 30  ? 11.118  39.651 -30.314 1.00 13.82 ? 12  PHE A CA    1 
ATOM   114  C C     . PHE A  1 30  ? 11.897  40.146 -29.080 1.00 13.36 ? 12  PHE A C     1 
ATOM   115  O O     . PHE A  1 30  ? 11.283  40.283 -27.975 1.00 13.62 ? 12  PHE A O     1 
ATOM   116  C CB    . PHE A  1 30  ? 11.505  38.216 -30.666 1.00 13.02 ? 12  PHE A CB    1 
ATOM   117  C CG    . PHE A  1 30  ? 11.455  37.232 -29.536 1.00 12.09 ? 12  PHE A CG    1 
ATOM   118  C CD1   . PHE A  1 30  ? 10.275  36.703 -29.081 1.00 12.28 ? 12  PHE A CD1   1 
ATOM   119  C CD2   . PHE A  1 30  ? 12.612  36.796 -28.932 1.00 11.59 ? 12  PHE A CD2   1 
ATOM   120  C CE1   . PHE A  1 30  ? 10.254  35.755 -28.063 1.00 11.83 ? 12  PHE A CE1   1 
ATOM   121  C CE2   . PHE A  1 30  ? 12.611  35.828 -27.926 1.00 11.08 ? 12  PHE A CE2   1 
ATOM   122  C CZ    . PHE A  1 30  ? 11.410  35.317 -27.467 1.00 11.00 ? 12  PHE A CZ    1 
ATOM   123  N N     . TYR A  1 31  ? 13.179  40.494 -29.279 1.00 12.79 ? 13  TYR A N     1 
ATOM   124  C CA    . TYR A  1 31  ? 13.950  41.039 -28.187 1.00 12.66 ? 13  TYR A CA    1 
ATOM   125  C C     . TYR A  1 31  ? 13.553  42.490 -27.853 1.00 13.17 ? 13  TYR A C     1 
ATOM   126  O O     . TYR A  1 31  ? 13.407  42.853 -26.643 1.00 13.33 ? 13  TYR A O     1 
ATOM   127  C CB    . TYR A  1 31  ? 15.429  40.940 -28.455 1.00 12.42 ? 13  TYR A CB    1 
ATOM   128  C CG    . TYR A  1 31  ? 15.935  39.509 -28.314 1.00 11.70 ? 13  TYR A CG    1 
ATOM   129  C CD1   . TYR A  1 31  ? 15.955  38.877 -27.103 1.00 11.15 ? 13  TYR A CD1   1 
ATOM   130  C CD2   . TYR A  1 31  ? 16.380  38.786 -29.427 1.00 11.69 ? 13  TYR A CD2   1 
ATOM   131  C CE1   . TYR A  1 31  ? 16.419  37.563 -26.975 1.00 10.77 ? 13  TYR A CE1   1 
ATOM   132  C CE2   . TYR A  1 31  ? 16.869  37.487 -29.285 1.00 11.32 ? 13  TYR A CE2   1 
ATOM   133  C CZ    . TYR A  1 31  ? 16.880  36.880 -28.054 1.00 10.49 ? 13  TYR A CZ    1 
ATOM   134  O OH    . TYR A  1 31  ? 17.336  35.581 -27.951 1.00 10.21 ? 13  TYR A OH    1 
ATOM   135  N N     . SER A  1 32  ? 13.365  43.316 -28.859 1.00 13.86 ? 14  SER A N     1 
ATOM   136  C CA    . SER A  1 32  ? 13.071  44.767 -28.560 1.00 14.81 ? 14  SER A CA    1 
ATOM   137  C C     . SER A  1 32  ? 11.713  44.954 -27.873 1.00 15.01 ? 14  SER A C     1 
ATOM   138  O O     . SER A  1 32  ? 11.543  45.830 -26.908 1.00 15.26 ? 14  SER A O     1 
ATOM   139  C CB    . SER A  1 32  ? 13.223  45.631 -29.775 1.00 15.89 ? 14  SER A CB    1 
ATOM   140  O OG    . SER A  1 32  ? 12.261  45.355 -30.748 1.00 16.75 ? 14  SER A OG    1 
ATOM   141  N N     . LYS A  1 33  ? 10.732  44.147 -28.257 1.00 14.51 ? 15  LYS A N     1 
ATOM   142  C CA    A LYS A  1 33  ? 9.435   44.236 -27.613 0.70 15.17 ? 15  LYS A CA    1 
ATOM   143  C CA    B LYS A  1 33  ? 9.417   44.219 -27.629 0.30 15.04 ? 15  LYS A CA    1 
ATOM   144  C C     . LYS A  1 33  ? 9.508   43.784 -26.149 1.00 14.36 ? 15  LYS A C     1 
ATOM   145  O O     . LYS A  1 33  ? 8.813   44.357 -25.293 1.00 14.57 ? 15  LYS A O     1 
ATOM   146  C CB    A LYS A  1 33  ? 8.366   43.424 -28.347 0.70 15.54 ? 15  LYS A CB    1 
ATOM   147  C CB    B LYS A  1 33  ? 8.378   43.379 -28.410 0.30 15.29 ? 15  LYS A CB    1 
ATOM   148  C CG    A LYS A  1 33  ? 8.001   44.014 -29.685 0.70 16.51 ? 15  LYS A CG    1 
ATOM   149  C CG    B LYS A  1 33  ? 6.915   43.675 -28.089 0.30 16.10 ? 15  LYS A CG    1 
ATOM   150  C CD    A LYS A  1 33  ? 7.040   43.120 -30.470 0.70 17.09 ? 15  LYS A CD    1 
ATOM   151  C CD    B LYS A  1 33  ? 5.933   42.939 -29.003 0.30 16.50 ? 15  LYS A CD    1 
ATOM   152  N N     . ALA A  1 34  ? 10.273  42.731 -25.869 1.00 13.37 ? 16  ALA A N     1 
ATOM   153  C CA    . ALA A  1 34  ? 10.435  42.269 -24.486 1.00 13.09 ? 16  ALA A CA    1 
ATOM   154  C C     . ALA A  1 34  ? 11.093  43.341 -23.653 1.00 13.66 ? 16  ALA A C     1 
ATOM   155  O O     . ALA A  1 34  ? 10.671  43.591 -22.490 1.00 13.41 ? 16  ALA A O     1 
ATOM   156  C CB    . ALA A  1 34  ? 11.252  40.985 -24.428 1.00 12.30 ? 16  ALA A CB    1 
ATOM   157  N N     . LYS A  1 35  ? 12.117  43.992 -24.222 1.00 14.22 ? 17  LYS A N     1 
ATOM   158  C CA    . LYS A  1 35  ? 12.848  45.054 -23.475 1.00 15.38 ? 17  LYS A CA    1 
ATOM   159  C C     . LYS A  1 35  ? 11.899  46.212 -23.131 1.00 16.13 ? 17  LYS A C     1 
ATOM   160  O O     . LYS A  1 35  ? 11.832  46.695 -21.951 1.00 16.18 ? 17  LYS A O     1 
ATOM   161  C CB    . LYS A  1 35  ? 14.016  45.566 -24.267 1.00 16.96 ? 17  LYS A CB    1 
ATOM   162  C CG    . LYS A  1 35  ? 14.985  46.352 -23.411 1.00 18.67 ? 17  LYS A CG    1 
ATOM   163  C CD    . LYS A  1 35  ? 16.181  46.796 -24.187 1.00 20.97 ? 17  LYS A CD    1 
ATOM   164  C CE    . LYS A  1 35  ? 17.040  47.637 -23.203 1.00 22.78 ? 17  LYS A CE    1 
ATOM   165  N NZ    . LYS A  1 35  ? 18.012  48.387 -23.938 1.00 23.54 ? 17  LYS A NZ    1 
ATOM   166  N N     . THR A  1 36  ? 11.104  46.629 -24.108 1.00 15.87 ? 18  THR A N     1 
ATOM   167  C CA    . THR A  1 36  ? 10.114  47.698 -23.864 1.00 17.06 ? 18  THR A CA    1 
ATOM   168  C C     . THR A  1 36  ? 9.065   47.268 -22.794 1.00 16.83 ? 18  THR A C     1 
ATOM   169  O O     . THR A  1 36  ? 8.645   48.102 -21.931 1.00 17.12 ? 18  THR A O     1 
ATOM   170  C CB    . THR A  1 36  ? 9.391   48.028 -25.175 1.00 17.92 ? 18  THR A CB    1 
ATOM   171  O OG1   . THR A  1 36  ? 10.363  48.478 -26.129 1.00 18.00 ? 18  THR A OG1   1 
ATOM   172  C CG2   . THR A  1 36  ? 8.244   49.084 -25.035 1.00 19.39 ? 18  THR A CG2   1 
ATOM   173  N N     . TYR A  1 37  ? 8.612   46.015 -22.889 1.00 15.71 ? 19  TYR A N     1 
ATOM   174  C CA    . TYR A  1 37  ? 7.632   45.491 -21.912 1.00 16.14 ? 19  TYR A CA    1 
ATOM   175  C C     . TYR A  1 37  ? 8.192   45.611 -20.504 1.00 15.66 ? 19  TYR A C     1 
ATOM   176  O O     . TYR A  1 37  ? 7.503   46.199 -19.642 1.00 16.75 ? 19  TYR A O     1 
ATOM   177  C CB    . TYR A  1 37  ? 7.246   44.040 -22.186 1.00 15.58 ? 19  TYR A CB    1 
ATOM   178  C CG    . TYR A  1 37  ? 6.455   43.406 -21.072 1.00 16.19 ? 19  TYR A CG    1 
ATOM   179  C CD1   . TYR A  1 37  ? 5.070   43.562 -20.982 1.00 17.78 ? 19  TYR A CD1   1 
ATOM   180  C CD2   . TYR A  1 37  ? 7.106   42.639 -20.107 1.00 15.75 ? 19  TYR A CD2   1 
ATOM   181  C CE1   . TYR A  1 37  ? 4.337   42.971 -19.921 1.00 18.44 ? 19  TYR A CE1   1 
ATOM   182  C CE2   . TYR A  1 37  ? 6.385   42.052 -19.029 1.00 16.40 ? 19  TYR A CE2   1 
ATOM   183  C CZ    . TYR A  1 37  ? 4.992   42.238 -18.968 1.00 17.82 ? 19  TYR A CZ    1 
ATOM   184  O OH    . TYR A  1 37  ? 4.309   41.652 -17.912 1.00 18.96 ? 19  TYR A OH    1 
ATOM   185  N N     . TRP A  1 38  ? 9.394   45.108 -20.264 1.00 14.35 ? 20  TRP A N     1 
ATOM   186  C CA    . TRP A  1 38  ? 9.940   45.105 -18.879 1.00 14.35 ? 20  TRP A CA    1 
ATOM   187  C C     . TRP A  1 38  ? 10.252  46.519 -18.415 1.00 15.96 ? 20  TRP A C     1 
ATOM   188  O O     . TRP A  1 38  ? 10.094  46.817 -17.205 1.00 15.69 ? 20  TRP A O     1 
ATOM   189  C CB    . TRP A  1 38  ? 11.155  44.161 -18.742 1.00 13.28 ? 20  TRP A CB    1 
ATOM   190  C CG    . TRP A  1 38  ? 10.678  42.740 -18.758 1.00 12.71 ? 20  TRP A CG    1 
ATOM   191  C CD1   . TRP A  1 38  ? 10.796  41.854 -19.765 1.00 12.21 ? 20  TRP A CD1   1 
ATOM   192  C CD2   . TRP A  1 38  ? 9.914   42.083 -17.732 1.00 12.68 ? 20  TRP A CD2   1 
ATOM   193  N NE1   . TRP A  1 38  ? 10.188  40.645 -19.405 1.00 12.00 ? 20  TRP A NE1   1 
ATOM   194  C CE2   . TRP A  1 38  ? 9.656   40.770 -18.160 1.00 12.17 ? 20  TRP A CE2   1 
ATOM   195  C CE3   . TRP A  1 38  ? 9.457   42.485 -16.467 1.00 13.48 ? 20  TRP A CE3   1 
ATOM   196  C CZ2   . TRP A  1 38  ? 8.938   39.854 -17.388 1.00 12.44 ? 20  TRP A CZ2   1 
ATOM   197  C CZ3   . TRP A  1 38  ? 8.748   41.581 -15.687 1.00 13.50 ? 20  TRP A CZ3   1 
ATOM   198  C CH2   . TRP A  1 38  ? 8.467   40.293 -16.150 1.00 13.31 ? 20  TRP A CH2   1 
ATOM   199  N N     . LYS A  1 39  ? 10.626  47.404 -19.332 1.00 16.84 ? 21  LYS A N     1 
ATOM   200  C CA    . LYS A  1 39  ? 10.908  48.803 -18.942 1.00 19.71 ? 21  LYS A CA    1 
ATOM   201  C C     . LYS A  1 39  ? 9.678   49.485 -18.360 1.00 20.53 ? 21  LYS A C     1 
ATOM   202  O O     . LYS A  1 39  ? 9.828   50.487 -17.609 1.00 21.89 ? 21  LYS A O     1 
ATOM   203  C CB    . LYS A  1 39  ? 11.495  49.554 -20.141 1.00 21.23 ? 21  LYS A CB    1 
ATOM   204  C CG    . LYS A  1 39  ? 11.719  51.021 -20.029 1.00 24.83 ? 21  LYS A CG    1 
ATOM   205  C CD    . LYS A  1 39  ? 12.617  51.480 -18.917 1.00 26.48 ? 21  LYS A CD    1 
ATOM   206  C CE    . LYS A  1 39  ? 12.546  53.020 -18.925 1.00 29.66 ? 21  LYS A CE    1 
ATOM   207  N NZ    . LYS A  1 39  ? 13.577  53.460 -17.970 1.00 30.98 ? 21  LYS A NZ    1 
ATOM   208  N N     . GLN A  1 40  ? 8.474   48.993 -18.648 1.00 20.15 ? 22  GLN A N     1 
ATOM   209  C CA    . GLN A  1 40  ? 7.250   49.635 -18.106 1.00 21.64 ? 22  GLN A CA    1 
ATOM   210  C C     . GLN A  1 40  ? 6.528   48.813 -17.041 1.00 20.91 ? 22  GLN A C     1 
ATOM   211  O O     . GLN A  1 40  ? 5.378   49.120 -16.688 1.00 22.40 ? 22  GLN A O     1 
ATOM   212  C CB    . GLN A  1 40  ? 6.339   50.067 -19.231 1.00 23.07 ? 22  GLN A CB    1 
ATOM   213  C CG    . GLN A  1 40  ? 5.814   49.006 -20.174 1.00 23.36 ? 22  GLN A CG    1 
ATOM   214  C CD    . GLN A  1 40  ? 4.623   48.227 -19.638 1.00 24.04 ? 22  GLN A CD    1 
ATOM   215  O OE1   . GLN A  1 40  ? 3.529   48.793 -19.508 1.00 26.24 ? 22  GLN A OE1   1 
ATOM   216  N NE2   . GLN A  1 40  ? 4.799   46.908 -19.453 1.00 23.23 ? 22  GLN A NE2   1 
ATOM   217  N N     . ILE A  1 41  ? 7.235   47.830 -16.461 1.00 19.09 ? 23  ILE A N     1 
ATOM   218  C CA    . ILE A  1 41  ? 6.736   47.069 -15.332 1.00 18.67 ? 23  ILE A CA    1 
ATOM   219  C C     . ILE A  1 41  ? 7.303   47.697 -14.042 1.00 19.25 ? 23  ILE A C     1 
ATOM   220  O O     . ILE A  1 41  ? 8.484   47.988 -13.968 1.00 18.65 ? 23  ILE A O     1 
ATOM   221  C CB    . ILE A  1 41  ? 7.194   45.604 -15.451 1.00 17.24 ? 23  ILE A CB    1 
ATOM   222  C CG1   . ILE A  1 41  ? 6.449   44.922 -16.620 1.00 16.89 ? 23  ILE A CG1   1 
ATOM   223  C CG2   . ILE A  1 41  ? 7.039   44.852 -14.163 1.00 17.17 ? 23  ILE A CG2   1 
ATOM   224  C CD1   . ILE A  1 41  ? 4.979   44.821 -16.442 1.00 17.64 ? 23  ILE A CD1   1 
ATOM   225  N N     . PRO A  1 42  ? 6.465   47.820 -12.988 1.00 20.25 ? 24  PRO A N     1 
ATOM   226  C CA    . PRO A  1 42  ? 7.030   48.370 -11.755 1.00 20.59 ? 24  PRO A CA    1 
ATOM   227  C C     . PRO A  1 42  ? 8.058   47.475 -11.103 1.00 19.31 ? 24  PRO A C     1 
ATOM   228  O O     . PRO A  1 42  ? 8.012   46.206 -11.207 1.00 18.02 ? 24  PRO A O     1 
ATOM   229  C CB    . PRO A  1 42  ? 5.830   48.562 -10.852 1.00 21.96 ? 24  PRO A CB    1 
ATOM   230  C CG    . PRO A  1 42  ? 4.894   47.515 -11.322 1.00 21.92 ? 24  PRO A CG    1 
ATOM   231  C CD    . PRO A  1 42  ? 5.071   47.410 -12.828 1.00 21.05 ? 24  PRO A CD    1 
ATOM   232  N N     . PRO A  1 43  ? 9.077   48.108 -10.490 1.00 19.60 ? 25  PRO A N     1 
ATOM   233  C CA    . PRO A  1 43  ? 10.198  47.368 -9.913  1.00 18.62 ? 25  PRO A CA    1 
ATOM   234  C C     . PRO A  1 43  ? 9.856   46.759 -8.546  1.00 18.78 ? 25  PRO A C     1 
ATOM   235  O O     . PRO A  1 43  ? 10.427  47.135 -7.478  1.00 18.99 ? 25  PRO A O     1 
ATOM   236  C CB    . PRO A  1 43  ? 11.282  48.392 -9.847  1.00 19.27 ? 25  PRO A CB    1 
ATOM   237  C CG    . PRO A  1 43  ? 10.552  49.628 -9.486  1.00 21.02 ? 25  PRO A CG    1 
ATOM   238  C CD    . PRO A  1 43  ? 9.269   49.566 -10.328 1.00 21.34 ? 25  PRO A CD    1 
ATOM   239  N N     . THR A  1 44  ? 8.875   45.871 -8.579  1.00 18.31 ? 26  THR A N     1 
ATOM   240  C CA    . THR A  1 44  ? 8.325   45.273 -7.383  1.00 18.58 ? 26  THR A CA    1 
ATOM   241  C C     . THR A  1 44  ? 8.241   43.776 -7.507  1.00 17.66 ? 26  THR A C     1 
ATOM   242  O O     . THR A  1 44  ? 8.237   43.215 -8.614  1.00 16.25 ? 26  THR A O     1 
ATOM   243  C CB    . THR A  1 44  ? 6.894   45.794 -7.122  1.00 19.95 ? 26  THR A CB    1 
ATOM   244  O OG1   . THR A  1 44  ? 6.001   45.383 -8.188  1.00 19.25 ? 26  THR A OG1   1 
ATOM   245  C CG2   . THR A  1 44  ? 6.855   47.291 -6.984  1.00 21.37 ? 26  THR A CG2   1 
ATOM   246  N N     . VAL A  1 45  ? 8.078   43.092 -6.381  1.00 17.68 ? 27  VAL A N     1 
ATOM   247  C CA    . VAL A  1 45  ? 7.834   41.642 -6.462  1.00 17.09 ? 27  VAL A CA    1 
ATOM   248  C C     . VAL A  1 45  ? 6.598   41.263 -7.329  1.00 17.26 ? 27  VAL A C     1 
ATOM   249  O O     . VAL A  1 45  ? 6.622   40.305 -8.082  1.00 15.80 ? 27  VAL A O     1 
ATOM   250  C CB    . VAL A  1 45  ? 7.733   41.022 -5.066  1.00 17.86 ? 27  VAL A CB    1 
ATOM   251  C CG1   . VAL A  1 45  ? 7.225   39.578 -5.071  1.00 17.62 ? 27  VAL A CG1   1 
ATOM   252  C CG2   . VAL A  1 45  ? 9.108   41.022 -4.462  1.00 17.53 ? 27  VAL A CG2   1 
ATOM   253  N N     . ASP A  1 46  ? 5.513   42.023 -7.173  1.00 18.60 ? 28  ASP A N     1 
ATOM   254  C CA    . ASP A  1 46  ? 4.354   41.730 -7.992  1.00 19.50 ? 28  ASP A CA    1 
ATOM   255  C C     . ASP A  1 46  ? 4.674   41.975 -9.485  1.00 18.75 ? 28  ASP A C     1 
ATOM   256  O O     . ASP A  1 46  ? 4.166   41.238 -10.367 1.00 18.97 ? 28  ASP A O     1 
ATOM   257  C CB    . ASP A  1 46  ? 3.142   42.514 -7.522  1.00 21.77 ? 28  ASP A CB    1 
ATOM   258  C CG    . ASP A  1 46  ? 1.819   41.874 -7.979  1.00 23.12 ? 28  ASP A CG    1 
ATOM   259  O OD1   . ASP A  1 46  ? 1.561   40.709 -7.603  1.00 22.42 ? 28  ASP A OD1   1 
ATOM   260  O OD2   . ASP A  1 46  ? 1.038   42.579 -8.684  1.00 25.20 ? 28  ASP A OD2   1 
ATOM   261  N N     . GLY A  1 47  ? 5.518   42.956 -9.795  1.00 18.10 ? 29  GLY A N     1 
ATOM   262  C CA    . GLY A  1 47  ? 5.967   43.135 -11.166 1.00 17.56 ? 29  GLY A CA    1 
ATOM   263  C C     . GLY A  1 47  ? 6.793   41.960 -11.705 1.00 15.90 ? 29  GLY A C     1 
ATOM   264  O O     . GLY A  1 47  ? 6.532   41.466 -12.842 1.00 15.47 ? 29  GLY A O     1 
ATOM   265  N N     . MET A  1 48  ? 7.726   41.472 -10.886 1.00 14.67 ? 30  MET A N     1 
ATOM   266  C CA    . MET A  1 48  ? 8.555   40.329 -11.247 1.00 13.84 ? 30  MET A CA    1 
ATOM   267  C C     . MET A  1 48  ? 7.683   39.109 -11.516 1.00 13.71 ? 30  MET A C     1 
ATOM   268  O O     . MET A  1 48  ? 7.990   38.307 -12.392 1.00 13.41 ? 30  MET A O     1 
ATOM   269  C CB    . MET A  1 48  ? 9.545   39.965 -10.131 1.00 13.33 ? 30  MET A CB    1 
ATOM   270  C CG    . MET A  1 48  ? 10.492  41.065 -9.719  1.00 13.95 ? 30  MET A CG    1 
ATOM   271  S SD    . MET A  1 48  ? 11.552  41.750 -10.996 1.00 13.52 ? 30  MET A SD    1 
ATOM   272  C CE    . MET A  1 48  ? 10.600  43.111 -11.548 1.00 14.46 ? 30  MET A CE    1 
ATOM   273  N N     . LEU A  1 49  ? 6.594   38.972 -10.740 1.00 14.00 ? 31  LEU A N     1 
ATOM   274  C CA    . LEU A  1 49  ? 5.785   37.773 -10.789 1.00 13.86 ? 31  LEU A CA    1 
ATOM   275  C C     . LEU A  1 49  ? 4.473   37.984 -11.526 1.00 14.54 ? 31  LEU A C     1 
ATOM   276  O O     . LEU A  1 49  ? 3.539   37.203 -11.388 1.00 14.69 ? 31  LEU A O     1 
ATOM   277  C CB    . LEU A  1 49  ? 5.598   37.197 -9.401  1.00 14.40 ? 31  LEU A CB    1 
ATOM   278  C CG    . LEU A  1 49  ? 6.881   36.791 -8.700  1.00 13.96 ? 31  LEU A CG    1 
ATOM   279  C CD1   . LEU A  1 49  ? 6.598   36.114 -7.336  1.00 14.68 ? 31  LEU A CD1   1 
ATOM   280  C CD2   . LEU A  1 49  ? 7.729   35.911 -9.575  1.00 13.27 ? 31  LEU A CD2   1 
ATOM   281  N N     . GLY A  1 50  ? 4.379   39.025 -12.336 1.00 14.77 ? 32  GLY A N     1 
ATOM   282  C CA    . GLY A  1 50  ? 3.217   39.120 -13.229 1.00 15.81 ? 32  GLY A CA    1 
ATOM   283  C C     . GLY A  1 50  ? 1.863   39.174 -12.532 1.00 17.02 ? 32  GLY A C     1 
ATOM   284  O O     . GLY A  1 50  ? 0.870   38.698 -13.059 1.00 18.03 ? 32  GLY A O     1 
ATOM   285  N N     . GLY A  1 51  ? 1.798   39.848 -11.389 1.00 17.29 ? 33  GLY A N     1 
ATOM   286  C CA    . GLY A  1 51  ? 0.590   39.868 -10.592 1.00 18.45 ? 33  GLY A CA    1 
ATOM   287  C C     . GLY A  1 51  ? 0.396   38.721 -9.603  1.00 18.44 ? 33  GLY A C     1 
ATOM   288  O O     . GLY A  1 51  ? -0.637  38.709 -8.828  1.00 19.87 ? 33  GLY A O     1 
ATOM   289  N N     . TYR A  1 52  ? 1.362   37.841 -9.550  1.00 17.05 ? 34  TYR A N     1 
ATOM   290  C CA    . TYR A  1 52  ? 1.356   36.677 -8.653  1.00 17.13 ? 34  TYR A CA    1 
ATOM   291  C C     . TYR A  1 52  ? 2.386   36.848 -7.547  1.00 16.47 ? 34  TYR A C     1 
ATOM   292  O O     . TYR A  1 52  ? 2.953   35.869 -7.044  1.00 15.69 ? 34  TYR A O     1 
ATOM   293  C CB    . TYR A  1 52  ? 1.592   35.394 -9.438  1.00 16.44 ? 34  TYR A CB    1 
ATOM   294  C CG    . TYR A  1 52  ? 0.398   35.004 -10.282 1.00 17.23 ? 34  TYR A CG    1 
ATOM   295  C CD1   . TYR A  1 52  ? -0.648  34.271 -9.782  1.00 18.39 ? 34  TYR A CD1   1 
ATOM   296  C CD2   . TYR A  1 52  ? 0.347   35.395 -11.636 1.00 17.29 ? 34  TYR A CD2   1 
ATOM   297  C CE1   . TYR A  1 52  ? -1.751  33.941 -10.545 1.00 19.18 ? 34  TYR A CE1   1 
ATOM   298  C CE2   . TYR A  1 52  ? -0.734  35.049 -12.420 1.00 17.99 ? 34  TYR A CE2   1 
ATOM   299  C CZ    . TYR A  1 52  ? -1.784  34.342 -11.883 1.00 19.05 ? 34  TYR A CZ    1 
ATOM   300  O OH    . TYR A  1 52  ? -2.861  34.009 -12.673 1.00 20.05 ? 34  TYR A OH    1 
ATOM   301  N N     . GLY A  1 53  ? 2.622   38.083 -7.104  1.00 17.13 ? 35  GLY A N     1 
ATOM   302  C CA    . GLY A  1 53  ? 3.597   38.303 -6.016  1.00 17.16 ? 35  GLY A CA    1 
ATOM   303  C C     . GLY A  1 53  ? 3.337   37.433 -4.789  1.00 17.75 ? 35  GLY A C     1 
ATOM   304  O O     . GLY A  1 53  ? 4.252   36.978 -4.106  1.00 17.25 ? 35  GLY A O     1 
ATOM   305  N N     . HIS A  1 54  ? 2.063   37.215 -4.522  1.00 18.93 ? 36  HIS A N     1 
ATOM   306  C CA    . HIS A  1 54  ? 1.653   36.360 -3.422  1.00 19.77 ? 36  HIS A CA    1 
ATOM   307  C C     . HIS A  1 54  ? 2.189   34.922 -3.409  1.00 18.59 ? 36  HIS A C     1 
ATOM   308  O O     . HIS A  1 54  ? 2.161   34.314 -2.327  1.00 19.03 ? 36  HIS A O     1 
ATOM   309  C CB    . HIS A  1 54  ? 0.148   36.352 -3.253  1.00 21.92 ? 36  HIS A CB    1 
ATOM   310  C CG    . HIS A  1 54  ? -0.588  35.650 -4.359  1.00 22.64 ? 36  HIS A CG    1 
ATOM   311  N ND1   . HIS A  1 54  ? -0.990  34.336 -4.257  1.00 23.28 ? 36  HIS A ND1   1 
ATOM   312  C CD2   . HIS A  1 54  ? -1.044  36.094 -5.560  1.00 23.35 ? 36  HIS A CD2   1 
ATOM   313  C CE1   . HIS A  1 54  ? -1.628  33.985 -5.354  1.00 23.53 ? 36  HIS A CE1   1 
ATOM   314  N NE2   . HIS A  1 54  ? -1.677  35.027 -6.161  1.00 23.65 ? 36  HIS A NE2   1 
ATOM   315  N N     . ILE A  1 55  ? 2.565   34.345 -4.542  1.00 17.12 ? 37  ILE A N     1 
ATOM   316  C CA    . ILE A  1 55  ? 3.133   32.996 -4.543  1.00 16.54 ? 37  ILE A CA    1 
ATOM   317  C C     . ILE A  1 55  ? 4.620   32.963 -4.245  1.00 15.10 ? 37  ILE A C     1 
ATOM   318  O O     . ILE A  1 55  ? 5.233   31.882 -4.294  1.00 14.65 ? 37  ILE A O     1 
ATOM   319  C CB    . ILE A  1 55  ? 2.922   32.260 -5.926  1.00 16.38 ? 37  ILE A CB    1 
ATOM   320  C CG1   . ILE A  1 55  ? 3.842   32.793 -7.042  1.00 15.84 ? 37  ILE A CG1   1 
ATOM   321  C CG2   . ILE A  1 55  ? 1.455   32.353 -6.273  1.00 17.57 ? 37  ILE A CG2   1 
ATOM   322  C CD1   . ILE A  1 55  ? 3.937   31.876 -8.236  1.00 15.42 ? 37  ILE A CD1   1 
ATOM   323  N N     . SER A  1 56  ? 5.242   34.105 -3.942  1.00 14.38 ? 38  SER A N     1 
ATOM   324  C CA    . SER A  1 56  ? 6.680   34.146 -3.857  1.00 13.32 ? 38  SER A CA    1 
ATOM   325  C C     . SER A  1 56  ? 7.244   33.212 -2.786  1.00 13.11 ? 38  SER A C     1 
ATOM   326  O O     . SER A  1 56  ? 8.299   32.615 -3.003  1.00 12.41 ? 38  SER A O     1 
ATOM   327  C CB    . SER A  1 56  ? 7.188   35.576 -3.595  1.00 13.54 ? 38  SER A CB    1 
ATOM   328  O OG    . SER A  1 56  ? 8.620   35.626 -3.692  1.00 12.81 ? 38  SER A OG    1 
ATOM   329  N N     . SER A  1 57  ? 6.592   33.143 -1.625  1.00 14.01 ? 39  SER A N     1 
ATOM   330  C CA    . SER A  1 57  ? 7.119   32.332 -0.518  1.00 14.10 ? 39  SER A CA    1 
ATOM   331  C C     . SER A  1 57  ? 7.028   30.822 -0.828  1.00 14.10 ? 39  SER A C     1 
ATOM   332  O O     . SER A  1 57  ? 7.967   30.045 -0.506  1.00 13.63 ? 39  SER A O     1 
ATOM   333  C CB    . SER A  1 57  ? 6.433   32.651 0.778   1.00 15.20 ? 39  SER A CB    1 
ATOM   334  O OG    . SER A  1 57  ? 7.066   32.055 1.877   1.00 15.10 ? 39  SER A OG    1 
ATOM   335  N N     . ILE A  1 58  ? 5.910   30.398 -1.442  1.00 14.62 ? 40  ILE A N     1 
ATOM   336  C CA    . ILE A  1 58  ? 5.778   29.002 -1.919  1.00 14.73 ? 40  ILE A CA    1 
ATOM   337  C C     . ILE A  1 58  ? 6.947   28.681 -2.846  1.00 13.66 ? 40  ILE A C     1 
ATOM   338  O O     . ILE A  1 58  ? 7.621   27.644 -2.728  1.00 13.35 ? 40  ILE A O     1 
ATOM   339  C CB    . ILE A  1 58  ? 4.425   28.864 -2.667  1.00 15.53 ? 40  ILE A CB    1 
ATOM   340  C CG1   . ILE A  1 58  ? 3.294   28.897 -1.687  1.00 16.98 ? 40  ILE A CG1   1 
ATOM   341  C CG2   . ILE A  1 58  ? 4.405   27.577 -3.511  1.00 15.41 ? 40  ILE A CG2   1 
ATOM   342  C CD1   . ILE A  1 58  ? 1.940   29.038 -2.287  1.00 17.81 ? 40  ILE A CD1   1 
ATOM   343  N N     . ASP A  1 59  ? 7.215   29.590 -3.806  1.00 13.12 ? 41  ASP A N     1 
ATOM   344  C CA    . ASP A  1 59  ? 8.276   29.415 -4.767  1.00 12.34 ? 41  ASP A CA    1 
ATOM   345  C C     . ASP A  1 59  ? 9.634   29.304 -4.093  1.00 12.08 ? 41  ASP A C     1 
ATOM   346  O O     . ASP A  1 59  ? 10.412  28.348 -4.378  1.00 11.92 ? 41  ASP A O     1 
ATOM   347  C CB    . ASP A  1 59  ? 8.297   30.618 -5.780  1.00 11.96 ? 41  ASP A CB    1 
ATOM   348  C CG    . ASP A  1 59  ? 9.506   30.613 -6.628  1.00 11.21 ? 41  ASP A CG    1 
ATOM   349  O OD1   . ASP A  1 59  ? 9.716   29.578 -7.406  1.00 10.87 ? 41  ASP A OD1   1 
ATOM   350  O OD2   . ASP A  1 59  ? 10.330  31.572 -6.511  1.00 10.95 ? 41  ASP A OD2   1 
ATOM   351  N N     . ILE A  1 60  ? 9.947   30.252 -3.207  1.00 12.29 ? 42  ILE A N     1 
ATOM   352  C CA    . ILE A  1 60  ? 11.258  30.279 -2.562  1.00 12.09 ? 42  ILE A CA    1 
ATOM   353  C C     . ILE A  1 60  ? 11.459  29.042 -1.671  1.00 12.37 ? 42  ILE A C     1 
ATOM   354  O O     . ILE A  1 60  ? 12.558  28.466 -1.710  1.00 12.02 ? 42  ILE A O     1 
ATOM   355  C CB    . ILE A  1 60  ? 11.477  31.571 -1.741  1.00 12.70 ? 42  ILE A CB    1 
ATOM   356  C CG1   . ILE A  1 60  ? 11.534  32.782 -2.628  1.00 12.74 ? 42  ILE A CG1   1 
ATOM   357  C CG2   . ILE A  1 60  ? 12.744  31.491 -0.877  1.00 12.79 ? 42  ILE A CG2   1 
ATOM   358  C CD1   . ILE A  1 60  ? 12.780  32.917 -3.464  1.00 12.40 ? 42  ILE A CD1   1 
ATOM   359  N N     . ASN A  1 61  ? 10.443  28.642 -0.925  1.00 12.79 ? 43  ASN A N     1 
ATOM   360  C CA    . ASN A  1 61  ? 10.561  27.454 -0.072  1.00 13.43 ? 43  ASN A CA    1 
ATOM   361  C C     . ASN A  1 61  ? 10.909  26.224 -0.917  1.00 13.08 ? 43  ASN A C     1 
ATOM   362  O O     . ASN A  1 61  ? 11.780  25.394 -0.507  1.00 13.13 ? 43  ASN A O     1 
ATOM   363  C CB    . ASN A  1 61  ? 9.330   27.204 0.770   1.00 14.41 ? 43  ASN A CB    1 
ATOM   364  C CG    . ASN A  1 61  ? 9.287   28.106 2.017   1.00 15.24 ? 43  ASN A CG    1 
ATOM   365  O OD1   . ASN A  1 61  ? 10.267  28.722 2.411   1.00 14.78 ? 43  ASN A OD1   1 
ATOM   366  N ND2   . ASN A  1 61  ? 8.147   28.162 2.637   1.00 16.36 ? 43  ASN A ND2   1 
ATOM   367  N N     . SER A  1 62  ? 10.199  26.061 -2.012  1.00 12.92 ? 44  SER A N     1 
ATOM   368  C CA    . SER A  1 62  ? 10.452  24.912 -2.889  1.00 12.97 ? 44  SER A CA    1 
ATOM   369  C C     . SER A  1 62  ? 11.833  24.960 -3.548  1.00 12.33 ? 44  SER A C     1 
ATOM   370  O O     . SER A  1 62  ? 12.552  23.939 -3.572  1.00 12.32 ? 44  SER A O     1 
ATOM   371  C CB    . SER A  1 62  ? 9.356   24.756 -3.941  1.00 13.16 ? 44  SER A CB    1 
ATOM   372  O OG    . SER A  1 62  ? 8.156   24.410 -3.333  1.00 14.32 ? 44  SER A OG    1 
ATOM   373  N N     . SER A  1 63  ? 12.251  26.135 -3.979  1.00 11.49 ? 45  SER A N     1 
ATOM   374  C CA    . SER A  1 63  ? 13.581  26.273 -4.559  1.00 11.11 ? 45  SER A CA    1 
ATOM   375  C C     . SER A  1 63  ? 14.648  25.958 -3.537  1.00 11.34 ? 45  SER A C     1 
ATOM   376  O O     . SER A  1 63  ? 15.667  25.316 -3.883  1.00 11.21 ? 45  SER A O     1 
ATOM   377  C CB    . SER A  1 63  ? 13.794  27.699 -5.068  1.00 10.60 ? 45  SER A CB    1 
ATOM   378  O OG    . SER A  1 63  ? 12.959  27.963 -6.203  1.00 10.65 ? 45  SER A OG    1 
ATOM   379  N N     . ARG A  1 64  ? 14.432  26.383 -2.299  1.00 11.85 ? 46  ARG A N     1 
ATOM   380  C CA    . ARG A  1 64  ? 15.434  26.111 -1.277  1.00 12.37 ? 46  ARG A CA    1 
ATOM   381  C C     . ARG A  1 64  ? 15.611  24.597 -1.048  1.00 12.94 ? 46  ARG A C     1 
ATOM   382  O O     . ARG A  1 64  ? 16.728  24.097 -0.921  1.00 12.90 ? 46  ARG A O     1 
ATOM   383  C CB    . ARG A  1 64  ? 15.065  26.816 0.051   1.00 13.24 ? 46  ARG A CB    1 
ATOM   384  C CG    . ARG A  1 64  ? 16.108  26.636 1.142   1.00 13.72 ? 46  ARG A CG    1 
ATOM   385  C CD    . ARG A  1 64  ? 15.677  27.329 2.423   1.00 14.76 ? 46  ARG A CD    1 
ATOM   386  N NE    . ARG A  1 64  ? 15.680  28.777 2.171   1.00 14.45 ? 46  ARG A NE    1 
ATOM   387  C CZ    . ARG A  1 64  ? 14.641  29.604 2.257   1.00 15.04 ? 46  ARG A CZ    1 
ATOM   388  N NH1   . ARG A  1 64  ? 13.438  29.173 2.640   1.00 15.66 ? 46  ARG A NH1   1 
ATOM   389  N NH2   . ARG A  1 64  ? 14.831  30.881 1.934   1.00 14.79 ? 46  ARG A NH2   1 
ATOM   390  N N     . LYS A  1 65  ? 14.511  23.885 -0.906  1.00 13.63 ? 47  LYS A N     1 
ATOM   391  C CA    . LYS A  1 65  ? 14.578  22.458 -0.701  1.00 14.82 ? 47  LYS A CA    1 
ATOM   392  C C     . LYS A  1 65  ? 15.261  21.779 -1.890  1.00 14.39 ? 47  LYS A C     1 
ATOM   393  O O     . LYS A  1 65  ? 16.021  20.797 -1.688  1.00 14.53 ? 47  LYS A O     1 
ATOM   394  C CB    . LYS A  1 65  ? 13.139  21.891 -0.540  1.00 16.45 ? 47  LYS A CB    1 
ATOM   395  C CG    . LYS A  1 65  ? 13.077  20.418 -0.105  1.00 17.90 ? 47  LYS A CG    1 
ATOM   396  C CD    . LYS A  1 65  ? 11.639  19.912 0.150   1.00 19.96 ? 47  LYS A CD    1 
ATOM   397  N N     . PHE A  1 66  ? 14.882  22.200 -3.079  1.00 13.98 ? 48  PHE A N     1 
ATOM   398  C CA    . PHE A  1 66  ? 15.456  21.678 -4.305  1.00 13.81 ? 48  PHE A CA    1 
ATOM   399  C C     . PHE A  1 66  ? 16.994  21.844 -4.309  1.00 14.07 ? 48  PHE A C     1 
ATOM   400  O O     . PHE A  1 66  ? 17.755  20.891 -4.592  1.00 13.68 ? 48  PHE A O     1 
ATOM   401  C CB    . PHE A  1 66  ? 14.849  22.362 -5.526  1.00 13.33 ? 48  PHE A CB    1 
ATOM   402  C CG    . PHE A  1 66  ? 15.256  21.736 -6.876  1.00 12.92 ? 48  PHE A CG    1 
ATOM   403  C CD1   . PHE A  1 66  ? 14.722  20.504 -7.254  1.00 13.66 ? 48  PHE A CD1   1 
ATOM   404  C CD2   . PHE A  1 66  ? 16.089  22.402 -7.765  1.00 12.27 ? 48  PHE A CD2   1 
ATOM   405  C CE1   . PHE A  1 66  ? 15.080  19.954 -8.508  1.00 13.57 ? 48  PHE A CE1   1 
ATOM   406  C CE2   . PHE A  1 66  ? 16.432  21.852 -9.001  1.00 11.94 ? 48  PHE A CE2   1 
ATOM   407  C CZ    . PHE A  1 66  ? 15.898  20.636 -9.353  1.00 12.62 ? 48  PHE A CZ    1 
ATOM   408  N N     . LEU A  1 67  ? 17.442  23.054 -4.035  1.00 13.91 ? 49  LEU A N     1 
ATOM   409  C CA    . LEU A  1 67  ? 18.864  23.363 -4.006  1.00 14.37 ? 49  LEU A CA    1 
ATOM   410  C C     . LEU A  1 67  ? 19.622  22.628 -2.929  1.00 15.81 ? 49  LEU A C     1 
ATOM   411  O O     . LEU A  1 67  ? 20.764  22.134 -3.133  1.00 15.05 ? 49  LEU A O     1 
ATOM   412  C CB    . LEU A  1 67  ? 19.019  24.869 -3.876  1.00 14.61 ? 49  LEU A CB    1 
ATOM   413  C CG    . LEU A  1 67  ? 20.423  25.394 -3.829  1.00 15.18 ? 49  LEU A CG    1 
ATOM   414  C CD1   . LEU A  1 67  ? 21.153  24.941 -5.089  1.00 15.04 ? 49  LEU A CD1   1 
ATOM   415  C CD2   . LEU A  1 67  ? 20.361  26.915 -3.699  1.00 15.55 ? 49  LEU A CD2   1 
ATOM   416  N N     . GLN A  1 68  ? 18.998  22.486 -1.767  1.00 17.14 ? 50  GLN A N     1 
ATOM   417  C CA    . GLN A  1 68  ? 19.714  21.843 -0.641  1.00 19.80 ? 50  GLN A CA    1 
ATOM   418  C C     . GLN A  1 68  ? 20.120  20.380 -0.860  1.00 20.57 ? 50  GLN A C     1 
ATOM   419  O O     . GLN A  1 68  ? 21.097  19.923 -0.246  1.00 20.75 ? 50  GLN A O     1 
ATOM   420  C CB    . GLN A  1 68  ? 18.871  21.980 0.648   1.00 22.80 ? 50  GLN A CB    1 
ATOM   421  C CG    . GLN A  1 68  ? 18.977  23.398 1.138   1.00 23.97 ? 50  GLN A CG    1 
ATOM   422  C CD    . GLN A  1 68  ? 18.066  23.644 2.274   1.00 27.31 ? 50  GLN A CD    1 
ATOM   423  O OE1   . GLN A  1 68  ? 16.977  23.008 2.392   1.00 29.54 ? 50  GLN A OE1   1 
ATOM   424  N NE2   . GLN A  1 68  ? 18.510  24.504 3.170   1.00 29.85 ? 50  GLN A NE2   1 
ATOM   425  N N     . ARG A  1 69  ? 19.428  19.730 -1.773  1.00 21.36 ? 51  ARG A N     1 
ATOM   426  C CA    A ARG A  1 69  ? 19.751  18.381 -2.291  0.50 21.46 ? 51  ARG A CA    1 
ATOM   427  C CA    B ARG A  1 69  ? 19.805  18.388 -2.198  0.50 22.15 ? 51  ARG A CA    1 
ATOM   428  C C     . ARG A  1 69  ? 21.271  18.341 -2.685  1.00 21.17 ? 51  ARG A C     1 
ATOM   429  O O     . ARG A  1 69  ? 21.996  17.320 -2.418  1.00 23.07 ? 51  ARG A O     1 
ATOM   430  C CB    A ARG A  1 69  ? 18.896  18.034 -3.547  0.50 21.85 ? 51  ARG A CB    1 
ATOM   431  C CB    B ARG A  1 69  ? 18.920  17.960 -3.324  0.50 23.41 ? 51  ARG A CB    1 
ATOM   432  C CG    A ARG A  1 69  ? 17.316  17.961 -3.496  0.50 22.39 ? 51  ARG A CG    1 
ATOM   433  C CG    B ARG A  1 69  ? 19.033  16.502 -3.665  0.50 25.36 ? 51  ARG A CG    1 
ATOM   434  C CD    A ARG A  1 69  ? 16.905  17.752 -4.944  0.50 22.50 ? 51  ARG A CD    1 
ATOM   435  C CD    B ARG A  1 69  ? 19.422  16.419 -5.120  0.50 25.86 ? 51  ARG A CD    1 
ATOM   436  N NE    A ARG A  1 69  ? 15.510  17.648 -5.302  0.50 23.60 ? 51  ARG A NE    1 
ATOM   437  N NE    B ARG A  1 69  ? 19.989  15.126 -5.437  0.50 26.86 ? 51  ARG A NE    1 
ATOM   438  C CZ    A ARG A  1 69  ? 15.020  16.668 -6.058  0.50 25.03 ? 51  ARG A CZ    1 
ATOM   439  C CZ    B ARG A  1 69  ? 19.322  14.244 -6.144  0.50 28.13 ? 51  ARG A CZ    1 
ATOM   440  N NH1   A ARG A  1 69  ? 13.749  16.642 -6.403  0.50 25.87 ? 51  ARG A NH1   1 
ATOM   441  N NH1   B ARG A  1 69  ? 18.119  14.557 -6.581  0.50 28.25 ? 51  ARG A NH1   1 
ATOM   442  N NH2   A ARG A  1 69  ? 15.803  15.691 -6.447  0.50 25.71 ? 51  ARG A NH2   1 
ATOM   443  N NH2   B ARG A  1 69  ? 19.845  13.071 -6.394  0.50 29.62 ? 51  ARG A NH2   1 
ATOM   444  N N     . PHE A  1 70  ? 21.722  19.406 -3.323  1.00 17.33 ? 52  PHE A N     1 
ATOM   445  C CA    . PHE A  1 70  ? 23.062  19.482 -3.922  1.00 16.77 ? 52  PHE A CA    1 
ATOM   446  C C     . PHE A  1 70  ? 24.134  19.967 -3.010  1.00 17.85 ? 52  PHE A C     1 
ATOM   447  O O     . PHE A  1 70  ? 25.284  19.920 -3.343  1.00 16.35 ? 52  PHE A O     1 
ATOM   448  C CB    . PHE A  1 70  ? 22.986  20.290 -5.221  1.00 15.44 ? 52  PHE A CB    1 
ATOM   449  C CG    . PHE A  1 70  ? 22.009  19.686 -6.153  1.00 15.10 ? 52  PHE A CG    1 
ATOM   450  C CD1   . PHE A  1 70  ? 22.321  18.531 -6.828  1.00 16.11 ? 52  PHE A CD1   1 
ATOM   451  C CD2   . PHE A  1 70  ? 20.759  20.242 -6.312  1.00 14.81 ? 52  PHE A CD2   1 
ATOM   452  C CE1   . PHE A  1 70  ? 21.347  17.922 -7.611  1.00 16.23 ? 52  PHE A CE1   1 
ATOM   453  C CE2   . PHE A  1 70  ? 19.811  19.667 -7.112  1.00 14.83 ? 52  PHE A CE2   1 
ATOM   454  C CZ    . PHE A  1 70  ? 20.110  18.511 -7.742  1.00 15.75 ? 52  PHE A CZ    1 
ATOM   455  N N     . LEU A  1 71  ? 23.715  20.438 -1.823  1.00 19.86 ? 53  LEU A N     1 
ATOM   456  C CA    . LEU A  1 71  ? 24.625  20.984 -0.809  1.00 21.93 ? 53  LEU A CA    1 
ATOM   457  C C     . LEU A  1 71  ? 25.067  20.053 0.249   1.00 22.81 ? 53  LEU A C     1 
ATOM   458  O O     . LEU A  1 71  ? 25.886  20.492 1.090   1.00 24.99 ? 53  LEU A O     1 
ATOM   459  C CB    . LEU A  1 71  ? 24.000  22.244 -0.164  1.00 22.34 ? 53  LEU A CB    1 
ATOM   460  C CG    . LEU A  1 71  ? 23.674  23.340 -1.161  1.00 21.70 ? 53  LEU A CG    1 
ATOM   461  C CD1   . LEU A  1 71  ? 23.019  24.575 -0.518  1.00 22.50 ? 53  LEU A CD1   1 
ATOM   462  C CD2   . LEU A  1 71  ? 24.824  23.886 -1.977  1.00 22.69 ? 53  LEU A CD2   1 
ATOM   463  N N     . ARG A  1 72  ? 24.610  18.779 0.241   1.00 21.77 ? 54  ARG A N     1 
ATOM   464  C CA    . ARG A  1 72  ? 25.009  17.760 1.160   1.00 22.84 ? 54  ARG A CA    1 
ATOM   465  C C     . ARG A  1 72  ? 26.507  17.475 1.065   1.00 21.44 ? 54  ARG A C     1 
ATOM   466  O O     . ARG A  1 72  ? 27.076  17.543 -0.046  1.00 19.56 ? 54  ARG A O     1 
ATOM   467  C CB    . ARG A  1 72  ? 24.229  16.440 0.934   1.00 25.46 ? 54  ARG A CB    1 
ATOM   468  C CG    . ARG A  1 72  ? 22.717  16.513 1.168   1.00 27.26 ? 54  ARG A CG    1 
ATOM   469  C CD    . ARG A  1 72  ? 22.125  15.098 1.090   1.00 29.33 ? 54  ARG A CD    1 
ATOM   470  N NE    . ARG A  1 72  ? 22.042  14.779 -0.329  1.00 30.36 ? 54  ARG A NE    1 
ATOM   471  C CZ    . ARG A  1 72  ? 21.624  13.621 -0.845  1.00 32.69 ? 54  ARG A CZ    1 
ATOM   472  N NH1   . ARG A  1 72  ? 21.155  12.665 -0.094  1.00 33.15 ? 54  ARG A NH1   1 
ATOM   473  N NH2   . ARG A  1 72  ? 21.637  13.472 -2.198  1.00 34.41 ? 54  ARG A NH2   1 
ATOM   474  N N     . GLU A  1 73  ? 27.117  17.071 2.168   1.00 20.92 ? 55  GLU A N     1 
ATOM   475  C CA    . GLU A  1 73  ? 28.540  16.720 2.131   1.00 21.28 ? 55  GLU A CA    1 
ATOM   476  C C     . GLU A  1 73  ? 28.678  15.473 1.261   1.00 20.91 ? 55  GLU A C     1 
ATOM   477  O O     . GLU A  1 73  ? 27.843  14.577 1.340   1.00 21.55 ? 55  GLU A O     1 
ATOM   478  C CB    . GLU A  1 73  ? 29.076  16.410 3.512   1.00 22.87 ? 55  GLU A CB    1 
ATOM   479  C CG    . GLU A  1 73  ? 28.972  17.589 4.474   1.00 23.66 ? 55  GLU A CG    1 
ATOM   480  C CD    . GLU A  1 73  ? 29.841  18.777 4.071   1.00 24.33 ? 55  GLU A CD    1 
ATOM   481  O OE1   . GLU A  1 73  ? 29.327  19.917 4.182   1.00 27.00 ? 55  GLU A OE1   1 
ATOM   482  O OE2   . GLU A  1 73  ? 30.980  18.610 3.627   1.00 24.36 ? 55  GLU A OE2   1 
ATOM   483  N N     . GLY A  1 74  ? 29.811  15.362 0.610   1.00 20.15 ? 56  GLY A N     1 
ATOM   484  C CA    . GLY A  1 74  ? 30.148  14.174 -0.185  1.00 20.10 ? 56  GLY A CA    1 
ATOM   485  C C     . GLY A  1 74  ? 30.930  14.627 -1.400  1.00 18.95 ? 56  GLY A C     1 
ATOM   486  O O     . GLY A  1 74  ? 31.213  15.813 -1.540  1.00 18.12 ? 56  GLY A O     1 
ATOM   487  N N     . PRO A  1 75  ? 31.274  13.682 -2.296  1.00 19.06 ? 57  PRO A N     1 
ATOM   488  C CA    A PRO A  1 75  ? 32.200  13.958 -3.388  0.60 18.78 ? 57  PRO A CA    1 
ATOM   489  C CA    B PRO A  1 75  ? 32.183  13.896 -3.411  0.40 18.78 ? 57  PRO A CA    1 
ATOM   490  C C     . PRO A  1 75  ? 31.722  14.954 -4.337  1.00 17.32 ? 57  PRO A C     1 
ATOM   491  O O     . PRO A  1 75  ? 32.553  15.654 -4.931  1.00 17.66 ? 57  PRO A O     1 
ATOM   492  C CB    A PRO A  1 75  ? 32.396  12.554 -4.055  0.60 19.71 ? 57  PRO A CB    1 
ATOM   493  C CB    B PRO A  1 75  ? 32.221  12.498 -4.108  0.40 19.58 ? 57  PRO A CB    1 
ATOM   494  C CG    A PRO A  1 75  ? 32.082  11.624 -2.970  0.60 20.65 ? 57  PRO A CG    1 
ATOM   495  C CG    B PRO A  1 75  ? 30.931  11.857 -3.738  0.40 19.58 ? 57  PRO A CG    1 
ATOM   496  C CD    A PRO A  1 75  ? 30.940  12.256 -2.232  0.60 20.00 ? 57  PRO A CD    1 
ATOM   497  C CD    B PRO A  1 75  ? 30.733  12.305 -2.308  0.40 19.82 ? 57  PRO A CD    1 
ATOM   498  N N     . ASN A  1 76  ? 30.405  15.102 -4.499  1.00 15.97 ? 58  ASN A N     1 
ATOM   499  C CA    . ASN A  1 76  ? 29.896  16.012 -5.473  1.00 14.61 ? 58  ASN A CA    1 
ATOM   500  C C     . ASN A  1 76  ? 29.277  17.288 -4.938  1.00 13.47 ? 58  ASN A C     1 
ATOM   501  O O     . ASN A  1 76  ? 28.572  18.007 -5.623  1.00 12.26 ? 58  ASN A O     1 
ATOM   502  C CB    . ASN A  1 76  ? 28.877  15.273 -6.323  1.00 14.52 ? 58  ASN A CB    1 
ATOM   503  C CG    . ASN A  1 76  ? 29.513  14.040 -6.949  1.00 15.43 ? 58  ASN A CG    1 
ATOM   504  O OD1   . ASN A  1 76  ? 30.513  14.169 -7.640  1.00 15.54 ? 58  ASN A OD1   1 
ATOM   505  N ND2   . ASN A  1 76  ? 29.035  12.892 -6.592  1.00 16.32 ? 58  ASN A ND2   1 
ATOM   506  N N     . LYS A  1 77  ? 29.548  17.565 -3.669  1.00 13.74 ? 59  LYS A N     1 
ATOM   507  C CA    . LYS A  1 77  ? 28.900  18.700 -3.000  1.00 13.44 ? 59  LYS A CA    1 
ATOM   508  C C     . LYS A  1 77  ? 29.132  19.968 -3.771  1.00 12.57 ? 59  LYS A C     1 
ATOM   509  O O     . LYS A  1 77  ? 30.276  20.303 -4.048  1.00 12.59 ? 59  LYS A O     1 
ATOM   510  C CB    . LYS A  1 77  ? 29.486  18.883 -1.579  1.00 14.30 ? 59  LYS A CB    1 
ATOM   511  C CG    . LYS A  1 77  ? 28.909  20.119 -0.868  1.00 14.11 ? 59  LYS A CG    1 
ATOM   512  C CD    . LYS A  1 77  ? 29.622  20.355 0.464   1.00 15.23 ? 59  LYS A CD    1 
ATOM   513  N N     . THR A  1 78  ? 28.065  20.673 -4.086  1.00 11.87 ? 60  THR A N     1 
ATOM   514  C CA    . THR A  1 78  ? 28.122  21.994 -4.730  1.00 11.46 ? 60  THR A CA    1 
ATOM   515  C C     . THR A  1 78  ? 28.628  23.025 -3.674  1.00 11.92 ? 60  THR A C     1 
ATOM   516  O O     . THR A  1 78  ? 28.188  22.999 -2.513  1.00 12.11 ? 60  THR A O     1 
ATOM   517  C CB    . THR A  1 78  ? 26.761  22.354 -5.302  1.00 10.92 ? 60  THR A CB    1 
ATOM   518  O OG1   . THR A  1 78  ? 26.472  21.384 -6.346  1.00 11.09 ? 60  THR A OG1   1 
ATOM   519  C CG2   . THR A  1 78  ? 26.710  23.713 -5.845  1.00 10.36 ? 60  THR A CG2   1 
ATOM   520  N N     . GLY A  1 79  ? 29.519  23.887 -4.099  1.00 12.13 ? 61  GLY A N     1 
ATOM   521  C CA    . GLY A  1 79  ? 30.072  24.928 -3.224  1.00 13.07 ? 61  GLY A CA    1 
ATOM   522  C C     . GLY A  1 79  ? 29.083  26.048 -2.898  1.00 12.91 ? 61  GLY A C     1 
ATOM   523  O O     . GLY A  1 79  ? 27.976  26.165 -3.467  1.00 12.30 ? 61  GLY A O     1 
ATOM   524  N N     . THR A  1 80  ? 29.547  26.930 -1.999  1.00 13.97 ? 62  THR A N     1 
ATOM   525  C CA    . THR A  1 80  ? 28.696  28.008 -1.521  1.00 14.33 ? 62  THR A CA    1 
ATOM   526  C C     . THR A  1 80  ? 29.444  29.356 -1.567  1.00 14.57 ? 62  THR A C     1 
ATOM   527  O O     . THR A  1 80  ? 29.109  30.290 -0.782  1.00 14.75 ? 62  THR A O     1 
ATOM   528  C CB    . THR A  1 80  ? 28.189  27.724 -0.099  1.00 15.55 ? 62  THR A CB    1 
ATOM   529  O OG1   . THR A  1 80  ? 29.273  27.358 0.737   1.00 16.61 ? 62  THR A OG1   1 
ATOM   530  C CG2   . THR A  1 80  ? 27.168  26.599 -0.077  1.00 16.19 ? 62  THR A CG2   1 
ATOM   531  N N     . SER A  1 81  ? 30.430  29.464 -2.433  1.00 14.12 ? 63  SER A N     1 
ATOM   532  C CA    A SER A  1 81  ? 31.224  30.690 -2.541  0.50 14.75 ? 63  SER A CA    1 
ATOM   533  C CA    B SER A  1 81  ? 31.216  30.699 -2.581  0.50 14.72 ? 63  SER A CA    1 
ATOM   534  C C     . SER A  1 81  ? 30.489  31.747 -3.421  1.00 14.05 ? 63  SER A C     1 
ATOM   535  O O     . SER A  1 81  ? 30.518  32.921 -3.103  1.00 14.26 ? 63  SER A O     1 
ATOM   536  C CB    A SER A  1 81  ? 32.641  30.392 -3.060  0.50 15.30 ? 63  SER A CB    1 
ATOM   537  C CB    B SER A  1 81  ? 32.580  30.427 -3.208  0.50 15.20 ? 63  SER A CB    1 
ATOM   538  O OG    A SER A  1 81  ? 32.615  30.038 -4.423  0.50 14.76 ? 63  SER A OG    1 
ATOM   539  O OG    B SER A  1 81  ? 33.363  29.791 -2.257  0.50 16.09 ? 63  SER A OG    1 
ATOM   540  N N     . CYS A  1 82  ? 29.878  31.361 -4.525  1.00 13.22 ? 64  CYS A N     1 
ATOM   541  C CA    . CYS A  1 82  ? 29.317  32.370 -5.446  1.00 12.92 ? 64  CYS A CA    1 
ATOM   542  C C     . CYS A  1 82  ? 28.211  31.792 -6.330  1.00 11.93 ? 64  CYS A C     1 
ATOM   543  O O     . CYS A  1 82  ? 28.331  30.643 -6.849  1.00 11.24 ? 64  CYS A O     1 
ATOM   544  C CB    . CYS A  1 82  ? 30.435  32.935 -6.330  1.00 14.12 ? 64  CYS A CB    1 
ATOM   545  S SG    . CYS A  1 82  ? 29.984  34.513 -7.110  1.00 16.40 ? 64  CYS A SG    1 
ATOM   546  N N     . ALA A  1 83  ? 27.104  32.524 -6.410  1.00 10.78 ? 65  ALA A N     1 
ATOM   547  C CA    . ALA A  1 83  ? 26.056  32.189 -7.315  1.00 10.27 ? 65  ALA A CA    1 
ATOM   548  C C     . ALA A  1 83  ? 25.829  33.320 -8.321  1.00 10.15 ? 65  ALA A C     1 
ATOM   549  O O     . ALA A  1 83  ? 26.081  34.495 -8.021  1.00 10.98 ? 65  ALA A O     1 
ATOM   550  C CB    . ALA A  1 83  ? 24.799  31.923 -6.528  1.00 10.19 ? 65  ALA A CB    1 
ATOM   551  N N     . LEU A  1 84  ? 25.192  32.976 -9.432  1.00 9.70  ? 66  LEU A N     1 
ATOM   552  C CA    . LEU A  1 84  ? 24.817  33.918 -10.468 1.00 9.70  ? 66  LEU A CA    1 
ATOM   553  C C     . LEU A  1 84  ? 23.284  33.834 -10.611 1.00 9.20  ? 66  LEU A C     1 
ATOM   554  O O     . LEU A  1 84  ? 22.773  32.754 -10.859 1.00 9.14  ? 66  LEU A O     1 
ATOM   555  C CB    . LEU A  1 84  ? 25.486  33.587 -11.800 1.00 9.64  ? 66  LEU A CB    1 
ATOM   556  C CG    . LEU A  1 84  ? 24.992  34.416 -13.005 1.00 9.76  ? 66  LEU A CG    1 
ATOM   557  C CD1   . LEU A  1 84  ? 25.402  35.870 -12.915 1.00 10.32 ? 66  LEU A CD1   1 
ATOM   558  C CD2   . LEU A  1 84  ? 25.570  33.792 -14.265 1.00 9.92  ? 66  LEU A CD2   1 
ATOM   559  N N     . ASP A  1 85  ? 22.593  34.956 -10.424 1.00 9.28  ? 67  ASP A N     1 
ATOM   560  C CA    . ASP A  1 85  ? 21.137  35.059 -10.624 1.00 9.16  ? 67  ASP A CA    1 
ATOM   561  C C     . ASP A  1 85  ? 20.870  35.656 -11.961 1.00 8.96  ? 67  ASP A C     1 
ATOM   562  O O     . ASP A  1 85  ? 21.149  36.845 -12.182 1.00 9.17  ? 67  ASP A O     1 
ATOM   563  C CB    . ASP A  1 85  ? 20.551  35.867 -9.484  1.00 9.70  ? 67  ASP A CB    1 
ATOM   564  C CG    . ASP A  1 85  ? 19.053  35.840 -9.431  1.00 10.17 ? 67  ASP A CG    1 
ATOM   565  O OD1   . ASP A  1 85  ? 18.422  35.260 -10.327 1.00 10.59 ? 67  ASP A OD1   1 
ATOM   566  O OD2   . ASP A  1 85  ? 18.494  36.479 -8.471  1.00 10.24 ? 67  ASP A OD2   1 
ATOM   567  N N     . CYS A  1 86  ? 20.307  34.840 -12.871 1.00 8.53  ? 68  CYS A N     1 
ATOM   568  C CA    . CYS A  1 86  ? 20.086  35.249 -14.282 1.00 8.51  ? 68  CYS A CA    1 
ATOM   569  C C     . CYS A  1 86  ? 18.653  35.714 -14.530 1.00 8.62  ? 68  CYS A C     1 
ATOM   570  O O     . CYS A  1 86  ? 17.668  35.041 -14.147 1.00 8.99  ? 68  CYS A O     1 
ATOM   571  C CB    . CYS A  1 86  ? 20.337  34.065 -15.263 1.00 8.19  ? 68  CYS A CB    1 
ATOM   572  S SG    . CYS A  1 86  ? 22.054  33.512 -15.135 1.00 9.47  ? 68  CYS A SG    1 
ATOM   573  N N     . GLY A  1 87  ? 18.502  36.861 -15.191 1.00 8.70  ? 69  GLY A N     1 
ATOM   574  C CA    . GLY A  1 87  ? 17.202  37.503 -15.263 1.00 8.76  ? 69  GLY A CA    1 
ATOM   575  C C     . GLY A  1 87  ? 16.713  37.841 -13.856 1.00 9.21  ? 69  GLY A C     1 
ATOM   576  O O     . GLY A  1 87  ? 15.533  37.646 -13.518 1.00 9.38  ? 69  GLY A O     1 
ATOM   577  N N     . ALA A  1 88  ? 17.612  38.358 -13.057 1.00 9.35  ? 70  ALA A N     1 
ATOM   578  C CA    . ALA A  1 88  ? 17.390  38.522 -11.589 1.00 9.72  ? 70  ALA A CA    1 
ATOM   579  C C     . ALA A  1 88  ? 16.345  39.551 -11.223 1.00 10.56 ? 70  ALA A C     1 
ATOM   580  O O     . ALA A  1 88  ? 15.806  39.508 -10.119 1.00 10.78 ? 70  ALA A O     1 
ATOM   581  C CB    . ALA A  1 88  ? 18.700  38.891 -10.939 1.00 9.98  ? 70  ALA A CB    1 
ATOM   582  N N     . GLY A  1 89  ? 16.045  40.466 -12.134 1.00 10.62 ? 71  GLY A N     1 
ATOM   583  C CA    . GLY A  1 89  ? 15.161  41.564 -11.780 1.00 11.71 ? 71  GLY A CA    1 
ATOM   584  C C     . GLY A  1 89  ? 15.655  42.344 -10.600 1.00 12.12 ? 71  GLY A C     1 
ATOM   585  O O     . GLY A  1 89  ? 16.855  42.657 -10.480 1.00 12.13 ? 71  GLY A O     1 
ATOM   586  N N     . ILE A  1 90  ? 14.718  42.679 -9.715  1.00 12.65 ? 72  ILE A N     1 
ATOM   587  C CA    . ILE A  1 90  ? 15.059  43.393 -8.501  1.00 13.70 ? 72  ILE A CA    1 
ATOM   588  C C     . ILE A  1 90  ? 15.785  42.568 -7.447  1.00 13.24 ? 72  ILE A C     1 
ATOM   589  O O     . ILE A  1 90  ? 16.206  43.136 -6.411  1.00 14.36 ? 72  ILE A O     1 
ATOM   590  C CB    . ILE A  1 90  ? 13.818  44.109 -7.855  1.00 14.66 ? 72  ILE A CB    1 
ATOM   591  C CG1   . ILE A  1 90  ? 12.823  43.067 -7.306  1.00 14.91 ? 72  ILE A CG1   1 
ATOM   592  C CG2   . ILE A  1 90  ? 13.153  45.028 -8.833  1.00 15.11 ? 72  ILE A CG2   1 
ATOM   593  C CD1   . ILE A  1 90  ? 11.718  43.678 -6.471  1.00 16.22 ? 72  ILE A CD1   1 
ATOM   594  N N     . GLY A  1 91  ? 15.943  41.278 -7.679  1.00 12.50 ? 73  GLY A N     1 
ATOM   595  C CA    . GLY A  1 91  ? 16.610  40.377 -6.757  1.00 12.23 ? 73  GLY A CA    1 
ATOM   596  C C     . GLY A  1 91  ? 15.743  39.659 -5.730  1.00 12.25 ? 73  GLY A C     1 
ATOM   597  O O     . GLY A  1 91  ? 16.217  39.337 -4.648  1.00 12.87 ? 73  GLY A O     1 
ATOM   598  N N     . ARG A  1 92  ? 14.512  39.344 -6.092  1.00 12.05 ? 74  ARG A N     1 
ATOM   599  C CA    . ARG A  1 92  ? 13.600  38.546 -5.293  1.00 12.26 ? 74  ARG A CA    1 
ATOM   600  C C     . ARG A  1 92  ? 14.279  37.241 -4.856  1.00 11.86 ? 74  ARG A C     1 
ATOM   601  O O     . ARG A  1 92  ? 14.256  36.841 -3.659  1.00 12.29 ? 74  ARG A O     1 
ATOM   602  C CB    . ARG A  1 92  ? 12.339  38.217 -6.131  1.00 11.91 ? 74  ARG A CB    1 
ATOM   603  C CG    . ARG A  1 92  ? 11.253  37.477 -5.332  1.00 12.32 ? 74  ARG A CG    1 
ATOM   604  C CD    . ARG A  1 92  ? 10.102  37.138 -6.229  1.00 12.36 ? 74  ARG A CD    1 
ATOM   605  N NE    . ARG A  1 92  ? 10.502  36.125 -7.202  1.00 11.41 ? 74  ARG A NE    1 
ATOM   606  C CZ    . ARG A  1 92  ? 10.435  34.802 -7.035  1.00 11.22 ? 74  ARG A CZ    1 
ATOM   607  N NH1   . ARG A  1 92  ? 10.004  34.271 -5.929  1.00 11.71 ? 74  ARG A NH1   1 
ATOM   608  N NH2   . ARG A  1 92  ? 10.849  33.984 -7.995  1.00 10.41 ? 74  ARG A NH2   1 
ATOM   609  N N     . ILE A  1 93  ? 14.882  36.565 -5.823  1.00 11.14 ? 75  ILE A N     1 
ATOM   610  C CA    . ILE A  1 93  ? 15.504  35.281 -5.531  1.00 10.94 ? 75  ILE A CA    1 
ATOM   611  C C     . ILE A  1 93  ? 16.873  35.488 -4.841  1.00 11.14 ? 75  ILE A C     1 
ATOM   612  O O     . ILE A  1 93  ? 17.231  34.779 -3.908  1.00 11.35 ? 75  ILE A O     1 
ATOM   613  C CB    . ILE A  1 93  ? 15.671  34.446 -6.826  1.00 10.78 ? 75  ILE A CB    1 
ATOM   614  C CG1   . ILE A  1 93  ? 14.351  34.216 -7.486  1.00 10.95 ? 75  ILE A CG1   1 
ATOM   615  C CG2   . ILE A  1 93  ? 16.308  33.079 -6.487  1.00 10.88 ? 75  ILE A CG2   1 
ATOM   616  C CD1   . ILE A  1 93  ? 14.436  33.713 -8.905  1.00 10.57 ? 75  ILE A CD1   1 
ATOM   617  N N     . THR A  1 94  ? 17.622  36.466 -5.325  1.00 11.06 ? 76  THR A N     1 
ATOM   618  C CA    . THR A  1 94  ? 18.891  36.875 -4.668  1.00 11.65 ? 76  THR A CA    1 
ATOM   619  C C     . THR A  1 94  ? 18.681  37.146 -3.200  1.00 12.60 ? 76  THR A C     1 
ATOM   620  O O     . THR A  1 94  ? 19.435  36.652 -2.351  1.00 12.50 ? 76  THR A O     1 
ATOM   621  C CB    . THR A  1 94  ? 19.561  38.032 -5.450  1.00 11.97 ? 76  THR A CB    1 
ATOM   622  O OG1   . THR A  1 94  ? 20.082  37.471 -6.640  1.00 12.32 ? 76  THR A OG1   1 
ATOM   623  C CG2   . THR A  1 94  ? 20.734  38.672 -4.736  1.00 12.40 ? 76  THR A CG2   1 
ATOM   624  N N     . LYS A  1 95  ? 17.618  37.872 -2.866  1.00 13.09 ? 77  LYS A N     1 
ATOM   625  C CA    . LYS A  1 95  ? 17.416  38.238 -1.480  1.00 14.52 ? 77  LYS A CA    1 
ATOM   626  C C     . LYS A  1 95  ? 17.087  37.036 -0.591  1.00 14.68 ? 77  LYS A C     1 
ATOM   627  O O     . LYS A  1 95  ? 17.666  36.894 0.503   1.00 14.68 ? 77  LYS A O     1 
ATOM   628  C CB    . LYS A  1 95  ? 16.273  39.253 -1.358  1.00 15.66 ? 77  LYS A CB    1 
ATOM   629  C CG    . LYS A  1 95  ? 16.147  39.834 0.050   1.00 17.58 ? 77  LYS A CG    1 
ATOM   630  C CD    . LYS A  1 95  ? 15.015  40.847 0.106   1.00 19.30 ? 77  LYS A CD    1 
ATOM   631  C CE    . LYS A  1 95  ? 14.829  41.505 1.411   1.00 22.09 ? 77  LYS A CE    1 
ATOM   632  N NZ    . LYS A  1 95  ? 15.920  42.437 1.786   1.00 23.64 ? 77  LYS A NZ    1 
ATOM   633  N N     . ARG A  1 96  ? 16.098  36.236 -1.013  1.00 14.60 ? 78  ARG A N     1 
ATOM   634  C CA    . ARG A  1 96  ? 15.507  35.286 -0.092  1.00 15.73 ? 78  ARG A CA    1 
ATOM   635  C C     . ARG A  1 96  ? 16.101  33.904 -0.192  1.00 14.64 ? 78  ARG A C     1 
ATOM   636  O O     . ARG A  1 96  ? 16.074  33.205 0.790   1.00 15.14 ? 78  ARG A O     1 
ATOM   637  C CB    . ARG A  1 96  ? 14.033  35.090 -0.310  1.00 17.05 ? 78  ARG A CB    1 
ATOM   638  C CG    A ARG A  1 96  ? 13.185  36.327 -0.313  0.60 18.48 ? 78  ARG A CG    1 
ATOM   639  C CG    B ARG A  1 96  ? 13.230  36.275 -0.748  0.40 17.54 ? 78  ARG A CG    1 
ATOM   640  C CD    A ARG A  1 96  ? 13.196  36.987 0.983   0.60 20.21 ? 78  ARG A CD    1 
ATOM   641  C CD    B ARG A  1 96  ? 12.860  37.087 0.427   0.40 18.48 ? 78  ARG A CD    1 
ATOM   642  N NE    A ARG A  1 96  ? 12.353  38.212 0.946   0.60 21.29 ? 78  ARG A NE    1 
ATOM   643  C CZ    A ARG A  1 96  ? 12.317  39.048 1.952   0.60 22.71 ? 78  ARG A CZ    1 
ATOM   644  N NH1   A ARG A  1 96  ? 13.074  38.842 3.029   0.60 22.78 ? 78  ARG A NH1   1 
ATOM   645  N NH2   A ARG A  1 96  ? 11.548  40.132 1.831   0.60 23.64 ? 78  ARG A NH2   1 
ATOM   646  N N     . LEU A  1 97  ? 16.617  33.525 -1.351  1.00 13.44 ? 79  LEU A N     1 
ATOM   647  C CA    . LEU A  1 97  ? 17.209  32.205 -1.556  1.00 12.83 ? 79  LEU A CA    1 
ATOM   648  C C     . LEU A  1 97  ? 18.728  32.221 -1.559  1.00 12.33 ? 79  LEU A C     1 
ATOM   649  O O     . LEU A  1 97  ? 19.374  31.490 -0.815  1.00 12.78 ? 79  LEU A O     1 
ATOM   650  C CB    . LEU A  1 97  ? 16.740  31.635 -2.903  1.00 12.23 ? 79  LEU A CB    1 
ATOM   651  C CG    . LEU A  1 97  ? 17.318  30.260 -3.236  1.00 12.20 ? 79  LEU A CG    1 
ATOM   652  C CD1   . LEU A  1 97  ? 16.812  29.205 -2.299  1.00 13.08 ? 79  LEU A CD1   1 
ATOM   653  C CD2   . LEU A  1 97  ? 17.010  29.937 -4.722  1.00 12.08 ? 79  LEU A CD2   1 
ATOM   654  N N     . LEU A  1 98  ? 19.307  33.080 -2.394  1.00 11.81 ? 80  LEU A N     1 
ATOM   655  C CA    . LEU A  1 98  ? 20.758  32.955 -2.689  1.00 11.58 ? 80  LEU A CA    1 
ATOM   656  C C     . LEU A  1 98  ? 21.708  33.644 -1.677  1.00 12.17 ? 80  LEU A C     1 
ATOM   657  O O     . LEU A  1 98  ? 22.659  33.044 -1.206  1.00 12.19 ? 80  LEU A O     1 
ATOM   658  C CB    . LEU A  1 98  ? 21.015  33.450 -4.081  1.00 11.41 ? 80  LEU A CB    1 
ATOM   659  C CG    . LEU A  1 98  ? 20.351  32.684 -5.244  1.00 10.84 ? 80  LEU A CG    1 
ATOM   660  C CD1   . LEU A  1 98  ? 20.621  33.369 -6.575  1.00 10.91 ? 80  LEU A CD1   1 
ATOM   661  C CD2   . LEU A  1 98  ? 20.840  31.266 -5.326  1.00 11.00 ? 80  LEU A CD2   1 
ATOM   662  N N     . LEU A  1 99  ? 21.458  34.901 -1.360  1.00 12.36 ? 81  LEU A N     1 
ATOM   663  C CA    . LEU A  1 99  ? 22.310  35.601 -0.373  1.00 13.23 ? 81  LEU A CA    1 
ATOM   664  C C     . LEU A  1 99  ? 22.480  34.865 0.949   1.00 13.99 ? 81  LEU A C     1 
ATOM   665  O O     . LEU A  1 99  ? 23.600  34.855 1.539   1.00 14.44 ? 81  LEU A O     1 
ATOM   666  C CB    . LEU A  1 99  ? 21.882  37.074 -0.164  1.00 13.83 ? 81  LEU A CB    1 
ATOM   667  C CG    . LEU A  1 99  ? 22.355  38.021 -1.252  1.00 13.75 ? 81  LEU A CG    1 
ATOM   668  C CD1   . LEU A  1 99  ? 21.595  39.342 -1.188  1.00 14.23 ? 81  LEU A CD1   1 
ATOM   669  C CD2   . LEU A  1 99  ? 23.845  38.209 -1.230  1.00 14.28 ? 81  LEU A CD2   1 
ATOM   670  N N     . PRO A  1 100 ? 21.397  34.215 1.435   1.00 14.33 ? 82  PRO A N     1 
ATOM   671  C CA    . PRO A  1 100 ? 21.572  33.477 2.679   1.00 15.12 ? 82  PRO A CA    1 
ATOM   672  C C     . PRO A  1 100 ? 22.510  32.295 2.617   1.00 15.17 ? 82  PRO A C     1 
ATOM   673  O O     . PRO A  1 100 ? 23.010  31.861 3.669   1.00 15.77 ? 82  PRO A O     1 
ATOM   674  C CB    . PRO A  1 100 ? 20.109  33.066 3.069   1.00 15.32 ? 82  PRO A CB    1 
ATOM   675  C CG    . PRO A  1 100 ? 19.268  34.105 2.403   1.00 15.13 ? 82  PRO A CG    1 
ATOM   676  C CD    . PRO A  1 100 ? 19.966  34.407 1.114   1.00 14.24 ? 82  PRO A CD    1 
ATOM   677  N N     . LEU A  1 101 ? 22.715  31.746 1.436   1.00 14.64 ? 83  LEU A N     1 
ATOM   678  C CA    . LEU A  1 101 ? 23.414  30.498 1.224   1.00 14.93 ? 83  LEU A CA    1 
ATOM   679  C C     . LEU A  1 101 ? 24.792  30.666 0.601   1.00 14.61 ? 83  LEU A C     1 
ATOM   680  O O     . LEU A  1 101 ? 25.632  29.758 0.746   1.00 14.99 ? 83  LEU A O     1 
ATOM   681  C CB    . LEU A  1 101 ? 22.547  29.604 0.322   1.00 14.86 ? 83  LEU A CB    1 
ATOM   682  C CG    . LEU A  1 101 ? 21.286  28.955 0.957   1.00 15.45 ? 83  LEU A CG    1 
ATOM   683  C CD1   . LEU A  1 101 ? 20.427  28.271 -0.088  1.00 15.35 ? 83  LEU A CD1   1 
ATOM   684  C CD2   . LEU A  1 101 ? 21.716  27.958 2.024   1.00 17.24 ? 83  LEU A CD2   1 
ATOM   685  N N     . PHE A  1 102 ? 25.017  31.769 -0.115  1.00 13.73 ? 84  PHE A N     1 
ATOM   686  C CA    . PHE A  1 102 ? 26.260  31.978 -0.879  1.00 13.37 ? 84  PHE A CA    1 
ATOM   687  C C     . PHE A  1 102 ? 26.984  33.197 -0.408  1.00 13.79 ? 84  PHE A C     1 
ATOM   688  O O     . PHE A  1 102 ? 26.334  34.194 -0.078  1.00 13.78 ? 84  PHE A O     1 
ATOM   689  C CB    . PHE A  1 102 ? 25.975  32.109 -2.392  1.00 12.69 ? 84  PHE A CB    1 
ATOM   690  C CG    . PHE A  1 102 ? 25.432  30.845 -2.957  1.00 12.36 ? 84  PHE A CG    1 
ATOM   691  C CD1   . PHE A  1 102 ? 24.073  30.594 -2.905  1.00 12.25 ? 84  PHE A CD1   1 
ATOM   692  C CD2   . PHE A  1 102 ? 26.265  29.895 -3.481  1.00 12.68 ? 84  PHE A CD2   1 
ATOM   693  C CE1   . PHE A  1 102 ? 23.533  29.413 -3.369  1.00 12.17 ? 84  PHE A CE1   1 
ATOM   694  C CE2   . PHE A  1 102 ? 25.737  28.659 -3.899  1.00 12.92 ? 84  PHE A CE2   1 
ATOM   695  C CZ    . PHE A  1 102 ? 24.373  28.410 -3.806  1.00 12.55 ? 84  PHE A CZ    1 
ATOM   696  N N     . ARG A  1 103 ? 28.308  33.098 -0.323  1.00 13.68 ? 85  ARG A N     1 
ATOM   697  C CA    A ARG A  1 103 ? 29.086  34.195 0.220   0.50 14.48 ? 85  ARG A CA    1 
ATOM   698  C CA    B ARG A  1 103 ? 29.085  34.193 0.226   0.50 14.48 ? 85  ARG A CA    1 
ATOM   699  C C     . ARG A  1 103 ? 28.905  35.472 -0.599  1.00 14.24 ? 85  ARG A C     1 
ATOM   700  O O     . ARG A  1 103 ? 28.813  36.592 -0.024  1.00 14.59 ? 85  ARG A O     1 
ATOM   701  C CB    A ARG A  1 103 ? 30.571  33.808 0.314   0.50 15.07 ? 85  ARG A CB    1 
ATOM   702  C CB    B ARG A  1 103 ? 30.575  33.808 0.344   0.50 15.08 ? 85  ARG A CB    1 
ATOM   703  C CG    A ARG A  1 103 ? 31.476  34.921 0.820   0.50 16.15 ? 85  ARG A CG    1 
ATOM   704  C CG    B ARG A  1 103 ? 30.881  32.759 1.412   0.50 15.71 ? 85  ARG A CG    1 
ATOM   705  N N     . GLU A  1 104 ? 28.898  35.315 -1.917  1.00 13.46 ? 86  GLU A N     1 
ATOM   706  C CA    . GLU A  1 104 ? 28.664  36.431 -2.848  1.00 13.75 ? 86  GLU A CA    1 
ATOM   707  C C     . GLU A  1 104 ? 27.675  35.999 -3.896  1.00 12.66 ? 86  GLU A C     1 
ATOM   708  O O     . GLU A  1 104 ? 27.576  34.789 -4.205  1.00 11.95 ? 86  GLU A O     1 
ATOM   709  C CB    . GLU A  1 104 ? 29.969  36.875 -3.519  1.00 14.66 ? 86  GLU A CB    1 
ATOM   710  C CG    . GLU A  1 104 ? 31.022  37.355 -2.552  1.00 16.46 ? 86  GLU A CG    1 
ATOM   711  C CD    . GLU A  1 104 ? 32.270  37.823 -3.289  1.00 17.37 ? 86  GLU A CD    1 
ATOM   712  O OE1   . GLU A  1 104 ? 33.171  36.999 -3.527  1.00 17.77 ? 86  GLU A OE1   1 
ATOM   713  O OE2   . GLU A  1 104 ? 32.370  39.029 -3.566  1.00 18.38 ? 86  GLU A OE2   1 
ATOM   714  N N     . VAL A  1 105 ? 27.004  36.960 -4.513  1.00 12.27 ? 87  VAL A N     1 
ATOM   715  C CA    . VAL A  1 105 ? 26.100  36.691 -5.620  1.00 11.58 ? 87  VAL A CA    1 
ATOM   716  C C     . VAL A  1 105 ? 26.310  37.728 -6.695  1.00 11.51 ? 87  VAL A C     1 
ATOM   717  O O     . VAL A  1 105 ? 26.485  38.895 -6.356  1.00 12.12 ? 87  VAL A O     1 
ATOM   718  C CB    . VAL A  1 105 ? 24.598  36.742 -5.165  1.00 11.60 ? 87  VAL A CB    1 
ATOM   719  C CG1   . VAL A  1 105 ? 23.627  36.544 -6.302  1.00 11.26 ? 87  VAL A CG1   1 
ATOM   720  C CG2   . VAL A  1 105 ? 24.336  35.733 -4.055  1.00 11.85 ? 87  VAL A CG2   1 
ATOM   721  N N     . ASP A  1 106 ? 26.270  37.317 -7.946  1.00 10.94 ? 88  ASP A N     1 
ATOM   722  C CA    . ASP A  1 106 ? 26.249  38.241 -9.065  1.00 11.16 ? 88  ASP A CA    1 
ATOM   723  C C     . ASP A  1 106 ? 24.850  38.219 -9.641  1.00 10.67 ? 88  ASP A C     1 
ATOM   724  O O     . ASP A  1 106 ? 24.217  37.138 -9.658  1.00 10.62 ? 88  ASP A O     1 
ATOM   725  C CB    . ASP A  1 106 ? 27.275  37.821 -10.172 1.00 11.27 ? 88  ASP A CB    1 
ATOM   726  C CG    . ASP A  1 106 ? 28.694  38.151 -9.847  1.00 12.41 ? 88  ASP A CG    1 
ATOM   727  O OD1   . ASP A  1 106 ? 28.976  38.823 -8.843  1.00 13.00 ? 88  ASP A OD1   1 
ATOM   728  O OD2   . ASP A  1 106 ? 29.563  37.680 -10.675 1.00 12.53 ? 88  ASP A OD2   1 
ATOM   729  N N     . MET A  1 107 ? 24.359  39.356 -10.133 1.00 10.97 ? 89  MET A N     1 
ATOM   730  C CA    . MET A  1 107 ? 23.063  39.450 -10.792 1.00 10.83 ? 89  MET A CA    1 
ATOM   731  C C     . MET A  1 107 ? 23.265  39.889 -12.242 1.00 10.89 ? 89  MET A C     1 
ATOM   732  O O     . MET A  1 107 ? 24.091  40.769 -12.503 1.00 11.29 ? 89  MET A O     1 
ATOM   733  C CB    . MET A  1 107 ? 22.137  40.459 -10.061 1.00 11.91 ? 89  MET A CB    1 
ATOM   734  C CG    . MET A  1 107 ? 21.799  40.029 -8.642  1.00 12.45 ? 89  MET A CG    1 
ATOM   735  S SD    . MET A  1 107 ? 21.075  41.376 -7.679  1.00 14.07 ? 89  MET A SD    1 
ATOM   736  C CE    . MET A  1 107 ? 19.524  41.558 -8.531  1.00 13.89 ? 89  MET A CE    1 
ATOM   737  N N     . VAL A  1 108 ? 22.433  39.360 -13.144 1.00 9.94  ? 90  VAL A N     1 
ATOM   738  C CA    . VAL A  1 108 ? 22.408  39.835 -14.524 1.00 9.82  ? 90  VAL A CA    1 
ATOM   739  C C     . VAL A  1 108 ? 20.973  40.033 -14.933 1.00 9.66  ? 90  VAL A C     1 
ATOM   740  O O     . VAL A  1 108 ? 20.107  39.136 -14.731 1.00 9.27  ? 90  VAL A O     1 
ATOM   741  C CB    . VAL A  1 108 ? 23.196  38.923 -15.508 1.00 9.69  ? 90  VAL A CB    1 
ATOM   742  C CG1   . VAL A  1 108 ? 22.828  37.491 -15.467 1.00 9.53  ? 90  VAL A CG1   1 
ATOM   743  C CG2   . VAL A  1 108 ? 23.205  39.504 -16.930 1.00 9.90  ? 90  VAL A CG2   1 
ATOM   744  N N     . ASP A  1 109 ? 20.707  41.176 -15.561 1.00 10.15 ? 91  ASP A N     1 
ATOM   745  C CA    . ASP A  1 109 ? 19.357  41.452 -16.042 1.00 10.20 ? 91  ASP A CA    1 
ATOM   746  C C     . ASP A  1 109 ? 19.426  42.500 -17.108 1.00 10.69 ? 91  ASP A C     1 
ATOM   747  O O     . ASP A  1 109 ? 20.282  43.423 -17.076 1.00 10.96 ? 91  ASP A O     1 
ATOM   748  C CB    . ASP A  1 109 ? 18.468  42.019 -14.894 1.00 10.72 ? 91  ASP A CB    1 
ATOM   749  C CG    . ASP A  1 109 ? 16.968  41.861 -15.184 1.00 10.82 ? 91  ASP A CG    1 
ATOM   750  O OD1   . ASP A  1 109 ? 16.401  40.800 -14.841 1.00 10.44 ? 91  ASP A OD1   1 
ATOM   751  O OD2   . ASP A  1 109 ? 16.371  42.819 -15.738 1.00 11.18 ? 91  ASP A OD2   1 
ATOM   752  N N     . ILE A  1 110 ? 18.483  42.455 -18.041 1.00 10.78 ? 92  ILE A N     1 
ATOM   753  C CA    . ILE A  1 110 ? 18.463  43.460 -19.083 1.00 11.64 ? 92  ILE A CA    1 
ATOM   754  C C     . ILE A  1 110 ? 17.914  44.827 -18.684 1.00 12.26 ? 92  ILE A C     1 
ATOM   755  O O     . ILE A  1 110 ? 18.164  45.804 -19.370 1.00 12.26 ? 92  ILE A O     1 
ATOM   756  C CB    . ILE A  1 110 ? 17.679  42.909 -20.302 1.00 12.27 ? 92  ILE A CB    1 
ATOM   757  C CG1   . ILE A  1 110 ? 18.229  43.503 -21.574 1.00 13.91 ? 92  ILE A CG1   1 
ATOM   758  C CG2   . ILE A  1 110 ? 16.172  43.000 -20.099 1.00 12.37 ? 92  ILE A CG2   1 
ATOM   759  C CD1   . ILE A  1 110 ? 17.578  42.866 -22.806 1.00 14.87 ? 92  ILE A CD1   1 
ATOM   760  N N     . THR A  1 111 ? 17.195  44.885 -17.567 1.00 12.17 ? 93  THR A N     1 
ATOM   761  C CA    . THR A  1 111 ? 16.439  46.083 -17.234 1.00 13.21 ? 93  THR A CA    1 
ATOM   762  C C     . THR A  1 111 ? 17.152  46.913 -16.173 1.00 14.46 ? 93  THR A C     1 
ATOM   763  O O     . THR A  1 111 ? 17.169  46.544 -15.003 1.00 13.95 ? 93  THR A O     1 
ATOM   764  C CB    . THR A  1 111 ? 14.991  45.752 -16.807 1.00 13.13 ? 93  THR A CB    1 
ATOM   765  O OG1   . THR A  1 111 ? 14.304  45.047 -17.878 1.00 12.49 ? 93  THR A OG1   1 
ATOM   766  C CG2   . THR A  1 111 ? 14.222  47.003 -16.502 1.00 14.04 ? 93  THR A CG2   1 
ATOM   767  N N     . GLU A  1 112 ? 17.768  48.007 -16.581 1.00 15.92 ? 94  GLU A N     1 
ATOM   768  C CA    A GLU A  1 112 ? 18.615  48.812 -15.673 0.70 17.53 ? 94  GLU A CA    1 
ATOM   769  C CA    B GLU A  1 112 ? 18.634  48.745 -15.648 0.30 16.96 ? 94  GLU A CA    1 
ATOM   770  C C     . GLU A  1 112 ? 17.834  49.215 -14.434 1.00 17.78 ? 94  GLU A C     1 
ATOM   771  O O     . GLU A  1 112 ? 18.366  49.151 -13.309 1.00 17.25 ? 94  GLU A O     1 
ATOM   772  C CB    A GLU A  1 112 ? 19.138  50.072 -16.385 0.70 20.02 ? 94  GLU A CB    1 
ATOM   773  C CB    B GLU A  1 112 ? 19.373  49.912 -16.324 0.30 18.32 ? 94  GLU A CB    1 
ATOM   774  C CG    A GLU A  1 112 ? 20.007  50.999 -15.529 0.70 22.83 ? 94  GLU A CG    1 
ATOM   775  C CG    B GLU A  1 112 ? 20.376  50.665 -15.440 0.30 19.56 ? 94  GLU A CG    1 
ATOM   776  C CD    A GLU A  1 112 ? 20.578  52.164 -16.334 0.70 25.41 ? 94  GLU A CD    1 
ATOM   777  C CD    B GLU A  1 112 ? 21.612  49.868 -15.085 0.30 19.35 ? 94  GLU A CD    1 
ATOM   778  O OE1   A GLU A  1 112 ? 20.304  52.327 -17.536 0.70 27.78 ? 94  GLU A OE1   1 
ATOM   779  O OE1   B GLU A  1 112 ? 21.726  49.454 -13.911 0.30 19.67 ? 94  GLU A OE1   1 
ATOM   780  O OE2   A GLU A  1 112 ? 21.322  52.922 -15.761 0.70 28.48 ? 94  GLU A OE2   1 
ATOM   781  O OE2   B GLU A  1 112 ? 22.475  49.671 -15.970 0.30 19.70 ? 94  GLU A OE2   1 
ATOM   782  N N     . ASP A  1 113 ? 16.596  49.642 -14.639 1.00 18.07 ? 95  ASP A N     1 
ATOM   783  C CA    . ASP A  1 113 ? 15.786  50.129 -13.491 1.00 19.51 ? 95  ASP A CA    1 
ATOM   784  C C     . ASP A  1 113 ? 15.578  49.098 -12.390 1.00 17.97 ? 95  ASP A C     1 
ATOM   785  O O     . ASP A  1 113 ? 15.488  49.448 -11.207 1.00 18.00 ? 95  ASP A O     1 
ATOM   786  C CB    . ASP A  1 113 ? 14.407  50.655 -13.940 1.00 21.13 ? 95  ASP A CB    1 
ATOM   787  C CG    . ASP A  1 113 ? 14.466  51.964 -14.696 1.00 23.97 ? 95  ASP A CG    1 
ATOM   788  O OD1   . ASP A  1 113 ? 15.507  52.678 -14.751 1.00 26.19 ? 95  ASP A OD1   1 
ATOM   789  O OD2   . ASP A  1 113 ? 13.404  52.339 -15.243 1.00 25.58 ? 95  ASP A OD2   1 
ATOM   790  N N     . PHE A  1 114 ? 15.539  47.820 -12.763 1.00 16.13 ? 96  PHE A N     1 
ATOM   791  C CA    . PHE A  1 114 ? 15.414  46.742 -11.758 1.00 15.31 ? 96  PHE A CA    1 
ATOM   792  C C     . PHE A  1 114 ? 16.705  46.580 -10.932 1.00 15.27 ? 96  PHE A C     1 
ATOM   793  O O     . PHE A  1 114 ? 16.652  46.360 -9.730  1.00 14.89 ? 96  PHE A O     1 
ATOM   794  C CB    . PHE A  1 114 ? 14.979  45.405 -12.401 1.00 14.02 ? 96  PHE A CB    1 
ATOM   795  C CG    . PHE A  1 114 ? 13.657  45.428 -13.076 1.00 14.04 ? 96  PHE A CG    1 
ATOM   796  C CD1   . PHE A  1 114 ? 12.683  46.398 -12.803 1.00 14.71 ? 96  PHE A CD1   1 
ATOM   797  C CD2   . PHE A  1 114 ? 13.345  44.438 -14.019 1.00 13.00 ? 96  PHE A CD2   1 
ATOM   798  C CE1   . PHE A  1 114 ? 11.438  46.349 -13.416 1.00 15.06 ? 96  PHE A CE1   1 
ATOM   799  C CE2   . PHE A  1 114 ? 12.117  44.408 -14.627 1.00 13.34 ? 96  PHE A CE2   1 
ATOM   800  C CZ    . PHE A  1 114 ? 11.160  45.362 -14.368 1.00 14.16 ? 96  PHE A CZ    1 
ATOM   801  N N     . LEU A  1 115 ? 17.870  46.642 -11.605 1.00 15.38 ? 97  LEU A N     1 
ATOM   802  C CA    . LEU A  1 115 ? 19.150  46.527 -10.920 1.00 15.82 ? 97  LEU A CA    1 
ATOM   803  C C     . LEU A  1 115 ? 19.364  47.739 -9.986  1.00 17.00 ? 97  LEU A C     1 
ATOM   804  O O     . LEU A  1 115 ? 19.933  47.582 -8.898  1.00 17.48 ? 97  LEU A O     1 
ATOM   805  C CB    . LEU A  1 115 ? 20.312  46.376 -11.923 1.00 16.11 ? 97  LEU A CB    1 
ATOM   806  C CG    . LEU A  1 115 ? 20.232  45.058 -12.703 1.00 15.68 ? 97  LEU A CG    1 
ATOM   807  C CD1   . LEU A  1 115 ? 21.368  45.038 -13.748 1.00 16.78 ? 97  LEU A CD1   1 
ATOM   808  C CD2   . LEU A  1 115 ? 20.258  43.803 -11.862 1.00 15.20 ? 97  LEU A CD2   1 
ATOM   809  N N     . VAL A  1 116 ? 18.918  48.913 -10.397 1.00 17.48 ? 98  VAL A N     1 
ATOM   810  C CA    . VAL A  1 116 ? 18.962  50.092 -9.487  1.00 19.01 ? 98  VAL A CA    1 
ATOM   811  C C     . VAL A  1 116 ? 18.056  49.841 -8.273  1.00 19.15 ? 98  VAL A C     1 
ATOM   812  O O     . VAL A  1 116 ? 18.481  50.074 -7.128  1.00 19.40 ? 98  VAL A O     1 
ATOM   813  C CB    . VAL A  1 116 ? 18.553  51.371 -10.187 1.00 20.21 ? 98  VAL A CB    1 
ATOM   814  C CG1   . VAL A  1 116 ? 18.562  52.573 -9.232  1.00 21.96 ? 98  VAL A CG1   1 
ATOM   815  C CG2   . VAL A  1 116 ? 19.512  51.663 -11.347 1.00 20.39 ? 98  VAL A CG2   1 
ATOM   816  N N     . GLN A  1 117 ? 16.814  49.392 -8.524  1.00 18.47 ? 99  GLN A N     1 
ATOM   817  C CA    . GLN A  1 117 ? 15.919  49.085 -7.412  1.00 18.95 ? 99  GLN A CA    1 
ATOM   818  C C     . GLN A  1 117 ? 16.483  48.037 -6.463  1.00 18.02 ? 99  GLN A C     1 
ATOM   819  O O     . GLN A  1 117 ? 16.336  48.161 -5.234  1.00 18.18 ? 99  GLN A O     1 
ATOM   820  C CB    . GLN A  1 117 ? 14.526  48.687 -7.865  1.00 19.30 ? 99  GLN A CB    1 
ATOM   821  C CG    . GLN A  1 117 ? 13.501  48.630 -6.720  1.00 20.88 ? 99  GLN A CG    1 
ATOM   822  C CD    . GLN A  1 117 ? 13.233  49.989 -6.119  1.00 23.15 ? 99  GLN A CD    1 
ATOM   823  O OE1   . GLN A  1 117 ? 13.206  51.002 -6.836  1.00 26.02 ? 99  GLN A OE1   1 
ATOM   824  N NE2   . GLN A  1 117 ? 12.993  50.061 -4.827  1.00 24.51 ? 99  GLN A NE2   1 
ATOM   825  N N     . ALA A  1 118 ? 17.157  47.033 -7.027  1.00 16.80 ? 100 ALA A N     1 
ATOM   826  C CA    . ALA A  1 118 ? 17.792  45.973 -6.240  1.00 16.43 ? 100 ALA A CA    1 
ATOM   827  C C     . ALA A  1 118 ? 18.650  46.515 -5.118  1.00 17.48 ? 100 ALA A C     1 
ATOM   828  O O     . ALA A  1 118 ? 18.731  45.930 -4.051  1.00 17.43 ? 100 ALA A O     1 
ATOM   829  C CB    . ALA A  1 118 ? 18.634  45.037 -7.127  1.00 15.18 ? 100 ALA A CB    1 
ATOM   830  N N     . LYS A  1 119 ? 19.346  47.607 -5.369  1.00 18.67 ? 101 LYS A N     1 
ATOM   831  C CA    . LYS A  1 119 ? 20.247  48.116 -4.347  1.00 20.40 ? 101 LYS A CA    1 
ATOM   832  C C     . LYS A  1 119 ? 19.432  48.499 -3.078  1.00 21.12 ? 101 LYS A C     1 
ATOM   833  O O     . LYS A  1 119 ? 19.912  48.298 -1.918  1.00 22.03 ? 101 LYS A O     1 
ATOM   834  C CB    . LYS A  1 119 ? 21.098  49.296 -4.908  1.00 21.92 ? 101 LYS A CB    1 
ATOM   835  C CG    . LYS A  1 119 ? 21.998  48.795 -6.084  1.00 22.00 ? 101 LYS A CG    1 
ATOM   836  N N     . THR A  1 120 ? 18.217  49.009 -3.280  1.00 21.13 ? 102 THR A N     1 
ATOM   837  C CA    . THR A  1 120 ? 17.328  49.304 -2.180  1.00 22.26 ? 102 THR A CA    1 
ATOM   838  C C     . THR A  1 120 ? 16.668  48.008 -1.632  1.00 21.27 ? 102 THR A C     1 
ATOM   839  O O     . THR A  1 120 ? 16.710  47.728 -0.398  1.00 21.41 ? 102 THR A O     1 
ATOM   840  C CB    . THR A  1 120 ? 16.300  50.401 -2.570  1.00 23.49 ? 102 THR A CB    1 
ATOM   841  O OG1   . THR A  1 120 ? 16.988  51.617 -2.876  1.00 24.52 ? 102 THR A OG1   1 
ATOM   842  C CG2   . THR A  1 120 ? 15.353  50.702 -1.412  1.00 25.02 ? 102 THR A CG2   1 
ATOM   843  N N     . TYR A  1 121 ? 16.070  47.246 -2.525  1.00 19.94 ? 103 TYR A N     1 
ATOM   844  C CA    . TYR A  1 121 ? 15.340  46.018 -2.175  1.00 19.55 ? 103 TYR A CA    1 
ATOM   845  C C     . TYR A  1 121 ? 16.180  45.044 -1.339  1.00 19.37 ? 103 TYR A C     1 
ATOM   846  O O     . TYR A  1 121 ? 15.702  44.447 -0.330  1.00 19.00 ? 103 TYR A O     1 
ATOM   847  C CB    . TYR A  1 121 ? 14.856  45.332 -3.449  1.00 18.77 ? 103 TYR A CB    1 
ATOM   848  C CG    . TYR A  1 121 ? 14.119  44.074 -3.224  1.00 18.44 ? 103 TYR A CG    1 
ATOM   849  C CD1   . TYR A  1 121 ? 12.842  44.086 -2.628  1.00 19.80 ? 103 TYR A CD1   1 
ATOM   850  C CD2   . TYR A  1 121 ? 14.673  42.866 -3.503  1.00 17.74 ? 103 TYR A CD2   1 
ATOM   851  C CE1   . TYR A  1 121 ? 12.177  42.904 -2.370  1.00 19.56 ? 103 TYR A CE1   1 
ATOM   852  C CE2   . TYR A  1 121 ? 13.984  41.681 -3.273  1.00 17.56 ? 103 TYR A CE2   1 
ATOM   853  C CZ    . TYR A  1 121 ? 12.738  41.734 -2.697  1.00 18.91 ? 103 TYR A CZ    1 
ATOM   854  O OH    . TYR A  1 121 ? 12.082  40.568 -2.410  1.00 20.23 ? 103 TYR A OH    1 
ATOM   855  N N     . LEU A  1 122 ? 17.453  44.917 -1.708  1.00 18.80 ? 104 LEU A N     1 
ATOM   856  C CA    . LEU A  1 122 ? 18.315  43.940 -1.039  1.00 18.94 ? 104 LEU A CA    1 
ATOM   857  C C     . LEU A  1 122 ? 18.805  44.382 0.328   1.00 20.57 ? 104 LEU A C     1 
ATOM   858  O O     . LEU A  1 122 ? 19.295  43.546 1.100   1.00 20.51 ? 104 LEU A O     1 
ATOM   859  C CB    . LEU A  1 122 ? 19.504  43.560 -1.913  1.00 18.26 ? 104 LEU A CB    1 
ATOM   860  C CG    . LEU A  1 122 ? 19.111  42.916 -3.214  1.00 17.79 ? 104 LEU A CG    1 
ATOM   861  C CD1   . LEU A  1 122 ? 20.375  42.741 -4.033  1.00 17.76 ? 104 LEU A CD1   1 
ATOM   862  C CD2   . LEU A  1 122 ? 18.438  41.597 -2.972  1.00 17.60 ? 104 LEU A CD2   1 
ATOM   863  N N     . GLY A  1 123 ? 18.747  45.668 0.622   1.00 22.12 ? 105 GLY A N     1 
ATOM   864  C CA    . GLY A  1 123 ? 19.178  46.160 1.943   1.00 24.00 ? 105 GLY A CA    1 
ATOM   865  C C     . GLY A  1 123 ? 20.654  45.859 2.231   1.00 24.39 ? 105 GLY A C     1 
ATOM   866  O O     . GLY A  1 123 ? 21.474  45.759 1.327   1.00 23.12 ? 105 GLY A O     1 
ATOM   867  N N     . GLU A  1 124 ? 20.963  45.661 3.508   1.00 25.52 ? 106 GLU A N     1 
ATOM   868  C CA    . GLU A  1 124 ? 22.321  45.507 3.982   1.00 27.00 ? 106 GLU A CA    1 
ATOM   869  C C     . GLU A  1 124 ? 23.011  44.253 3.410   1.00 24.41 ? 106 GLU A C     1 
ATOM   870  O O     . GLU A  1 124 ? 24.177  44.292 3.073   1.00 23.50 ? 106 GLU A O     1 
ATOM   871  C CB    . GLU A  1 124 ? 22.298  45.356 5.511   1.00 29.97 ? 106 GLU A CB    1 
ATOM   872  C CG    . GLU A  1 124 ? 23.689  45.337 6.146   1.00 33.47 ? 106 GLU A CG    1 
ATOM   873  C CD    . GLU A  1 124 ? 24.439  46.676 6.021   1.00 36.96 ? 106 GLU A CD    1 
ATOM   874  O OE1   . GLU A  1 124 ? 23.836  47.732 5.628   1.00 39.71 ? 106 GLU A OE1   1 
ATOM   875  O OE2   . GLU A  1 124 ? 25.669  46.684 6.314   1.00 41.34 ? 106 GLU A OE2   1 
ATOM   876  N N     . GLU A  1 125 ? 22.252  43.168 3.317   1.00 22.84 ? 107 GLU A N     1 
ATOM   877  C CA    . GLU A  1 125 ? 22.766  41.911 2.771   1.00 21.70 ? 107 GLU A CA    1 
ATOM   878  C C     . GLU A  1 125 ? 23.182  42.096 1.309   1.00 19.83 ? 107 GLU A C     1 
ATOM   879  O O     . GLU A  1 125 ? 24.039  41.380 0.811   1.00 18.40 ? 107 GLU A O     1 
ATOM   880  C CB    . GLU A  1 125 ? 21.709  40.791 2.893   1.00 21.55 ? 107 GLU A CB    1 
ATOM   881  C CG    . GLU A  1 125 ? 21.455  40.399 4.353   1.00 23.79 ? 107 GLU A CG    1 
ATOM   882  C CD    . GLU A  1 125 ? 22.701  39.838 5.035   1.00 24.48 ? 107 GLU A CD    1 
ATOM   883  O OE1   . GLU A  1 125 ? 23.126  38.688 4.740   1.00 24.09 ? 107 GLU A OE1   1 
ATOM   884  O OE2   . GLU A  1 125 ? 23.292  40.551 5.878   1.00 27.06 ? 107 GLU A OE2   1 
ATOM   885  N N     . GLY A  1 126 ? 22.551  43.046 0.631   1.00 19.34 ? 108 GLY A N     1 
ATOM   886  C CA    . GLY A  1 126 ? 22.893  43.381 -0.743  1.00 18.37 ? 108 GLY A CA    1 
ATOM   887  C C     . GLY A  1 126 ? 24.320  43.875 -0.938  1.00 18.59 ? 108 GLY A C     1 
ATOM   888  O O     . GLY A  1 126 ? 24.806  43.884 -2.083  1.00 17.80 ? 108 GLY A O     1 
ATOM   889  N N     . LYS A  1 127 ? 24.997  44.201 0.171   1.00 19.09 ? 109 LYS A N     1 
ATOM   890  C CA    . LYS A  1 127 ? 26.409  44.575 0.102   1.00 19.98 ? 109 LYS A CA    1 
ATOM   891  C C     . LYS A  1 127 ? 27.265  43.370 -0.375  1.00 18.97 ? 109 LYS A C     1 
ATOM   892  O O     . LYS A  1 127 ? 28.393  43.577 -0.869  1.00 19.40 ? 109 LYS A O     1 
ATOM   893  C CB    . LYS A  1 127 ? 26.883  45.136 1.405   1.00 21.71 ? 109 LYS A CB    1 
ATOM   894  C CG    . LYS A  1 127 ? 26.244  46.526 1.650   1.00 23.55 ? 109 LYS A CG    1 
ATOM   895  N N     . ARG A  1 128 ? 26.714  42.152 -0.281  1.00 17.36 ? 110 ARG A N     1 
ATOM   896  C CA    . ARG A  1 128 ? 27.423  40.958 -0.801  1.00 16.48 ? 110 ARG A CA    1 
ATOM   897  C C     . ARG A  1 128 ? 27.100  40.619 -2.257  1.00 15.38 ? 110 ARG A C     1 
ATOM   898  O O     . ARG A  1 128 ? 27.649  39.620 -2.798  1.00 14.87 ? 110 ARG A O     1 
ATOM   899  C CB    . ARG A  1 128 ? 27.248  39.745 0.126   1.00 16.25 ? 110 ARG A CB    1 
ATOM   900  C CG    . ARG A  1 128 ? 27.878  39.973 1.503   1.00 17.29 ? 110 ARG A CG    1 
ATOM   901  C CD    . ARG A  1 128 ? 27.779  38.782 2.440   1.00 17.30 ? 110 ARG A CD    1 
ATOM   902  N NE    . ARG A  1 128 ? 26.414  38.478 2.844   1.00 16.98 ? 110 ARG A NE    1 
ATOM   903  C CZ    . ARG A  1 128 ? 25.686  37.483 2.322   1.00 16.26 ? 110 ARG A CZ    1 
ATOM   904  N NH1   . ARG A  1 128 ? 26.174  36.653 1.392   1.00 15.26 ? 110 ARG A NH1   1 
ATOM   905  N NH2   . ARG A  1 128 ? 24.456  37.302 2.793   1.00 16.39 ? 110 ARG A NH2   1 
ATOM   906  N N     . VAL A  1 129 ? 26.262  41.425 -2.902  1.00 14.90 ? 111 VAL A N     1 
ATOM   907  C CA    . VAL A  1 129 ? 26.145  41.323 -4.375  1.00 14.50 ? 111 VAL A CA    1 
ATOM   908  C C     . VAL A  1 129 ? 27.390  41.959 -4.934  1.00 15.04 ? 111 VAL A C     1 
ATOM   909  O O     . VAL A  1 129 ? 27.745  43.122 -4.555  1.00 16.57 ? 111 VAL A O     1 
ATOM   910  C CB    . VAL A  1 129 ? 24.888  41.983 -4.922  1.00 14.30 ? 111 VAL A CB    1 
ATOM   911  C CG1   . VAL A  1 129 ? 24.861  41.970 -6.458  1.00 13.76 ? 111 VAL A CG1   1 
ATOM   912  C CG2   . VAL A  1 129 ? 23.682  41.218 -4.375  1.00 14.16 ? 111 VAL A CG2   1 
ATOM   913  N N     . ARG A  1 130 ? 28.086  41.221 -5.770  1.00 14.38 ? 112 ARG A N     1 
ATOM   914  C CA    . ARG A  1 130 ? 29.361  41.664 -6.255  1.00 15.49 ? 112 ARG A CA    1 
ATOM   915  C C     . ARG A  1 130 ? 29.121  42.462 -7.561  1.00 15.20 ? 112 ARG A C     1 
ATOM   916  O O     . ARG A  1 130 ? 29.076  43.695 -7.550  1.00 16.31 ? 112 ARG A O     1 
ATOM   917  C CB    . ARG A  1 130 ? 30.256  40.455 -6.403  1.00 15.57 ? 112 ARG A CB    1 
ATOM   918  C CG    . ARG A  1 130 ? 31.610  40.757 -6.995  1.00 16.80 ? 112 ARG A CG    1 
ATOM   919  C CD    . ARG A  1 130 ? 32.401  39.465 -7.076  1.00 17.25 ? 112 ARG A CD    1 
ATOM   920  N NE    . ARG A  1 130 ? 31.863  38.516 -8.010  1.00 16.78 ? 112 ARG A NE    1 
ATOM   921  C CZ    . ARG A  1 130 ? 32.481  37.394 -8.367  1.00 17.80 ? 112 ARG A CZ    1 
ATOM   922  N NH1   . ARG A  1 130 ? 33.608  37.045 -7.746  1.00 19.42 ? 112 ARG A NH1   1 
ATOM   923  N NH2   . ARG A  1 130 ? 31.973  36.623 -9.281  1.00 17.62 ? 112 ARG A NH2   1 
ATOM   924  N N     . ASN A  1 131 ? 28.810  41.759 -8.641  1.00 14.18 ? 113 ASN A N     1 
ATOM   925  C CA    . ASN A  1 131 ? 28.605  42.365 -9.937  1.00 13.94 ? 113 ASN A CA    1 
ATOM   926  C C     . ASN A  1 131 ? 27.103  42.473 -10.226 1.00 13.35 ? 113 ASN A C     1 
ATOM   927  O O     . ASN A  1 131 ? 26.347  41.482 -10.078 1.00 12.38 ? 113 ASN A O     1 
ATOM   928  C CB    . ASN A  1 131 ? 29.237  41.492 -11.008 1.00 13.44 ? 113 ASN A CB    1 
ATOM   929  C CG    . ASN A  1 131 ? 30.759  41.363 -10.849 1.00 14.27 ? 113 ASN A CG    1 
ATOM   930  O OD1   . ASN A  1 131 ? 31.435  42.387 -10.832 1.00 15.35 ? 113 ASN A OD1   1 
ATOM   931  N ND2   . ASN A  1 131 ? 31.296  40.168 -10.872 1.00 13.76 ? 113 ASN A ND2   1 
ATOM   932  N N     . TYR A  1 132 ? 26.700  43.684 -10.626 1.00 14.24 ? 114 TYR A N     1 
ATOM   933  C CA    . TYR A  1 132 ? 25.377  43.897 -11.203 1.00 14.24 ? 114 TYR A CA    1 
ATOM   934  C C     . TYR A  1 132 ? 25.579  44.120 -12.712 1.00 13.62 ? 114 TYR A C     1 
ATOM   935  O O     . TYR A  1 132 ? 26.099  45.184 -13.146 1.00 15.00 ? 114 TYR A O     1 
ATOM   936  C CB    . TYR A  1 132 ? 24.738  45.164 -10.635 1.00 15.62 ? 114 TYR A CB    1 
ATOM   937  C CG    . TYR A  1 132 ? 24.367  45.147 -9.171  1.00 16.75 ? 114 TYR A CG    1 
ATOM   938  C CD1   . TYR A  1 132 ? 25.270  45.590 -8.201  1.00 18.41 ? 114 TYR A CD1   1 
ATOM   939  C CD2   . TYR A  1 132 ? 23.075  44.764 -8.771  1.00 17.31 ? 114 TYR A CD2   1 
ATOM   940  C CE1   . TYR A  1 132 ? 24.880  45.633 -6.849  1.00 19.36 ? 114 TYR A CE1   1 
ATOM   941  C CE2   . TYR A  1 132 ? 22.688  44.833 -7.461  1.00 18.27 ? 114 TYR A CE2   1 
ATOM   942  C CZ    . TYR A  1 132 ? 23.573  45.241 -6.524  1.00 18.85 ? 114 TYR A CZ    1 
ATOM   943  O OH    . TYR A  1 132 ? 23.165  45.274 -5.192  1.00 21.45 ? 114 TYR A OH    1 
ATOM   944  N N     . PHE A  1 133 ? 25.272  43.109 -13.487 1.00 12.76 ? 115 PHE A N     1 
ATOM   945  C CA    . PHE A  1 133 ? 25.494  43.139 -14.922 1.00 12.69 ? 115 PHE A CA    1 
ATOM   946  C C     . PHE A  1 133 ? 24.198  43.534 -15.604 1.00 12.37 ? 115 PHE A C     1 
ATOM   947  O O     . PHE A  1 133 ? 23.189  42.799 -15.494 1.00 11.92 ? 115 PHE A O     1 
ATOM   948  C CB    . PHE A  1 133 ? 25.920  41.781 -15.462 1.00 11.90 ? 115 PHE A CB    1 
ATOM   949  C CG    . PHE A  1 133 ? 27.272  41.286 -14.978 1.00 12.07 ? 115 PHE A CG    1 
ATOM   950  C CD1   . PHE A  1 133 ? 28.445  41.855 -15.478 1.00 13.14 ? 115 PHE A CD1   1 
ATOM   951  C CD2   . PHE A  1 133 ? 27.383  40.179 -14.149 1.00 11.78 ? 115 PHE A CD2   1 
ATOM   952  C CE1   . PHE A  1 133 ? 29.679  41.397 -15.101 1.00 13.23 ? 115 PHE A CE1   1 
ATOM   953  C CE2   . PHE A  1 133 ? 28.657  39.722 -13.791 1.00 12.15 ? 115 PHE A CE2   1 
ATOM   954  C CZ    . PHE A  1 133 ? 29.768  40.312 -14.274 1.00 12.75 ? 115 PHE A CZ    1 
ATOM   955  N N     . CYS A  1 134 ? 24.235  44.649 -16.328 1.00 13.10 ? 116 CYS A N     1 
ATOM   956  C CA    . CYS A  1 134 ? 23.029  45.048 -17.079 1.00 13.46 ? 116 CYS A CA    1 
ATOM   957  C C     . CYS A  1 134 ? 23.228  44.676 -18.556 1.00 13.17 ? 116 CYS A C     1 
ATOM   958  O O     . CYS A  1 134 ? 23.915  45.367 -19.291 1.00 13.87 ? 116 CYS A O     1 
ATOM   959  C CB    . CYS A  1 134 ? 22.728  46.484 -16.883 1.00 14.88 ? 116 CYS A CB    1 
ATOM   960  S SG    . CYS A  1 134 ? 21.204  46.982 -17.748 1.00 15.64 ? 116 CYS A SG    1 
ATOM   961  N N     A CYS A  1 135 ? 22.646  43.562 -18.938 0.70 12.35 ? 117 CYS A N     1 
ATOM   962  N N     B CYS A  1 135 ? 22.691  43.551 -18.982 0.30 12.33 ? 117 CYS A N     1 
ATOM   963  C CA    A CYS A  1 135 ? 22.910  42.948 -20.226 0.70 12.26 ? 117 CYS A CA    1 
ATOM   964  C CA    B CYS A  1 135 ? 22.663  43.231 -20.412 0.30 12.21 ? 117 CYS A CA    1 
ATOM   965  C C     A CYS A  1 135 ? 21.843  41.908 -20.532 0.70 11.50 ? 117 CYS A C     1 
ATOM   966  C C     B CYS A  1 135 ? 21.787  42.025 -20.563 0.30 11.48 ? 117 CYS A C     1 
ATOM   967  O O     A CYS A  1 135 ? 21.300  41.301 -19.608 0.70 11.35 ? 117 CYS A O     1 
ATOM   968  O O     B CYS A  1 135 ? 21.374  41.405 -19.584 0.30 11.18 ? 117 CYS A O     1 
ATOM   969  C CB    A CYS A  1 135 ? 24.286  42.253 -20.039 0.70 12.23 ? 117 CYS A CB    1 
ATOM   970  C CB    B CYS A  1 135 ? 24.049  42.861 -20.948 0.30 12.34 ? 117 CYS A CB    1 
ATOM   971  S SG    A CYS A  1 135 ? 25.054  41.591 -21.516 0.70 12.48 ? 117 CYS A SG    1 
ATOM   972  S SG    B CYS A  1 135 ? 24.603  41.284 -20.235 0.30 11.60 ? 117 CYS A SG    1 
ATOM   973  N N     . GLY A  1 136 ? 21.516  41.695 -21.815 1.00 11.39 ? 118 GLY A N     1 
ATOM   974  C CA    . GLY A  1 136 ? 20.721  40.545 -22.132 1.00 10.89 ? 118 GLY A CA    1 
ATOM   975  C C     . GLY A  1 136 ? 21.515  39.268 -21.987 1.00 10.27 ? 118 GLY A C     1 
ATOM   976  O O     . GLY A  1 136 ? 22.740  39.239 -22.235 1.00 11.18 ? 118 GLY A O     1 
ATOM   977  N N     . LEU A  1 137 ? 20.859  38.178 -21.607 1.00 9.51  ? 119 LEU A N     1 
ATOM   978  C CA    . LEU A  1 137 ? 21.550  36.888 -21.459 1.00 9.38  ? 119 LEU A CA    1 
ATOM   979  C C     . LEU A  1 137 ? 22.212  36.494 -22.775 1.00 9.40  ? 119 LEU A C     1 
ATOM   980  O O     . LEU A  1 137 ? 23.306  35.933 -22.783 1.00 9.31  ? 119 LEU A O     1 
ATOM   981  C CB    . LEU A  1 137 ? 20.644  35.775 -21.017 1.00 9.03  ? 119 LEU A CB    1 
ATOM   982  C CG    . LEU A  1 137 ? 19.932  35.980 -19.658 1.00 9.48  ? 119 LEU A CG    1 
ATOM   983  C CD1   . LEU A  1 137 ? 19.155  34.746 -19.236 1.00 9.53  ? 119 LEU A CD1   1 
ATOM   984  C CD2   . LEU A  1 137 ? 20.870  36.434 -18.520 1.00 9.70  ? 119 LEU A CD2   1 
ATOM   985  N N     . GLN A  1 138 ? 21.527  36.830 -23.860 1.00 9.76  ? 120 GLN A N     1 
ATOM   986  C CA    . GLN A  1 138 ? 22.045  36.503 -25.210 1.00 9.98  ? 120 GLN A CA    1 
ATOM   987  C C     . GLN A  1 138 ? 23.362  37.180 -25.528 1.00 10.86 ? 120 GLN A C     1 
ATOM   988  O O     . GLN A  1 138 ? 24.059  36.750 -26.460 1.00 11.17 ? 120 GLN A O     1 
ATOM   989  C CB    . GLN A  1 138 ? 20.994  36.818 -26.292 1.00 10.57 ? 120 GLN A CB    1 
ATOM   990  C CG    . GLN A  1 138 ? 20.660  38.268 -26.525 1.00 11.39 ? 120 GLN A CG    1 
ATOM   991  C CD    . GLN A  1 138 ? 19.645  38.913 -25.602 1.00 11.58 ? 120 GLN A CD    1 
ATOM   992  O OE1   . GLN A  1 138 ? 19.327  38.390 -24.565 1.00 10.77 ? 120 GLN A OE1   1 
ATOM   993  N NE2   . GLN A  1 138 ? 19.082  40.035 -26.050 1.00 13.29 ? 120 GLN A NE2   1 
ATOM   994  N N     . ASP A  1 139 ? 23.716  38.243 -24.800 1.00 10.68 ? 121 ASP A N     1 
ATOM   995  C CA    . ASP A  1 139 ? 24.972  38.970 -24.945 1.00 11.90 ? 121 ASP A CA    1 
ATOM   996  C C     . ASP A  1 139 ? 25.936  38.796 -23.759 1.00 11.26 ? 121 ASP A C     1 
ATOM   997  O O     . ASP A  1 139 ? 26.969  39.440 -23.736 1.00 11.52 ? 121 ASP A O     1 
ATOM   998  C CB    . ASP A  1 139 ? 24.640  40.477 -25.107 1.00 13.12 ? 121 ASP A CB    1 
ATOM   999  C CG    . ASP A  1 139 ? 23.905  40.767 -26.394 1.00 14.58 ? 121 ASP A CG    1 
ATOM   1000 O OD1   . ASP A  1 139 ? 24.307  40.238 -27.419 1.00 15.55 ? 121 ASP A OD1   1 
ATOM   1001 O OD2   . ASP A  1 139 ? 22.901  41.476 -26.368 1.00 15.88 ? 121 ASP A OD2   1 
ATOM   1002 N N     . PHE A  1 140 ? 25.613  37.916 -22.834 1.00 10.25 ? 122 PHE A N     1 
ATOM   1003 C CA    . PHE A  1 140 ? 26.377  37.793 -21.578 1.00 10.30 ? 122 PHE A CA    1 
ATOM   1004 C C     . PHE A  1 140 ? 27.257  36.523 -21.614 1.00 9.93  ? 122 PHE A C     1 
ATOM   1005 O O     . PHE A  1 140 ? 26.756  35.397 -21.926 1.00 9.10  ? 122 PHE A O     1 
ATOM   1006 C CB    . PHE A  1 140 ? 25.392  37.696 -20.402 1.00 10.25 ? 122 PHE A CB    1 
ATOM   1007 C CG    . PHE A  1 140 ? 26.058  37.660 -19.028 1.00 10.66 ? 122 PHE A CG    1 
ATOM   1008 C CD1   . PHE A  1 140 ? 26.870  38.724 -18.639 1.00 11.77 ? 122 PHE A CD1   1 
ATOM   1009 C CD2   . PHE A  1 140 ? 25.870  36.616 -18.166 1.00 10.73 ? 122 PHE A CD2   1 
ATOM   1010 C CE1   . PHE A  1 140 ? 27.491  38.721 -17.402 1.00 11.95 ? 122 PHE A CE1   1 
ATOM   1011 C CE2   . PHE A  1 140 ? 26.525  36.592 -16.925 1.00 11.03 ? 122 PHE A CE2   1 
ATOM   1012 C CZ    . PHE A  1 140 ? 27.322  37.668 -16.585 1.00 11.69 ? 122 PHE A CZ    1 
ATOM   1013 N N     . THR A  1 141 ? 28.542  36.713 -21.309 1.00 10.05 ? 123 THR A N     1 
ATOM   1014 C CA    . THR A  1 141 ? 29.484  35.579 -21.175 1.00 10.12 ? 123 THR A CA    1 
ATOM   1015 C C     . THR A  1 141 ? 30.044  35.550 -19.742 1.00 10.52 ? 123 THR A C     1 
ATOM   1016 O O     . THR A  1 141 ? 31.012  36.270 -19.485 1.00 11.01 ? 123 THR A O     1 
ATOM   1017 C CB    . THR A  1 141 ? 30.598  35.675 -22.174 1.00 10.76 ? 123 THR A CB    1 
ATOM   1018 O OG1   . THR A  1 141 ? 30.052  35.786 -23.518 1.00 10.52 ? 123 THR A OG1   1 
ATOM   1019 C CG2   . THR A  1 141 ? 31.475  34.427 -22.121 1.00 11.04 ? 123 THR A CG2   1 
ATOM   1020 N N     . PRO A  1 142 ? 29.459  34.703 -18.883 1.00 10.41 ? 124 PRO A N     1 
ATOM   1021 C CA    . PRO A  1 142 ? 29.974  34.636 -17.494 1.00 11.18 ? 124 PRO A CA    1 
ATOM   1022 C C     . PRO A  1 142 ? 31.403  34.179 -17.456 1.00 11.89 ? 124 PRO A C     1 
ATOM   1023 O O     . PRO A  1 142 ? 31.900  33.426 -18.329 1.00 11.67 ? 124 PRO A O     1 
ATOM   1024 C CB    . PRO A  1 142 ? 29.010  33.725 -16.776 1.00 10.36 ? 124 PRO A CB    1 
ATOM   1025 C CG    . PRO A  1 142 ? 28.429  32.909 -17.830 1.00 10.35 ? 124 PRO A CG    1 
ATOM   1026 C CD    . PRO A  1 142 ? 28.325  33.799 -19.049 1.00 10.16 ? 124 PRO A CD    1 
ATOM   1027 N N     . GLU A  1 143 ? 32.120  34.735 -16.473 1.00 12.35 ? 125 GLU A N     1 
ATOM   1028 C CA    . GLU A  1 143 ? 33.527  34.410 -16.298 1.00 13.09 ? 125 GLU A CA    1 
ATOM   1029 C C     . GLU A  1 143 ? 33.749  32.893 -16.087 1.00 13.15 ? 125 GLU A C     1 
ATOM   1030 O O     . GLU A  1 143 ? 33.080  32.319 -15.264 1.00 12.12 ? 125 GLU A O     1 
ATOM   1031 C CB    . GLU A  1 143 ? 34.096  35.167 -15.076 1.00 13.85 ? 125 GLU A CB    1 
ATOM   1032 C CG    . GLU A  1 143 ? 35.561  34.972 -14.878 1.00 14.77 ? 125 GLU A CG    1 
ATOM   1033 C CD    . GLU A  1 143 ? 36.147  35.623 -13.647 1.00 15.91 ? 125 GLU A CD    1 
ATOM   1034 O OE1   . GLU A  1 143 ? 37.267  35.221 -13.212 1.00 16.75 ? 125 GLU A OE1   1 
ATOM   1035 O OE2   . GLU A  1 143 ? 35.464  36.521 -13.099 1.00 16.85 ? 125 GLU A OE2   1 
ATOM   1036 N N     . PRO A  1 144 ? 34.724  32.310 -16.789 1.00 14.11 ? 126 PRO A N     1 
ATOM   1037 C CA    . PRO A  1 144 ? 35.000  30.897 -16.564 1.00 14.43 ? 126 PRO A CA    1 
ATOM   1038 C C     . PRO A  1 144 ? 35.268  30.581 -15.118 1.00 14.57 ? 126 PRO A C     1 
ATOM   1039 O O     . PRO A  1 144 ? 35.930  31.378 -14.421 1.00 14.28 ? 126 PRO A O     1 
ATOM   1040 C CB    . PRO A  1 144 ? 36.235  30.661 -17.381 1.00 15.79 ? 126 PRO A CB    1 
ATOM   1041 C CG    . PRO A  1 144 ? 36.050  31.517 -18.589 1.00 16.02 ? 126 PRO A CG    1 
ATOM   1042 C CD    . PRO A  1 144 ? 35.392  32.771 -18.033 1.00 15.57 ? 126 PRO A CD    1 
ATOM   1043 N N     . ASP A  1 145 ? 34.850  29.383 -14.666 1.00 14.62 ? 127 ASP A N     1 
ATOM   1044 C CA    . ASP A  1 145 ? 35.259  28.852 -13.368 1.00 15.51 ? 127 ASP A CA    1 
ATOM   1045 C C     . ASP A  1 145 ? 34.939  29.816 -12.218 1.00 14.78 ? 127 ASP A C     1 
ATOM   1046 O O     . ASP A  1 145 ? 35.809  30.116 -11.354 1.00 15.59 ? 127 ASP A O     1 
ATOM   1047 C CB    . ASP A  1 145 ? 36.757  28.468 -13.382 1.00 18.13 ? 127 ASP A CB    1 
ATOM   1048 C CG    . ASP A  1 145 ? 37.219  27.731 -12.134 1.00 20.03 ? 127 ASP A CG    1 
ATOM   1049 O OD1   . ASP A  1 145 ? 36.453  26.927 -11.570 1.00 19.51 ? 127 ASP A OD1   1 
ATOM   1050 O OD2   . ASP A  1 145 ? 38.405  27.926 -11.688 1.00 22.42 ? 127 ASP A OD2   1 
ATOM   1051 N N     . SER A  1 146 ? 33.735  30.345 -12.230 1.00 13.35 ? 128 SER A N     1 
ATOM   1052 C CA    . SER A  1 146 ? 33.352  31.385 -11.282 1.00 13.47 ? 128 SER A CA    1 
ATOM   1053 C C     . SER A  1 146 ? 32.180  31.080 -10.370 1.00 12.75 ? 128 SER A C     1 
ATOM   1054 O O     . SER A  1 146 ? 32.102  31.702 -9.273  1.00 13.29 ? 128 SER A O     1 
ATOM   1055 C CB    . SER A  1 146 ? 33.012  32.684 -12.063 1.00 13.60 ? 128 SER A CB    1 
ATOM   1056 O OG    . SER A  1 146 ? 34.220  33.207 -12.512 1.00 15.00 ? 128 SER A OG    1 
ATOM   1057 N N     . TYR A  1 147 ? 31.245  30.238 -10.778 1.00 11.66 ? 129 TYR A N     1 
ATOM   1058 C CA    . TYR A  1 147 ? 29.993  30.106 -10.034 1.00 10.93 ? 129 TYR A CA    1 
ATOM   1059 C C     . TYR A  1 147 ? 29.764  28.648 -9.591  1.00 11.07 ? 129 TYR A C     1 
ATOM   1060 O O     . TYR A  1 147 ? 29.934  27.708 -10.347 1.00 10.69 ? 129 TYR A O     1 
ATOM   1061 C CB    . TYR A  1 147 ? 28.782  30.561 -10.843 1.00 10.52 ? 129 TYR A CB    1 
ATOM   1062 C CG    . TYR A  1 147 ? 28.923  31.995 -11.287 1.00 10.62 ? 129 TYR A CG    1 
ATOM   1063 C CD1   . TYR A  1 147 ? 28.852  33.025 -10.366 1.00 11.14 ? 129 TYR A CD1   1 
ATOM   1064 C CD2   . TYR A  1 147 ? 29.136  32.311 -12.624 1.00 10.74 ? 129 TYR A CD2   1 
ATOM   1065 C CE1   . TYR A  1 147 ? 28.950  34.361 -10.756 1.00 11.39 ? 129 TYR A CE1   1 
ATOM   1066 C CE2   . TYR A  1 147 ? 29.248  33.624 -13.010 1.00 10.90 ? 129 TYR A CE2   1 
ATOM   1067 C CZ    . TYR A  1 147 ? 29.111  34.646 -12.117 1.00 11.43 ? 129 TYR A CZ    1 
ATOM   1068 O OH    . TYR A  1 147 ? 29.234  35.953 -12.565 1.00 11.46 ? 129 TYR A OH    1 
ATOM   1069 N N     . ASP A  1 148 ? 29.348  28.518 -8.360  1.00 10.73 ? 130 ASP A N     1 
ATOM   1070 C CA    . ASP A  1 148 ? 28.849  27.260 -7.831  1.00 10.79 ? 130 ASP A CA    1 
ATOM   1071 C C     . ASP A  1 148 ? 27.443  26.928 -8.289  1.00 10.23 ? 130 ASP A C     1 
ATOM   1072 O O     . ASP A  1 148 ? 27.113  25.762 -8.548  1.00 10.32 ? 130 ASP A O     1 
ATOM   1073 C CB    . ASP A  1 148 ? 28.901  27.313 -6.287  1.00 11.22 ? 130 ASP A CB    1 
ATOM   1074 C CG    . ASP A  1 148 ? 30.317  27.492 -5.786  1.00 12.08 ? 130 ASP A CG    1 
ATOM   1075 O OD1   . ASP A  1 148 ? 31.206  26.645 -6.125  1.00 12.16 ? 130 ASP A OD1   1 
ATOM   1076 O OD2   . ASP A  1 148 ? 30.586  28.561 -5.112  1.00 12.64 ? 130 ASP A OD2   1 
ATOM   1077 N N     . VAL A  1 149 ? 26.582  27.938 -8.335  1.00 9.51  ? 131 VAL A N     1 
ATOM   1078 C CA    . VAL A  1 149 ? 25.231  27.803 -8.793  1.00 9.34  ? 131 VAL A CA    1 
ATOM   1079 C C     . VAL A  1 149 ? 24.883  28.931 -9.745  1.00 9.16  ? 131 VAL A C     1 
ATOM   1080 O O     . VAL A  1 149 ? 25.160  30.087 -9.457  1.00 9.25  ? 131 VAL A O     1 
ATOM   1081 C CB    . VAL A  1 149 ? 24.245  27.756 -7.641  1.00 9.64  ? 131 VAL A CB    1 
ATOM   1082 C CG1   . VAL A  1 149 ? 22.813  27.839 -8.098  1.00 9.34  ? 131 VAL A CG1   1 
ATOM   1083 C CG2   . VAL A  1 149 ? 24.479  26.510 -6.808  1.00 10.06 ? 131 VAL A CG2   1 
ATOM   1084 N N     . ILE A  1 150 ? 24.329  28.560 -10.905 1.00 8.63  ? 132 ILE A N     1 
ATOM   1085 C CA    . ILE A  1 150 ? 23.814  29.522 -11.851 1.00 8.74  ? 132 ILE A CA    1 
ATOM   1086 C C     . ILE A  1 150 ? 22.315  29.303 -11.871 1.00 8.66  ? 132 ILE A C     1 
ATOM   1087 O O     . ILE A  1 150 ? 21.873  28.226 -12.254 1.00 8.93  ? 132 ILE A O     1 
ATOM   1088 C CB    . ILE A  1 150 ? 24.408  29.341 -13.247 1.00 8.78  ? 132 ILE A CB    1 
ATOM   1089 C CG1   . ILE A  1 150 ? 25.921  29.586 -13.155 1.00 8.89  ? 132 ILE A CG1   1 
ATOM   1090 C CG2   . ILE A  1 150 ? 23.723  30.321 -14.191 1.00 8.50  ? 132 ILE A CG2   1 
ATOM   1091 C CD1   . ILE A  1 150 ? 26.690  29.334 -14.451 1.00 9.30  ? 132 ILE A CD1   1 
ATOM   1092 N N     . TRP A  1 151 ? 21.560  30.302 -11.428 1.00 8.53  ? 133 TRP A N     1 
ATOM   1093 C CA    . TRP A  1 151 ? 20.118  30.204 -11.208 1.00 8.78  ? 133 TRP A CA    1 
ATOM   1094 C C     . TRP A  1 151 ? 19.400  30.966 -12.322 1.00 8.72  ? 133 TRP A C     1 
ATOM   1095 O O     . TRP A  1 151 ? 19.602  32.184 -12.465 1.00 9.03  ? 133 TRP A O     1 
ATOM   1096 C CB    . TRP A  1 151 ? 19.708  30.749 -9.818  1.00 9.13  ? 133 TRP A CB    1 
ATOM   1097 C CG    . TRP A  1 151 ? 18.378  30.293 -9.429  1.00 9.12  ? 133 TRP A CG    1 
ATOM   1098 C CD1   . TRP A  1 151 ? 17.187  30.862 -9.738  1.00 9.22  ? 133 TRP A CD1   1 
ATOM   1099 C CD2   . TRP A  1 151 ? 18.044  29.134 -8.618  1.00 9.47  ? 133 TRP A CD2   1 
ATOM   1100 N NE1   . TRP A  1 151 ? 16.156  30.159 -9.210  1.00 9.29  ? 133 TRP A NE1   1 
ATOM   1101 C CE2   . TRP A  1 151 ? 16.631  29.054 -8.566  1.00 9.50  ? 133 TRP A CE2   1 
ATOM   1102 C CE3   . TRP A  1 151 ? 18.778  28.156 -8.030  1.00 9.74  ? 133 TRP A CE3   1 
ATOM   1103 C CZ2   . TRP A  1 151 ? 15.974  28.076 -7.836  1.00 9.88  ? 133 TRP A CZ2   1 
ATOM   1104 C CZ3   . TRP A  1 151 ? 18.140  27.167 -7.343  1.00 10.10 ? 133 TRP A CZ3   1 
ATOM   1105 C CH2   . TRP A  1 151 ? 16.734  27.129 -7.253  1.00 10.04 ? 133 TRP A CH2   1 
ATOM   1106 N N     . ILE A  1 152 ? 18.621  30.272 -13.112 1.00 8.35  ? 134 ILE A N     1 
ATOM   1107 C CA    . ILE A  1 152 ? 17.921  30.877 -14.258 1.00 8.16  ? 134 ILE A CA    1 
ATOM   1108 C C     . ILE A  1 152 ? 16.423  30.671 -14.113 1.00 8.58  ? 134 ILE A C     1 
ATOM   1109 O O     . ILE A  1 152 ? 15.905  29.590 -14.413 1.00 8.77  ? 134 ILE A O     1 
ATOM   1110 C CB    . ILE A  1 152 ? 18.402  30.238 -15.598 1.00 8.00  ? 134 ILE A CB    1 
ATOM   1111 C CG1   . ILE A  1 152 ? 19.945  30.159 -15.660 1.00 7.97  ? 134 ILE A CG1   1 
ATOM   1112 C CG2   . ILE A  1 152 ? 17.816  31.016 -16.792 1.00 8.22  ? 134 ILE A CG2   1 
ATOM   1113 C CD1   . ILE A  1 152 ? 20.462  29.370 -16.846 1.00 7.92  ? 134 ILE A CD1   1 
ATOM   1114 N N     . GLN A  1 153 ? 15.691  31.710 -13.674 1.00 8.25  ? 135 GLN A N     1 
ATOM   1115 C CA    . GLN A  1 153 ? 14.265  31.537 -13.341 1.00 8.58  ? 135 GLN A CA    1 
ATOM   1116 C C     . GLN A  1 153 ? 13.371  32.574 -14.012 1.00 8.95  ? 135 GLN A C     1 
ATOM   1117 O O     . GLN A  1 153 ? 13.654  33.795 -13.938 1.00 8.87  ? 135 GLN A O     1 
ATOM   1118 C CB    . GLN A  1 153 ? 14.069  31.546 -11.843 1.00 8.90  ? 135 GLN A CB    1 
ATOM   1119 C CG    . GLN A  1 153 ? 12.606  31.398 -11.428 1.00 9.40  ? 135 GLN A CG    1 
ATOM   1120 C CD    . GLN A  1 153 ? 12.383  30.850 -10.018 1.00 10.09 ? 135 GLN A CD    1 
ATOM   1121 O OE1   . GLN A  1 153 ? 13.325  30.456 -9.276  1.00 10.33 ? 135 GLN A OE1   1 
ATOM   1122 N NE2   . GLN A  1 153 ? 11.104  30.764 -9.669  1.00 10.44 ? 135 GLN A NE2   1 
ATOM   1123 N N     . TRP A  1 154 ? 12.352  32.081 -14.699 1.00 9.23  ? 136 TRP A N     1 
ATOM   1124 C CA    . TRP A  1 154 ? 11.359  32.899 -15.316 1.00 9.38  ? 136 TRP A CA    1 
ATOM   1125 C C     . TRP A  1 154 ? 11.972  33.881 -16.320 1.00 9.60  ? 136 TRP A C     1 
ATOM   1126 O O     . TRP A  1 154 ? 11.617  35.085 -16.400 1.00 9.70  ? 136 TRP A O     1 
ATOM   1127 C CB    . TRP A  1 154 ? 10.420  33.540 -14.240 1.00 9.91  ? 136 TRP A CB    1 
ATOM   1128 C CG    . TRP A  1 154 ? 9.359   32.599 -13.819 1.00 10.38 ? 136 TRP A CG    1 
ATOM   1129 C CD1   . TRP A  1 154 ? 8.638   31.778 -14.624 1.00 10.69 ? 136 TRP A CD1   1 
ATOM   1130 C CD2   . TRP A  1 154 ? 8.861   32.377 -12.491 1.00 10.76 ? 136 TRP A CD2   1 
ATOM   1131 N NE1   . TRP A  1 154 ? 7.756   31.014 -13.881 1.00 11.14 ? 136 TRP A NE1   1 
ATOM   1132 C CE2   . TRP A  1 154 ? 7.838   31.402 -12.580 1.00 11.40 ? 136 TRP A CE2   1 
ATOM   1133 C CE3   . TRP A  1 154 ? 9.138   32.927 -11.243 1.00 10.92 ? 136 TRP A CE3   1 
ATOM   1134 C CZ2   . TRP A  1 154 ? 7.152   30.915 -11.464 1.00 11.80 ? 136 TRP A CZ2   1 
ATOM   1135 C CZ3   . TRP A  1 154 ? 8.381   32.476 -10.129 1.00 11.49 ? 136 TRP A CZ3   1 
ATOM   1136 C CH2   . TRP A  1 154 ? 7.427   31.447 -10.266 1.00 11.95 ? 136 TRP A CH2   1 
ATOM   1137 N N     . VAL A  1 155 ? 12.892  33.354 -17.110 1.00 8.82  ? 137 VAL A N     1 
ATOM   1138 C CA    . VAL A  1 155 ? 13.515  34.169 -18.154 1.00 9.05  ? 137 VAL A CA    1 
ATOM   1139 C C     . VAL A  1 155 ? 13.869  33.363 -19.396 1.00 9.28  ? 137 VAL A C     1 
ATOM   1140 O O     . VAL A  1 155 ? 14.049  33.974 -20.404 1.00 8.81  ? 137 VAL A O     1 
ATOM   1141 C CB    . VAL A  1 155 ? 14.732  34.925 -17.610 1.00 8.95  ? 137 VAL A CB    1 
ATOM   1142 C CG1   . VAL A  1 155 ? 15.843  33.956 -17.177 1.00 8.57  ? 137 VAL A CG1   1 
ATOM   1143 C CG2   . VAL A  1 155 ? 15.231  35.991 -18.547 1.00 9.36  ? 137 VAL A CG2   1 
ATOM   1144 N N     . ILE A  1 156 ? 13.915  32.020 -19.363 1.00 9.45  ? 138 ILE A N     1 
ATOM   1145 C CA    . ILE A  1 156 ? 14.347  31.341 -20.574 1.00 9.05  ? 138 ILE A CA    1 
ATOM   1146 C C     . ILE A  1 156 ? 13.413  31.536 -21.748 1.00 9.00  ? 138 ILE A C     1 
ATOM   1147 O O     . ILE A  1 156 ? 13.873  31.370 -22.915 1.00 8.74  ? 138 ILE A O     1 
ATOM   1148 C CB    . ILE A  1 156 ? 14.557  29.800 -20.408 1.00 9.72  ? 138 ILE A CB    1 
ATOM   1149 C CG1   . ILE A  1 156 ? 13.241  29.037 -20.181 1.00 10.10 ? 138 ILE A CG1   1 
ATOM   1150 C CG2   . ILE A  1 156 ? 15.563  29.532 -19.269 1.00 9.95  ? 138 ILE A CG2   1 
ATOM   1151 C CD1   . ILE A  1 156 ? 13.374  27.507 -20.318 1.00 10.26 ? 138 ILE A CD1   1 
ATOM   1152 N N     . GLY A  1 157 ? 12.141  31.855 -21.495 1.00 8.83  ? 139 GLY A N     1 
ATOM   1153 C CA    . GLY A  1 157 ? 11.200  32.104 -22.573 1.00 9.43  ? 139 GLY A CA    1 
ATOM   1154 C C     . GLY A  1 157 ? 11.518  33.389 -23.338 1.00 9.30  ? 139 GLY A C     1 
ATOM   1155 O O     . GLY A  1 157 ? 10.950  33.609 -24.374 1.00 9.69  ? 139 GLY A O     1 
ATOM   1156 N N     . HIS A  1 158 ? 12.432  34.194 -22.845 1.00 9.23  ? 140 HIS A N     1 
ATOM   1157 C CA    . HIS A  1 158 ? 12.858  35.396 -23.528 1.00 9.35  ? 140 HIS A CA    1 
ATOM   1158 C C     . HIS A  1 158 ? 14.011  35.212 -24.498 1.00 9.52  ? 140 HIS A C     1 
ATOM   1159 O O     . HIS A  1 158 ? 14.399  36.175 -25.172 1.00 9.47  ? 140 HIS A O     1 
ATOM   1160 C CB    . HIS A  1 158 ? 13.165  36.520 -22.525 1.00 9.43  ? 140 HIS A CB    1 
ATOM   1161 C CG    . HIS A  1 158 ? 11.928  37.202 -22.043 1.00 9.77  ? 140 HIS A CG    1 
ATOM   1162 N ND1   . HIS A  1 158 ? 11.105  37.912 -22.876 1.00 10.38 ? 140 HIS A ND1   1 
ATOM   1163 C CD2   . HIS A  1 158 ? 11.359  37.240 -20.823 1.00 10.01 ? 140 HIS A CD2   1 
ATOM   1164 C CE1   . HIS A  1 158 ? 10.079  38.393 -22.182 1.00 10.96 ? 140 HIS A CE1   1 
ATOM   1165 N NE2   . HIS A  1 158 ? 10.227  38.005 -20.923 1.00 10.73 ? 140 HIS A NE2   1 
ATOM   1166 N N     . LEU A  1 159 ? 14.548  33.997 -24.592 1.00 9.58  ? 141 LEU A N     1 
ATOM   1167 C CA    . LEU A  1 159 ? 15.619  33.730 -25.531 1.00 10.11 ? 141 LEU A CA    1 
ATOM   1168 C C     . LEU A  1 159 ? 15.132  32.791 -26.621 1.00 9.55  ? 141 LEU A C     1 
ATOM   1169 O O     . LEU A  1 159 ? 14.336  31.886 -26.359 1.00 9.19  ? 141 LEU A O     1 
ATOM   1170 C CB    . LEU A  1 159 ? 16.859  33.080 -24.879 1.00 11.17 ? 141 LEU A CB    1 
ATOM   1171 C CG    . LEU A  1 159 ? 17.597  33.781 -23.788 1.00 13.98 ? 141 LEU A CG    1 
ATOM   1172 C CD1   . LEU A  1 159 ? 18.991  33.165 -23.548 1.00 14.87 ? 141 LEU A CD1   1 
ATOM   1173 C CD2   . LEU A  1 159 ? 17.736  35.223 -23.957 1.00 14.77 ? 141 LEU A CD2   1 
ATOM   1174 N N     . THR A  1 160 ? 15.658  32.970 -27.821 1.00 9.03  ? 142 THR A N     1 
ATOM   1175 C CA    . THR A  1 160 ? 15.397  32.013 -28.931 1.00 9.45  ? 142 THR A CA    1 
ATOM   1176 C C     . THR A  1 160 ? 16.063  30.671 -28.563 1.00 8.99  ? 142 THR A C     1 
ATOM   1177 O O     . THR A  1 160 ? 16.942  30.637 -27.689 1.00 8.74  ? 142 THR A O     1 
ATOM   1178 C CB    . THR A  1 160 ? 16.032  32.501 -30.246 1.00 9.92  ? 142 THR A CB    1 
ATOM   1179 O OG1   . THR A  1 160 ? 17.481  32.552 -30.077 1.00 9.95  ? 142 THR A OG1   1 
ATOM   1180 C CG2   . THR A  1 160 ? 15.473  33.867 -30.698 1.00 10.19 ? 142 THR A CG2   1 
ATOM   1181 N N     . ASP A  1 161 ? 15.700  29.595 -29.252 1.00 9.54  ? 143 ASP A N     1 
ATOM   1182 C CA    . ASP A  1 161 ? 16.307  28.304 -28.971 1.00 9.51  ? 143 ASP A CA    1 
ATOM   1183 C C     . ASP A  1 161 ? 17.815  28.357 -29.201 1.00 9.30  ? 143 ASP A C     1 
ATOM   1184 O O     . ASP A  1 161 ? 18.581  27.862 -28.362 1.00 9.22  ? 143 ASP A O     1 
ATOM   1185 C CB    . ASP A  1 161 ? 15.741  27.204 -29.859 1.00 10.06 ? 143 ASP A CB    1 
ATOM   1186 C CG    . ASP A  1 161 ? 14.282  26.895 -29.623 1.00 10.32 ? 143 ASP A CG    1 
ATOM   1187 O OD1   . ASP A  1 161 ? 13.745  27.260 -28.580 1.00 10.34 ? 143 ASP A OD1   1 
ATOM   1188 O OD2   . ASP A  1 161 ? 13.709  26.325 -30.584 1.00 10.72 ? 143 ASP A OD2   1 
ATOM   1189 N N     . GLN A  1 162 ? 18.232  29.033 -30.263 1.00 9.80  ? 144 GLN A N     1 
ATOM   1190 C CA    . GLN A  1 162 ? 19.695  29.080 -30.524 1.00 10.00 ? 144 GLN A CA    1 
ATOM   1191 C C     . GLN A  1 162 ? 20.386  29.854 -29.399 1.00 10.16 ? 144 GLN A C     1 
ATOM   1192 O O     . GLN A  1 162 ? 21.439  29.425 -28.914 1.00 9.60  ? 144 GLN A O     1 
ATOM   1193 C CB    . GLN A  1 162 ? 19.972  29.720 -31.850 1.00 10.45 ? 144 GLN A CB    1 
ATOM   1194 C CG    . GLN A  1 162 ? 21.414  29.853 -32.245 1.00 10.65 ? 144 GLN A CG    1 
ATOM   1195 C CD    . GLN A  1 162 ? 22.056  28.513 -32.523 1.00 10.86 ? 144 GLN A CD    1 
ATOM   1196 O OE1   . GLN A  1 162 ? 21.426  27.622 -33.091 1.00 10.95 ? 144 GLN A OE1   1 
ATOM   1197 N NE2   . GLN A  1 162 ? 23.363  28.373 -32.170 1.00 10.93 ? 144 GLN A NE2   1 
ATOM   1198 N N     . HIS A  1 163 ? 19.806  30.993 -28.998 1.00 9.92  ? 145 HIS A N     1 
ATOM   1199 C CA    . HIS A  1 163 ? 20.479  31.809 -27.979 1.00 10.54 ? 145 HIS A CA    1 
ATOM   1200 C C     . HIS A  1 163 ? 20.411  31.143 -26.615 1.00 9.08  ? 145 HIS A C     1 
ATOM   1201 O O     . HIS A  1 163 ? 21.355  31.266 -25.844 1.00 8.77  ? 145 HIS A O     1 
ATOM   1202 C CB    . HIS A  1 163 ? 19.812  33.133 -27.865 1.00 12.21 ? 145 HIS A CB    1 
ATOM   1203 C CG    . HIS A  1 163 ? 20.151  34.027 -28.985 1.00 15.59 ? 145 HIS A CG    1 
ATOM   1204 N ND1   . HIS A  1 163 ? 19.401  35.150 -29.291 1.00 17.06 ? 145 HIS A ND1   1 
ATOM   1205 C CD2   . HIS A  1 163 ? 21.201  34.016 -29.838 1.00 19.22 ? 145 HIS A CD2   1 
ATOM   1206 C CE1   . HIS A  1 163 ? 19.980  35.800 -30.285 1.00 19.50 ? 145 HIS A CE1   1 
ATOM   1207 N NE2   . HIS A  1 163 ? 21.056  35.122 -30.672 1.00 21.60 ? 145 HIS A NE2   1 
ATOM   1208 N N     . LEU A  1 164 ? 19.342  30.414 -26.340 1.00 8.46  ? 146 LEU A N     1 
ATOM   1209 C CA    . LEU A  1 164 ? 19.234  29.682 -25.083 1.00 8.15  ? 146 LEU A CA    1 
ATOM   1210 C C     . LEU A  1 164 ? 20.311  28.549 -25.016 1.00 8.04  ? 146 LEU A C     1 
ATOM   1211 O O     . LEU A  1 164 ? 21.006  28.370 -23.985 1.00 7.91  ? 146 LEU A O     1 
ATOM   1212 C CB    . LEU A  1 164 ? 17.831  29.139 -24.871 1.00 8.53  ? 146 LEU A CB    1 
ATOM   1213 C CG    . LEU A  1 164 ? 17.628  28.364 -23.566 1.00 8.70  ? 146 LEU A CG    1 
ATOM   1214 C CD1   . LEU A  1 164 ? 18.007  29.150 -22.330 1.00 8.68  ? 146 LEU A CD1   1 
ATOM   1215 C CD2   . LEU A  1 164 ? 16.194  27.856 -23.514 1.00 9.32  ? 146 LEU A CD2   1 
ATOM   1216 N N     . ALA A  1 165 ? 20.414  27.796 -26.095 1.00 7.92  ? 147 ALA A N     1 
ATOM   1217 C CA    . ALA A  1 165 ? 21.427  26.716 -26.154 1.00 8.22  ? 147 ALA A CA    1 
ATOM   1218 C C     . ALA A  1 165 ? 22.817  27.328 -25.966 1.00 8.05  ? 147 ALA A C     1 
ATOM   1219 O O     . ALA A  1 165 ? 23.610  26.836 -25.137 1.00 8.20  ? 147 ALA A O     1 
ATOM   1220 C CB    . ALA A  1 165 ? 21.376  25.954 -27.434 1.00 8.67  ? 147 ALA A CB    1 
ATOM   1221 N N     . GLU A  1 166 ? 23.103  28.408 -26.676 1.00 8.11  ? 148 GLU A N     1 
ATOM   1222 C CA    . GLU A  1 166 ? 24.416  29.050 -26.550 1.00 8.41  ? 148 GLU A CA    1 
ATOM   1223 C C     . GLU A  1 166 ? 24.679  29.623 -25.116 1.00 8.02  ? 148 GLU A C     1 
ATOM   1224 O O     . GLU A  1 166 ? 25.800  29.425 -24.547 1.00 8.13  ? 148 GLU A O     1 
ATOM   1225 C CB    . GLU A  1 166 ? 24.630  30.174 -27.558 1.00 9.06  ? 148 GLU A CB    1 
ATOM   1226 C CG    . GLU A  1 166 ? 24.708  29.668 -28.972 1.00 9.91  ? 148 GLU A CG    1 
ATOM   1227 C CD    . GLU A  1 166 ? 25.133  30.685 -29.978 1.00 11.33 ? 148 GLU A CD    1 
ATOM   1228 O OE1   . GLU A  1 166 ? 26.025  31.528 -29.611 1.00 12.56 ? 148 GLU A OE1   1 
ATOM   1229 O OE2   . GLU A  1 166 ? 24.802  30.580 -31.188 1.00 11.04 ? 148 GLU A OE2   1 
ATOM   1230 N N     . PHE A  1 167 ? 23.678  30.244 -24.554 1.00 8.00  ? 149 PHE A N     1 
ATOM   1231 C CA    . PHE A  1 167 ? 23.823  30.797 -23.177 1.00 7.90  ? 149 PHE A CA    1 
ATOM   1232 C C     . PHE A  1 167 ? 24.132  29.647 -22.190 1.00 7.75  ? 149 PHE A C     1 
ATOM   1233 O O     . PHE A  1 167 ? 25.044  29.760 -21.361 1.00 7.73  ? 149 PHE A O     1 
ATOM   1234 C CB    . PHE A  1 167 ? 22.589  31.561 -22.750 1.00 8.03  ? 149 PHE A CB    1 
ATOM   1235 C CG    . PHE A  1 167 ? 22.693  32.112 -21.373 1.00 8.11  ? 149 PHE A CG    1 
ATOM   1236 C CD1   . PHE A  1 167 ? 23.702  33.039 -21.104 1.00 8.67  ? 149 PHE A CD1   1 
ATOM   1237 C CD2   . PHE A  1 167 ? 21.889  31.645 -20.366 1.00 8.12  ? 149 PHE A CD2   1 
ATOM   1238 C CE1   . PHE A  1 167 ? 23.860  33.523 -19.826 1.00 9.17  ? 149 PHE A CE1   1 
ATOM   1239 C CE2   . PHE A  1 167 ? 22.026  32.147 -19.068 1.00 8.71  ? 149 PHE A CE2   1 
ATOM   1240 C CZ    . PHE A  1 167 ? 22.991  33.097 -18.818 1.00 8.59  ? 149 PHE A CZ    1 
ATOM   1241 N N     . LEU A  1 168 ? 23.425  28.540 -22.317 1.00 7.89  ? 150 LEU A N     1 
ATOM   1242 C CA    . LEU A  1 168 ? 23.667  27.363 -21.453 1.00 8.28  ? 150 LEU A CA    1 
ATOM   1243 C C     . LEU A  1 168 ? 25.101  26.836 -21.644 1.00 8.66  ? 150 LEU A C     1 
ATOM   1244 O O     . LEU A  1 168 ? 25.742  26.426 -20.668 1.00 8.82  ? 150 LEU A O     1 
ATOM   1245 C CB    . LEU A  1 168 ? 22.633  26.246 -21.680 1.00 8.80  ? 150 LEU A CB    1 
ATOM   1246 C CG    . LEU A  1 168 ? 21.275  26.651 -21.168 1.00 8.76  ? 150 LEU A CG    1 
ATOM   1247 C CD1   . LEU A  1 168 ? 20.236  25.648 -21.545 1.00 9.33  ? 150 LEU A CD1   1 
ATOM   1248 C CD2   . LEU A  1 168 ? 21.200  26.827 -19.641 1.00 8.95  ? 150 LEU A CD2   1 
ATOM   1249 N N     . ARG A  1 169 ? 25.614  26.786 -22.895 1.00 8.70  ? 151 ARG A N     1 
ATOM   1250 C CA    . ARG A  1 169 ? 26.993  26.378 -23.114 1.00 9.12  ? 151 ARG A CA    1 
ATOM   1251 C C     . ARG A  1 169 ? 27.991  27.319 -22.363 1.00 9.25  ? 151 ARG A C     1 
ATOM   1252 O O     . ARG A  1 169 ? 29.026  26.884 -21.765 1.00 9.60  ? 151 ARG A O     1 
ATOM   1253 C CB    . ARG A  1 169 ? 27.357  26.356 -24.604 1.00 9.76  ? 151 ARG A CB    1 
ATOM   1254 C CG    . ARG A  1 169 ? 26.610  25.331 -25.408 1.00 10.14 ? 151 ARG A CG    1 
ATOM   1255 C CD    . ARG A  1 169 ? 27.085  25.313 -26.869 1.00 10.99 ? 151 ARG A CD    1 
ATOM   1256 N NE    . ARG A  1 169 ? 26.237  24.357 -27.589 1.00 11.62 ? 151 ARG A NE    1 
ATOM   1257 C CZ    . ARG A  1 169 ? 25.189  24.659 -28.333 1.00 11.57 ? 151 ARG A CZ    1 
ATOM   1258 N NH1   . ARG A  1 169 ? 24.957  25.905 -28.746 1.00 11.50 ? 151 ARG A NH1   1 
ATOM   1259 N NH2   . ARG A  1 169 ? 24.390  23.716 -28.731 1.00 11.94 ? 151 ARG A NH2   1 
ATOM   1260 N N     . ARG A  1 170 ? 27.736  28.617 -22.468 1.00 8.63  ? 152 ARG A N     1 
ATOM   1261 C CA    . ARG A  1 170 ? 28.554  29.594 -21.780 1.00 9.10  ? 152 ARG A CA    1 
ATOM   1262 C C     . ARG A  1 170 ? 28.491  29.435 -20.272 1.00 9.25  ? 152 ARG A C     1 
ATOM   1263 O O     . ARG A  1 170 ? 29.530  29.519 -19.580 1.00 10.06 ? 152 ARG A O     1 
ATOM   1264 C CB    . ARG A  1 170 ? 28.249  31.041 -22.273 1.00 8.79  ? 152 ARG A CB    1 
ATOM   1265 C CG    . ARG A  1 170 ? 28.475  31.229 -23.779 1.00 8.96  ? 152 ARG A CG    1 
ATOM   1266 C CD    . ARG A  1 170 ? 28.602  32.683 -24.204 1.00 9.21  ? 152 ARG A CD    1 
ATOM   1267 N NE    . ARG A  1 170 ? 27.407  33.449 -23.870 1.00 8.85  ? 152 ARG A NE    1 
ATOM   1268 C CZ    . ARG A  1 170 ? 26.274  33.483 -24.559 1.00 8.86  ? 152 ARG A CZ    1 
ATOM   1269 N NH1   . ARG A  1 170 ? 26.168  32.810 -25.680 1.00 8.97  ? 152 ARG A NH1   1 
ATOM   1270 N NH2   . ARG A  1 170 ? 25.275  34.246 -24.198 1.00 8.53  ? 152 ARG A NH2   1 
ATOM   1271 N N     . CYS A  1 171 ? 27.298  29.198 -19.761 1.00 9.19  ? 153 CYS A N     1 
ATOM   1272 C CA    . CYS A  1 171 ? 27.081  28.885 -18.346 1.00 9.73  ? 153 CYS A CA    1 
ATOM   1273 C C     . CYS A  1 171 ? 27.858  27.676 -17.910 1.00 10.12 ? 153 CYS A C     1 
ATOM   1274 O O     . CYS A  1 171 ? 28.522  27.709 -16.851 1.00 10.04 ? 153 CYS A O     1 
ATOM   1275 C CB    . CYS A  1 171 ? 25.598  28.740 -18.063 1.00 9.59  ? 153 CYS A CB    1 
ATOM   1276 S SG    . CYS A  1 171 ? 24.672  30.280 -18.019 1.00 10.62 ? 153 CYS A SG    1 
ATOM   1277 N N     . LYS A  1 172 ? 27.838  26.618 -18.700 1.00 10.01 ? 154 LYS A N     1 
ATOM   1278 C CA    . LYS A  1 172 ? 28.602  25.409 -18.356 1.00 10.81 ? 154 LYS A CA    1 
ATOM   1279 C C     . LYS A  1 172 ? 30.065  25.721 -18.129 1.00 11.18 ? 154 LYS A C     1 
ATOM   1280 O O     . LYS A  1 172 ? 30.677  25.188 -17.198 1.00 11.24 ? 154 LYS A O     1 
ATOM   1281 C CB    . LYS A  1 172 ? 28.448  24.385 -19.474 1.00 11.58 ? 154 LYS A CB    1 
ATOM   1282 C CG    . LYS A  1 172 ? 29.076  23.019 -19.172 1.00 12.65 ? 154 LYS A CG    1 
ATOM   1283 C CD    . LYS A  1 172 ? 28.917  22.036 -20.325 1.00 14.06 ? 154 LYS A CD    1 
ATOM   1284 C CE    . LYS A  1 172 ? 29.711  20.755 -20.028 1.00 16.46 ? 154 LYS A CE    1 
ATOM   1285 N NZ    . LYS A  1 172 ? 29.617  19.734 -21.115 1.00 17.81 ? 154 LYS A NZ    1 
ATOM   1286 N N     . GLY A  1 173 ? 30.641  26.558 -19.015 1.00 11.10 ? 155 GLY A N     1 
ATOM   1287 C CA    . GLY A  1 173 ? 32.008  26.975 -18.961 1.00 12.59 ? 155 GLY A CA    1 
ATOM   1288 C C     . GLY A  1 173 ? 32.343  27.853 -17.738 1.00 13.10 ? 155 GLY A C     1 
ATOM   1289 O O     . GLY A  1 173 ? 33.513  27.970 -17.352 1.00 15.94 ? 155 GLY A O     1 
ATOM   1290 N N     . SER A  1 174 ? 31.343  28.385 -17.078 1.00 11.91 ? 156 SER A N     1 
ATOM   1291 C CA    . SER A  1 174 ? 31.550  29.296 -15.937 1.00 11.85 ? 156 SER A CA    1 
ATOM   1292 C C     . SER A  1 174 ? 31.385  28.554 -14.597 1.00 11.82 ? 156 SER A C     1 
ATOM   1293 O O     . SER A  1 174 ? 31.541  29.177 -13.530 1.00 12.23 ? 156 SER A O     1 
ATOM   1294 C CB    A SER A  1 174 ? 30.693  30.521 -16.025 0.80 11.99 ? 156 SER A CB    1 
ATOM   1295 C CB    B SER A  1 174 ? 30.532  30.441 -16.066 0.10 11.32 ? 156 SER A CB    1 
ATOM   1296 C CB    C SER A  1 174 ? 30.599  30.478 -16.043 0.10 11.40 ? 156 SER A CB    1 
ATOM   1297 O OG    A SER A  1 174 ? 29.406  30.202 -15.743 0.80 12.04 ? 156 SER A OG    1 
ATOM   1298 O OG    B SER A  1 174 ? 30.535  31.324 -14.969 0.10 11.26 ? 156 SER A OG    1 
ATOM   1299 O OG    C SER A  1 174 ? 30.876  31.185 -17.238 0.10 11.48 ? 156 SER A OG    1 
ATOM   1300 N N     . LEU A  1 175 ? 30.982  27.266 -14.621 1.00 11.31 ? 157 LEU A N     1 
ATOM   1301 C CA    . LEU A  1 175 ? 30.786  26.528 -13.343 1.00 11.06 ? 157 LEU A CA    1 
ATOM   1302 C C     . LEU A  1 175 ? 32.110  26.148 -12.707 1.00 11.81 ? 157 LEU A C     1 
ATOM   1303 O O     . LEU A  1 175 ? 33.078  25.703 -13.367 1.00 12.23 ? 157 LEU A O     1 
ATOM   1304 C CB    . LEU A  1 175 ? 30.012  25.246 -13.576 1.00 11.04 ? 157 LEU A CB    1 
ATOM   1305 C CG    . LEU A  1 175 ? 28.565  25.448 -13.963 1.00 10.31 ? 157 LEU A CG    1 
ATOM   1306 C CD1   . LEU A  1 175 ? 28.001  24.078 -14.349 1.00 10.63 ? 157 LEU A CD1   1 
ATOM   1307 C CD2   . LEU A  1 175 ? 27.758  26.164 -12.964 1.00 10.26 ? 157 LEU A CD2   1 
ATOM   1308 N N     . ARG A  1 176 ? 32.174  26.330 -11.380 1.00 12.06 ? 158 ARG A N     1 
ATOM   1309 C CA    . ARG A  1 176 ? 33.229  25.763 -10.540 1.00 13.04 ? 158 ARG A CA    1 
ATOM   1310 C C     . ARG A  1 176 ? 33.082  24.234 -10.488 1.00 13.21 ? 158 ARG A C     1 
ATOM   1311 O O     . ARG A  1 176 ? 32.055  23.709 -10.898 1.00 11.95 ? 158 ARG A O     1 
ATOM   1312 C CB    A ARG A  1 176 ? 33.076  26.315 -9.095  0.60 13.38 ? 158 ARG A CB    1 
ATOM   1313 C CB    B ARG A  1 176 ? 33.249  26.452 -9.160  0.40 13.41 ? 158 ARG A CB    1 
ATOM   1314 C CG    A ARG A  1 176 ? 33.326  27.806 -8.916  0.60 13.60 ? 158 ARG A CG    1 
ATOM   1315 C CG    B ARG A  1 176 ? 33.633  27.917 -9.317  0.40 13.63 ? 158 ARG A CG    1 
ATOM   1316 C CD    A ARG A  1 176 ? 34.801  28.099 -8.929  0.60 14.66 ? 158 ARG A CD    1 
ATOM   1317 C CD    B ARG A  1 176 ? 34.100  28.605 -8.061  0.40 14.40 ? 158 ARG A CD    1 
ATOM   1318 N NE    A ARG A  1 176 ? 35.420  27.692 -7.706  0.60 15.63 ? 158 ARG A NE    1 
ATOM   1319 N NE    B ARG A  1 176 ? 35.076  29.629 -8.418  0.40 15.07 ? 158 ARG A NE    1 
ATOM   1320 N N     . PRO A  1 177 ? 34.111  23.531 -10.044 1.00 14.45 ? 159 PRO A N     1 
ATOM   1321 C CA    . PRO A  1 177 ? 33.946  22.092 -9.808  1.00 14.95 ? 159 PRO A CA    1 
ATOM   1322 C C     . PRO A  1 177 ? 32.751  21.849 -8.917  1.00 14.23 ? 159 PRO A C     1 
ATOM   1323 O O     . PRO A  1 177 ? 32.526  22.539 -7.882  1.00 13.69 ? 159 PRO A O     1 
ATOM   1324 C CB    . PRO A  1 177 ? 35.214  21.691 -9.081  1.00 16.24 ? 159 PRO A CB    1 
ATOM   1325 C CG    . PRO A  1 177 ? 36.251  22.702 -9.591  1.00 16.71 ? 159 PRO A CG    1 
ATOM   1326 C CD    . PRO A  1 177 ? 35.470  23.977 -9.658  1.00 15.77 ? 159 PRO A CD    1 
ATOM   1327 N N     . ASN A  1 178 ? 31.975  20.839 -9.342  1.00 13.78 ? 160 ASN A N     1 
ATOM   1328 C CA    . ASN A  1 178 ? 30.735  20.437 -8.661  1.00 13.17 ? 160 ASN A CA    1 
ATOM   1329 C C     . ASN A  1 178 ? 29.610  21.452 -8.806  1.00 11.91 ? 160 ASN A C     1 
ATOM   1330 O O     . ASN A  1 178 ? 28.562  21.319 -8.179  1.00 11.35 ? 160 ASN A O     1 
ATOM   1331 C CB    . ASN A  1 178 ? 30.899  20.084 -7.173  1.00 13.96 ? 160 ASN A CB    1 
ATOM   1332 C CG    . ASN A  1 178 ? 31.807  18.938 -6.921  1.00 15.38 ? 160 ASN A CG    1 
ATOM   1333 O OD1   . ASN A  1 178 ? 32.114  18.170 -7.816  1.00 15.84 ? 160 ASN A OD1   1 
ATOM   1334 N ND2   . ASN A  1 178 ? 32.128  18.737 -5.679  1.00 16.45 ? 160 ASN A ND2   1 
ATOM   1335 N N     . GLY A  1 179 ? 29.788  22.476 -9.629  1.00 11.00 ? 161 GLY A N     1 
ATOM   1336 C CA    . GLY A  1 179 ? 28.752  23.454 -9.828  1.00 10.35 ? 161 GLY A CA    1 
ATOM   1337 C C     . GLY A  1 179 ? 27.553  22.942 -10.613 1.00 9.93  ? 161 GLY A C     1 
ATOM   1338 O O     . GLY A  1 179 ? 27.654  21.937 -11.305 1.00 10.15 ? 161 GLY A O     1 
ATOM   1339 N N     . ILE A  1 180 ? 26.442  23.601 -10.472 1.00 9.36  ? 162 ILE A N     1 
ATOM   1340 C CA    . ILE A  1 180 ? 25.215  23.265 -11.179 1.00 9.34  ? 162 ILE A CA    1 
ATOM   1341 C C     . ILE A  1 180 ? 24.548  24.502 -11.754 1.00 9.11  ? 162 ILE A C     1 
ATOM   1342 O O     . ILE A  1 180 ? 24.727  25.660 -11.264 1.00 8.36  ? 162 ILE A O     1 
ATOM   1343 C CB    . ILE A  1 180 ? 24.221  22.513 -10.274 1.00 9.80  ? 162 ILE A CB    1 
ATOM   1344 C CG1   . ILE A  1 180 ? 23.780  23.436 -9.120  1.00 10.02 ? 162 ILE A CG1   1 
ATOM   1345 C CG2   . ILE A  1 180 ? 24.776  21.206 -9.740  1.00 10.59 ? 162 ILE A CG2   1 
ATOM   1346 C CD1   . ILE A  1 180 ? 22.625  22.817 -8.314  1.00 10.66 ? 162 ILE A CD1   1 
ATOM   1347 N N     . ILE A  1 181 ? 23.774  24.251 -12.825 1.00 8.94  ? 163 ILE A N     1 
ATOM   1348 C CA    . ILE A  1 181 ? 22.844  25.214 -13.369 1.00 8.58  ? 163 ILE A CA    1 
ATOM   1349 C C     . ILE A  1 181 ? 21.442  24.780 -12.969 1.00 8.92  ? 163 ILE A C     1 
ATOM   1350 O O     . ILE A  1 181 ? 21.096  23.607 -13.109 1.00 8.83  ? 163 ILE A O     1 
ATOM   1351 C CB    . ILE A  1 181 ? 22.961  25.303 -14.900 1.00 8.67  ? 163 ILE A CB    1 
ATOM   1352 C CG1   . ILE A  1 181 ? 24.341  25.829 -15.307 1.00 8.84  ? 163 ILE A CG1   1 
ATOM   1353 C CG2   . ILE A  1 181 ? 21.893  26.182 -15.499 1.00 8.54  ? 163 ILE A CG2   1 
ATOM   1354 C CD1   . ILE A  1 181 ? 24.782  25.422 -16.727 1.00 9.19  ? 163 ILE A CD1   1 
ATOM   1355 N N     . VAL A  1 182 ? 20.620  25.743 -12.549 1.00 8.86  ? 164 VAL A N     1 
ATOM   1356 C CA    . VAL A  1 182 ? 19.219  25.446 -12.240 1.00 9.23  ? 164 VAL A CA    1 
ATOM   1357 C C     . VAL A  1 182 ? 18.374  26.325 -13.156 1.00 9.26  ? 164 VAL A C     1 
ATOM   1358 O O     . VAL A  1 182 ? 18.585  27.540 -13.274 1.00 9.26  ? 164 VAL A O     1 
ATOM   1359 C CB    . VAL A  1 182 ? 18.852  25.711 -10.767 1.00 9.53  ? 164 VAL A CB    1 
ATOM   1360 C CG1   . VAL A  1 182 ? 17.329  25.523 -10.597 1.00 10.02 ? 164 VAL A CG1   1 
ATOM   1361 C CG2   . VAL A  1 182 ? 19.638  24.785 -9.839  1.00 9.94  ? 164 VAL A CG2   1 
ATOM   1362 N N     . ILE A  1 183 ? 17.462  25.685 -13.892 1.00 9.42  ? 165 ILE A N     1 
ATOM   1363 C CA    . ILE A  1 183 ? 16.451  26.353 -14.618 1.00 9.22  ? 165 ILE A CA    1 
ATOM   1364 C C     . ILE A  1 183 ? 15.127  26.095 -13.887 1.00 9.56  ? 165 ILE A C     1 
ATOM   1365 O O     . ILE A  1 183 ? 14.752  24.971 -13.597 1.00 9.76  ? 165 ILE A O     1 
ATOM   1366 C CB    . ILE A  1 183 ? 16.332  25.796 -16.085 1.00 9.53  ? 165 ILE A CB    1 
ATOM   1367 C CG1   . ILE A  1 183 ? 17.561  26.105 -16.878 1.00 9.44  ? 165 ILE A CG1   1 
ATOM   1368 C CG2   . ILE A  1 183 ? 15.116  26.340 -16.809 1.00 9.68  ? 165 ILE A CG2   1 
ATOM   1369 C CD1   . ILE A  1 183 ? 17.629  25.380 -18.231 1.00 9.87  ? 165 ILE A CD1   1 
ATOM   1370 N N     . LYS A  1 184 ? 14.360  27.158 -13.673 1.00 9.45  ? 166 LYS A N     1 
ATOM   1371 C CA    . LYS A  1 184 ? 13.004  27.031 -13.113 1.00 9.69  ? 166 LYS A CA    1 
ATOM   1372 C C     . LYS A  1 184 ? 12.113  27.945 -13.941 1.00 9.82  ? 166 LYS A C     1 
ATOM   1373 O O     . LYS A  1 184 ? 12.341  29.205 -14.015 1.00 9.66  ? 166 LYS A O     1 
ATOM   1374 C CB    . LYS A  1 184 ? 12.993  27.436 -11.637 1.00 9.87  ? 166 LYS A CB    1 
ATOM   1375 C CG    . LYS A  1 184 ? 11.657  27.218 -10.948 1.00 10.20 ? 166 LYS A CG    1 
ATOM   1376 C CD    . LYS A  1 184 ? 11.755  27.227 -9.428  1.00 10.34 ? 166 LYS A CD    1 
ATOM   1377 C CE    . LYS A  1 184 ? 10.460  26.842 -8.786  1.00 11.02 ? 166 LYS A CE    1 
ATOM   1378 N NZ    . LYS A  1 184 ? 10.500  26.915 -7.285  1.00 11.28 ? 166 LYS A NZ    1 
ATOM   1379 N N     . ASP A  1 185 ? 11.070  27.376 -14.547 1.00 10.22 ? 167 ASP A N     1 
ATOM   1380 C CA    . ASP A  1 185 ? 10.303  28.196 -15.496 1.00 10.46 ? 167 ASP A CA    1 
ATOM   1381 C C     . ASP A  1 185 ? 8.987   27.559 -15.809 1.00 10.95 ? 167 ASP A C     1 
ATOM   1382 O O     . ASP A  1 185 ? 8.741   26.424 -15.521 1.00 10.92 ? 167 ASP A O     1 
ATOM   1383 C CB    . ASP A  1 185 ? 11.185  28.453 -16.775 1.00 10.39 ? 167 ASP A CB    1 
ATOM   1384 C CG    . ASP A  1 185 ? 11.119  29.909 -17.253 1.00 10.66 ? 167 ASP A CG    1 
ATOM   1385 O OD1   . ASP A  1 185 ? 9.979   30.408 -17.420 1.00 11.98 ? 167 ASP A OD1   1 
ATOM   1386 O OD2   . ASP A  1 185 ? 12.174  30.556 -17.368 1.00 11.05 ? 167 ASP A OD2   1 
ATOM   1387 N N     . ASN A  1 186 ? 8.151   28.331 -16.505 1.00 11.69 ? 168 ASN A N     1 
ATOM   1388 C CA    . ASN A  1 186 ? 6.912   27.891 -17.054 1.00 12.78 ? 168 ASN A CA    1 
ATOM   1389 C C     . ASN A  1 186 ? 7.160   26.858 -18.157 1.00 12.98 ? 168 ASN A C     1 
ATOM   1390 O O     . ASN A  1 186 ? 8.133   27.034 -18.962 1.00 13.40 ? 168 ASN A O     1 
ATOM   1391 C CB    . ASN A  1 186 ? 6.188   29.050 -17.744 1.00 12.88 ? 168 ASN A CB    1 
ATOM   1392 C CG    . ASN A  1 186 ? 5.848   30.163 -16.792 1.00 13.38 ? 168 ASN A CG    1 
ATOM   1393 O OD1   . ASN A  1 186 ? 5.662   29.932 -15.595 1.00 13.02 ? 168 ASN A OD1   1 
ATOM   1394 N ND2   . ASN A  1 186 ? 5.758   31.362 -17.325 1.00 13.35 ? 168 ASN A ND2   1 
ATOM   1395 N N     . MET A  1 187 ? 6.337   25.838 -18.171 1.00 13.82 ? 169 MET A N     1 
ATOM   1396 C CA    . MET A  1 187 ? 6.371   24.776 -19.180 1.00 14.43 ? 169 MET A CA    1 
ATOM   1397 C C     . MET A  1 187 ? 4.985   24.677 -19.823 1.00 15.59 ? 169 MET A C     1 
ATOM   1398 O O     . MET A  1 187 ? 3.972   24.688 -19.140 1.00 16.42 ? 169 MET A O     1 
ATOM   1399 C CB    . MET A  1 187 ? 6.770   23.465 -18.542 1.00 15.02 ? 169 MET A CB    1 
ATOM   1400 C CG    . MET A  1 187 ? 8.114   23.494 -17.878 1.00 15.00 ? 169 MET A CG    1 
ATOM   1401 S SD    . MET A  1 187 ? 9.506   23.635 -19.006 1.00 15.21 ? 169 MET A SD    1 
ATOM   1402 C CE    . MET A  1 187 ? 10.583  24.697 -18.103 1.00 15.44 ? 169 MET A CE    1 
ATOM   1403 N N     . ALA A  1 188 ? 4.925   24.508 -21.152 1.00 15.22 ? 170 ALA A N     1 
ATOM   1404 C CA    . ALA A  1 188 ? 3.705   24.287 -21.894 1.00 15.95 ? 170 ALA A CA    1 
ATOM   1405 C C     . ALA A  1 188 ? 3.371   22.818 -21.856 1.00 16.89 ? 170 ALA A C     1 
ATOM   1406 O O     . ALA A  1 188 ? 4.267   21.985 -21.805 1.00 16.45 ? 170 ALA A O     1 
ATOM   1407 C CB    . ALA A  1 188 ? 3.873   24.702 -23.349 1.00 15.79 ? 170 ALA A CB    1 
ATOM   1408 N N     . GLN A  1 189 ? 2.079   22.495 -21.886 1.00 17.97 ? 171 GLN A N     1 
ATOM   1409 C CA    . GLN A  1 189 ? 1.652   21.126 -21.994 1.00 19.31 ? 171 GLN A CA    1 
ATOM   1410 C C     . GLN A  1 189 ? 2.225   20.505 -23.297 1.00 19.33 ? 171 GLN A C     1 
ATOM   1411 O O     . GLN A  1 189 ? 2.661   19.375 -23.279 1.00 19.40 ? 171 GLN A O     1 
ATOM   1412 C CB    . GLN A  1 189 ? 0.113   21.016 -21.990 1.00 20.78 ? 171 GLN A CB    1 
ATOM   1413 C CG    . GLN A  1 189 ? -0.357  19.571 -22.207 1.00 22.50 ? 171 GLN A CG    1 
ATOM   1414 N N     . GLU A  1 190 ? 2.231   21.260 -24.408 1.00 19.33 ? 172 GLU A N     1 
ATOM   1415 C CA    . GLU A  1 190 ? 2.650   20.703 -25.692 1.00 19.79 ? 172 GLU A CA    1 
ATOM   1416 C C     . GLU A  1 190 ? 3.097   21.861 -26.578 1.00 18.73 ? 172 GLU A C     1 
ATOM   1417 O O     . GLU A  1 190 ? 2.394   22.830 -26.715 1.00 18.69 ? 172 GLU A O     1 
ATOM   1418 C CB    . GLU A  1 190 ? 1.523   19.915 -26.396 1.00 22.95 ? 172 GLU A CB    1 
ATOM   1419 C CG    . GLU A  1 190 ? 2.073   19.161 -27.589 1.00 24.60 ? 172 GLU A CG    1 
ATOM   1420 C CD    . GLU A  1 190 ? 1.135   18.145 -28.142 1.00 27.82 ? 172 GLU A CD    1 
ATOM   1421 O OE1   . GLU A  1 190 ? 1.647   17.070 -28.521 1.00 30.75 ? 172 GLU A OE1   1 
ATOM   1422 O OE2   . GLU A  1 190 ? -0.049  18.438 -28.284 1.00 29.27 ? 172 GLU A OE2   1 
ATOM   1423 N N     . GLY A  1 191 ? 4.266   21.712 -27.149 1.00 17.30 ? 173 GLY A N     1 
ATOM   1424 C CA    . GLY A  1 191 ? 4.779   22.641 -28.175 1.00 16.86 ? 173 GLY A CA    1 
ATOM   1425 C C     . GLY A  1 191 ? 5.478   23.851 -27.675 1.00 15.04 ? 173 GLY A C     1 
ATOM   1426 O O     . GLY A  1 191 ? 6.082   23.836 -26.618 1.00 14.10 ? 173 GLY A O     1 
ATOM   1427 N N     . VAL A  1 192 ? 5.383   24.924 -28.477 1.00 14.81 ? 174 VAL A N     1 
ATOM   1428 C CA    . VAL A  1 192 ? 6.116   26.203 -28.194 1.00 13.71 ? 174 VAL A CA    1 
ATOM   1429 C C     . VAL A  1 192 ? 5.112   27.278 -28.453 1.00 14.08 ? 174 VAL A C     1 
ATOM   1430 O O     . VAL A  1 192 ? 4.581   27.370 -29.589 1.00 14.71 ? 174 VAL A O     1 
ATOM   1431 C CB    . VAL A  1 192 ? 7.369   26.401 -29.105 1.00 13.41 ? 174 VAL A CB    1 
ATOM   1432 C CG1   . VAL A  1 192 ? 8.039   27.735 -28.756 1.00 12.75 ? 174 VAL A CG1   1 
ATOM   1433 C CG2   . VAL A  1 192 ? 8.343   25.244 -28.880 1.00 13.28 ? 174 VAL A CG2   1 
ATOM   1434 N N     . ILE A  1 193 ? 4.756   28.016 -27.402 1.00 13.52 ? 175 ILE A N     1 
ATOM   1435 C CA    . ILE A  1 193 ? 3.636   28.946 -27.458 1.00 14.28 ? 175 ILE A CA    1 
ATOM   1436 C C     . ILE A  1 193 ? 4.147   30.354 -27.270 1.00 13.66 ? 175 ILE A C     1 
ATOM   1437 O O     . ILE A  1 193 ? 4.758   30.646 -26.267 1.00 12.84 ? 175 ILE A O     1 
ATOM   1438 C CB    . ILE A  1 193 ? 2.624   28.657 -26.319 1.00 14.87 ? 175 ILE A CB    1 
ATOM   1439 C CG1   A ILE A  1 193 ? 2.104   27.215 -26.410 0.60 15.67 ? 175 ILE A CG1   1 
ATOM   1440 C CG1   B ILE A  1 193 ? 2.208   27.180 -26.283 0.40 15.55 ? 175 ILE A CG1   1 
ATOM   1441 C CG2   . ILE A  1 193 ? 1.415   29.617 -26.421 1.00 15.77 ? 175 ILE A CG2   1 
ATOM   1442 C CD1   A ILE A  1 193 ? 1.247   26.785 -25.226 0.60 16.21 ? 175 ILE A CD1   1 
ATOM   1443 C CD1   B ILE A  1 193 ? 1.336   26.724 -27.427 0.40 16.67 ? 175 ILE A CD1   1 
ATOM   1444 N N     . LEU A  1 194 ? 3.848   31.236 -28.232 1.00 14.16 ? 176 LEU A N     1 
ATOM   1445 C CA    . LEU A  1 194 ? 4.224   32.653 -28.171 1.00 14.27 ? 176 LEU A CA    1 
ATOM   1446 C C     . LEU A  1 194 ? 3.216   33.499 -27.353 1.00 15.07 ? 176 LEU A C     1 
ATOM   1447 O O     . LEU A  1 194 ? 2.022   33.410 -27.582 1.00 15.33 ? 176 LEU A O     1 
ATOM   1448 C CB    . LEU A  1 194 ? 4.274   33.242 -29.591 1.00 14.88 ? 176 LEU A CB    1 
ATOM   1449 C CG    . LEU A  1 194 ? 4.592   34.729 -29.742 1.00 15.10 ? 176 LEU A CG    1 
ATOM   1450 C CD1   . LEU A  1 194 ? 5.998   34.967 -29.233 1.00 14.36 ? 176 LEU A CD1   1 
ATOM   1451 C CD2   . LEU A  1 194 ? 4.402   35.237 -31.157 1.00 15.85 ? 176 LEU A CD2   1 
ATOM   1452 N N     . ASP A  1 195 ? 3.760   34.253 -26.415 1.00 15.00 ? 177 ASP A N     1 
ATOM   1453 C CA    . ASP A  1 195 ? 3.045   35.342 -25.760 1.00 16.82 ? 177 ASP A CA    1 
ATOM   1454 C C     . ASP A  1 195 ? 3.507   36.678 -26.421 1.00 17.69 ? 177 ASP A C     1 
ATOM   1455 O O     . ASP A  1 195 ? 4.603   37.173 -26.169 1.00 16.21 ? 177 ASP A O     1 
ATOM   1456 C CB    . ASP A  1 195 ? 3.311   35.355 -24.257 1.00 16.52 ? 177 ASP A CB    1 
ATOM   1457 C CG    . ASP A  1 195 ? 2.482   36.473 -23.496 1.00 17.89 ? 177 ASP A CG    1 
ATOM   1458 O OD1   . ASP A  1 195 ? 2.139   37.503 -24.115 1.00 19.36 ? 177 ASP A OD1   1 
ATOM   1459 O OD2   . ASP A  1 195 ? 2.296   36.284 -22.273 1.00 17.58 ? 177 ASP A OD2   1 
ATOM   1460 N N     . ASP A  1 196 ? 2.653   37.253 -27.253 1.00 20.54 ? 178 ASP A N     1 
ATOM   1461 C CA    . ASP A  1 196 ? 3.072   38.429 -28.034 1.00 22.74 ? 178 ASP A CA    1 
ATOM   1462 C C     . ASP A  1 196 ? 2.918   39.782 -27.301 1.00 23.29 ? 178 ASP A C     1 
ATOM   1463 O O     . ASP A  1 196 ? 3.230   40.871 -27.868 1.00 25.45 ? 178 ASP A O     1 
ATOM   1464 C CB    . ASP A  1 196 ? 2.349   38.417 -29.404 1.00 25.57 ? 178 ASP A CB    1 
ATOM   1465 C CG    . ASP A  1 196 ? 2.926   39.444 -30.404 1.00 28.01 ? 178 ASP A CG    1 
ATOM   1466 O OD1   . ASP A  1 196 ? 4.195   39.590 -30.566 1.00 29.79 ? 178 ASP A OD1   1 
ATOM   1467 O OD2   . ASP A  1 196 ? 2.064   40.174 -30.967 1.00 31.40 ? 178 ASP A OD2   1 
ATOM   1468 N N     . VAL A  1 197 ? 2.439   39.722 -26.080 1.00 21.78 ? 179 VAL A N     1 
ATOM   1469 C CA    . VAL A  1 197 ? 2.311   40.886 -25.227 1.00 21.98 ? 179 VAL A CA    1 
ATOM   1470 C C     . VAL A  1 197 ? 3.610   41.112 -24.474 1.00 19.54 ? 179 VAL A C     1 
ATOM   1471 O O     . VAL A  1 197 ? 4.172   42.200 -24.625 1.00 20.07 ? 179 VAL A O     1 
ATOM   1472 C CB    . VAL A  1 197 ? 1.173   40.701 -24.221 1.00 23.45 ? 179 VAL A CB    1 
ATOM   1473 C CG1   . VAL A  1 197 ? 1.031   41.887 -23.275 1.00 24.93 ? 179 VAL A CG1   1 
ATOM   1474 C CG2   . VAL A  1 197 ? -0.144  40.551 -24.976 1.00 25.27 ? 179 VAL A CG2   1 
ATOM   1475 N N     . ASP A  1 198 ? 4.131   40.110 -23.747 1.00 16.90 ? 180 ASP A N     1 
ATOM   1476 C CA    . ASP A  1 198 ? 5.443   40.268 -23.105 1.00 15.33 ? 180 ASP A CA    1 
ATOM   1477 C C     . ASP A  1 198 ? 6.636   39.847 -24.002 1.00 13.99 ? 180 ASP A C     1 
ATOM   1478 O O     . ASP A  1 198 ? 7.783   40.066 -23.667 1.00 13.29 ? 180 ASP A O     1 
ATOM   1479 C CB    . ASP A  1 198 ? 5.517   39.705 -21.676 1.00 14.89 ? 180 ASP A CB    1 
ATOM   1480 C CG    . ASP A  1 198 ? 5.560   38.195 -21.593 1.00 14.15 ? 180 ASP A CG    1 
ATOM   1481 O OD1   . ASP A  1 198 ? 5.538   37.557 -22.656 1.00 13.91 ? 180 ASP A OD1   1 
ATOM   1482 O OD2   . ASP A  1 198 ? 5.553   37.666 -20.418 1.00 13.70 ? 180 ASP A OD2   1 
ATOM   1483 N N     . SER A  1 199 ? 6.304   39.269 -25.147 1.00 14.00 ? 181 SER A N     1 
ATOM   1484 C CA    . SER A  1 199 ? 7.297   38.838 -26.138 1.00 13.20 ? 181 SER A CA    1 
ATOM   1485 C C     . SER A  1 199 ? 8.202   37.773 -25.546 1.00 12.10 ? 181 SER A C     1 
ATOM   1486 O O     . SER A  1 199 ? 9.423   37.935 -25.364 1.00 11.36 ? 181 SER A O     1 
ATOM   1487 C CB    . SER A  1 199 ? 8.075   40.045 -26.682 1.00 13.60 ? 181 SER A CB    1 
ATOM   1488 O OG    . SER A  1 199 ? 8.685   39.719 -27.908 1.00 13.68 ? 181 SER A OG    1 
ATOM   1489 N N     . SER A  1 200 ? 7.617   36.614 -25.337 1.00 11.99 ? 182 SER A N     1 
ATOM   1490 C CA    . SER A  1 200 ? 8.304   35.443 -24.714 1.00 11.62 ? 182 SER A CA    1 
ATOM   1491 C C     . SER A  1 200 ? 7.632   34.184 -25.264 1.00 12.02 ? 182 SER A C     1 
ATOM   1492 O O     . SER A  1 200 ? 6.525   34.268 -25.819 1.00 13.11 ? 182 SER A O     1 
ATOM   1493 C CB    . SER A  1 200 ? 8.209   35.384 -23.183 1.00 11.65 ? 182 SER A CB    1 
ATOM   1494 O OG    . SER A  1 200 ? 6.902   35.242 -22.713 1.00 12.16 ? 182 SER A OG    1 
ATOM   1495 N N     . VAL A  1 201 ? 8.292   33.034 -25.087 1.00 11.53 ? 183 VAL A N     1 
ATOM   1496 C CA    . VAL A  1 201 ? 7.675   31.777 -25.388 1.00 12.04 ? 183 VAL A CA    1 
ATOM   1497 C C     . VAL A  1 201 ? 7.642   30.853 -24.161 1.00 12.30 ? 183 VAL A C     1 
ATOM   1498 O O     . VAL A  1 201 ? 8.397   31.054 -23.223 1.00 11.55 ? 183 VAL A O     1 
ATOM   1499 C CB    . VAL A  1 201 ? 8.393   31.044 -26.539 1.00 11.88 ? 183 VAL A CB    1 
ATOM   1500 C CG1   . VAL A  1 201 ? 8.380   31.903 -27.813 1.00 12.46 ? 183 VAL A CG1   1 
ATOM   1501 C CG2   . VAL A  1 201 ? 9.802   30.637 -26.155 1.00 11.26 ? 183 VAL A CG2   1 
ATOM   1502 N N     . CYS A  1 202 ? 6.732   29.898 -24.191 1.00 13.38 ? 184 CYS A N     1 
ATOM   1503 C CA    . CYS A  1 202 ? 6.574   28.857 -23.205 1.00 14.67 ? 184 CYS A CA    1 
ATOM   1504 C C     . CYS A  1 202 ? 6.808   27.557 -24.013 1.00 14.28 ? 184 CYS A C     1 
ATOM   1505 O O     . CYS A  1 202 ? 6.076   27.337 -24.992 1.00 15.86 ? 184 CYS A O     1 
ATOM   1506 C CB    . CYS A  1 202 ? 5.077   28.891 -22.607 1.00 17.09 ? 184 CYS A CB    1 
ATOM   1507 S SG    . CYS A  1 202 ? 5.069   27.837 -21.234 1.00 22.13 ? 184 CYS A SG    1 
ATOM   1508 N N     . ARG A  1 203 ? 7.718   26.681 -23.587 1.00 12.76 ? 185 ARG A N     1 
ATOM   1509 C CA    . ARG A  1 203 ? 8.082   25.452 -24.307 1.00 12.47 ? 185 ARG A CA    1 
ATOM   1510 C C     . ARG A  1 203 ? 7.698   24.235 -23.491 1.00 12.80 ? 185 ARG A C     1 
ATOM   1511 O O     . ARG A  1 203 ? 7.726   24.285 -22.248 1.00 12.25 ? 185 ARG A O     1 
ATOM   1512 C CB    . ARG A  1 203 ? 9.596   25.367 -24.476 1.00 11.72 ? 185 ARG A CB    1 
ATOM   1513 C CG    . ARG A  1 203 ? 10.165  26.560 -25.261 1.00 11.30 ? 185 ARG A CG    1 
ATOM   1514 C CD    . ARG A  1 203 ? 11.654  26.542 -25.064 1.00 10.76 ? 185 ARG A CD    1 
ATOM   1515 N NE    . ARG A  1 203 ? 12.460  27.389 -25.957 1.00 10.33 ? 185 ARG A NE    1 
ATOM   1516 C CZ    . ARG A  1 203 ? 13.013  28.548 -25.626 1.00 9.86  ? 185 ARG A CZ    1 
ATOM   1517 N NH1   . ARG A  1 203 ? 12.749  29.083 -24.446 1.00 9.53  ? 185 ARG A NH1   1 
ATOM   1518 N NH2   . ARG A  1 203 ? 13.857  29.177 -26.460 1.00 9.78  ? 185 ARG A NH2   1 
ATOM   1519 N N     . ASP A  1 204 ? 7.318   23.166 -24.171 1.00 13.47 ? 186 ASP A N     1 
ATOM   1520 C CA    . ASP A  1 204 ? 7.025   21.905 -23.472 1.00 14.36 ? 186 ASP A CA    1 
ATOM   1521 C C     . ASP A  1 204 ? 8.294   21.245 -22.878 1.00 14.19 ? 186 ASP A C     1 
ATOM   1522 O O     . ASP A  1 204 ? 9.439   21.645 -23.203 1.00 12.74 ? 186 ASP A O     1 
ATOM   1523 C CB    . ASP A  1 204 ? 6.121   20.975 -24.258 1.00 15.65 ? 186 ASP A CB    1 
ATOM   1524 C CG    . ASP A  1 204 ? 6.805   20.193 -25.368 1.00 16.22 ? 186 ASP A CG    1 
ATOM   1525 O OD1   . ASP A  1 204 ? 7.997   19.898 -25.332 1.00 15.83 ? 186 ASP A OD1   1 
ATOM   1526 O OD2   . ASP A  1 204 ? 6.081   19.807 -26.307 1.00 17.23 ? 186 ASP A OD2   1 
ATOM   1527 N N     . LEU A  1 205 ? 8.079   20.247 -22.004 1.00 15.12 ? 187 LEU A N     1 
ATOM   1528 C CA    . LEU A  1 205 ? 9.227   19.614 -21.351 1.00 15.24 ? 187 LEU A CA    1 
ATOM   1529 C C     . LEU A  1 205 ? 10.210  18.956 -22.375 1.00 15.10 ? 187 LEU A C     1 
ATOM   1530 O O     . LEU A  1 205 ? 11.441  18.992 -22.178 1.00 14.62 ? 187 LEU A O     1 
ATOM   1531 C CB    . LEU A  1 205 ? 8.757   18.543 -20.365 1.00 16.43 ? 187 LEU A CB    1 
ATOM   1532 C CG    . LEU A  1 205 ? 8.107   19.057 -19.067 1.00 16.94 ? 187 LEU A CG    1 
ATOM   1533 C CD1   . LEU A  1 205 ? 7.331   17.942 -18.387 1.00 18.22 ? 187 LEU A CD1   1 
ATOM   1534 C CD2   . LEU A  1 205 ? 9.112   19.738 -18.171 1.00 16.25 ? 187 LEU A CD2   1 
ATOM   1535 N N     . ASP A  1 206 ? 9.666   18.335 -23.407 1.00 16.10 ? 188 ASP A N     1 
ATOM   1536 C CA    . ASP A  1 206 ? 10.501  17.680 -24.440 1.00 16.80 ? 188 ASP A CA    1 
ATOM   1537 C C     . ASP A  1 206 ? 11.397  18.693 -25.171 1.00 14.98 ? 188 ASP A C     1 
ATOM   1538 O O     . ASP A  1 206 ? 12.596  18.437 -25.372 1.00 14.46 ? 188 ASP A O     1 
ATOM   1539 C CB    . ASP A  1 206 ? 9.682   16.885 -25.402 1.00 19.39 ? 188 ASP A CB    1 
ATOM   1540 C CG    . ASP A  1 206 ? 9.038   15.676 -24.743 1.00 22.62 ? 188 ASP A CG    1 
ATOM   1541 O OD1   . ASP A  1 206 ? 9.618   15.051 -23.857 1.00 24.03 ? 188 ASP A OD1   1 
ATOM   1542 O OD2   . ASP A  1 206 ? 7.913   15.359 -25.106 1.00 26.81 ? 188 ASP A OD2   1 
ATOM   1543 N N     . VAL A  1 207 ? 10.841  19.871 -25.442 1.00 13.73 ? 189 VAL A N     1 
ATOM   1544 C CA    . VAL A  1 207 ? 11.620  20.945 -26.084 1.00 12.69 ? 189 VAL A CA    1 
ATOM   1545 C C     . VAL A  1 207 ? 12.746  21.427 -25.173 1.00 11.89 ? 189 VAL A C     1 
ATOM   1546 O O     . VAL A  1 207 ? 13.930  21.566 -25.580 1.00 11.37 ? 189 VAL A O     1 
ATOM   1547 C CB    . VAL A  1 207 ? 10.717  22.097 -26.580 1.00 12.70 ? 189 VAL A CB    1 
ATOM   1548 C CG1   . VAL A  1 207 ? 11.562  23.269 -27.124 1.00 11.88 ? 189 VAL A CG1   1 
ATOM   1549 C CG2   . VAL A  1 207 ? 9.767   21.590 -27.656 1.00 13.97 ? 189 VAL A CG2   1 
ATOM   1550 N N     . VAL A  1 208 ? 12.431  21.684 -23.894 1.00 11.37 ? 190 VAL A N     1 
ATOM   1551 C CA    . VAL A  1 208 ? 13.421  22.176 -22.986 1.00 10.90 ? 190 VAL A CA    1 
ATOM   1552 C C     . VAL A  1 208 ? 14.523  21.112 -22.821 1.00 11.19 ? 190 VAL A C     1 
ATOM   1553 O O     . VAL A  1 208 ? 15.735  21.452 -22.842 1.00 10.87 ? 190 VAL A O     1 
ATOM   1554 C CB    . VAL A  1 208 ? 12.774  22.576 -21.644 1.00 10.71 ? 190 VAL A CB    1 
ATOM   1555 C CG1   . VAL A  1 208 ? 13.843  22.972 -20.657 1.00 10.50 ? 190 VAL A CG1   1 
ATOM   1556 C CG2   . VAL A  1 208 ? 11.847  23.784 -21.839 1.00 10.70 ? 190 VAL A CG2   1 
ATOM   1557 N N     . ARG A  1 209 ? 14.141  19.863 -22.617 1.00 11.95 ? 191 ARG A N     1 
ATOM   1558 C CA    . ARG A  1 209 ? 15.154  18.811 -22.479 1.00 13.07 ? 191 ARG A CA    1 
ATOM   1559 C C     . ARG A  1 209 ? 16.061  18.698 -23.728 1.00 12.81 ? 191 ARG A C     1 
ATOM   1560 O O     . ARG A  1 209 ? 17.241  18.383 -23.638 1.00 12.43 ? 191 ARG A O     1 
ATOM   1561 C CB    . ARG A  1 209 ? 14.527  17.476 -22.157 1.00 15.10 ? 191 ARG A CB    1 
ATOM   1562 C CG    . ARG A  1 209 ? 13.927  17.389 -20.773 1.00 17.01 ? 191 ARG A CG    1 
ATOM   1563 C CD    . ARG A  1 209 ? 13.411  15.960 -20.555 1.00 20.05 ? 191 ARG A CD    1 
ATOM   1564 N NE    . ARG A  1 209 ? 12.386  15.868 -19.518 1.00 23.09 ? 191 ARG A NE    1 
ATOM   1565 C CZ    . ARG A  1 209 ? 11.086  15.594 -19.686 1.00 24.89 ? 191 ARG A CZ    1 
ATOM   1566 N NH1   . ARG A  1 209 ? 10.296  15.579 -18.614 1.00 26.18 ? 191 ARG A NH1   1 
ATOM   1567 N NH2   . ARG A  1 209 ? 10.560  15.244 -20.880 1.00 25.90 ? 191 ARG A NH2   1 
ATOM   1568 N N     . ARG A  1 210 ? 15.472  18.905 -24.906 1.00 12.75 ? 192 ARG A N     1 
ATOM   1569 C CA    . ARG A  1 210 ? 16.232  18.868 -26.138 1.00 13.14 ? 192 ARG A CA    1 
ATOM   1570 C C     . ARG A  1 210 ? 17.288  19.960 -26.136 1.00 11.88 ? 192 ARG A C     1 
ATOM   1571 O O     . ARG A  1 210 ? 18.471  19.738 -26.524 1.00 11.74 ? 192 ARG A O     1 
ATOM   1572 C CB    . ARG A  1 210 ? 15.285  18.998 -27.357 1.00 14.34 ? 192 ARG A CB    1 
ATOM   1573 C CG    . ARG A  1 210 ? 15.986  18.957 -28.710 1.00 15.83 ? 192 ARG A CG    1 
ATOM   1574 C CD    . ARG A  1 210 ? 15.025  19.426 -29.800 1.00 17.37 ? 192 ARG A CD    1 
ATOM   1575 N NE    . ARG A  1 210 ? 14.954  20.889 -29.781 1.00 17.83 ? 192 ARG A NE    1 
ATOM   1576 C CZ    . ARG A  1 210 ? 13.897  21.666 -30.114 1.00 19.73 ? 192 ARG A CZ    1 
ATOM   1577 N NH1   . ARG A  1 210 ? 12.685  21.163 -30.276 1.00 20.87 ? 192 ARG A NH1   1 
ATOM   1578 N NH2   . ARG A  1 210 ? 14.060  23.014 -30.114 1.00 20.11 ? 192 ARG A NH2   1 
ATOM   1579 N N     . ILE A  1 211 ? 16.882  21.161 -25.722 1.00 10.71 ? 193 ILE A N     1 
ATOM   1580 C CA    . ILE A  1 211 ? 17.782  22.275 -25.689 1.00 10.14 ? 193 ILE A CA    1 
ATOM   1581 C C     . ILE A  1 211 ? 18.926  22.044 -24.685 1.00 10.02 ? 193 ILE A C     1 
ATOM   1582 O O     . ILE A  1 211 ? 20.129  22.300 -24.970 1.00 9.61  ? 193 ILE A O     1 
ATOM   1583 C CB    . ILE A  1 211 ? 17.033  23.602 -25.418 1.00 9.68  ? 193 ILE A CB    1 
ATOM   1584 C CG1   . ILE A  1 211 ? 16.083  23.888 -26.581 1.00 10.20 ? 193 ILE A CG1   1 
ATOM   1585 C CG2   . ILE A  1 211 ? 18.029  24.715 -25.181 1.00 9.29  ? 193 ILE A CG2   1 
ATOM   1586 C CD1   . ILE A  1 211 ? 15.114  25.051 -26.377 1.00 10.14 ? 193 ILE A CD1   1 
ATOM   1587 N N     . ILE A  1 212 ? 18.567  21.524 -23.510 1.00 10.10 ? 194 ILE A N     1 
ATOM   1588 C CA    . ILE A  1 212 ? 19.559  21.230 -22.513 1.00 10.38 ? 194 ILE A CA    1 
ATOM   1589 C C     . ILE A  1 212 ? 20.579  20.216 -23.024 1.00 10.95 ? 194 ILE A C     1 
ATOM   1590 O O     . ILE A  1 212 ? 21.799  20.398 -22.837 1.00 11.01 ? 194 ILE A O     1 
ATOM   1591 C CB    . ILE A  1 212 ? 18.847  20.658 -21.249 1.00 10.68 ? 194 ILE A CB    1 
ATOM   1592 C CG1   . ILE A  1 212 ? 18.091  21.752 -20.514 1.00 10.47 ? 194 ILE A CG1   1 
ATOM   1593 C CG2   . ILE A  1 212 ? 19.851  19.964 -20.326 1.00 10.84 ? 194 ILE A CG2   1 
ATOM   1594 C CD1   . ILE A  1 212 ? 17.050  21.244 -19.526 1.00 10.93 ? 194 ILE A CD1   1 
ATOM   1595 N N     . CYS A  1 213 ? 20.109  19.155 -23.666 1.00 11.68 ? 195 CYS A N     1 
ATOM   1596 C CA    . CYS A  1 213 ? 20.978  18.163 -24.272 1.00 13.05 ? 195 CYS A CA    1 
ATOM   1597 C C     . CYS A  1 213 ? 21.907  18.787 -25.335 1.00 12.28 ? 195 CYS A C     1 
ATOM   1598 O O     . CYS A  1 213 ? 23.125  18.491 -25.382 1.00 11.73 ? 195 CYS A O     1 
ATOM   1599 C CB    . CYS A  1 213 ? 20.166  17.037 -24.875 1.00 14.97 ? 195 CYS A CB    1 
ATOM   1600 S SG    . CYS A  1 213 ? 21.085  15.773 -25.746 1.00 20.12 ? 195 CYS A SG    1 
ATOM   1601 N N     . SER A  1 214 ? 21.350  19.664 -26.165 1.00 11.38 ? 196 SER A N     1 
ATOM   1602 C CA    A SER A  1 214 ? 22.168  20.282 -27.228 0.60 11.74 ? 196 SER A CA    1 
ATOM   1603 C CA    B SER A  1 214 ? 22.105  20.347 -27.232 0.40 11.33 ? 196 SER A CA    1 
ATOM   1604 C C     . SER A  1 214 ? 23.252  21.172 -26.663 1.00 10.97 ? 196 SER A C     1 
ATOM   1605 O O     . SER A  1 214 ? 24.266  21.352 -27.322 1.00 11.26 ? 196 SER A O     1 
ATOM   1606 C CB    A SER A  1 214 ? 21.345  21.094 -28.199 0.60 12.07 ? 196 SER A CB    1 
ATOM   1607 C CB    B SER A  1 214 ? 21.182  21.247 -28.081 0.40 11.09 ? 196 SER A CB    1 
ATOM   1608 O OG    A SER A  1 214 ? 20.888  22.222 -27.530 0.60 11.94 ? 196 SER A OG    1 
ATOM   1609 O OG    B SER A  1 214 ? 20.190  20.492 -28.777 0.40 11.27 ? 196 SER A OG    1 
ATOM   1610 N N     . ALA A  1 215 ? 23.050  21.688 -25.446 1.00 10.43 ? 197 ALA A N     1 
ATOM   1611 C CA    . ALA A  1 215 ? 24.086  22.501 -24.771 1.00 10.19 ? 197 ALA A CA    1 
ATOM   1612 C C     . ALA A  1 215 ? 25.163  21.681 -24.115 1.00 10.74 ? 197 ALA A C     1 
ATOM   1613 O O     . ALA A  1 215 ? 26.032  22.252 -23.443 1.00 10.87 ? 197 ALA A O     1 
ATOM   1614 C CB    . ALA A  1 215 ? 23.480  23.451 -23.799 1.00 9.36  ? 197 ALA A CB    1 
ATOM   1615 N N     . GLY A  1 216 ? 25.087  20.350 -24.203 1.00 11.16 ? 198 GLY A N     1 
ATOM   1616 C CA    . GLY A  1 216 ? 26.124  19.493 -23.608 1.00 12.00 ? 198 GLY A CA    1 
ATOM   1617 C C     . GLY A  1 216 ? 25.926  19.335 -22.106 1.00 11.79 ? 198 GLY A C     1 
ATOM   1618 O O     . GLY A  1 216 ? 26.861  19.005 -21.393 1.00 12.35 ? 198 GLY A O     1 
ATOM   1619 N N     . LEU A  1 217 ? 24.685  19.492 -21.649 1.00 10.91 ? 199 LEU A N     1 
ATOM   1620 C CA    . LEU A  1 217 ? 24.326  19.333 -20.257 1.00 10.68 ? 199 LEU A CA    1 
ATOM   1621 C C     . LEU A  1 217 ? 23.452  18.100 -20.007 1.00 10.70 ? 199 LEU A C     1 
ATOM   1622 O O     . LEU A  1 217 ? 22.864  17.543 -20.936 1.00 10.76 ? 199 LEU A O     1 
ATOM   1623 C CB    . LEU A  1 217 ? 23.597  20.562 -19.781 1.00 10.34 ? 199 LEU A CB    1 
ATOM   1624 C CG    . LEU A  1 217 ? 24.440  21.817 -19.750 1.00 10.29 ? 199 LEU A CG    1 
ATOM   1625 C CD1   . LEU A  1 217 ? 23.596  23.069 -19.552 1.00 10.25 ? 199 LEU A CD1   1 
ATOM   1626 C CD2   . LEU A  1 217 ? 25.449  21.733 -18.641 1.00 10.60 ? 199 LEU A CD2   1 
ATOM   1627 N N     . SER A  1 218 ? 23.433  17.659 -18.746 1.00 10.38 ? 200 SER A N     1 
ATOM   1628 C CA    . SER A  1 218 ? 22.704  16.493 -18.331 1.00 11.25 ? 200 SER A CA    1 
ATOM   1629 C C     . SER A  1 218 ? 21.844  16.860 -17.143 1.00 11.33 ? 200 SER A C     1 
ATOM   1630 O O     . SER A  1 218 ? 22.229  17.678 -16.332 1.00 10.49 ? 200 SER A O     1 
ATOM   1631 C CB    . SER A  1 218 ? 23.621  15.377 -17.910 1.00 11.94 ? 200 SER A CB    1 
ATOM   1632 O OG    . SER A  1 218 ? 24.396  14.895 -19.048 1.00 12.11 ? 200 SER A OG    1 
ATOM   1633 N N     . LEU A  1 219 ? 20.752  16.139 -16.986 1.00 12.30 ? 201 LEU A N     1 
ATOM   1634 C CA    A LEU A  1 219 ? 19.854  16.399 -15.841 0.50 12.52 ? 201 LEU A CA    1 
ATOM   1635 C CA    B LEU A  1 219 ? 19.855  16.380 -15.856 0.50 12.60 ? 201 LEU A CA    1 
ATOM   1636 C C     . LEU A  1 219 ? 20.315  15.637 -14.615 1.00 13.18 ? 201 LEU A C     1 
ATOM   1637 O O     . LEU A  1 219 ? 20.468  14.423 -14.648 1.00 13.67 ? 201 LEU A O     1 
ATOM   1638 C CB    A LEU A  1 219 ? 18.406  16.033 -16.130 0.50 13.34 ? 201 LEU A CB    1 
ATOM   1639 C CB    B LEU A  1 219 ? 18.454  15.944 -16.214 0.50 13.53 ? 201 LEU A CB    1 
ATOM   1640 C CG    A LEU A  1 219 ? 17.586  17.030 -16.940 0.50 13.21 ? 201 LEU A CG    1 
ATOM   1641 C CG    B LEU A  1 219 ? 17.721  16.959 -17.057 0.50 13.42 ? 201 LEU A CG    1 
ATOM   1642 C CD1   A LEU A  1 219 ? 18.036  17.037 -18.352 0.50 13.31 ? 201 LEU A CD1   1 
ATOM   1643 C CD1   B LEU A  1 219 ? 16.651  16.169 -17.793 0.50 14.49 ? 201 LEU A CD1   1 
ATOM   1644 C CD2   A LEU A  1 219 ? 16.120  16.639 -16.755 0.50 13.85 ? 201 LEU A CD2   1 
ATOM   1645 C CD2   B LEU A  1 219 ? 17.203  17.925 -15.958 0.50 13.06 ? 201 LEU A CD2   1 
ATOM   1646 N N     . LEU A  1 220 ? 20.427  16.355 -13.510 1.00 12.78 ? 202 LEU A N     1 
ATOM   1647 C CA    . LEU A  1 220 ? 20.576  15.781 -12.201 1.00 13.56 ? 202 LEU A CA    1 
ATOM   1648 C C     . LEU A  1 220 ? 19.235  15.521 -11.505 1.00 14.03 ? 202 LEU A C     1 
ATOM   1649 O O     . LEU A  1 220 ? 19.099  14.552 -10.716 1.00 14.83 ? 202 LEU A O     1 
ATOM   1650 C CB    . LEU A  1 220 ? 21.425  16.705 -11.309 1.00 13.47 ? 202 LEU A CB    1 
ATOM   1651 C CG    . LEU A  1 220 ? 22.900  16.914 -11.737 1.00 13.89 ? 202 LEU A CG    1 
ATOM   1652 C CD1   . LEU A  1 220 ? 23.508  18.006 -10.894 1.00 14.34 ? 202 LEU A CD1   1 
ATOM   1653 C CD2   . LEU A  1 220 ? 23.681  15.652 -11.584 1.00 15.07 ? 202 LEU A CD2   1 
ATOM   1654 N N     . ALA A  1 221 ? 18.284  16.393 -11.754 1.00 13.54 ? 203 ALA A N     1 
ATOM   1655 C CA    . ALA A  1 221 ? 16.979  16.264 -11.128 1.00 14.66 ? 203 ALA A CA    1 
ATOM   1656 C C     . ALA A  1 221 ? 15.987  17.169 -11.853 1.00 14.25 ? 203 ALA A C     1 
ATOM   1657 O O     . ALA A  1 221 ? 16.369  18.102 -12.501 1.00 13.29 ? 203 ALA A O     1 
ATOM   1658 C CB    . ALA A  1 221 ? 17.110  16.652 -9.673  1.00 14.99 ? 203 ALA A CB    1 
ATOM   1659 N N     . GLU A  1 222 ? 14.695  16.823 -11.761 1.00 15.65 ? 204 GLU A N     1 
ATOM   1660 C CA    . GLU A  1 222 ? 13.618  17.593 -12.404 1.00 16.13 ? 204 GLU A CA    1 
ATOM   1661 C C     . GLU A  1 222 ? 12.430  17.499 -11.447 1.00 16.24 ? 204 GLU A C     1 
ATOM   1662 O O     . GLU A  1 222 ? 12.172  16.404 -10.904 1.00 17.12 ? 204 GLU A O     1 
ATOM   1663 C CB    . GLU A  1 222 ? 13.307  16.961 -13.766 1.00 18.72 ? 204 GLU A CB    1 
ATOM   1664 C CG    . GLU A  1 222 ? 12.170  17.482 -14.563 1.00 21.44 ? 204 GLU A CG    1 
ATOM   1665 C CD    . GLU A  1 222 ? 11.925  16.629 -15.827 1.00 24.59 ? 204 GLU A CD    1 
ATOM   1666 O OE1   . GLU A  1 222 ? 12.821  16.413 -16.668 1.00 25.46 ? 204 GLU A OE1   1 
ATOM   1667 O OE2   . GLU A  1 222 ? 10.771  16.178 -15.988 1.00 29.03 ? 204 GLU A OE2   1 
ATOM   1668 N N     . GLU A  1 223 ? 11.751  18.601 -11.169 1.00 14.97 ? 205 GLU A N     1 
ATOM   1669 C CA    . GLU A  1 223 ? 10.667  18.564 -10.199 1.00 16.07 ? 205 GLU A CA    1 
ATOM   1670 C C     . GLU A  1 223 ? 9.619   19.571 -10.596 1.00 14.92 ? 205 GLU A C     1 
ATOM   1671 O O     . GLU A  1 223 ? 9.969   20.693 -10.864 1.00 13.54 ? 205 GLU A O     1 
ATOM   1672 C CB    . GLU A  1 223 ? 11.250  18.912 -8.836  1.00 17.34 ? 205 GLU A CB    1 
ATOM   1673 C CG    . GLU A  1 223 ? 10.302  18.916 -7.686  1.00 19.65 ? 205 GLU A CG    1 
ATOM   1674 C CD    . GLU A  1 223 ? 11.087  19.259 -6.416  1.00 20.98 ? 205 GLU A CD    1 
ATOM   1675 O OE1   . GLU A  1 223 ? 11.796  18.360 -5.905  1.00 23.99 ? 205 GLU A OE1   1 
ATOM   1676 O OE2   . GLU A  1 223 ? 11.077  20.437 -6.010  1.00 20.07 ? 205 GLU A OE2   1 
ATOM   1677 N N     . ARG A  1 224 ? 8.356   19.151 -10.541 1.00 15.34 ? 206 ARG A N     1 
ATOM   1678 C CA    . ARG A  1 224 ? 7.228   20.042 -10.728 1.00 15.65 ? 206 ARG A CA    1 
ATOM   1679 C C     . ARG A  1 224 ? 6.985   20.882 -9.458  1.00 15.53 ? 206 ARG A C     1 
ATOM   1680 O O     . ARG A  1 224 ? 6.977   20.320 -8.351  1.00 15.97 ? 206 ARG A O     1 
ATOM   1681 C CB    . ARG A  1 224 ? 5.966   19.267 -11.023 1.00 17.35 ? 206 ARG A CB    1 
ATOM   1682 C CG    . ARG A  1 224 ? 4.852   20.192 -11.531 1.00 18.24 ? 206 ARG A CG    1 
ATOM   1683 C CD    . ARG A  1 224 ? 3.655   19.475 -12.013 1.00 20.43 ? 206 ARG A CD    1 
ATOM   1684 N NE    . ARG A  1 224 ? 2.563   20.444 -12.058 1.00 21.70 ? 206 ARG A NE    1 
ATOM   1685 C CZ    . ARG A  1 224 ? 1.315   20.124 -12.255 1.00 24.18 ? 206 ARG A CZ    1 
ATOM   1686 N NH1   . ARG A  1 224 ? 0.980   18.855 -12.480 1.00 26.16 ? 206 ARG A NH1   1 
ATOM   1687 N NH2   . ARG A  1 224 ? 0.369   21.069 -12.183 1.00 24.85 ? 206 ARG A NH2   1 
ATOM   1688 N N     . GLN A  1 225 ? 6.742   22.167 -9.637  1.00 15.20 ? 207 GLN A N     1 
ATOM   1689 C CA    . GLN A  1 225 ? 6.357   23.069 -8.515  1.00 15.41 ? 207 GLN A CA    1 
ATOM   1690 C C     . GLN A  1 225 ? 4.931   22.784 -8.096  1.00 16.67 ? 207 GLN A C     1 
ATOM   1691 O O     . GLN A  1 225 ? 3.999   22.849 -8.918  1.00 17.10 ? 207 GLN A O     1 
ATOM   1692 C CB    . GLN A  1 225 ? 6.449   24.537 -8.944  1.00 14.83 ? 207 GLN A CB    1 
ATOM   1693 C CG    . GLN A  1 225 ? 6.009   25.523 -7.867  1.00 15.11 ? 207 GLN A CG    1 
ATOM   1694 C CD    . GLN A  1 225 ? 6.873   25.477 -6.636  1.00 15.03 ? 207 GLN A CD    1 
ATOM   1695 O OE1   . GLN A  1 225 ? 8.113   25.593 -6.730  1.00 14.26 ? 207 GLN A OE1   1 
ATOM   1696 N NE2   . GLN A  1 225 ? 6.235   25.361 -5.468  1.00 15.88 ? 207 GLN A NE2   1 
ATOM   1697 N N     . GLU A  1 226 ? 4.748   22.480 -6.825  1.00 17.56 ? 208 GLU A N     1 
ATOM   1698 C CA    . GLU A  1 226 ? 3.435   22.252 -6.251  1.00 19.42 ? 208 GLU A CA    1 
ATOM   1699 C C     . GLU A  1 226 ? 2.800   23.550 -5.667  1.00 18.85 ? 208 GLU A C     1 
ATOM   1700 O O     . GLU A  1 226 ? 3.446   24.558 -5.561  1.00 16.92 ? 208 GLU A O     1 
ATOM   1701 C CB    A GLU A  1 226 ? 3.527   21.201 -5.133  0.70 21.66 ? 208 GLU A CB    1 
ATOM   1702 C CB    B GLU A  1 226 ? 3.513   21.189 -5.143  0.30 20.21 ? 208 GLU A CB    1 
ATOM   1703 C CG    A GLU A  1 226 ? 4.235   19.900 -5.522  0.70 23.06 ? 208 GLU A CG    1 
ATOM   1704 C CG    B GLU A  1 226 ? 4.177   19.868 -5.537  0.30 20.35 ? 208 GLU A CG    1 
ATOM   1705 C CD    A GLU A  1 226 ? 4.338   18.923 -4.358  0.70 25.79 ? 208 GLU A CD    1 
ATOM   1706 C CD    B GLU A  1 226 ? 3.269   18.936 -6.314  0.30 21.39 ? 208 GLU A CD    1 
ATOM   1707 O OE1   A GLU A  1 226 ? 3.754   17.851 -4.459  0.70 29.18 ? 208 GLU A OE1   1 
ATOM   1708 O OE1   B GLU A  1 226 ? 2.058   19.169 -6.356  0.30 22.42 ? 208 GLU A OE1   1 
ATOM   1709 O OE2   A GLU A  1 226 ? 4.961   19.242 -3.307  0.70 27.65 ? 208 GLU A OE2   1 
ATOM   1710 O OE2   B GLU A  1 226 ? 3.782   17.957 -6.899  0.30 21.63 ? 208 GLU A OE2   1 
ATOM   1711 N N     . ASN A  1 227 ? 1.499   23.456 -5.378  1.00 19.59 ? 209 ASN A N     1 
ATOM   1712 C CA    . ASN A  1 227 ? 0.757   24.481 -4.660  1.00 20.62 ? 209 ASN A CA    1 
ATOM   1713 C C     . ASN A  1 227 ? 0.632   25.798 -5.393  1.00 20.36 ? 209 ASN A C     1 
ATOM   1714 O O     . ASN A  1 227 ? 0.485   26.825 -4.778  1.00 20.22 ? 209 ASN A O     1 
ATOM   1715 C CB    . ASN A  1 227 ? 1.366   24.686 -3.265  1.00 20.63 ? 209 ASN A CB    1 
ATOM   1716 C CG    . ASN A  1 227 ? 1.276   23.445 -2.445  1.00 21.66 ? 209 ASN A CG    1 
ATOM   1717 O OD1   . ASN A  1 227 ? 0.195   22.969 -2.186  1.00 22.96 ? 209 ASN A OD1   1 
ATOM   1718 N ND2   . ASN A  1 227 ? 2.427   22.908 -2.023  1.00 21.66 ? 209 ASN A ND2   1 
ATOM   1719 N N     . LEU A  1 228 ? 0.691   25.741 -6.715  1.00 19.97 ? 210 LEU A N     1 
ATOM   1720 C CA    . LEU A  1 228 ? 0.407   26.899 -7.548  1.00 19.97 ? 210 LEU A CA    1 
ATOM   1721 C C     . LEU A  1 228 ? -1.070  27.041 -7.913  1.00 21.14 ? 210 LEU A C     1 
ATOM   1722 O O     . LEU A  1 228 ? -1.799  26.063 -7.890  1.00 21.64 ? 210 LEU A O     1 
ATOM   1723 C CB    . LEU A  1 228 ? 1.201   26.778 -8.859  1.00 19.48 ? 210 LEU A CB    1 
ATOM   1724 C CG    . LEU A  1 228 ? 2.722   26.746 -8.721  1.00 18.79 ? 210 LEU A CG    1 
ATOM   1725 C CD1   . LEU A  1 228 ? 3.375   26.733 -10.105 1.00 18.38 ? 210 LEU A CD1   1 
ATOM   1726 C CD2   . LEU A  1 228 ? 3.196   27.919 -7.919  1.00 18.76 ? 210 LEU A CD2   1 
ATOM   1727 N N     . PRO A  1 229 ? -1.511  28.280 -8.238  1.00 21.32 ? 211 PRO A N     1 
ATOM   1728 C CA    . PRO A  1 229 ? -2.860  28.510 -8.739  1.00 22.88 ? 211 PRO A CA    1 
ATOM   1729 C C     . PRO A  1 229 ? -3.136  27.602 -9.939  1.00 23.21 ? 211 PRO A C     1 
ATOM   1730 O O     . PRO A  1 229 ? -2.230  27.417 -10.764 1.00 21.71 ? 211 PRO A O     1 
ATOM   1731 C CB    . PRO A  1 229 ? -2.844  29.974 -9.123  1.00 22.67 ? 211 PRO A CB    1 
ATOM   1732 C CG    . PRO A  1 229 ? -1.761  30.595 -8.297  1.00 21.76 ? 211 PRO A CG    1 
ATOM   1733 C CD    . PRO A  1 229 ? -0.718  29.515 -8.218  1.00 20.72 ? 211 PRO A CD    1 
ATOM   1734 N N     . ASP A  1 230 ? -4.353  27.064 -10.023 1.00 25.02 ? 212 ASP A N     1 
ATOM   1735 C CA    A ASP A  1 230 ? -4.720  26.130 -11.083 0.70 25.94 ? 212 ASP A CA    1 
ATOM   1736 C CA    B ASP A  1 230 ? -4.706  26.115 -11.089 0.30 25.53 ? 212 ASP A CA    1 
ATOM   1737 C C     . ASP A  1 230 ? -4.647  26.708 -12.510 1.00 25.13 ? 212 ASP A C     1 
ATOM   1738 O O     . ASP A  1 230 ? -4.436  25.953 -13.498 1.00 24.57 ? 212 ASP A O     1 
ATOM   1739 C CB    A ASP A  1 230 ? -6.132  25.589 -10.885 0.70 28.77 ? 212 ASP A CB    1 
ATOM   1740 C CB    B ASP A  1 230 ? -6.097  25.515 -10.863 0.30 27.65 ? 212 ASP A CB    1 
ATOM   1741 C CG    A ASP A  1 230 ? -6.211  24.479 -9.839  0.70 30.24 ? 212 ASP A CG    1 
ATOM   1742 C CG    B ASP A  1 230 ? -6.408  24.352 -11.814 0.30 28.36 ? 212 ASP A CG    1 
ATOM   1743 O OD1   A ASP A  1 230 ? -5.159  24.026 -9.339  0.70 30.75 ? 212 ASP A OD1   1 
ATOM   1744 O OD1   B ASP A  1 230 ? -5.682  23.338 -11.782 0.30 28.13 ? 212 ASP A OD1   1 
ATOM   1745 O OD2   A ASP A  1 230 ? -7.328  24.058 -9.548  0.70 32.57 ? 212 ASP A OD2   1 
ATOM   1746 O OD2   B ASP A  1 230 ? -7.379  24.461 -12.595 0.30 29.51 ? 212 ASP A OD2   1 
ATOM   1747 N N     . GLU A  1 231 ? -4.810  28.017 -12.629 1.00 24.21 ? 213 GLU A N     1 
ATOM   1748 C CA    . GLU A  1 231 ? -4.946  28.613 -13.943 1.00 24.04 ? 213 GLU A CA    1 
ATOM   1749 C C     . GLU A  1 231 ? -3.659  28.920 -14.682 1.00 21.73 ? 213 GLU A C     1 
ATOM   1750 O O     . GLU A  1 231 ? -3.734  29.292 -15.846 1.00 21.25 ? 213 GLU A O     1 
ATOM   1751 C CB    . GLU A  1 231 ? -5.772  29.879 -13.851 1.00 25.59 ? 213 GLU A CB    1 
ATOM   1752 C CG    . GLU A  1 231 ? -4.997  31.066 -13.307 1.00 25.36 ? 213 GLU A CG    1 
ATOM   1753 C CD    . GLU A  1 231 ? -5.102  31.274 -11.811 1.00 26.68 ? 213 GLU A CD    1 
ATOM   1754 O OE1   . GLU A  1 231 ? -4.654  32.390 -11.422 1.00 27.88 ? 213 GLU A OE1   1 
ATOM   1755 O OE2   . GLU A  1 231 ? -5.689  30.436 -11.053 1.00 27.67 ? 213 GLU A OE2   1 
ATOM   1756 N N     . ILE A  1 232 ? -2.511  28.822 -14.006 1.00 19.77 ? 214 ILE A N     1 
ATOM   1757 C CA    . ILE A  1 232 ? -1.248  29.207 -14.613 1.00 18.40 ? 214 ILE A CA    1 
ATOM   1758 C C     . ILE A  1 232 ? -0.492  28.024 -15.203 1.00 17.47 ? 214 ILE A C     1 
ATOM   1759 O O     . ILE A  1 232 ? -0.744  26.872 -14.880 1.00 17.28 ? 214 ILE A O     1 
ATOM   1760 C CB    . ILE A  1 232 ? -0.310  29.969 -13.648 1.00 17.59 ? 214 ILE A CB    1 
ATOM   1761 C CG1   . ILE A  1 232 ? 0.209   29.112 -12.501 1.00 17.61 ? 214 ILE A CG1   1 
ATOM   1762 C CG2   . ILE A  1 232 ? -1.009  31.209 -13.096 1.00 18.46 ? 214 ILE A CG2   1 
ATOM   1763 C CD1   . ILE A  1 232 ? 1.266   29.807 -11.639 1.00 16.87 ? 214 ILE A CD1   1 
ATOM   1764 N N     . TYR A  1 233 ? 0.439   28.332 -16.094 1.00 16.73 ? 215 TYR A N     1 
ATOM   1765 C CA    . TYR A  1 233 ? 1.265   27.264 -16.655 1.00 16.39 ? 215 TYR A CA    1 
ATOM   1766 C C     . TYR A  1 233 ? 1.964   26.499 -15.546 1.00 15.89 ? 215 TYR A C     1 
ATOM   1767 O O     . TYR A  1 233 ? 2.414   27.073 -14.540 1.00 15.40 ? 215 TYR A O     1 
ATOM   1768 C CB    . TYR A  1 233 ? 2.332   27.813 -17.582 1.00 15.80 ? 215 TYR A CB    1 
ATOM   1769 C CG    . TYR A  1 233 ? 1.794   28.291 -18.922 1.00 16.69 ? 215 TYR A CG    1 
ATOM   1770 C CD1   . TYR A  1 233 ? 1.439   27.391 -19.885 1.00 17.58 ? 215 TYR A CD1   1 
ATOM   1771 C CD2   . TYR A  1 233 ? 1.677   29.638 -19.199 1.00 17.24 ? 215 TYR A CD2   1 
ATOM   1772 C CE1   . TYR A  1 233 ? 0.925   27.791 -21.111 1.00 18.63 ? 215 TYR A CE1   1 
ATOM   1773 C CE2   . TYR A  1 233 ? 1.177   30.090 -20.444 1.00 17.74 ? 215 TYR A CE2   1 
ATOM   1774 C CZ    . TYR A  1 233 ? 0.800   29.166 -21.390 1.00 18.51 ? 215 TYR A CZ    1 
ATOM   1775 O OH    . TYR A  1 233 ? 0.254   29.579 -22.599 1.00 19.43 ? 215 TYR A OH    1 
ATOM   1776 N N     . HIS A  1 234 ? 2.135   25.215 -15.761 1.00 16.10 ? 216 HIS A N     1 
ATOM   1777 C CA    . HIS A  1 234 ? 2.929   24.416 -14.816 1.00 16.10 ? 216 HIS A CA    1 
ATOM   1778 C C     . HIS A  1 234 ? 4.372   24.916 -14.794 1.00 14.60 ? 216 HIS A C     1 
ATOM   1779 O O     . HIS A  1 234 ? 4.882   25.517 -15.760 1.00 13.97 ? 216 HIS A O     1 
ATOM   1780 C CB    . HIS A  1 234 ? 2.880   22.939 -15.204 1.00 17.04 ? 216 HIS A CB    1 
ATOM   1781 C CG    . HIS A  1 234 ? 1.501   22.358 -15.215 1.00 18.93 ? 216 HIS A CG    1 
ATOM   1782 N ND1   . HIS A  1 234 ? 1.266   21.031 -15.501 1.00 20.37 ? 216 HIS A ND1   1 
ATOM   1783 C CD2   . HIS A  1 234 ? 0.297   22.890 -14.918 1.00 20.12 ? 216 HIS A CD2   1 
ATOM   1784 C CE1   . HIS A  1 234 ? -0.031  20.779 -15.420 1.00 21.56 ? 216 HIS A CE1   1 
ATOM   1785 N NE2   . HIS A  1 234 ? -0.649  21.895 -15.062 1.00 21.41 ? 216 HIS A NE2   1 
ATOM   1786 N N     . VAL A  1 235 ? 5.032   24.781 -13.634 1.00 13.87 ? 217 VAL A N     1 
ATOM   1787 C CA    . VAL A  1 235 ? 6.378   25.298 -13.489 1.00 12.70 ? 217 VAL A CA    1 
ATOM   1788 C C     . VAL A  1 235 ? 7.258   24.116 -13.055 1.00 12.59 ? 217 VAL A C     1 
ATOM   1789 O O     . VAL A  1 235 ? 6.853   23.285 -12.216 1.00 12.76 ? 217 VAL A O     1 
ATOM   1790 C CB    . VAL A  1 235 ? 6.397   26.408 -12.398 1.00 12.48 ? 217 VAL A CB    1 
ATOM   1791 C CG1   . VAL A  1 235 ? 7.806   26.791 -11.984 1.00 11.77 ? 217 VAL A CG1   1 
ATOM   1792 C CG2   . VAL A  1 235 ? 5.612   27.632 -12.888 1.00 12.72 ? 217 VAL A CG2   1 
ATOM   1793 N N     . TYR A  1 236 ? 8.439   24.018 -13.661 1.00 12.03 ? 218 TYR A N     1 
ATOM   1794 C CA    . TYR A  1 236 ? 9.352   22.924 -13.302 1.00 12.04 ? 218 TYR A CA    1 
ATOM   1795 C C     . TYR A  1 236 ? 10.720  23.472 -13.028 1.00 10.88 ? 218 TYR A C     1 
ATOM   1796 O O     . TYR A  1 236 ? 11.129  24.511 -13.602 1.00 9.84  ? 218 TYR A O     1 
ATOM   1797 C CB    . TYR A  1 236 ? 9.540   21.956 -14.515 1.00 12.69 ? 218 TYR A CB    1 
ATOM   1798 C CG    . TYR A  1 236 ? 8.407   20.965 -14.639 1.00 14.14 ? 218 TYR A CG    1 
ATOM   1799 C CD1   . TYR A  1 236 ? 7.128   21.363 -15.063 1.00 14.88 ? 218 TYR A CD1   1 
ATOM   1800 C CD2   . TYR A  1 236 ? 8.598   19.605 -14.347 1.00 15.56 ? 218 TYR A CD2   1 
ATOM   1801 C CE1   . TYR A  1 236 ? 6.087   20.448 -15.183 1.00 16.37 ? 218 TYR A CE1   1 
ATOM   1802 C CE2   . TYR A  1 236 ? 7.589   18.683 -14.494 1.00 16.53 ? 218 TYR A CE2   1 
ATOM   1803 C CZ    . TYR A  1 236 ? 6.322   19.113 -14.861 1.00 17.15 ? 218 TYR A CZ    1 
ATOM   1804 O OH    . TYR A  1 236 ? 5.305   18.233 -14.997 1.00 18.75 ? 218 TYR A OH    1 
ATOM   1805 N N     . SER A  1 237 ? 11.450  22.741 -12.196 1.00 10.73 ? 219 SER A N     1 
ATOM   1806 C CA    . SER A  1 237 ? 12.867  23.039 -11.906 1.00 10.43 ? 219 SER A CA    1 
ATOM   1807 C C     . SER A  1 237 ? 13.722  21.885 -12.475 1.00 10.54 ? 219 SER A C     1 
ATOM   1808 O O     . SER A  1 237 ? 13.338  20.718 -12.343 1.00 10.85 ? 219 SER A O     1 
ATOM   1809 C CB    . SER A  1 237 ? 13.105  23.070 -10.383 1.00 10.83 ? 219 SER A CB    1 
ATOM   1810 O OG    . SER A  1 237 ? 12.268  24.079 -9.809  1.00 11.19 ? 219 SER A OG    1 
ATOM   1811 N N     . PHE A  1 238 ? 14.882  22.250 -13.010 1.00 10.78 ? 220 PHE A N     1 
ATOM   1812 C CA    . PHE A  1 238 ? 15.820  21.284 -13.552 1.00 11.21 ? 220 PHE A CA    1 
ATOM   1813 C C     . PHE A  1 238 ? 17.192  21.675 -12.963 1.00 10.55 ? 220 PHE A C     1 
ATOM   1814 O O     . PHE A  1 238 ? 17.558  22.853 -12.959 1.00 10.50 ? 220 PHE A O     1 
ATOM   1815 C CB    . PHE A  1 238 ? 15.979  21.419 -15.087 1.00 11.92 ? 220 PHE A CB    1 
ATOM   1816 C CG    . PHE A  1 238 ? 14.733  21.264 -15.858 1.00 13.63 ? 220 PHE A CG    1 
ATOM   1817 C CD1   . PHE A  1 238 ? 13.931  22.364 -16.047 1.00 14.35 ? 220 PHE A CD1   1 
ATOM   1818 C CD2   . PHE A  1 238 ? 14.399  20.051 -16.428 1.00 16.09 ? 220 PHE A CD2   1 
ATOM   1819 C CE1   . PHE A  1 238 ? 12.757  22.245 -16.760 1.00 16.11 ? 220 PHE A CE1   1 
ATOM   1820 C CE2   . PHE A  1 238 ? 13.209  19.962 -17.202 1.00 17.16 ? 220 PHE A CE2   1 
ATOM   1821 C CZ    . PHE A  1 238 ? 12.404  21.064 -17.310 1.00 17.00 ? 220 PHE A CZ    1 
ATOM   1822 N N     . ALA A  1 239 ? 17.911  20.704 -12.439 1.00 10.10 ? 221 ALA A N     1 
ATOM   1823 C CA    . ALA A  1 239 ? 19.301  20.911 -12.005 1.00 9.98  ? 221 ALA A CA    1 
ATOM   1824 C C     . ALA A  1 239 ? 20.184  20.211 -13.021 1.00 10.14 ? 221 ALA A C     1 
ATOM   1825 O O     . ALA A  1 239 ? 19.910  19.084 -13.336 1.00 10.19 ? 221 ALA A O     1 
ATOM   1826 C CB    . ALA A  1 239 ? 19.563  20.291 -10.663 1.00 10.56 ? 221 ALA A CB    1 
ATOM   1827 N N     . LEU A  1 240 ? 21.192  20.918 -13.509 1.00 10.04 ? 222 LEU A N     1 
ATOM   1828 C CA    . LEU A  1 240 ? 21.974  20.466 -14.642 1.00 10.58 ? 222 LEU A CA    1 
ATOM   1829 C C     . LEU A  1 240 ? 23.473  20.559 -14.363 1.00 10.37 ? 222 LEU A C     1 
ATOM   1830 O O     . LEU A  1 240 ? 23.924  21.454 -13.626 1.00 10.09 ? 222 LEU A O     1 
ATOM   1831 C CB    . LEU A  1 240 ? 21.709  21.401 -15.822 1.00 10.91 ? 222 LEU A CB    1 
ATOM   1832 C CG    . LEU A  1 240 ? 20.228  21.703 -16.159 1.00 11.34 ? 222 LEU A CG    1 
ATOM   1833 C CD1   . LEU A  1 240 ? 20.163  22.713 -17.263 1.00 12.10 ? 222 LEU A CD1   1 
ATOM   1834 C CD2   . LEU A  1 240 ? 19.588  20.381 -16.514 1.00 12.40 ? 222 LEU A CD2   1 
ATOM   1835 N N     . ARG A  1 241 ? 24.260  19.676 -14.996 1.00 10.84 ? 223 ARG A N     1 
ATOM   1836 C CA    . ARG A  1 241 ? 25.731  19.863 -15.102 1.00 11.10 ? 223 ARG A CA    1 
ATOM   1837 C C     . ARG A  1 241 ? 26.257  19.289 -16.372 1.00 11.27 ? 223 ARG A C     1 
ATOM   1838 O O     . ARG A  1 241 ? 25.450  18.574 -17.094 1.00 11.78 ? 223 ARG A O     1 
ATOM   1839 C CB    . ARG A  1 241 ? 26.478  19.326 -13.885 1.00 12.30 ? 223 ARG A CB    1 
ATOM   1840 C CG    . ARG A  1 241 ? 26.013  18.000 -13.471 1.00 13.41 ? 223 ARG A CG    1 
ATOM   1841 C CD    . ARG A  1 241 ? 26.502  16.827 -14.120 1.00 14.38 ? 223 ARG A CD    1 
ATOM   1842 N NE    . ARG A  1 241 ? 27.986  16.746 -14.384 1.00 14.78 ? 223 ARG A NE    1 
ATOM   1843 C CZ    . ARG A  1 241 ? 28.498  15.837 -15.202 1.00 15.12 ? 223 ARG A CZ    1 
ATOM   1844 N NH1   . ARG A  1 241 ? 29.795  15.906 -15.577 1.00 15.12 ? 223 ARG A NH1   1 
ATOM   1845 N NH2   . ARG A  1 241 ? 27.712  14.845 -15.627 1.00 15.01 ? 223 ARG A NH2   1 
ATOM   1846 O OXT   . ARG A  1 241 ? 27.470  19.469 -16.670 1.00 10.87 ? 223 ARG A OXT   1 
ATOM   1847 C CA    . PRO B  1 16  ? -11.089 14.550 10.633  1.00 58.69 ? -2  PRO B CA    1 
ATOM   1848 C C     . PRO B  1 16  ? -10.612 14.677 12.086  1.00 57.87 ? -2  PRO B C     1 
ATOM   1849 O O     . PRO B  1 16  ? -11.356 14.336 12.997  1.00 59.35 ? -2  PRO B O     1 
ATOM   1850 N N     . ARG B  1 17  ? -9.392  15.183 12.300  1.00 55.22 ? -1  ARG B N     1 
ATOM   1851 C CA    . ARG B  1 17  ? -8.773  15.268 13.654  1.00 53.61 ? -1  ARG B CA    1 
ATOM   1852 C C     . ARG B  1 17  ? -9.324  16.434 14.467  1.00 50.50 ? -1  ARG B C     1 
ATOM   1853 O O     . ARG B  1 17  ? -9.745  17.437 13.901  1.00 48.88 ? -1  ARG B O     1 
ATOM   1854 C CB    . ARG B  1 17  ? -7.254  15.406 13.541  1.00 53.31 ? -1  ARG B CB    1 
ATOM   1855 N N     . GLY B  1 18  ? -9.327  16.313 15.797  1.00 49.34 ? 0   GLY B N     1 
ATOM   1856 C CA    . GLY B  1 18  ? -10.089 17.242 16.689  1.00 46.66 ? 0   GLY B CA    1 
ATOM   1857 C C     . GLY B  1 18  ? -9.361  18.392 17.385  1.00 43.09 ? 0   GLY B C     1 
ATOM   1858 O O     . GLY B  1 18  ? -9.986  19.203 18.047  1.00 41.88 ? 0   GLY B O     1 
ATOM   1859 N N     . SER B  1 19  ? -8.044  18.479 17.229  1.00 41.03 ? 1   SER B N     1 
ATOM   1860 C CA    . SER B  1 19  ? -7.231  19.461 17.960  1.00 38.99 ? 1   SER B CA    1 
ATOM   1861 C C     . SER B  1 19  ? -5.880  19.634 17.329  1.00 37.20 ? 1   SER B C     1 
ATOM   1862 O O     . SER B  1 19  ? -5.461  18.765 16.563  1.00 37.92 ? 1   SER B O     1 
ATOM   1863 C CB    . SER B  1 19  ? -7.022  19.007 19.402  1.00 40.77 ? 1   SER B CB    1 
ATOM   1864 O OG    . SER B  1 19  ? -6.235  17.848 19.443  1.00 42.22 ? 1   SER B OG    1 
ATOM   1865 N N     . THR B  1 20  ? -5.165  20.705 17.686  1.00 35.00 ? 2   THR B N     1 
ATOM   1866 C CA    . THR B  1 20  ? -3.843  20.956 17.084  1.00 34.21 ? 2   THR B CA    1 
ATOM   1867 C C     . THR B  1 20  ? -2.835  19.900 17.495  1.00 36.78 ? 2   THR B C     1 
ATOM   1868 O O     . THR B  1 20  ? -1.983  19.529 16.705  1.00 36.71 ? 2   THR B O     1 
ATOM   1869 C CB    . THR B  1 20  ? -3.242  22.360 17.361  1.00 31.94 ? 2   THR B CB    1 
ATOM   1870 O OG1   . THR B  1 20  ? -3.145  22.631 18.772  1.00 31.82 ? 2   THR B OG1   1 
ATOM   1871 C CG2   . THR B  1 20  ? -4.052  23.403 16.683  1.00 30.19 ? 2   THR B CG2   1 
ATOM   1872 N N     . SER B  1 21  ? -2.975  19.377 18.705  1.00 39.40 ? 3   SER B N     1 
ATOM   1873 C CA    . SER B  1 21  ? -1.966  18.479 19.212  1.00 42.19 ? 3   SER B CA    1 
ATOM   1874 C C     . SER B  1 21  ? -2.022  17.129 18.461  1.00 44.24 ? 3   SER B C     1 
ATOM   1875 O O     . SER B  1 21  ? -1.056  16.372 18.486  1.00 46.03 ? 3   SER B O     1 
ATOM   1876 C CB    . SER B  1 21  ? -2.116  18.325 20.716  1.00 43.95 ? 3   SER B CB    1 
ATOM   1877 O OG    . SER B  1 21  ? -3.178  17.425 21.009  1.00 46.92 ? 3   SER B OG    1 
ATOM   1878 N N     . GLU B  1 22  ? -3.153  16.864 17.797  1.00 44.82 ? 4   GLU B N     1 
ATOM   1879 C CA    . GLU B  1 22  ? -3.335  15.716 16.921  1.00 46.92 ? 4   GLU B CA    1 
ATOM   1880 C C     . GLU B  1 22  ? -2.770  15.913 15.498  1.00 45.06 ? 4   GLU B C     1 
ATOM   1881 O O     . GLU B  1 22  ? -2.365  14.932 14.874  1.00 44.71 ? 4   GLU B O     1 
ATOM   1882 C CB    . GLU B  1 22  ? -4.818  15.331 16.837  1.00 49.15 ? 4   GLU B CB    1 
ATOM   1883 C CG    . GLU B  1 22  ? -5.311  14.607 18.077  1.00 52.25 ? 4   GLU B CG    1 
ATOM   1884 C CD    . GLU B  1 22  ? -6.817  14.589 18.185  1.00 54.27 ? 4   GLU B CD    1 
ATOM   1885 O OE1   . GLU B  1 22  ? -7.446  15.671 18.114  1.00 54.74 ? 4   GLU B OE1   1 
ATOM   1886 O OE2   . GLU B  1 22  ? -7.383  13.504 18.418  1.00 58.33 ? 4   GLU B OE2   1 
ATOM   1887 N N     . VAL B  1 23  ? -2.755  17.141 14.981  1.00 41.76 ? 5   VAL B N     1 
ATOM   1888 C CA    . VAL B  1 23  ? -2.271  17.377 13.609  1.00 40.92 ? 5   VAL B CA    1 
ATOM   1889 C C     . VAL B  1 23  ? -0.852  17.972 13.522  1.00 39.44 ? 5   VAL B C     1 
ATOM   1890 O O     . VAL B  1 23  ? -0.213  17.861 12.477  1.00 39.32 ? 5   VAL B O     1 
ATOM   1891 C CB    . VAL B  1 23  ? -3.286  18.159 12.727  1.00 39.80 ? 5   VAL B CB    1 
ATOM   1892 C CG1   . VAL B  1 23  ? -4.645  17.457 12.739  1.00 41.97 ? 5   VAL B CG1   1 
ATOM   1893 C CG2   . VAL B  1 23  ? -3.428  19.579 13.181  1.00 38.05 ? 5   VAL B CG2   1 
ATOM   1894 N N     . ILE B  1 24  ? -0.375  18.597 14.599  1.00 38.01 ? 6   ILE B N     1 
ATOM   1895 C CA    . ILE B  1 24  ? 0.977   19.147 14.642  1.00 36.67 ? 6   ILE B CA    1 
ATOM   1896 C C     . ILE B  1 24  ? 1.939   18.072 15.144  1.00 38.87 ? 6   ILE B C     1 
ATOM   1897 O O     . ILE B  1 24  ? 1.879   17.666 16.315  1.00 40.46 ? 6   ILE B O     1 
ATOM   1898 C CB    . ILE B  1 24  ? 1.025   20.448 15.489  1.00 35.23 ? 6   ILE B CB    1 
ATOM   1899 C CG1   . ILE B  1 24  ? 0.087   21.465 14.861  1.00 32.93 ? 6   ILE B CG1   1 
ATOM   1900 C CG2   . ILE B  1 24  ? 2.468   20.947 15.634  1.00 34.93 ? 6   ILE B CG2   1 
ATOM   1901 C CD1   . ILE B  1 24  ? -0.025  22.777 15.603  1.00 31.92 ? 6   ILE B CD1   1 
ATOM   1902 N N     . GLU B  1 25  ? 2.782   17.601 14.239  1.00 38.58 ? 7   GLU B N     1 
ATOM   1903 C CA    . GLU B  1 25  ? 3.812   16.625 14.550  1.00 40.89 ? 7   GLU B CA    1 
ATOM   1904 C C     . GLU B  1 25  ? 4.938   17.218 15.430  1.00 40.65 ? 7   GLU B C     1 
ATOM   1905 O O     . GLU B  1 25  ? 5.477   16.493 16.265  1.00 42.68 ? 7   GLU B O     1 
ATOM   1906 C CB    . GLU B  1 25  ? 4.376   16.015 13.242  1.00 41.15 ? 7   GLU B CB    1 
ATOM   1907 N N     . ASP B  1 26  ? 5.282   18.499 15.243  1.00 37.75 ? 8   ASP B N     1 
ATOM   1908 C CA    . ASP B  1 26  ? 6.482   19.140 15.829  1.00 37.05 ? 8   ASP B CA    1 
ATOM   1909 C C     . ASP B  1 26  ? 6.204   20.616 16.013  1.00 34.66 ? 8   ASP B C     1 
ATOM   1910 O O     . ASP B  1 26  ? 6.189   21.403 15.021  1.00 32.13 ? 8   ASP B O     1 
ATOM   1911 C CB    . ASP B  1 26  ? 7.675   18.975 14.870  1.00 37.70 ? 8   ASP B CB    1 
ATOM   1912 C CG    . ASP B  1 26  ? 9.016   19.478 15.449  1.00 38.39 ? 8   ASP B CG    1 
ATOM   1913 O OD1   . ASP B  1 26  ? 9.145   20.533 16.041  1.00 37.35 ? 8   ASP B OD1   1 
ATOM   1914 O OD2   . ASP B  1 26  ? 10.028  18.801 15.218  1.00 41.50 ? 8   ASP B OD2   1 
ATOM   1915 N N     . GLU B  1 27  ? 5.990   21.019 17.260  1.00 34.03 ? 9   GLU B N     1 
ATOM   1916 C CA    . GLU B  1 27  ? 5.569   22.383 17.520  1.00 32.26 ? 9   GLU B CA    1 
ATOM   1917 C C     . GLU B  1 27  ? 6.635   23.444 17.181  1.00 30.61 ? 9   GLU B C     1 
ATOM   1918 O O     . GLU B  1 27  ? 6.320   24.514 16.658  1.00 28.17 ? 9   GLU B O     1 
ATOM   1919 C CB    . GLU B  1 27  ? 5.180   22.505 18.975  1.00 33.49 ? 9   GLU B CB    1 
ATOM   1920 C CG    . GLU B  1 27  ? 4.556   23.842 19.342  1.00 32.37 ? 9   GLU B CG    1 
ATOM   1921 C CD    . GLU B  1 27  ? 4.105   23.868 20.785  1.00 34.39 ? 9   GLU B CD    1 
ATOM   1922 O OE1   . GLU B  1 27  ? 3.177   23.081 21.131  1.00 35.46 ? 9   GLU B OE1   1 
ATOM   1923 O OE2   . GLU B  1 27  ? 4.687   24.682 21.545  1.00 35.03 ? 9   GLU B OE2   1 
ATOM   1924 N N     . LYS B  1 28  ? 7.887   23.168 17.547  1.00 31.73 ? 10  LYS B N     1 
ATOM   1925 C CA    . LYS B  1 28  ? 8.969   24.096 17.205  1.00 31.22 ? 10  LYS B CA    1 
ATOM   1926 C C     . LYS B  1 28  ? 8.937   24.408 15.667  1.00 29.56 ? 10  LYS B C     1 
ATOM   1927 O O     . LYS B  1 28  ? 9.036   25.573 15.250  1.00 28.09 ? 10  LYS B O     1 
ATOM   1928 C CB    . LYS B  1 28  ? 10.340  23.525 17.588  1.00 33.48 ? 10  LYS B CB    1 
ATOM   1929 C CG    . LYS B  1 28  ? 11.380  24.631 17.487  1.00 33.46 ? 10  LYS B CG    1 
ATOM   1930 N N     . GLN B  1 29  ? 8.780   23.365 14.856  1.00 30.29 ? 11  GLN B N     1 
ATOM   1931 C CA    . GLN B  1 29  ? 8.763   23.515 13.402  1.00 29.48 ? 11  GLN B CA    1 
ATOM   1932 C C     . GLN B  1 29  ? 7.487   24.170 12.921  1.00 27.12 ? 11  GLN B C     1 
ATOM   1933 O O     . GLN B  1 29  ? 7.515   24.924 11.960  1.00 25.33 ? 11  GLN B O     1 
ATOM   1934 C CB    . GLN B  1 29  ? 8.952   22.214 12.668  1.00 32.29 ? 11  GLN B CB    1 
ATOM   1935 C CG    . GLN B  1 29  ? 10.381  21.703 12.727  1.00 35.68 ? 11  GLN B CG    1 
ATOM   1936 C CD    . GLN B  1 29  ? 10.575  20.545 11.773  1.00 38.73 ? 11  GLN B CD    1 
ATOM   1937 O OE1   . GLN B  1 29  ? 10.644  20.735 10.569  1.00 43.00 ? 11  GLN B OE1   1 
ATOM   1938 N NE2   . GLN B  1 29  ? 10.622  19.367 12.288  1.00 41.84 ? 11  GLN B NE2   1 
ATOM   1939 N N     . PHE B  1 30  ? 6.361   23.878 13.568  1.00 26.33 ? 12  PHE B N     1 
ATOM   1940 C CA    . PHE B  1 30  ? 5.110   24.569 13.243  1.00 24.75 ? 12  PHE B CA    1 
ATOM   1941 C C     . PHE B  1 30  ? 5.306   26.091 13.311  1.00 22.85 ? 12  PHE B C     1 
ATOM   1942 O O     . PHE B  1 30  ? 4.882   26.830 12.424  1.00 21.77 ? 12  PHE B O     1 
ATOM   1943 C CB    . PHE B  1 30  ? 3.984   24.080 14.164  1.00 25.40 ? 12  PHE B CB    1 
ATOM   1944 C CG    . PHE B  1 30  ? 2.683   24.839 14.014  1.00 24.15 ? 12  PHE B CG    1 
ATOM   1945 C CD1   . PHE B  1 30  ? 1.825   24.581 12.952  1.00 23.68 ? 12  PHE B CD1   1 
ATOM   1946 C CD2   . PHE B  1 30  ? 2.276   25.739 15.003  1.00 23.65 ? 12  PHE B CD2   1 
ATOM   1947 C CE1   . PHE B  1 30  ? 0.597   25.248 12.846  1.00 22.72 ? 12  PHE B CE1   1 
ATOM   1948 C CE2   . PHE B  1 30  ? 1.064   26.423 14.871  1.00 22.59 ? 12  PHE B CE2   1 
ATOM   1949 C CZ    . PHE B  1 30  ? 0.239   26.172 13.798  1.00 22.23 ? 12  PHE B CZ    1 
ATOM   1950 N N     . TYR B  1 31  ? 5.938   26.576 14.360  1.00 22.72 ? 13  TYR B N     1 
ATOM   1951 C CA    . TYR B  1 31  ? 6.223   27.985 14.482  1.00 21.43 ? 13  TYR B CA    1 
ATOM   1952 C C     . TYR B  1 31  ? 7.354   28.487 13.585  1.00 20.89 ? 13  TYR B C     1 
ATOM   1953 O O     . TYR B  1 31  ? 7.225   29.549 12.947  1.00 19.39 ? 13  TYR B O     1 
ATOM   1954 C CB    . TYR B  1 31  ? 6.532   28.333 15.914  1.00 22.29 ? 13  TYR B CB    1 
ATOM   1955 C CG    . TYR B  1 31  ? 5.285   28.379 16.771  1.00 22.14 ? 13  TYR B CG    1 
ATOM   1956 C CD1   . TYR B  1 31  ? 4.257   29.282 16.514  1.00 20.94 ? 13  TYR B CD1   1 
ATOM   1957 C CD2   . TYR B  1 31  ? 5.130   27.479 17.833  1.00 23.54 ? 13  TYR B CD2   1 
ATOM   1958 C CE1   . TYR B  1 31  ? 3.152   29.323 17.328  1.00 20.86 ? 13  TYR B CE1   1 
ATOM   1959 C CE2   . TYR B  1 31  ? 4.002   27.504 18.620  1.00 23.62 ? 13  TYR B CE2   1 
ATOM   1960 C CZ    . TYR B  1 31  ? 3.016   28.424 18.375  1.00 22.19 ? 13  TYR B CZ    1 
ATOM   1961 O OH    . TYR B  1 31  ? 1.883   28.463 19.195  1.00 22.32 ? 13  TYR B OH    1 
ATOM   1962 N N     . SER B  1 32  ? 8.430   27.711 13.476  1.00 21.75 ? 14  SER B N     1 
ATOM   1963 C CA    . SER B  1 32  ? 9.588   28.233 12.709  1.00 21.55 ? 14  SER B CA    1 
ATOM   1964 C C     . SER B  1 32  ? 9.249   28.302 11.213  1.00 20.62 ? 14  SER B C     1 
ATOM   1965 O O     . SER B  1 32  ? 9.612   29.256 10.523  1.00 19.79 ? 14  SER B O     1 
ATOM   1966 C CB    . SER B  1 32  ? 10.881  27.436 12.949  1.00 23.11 ? 14  SER B CB    1 
ATOM   1967 O OG    . SER B  1 32  ? 10.776  26.076 12.530  1.00 23.86 ? 14  SER B OG    1 
ATOM   1968 N N     . LYS B  1 33  ? 8.558   27.283 10.709  1.00 21.05 ? 15  LYS B N     1 
ATOM   1969 C CA    . LYS B  1 33  ? 8.154   27.267 9.284   1.00 20.45 ? 15  LYS B CA    1 
ATOM   1970 C C     . LYS B  1 33  ? 7.241   28.462 8.975   1.00 18.62 ? 15  LYS B C     1 
ATOM   1971 O O     . LYS B  1 33  ? 7.314   29.094 7.914   1.00 17.51 ? 15  LYS B O     1 
ATOM   1972 C CB    . LYS B  1 33  ? 7.455   25.939 8.935   1.00 21.84 ? 15  LYS B CB    1 
ATOM   1973 C CG    . LYS B  1 33  ? 8.399   24.783 8.799   1.00 24.17 ? 15  LYS B CG    1 
ATOM   1974 C CD    . LYS B  1 33  ? 7.713   23.456 8.407   1.00 25.72 ? 15  LYS B CD    1 
ATOM   1975 C CE    . LYS B  1 33  ? 8.632   22.268 8.474   1.00 28.32 ? 15  LYS B CE    1 
ATOM   1976 N N     . ALA B  1 34  ? 6.352   28.806 9.905   1.00 18.00 ? 16  ALA B N     1 
ATOM   1977 C CA    . ALA B  1 34  ? 5.406   29.879 9.632   1.00 16.67 ? 16  ALA B CA    1 
ATOM   1978 C C     . ALA B  1 34  ? 6.141   31.218 9.608   1.00 16.28 ? 16  ALA B C     1 
ATOM   1979 O O     . ALA B  1 34  ? 5.816   32.099 8.818   1.00 15.29 ? 16  ALA B O     1 
ATOM   1980 C CB    . ALA B  1 34  ? 4.299   29.915 10.709  1.00 16.63 ? 16  ALA B CB    1 
ATOM   1981 N N     . LYS B  1 35  ? 7.152   31.366 10.466  1.00 17.08 ? 17  LYS B N     1 
ATOM   1982 C CA    . LYS B  1 35  ? 7.919   32.633 10.539  1.00 17.15 ? 17  LYS B CA    1 
ATOM   1983 C C     . LYS B  1 35  ? 8.692   32.823 9.195   1.00 16.70 ? 17  LYS B C     1 
ATOM   1984 O O     . LYS B  1 35  ? 8.637   33.905 8.575   1.00 15.98 ? 17  LYS B O     1 
ATOM   1985 C CB    . LYS B  1 35  ? 8.871   32.638 11.695  1.00 19.15 ? 17  LYS B CB    1 
ATOM   1986 C CG    . LYS B  1 35  ? 9.604   33.959 11.809  1.00 20.52 ? 17  LYS B CG    1 
ATOM   1987 C CD    . LYS B  1 35  ? 10.396  34.109 13.103  1.00 22.98 ? 17  LYS B CD    1 
ATOM   1988 C CE    . LYS B  1 35  ? 11.377  35.307 13.034  1.00 24.36 ? 17  LYS B CE    1 
ATOM   1989 N NZ    . LYS B  1 35  ? 12.068  35.451 14.337  1.00 26.37 ? 17  LYS B NZ    1 
ATOM   1990 N N     . THR B  1 36  ? 9.289   31.741 8.735   1.00 16.76 ? 18  THR B N     1 
ATOM   1991 C CA    . THR B  1 36  ? 9.930   31.731 7.434   1.00 16.88 ? 18  THR B CA    1 
ATOM   1992 C C     . THR B  1 36  ? 8.958   32.039 6.300   1.00 15.97 ? 18  THR B C     1 
ATOM   1993 O O     . THR B  1 36  ? 9.283   32.840 5.362   1.00 15.87 ? 18  THR B O     1 
ATOM   1994 C CB    . THR B  1 36  ? 10.578  30.374 7.174   1.00 17.73 ? 18  THR B CB    1 
ATOM   1995 O OG1   . THR B  1 36  ? 11.617  30.152 8.152   1.00 18.62 ? 18  THR B OG1   1 
ATOM   1996 C CG2   . THR B  1 36  ? 11.114  30.263 5.746   1.00 17.91 ? 18  THR B CG2   1 
ATOM   1997 N N     . TYR B  1 37  ? 7.804   31.392 6.349   1.00 15.85 ? 19  TYR B N     1 
ATOM   1998 C CA    . TYR B  1 37  ? 6.826   31.603 5.295   1.00 15.43 ? 19  TYR B CA    1 
ATOM   1999 C C     . TYR B  1 37  ? 6.544   33.094 5.114   1.00 14.62 ? 19  TYR B C     1 
ATOM   2000 O O     . TYR B  1 37  ? 6.583   33.621 3.998   1.00 14.04 ? 19  TYR B O     1 
ATOM   2001 C CB    . TYR B  1 37  ? 5.518   30.829 5.587   1.00 15.76 ? 19  TYR B CB    1 
ATOM   2002 C CG    . TYR B  1 37  ? 4.534   31.013 4.458   1.00 15.72 ? 19  TYR B CG    1 
ATOM   2003 C CD1   . TYR B  1 37  ? 4.691   30.255 3.313   1.00 16.70 ? 19  TYR B CD1   1 
ATOM   2004 C CD2   . TYR B  1 37  ? 3.549   32.029 4.481   1.00 15.36 ? 19  TYR B CD2   1 
ATOM   2005 C CE1   . TYR B  1 37  ? 3.885   30.434 2.233   1.00 16.84 ? 19  TYR B CE1   1 
ATOM   2006 C CE2   . TYR B  1 37  ? 2.701   32.207 3.380   1.00 15.49 ? 19  TYR B CE2   1 
ATOM   2007 C CZ    . TYR B  1 37  ? 2.919   31.380 2.276   1.00 16.41 ? 19  TYR B CZ    1 
ATOM   2008 O OH    . TYR B  1 37  ? 2.194   31.474 1.090   1.00 17.56 ? 19  TYR B OH    1 
ATOM   2009 N N     . TRP B  1 38  ? 6.168   33.763 6.217   1.00 14.32 ? 20  TRP B N     1 
ATOM   2010 C CA    . TRP B  1 38  ? 5.747   35.140 6.135   1.00 13.80 ? 20  TRP B CA    1 
ATOM   2011 C C     . TRP B  1 38  ? 6.891   36.116 5.856   1.00 14.27 ? 20  TRP B C     1 
ATOM   2012 O O     . TRP B  1 38  ? 6.659   37.153 5.225   1.00 13.53 ? 20  TRP B O     1 
ATOM   2013 C CB    . TRP B  1 38  ? 4.964   35.539 7.422   1.00 13.83 ? 20  TRP B CB    1 
ATOM   2014 C CG    . TRP B  1 38  ? 3.609   34.928 7.417   1.00 13.67 ? 20  TRP B CG    1 
ATOM   2015 C CD1   . TRP B  1 38  ? 3.182   33.850 8.114   1.00 14.41 ? 20  TRP B CD1   1 
ATOM   2016 C CD2   . TRP B  1 38  ? 2.524   35.310 6.561   1.00 13.59 ? 20  TRP B CD2   1 
ATOM   2017 N NE1   . TRP B  1 38  ? 1.899   33.570 7.812   1.00 14.16 ? 20  TRP B NE1   1 
ATOM   2018 C CE2   . TRP B  1 38  ? 1.456   34.459 6.853   1.00 13.84 ? 20  TRP B CE2   1 
ATOM   2019 C CE3   . TRP B  1 38  ? 2.342   36.347 5.648   1.00 13.24 ? 20  TRP B CE3   1 
ATOM   2020 C CZ2   . TRP B  1 38  ? 0.229   34.554 6.195   1.00 13.84 ? 20  TRP B CZ2   1 
ATOM   2021 C CZ3   . TRP B  1 38  ? 1.122   36.455 4.992   1.00 13.33 ? 20  TRP B CZ3   1 
ATOM   2022 C CH2   . TRP B  1 38  ? 0.075   35.584 5.283   1.00 13.88 ? 20  TRP B CH2   1 
ATOM   2023 N N     . LYS B  1 39  ? 8.107   35.781 6.304   1.00 15.25 ? 21  LYS B N     1 
ATOM   2024 C CA    . LYS B  1 39  ? 9.318   36.577 5.940   1.00 16.37 ? 21  LYS B CA    1 
ATOM   2025 C C     . LYS B  1 39  ? 9.457   36.760 4.450   1.00 16.01 ? 21  LYS B C     1 
ATOM   2026 O O     . LYS B  1 39  ? 10.032  37.776 3.997   1.00 16.53 ? 21  LYS B O     1 
ATOM   2027 C CB    . LYS B  1 39  ? 10.574  35.922 6.530   1.00 18.50 ? 21  LYS B CB    1 
ATOM   2028 C CG    . LYS B  1 39  ? 11.890  36.662 6.357   1.00 20.51 ? 21  LYS B CG    1 
ATOM   2029 C CD    . LYS B  1 39  ? 13.037  35.961 7.052   1.00 22.76 ? 21  LYS B CD    1 
ATOM   2030 C CE    . LYS B  1 39  ? 14.258  36.882 7.207   1.00 25.20 ? 21  LYS B CE    1 
ATOM   2031 N N     . GLN B  1 40  ? 8.997   35.766 3.698   1.00 14.97 ? 22  GLN B N     1 
ATOM   2032 C CA    . GLN B  1 40  ? 9.143   35.753 2.247   1.00 15.08 ? 22  GLN B CA    1 
ATOM   2033 C C     . GLN B  1 40  ? 7.953   36.296 1.485   1.00 14.53 ? 22  GLN B C     1 
ATOM   2034 O O     . GLN B  1 40  ? 7.960   36.172 0.242   1.00 14.76 ? 22  GLN B O     1 
ATOM   2035 C CB    . GLN B  1 40  ? 9.489   34.344 1.794   1.00 15.22 ? 22  GLN B CB    1 
ATOM   2036 C CG    . GLN B  1 40  ? 10.751  33.829 2.501   1.00 15.74 ? 22  GLN B CG    1 
ATOM   2037 C CD    . GLN B  1 40  ? 11.029  32.322 2.402   1.00 16.24 ? 22  GLN B CD    1 
ATOM   2038 O OE1   . GLN B  1 40  ? 12.150  31.893 2.640   1.00 16.77 ? 22  GLN B OE1   1 
ATOM   2039 N NE2   . GLN B  1 40  ? 9.993   31.511 2.051   1.00 15.86 ? 22  GLN B NE2   1 
ATOM   2040 N N     . ILE B  1 41  ? 6.933   36.801 2.172   1.00 14.05 ? 23  ILE B N     1 
ATOM   2041 C CA    . ILE B  1 41  ? 5.688   37.300 1.528   1.00 13.86 ? 23  ILE B CA    1 
ATOM   2042 C C     . ILE B  1 41  ? 5.861   38.803 1.270   1.00 14.35 ? 23  ILE B C     1 
ATOM   2043 O O     . ILE B  1 41  ? 6.313   39.513 2.157   1.00 14.48 ? 23  ILE B O     1 
ATOM   2044 C CB    . ILE B  1 41  ? 4.444   36.981 2.417   1.00 13.32 ? 23  ILE B CB    1 
ATOM   2045 C CG1   . ILE B  1 41  ? 4.069   35.471 2.301   1.00 13.52 ? 23  ILE B CG1   1 
ATOM   2046 C CG2   . ILE B  1 41  ? 3.282   37.910 2.096   1.00 12.98 ? 23  ILE B CG2   1 
ATOM   2047 C CD1   . ILE B  1 41  ? 3.554   34.982 0.960   1.00 13.79 ? 23  ILE B CD1   1 
ATOM   2048 N N     . PRO B  1 42  ? 5.515   39.293 0.071   1.00 14.92 ? 24  PRO B N     1 
ATOM   2049 C CA    . PRO B  1 42  ? 5.605   40.722 -0.165  1.00 15.26 ? 24  PRO B CA    1 
ATOM   2050 C C     . PRO B  1 42  ? 4.719   41.524 0.752   1.00 14.17 ? 24  PRO B C     1 
ATOM   2051 O O     . PRO B  1 42  ? 3.596   41.121 1.092   1.00 13.74 ? 24  PRO B O     1 
ATOM   2052 C CB    . PRO B  1 42  ? 5.188   40.911 -1.647  1.00 16.02 ? 24  PRO B CB    1 
ATOM   2053 C CG    . PRO B  1 42  ? 4.365   39.728 -1.906  1.00 16.13 ? 24  PRO B CG    1 
ATOM   2054 C CD    . PRO B  1 42  ? 4.981   38.591 -1.103  1.00 15.56 ? 24  PRO B CD    1 
ATOM   2055 N N     . PRO B  1 43  ? 5.236   42.651 1.224   1.00 14.43 ? 25  PRO B N     1 
ATOM   2056 C CA    . PRO B  1 43  ? 4.472   43.449 2.230   1.00 13.88 ? 25  PRO B CA    1 
ATOM   2057 C C     . PRO B  1 43  ? 3.423   44.292 1.557   1.00 13.96 ? 25  PRO B C     1 
ATOM   2058 O O     . PRO B  1 43  ? 3.493   45.558 1.551   1.00 14.51 ? 25  PRO B O     1 
ATOM   2059 C CB    . PRO B  1 43  ? 5.602   44.316 2.874   1.00 14.82 ? 25  PRO B CB    1 
ATOM   2060 C CG    . PRO B  1 43  ? 6.529   44.547 1.741   1.00 15.71 ? 25  PRO B CG    1 
ATOM   2061 C CD    . PRO B  1 43  ? 6.585   43.184 1.022   1.00 15.59 ? 25  PRO B CD    1 
ATOM   2062 N N     . THR B  1 44  ? 2.422   43.632 1.029   1.00 13.62 ? 26  THR B N     1 
ATOM   2063 C CA    . THR B  1 44  ? 1.343   44.281 0.252   1.00 13.96 ? 26  THR B CA    1 
ATOM   2064 C C     . THR B  1 44  ? 0.032   43.726 0.760   1.00 13.36 ? 26  THR B C     1 
ATOM   2065 O O     . THR B  1 44  ? -0.010  42.669 1.378   1.00 12.24 ? 26  THR B O     1 
ATOM   2066 C CB    . THR B  1 44  ? 1.476   43.953 -1.239  1.00 14.86 ? 26  THR B CB    1 
ATOM   2067 O OG1   . THR B  1 44  ? 1.331   42.548 -1.394  1.00 14.50 ? 26  THR B OG1   1 
ATOM   2068 C CG2   . THR B  1 44  ? 2.841   44.305 -1.758  1.00 16.10 ? 26  THR B CG2   1 
ATOM   2069 N N     . VAL B  1 45  ? -1.078  44.396 0.430   1.00 13.27 ? 27  VAL B N     1 
ATOM   2070 C CA    . VAL B  1 45  ? -2.391  43.868 0.766   1.00 13.38 ? 27  VAL B CA    1 
ATOM   2071 C C     . VAL B  1 45  ? -2.628  42.506 0.123   1.00 13.58 ? 27  VAL B C     1 
ATOM   2072 O O     . VAL B  1 45  ? -3.181  41.614 0.778   1.00 13.46 ? 27  VAL B O     1 
ATOM   2073 C CB    . VAL B  1 45  ? -3.539  44.852 0.344   1.00 14.06 ? 27  VAL B CB    1 
ATOM   2074 C CG1   . VAL B  1 45  ? -4.921  44.237 0.464   1.00 14.10 ? 27  VAL B CG1   1 
ATOM   2075 C CG2   . VAL B  1 45  ? -3.451  46.101 1.182   1.00 14.10 ? 27  VAL B CG2   1 
ATOM   2076 N N     . ASP B  1 46  ? -2.198  42.364 -1.130  1.00 14.27 ? 28  ASP B N     1 
ATOM   2077 C CA    . ASP B  1 46  ? -2.383  41.059 -1.795  1.00 15.06 ? 28  ASP B CA    1 
ATOM   2078 C C     . ASP B  1 46  ? -1.534  39.960 -1.133  1.00 14.81 ? 28  ASP B C     1 
ATOM   2079 O O     . ASP B  1 46  ? -1.962  38.802 -1.077  1.00 15.15 ? 28  ASP B O     1 
ATOM   2080 C CB    . ASP B  1 46  ? -2.091  41.134 -3.267  1.00 16.53 ? 28  ASP B CB    1 
ATOM   2081 C CG    . ASP B  1 46  ? -2.822  40.009 -4.082  1.00 17.85 ? 28  ASP B CG    1 
ATOM   2082 O OD1   . ASP B  1 46  ? -4.038  39.699 -3.884  1.00 18.26 ? 28  ASP B OD1   1 
ATOM   2083 O OD2   . ASP B  1 46  ? -2.185  39.445 -4.949  1.00 19.02 ? 28  ASP B OD2   1 
ATOM   2084 N N     . GLY B  1 47  ? -0.386  40.329 -0.563  1.00 14.10 ? 29  GLY B N     1 
ATOM   2085 C CA    . GLY B  1 47  ? 0.418   39.376 0.198   1.00 13.96 ? 29  GLY B CA    1 
ATOM   2086 C C     . GLY B  1 47  ? -0.280  39.003 1.512   1.00 13.61 ? 29  GLY B C     1 
ATOM   2087 O O     . GLY B  1 47  ? -0.355  37.791 1.869   1.00 13.54 ? 29  GLY B O     1 
ATOM   2088 N N     . MET B  1 48  ? -0.810  40.003 2.203   1.00 13.11 ? 30  MET B N     1 
ATOM   2089 C CA    . MET B  1 48  ? -1.543  39.782 3.490   1.00 13.29 ? 30  MET B CA    1 
ATOM   2090 C C     . MET B  1 48  ? -2.689  38.773 3.228   1.00 13.90 ? 30  MET B C     1 
ATOM   2091 O O     . MET B  1 48  ? -2.986  37.896 4.082   1.00 15.03 ? 30  MET B O     1 
ATOM   2092 C CB    . MET B  1 48  ? -2.111  41.069 4.058   1.00 13.16 ? 30  MET B CB    1 
ATOM   2093 C CG    . MET B  1 48  ? -1.116  42.198 4.424   1.00 13.45 ? 30  MET B CG    1 
ATOM   2094 S SD    . MET B  1 48  ? 0.182   41.659 5.575   1.00 13.42 ? 30  MET B SD    1 
ATOM   2095 C CE    . MET B  1 48  ? 1.542   41.248 4.484   1.00 14.15 ? 30  MET B CE    1 
ATOM   2096 N N     . LEU B  1 49  ? -3.341  38.906 2.065   1.00 13.36 ? 31  LEU B N     1 
ATOM   2097 C CA    . LEU B  1 49  ? -4.586  38.154 1.783   1.00 13.81 ? 31  LEU B CA    1 
ATOM   2098 C C     . LEU B  1 49  ? -4.377  37.012 0.830   1.00 13.90 ? 31  LEU B C     1 
ATOM   2099 O O     . LEU B  1 49  ? -5.350  36.468 0.283   1.00 13.94 ? 31  LEU B O     1 
ATOM   2100 C CB    . LEU B  1 49  ? -5.680  39.128 1.285   1.00 14.18 ? 31  LEU B CB    1 
ATOM   2101 C CG    . LEU B  1 49  ? -6.084  40.223 2.287   1.00 13.96 ? 31  LEU B CG    1 
ATOM   2102 C CD1   . LEU B  1 49  ? -7.268  41.038 1.795   1.00 14.73 ? 31  LEU B CD1   1 
ATOM   2103 C CD2   . LEU B  1 49  ? -6.412  39.579 3.636   1.00 14.08 ? 31  LEU B CD2   1 
ATOM   2104 N N     . GLY B  1 50  ? -3.114  36.588 0.613   1.00 13.64 ? 32  GLY B N     1 
ATOM   2105 C CA    . GLY B  1 50  ? -2.912  35.357 -0.104  1.00 14.41 ? 32  GLY B CA    1 
ATOM   2106 C C     . GLY B  1 50  ? -3.486  35.282 -1.504  1.00 14.96 ? 32  GLY B C     1 
ATOM   2107 O O     . GLY B  1 50  ? -3.962  34.237 -1.961  1.00 15.70 ? 32  GLY B O     1 
ATOM   2108 N N     . GLY B  1 51  ? -3.418  36.407 -2.188  1.00 14.94 ? 33  GLY B N     1 
ATOM   2109 C CA    . GLY B  1 51  ? -3.901  36.554 -3.553  1.00 16.04 ? 33  GLY B CA    1 
ATOM   2110 C C     . GLY B  1 51  ? -5.337  37.000 -3.633  1.00 16.63 ? 33  GLY B C     1 
ATOM   2111 O O     . GLY B  1 51  ? -5.879  37.164 -4.742  1.00 17.42 ? 33  GLY B O     1 
ATOM   2112 N N     . TYR B  1 52  ? -5.968  37.186 -2.484  1.00 16.27 ? 34  TYR B N     1 
ATOM   2113 C CA    . TYR B  1 52  ? -7.348  37.676 -2.407  1.00 17.06 ? 34  TYR B CA    1 
ATOM   2114 C C     . TYR B  1 52  ? -7.399  39.122 -1.989  1.00 17.12 ? 34  TYR B C     1 
ATOM   2115 O O     . TYR B  1 52  ? -8.346  39.571 -1.354  1.00 16.27 ? 34  TYR B O     1 
ATOM   2116 C CB    . TYR B  1 52  ? -8.216  36.806 -1.483  1.00 17.08 ? 34  TYR B CB    1 
ATOM   2117 C CG    . TYR B  1 52  ? -8.500  35.464 -2.050  1.00 18.39 ? 34  TYR B CG    1 
ATOM   2118 C CD1   . TYR B  1 52  ? -9.584  35.249 -2.937  1.00 19.83 ? 34  TYR B CD1   1 
ATOM   2119 C CD2   . TYR B  1 52  ? -7.694  34.381 -1.724  1.00 18.57 ? 34  TYR B CD2   1 
ATOM   2120 C CE1   . TYR B  1 52  ? -9.822  34.007 -3.475  1.00 21.24 ? 34  TYR B CE1   1 
ATOM   2121 C CE2   . TYR B  1 52  ? -7.920  33.136 -2.251  1.00 20.08 ? 34  TYR B CE2   1 
ATOM   2122 C CZ    . TYR B  1 52  ? -8.988  32.955 -3.139  1.00 21.28 ? 34  TYR B CZ    1 
ATOM   2123 O OH    . TYR B  1 52  ? -9.219  31.695 -3.655  1.00 23.17 ? 34  TYR B OH    1 
ATOM   2124 N N     . GLY B  1 53  ? -6.397  39.901 -2.361  1.00 17.68 ? 35  GLY B N     1 
ATOM   2125 C CA    . GLY B  1 53  ? -6.418  41.325 -2.033  1.00 18.19 ? 35  GLY B CA    1 
ATOM   2126 C C     . GLY B  1 53  ? -7.697  42.038 -2.457  1.00 19.16 ? 35  GLY B C     1 
ATOM   2127 O O     . GLY B  1 53  ? -8.129  42.965 -1.763  1.00 19.37 ? 35  GLY B O     1 
ATOM   2128 N N     . HIS B  1 54  ? -8.297  41.586 -3.558  1.00 20.66 ? 36  HIS B N     1 
ATOM   2129 C CA    . HIS B  1 54  ? -9.539  42.151 -4.083  1.00 22.37 ? 36  HIS B CA    1 
ATOM   2130 C C     . HIS B  1 54  ? -10.752 42.024 -3.121  1.00 21.42 ? 36  HIS B C     1 
ATOM   2131 O O     . HIS B  1 54  ? -11.778 42.740 -3.341  1.00 22.59 ? 36  HIS B O     1 
ATOM   2132 C CB    . HIS B  1 54  ? -9.872  41.565 -5.455  1.00 25.24 ? 36  HIS B CB    1 
ATOM   2133 C CG    . HIS B  1 54  ? -10.195 40.093 -5.437  1.00 27.79 ? 36  HIS B CG    1 
ATOM   2134 N ND1   . HIS B  1 54  ? -9.231  39.104 -5.618  1.00 29.60 ? 36  HIS B ND1   1 
ATOM   2135 C CD2   . HIS B  1 54  ? -11.379 39.448 -5.311  1.00 30.08 ? 36  HIS B CD2   1 
ATOM   2136 C CE1   . HIS B  1 54  ? -9.824  37.916 -5.626  1.00 31.16 ? 36  HIS B CE1   1 
ATOM   2137 N NE2   . HIS B  1 54  ? -11.119 38.096 -5.402  1.00 32.17 ? 36  HIS B NE2   1 
ATOM   2138 N N     . ILE B  1 55  ? -10.686 41.165 -2.092  1.00 19.17 ? 37  ILE B N     1 
ATOM   2139 C CA    . ILE B  1 55  ? -11.832 41.072 -1.128  1.00 18.88 ? 37  ILE B CA    1 
ATOM   2140 C C     . ILE B  1 55  ? -11.672 42.027 0.057   1.00 16.82 ? 37  ILE B C     1 
ATOM   2141 O O     . ILE B  1 55  ? -12.470 41.991 0.980   1.00 16.51 ? 37  ILE B O     1 
ATOM   2142 C CB    . ILE B  1 55  ? -12.126 39.634 -0.608  1.00 19.68 ? 37  ILE B CB    1 
ATOM   2143 C CG1   . ILE B  1 55  ? -11.052 39.167 0.364   1.00 19.42 ? 37  ILE B CG1   1 
ATOM   2144 C CG2   . ILE B  1 55  ? -12.248 38.651 -1.782  1.00 21.38 ? 37  ILE B CG2   1 
ATOM   2145 C CD1   . ILE B  1 55  ? -11.370 37.885 1.087   1.00 20.65 ? 37  ILE B CD1   1 
ATOM   2146 N N     . SER B  1 56  ? -10.629 42.853 0.080   1.00 15.60 ? 38  SER B N     1 
ATOM   2147 C CA    . SER B  1 56  ? -10.272 43.588 1.298   1.00 14.59 ? 38  SER B CA    1 
ATOM   2148 C C     . SER B  1 56  ? -11.406 44.514 1.648   1.00 14.81 ? 38  SER B C     1 
ATOM   2149 O O     . SER B  1 56  ? -11.760 44.604 2.843   1.00 14.12 ? 38  SER B O     1 
ATOM   2150 C CB    . SER B  1 56  ? -8.960  44.344 1.147   1.00 14.17 ? 38  SER B CB    1 
ATOM   2151 O OG    . SER B  1 56  ? -8.620  44.954 2.377   1.00 13.17 ? 38  SER B OG    1 
ATOM   2152 N N     . SER B  1 57  ? -12.015 45.220 0.658   1.00 15.78 ? 39  SER B N     1 
ATOM   2153 C CA    A SER B  1 57  ? -13.103 46.162 1.012   0.80 16.31 ? 39  SER B CA    1 
ATOM   2154 C CA    B SER B  1 57  ? -13.085 46.164 1.019   0.20 16.09 ? 39  SER B CA    1 
ATOM   2155 C C     . SER B  1 57  ? -14.325 45.431 1.555   1.00 16.46 ? 39  SER B C     1 
ATOM   2156 O O     . SER B  1 57  ? -14.937 45.902 2.480   1.00 15.97 ? 39  SER B O     1 
ATOM   2157 C CB    A SER B  1 57  ? -13.537 47.008 -0.166  0.80 17.76 ? 39  SER B CB    1 
ATOM   2158 C CB    B SER B  1 57  ? -13.453 47.119 -0.123  0.20 17.21 ? 39  SER B CB    1 
ATOM   2159 O OG    A SER B  1 57  ? -12.435 47.805 -0.520  0.80 18.21 ? 39  SER B OG    1 
ATOM   2160 O OG    B SER B  1 57  ? -13.928 46.446 -1.260  0.20 18.17 ? 39  SER B OG    1 
ATOM   2161 N N     . ILE B  1 58  ? -14.667 44.277 0.974   1.00 16.62 ? 40  ILE B N     1 
ATOM   2162 C CA    . ILE B  1 58  ? -15.823 43.508 1.441   1.00 17.26 ? 40  ILE B CA    1 
ATOM   2163 C C     . ILE B  1 58  ? -15.607 43.164 2.933   1.00 15.75 ? 40  ILE B C     1 
ATOM   2164 O O     . ILE B  1 58  ? -16.495 43.305 3.798   1.00 15.21 ? 40  ILE B O     1 
ATOM   2165 C CB    . ILE B  1 58  ? -16.012 42.207 0.599   1.00 18.56 ? 40  ILE B CB    1 
ATOM   2166 C CG1   A ILE B  1 58  ? -16.561 42.536 -0.801  0.80 20.15 ? 40  ILE B CG1   1 
ATOM   2167 C CG1   B ILE B  1 58  ? -16.560 42.537 -0.804  0.20 19.91 ? 40  ILE B CG1   1 
ATOM   2168 C CG2   . ILE B  1 58  ? -16.932 41.192 1.282   1.00 19.47 ? 40  ILE B CG2   1 
ATOM   2169 C CD1   A ILE B  1 58  ? -16.329 41.443 -1.819  0.80 21.06 ? 40  ILE B CD1   1 
ATOM   2170 C CD1   B ILE B  1 58  ? -17.933 43.187 -0.840  0.20 20.79 ? 40  ILE B CD1   1 
ATOM   2171 N N     . ASP B  1 59  ? -14.409 42.672 3.201   1.00 14.59 ? 41  ASP B N     1 
ATOM   2172 C CA    . ASP B  1 59  ? -14.014 42.284 4.564   1.00 13.88 ? 41  ASP B CA    1 
ATOM   2173 C C     . ASP B  1 59  ? -14.094 43.480 5.523   1.00 13.39 ? 41  ASP B C     1 
ATOM   2174 O O     . ASP B  1 59  ? -14.741 43.403 6.555   1.00 13.09 ? 41  ASP B O     1 
ATOM   2175 C CB    . ASP B  1 59  ? -12.591 41.729 4.570   1.00 13.44 ? 41  ASP B CB    1 
ATOM   2176 C CG    . ASP B  1 59  ? -11.988 41.620 5.944   1.00 12.98 ? 41  ASP B CG    1 
ATOM   2177 O OD1   . ASP B  1 59  ? -12.551 40.866 6.793   1.00 13.24 ? 41  ASP B OD1   1 
ATOM   2178 O OD2   . ASP B  1 59  ? -10.916 42.304 6.197   1.00 12.73 ? 41  ASP B OD2   1 
ATOM   2179 N N     . ILE B  1 60  ? -13.454 44.581 5.137   1.00 13.39 ? 42  ILE B N     1 
ATOM   2180 C CA    . ILE B  1 60  ? -13.352 45.721 6.062   1.00 13.40 ? 42  ILE B CA    1 
ATOM   2181 C C     . ILE B  1 60  ? -14.723 46.319 6.326   1.00 13.48 ? 42  ILE B C     1 
ATOM   2182 O O     . ILE B  1 60  ? -15.030 46.719 7.462   1.00 12.88 ? 42  ILE B O     1 
ATOM   2183 C CB    . ILE B  1 60  ? -12.379 46.797 5.478   1.00 14.10 ? 42  ILE B CB    1 
ATOM   2184 C CG1   . ILE B  1 60  ? -10.926 46.267 5.480   1.00 13.97 ? 42  ILE B CG1   1 
ATOM   2185 C CG2   . ILE B  1 60  ? -12.508 48.111 6.211   1.00 14.26 ? 42  ILE B CG2   1 
ATOM   2186 C CD1   . ILE B  1 60  ? -10.284 46.098 6.793   1.00 13.95 ? 42  ILE B CD1   1 
ATOM   2187 N N     . ASN B  1 61  ? -15.519 46.467 5.270   1.00 13.94 ? 43  ASN B N     1 
ATOM   2188 C CA    . ASN B  1 61  ? -16.828 47.110 5.447   1.00 14.62 ? 43  ASN B CA    1 
ATOM   2189 C C     . ASN B  1 61  ? -17.730 46.283 6.362   1.00 14.47 ? 43  ASN B C     1 
ATOM   2190 O O     . ASN B  1 61  ? -18.488 46.861 7.169   1.00 14.86 ? 43  ASN B O     1 
ATOM   2191 C CB    . ASN B  1 61  ? -17.470 47.370 4.123   1.00 16.06 ? 43  ASN B CB    1 
ATOM   2192 C CG    . ASN B  1 61  ? -16.751 48.463 3.345   1.00 16.69 ? 43  ASN B CG    1 
ATOM   2193 O OD1   . ASN B  1 61  ? -16.115 49.361 3.910   1.00 16.52 ? 43  ASN B OD1   1 
ATOM   2194 N ND2   . ASN B  1 61  ? -16.838 48.380 2.042   1.00 17.84 ? 43  ASN B ND2   1 
ATOM   2195 N N     . SER B  1 62  ? -17.607 44.942 6.294   1.00 14.07 ? 44  SER B N     1 
ATOM   2196 C CA    . SER B  1 62  ? -18.377 44.073 7.194   1.00 14.39 ? 44  SER B CA    1 
ATOM   2197 C C     . SER B  1 62  ? -17.838 44.167 8.597   1.00 13.27 ? 44  SER B C     1 
ATOM   2198 O O     . SER B  1 62  ? -18.634 44.291 9.553   1.00 13.46 ? 44  SER B O     1 
ATOM   2199 C CB    . SER B  1 62  ? -18.357 42.634 6.716   1.00 14.96 ? 44  SER B CB    1 
ATOM   2200 O OG    . SER B  1 62  ? -19.061 42.503 5.488   1.00 16.16 ? 44  SER B OG    1 
ATOM   2201 N N     . SER B  1 63  ? -16.506 44.167 8.714   1.00 12.44 ? 45  SER B N     1 
ATOM   2202 C CA    . SER B  1 63  ? -15.874 44.310 10.005  1.00 11.98 ? 45  SER B CA    1 
ATOM   2203 C C     . SER B  1 63  ? -16.354 45.593 10.707  1.00 11.99 ? 45  SER B C     1 
ATOM   2204 O O     . SER B  1 63  ? -16.601 45.592 11.945  1.00 12.10 ? 45  SER B O     1 
ATOM   2205 C CB    . SER B  1 63  ? -14.347 44.296 9.963   1.00 11.50 ? 45  SER B CB    1 
ATOM   2206 O OG    . SER B  1 63  ? -13.903 43.001 9.605   1.00 11.58 ? 45  SER B OG    1 
ATOM   2207 N N     . ARG B  1 64  ? -16.385 46.675 9.956   1.00 12.21 ? 46  ARG B N     1 
ATOM   2208 C CA    . ARG B  1 64  ? -16.756 47.974 10.549  1.00 12.71 ? 46  ARG B CA    1 
ATOM   2209 C C     . ARG B  1 64  ? -18.213 47.912 11.078  1.00 13.22 ? 46  ARG B C     1 
ATOM   2210 O O     . ARG B  1 64  ? -18.503 48.447 12.166  1.00 12.94 ? 46  ARG B O     1 
ATOM   2211 C CB    . ARG B  1 64  ? -16.564 49.096 9.525   1.00 13.31 ? 46  ARG B CB    1 
ATOM   2212 C CG    . ARG B  1 64  ? -16.635 50.443 10.167  1.00 13.96 ? 46  ARG B CG    1 
ATOM   2213 C CD    . ARG B  1 64  ? -16.613 51.521 9.135   1.00 14.70 ? 46  ARG B CD    1 
ATOM   2214 N NE    . ARG B  1 64  ? -15.332 51.529 8.433   1.00 14.82 ? 46  ARG B NE    1 
ATOM   2215 C CZ    . ARG B  1 64  ? -15.128 51.108 7.202   1.00 15.28 ? 46  ARG B CZ    1 
ATOM   2216 N NH1   . ARG B  1 64  ? -16.137 50.709 6.417   1.00 15.84 ? 46  ARG B NH1   1 
ATOM   2217 N NH2   . ARG B  1 64  ? -13.901 51.213 6.671   1.00 15.22 ? 46  ARG B NH2   1 
ATOM   2218 N N     . LYS B  1 65  ? -19.121 47.306 10.320  1.00 13.76 ? 47  LYS B N     1 
ATOM   2219 C CA    . LYS B  1 65  ? -20.493 47.244 10.751  1.00 15.14 ? 47  LYS B CA    1 
ATOM   2220 C C     . LYS B  1 65  ? -20.606 46.409 12.032  1.00 14.76 ? 47  LYS B C     1 
ATOM   2221 O O     . LYS B  1 65  ? -21.318 46.732 12.943  1.00 14.87 ? 47  LYS B O     1 
ATOM   2222 C CB    . LYS B  1 65  ? -21.389 46.649 9.689   1.00 16.69 ? 47  LYS B CB    1 
ATOM   2223 C CG    . LYS B  1 65  ? -21.539 47.598 8.514   1.00 18.14 ? 47  LYS B CG    1 
ATOM   2224 C CD    . LYS B  1 65  ? -22.366 47.006 7.406   1.00 20.58 ? 47  LYS B CD    1 
ATOM   2225 C CE    . LYS B  1 65  ? -22.113 47.876 6.169   1.00 22.13 ? 47  LYS B CE    1 
ATOM   2226 N NZ    . LYS B  1 65  ? -22.725 47.392 4.934   1.00 24.66 ? 47  LYS B NZ    1 
ATOM   2227 N N     . PHE B  1 66  ? -19.872 45.295 12.049  1.00 14.27 ? 48  PHE B N     1 
ATOM   2228 C CA    . PHE B  1 66  ? -19.819 44.418 13.217  1.00 14.46 ? 48  PHE B CA    1 
ATOM   2229 C C     . PHE B  1 66  ? -19.352 45.135 14.453  1.00 14.11 ? 48  PHE B C     1 
ATOM   2230 O O     . PHE B  1 66  ? -19.940 45.005 15.509  1.00 14.75 ? 48  PHE B O     1 
ATOM   2231 C CB    . PHE B  1 66  ? -18.943 43.193 12.884  1.00 14.34 ? 48  PHE B CB    1 
ATOM   2232 C CG    . PHE B  1 66  ? -18.913 42.099 13.992  1.00 14.62 ? 48  PHE B CG    1 
ATOM   2233 C CD1   . PHE B  1 66  ? -19.998 41.256 14.152  1.00 15.85 ? 48  PHE B CD1   1 
ATOM   2234 C CD2   . PHE B  1 66  ? -17.807 41.933 14.781  1.00 14.12 ? 48  PHE B CD2   1 
ATOM   2235 C CE1   . PHE B  1 66  ? -19.962 40.257 15.104  1.00 16.42 ? 48  PHE B CE1   1 
ATOM   2236 C CE2   . PHE B  1 66  ? -17.765 40.939 15.756  1.00 14.72 ? 48  PHE B CE2   1 
ATOM   2237 C CZ    . PHE B  1 66  ? -18.814 40.080 15.865  1.00 15.81 ? 48  PHE B CZ    1 
ATOM   2238 N N     . LEU B  1 67  ? -18.309 45.923 14.305  1.00 13.22 ? 49  LEU B N     1 
ATOM   2239 C CA    . LEU B  1 67  ? -17.686 46.581 15.427  1.00 13.02 ? 49  LEU B CA    1 
ATOM   2240 C C     . LEU B  1 67  ? -18.482 47.816 15.876  1.00 13.37 ? 49  LEU B C     1 
ATOM   2241 O O     . LEU B  1 67  ? -18.584 48.053 17.076  1.00 13.28 ? 49  LEU B O     1 
ATOM   2242 C CB    . LEU B  1 67  ? -16.263 47.016 15.041  1.00 12.69 ? 49  LEU B CB    1 
ATOM   2243 C CG    . LEU B  1 67  ? -15.459 47.780 16.097  1.00 12.81 ? 49  LEU B CG    1 
ATOM   2244 C CD1   . LEU B  1 67  ? -15.326 46.951 17.378  1.00 13.48 ? 49  LEU B CD1   1 
ATOM   2245 C CD2   . LEU B  1 67  ? -14.131 48.152 15.450  1.00 12.71 ? 49  LEU B CD2   1 
ATOM   2246 N N     . GLN B  1 68  ? -19.012 48.581 14.926  1.00 13.47 ? 50  GLN B N     1 
ATOM   2247 C CA    . GLN B  1 68  ? -19.739 49.828 15.296  1.00 13.84 ? 50  GLN B CA    1 
ATOM   2248 C C     . GLN B  1 68  ? -20.882 49.606 16.244  1.00 14.23 ? 50  GLN B C     1 
ATOM   2249 O O     . GLN B  1 68  ? -21.176 50.454 17.094  1.00 14.14 ? 50  GLN B O     1 
ATOM   2250 C CB    . GLN B  1 68  ? -20.214 50.552 14.023  1.00 14.32 ? 50  GLN B CB    1 
ATOM   2251 C CG    . GLN B  1 68  ? -19.134 51.256 13.203  1.00 13.99 ? 50  GLN B CG    1 
ATOM   2252 C CD    . GLN B  1 68  ? -18.729 52.611 13.804  1.00 14.37 ? 50  GLN B CD    1 
ATOM   2253 O OE1   . GLN B  1 68  ? -18.447 52.728 14.983  1.00 14.15 ? 50  GLN B OE1   1 
ATOM   2254 N NE2   . GLN B  1 68  ? -18.639 53.605 12.943  1.00 14.92 ? 50  GLN B NE2   1 
ATOM   2255 N N     . ARG B  1 69  ? -21.519 48.429 16.189  1.00 14.52 ? 51  ARG B N     1 
ATOM   2256 C CA    A ARG B  1 69  ? -22.608 48.156 17.112  0.50 15.42 ? 51  ARG B CA    1 
ATOM   2257 C CA    B ARG B  1 69  ? -22.541 48.043 17.151  0.50 15.38 ? 51  ARG B CA    1 
ATOM   2258 C C     . ARG B  1 69  ? -22.110 48.224 18.601  1.00 15.27 ? 51  ARG B C     1 
ATOM   2259 O O     . ARG B  1 69  ? -22.831 48.686 19.461  1.00 15.46 ? 51  ARG B O     1 
ATOM   2260 C CB    A ARG B  1 69  ? -23.411 46.846 16.705  0.50 16.39 ? 51  ARG B CB    1 
ATOM   2261 C CB    B ARG B  1 69  ? -22.895 46.550 16.944  0.50 16.02 ? 51  ARG B CB    1 
ATOM   2262 C CG    A ARG B  1 69  ? -24.269 46.989 15.411  0.50 17.09 ? 51  ARG B CG    1 
ATOM   2263 C CG    B ARG B  1 69  ? -23.762 45.962 18.038  0.50 17.13 ? 51  ARG B CG    1 
ATOM   2264 C CD    A ARG B  1 69  ? -25.525 46.093 15.342  0.50 18.62 ? 51  ARG B CD    1 
ATOM   2265 C CD    B ARG B  1 69  ? -22.948 45.084 18.968  0.50 17.18 ? 51  ARG B CD    1 
ATOM   2266 N NE    A ARG B  1 69  ? -26.485 46.264 16.484  0.50 19.41 ? 51  ARG B NE    1 
ATOM   2267 N NE    B ARG B  1 69  ? -23.862 44.259 19.752  0.50 18.47 ? 51  ARG B NE    1 
ATOM   2268 C CZ    A ARG B  1 69  ? -27.096 45.213 17.074  0.50 20.71 ? 51  ARG B CZ    1 
ATOM   2269 C CZ    B ARG B  1 69  ? -24.312 43.091 19.332  0.50 19.29 ? 51  ARG B CZ    1 
ATOM   2270 N NH1   A ARG B  1 69  ? -26.922 44.007 16.601  0.50 21.12 ? 51  ARG B NH1   1 
ATOM   2271 N NH1   B ARG B  1 69  ? -23.914 42.618 18.181  0.50 19.03 ? 51  ARG B NH1   1 
ATOM   2272 N NH2   A ARG B  1 69  ? -27.859 45.331 18.130  0.50 21.50 ? 51  ARG B NH2   1 
ATOM   2273 N NH2   B ARG B  1 69  ? -25.154 42.402 20.061  0.50 20.44 ? 51  ARG B NH2   1 
ATOM   2274 N N     . PHE B  1 70  ? -20.911 47.750 18.882  1.00 14.38 ? 52  PHE B N     1 
ATOM   2275 C CA    . PHE B  1 70  ? -20.347 47.793 20.229  1.00 14.32 ? 52  PHE B CA    1 
ATOM   2276 C C     . PHE B  1 70  ? -19.852 49.173 20.621  1.00 13.97 ? 52  PHE B C     1 
ATOM   2277 O O     . PHE B  1 70  ? -19.925 49.529 21.780  1.00 14.26 ? 52  PHE B O     1 
ATOM   2278 C CB    . PHE B  1 70  ? -19.185 46.812 20.345  1.00 14.10 ? 52  PHE B CB    1 
ATOM   2279 C CG    . PHE B  1 70  ? -19.624 45.402 20.235  1.00 14.63 ? 52  PHE B CG    1 
ATOM   2280 C CD1   . PHE B  1 70  ? -20.151 44.730 21.331  1.00 15.79 ? 52  PHE B CD1   1 
ATOM   2281 C CD2   . PHE B  1 70  ? -19.578 44.750 19.010  1.00 14.66 ? 52  PHE B CD2   1 
ATOM   2282 C CE1   . PHE B  1 70  ? -20.578 43.410 21.229  1.00 16.35 ? 52  PHE B CE1   1 
ATOM   2283 C CE2   . PHE B  1 70  ? -20.025 43.418 18.927  1.00 15.17 ? 52  PHE B CE2   1 
ATOM   2284 C CZ    . PHE B  1 70  ? -20.561 42.787 20.002  1.00 16.14 ? 52  PHE B CZ    1 
ATOM   2285 N N     . LEU B  1 71  ? -19.400 49.926 19.630  1.00 13.50 ? 53  LEU B N     1 
ATOM   2286 C CA    . LEU B  1 71  ? -18.832 51.267 19.923  1.00 13.55 ? 53  LEU B CA    1 
ATOM   2287 C C     . LEU B  1 71  ? -19.907 52.333 20.114  1.00 14.11 ? 53  LEU B C     1 
ATOM   2288 O O     . LEU B  1 71  ? -19.620 53.422 20.693  1.00 14.28 ? 53  LEU B O     1 
ATOM   2289 C CB    . LEU B  1 71  ? -17.880 51.732 18.799  1.00 13.33 ? 53  LEU B CB    1 
ATOM   2290 C CG    . LEU B  1 71  ? -16.698 50.815 18.422  1.00 12.83 ? 53  LEU B CG    1 
ATOM   2291 C CD1   . LEU B  1 71  ? -15.913 51.537 17.342  1.00 12.71 ? 53  LEU B CD1   1 
ATOM   2292 C CD2   . LEU B  1 71  ? -15.890 50.543 19.696  1.00 13.26 ? 53  LEU B CD2   1 
ATOM   2293 N N     . ARG B  1 72  ? -21.153 52.085 19.642  1.00 14.26 ? 54  ARG B N     1 
ATOM   2294 C CA    . ARG B  1 72  ? -22.227 53.122 19.711  1.00 14.70 ? 54  ARG B CA    1 
ATOM   2295 C C     . ARG B  1 72  ? -23.452 52.761 20.585  1.00 15.60 ? 54  ARG B C     1 
ATOM   2296 O O     . ARG B  1 72  ? -24.278 53.621 20.878  1.00 15.67 ? 54  ARG B O     1 
ATOM   2297 C CB    . ARG B  1 72  ? -22.734 53.511 18.306  1.00 14.77 ? 54  ARG B CB    1 
ATOM   2298 C CG    . ARG B  1 72  ? -21.627 53.696 17.320  1.00 14.04 ? 54  ARG B CG    1 
ATOM   2299 C CD    . ARG B  1 72  ? -20.624 54.764 17.701  1.00 13.91 ? 54  ARG B CD    1 
ATOM   2300 N NE    . ARG B  1 72  ? -19.380 54.614 16.942  1.00 13.12 ? 54  ARG B NE    1 
ATOM   2301 C CZ    . ARG B  1 72  ? -18.242 55.225 17.226  1.00 13.02 ? 54  ARG B CZ    1 
ATOM   2302 N NH1   . ARG B  1 72  ? -17.209 54.966 16.463  1.00 12.74 ? 54  ARG B NH1   1 
ATOM   2303 N NH2   . ARG B  1 72  ? -18.152 56.099 18.267  1.00 13.54 ? 54  ARG B NH2   1 
ATOM   2304 N N     . GLU B  1 73  ? -23.556 51.480 20.990  1.00 15.85 ? 55  GLU B N     1 
ATOM   2305 C CA    . GLU B  1 73  ? -24.706 51.013 21.733  1.00 17.20 ? 55  GLU B CA    1 
ATOM   2306 C C     . GLU B  1 73  ? -24.372 50.741 23.200  1.00 18.05 ? 55  GLU B C     1 
ATOM   2307 O O     . GLU B  1 73  ? -23.441 49.990 23.515  1.00 18.04 ? 55  GLU B O     1 
ATOM   2308 C CB    . GLU B  1 73  ? -25.279 49.757 21.087  1.00 17.44 ? 55  GLU B CB    1 
ATOM   2309 C CG    . GLU B  1 73  ? -25.738 49.957 19.656  1.00 17.37 ? 55  GLU B CG    1 
ATOM   2310 C CD    . GLU B  1 73  ? -26.195 48.687 18.976  1.00 18.01 ? 55  GLU B CD    1 
ATOM   2311 O OE1   . GLU B  1 73  ? -26.301 47.631 19.673  1.00 17.96 ? 55  GLU B OE1   1 
ATOM   2312 O OE2   . GLU B  1 73  ? -26.407 48.729 17.713  1.00 17.72 ? 55  GLU B OE2   1 
ATOM   2313 N N     . GLY B  1 74  ? -25.091 51.375 24.074  1.00 19.38 ? 56  GLY B N     1 
ATOM   2314 C CA    . GLY B  1 74  ? -25.021 51.099 25.496  1.00 20.72 ? 56  GLY B CA    1 
ATOM   2315 C C     . GLY B  1 74  ? -26.134 50.130 25.852  1.00 22.41 ? 56  GLY B C     1 
ATOM   2316 O O     . GLY B  1 74  ? -26.835 49.660 24.974  1.00 22.98 ? 56  GLY B O     1 
ATOM   2317 N N     A PRO B  1 75  ? -26.314 49.839 27.134  0.60 23.73 ? 57  PRO B N     1 
ATOM   2318 N N     B PRO B  1 75  ? -26.338 49.886 27.137  0.40 23.57 ? 57  PRO B N     1 
ATOM   2319 C CA    A PRO B  1 75  ? -25.403 50.270 28.190  0.60 24.21 ? 57  PRO B CA    1 
ATOM   2320 C CA    B PRO B  1 75  ? -25.823 50.661 28.272  0.40 24.12 ? 57  PRO B CA    1 
ATOM   2321 C C     A PRO B  1 75  ? -24.070 49.564 28.039  0.60 23.90 ? 57  PRO B C     1 
ATOM   2322 C C     B PRO B  1 75  ? -24.360 50.429 28.610  0.40 23.92 ? 57  PRO B C     1 
ATOM   2323 O O     A PRO B  1 75  ? -23.956 48.600 27.281  0.60 23.48 ? 57  PRO B O     1 
ATOM   2324 O O     B PRO B  1 75  ? -23.819 51.123 29.463  0.40 24.40 ? 57  PRO B O     1 
ATOM   2325 C CB    A PRO B  1 75  ? -26.089 49.786 29.477  0.60 25.65 ? 57  PRO B CB    1 
ATOM   2326 C CB    B PRO B  1 75  ? -26.703 50.174 29.432  0.40 25.59 ? 57  PRO B CB    1 
ATOM   2327 C CG    A PRO B  1 75  ? -27.529 49.710 29.133  0.60 26.25 ? 57  PRO B CG    1 
ATOM   2328 C CG    B PRO B  1 75  ? -27.032 48.759 29.056  0.40 25.71 ? 57  PRO B CG    1 
ATOM   2329 C CD    A PRO B  1 75  ? -27.609 49.357 27.678  0.60 25.17 ? 57  PRO B CD    1 
ATOM   2330 C CD    B PRO B  1 75  ? -27.272 48.829 27.575  0.40 24.80 ? 57  PRO B CD    1 
ATOM   2331 N N     A ASN B  1 76  ? -23.073 50.028 28.783  0.60 24.55 ? 58  ASN B N     1 
ATOM   2332 N N     B ASN B  1 76  ? -23.720 49.456 27.964  0.40 23.47 ? 58  ASN B N     1 
ATOM   2333 C CA    A ASN B  1 76  ? -21.754 49.424 28.732  0.60 24.29 ? 58  ASN B CA    1 
ATOM   2334 C CA    B ASN B  1 76  ? -22.361 49.091 28.347  0.40 23.41 ? 58  ASN B CA    1 
ATOM   2335 C C     A ASN B  1 76  ? -21.215 49.430 27.290  0.60 22.28 ? 58  ASN B C     1 
ATOM   2336 C C     B ASN B  1 76  ? -21.363 49.353 27.189  0.40 21.85 ? 58  ASN B C     1 
ATOM   2337 O O     A ASN B  1 76  ? -20.751 48.425 26.750  0.60 22.11 ? 58  ASN B O     1 
ATOM   2338 O O     B ASN B  1 76  ? -20.633 48.446 26.779  0.40 21.56 ? 58  ASN B O     1 
ATOM   2339 C CB    A ASN B  1 76  ? -21.765 47.998 29.285  0.60 25.57 ? 58  ASN B CB    1 
ATOM   2340 C CB    B ASN B  1 76  ? -22.293 47.604 28.791  0.40 24.28 ? 58  ASN B CB    1 
ATOM   2341 C CG    A ASN B  1 76  ? -22.479 47.883 30.615  0.60 27.42 ? 58  ASN B CG    1 
ATOM   2342 C CG    B ASN B  1 76  ? -23.359 47.208 29.838  0.40 26.05 ? 58  ASN B CG    1 
ATOM   2343 O OD1   A ASN B  1 76  ? -22.578 48.845 31.412  0.60 28.82 ? 58  ASN B OD1   1 
ATOM   2344 O OD1   B ASN B  1 76  ? -24.028 46.186 29.673  0.40 26.88 ? 58  ASN B OD1   1 
ATOM   2345 N ND2   A ASN B  1 76  ? -23.056 46.714 30.838  0.60 28.44 ? 58  ASN B ND2   1 
ATOM   2346 N ND2   B ASN B  1 76  ? -23.507 47.988 30.926  0.40 26.99 ? 58  ASN B ND2   1 
ATOM   2347 N N     . LYS B  1 77  ? -21.332 50.586 26.664  1.00 21.33 ? 59  LYS B N     1 
ATOM   2348 C CA    . LYS B  1 77  ? -20.734 50.840 25.362  1.00 20.14 ? 59  LYS B CA    1 
ATOM   2349 C C     . LYS B  1 77  ? -19.222 50.692 25.407  1.00 18.68 ? 59  LYS B C     1 
ATOM   2350 O O     . LYS B  1 77  ? -18.578 51.097 26.352  1.00 18.84 ? 59  LYS B O     1 
ATOM   2351 C CB    . LYS B  1 77  ? -21.070 52.287 25.017  1.00 21.30 ? 59  LYS B CB    1 
ATOM   2352 C CG    . LYS B  1 77  ? -20.629 52.763 23.726  1.00 21.76 ? 59  LYS B CG    1 
ATOM   2353 C CD    . LYS B  1 77  ? -21.109 54.183 23.360  1.00 22.76 ? 59  LYS B CD    1 
ATOM   2354 C CE    . LYS B  1 77  ? -20.699 55.242 24.325  1.00 25.20 ? 59  LYS B CE    1 
ATOM   2355 N NZ    . LYS B  1 77  ? -19.279 55.651 24.172  1.00 26.27 ? 59  LYS B NZ    1 
ATOM   2356 N N     . THR B  1 78  ? -18.654 50.101 24.387  1.00 17.04 ? 60  THR B N     1 
ATOM   2357 C CA    . THR B  1 78  ? -17.204 50.031 24.237  1.00 16.48 ? 60  THR B CA    1 
ATOM   2358 C C     . THR B  1 78  ? -16.574 51.367 23.867  1.00 16.17 ? 60  THR B C     1 
ATOM   2359 O O     . THR B  1 78  ? -17.130 52.078 23.032  1.00 15.81 ? 60  THR B O     1 
ATOM   2360 C CB    . THR B  1 78  ? -16.859 48.973 23.162  1.00 15.53 ? 60  THR B CB    1 
ATOM   2361 O OG1   . THR B  1 78  ? -17.403 47.730 23.635  1.00 15.99 ? 60  THR B OG1   1 
ATOM   2362 C CG2   . THR B  1 78  ? -15.356 48.838 22.919  1.00 15.04 ? 60  THR B CG2   1 
ATOM   2363 N N     . GLY B  1 79  ? -15.437 51.691 24.500  1.00 16.18 ? 61  GLY B N     1 
ATOM   2364 C CA    . GLY B  1 79  ? -14.691 52.920 24.243  1.00 16.48 ? 61  GLY B CA    1 
ATOM   2365 C C     . GLY B  1 79  ? -13.910 52.943 22.950  1.00 15.61 ? 61  GLY B C     1 
ATOM   2366 O O     . GLY B  1 79  ? -13.848 51.951 22.217  1.00 14.46 ? 61  GLY B O     1 
ATOM   2367 N N     . THR B  1 80  ? -13.349 54.134 22.675  1.00 15.86 ? 62  THR B N     1 
ATOM   2368 C CA    . THR B  1 80  ? -12.644 54.368 21.440  1.00 15.71 ? 62  THR B CA    1 
ATOM   2369 C C     . THR B  1 80  ? -11.257 55.003 21.651  1.00 16.40 ? 62  THR B C     1 
ATOM   2370 O O     . THR B  1 80  ? -10.778 55.678 20.746  1.00 16.80 ? 62  THR B O     1 
ATOM   2371 C CB    . THR B  1 80  ? -13.491 55.257 20.493  1.00 15.95 ? 62  THR B CB    1 
ATOM   2372 O OG1   . THR B  1 80  ? -13.902 56.449 21.177  1.00 16.96 ? 62  THR B OG1   1 
ATOM   2373 C CG2   . THR B  1 80  ? -14.739 54.490 20.055  1.00 15.51 ? 62  THR B CG2   1 
ATOM   2374 N N     A SER B  1 81  ? -10.645 54.792 22.824  0.60 17.09 ? 63  SER B N     1 
ATOM   2375 N N     B SER B  1 81  ? -10.619 54.785 22.794  0.40 17.08 ? 63  SER B N     1 
ATOM   2376 C CA    A SER B  1 81  ? -9.326  55.393 23.133  0.60 18.10 ? 63  SER B CA    1 
ATOM   2377 C CA    B SER B  1 81  ? -9.321  55.423 23.048  0.40 18.00 ? 63  SER B CA    1 
ATOM   2378 C C     A SER B  1 81  ? -8.200  54.642 22.404  0.60 17.62 ? 63  SER B C     1 
ATOM   2379 C C     B SER B  1 81  ? -8.144  54.638 22.472  0.40 17.63 ? 63  SER B C     1 
ATOM   2380 O O     A SER B  1 81  ? -7.306  55.259 21.862  0.60 18.25 ? 63  SER B O     1 
ATOM   2381 O O     B SER B  1 81  ? -7.121  55.229 22.143  0.40 18.31 ? 63  SER B O     1 
ATOM   2382 C CB    A SER B  1 81  ? -9.035  55.486 24.641  0.60 19.31 ? 63  SER B CB    1 
ATOM   2383 C CB    B SER B  1 81  ? -9.123  55.646 24.526  0.40 19.16 ? 63  SER B CB    1 
ATOM   2384 O OG    A SER B  1 81  ? -8.790  54.236 25.286  0.60 19.37 ? 63  SER B OG    1 
ATOM   2385 O OG    B SER B  1 81  ? -10.128 56.517 24.994  0.40 19.72 ? 63  SER B OG    1 
ATOM   2386 N N     . CYS B  1 82  ? -8.256  53.315 22.383  1.00 16.92 ? 64  CYS B N     1 
ATOM   2387 C CA    . CYS B  1 82  ? -7.108  52.501 21.999  1.00 16.89 ? 64  CYS B CA    1 
ATOM   2388 C C     . CYS B  1 82  ? -7.487  51.109 21.555  1.00 15.32 ? 64  CYS B C     1 
ATOM   2389 O O     . CYS B  1 82  ? -8.282  50.440 22.231  1.00 15.37 ? 64  CYS B O     1 
ATOM   2390 C CB    . CYS B  1 82  ? -6.095  52.399 23.171  1.00 18.71 ? 64  CYS B CB    1 
ATOM   2391 S SG    . CYS B  1 82  ? -4.445  51.915 22.617  1.00 21.35 ? 64  CYS B SG    1 
ATOM   2392 N N     . ALA B  1 83  ? -6.898  50.654 20.441  1.00 14.27 ? 65  ALA B N     1 
ATOM   2393 C CA    . ALA B  1 83  ? -7.134  49.314 19.924  1.00 13.70 ? 65  ALA B CA    1 
ATOM   2394 C C     . ALA B  1 83  ? -5.783  48.641 19.691  1.00 14.10 ? 65  ALA B C     1 
ATOM   2395 O O     . ALA B  1 83  ? -4.790  49.343 19.515  1.00 14.55 ? 65  ALA B O     1 
ATOM   2396 C CB    . ALA B  1 83  ? -7.957  49.311 18.639  1.00 13.07 ? 65  ALA B CB    1 
ATOM   2397 N N     . LEU B  1 84  ? -5.774  47.328 19.776  1.00 13.73 ? 66  LEU B N     1 
ATOM   2398 C CA    . LEU B  1 84  ? -4.599  46.516 19.478  1.00 13.87 ? 66  LEU B CA    1 
ATOM   2399 C C     . LEU B  1 84  ? -4.921  45.657 18.259  1.00 13.09 ? 66  LEU B C     1 
ATOM   2400 O O     . LEU B  1 84  ? -5.936  44.954 18.264  1.00 13.30 ? 66  LEU B O     1 
ATOM   2401 C CB    . LEU B  1 84  ? -4.252  45.607 20.659  1.00 14.70 ? 66  LEU B CB    1 
ATOM   2402 C CG    . LEU B  1 84  ? -3.071  44.644 20.433  1.00 15.09 ? 66  LEU B CG    1 
ATOM   2403 C CD1   . LEU B  1 84  ? -1.715  45.332 20.238  1.00 15.56 ? 66  LEU B CD1   1 
ATOM   2404 C CD2   . LEU B  1 84  ? -2.972  43.624 21.564  1.00 16.13 ? 66  LEU B CD2   1 
ATOM   2405 N N     . ASP B  1 85  ? -4.075  45.703 17.246  1.00 12.47 ? 67  ASP B N     1 
ATOM   2406 C CA    . ASP B  1 85  ? -4.294  44.940 16.003  1.00 12.00 ? 67  ASP B CA    1 
ATOM   2407 C C     . ASP B  1 85  ? -3.265  43.787 16.064  1.00 12.27 ? 67  ASP B C     1 
ATOM   2408 O O     . ASP B  1 85  ? -2.062  44.045 16.014  1.00 12.37 ? 67  ASP B O     1 
ATOM   2409 C CB    . ASP B  1 85  ? -4.046  45.830 14.788  1.00 11.90 ? 67  ASP B CB    1 
ATOM   2410 C CG    . ASP B  1 85  ? -4.419  45.184 13.471  1.00 12.09 ? 67  ASP B CG    1 
ATOM   2411 O OD1   . ASP B  1 85  ? -4.716  43.966 13.485  1.00 12.29 ? 67  ASP B OD1   1 
ATOM   2412 O OD2   . ASP B  1 85  ? -4.327  45.919 12.431  1.00 11.83 ? 67  ASP B OD2   1 
ATOM   2413 N N     . CYS B  1 86  ? -3.770  42.551 16.213  1.00 12.23 ? 68  CYS B N     1 
ATOM   2414 C CA    . CYS B  1 86  ? -2.892  41.354 16.432  1.00 12.65 ? 68  CYS B CA    1 
ATOM   2415 C C     . CYS B  1 86  ? -2.689  40.598 15.119  1.00 12.47 ? 68  CYS B C     1 
ATOM   2416 O O     . CYS B  1 86  ? -3.659  40.308 14.359  1.00 12.16 ? 68  CYS B O     1 
ATOM   2417 C CB    . CYS B  1 86  ? -3.529  40.381 17.435  1.00 13.36 ? 68  CYS B CB    1 
ATOM   2418 S SG    . CYS B  1 86  ? -3.791  41.135 19.039  1.00 14.11 ? 68  CYS B SG    1 
ATOM   2419 N N     . GLY B  1 87  ? -1.430  40.230 14.852  1.00 12.52 ? 69  GLY B N     1 
ATOM   2420 C CA    . GLY B  1 87  ? -1.144  39.738 13.521  1.00 12.16 ? 69  GLY B CA    1 
ATOM   2421 C C     . GLY B  1 87  ? -1.400  40.784 12.456  1.00 11.45 ? 69  GLY B C     1 
ATOM   2422 O O     . GLY B  1 87  ? -1.846  40.475 11.393  1.00 11.39 ? 69  GLY B O     1 
ATOM   2423 N N     . ALA B  1 88  ? -1.027  42.007 12.757  1.00 11.42 ? 70  ALA B N     1 
ATOM   2424 C CA    . ALA B  1 88  ? -1.473  43.229 11.997  1.00 11.35 ? 70  ALA B CA    1 
ATOM   2425 C C     . ALA B  1 88  ? -0.865  43.281 10.618  1.00 11.43 ? 70  ALA B C     1 
ATOM   2426 O O     . ALA B  1 88  ? -1.417  43.942 9.727   1.00 11.36 ? 70  ALA B O     1 
ATOM   2427 C CB    . ALA B  1 88  ? -1.074  44.463 12.742  1.00 11.68 ? 70  ALA B CB    1 
ATOM   2428 N N     . GLY B  1 89  ? 0.249   42.599 10.411  1.00 11.69 ? 71  GLY B N     1 
ATOM   2429 C CA    . GLY B  1 89  ? 0.881   42.671 9.114   1.00 12.01 ? 71  GLY B CA    1 
ATOM   2430 C C     . GLY B  1 89  ? 1.317   44.094 8.818   1.00 12.15 ? 71  GLY B C     1 
ATOM   2431 O O     . GLY B  1 89  ? 1.768   44.839 9.722   1.00 12.43 ? 71  GLY B O     1 
ATOM   2432 N N     . ILE B  1 90  ? 1.094   44.534 7.587   1.00 12.16 ? 72  ILE B N     1 
ATOM   2433 C CA    . ILE B  1 90  ? 1.443   45.917 7.175   1.00 12.91 ? 72  ILE B CA    1 
ATOM   2434 C C     . ILE B  1 90  ? 0.415   46.943 7.627   1.00 13.12 ? 72  ILE B C     1 
ATOM   2435 O O     . ILE B  1 90  ? 0.568   48.133 7.357   1.00 13.68 ? 72  ILE B O     1 
ATOM   2436 C CB    . ILE B  1 90  ? 1.604   46.051 5.643   1.00 13.27 ? 72  ILE B CB    1 
ATOM   2437 C CG1   . ILE B  1 90  ? 0.276   45.810 4.936   1.00 13.13 ? 72  ILE B CG1   1 
ATOM   2438 C CG2   . ILE B  1 90  ? 2.731   45.158 5.181   1.00 13.70 ? 72  ILE B CG2   1 
ATOM   2439 C CD1   . ILE B  1 90  ? 0.297   46.124 3.437   1.00 13.93 ? 72  ILE B CD1   1 
ATOM   2440 N N     . GLY B  1 91  ? -0.646  46.493 8.273   1.00 12.41 ? 73  GLY B N     1 
ATOM   2441 C CA    . GLY B  1 91  ? -1.706  47.401 8.719   1.00 12.39 ? 73  GLY B CA    1 
ATOM   2442 C C     . GLY B  1 91  ? -2.874  47.627 7.808   1.00 12.06 ? 73  GLY B C     1 
ATOM   2443 O O     . GLY B  1 91  ? -3.508  48.732 7.833   1.00 12.04 ? 73  GLY B O     1 
ATOM   2444 N N     . ARG B  1 92  ? -3.257  46.595 7.053   1.00 11.44 ? 74  ARG B N     1 
ATOM   2445 C CA    . ARG B  1 92  ? -4.442  46.695 6.217   1.00 11.49 ? 74  ARG B CA    1 
ATOM   2446 C C     . ARG B  1 92  ? -5.676  47.091 7.083   1.00 11.57 ? 74  ARG B C     1 
ATOM   2447 O O     . ARG B  1 92  ? -6.442  48.005 6.695   1.00 12.72 ? 74  ARG B O     1 
ATOM   2448 C CB    . ARG B  1 92  ? -4.698  45.360 5.527   1.00 11.42 ? 74  ARG B CB    1 
ATOM   2449 C CG    . ARG B  1 92  ? -5.898  45.284 4.563   1.00 11.69 ? 74  ARG B CG    1 
ATOM   2450 C CD    . ARG B  1 92  ? -6.048  43.866 4.118   1.00 11.78 ? 74  ARG B CD    1 
ATOM   2451 N NE    . ARG B  1 92  ? -6.498  42.988 5.169   1.00 11.46 ? 74  ARG B NE    1 
ATOM   2452 C CZ    . ARG B  1 92  ? -7.761  42.768 5.487   1.00 11.56 ? 74  ARG B CZ    1 
ATOM   2453 N NH1   . ARG B  1 92  ? -8.761  43.362 4.849   1.00 11.88 ? 74  ARG B NH1   1 
ATOM   2454 N NH2   . ARG B  1 92  ? -8.040  41.961 6.463   1.00 11.62 ? 74  ARG B NH2   1 
ATOM   2455 N N     . ILE B  1 93  ? -5.850  46.412 8.204   1.00 11.18 ? 75  ILE B N     1 
ATOM   2456 C CA    . ILE B  1 93  ? -6.973  46.648 9.098   1.00 11.30 ? 75  ILE B CA    1 
ATOM   2457 C C     . ILE B  1 93  ? -6.740  47.905 9.911   1.00 11.63 ? 75  ILE B C     1 
ATOM   2458 O O     . ILE B  1 93  ? -7.711  48.682 10.181  1.00 11.90 ? 75  ILE B O     1 
ATOM   2459 C CB    . ILE B  1 93  ? -7.221  45.432 10.016  1.00 11.25 ? 75  ILE B CB    1 
ATOM   2460 C CG1   . ILE B  1 93  ? -7.466  44.186 9.141   1.00 11.62 ? 75  ILE B CG1   1 
ATOM   2461 C CG2   . ILE B  1 93  ? -8.414  45.593 10.941  1.00 11.60 ? 75  ILE B CG2   1 
ATOM   2462 C CD1   . ILE B  1 93  ? -7.391  42.928 9.949   1.00 11.82 ? 75  ILE B CD1   1 
ATOM   2463 N N     . THR B  1 94  ? -5.527  48.096 10.381  1.00 11.75 ? 76  THR B N     1 
ATOM   2464 C CA    . THR B  1 94  ? -5.194  49.323 11.123  1.00 12.88 ? 76  THR B CA    1 
ATOM   2465 C C     . THR B  1 94  ? -5.514  50.546 10.297  1.00 13.22 ? 76  THR B C     1 
ATOM   2466 O O     . THR B  1 94  ? -6.125  51.481 10.820  1.00 13.43 ? 76  THR B O     1 
ATOM   2467 C CB    . THR B  1 94  ? -3.712  49.297 11.614  1.00 13.37 ? 76  THR B CB    1 
ATOM   2468 O OG1   . THR B  1 94  ? -3.613  48.375 12.714  1.00 14.02 ? 76  THR B OG1   1 
ATOM   2469 C CG2   . THR B  1 94  ? -3.256  50.598 12.122  1.00 13.92 ? 76  THR B CG2   1 
ATOM   2470 N N     . LYS B  1 95  ? -5.183  50.537 9.007   1.00 13.57 ? 77  LYS B N     1 
ATOM   2471 C CA    . LYS B  1 95  ? -5.477  51.668 8.159   1.00 15.11 ? 77  LYS B CA    1 
ATOM   2472 C C     . LYS B  1 95  ? -6.941  51.966 7.982   1.00 14.72 ? 77  LYS B C     1 
ATOM   2473 O O     . LYS B  1 95  ? -7.382  53.110 8.160   1.00 14.77 ? 77  LYS B O     1 
ATOM   2474 C CB    . LYS B  1 95  ? -4.882  51.467 6.761   1.00 16.14 ? 77  LYS B CB    1 
ATOM   2475 C CG    . LYS B  1 95  ? -4.943  52.691 5.883   1.00 19.08 ? 77  LYS B CG    1 
ATOM   2476 C CD    . LYS B  1 95  ? -4.163  52.384 4.594   1.00 20.78 ? 77  LYS B CD    1 
ATOM   2477 C CE    . LYS B  1 95  ? -4.047  53.563 3.685   1.00 24.58 ? 77  LYS B CE    1 
ATOM   2478 N NZ    . LYS B  1 95  ? -3.293  54.705 4.295   1.00 25.72 ? 77  LYS B NZ    1 
ATOM   2479 N N     . ARG B  1 96  ? -7.711  50.965 7.538   1.00 14.25 ? 78  ARG B N     1 
ATOM   2480 C CA    . ARG B  1 96  ? -9.066  51.254 7.108   1.00 15.22 ? 78  ARG B CA    1 
ATOM   2481 C C     . ARG B  1 96  ? -10.133 51.028 8.123   1.00 14.23 ? 78  ARG B C     1 
ATOM   2482 O O     . ARG B  1 96  ? -11.199 51.611 7.967   1.00 15.07 ? 78  ARG B O     1 
ATOM   2483 C CB    . ARG B  1 96  ? -9.436  50.471 5.852   1.00 16.99 ? 78  ARG B CB    1 
ATOM   2484 C CG    . ARG B  1 96  ? -8.666  50.855 4.657   1.00 19.56 ? 78  ARG B CG    1 
ATOM   2485 C CD    . ARG B  1 96  ? -9.030  49.873 3.522   1.00 21.44 ? 78  ARG B CD    1 
ATOM   2486 N NE    . ARG B  1 96  ? -10.411 50.059 3.099   1.00 23.36 ? 78  ARG B NE    1 
ATOM   2487 C CZ    . ARG B  1 96  ? -11.001 49.402 2.113   1.00 25.11 ? 78  ARG B CZ    1 
ATOM   2488 N NH1   . ARG B  1 96  ? -10.313 48.490 1.385   1.00 24.89 ? 78  ARG B NH1   1 
ATOM   2489 N NH2   . ARG B  1 96  ? -12.255 49.743 1.770   1.00 26.61 ? 78  ARG B NH2   1 
ATOM   2490 N N     . LEU B  1 97  ? -9.882  50.225 9.149   1.00 12.99 ? 79  LEU B N     1 
ATOM   2491 C CA    . LEU B  1 97  ? -10.832 49.937 10.179  1.00 12.76 ? 79  LEU B CA    1 
ATOM   2492 C C     . LEU B  1 97  ? -10.503 50.705 11.472  1.00 12.65 ? 79  LEU B C     1 
ATOM   2493 O O     . LEU B  1 97  ? -11.340 51.409 12.030  1.00 13.00 ? 79  LEU B O     1 
ATOM   2494 C CB    . LEU B  1 97  ? -10.987 48.447 10.470  1.00 12.56 ? 79  LEU B CB    1 
ATOM   2495 C CG    . LEU B  1 97  ? -11.948 48.035 11.610  1.00 12.61 ? 79  LEU B CG    1 
ATOM   2496 C CD1   . LEU B  1 97  ? -13.420 48.406 11.286  1.00 13.22 ? 79  LEU B CD1   1 
ATOM   2497 C CD2   . LEU B  1 97  ? -11.750 46.559 11.984  1.00 12.67 ? 79  LEU B CD2   1 
ATOM   2498 N N     . LEU B  1 98  ? -9.304  50.532 11.999  1.00 12.14 ? 80  LEU B N     1 
ATOM   2499 C CA    . LEU B  1 98  ? -9.052  50.896 13.380  1.00 12.03 ? 80  LEU B CA    1 
ATOM   2500 C C     . LEU B  1 98  ? -8.611  52.341 13.589  1.00 12.41 ? 80  LEU B C     1 
ATOM   2501 O O     . LEU B  1 98  ? -9.192  53.063 14.428  1.00 12.41 ? 80  LEU B O     1 
ATOM   2502 C CB    . LEU B  1 98  ? -8.008  49.952 13.956  1.00 11.98 ? 80  LEU B CB    1 
ATOM   2503 C CG    . LEU B  1 98  ? -8.405  48.480 14.009  1.00 11.77 ? 80  LEU B CG    1 
ATOM   2504 C CD1   . LEU B  1 98  ? -7.278  47.625 14.490  1.00 12.13 ? 80  LEU B CD1   1 
ATOM   2505 C CD2   . LEU B  1 98  ? -9.602  48.244 14.905  1.00 11.84 ? 80  LEU B CD2   1 
ATOM   2506 N N     . LEU B  1 99  ? -7.641  52.811 12.801  1.00 12.32 ? 81  LEU B N     1 
ATOM   2507 C CA    . LEU B  1 99  ? -7.195  54.227 12.955  1.00 13.21 ? 81  LEU B CA    1 
ATOM   2508 C C     . LEU B  1 99  ? -8.359  55.253 12.862  1.00 13.55 ? 81  LEU B C     1 
ATOM   2509 O O     . LEU B  1 99  ? -8.367  56.265 13.576  1.00 13.93 ? 81  LEU B O     1 
ATOM   2510 C CB    . LEU B  1 99  ? -6.034  54.606 12.005  1.00 13.46 ? 81  LEU B CB    1 
ATOM   2511 C CG    . LEU B  1 99  ? -4.637  54.121 12.498  1.00 13.89 ? 81  LEU B CG    1 
ATOM   2512 C CD1   . LEU B  1 99  ? -3.648  54.230 11.347  1.00 14.10 ? 81  LEU B CD1   1 
ATOM   2513 C CD2   . LEU B  1 99  ? -4.144  54.969 13.652  1.00 15.04 ? 81  LEU B CD2   1 
ATOM   2514 N N     . PRO B  1 100 ? -9.330  55.028 11.952  1.00 13.43 ? 82  PRO B N     1 
ATOM   2515 C CA    . PRO B  1 100 ? -10.383 56.037 11.864  1.00 14.21 ? 82  PRO B CA    1 
ATOM   2516 C C     . PRO B  1 100 ? -11.315 56.034 13.095  1.00 14.38 ? 82  PRO B C     1 
ATOM   2517 O O     . PRO B  1 100 ? -12.031 57.002 13.283  1.00 15.26 ? 82  PRO B O     1 
ATOM   2518 C CB    . PRO B  1 100 ? -11.185 55.592 10.614  1.00 14.22 ? 82  PRO B CB    1 
ATOM   2519 C CG    . PRO B  1 100 ? -10.165 54.833 9.777   1.00 13.83 ? 82  PRO B CG    1 
ATOM   2520 C CD    . PRO B  1 100 ? -9.365  54.105 10.794  1.00 13.15 ? 82  PRO B CD    1 
ATOM   2521 N N     . LEU B  1 101 ? -11.352 54.963 13.861  1.00 13.64 ? 83  LEU B N     1 
ATOM   2522 C CA    . LEU B  1 101 ? -12.265 54.788 14.989  1.00 13.78 ? 83  LEU B CA    1 
ATOM   2523 C C     . LEU B  1 101 ? -11.641 54.936 16.386  1.00 14.15 ? 83  LEU B C     1 
ATOM   2524 O O     . LEU B  1 101 ? -12.376 55.223 17.340  1.00 14.74 ? 83  LEU B O     1 
ATOM   2525 C CB    . LEU B  1 101 ? -12.991 53.425 14.935  1.00 13.25 ? 83  LEU B CB    1 
ATOM   2526 C CG    . LEU B  1 101 ? -13.860 53.175 13.686  1.00 13.29 ? 83  LEU B CG    1 
ATOM   2527 C CD1   . LEU B  1 101 ? -14.189 51.698 13.670  1.00 13.08 ? 83  LEU B CD1   1 
ATOM   2528 C CD2   . LEU B  1 101 ? -15.125 54.025 13.678  1.00 14.05 ? 83  LEU B CD2   1 
ATOM   2529 N N     . PHE B  1 102 ? -10.337 54.740 16.529  1.00 13.70 ? 84  PHE B N     1 
ATOM   2530 C CA    . PHE B  1 102 ? -9.677  54.753 17.836  1.00 14.02 ? 84  PHE B CA    1 
ATOM   2531 C C     . PHE B  1 102 ? -8.613  55.866 17.835  1.00 14.80 ? 84  PHE B C     1 
ATOM   2532 O O     . PHE B  1 102 ? -7.899  56.065 16.829  1.00 14.75 ? 84  PHE B O     1 
ATOM   2533 C CB    . PHE B  1 102 ? -9.062  53.402 18.106  1.00 13.75 ? 84  PHE B CB    1 
ATOM   2534 C CG    . PHE B  1 102 ? -10.091 52.329 18.231  1.00 13.17 ? 84  PHE B CG    1 
ATOM   2535 C CD1   . PHE B  1 102 ? -10.656 52.079 19.423  1.00 13.70 ? 84  PHE B CD1   1 
ATOM   2536 C CD2   . PHE B  1 102 ? -10.514 51.608 17.111  1.00 12.93 ? 84  PHE B CD2   1 
ATOM   2537 C CE1   . PHE B  1 102 ? -11.668 51.138 19.555  1.00 13.64 ? 84  PHE B CE1   1 
ATOM   2538 C CE2   . PHE B  1 102 ? -11.543 50.653 17.235  1.00 12.72 ? 84  PHE B CE2   1 
ATOM   2539 C CZ    . PHE B  1 102 ? -12.124 50.448 18.454  1.00 13.16 ? 84  PHE B CZ    1 
ATOM   2540 N N     . ARG B  1 103 ? -8.489  56.552 18.955  1.00 15.48 ? 85  ARG B N     1 
ATOM   2541 C CA    . ARG B  1 103 ? -7.546  57.675 19.063  1.00 16.52 ? 85  ARG B CA    1 
ATOM   2542 C C     . ARG B  1 103 ? -6.108  57.188 18.835  1.00 16.49 ? 85  ARG B C     1 
ATOM   2543 O O     . ARG B  1 103 ? -5.346  57.860 18.146  1.00 16.52 ? 85  ARG B O     1 
ATOM   2544 C CB    . ARG B  1 103 ? -7.692  58.408 20.412  1.00 17.72 ? 85  ARG B CB    1 
ATOM   2545 C CG    . ARG B  1 103 ? -9.055  59.012 20.489  1.00 18.28 ? 85  ARG B CG    1 
ATOM   2546 N N     . GLU B  1 104 ? -5.774  55.999 19.368  1.00 16.13 ? 86  GLU B N     1 
ATOM   2547 C CA    . GLU B  1 104 ? -4.489  55.373 19.171  1.00 16.47 ? 86  GLU B CA    1 
ATOM   2548 C C     . GLU B  1 104 ? -4.646  53.889 18.900  1.00 15.17 ? 86  GLU B C     1 
ATOM   2549 O O     . GLU B  1 104 ? -5.673  53.297 19.294  1.00 14.45 ? 86  GLU B O     1 
ATOM   2550 C CB    . GLU B  1 104 ? -3.614  55.544 20.402  1.00 17.83 ? 86  GLU B CB    1 
ATOM   2551 C CG    . GLU B  1 104 ? -3.321  56.981 20.739  1.00 19.78 ? 86  GLU B CG    1 
ATOM   2552 C CD    . GLU B  1 104 ? -2.436  57.049 21.974  1.00 21.42 ? 86  GLU B CD    1 
ATOM   2553 O OE1   . GLU B  1 104 ? -2.932  56.898 23.098  1.00 22.31 ? 86  GLU B OE1   1 
ATOM   2554 O OE2   . GLU B  1 104 ? -1.249  57.257 21.828  1.00 22.69 ? 86  GLU B OE2   1 
ATOM   2555 N N     . VAL B  1 105 ? -3.673  53.342 18.162  1.00 14.95 ? 87  VAL B N     1 
ATOM   2556 C CA    . VAL B  1 105 ? -3.600  51.951 17.818  1.00 14.37 ? 87  VAL B CA    1 
ATOM   2557 C C     . VAL B  1 105 ? -2.206  51.405 18.080  1.00 15.02 ? 87  VAL B C     1 
ATOM   2558 O O     . VAL B  1 105 ? -1.236  52.093 17.819  1.00 15.80 ? 87  VAL B O     1 
ATOM   2559 C CB    . VAL B  1 105 ? -4.040  51.685 16.355  1.00 13.69 ? 87  VAL B CB    1 
ATOM   2560 C CG1   . VAL B  1 105 ? -4.001  50.175 15.977  1.00 13.40 ? 87  VAL B CG1   1 
ATOM   2561 C CG2   . VAL B  1 105 ? -5.445  52.240 16.119  1.00 13.52 ? 87  VAL B CG2   1 
ATOM   2562 N N     . ASP B  1 106 ? -2.142  50.187 18.640  1.00 14.81 ? 88  ASP B N     1 
ATOM   2563 C CA    . ASP B  1 106 ? -0.898  49.418 18.750  1.00 15.50 ? 88  ASP B CA    1 
ATOM   2564 C C     . ASP B  1 106 ? -1.003  48.263 17.770  1.00 14.56 ? 88  ASP B C     1 
ATOM   2565 O O     . ASP B  1 106 ? -2.109  47.726 17.559  1.00 14.14 ? 88  ASP B O     1 
ATOM   2566 C CB    . ASP B  1 106 ? -0.683  48.813 20.151  1.00 16.17 ? 88  ASP B CB    1 
ATOM   2567 C CG    . ASP B  1 106 ? -0.315  49.841 21.218  1.00 17.62 ? 88  ASP B CG    1 
ATOM   2568 O OD1   . ASP B  1 106 ? 0.039   50.968 20.853  1.00 18.22 ? 88  ASP B OD1   1 
ATOM   2569 O OD2   . ASP B  1 106 ? -0.310  49.498 22.447  1.00 17.99 ? 88  ASP B OD2   1 
ATOM   2570 N N     . MET B  1 107 ? 0.140   47.904 17.164  1.00 14.75 ? 89  MET B N     1 
ATOM   2571 C CA    . MET B  1 107 ? 0.210   46.774 16.261  1.00 14.25 ? 89  MET B CA    1 
ATOM   2572 C C     . MET B  1 107 ? 1.143   45.755 16.806  1.00 14.79 ? 89  MET B C     1 
ATOM   2573 O O     . MET B  1 107 ? 2.212   46.117 17.277  1.00 15.87 ? 89  MET B O     1 
ATOM   2574 C CB    . MET B  1 107 ? 0.692   47.218 14.854  1.00 14.40 ? 89  MET B CB    1 
ATOM   2575 C CG    . MET B  1 107 ? -0.259  48.194 14.219  1.00 14.44 ? 89  MET B CG    1 
ATOM   2576 S SD    . MET B  1 107 ? 0.424   48.961 12.723  1.00 15.67 ? 89  MET B SD    1 
ATOM   2577 C CE    . MET B  1 107 ? 0.421   47.587 11.564  1.00 14.57 ? 89  MET B CE    1 
ATOM   2578 N N     . VAL B  1 108 ? 0.789   44.483 16.671  1.00 14.24 ? 90  VAL B N     1 
ATOM   2579 C CA    . VAL B  1 108 ? 1.696   43.392 17.015  1.00 14.78 ? 90  VAL B CA    1 
ATOM   2580 C C     . VAL B  1 108 ? 1.760   42.404 15.887  1.00 14.12 ? 90  VAL B C     1 
ATOM   2581 O O     . VAL B  1 108 ? 0.724   41.991 15.352  1.00 13.76 ? 90  VAL B O     1 
ATOM   2582 C CB    . VAL B  1 108 ? 1.444   42.758 18.416  1.00 15.43 ? 90  VAL B CB    1 
ATOM   2583 C CG1   . VAL B  1 108 ? 0.041   42.187 18.565  1.00 15.21 ? 90  VAL B CG1   1 
ATOM   2584 C CG2   . VAL B  1 108 ? 2.476   41.679 18.744  1.00 16.39 ? 90  VAL B CG2   1 
ATOM   2585 N N     . ASP B  1 109 ? 2.974   42.065 15.460  1.00 14.48 ? 91  ASP B N     1 
ATOM   2586 C CA    . ASP B  1 109 ? 3.133   41.073 14.404  1.00 14.09 ? 91  ASP B CA    1 
ATOM   2587 C C     . ASP B  1 109 ? 4.501   40.414 14.535  1.00 15.10 ? 91  ASP B C     1 
ATOM   2588 O O     . ASP B  1 109 ? 5.458   41.033 15.013  1.00 15.68 ? 91  ASP B O     1 
ATOM   2589 C CB    . ASP B  1 109 ? 3.066   41.723 13.004  1.00 13.48 ? 91  ASP B CB    1 
ATOM   2590 C CG    . ASP B  1 109 ? 2.790   40.746 11.922  1.00 13.06 ? 91  ASP B CG    1 
ATOM   2591 O OD1   . ASP B  1 109 ? 1.596   40.501 11.651  1.00 12.64 ? 91  ASP B OD1   1 
ATOM   2592 O OD2   . ASP B  1 109 ? 3.762   40.203 11.365  1.00 13.69 ? 91  ASP B OD2   1 
ATOM   2593 N N     . ILE B  1 110 ? 4.609   39.149 14.115  1.00 15.29 ? 92  ILE B N     1 
ATOM   2594 C CA    . ILE B  1 110 ? 5.888   38.453 14.207  1.00 16.34 ? 92  ILE B CA    1 
ATOM   2595 C C     . ILE B  1 110 ? 6.924   38.898 13.151  1.00 16.62 ? 92  ILE B C     1 
ATOM   2596 O O     . ILE B  1 110 ? 8.135   38.648 13.351  1.00 16.98 ? 92  ILE B O     1 
ATOM   2597 C CB    . ILE B  1 110 ? 5.670   36.924 14.144  1.00 16.98 ? 92  ILE B CB    1 
ATOM   2598 C CG1   . ILE B  1 110 ? 6.824   36.175 14.760  1.00 18.88 ? 92  ILE B CG1   1 
ATOM   2599 C CG2   . ILE B  1 110 ? 5.379   36.465 12.695  1.00 16.45 ? 92  ILE B CG2   1 
ATOM   2600 C CD1   . ILE B  1 110 ? 6.577   34.676 14.892  1.00 19.80 ? 92  ILE B CD1   1 
ATOM   2601 N N     . THR B  1 111 ? 6.458   39.492 12.039  1.00 15.50 ? 93  THR B N     1 
ATOM   2602 C CA    . THR B  1 111 ? 7.294   39.831 10.892  1.00 15.90 ? 93  THR B CA    1 
ATOM   2603 C C     . THR B  1 111 ? 7.784   41.266 10.880  1.00 16.54 ? 93  THR B C     1 
ATOM   2604 O O     . THR B  1 111 ? 7.037   42.160 10.518  1.00 16.01 ? 93  THR B O     1 
ATOM   2605 C CB    . THR B  1 111 ? 6.568   39.447 9.588   1.00 14.76 ? 93  THR B CB    1 
ATOM   2606 O OG1   . THR B  1 111 ? 6.256   38.042 9.660   1.00 14.33 ? 93  THR B OG1   1 
ATOM   2607 C CG2   . THR B  1 111 ? 7.464   39.739 8.354   1.00 15.25 ? 93  THR B CG2   1 
ATOM   2608 N N     . GLU B  1 112 ? 9.051   41.478 11.243  1.00 18.63 ? 94  GLU B N     1 
ATOM   2609 C CA    . GLU B  1 112 ? 9.580   42.832 11.352  1.00 20.37 ? 94  GLU B CA    1 
ATOM   2610 C C     . GLU B  1 112 ? 9.348   43.671 10.082  1.00 19.62 ? 94  GLU B C     1 
ATOM   2611 O O     . GLU B  1 112 ? 8.924   44.826 10.156  1.00 18.71 ? 94  GLU B O     1 
ATOM   2612 C CB    . GLU B  1 112 ? 11.057  42.834 11.732  1.00 23.59 ? 94  GLU B CB    1 
ATOM   2613 C CG    . GLU B  1 112 ? 11.707  44.212 11.805  1.00 26.81 ? 94  GLU B CG    1 
ATOM   2614 C CD    A GLU B  1 112 ? 11.196  45.120 12.911  0.80 29.48 ? 94  GLU B CD    1 
ATOM   2615 O OE1   A GLU B  1 112 ? 10.329  44.712 13.683  0.80 32.25 ? 94  GLU B OE1   1 
ATOM   2616 O OE2   A GLU B  1 112 ? 11.663  46.282 13.029  0.80 34.47 ? 94  GLU B OE2   1 
ATOM   2617 N N     . ASP B  1 113 ? 9.606   43.093 8.897   1.00 19.44 ? 95  ASP B N     1 
ATOM   2618 C CA    . ASP B  1 113 ? 9.489   43.862 7.674   1.00 19.61 ? 95  ASP B CA    1 
ATOM   2619 C C     . ASP B  1 113 ? 8.095   44.382 7.395   1.00 17.81 ? 95  ASP B C     1 
ATOM   2620 O O     . ASP B  1 113 ? 7.942   45.427 6.727   1.00 17.86 ? 95  ASP B O     1 
ATOM   2621 C CB    . ASP B  1 113 ? 9.999   43.062 6.444   1.00 21.12 ? 95  ASP B CB    1 
ATOM   2622 C CG    . ASP B  1 113 ? 11.456  42.899 6.421   1.00 24.24 ? 95  ASP B CG    1 
ATOM   2623 O OD1   . ASP B  1 113 ? 12.219  43.602 7.117   1.00 25.97 ? 95  ASP B OD1   1 
ATOM   2624 O OD2   . ASP B  1 113 ? 11.893  42.025 5.647   1.00 26.43 ? 95  ASP B OD2   1 
ATOM   2625 N N     . PHE B  1 114 ? 7.073   43.727 7.954   1.00 16.19 ? 96  PHE B N     1 
ATOM   2626 C CA    . PHE B  1 114 ? 5.719   44.171 7.735   1.00 14.87 ? 96  PHE B CA    1 
ATOM   2627 C C     . PHE B  1 114 ? 5.444   45.377 8.586   1.00 15.18 ? 96  PHE B C     1 
ATOM   2628 O O     . PHE B  1 114 ? 4.815   46.312 8.124   1.00 14.96 ? 96  PHE B O     1 
ATOM   2629 C CB    . PHE B  1 114 ? 4.693   43.095 8.056   1.00 13.92 ? 96  PHE B CB    1 
ATOM   2630 C CG    . PHE B  1 114 ? 4.692   41.927 7.147   1.00 13.70 ? 96  PHE B CG    1 
ATOM   2631 C CD1   . PHE B  1 114 ? 5.320   41.943 5.928   1.00 14.05 ? 96  PHE B CD1   1 
ATOM   2632 C CD2   . PHE B  1 114 ? 4.002   40.792 7.528   1.00 13.42 ? 96  PHE B CD2   1 
ATOM   2633 C CE1   . PHE B  1 114 ? 5.281   40.818 5.119   1.00 14.32 ? 96  PHE B CE1   1 
ATOM   2634 C CE2   . PHE B  1 114 ? 3.995   39.644 6.721   1.00 13.60 ? 96  PHE B CE2   1 
ATOM   2635 C CZ    . PHE B  1 114 ? 4.601   39.710 5.493   1.00 13.70 ? 96  PHE B CZ    1 
ATOM   2636 N N     . LEU B  1 115 ? 6.025   45.417 9.782   1.00 16.07 ? 97  LEU B N     1 
ATOM   2637 C CA    . LEU B  1 115 ? 5.856   46.576 10.650  1.00 16.55 ? 97  LEU B CA    1 
ATOM   2638 C C     . LEU B  1 115 ? 6.637   47.767 10.126  1.00 17.24 ? 97  LEU B C     1 
ATOM   2639 O O     . LEU B  1 115 ? 6.186   48.928 10.232  1.00 17.36 ? 97  LEU B O     1 
ATOM   2640 C CB    . LEU B  1 115 ? 6.262   46.208 12.107  1.00 17.49 ? 97  LEU B CB    1 
ATOM   2641 C CG    . LEU B  1 115 ? 5.431   45.094 12.769  1.00 17.26 ? 97  LEU B CG    1 
ATOM   2642 C CD1   . LEU B  1 115 ? 5.911   44.780 14.161  1.00 18.73 ? 97  LEU B CD1   1 
ATOM   2643 C CD2   . LEU B  1 115 ? 3.965   45.471 12.821  1.00 16.87 ? 97  LEU B CD2   1 
ATOM   2644 N N     . VAL B  1 116 ? 7.814   47.517 9.546   1.00 17.72 ? 98  VAL B N     1 
ATOM   2645 C CA    . VAL B  1 116 ? 8.539   48.550 8.873   1.00 18.77 ? 98  VAL B CA    1 
ATOM   2646 C C     . VAL B  1 116 ? 7.731   49.096 7.714   1.00 18.58 ? 98  VAL B C     1 
ATOM   2647 O O     . VAL B  1 116 ? 7.567   50.337 7.543   1.00 18.86 ? 98  VAL B O     1 
ATOM   2648 C CB    . VAL B  1 116 ? 9.915   48.025 8.378   1.00 19.72 ? 98  VAL B CB    1 
ATOM   2649 C CG1   . VAL B  1 116 ? 10.580  49.025 7.449   1.00 21.01 ? 98  VAL B CG1   1 
ATOM   2650 C CG2   . VAL B  1 116 ? 10.780  47.670 9.589   1.00 20.82 ? 98  VAL B CG2   1 
ATOM   2651 N N     . GLN B  1 117 ? 7.215   48.203 6.878   1.00 17.87 ? 99  GLN B N     1 
ATOM   2652 C CA    . GLN B  1 117 ? 6.379   48.663 5.773   1.00 18.32 ? 99  GLN B CA    1 
ATOM   2653 C C     . GLN B  1 117 ? 5.143   49.475 6.262   1.00 17.32 ? 99  GLN B C     1 
ATOM   2654 O O     . GLN B  1 117 ? 4.748   50.444 5.612   1.00 17.54 ? 99  GLN B O     1 
ATOM   2655 C CB    . GLN B  1 117 ? 5.923   47.489 4.879   1.00 18.72 ? 99  GLN B CB    1 
ATOM   2656 C CG    . GLN B  1 117 ? 5.337   48.007 3.596   1.00 20.03 ? 99  GLN B CG    1 
ATOM   2657 C CD    . GLN B  1 117 ? 6.384   48.729 2.759   1.00 21.82 ? 99  GLN B CD    1 
ATOM   2658 O OE1   . GLN B  1 117 ? 7.579   48.381 2.740   1.00 25.86 ? 99  GLN B OE1   1 
ATOM   2659 N NE2   . GLN B  1 117 ? 5.961   49.743 2.101   1.00 23.05 ? 99  GLN B NE2   1 
ATOM   2660 N N     . ALA B  1 118 ? 4.555   49.090 7.382   1.00 16.25 ? 100 ALA B N     1 
ATOM   2661 C CA    . ALA B  1 118 ? 3.391   49.800 7.912   1.00 16.03 ? 100 ALA B CA    1 
ATOM   2662 C C     . ALA B  1 118 ? 3.631   51.288 8.096   1.00 16.91 ? 100 ALA B C     1 
ATOM   2663 O O     . ALA B  1 118 ? 2.718   52.101 7.878   1.00 16.51 ? 100 ALA B O     1 
ATOM   2664 C CB    . ALA B  1 118 ? 2.899   49.174 9.233   1.00 15.83 ? 100 ALA B CB    1 
ATOM   2665 N N     . LYS B  1 119 ? 4.836   51.673 8.469   1.00 18.14 ? 101 LYS B N     1 
ATOM   2666 C CA    . LYS B  1 119 ? 5.116   53.093 8.697   1.00 20.06 ? 101 LYS B CA    1 
ATOM   2667 C C     . LYS B  1 119 ? 4.867   53.881 7.410   1.00 20.42 ? 101 LYS B C     1 
ATOM   2668 O O     . LYS B  1 119 ? 4.359   55.013 7.435   1.00 21.05 ? 101 LYS B O     1 
ATOM   2669 C CB    . LYS B  1 119 ? 6.566   53.326 9.213   1.00 22.05 ? 101 LYS B CB    1 
ATOM   2670 C CG    A LYS B  1 119 ? 6.698   52.604 10.559  0.70 22.75 ? 101 LYS B CG    1 
ATOM   2671 C CG    B LYS B  1 119 ? 7.042   52.532 10.443  0.30 22.03 ? 101 LYS B CG    1 
ATOM   2672 C CD    A LYS B  1 119 ? 8.022   52.788 11.302  0.70 25.01 ? 101 LYS B CD    1 
ATOM   2673 C CD    B LYS B  1 119 ? 8.584   52.486 10.554  0.30 23.46 ? 101 LYS B CD    1 
ATOM   2674 C CE    A LYS B  1 119 ? 8.047   51.951 12.597  0.70 25.33 ? 101 LYS B CE    1 
ATOM   2675 C CE    B LYS B  1 119 ? 9.105   51.353 11.460  0.30 23.36 ? 101 LYS B CE    1 
ATOM   2676 N NZ    A LYS B  1 119 ? 7.811   50.485 12.306  0.70 24.17 ? 101 LYS B NZ    1 
ATOM   2677 N NZ    B LYS B  1 119 ? 9.275   51.695 12.908  0.30 24.26 ? 101 LYS B NZ    1 
ATOM   2678 N N     . THR B  1 120 ? 5.223   53.271 6.280   1.00 19.79 ? 102 THR B N     1 
ATOM   2679 C CA    . THR B  1 120 ? 4.966   53.840 4.958   1.00 20.00 ? 102 THR B CA    1 
ATOM   2680 C C     . THR B  1 120 ? 3.485   53.698 4.571   1.00 18.84 ? 102 THR B C     1 
ATOM   2681 O O     . THR B  1 120 ? 2.812   54.683 4.207   1.00 19.00 ? 102 THR B O     1 
ATOM   2682 C CB    . THR B  1 120 ? 5.887   53.212 3.916   1.00 20.45 ? 102 THR B CB    1 
ATOM   2683 O OG1   . THR B  1 120 ? 7.214   53.651 4.177   1.00 21.69 ? 102 THR B OG1   1 
ATOM   2684 C CG2   . THR B  1 120 ? 5.522   53.682 2.501   1.00 21.23 ? 102 THR B CG2   1 
ATOM   2685 N N     . TYR B  1 121 ? 2.981   52.487 4.654   1.00 17.62 ? 103 TYR B N     1 
ATOM   2686 C CA    . TYR B  1 121 ? 1.629   52.138 4.180   1.00 17.23 ? 103 TYR B CA    1 
ATOM   2687 C C     . TYR B  1 121 ? 0.557   52.964 4.879   1.00 17.19 ? 103 TYR B C     1 
ATOM   2688 O O     . TYR B  1 121 ? -0.416  53.457 4.261   1.00 17.48 ? 103 TYR B O     1 
ATOM   2689 C CB    . TYR B  1 121 ? 1.342   50.655 4.453   1.00 16.41 ? 103 TYR B CB    1 
ATOM   2690 C CG    . TYR B  1 121 ? -0.043  50.209 4.049   1.00 16.04 ? 103 TYR B CG    1 
ATOM   2691 C CD1   . TYR B  1 121 ? -0.378  50.111 2.708   1.00 17.16 ? 103 TYR B CD1   1 
ATOM   2692 C CD2   . TYR B  1 121 ? -0.992  49.842 4.969   1.00 15.82 ? 103 TYR B CD2   1 
ATOM   2693 C CE1   . TYR B  1 121 ? -1.656  49.738 2.324   1.00 16.79 ? 103 TYR B CE1   1 
ATOM   2694 C CE2   . TYR B  1 121 ? -2.263  49.436 4.600   1.00 15.56 ? 103 TYR B CE2   1 
ATOM   2695 C CZ    . TYR B  1 121 ? -2.579  49.386 3.275   1.00 16.21 ? 103 TYR B CZ    1 
ATOM   2696 O OH    . TYR B  1 121 ? -3.856  49.021 2.926   1.00 16.50 ? 103 TYR B OH    1 
ATOM   2697 N N     . LEU B  1 122 ? 0.715   53.138 6.191   1.00 17.05 ? 104 LEU B N     1 
ATOM   2698 C CA    . LEU B  1 122 ? -0.263  53.912 6.986   1.00 17.06 ? 104 LEU B CA    1 
ATOM   2699 C C     . LEU B  1 122 ? -0.221  55.412 6.818   1.00 18.62 ? 104 LEU B C     1 
ATOM   2700 O O     . LEU B  1 122 ? -1.168  56.107 7.234   1.00 18.86 ? 104 LEU B O     1 
ATOM   2701 C CB    . LEU B  1 122 ? -0.104  53.575 8.469   1.00 16.92 ? 104 LEU B CB    1 
ATOM   2702 C CG    . LEU B  1 122 ? -0.311  52.104 8.783   1.00 16.18 ? 104 LEU B CG    1 
ATOM   2703 C CD1   . LEU B  1 122 ? 0.008   51.898 10.232  1.00 16.21 ? 104 LEU B CD1   1 
ATOM   2704 C CD2   . LEU B  1 122 ? -1.748  51.650 8.447   1.00 15.41 ? 104 LEU B CD2   1 
ATOM   2705 N N     . GLY B  1 123 ? 0.869   55.953 6.278   1.00 19.39 ? 105 GLY B N     1 
ATOM   2706 C CA    . GLY B  1 123 ? 0.940   57.355 5.974   1.00 21.03 ? 105 GLY B CA    1 
ATOM   2707 C C     . GLY B  1 123 ? 0.757   58.279 7.172   1.00 21.60 ? 105 GLY B C     1 
ATOM   2708 O O     . GLY B  1 123 ? 1.111   57.947 8.292   1.00 20.83 ? 105 GLY B O     1 
ATOM   2709 N N     . GLU B  1 124 ? 0.160   59.431 6.938   1.00 22.27 ? 106 GLU B N     1 
ATOM   2710 C CA    . GLU B  1 124 ? 0.009   60.417 8.016   1.00 23.67 ? 106 GLU B CA    1 
ATOM   2711 C C     . GLU B  1 124 ? -0.799  59.934 9.185   1.00 22.11 ? 106 GLU B C     1 
ATOM   2712 O O     . GLU B  1 124 ? -0.440  60.251 10.337  1.00 22.30 ? 106 GLU B O     1 
ATOM   2713 C CB    . GLU B  1 124 ? -0.611  61.707 7.506   1.00 25.65 ? 106 GLU B CB    1 
ATOM   2714 C CG    A GLU B  1 124 ? 0.329   62.504 6.620   0.80 28.46 ? 106 GLU B CG    1 
ATOM   2715 C CD    A GLU B  1 124 ? 1.564   62.991 7.342   0.80 30.38 ? 106 GLU B CD    1 
ATOM   2716 O OE1   A GLU B  1 124 ? 2.672   62.814 6.814   0.80 33.26 ? 106 GLU B OE1   1 
ATOM   2717 O OE2   A GLU B  1 124 ? 1.415   63.429 8.471   0.80 31.46 ? 106 GLU B OE2   1 
ATOM   2718 N N     . GLU B  1 125 ? -1.879  59.185 8.935   1.00 20.56 ? 107 GLU B N     1 
ATOM   2719 C CA    . GLU B  1 125 ? -2.698  58.721 10.031  1.00 19.72 ? 107 GLU B CA    1 
ATOM   2720 C C     . GLU B  1 125 ? -1.942  57.732 10.871  1.00 18.58 ? 107 GLU B C     1 
ATOM   2721 O O     . GLU B  1 125 ? -2.266  57.590 12.043  1.00 18.09 ? 107 GLU B O     1 
ATOM   2722 C CB    . GLU B  1 125 ? -4.005  58.099 9.559   1.00 19.42 ? 107 GLU B CB    1 
ATOM   2723 C CG    . GLU B  1 125 ? -4.942  59.075 8.851   1.00 20.50 ? 107 GLU B CG    1 
ATOM   2724 C CD    . GLU B  1 125 ? -5.499  60.134 9.777   1.00 21.88 ? 107 GLU B CD    1 
ATOM   2725 O OE1   . GLU B  1 125 ? -6.303  59.746 10.667  1.00 21.74 ? 107 GLU B OE1   1 
ATOM   2726 O OE2   . GLU B  1 125 ? -5.176  61.329 9.624   1.00 22.83 ? 107 GLU B OE2   1 
ATOM   2727 N N     . GLY B  1 126 ? -0.951  57.060 10.286  1.00 17.92 ? 108 GLY B N     1 
ATOM   2728 C CA    . GLY B  1 126 ? -0.050  56.165 11.003  1.00 17.32 ? 108 GLY B CA    1 
ATOM   2729 C C     . GLY B  1 126 ? 0.746   56.765 12.165  1.00 18.37 ? 108 GLY B C     1 
ATOM   2730 O O     . GLY B  1 126 ? 1.280   56.013 12.991  1.00 18.37 ? 108 GLY B O     1 
ATOM   2731 N N     . LYS B  1 127 ? 0.839   58.075 12.225  1.00 19.31 ? 109 LYS B N     1 
ATOM   2732 C CA    . LYS B  1 127 ? 1.482   58.760 13.340  1.00 20.70 ? 109 LYS B CA    1 
ATOM   2733 C C     . LYS B  1 127 ? 0.764   58.466 14.653  1.00 20.23 ? 109 LYS B C     1 
ATOM   2734 O O     . LYS B  1 127 ? 1.359   58.651 15.720  1.00 21.62 ? 109 LYS B O     1 
ATOM   2735 C CB    . LYS B  1 127 ? 1.597   60.248 13.091  1.00 22.41 ? 109 LYS B CB    1 
ATOM   2736 C CG    . LYS B  1 127 ? 2.685   60.591 12.060  1.00 23.49 ? 109 LYS B CG    1 
ATOM   2737 C CD    . LYS B  1 127 ? 2.589   62.068 11.636  1.00 25.35 ? 109 LYS B CD    1 
ATOM   2738 C CE    . LYS B  1 127 ? 3.709   62.472 10.660  1.00 26.89 ? 109 LYS B CE    1 
ATOM   2739 N NZ    . LYS B  1 127 ? 3.502   63.848 10.184  1.00 28.66 ? 109 LYS B NZ    1 
ATOM   2740 N N     . ARG B  1 128 ? -0.491  58.043 14.591  1.00 18.87 ? 110 ARG B N     1 
ATOM   2741 C CA    . ARG B  1 128 ? -1.233  57.667 15.784  1.00 18.50 ? 110 ARG B CA    1 
ATOM   2742 C C     . ARG B  1 128 ? -1.061  56.208 16.184  1.00 17.75 ? 110 ARG B C     1 
ATOM   2743 O O     . ARG B  1 128 ? -1.678  55.760 17.169  1.00 17.57 ? 110 ARG B O     1 
ATOM   2744 C CB    . ARG B  1 128 ? -2.698  58.045 15.648  1.00 18.09 ? 110 ARG B CB    1 
ATOM   2745 C CG    . ARG B  1 128 ? -2.927  59.530 15.603  1.00 19.35 ? 110 ARG B CG    1 
ATOM   2746 C CD    . ARG B  1 128 ? -4.371  60.014 15.581  1.00 19.18 ? 110 ARG B CD    1 
ATOM   2747 N NE    . ARG B  1 128 ? -5.058  59.591 14.386  1.00 18.61 ? 110 ARG B NE    1 
ATOM   2748 C CZ    . ARG B  1 128 ? -5.942  58.591 14.295  1.00 17.59 ? 110 ARG B CZ    1 
ATOM   2749 N NH1   . ARG B  1 128 ? -6.294  57.831 15.336  1.00 17.07 ? 110 ARG B NH1   1 
ATOM   2750 N NH2   . ARG B  1 128 ? -6.502  58.353 13.109  1.00 17.18 ? 110 ARG B NH2   1 
ATOM   2751 N N     . VAL B  1 129 ? -0.249  55.446 15.446  1.00 17.27 ? 111 VAL B N     1 
ATOM   2752 C CA    . VAL B  1 129 ? 0.159   54.166 15.938  1.00 17.18 ? 111 VAL B CA    1 
ATOM   2753 C C     . VAL B  1 129 ? 1.131   54.402 17.072  1.00 18.91 ? 111 VAL B C     1 
ATOM   2754 O O     . VAL B  1 129 ? 2.155   55.054 16.902  1.00 20.34 ? 111 VAL B O     1 
ATOM   2755 C CB    . VAL B  1 129 ? 0.764   53.256 14.890  1.00 16.62 ? 111 VAL B CB    1 
ATOM   2756 C CG1   . VAL B  1 129 ? 1.288   51.957 15.545  1.00 16.23 ? 111 VAL B CG1   1 
ATOM   2757 C CG2   . VAL B  1 129 ? -0.313  52.895 13.876  1.00 15.55 ? 111 VAL B CG2   1 
ATOM   2758 N N     . ARG B  1 130 ? 0.802   53.888 18.248  1.00 19.57 ? 112 ARG B N     1 
ATOM   2759 C CA    . ARG B  1 130 ? 1.562   54.242 19.456  1.00 21.91 ? 112 ARG B CA    1 
ATOM   2760 C C     . ARG B  1 130 ? 2.734   53.279 19.616  1.00 22.86 ? 112 ARG B C     1 
ATOM   2761 O O     . ARG B  1 130 ? 3.854   53.711 19.777  1.00 24.33 ? 112 ARG B O     1 
ATOM   2762 C CB    . ARG B  1 130 ? 0.586   54.295 20.659  1.00 22.44 ? 112 ARG B CB    1 
ATOM   2763 C CG    . ARG B  1 130 ? 1.180   54.426 22.039  1.00 24.68 ? 112 ARG B CG    1 
ATOM   2764 C CD    . ARG B  1 130 ? 0.048   54.290 23.094  1.00 25.12 ? 112 ARG B CD    1 
ATOM   2765 N NE    . ARG B  1 130 ? -0.319  52.857 23.269  1.00 24.33 ? 112 ARG B NE    1 
ATOM   2766 C CZ    . ARG B  1 130 ? -1.028  52.369 24.290  1.00 25.39 ? 112 ARG B CZ    1 
ATOM   2767 N NH1   . ARG B  1 130 ? -1.502  53.182 25.257  1.00 26.10 ? 112 ARG B NH1   1 
ATOM   2768 N NH2   . ARG B  1 130 ? -1.258  51.071 24.382  1.00 24.79 ? 112 ARG B NH2   1 
ATOM   2769 N N     . ASN B  1 131 ? 2.480   51.982 19.528  1.00 22.44 ? 113 ASN B N     1 
ATOM   2770 C CA    . ASN B  1 131 ? 3.530   50.939 19.630  1.00 23.51 ? 113 ASN B CA    1 
ATOM   2771 C C     . ASN B  1 131 ? 3.444   49.988 18.485  1.00 22.51 ? 113 ASN B C     1 
ATOM   2772 O O     . ASN B  1 131 ? 2.342   49.579 18.129  1.00 21.62 ? 113 ASN B O     1 
ATOM   2773 C CB    . ASN B  1 131 ? 3.352   50.122 20.927  1.00 24.33 ? 113 ASN B CB    1 
ATOM   2774 C CG    . ASN B  1 131 ? 3.430   50.961 22.182  1.00 26.35 ? 113 ASN B CG    1 
ATOM   2775 O OD1   . ASN B  1 131 ? 2.491   51.036 23.017  1.00 27.87 ? 113 ASN B OD1   1 
ATOM   2776 N ND2   . ASN B  1 131 ? 4.556   51.570 22.354  1.00 27.97 ? 113 ASN B ND2   1 
ATOM   2777 N N     . TYR B  1 132 ? 4.589   49.661 17.865  1.00 22.92 ? 114 TYR B N     1 
ATOM   2778 C CA    . TYR B  1 132 ? 4.712   48.553 16.944  1.00 22.77 ? 114 TYR B CA    1 
ATOM   2779 C C     . TYR B  1 132 ? 5.482   47.475 17.674  1.00 23.25 ? 114 TYR B C     1 
ATOM   2780 O O     . TYR B  1 132 ? 6.634   47.712 18.002  1.00 27.73 ? 114 TYR B O     1 
ATOM   2781 C CB    . TYR B  1 132 ? 5.587   48.937 15.744  1.00 23.54 ? 114 TYR B CB    1 
ATOM   2782 C CG    . TYR B  1 132 ? 5.029   50.012 14.841  1.00 23.63 ? 114 TYR B CG    1 
ATOM   2783 C CD1   . TYR B  1 132 ? 5.292   51.351 15.081  1.00 25.48 ? 114 TYR B CD1   1 
ATOM   2784 C CD2   . TYR B  1 132 ? 4.257   49.696 13.734  1.00 23.35 ? 114 TYR B CD2   1 
ATOM   2785 C CE1   . TYR B  1 132 ? 4.778   52.343 14.238  1.00 25.99 ? 114 TYR B CE1   1 
ATOM   2786 C CE2   . TYR B  1 132 ? 3.770   50.671 12.882  1.00 23.13 ? 114 TYR B CE2   1 
ATOM   2787 C CZ    . TYR B  1 132 ? 4.060   51.987 13.116  1.00 24.64 ? 114 TYR B CZ    1 
ATOM   2788 O OH    . TYR B  1 132 ? 3.564   52.968 12.252  1.00 25.76 ? 114 TYR B OH    1 
ATOM   2789 N N     . PHE B  1 133 ? 4.885   46.339 17.971  1.00 20.94 ? 115 PHE B N     1 
ATOM   2790 C CA    . PHE B  1 133 ? 5.523   45.305 18.757  1.00 20.64 ? 115 PHE B CA    1 
ATOM   2791 C C     . PHE B  1 133 ? 5.857   44.190 17.767  1.00 19.86 ? 115 PHE B C     1 
ATOM   2792 O O     . PHE B  1 133 ? 4.950   43.631 17.152  1.00 18.45 ? 115 PHE B O     1 
ATOM   2793 C CB    . PHE B  1 133 ? 4.531   44.742 19.773  1.00 20.23 ? 115 PHE B CB    1 
ATOM   2794 C CG    . PHE B  1 133 ? 4.089   45.738 20.848  1.00 20.66 ? 115 PHE B CG    1 
ATOM   2795 C CD1   . PHE B  1 133 ? 5.005   46.170 21.807  1.00 22.53 ? 115 PHE B CD1   1 
ATOM   2796 C CD2   . PHE B  1 133 ? 2.777   46.119 20.970  1.00 20.00 ? 115 PHE B CD2   1 
ATOM   2797 C CE1   . PHE B  1 133 ? 4.603   47.020 22.833  1.00 23.20 ? 115 PHE B CE1   1 
ATOM   2798 C CE2   . PHE B  1 133 ? 2.374   46.972 21.987  1.00 20.69 ? 115 PHE B CE2   1 
ATOM   2799 C CZ    . PHE B  1 133 ? 3.291   47.415 22.911  1.00 22.26 ? 115 PHE B CZ    1 
ATOM   2800 N N     . CYS B  1 134 ? 7.126   43.852 17.643  1.00 20.41 ? 116 CYS B N     1 
ATOM   2801 C CA    . CYS B  1 134 ? 7.546   42.707 16.821  1.00 20.26 ? 116 CYS B CA    1 
ATOM   2802 C C     . CYS B  1 134 ? 7.674   41.509 17.720  1.00 21.03 ? 116 CYS B C     1 
ATOM   2803 O O     . CYS B  1 134 ? 8.652   41.407 18.451  1.00 22.14 ? 116 CYS B O     1 
ATOM   2804 C CB    . CYS B  1 134 ? 8.838   42.980 16.081  1.00 21.18 ? 116 CYS B CB    1 
ATOM   2805 S SG    . CYS B  1 134 ? 9.199   41.625 14.926  1.00 20.98 ? 116 CYS B SG    1 
ATOM   2806 N N     . CYS B  1 135 ? 6.681   40.613 17.689  1.00 20.25 ? 117 CYS B N     1 
ATOM   2807 C CA    . CYS B  1 135 ? 6.591   39.494 18.657  1.00 21.25 ? 117 CYS B CA    1 
ATOM   2808 C C     . CYS B  1 135 ? 5.610   38.475 18.129  1.00 19.92 ? 117 CYS B C     1 
ATOM   2809 O O     . CYS B  1 135 ? 4.598   38.856 17.522  1.00 18.67 ? 117 CYS B O     1 
ATOM   2810 C CB    . CYS B  1 135 ? 6.057   40.010 20.023  1.00 22.31 ? 117 CYS B CB    1 
ATOM   2811 S SG    . CYS B  1 135 ? 6.318   38.864 21.388  1.00 25.46 ? 117 CYS B SG    1 
ATOM   2812 N N     . GLY B  1 136 ? 5.860   37.185 18.371  1.00 20.21 ? 118 GLY B N     1 
ATOM   2813 C CA    . GLY B  1 136 ? 4.831   36.197 18.088  1.00 19.60 ? 118 GLY B CA    1 
ATOM   2814 C C     . GLY B  1 136 ? 3.748   36.346 19.169  1.00 19.49 ? 118 GLY B C     1 
ATOM   2815 O O     . GLY B  1 136 ? 4.059   36.652 20.372  1.00 20.68 ? 118 GLY B O     1 
ATOM   2816 N N     . LEU B  1 137 ? 2.484   36.135 18.823  1.00 18.69 ? 119 LEU B N     1 
ATOM   2817 C CA    . LEU B  1 137 ? 1.438   36.292 19.849  1.00 18.38 ? 119 LEU B CA    1 
ATOM   2818 C C     . LEU B  1 137 ? 1.620   35.325 21.050  1.00 19.81 ? 119 LEU B C     1 
ATOM   2819 O O     . LEU B  1 137 ? 1.333   35.667 22.196  1.00 20.12 ? 119 LEU B O     1 
ATOM   2820 C CB    . LEU B  1 137 ? 0.034   36.110 19.274  1.00 17.59 ? 119 LEU B CB    1 
ATOM   2821 C CG    . LEU B  1 137 ? -0.355  36.990 18.080  1.00 16.34 ? 119 LEU B CG    1 
ATOM   2822 C CD1   . LEU B  1 137 ? -1.775  36.646 17.633  1.00 15.73 ? 119 LEU B CD1   1 
ATOM   2823 C CD2   . LEU B  1 137 ? -0.179  38.454 18.403  1.00 16.05 ? 119 LEU B CD2   1 
ATOM   2824 N N     . GLN B  1 138 ? 2.116   34.133 20.739  1.00 20.51 ? 120 GLN B N     1 
ATOM   2825 C CA    . GLN B  1 138 ? 2.492   33.112 21.734  1.00 22.26 ? 120 GLN B CA    1 
ATOM   2826 C C     . GLN B  1 138 ? 3.498   33.595 22.803  1.00 23.74 ? 120 GLN B C     1 
ATOM   2827 O O     . GLN B  1 138 ? 3.520   33.049 23.913  1.00 24.95 ? 120 GLN B O     1 
ATOM   2828 C CB    . GLN B  1 138 ? 2.982   31.822 21.069  1.00 22.81 ? 120 GLN B CB    1 
ATOM   2829 C CG    . GLN B  1 138 ? 4.350   31.839 20.417  1.00 23.16 ? 120 GLN B CG    1 
ATOM   2830 C CD    . GLN B  1 138 ? 4.374   32.349 18.964  1.00 21.78 ? 120 GLN B CD    1 
ATOM   2831 O OE1   . GLN B  1 138 ? 3.435   32.974 18.491  1.00 20.05 ? 120 GLN B OE1   1 
ATOM   2832 N NE2   . GLN B  1 138 ? 5.456   32.010 18.238  1.00 22.70 ? 120 GLN B NE2   1 
ATOM   2833 N N     . ASP B  1 139 ? 4.268   34.642 22.491  1.00 23.52 ? 121 ASP B N     1 
ATOM   2834 C CA    . ASP B  1 139 ? 5.188   35.267 23.425  1.00 25.31 ? 121 ASP B CA    1 
ATOM   2835 C C     . ASP B  1 139 ? 4.779   36.666 23.913  1.00 24.78 ? 121 ASP B C     1 
ATOM   2836 O O     . ASP B  1 139 ? 5.542   37.336 24.643  1.00 26.00 ? 121 ASP B O     1 
ATOM   2837 C CB    . ASP B  1 139 ? 6.588   35.343 22.767  1.00 25.93 ? 121 ASP B CB    1 
ATOM   2838 C CG    . ASP B  1 139 ? 7.164   33.970 22.448  1.00 27.22 ? 121 ASP B CG    1 
ATOM   2839 O OD1   . ASP B  1 139 ? 7.191   33.120 23.359  1.00 28.91 ? 121 ASP B OD1   1 
ATOM   2840 O OD2   . ASP B  1 139 ? 7.539   33.742 21.287  1.00 26.19 ? 121 ASP B OD2   1 
ATOM   2841 N N     . PHE B  1 140 ? 3.574   37.113 23.559  1.00 23.46 ? 122 PHE B N     1 
ATOM   2842 C CA    . PHE B  1 140 ? 3.189   38.507 23.735  1.00 22.65 ? 122 PHE B CA    1 
ATOM   2843 C C     . PHE B  1 140 ? 2.170   38.651 24.866  1.00 23.36 ? 122 PHE B C     1 
ATOM   2844 O O     . PHE B  1 140 ? 1.199   37.895 24.928  1.00 22.67 ? 122 PHE B O     1 
ATOM   2845 C CB    . PHE B  1 140 ? 2.565   39.017 22.464  1.00 20.80 ? 122 PHE B CB    1 
ATOM   2846 C CG    . PHE B  1 140 ? 2.205   40.477 22.499  1.00 20.32 ? 122 PHE B CG    1 
ATOM   2847 C CD1   . PHE B  1 140 ? 3.189   41.448 22.562  1.00 21.00 ? 122 PHE B CD1   1 
ATOM   2848 C CD2   . PHE B  1 140 ? 0.888   40.872 22.443  1.00 19.64 ? 122 PHE B CD2   1 
ATOM   2849 C CE1   . PHE B  1 140 ? 2.858   42.799 22.576  1.00 20.88 ? 122 PHE B CE1   1 
ATOM   2850 C CE2   . PHE B  1 140 ? 0.530   42.228 22.500  1.00 19.48 ? 122 PHE B CE2   1 
ATOM   2851 C CZ    . PHE B  1 140 ? 1.522   43.197 22.573  1.00 20.14 ? 122 PHE B CZ    1 
ATOM   2852 N N     . THR B  1 141 ? 2.432   39.602 25.748  1.00 24.78 ? 123 THR B N     1 
ATOM   2853 C CA    . THR B  1 141 ? 1.564   39.926 26.858  1.00 25.82 ? 123 THR B CA    1 
ATOM   2854 C C     . THR B  1 141 ? 1.112   41.375 26.661  1.00 25.92 ? 123 THR B C     1 
ATOM   2855 O O     . THR B  1 141 ? 1.861   42.282 26.928  1.00 26.82 ? 123 THR B O     1 
ATOM   2856 C CB    . THR B  1 141 ? 2.302   39.827 28.188  1.00 27.80 ? 123 THR B CB    1 
ATOM   2857 O OG1   . THR B  1 141 ? 2.717   38.466 28.406  1.00 28.73 ? 123 THR B OG1   1 
ATOM   2858 C CG2   . THR B  1 141 ? 1.428   40.276 29.325  1.00 28.43 ? 123 THR B CG2   1 
ATOM   2859 N N     . PRO B  1 142 ? -0.117  41.583 26.209  1.00 25.62 ? 124 PRO B N     1 
ATOM   2860 C CA    . PRO B  1 142 ? -0.621  42.955 26.158  1.00 25.43 ? 124 PRO B CA    1 
ATOM   2861 C C     . PRO B  1 142 ? -0.744  43.557 27.558  1.00 27.26 ? 124 PRO B C     1 
ATOM   2862 O O     . PRO B  1 142 ? -0.996  42.834 28.532  1.00 27.79 ? 124 PRO B O     1 
ATOM   2863 C CB    . PRO B  1 142 ? -1.943  42.812 25.463  1.00 24.36 ? 124 PRO B CB    1 
ATOM   2864 C CG    . PRO B  1 142 ? -2.361  41.413 25.705  1.00 24.91 ? 124 PRO B CG    1 
ATOM   2865 C CD    . PRO B  1 142 ? -1.104  40.614 25.713  1.00 25.43 ? 124 PRO B CD    1 
ATOM   2866 N N     . GLU B  1 143 ? -0.464  44.849 27.686  1.00 28.29 ? 125 GLU B N     1 
ATOM   2867 C CA    A GLU B  1 143 ? -0.416  45.490 28.987  0.70 30.50 ? 125 GLU B CA    1 
ATOM   2868 C CA    B GLU B  1 143 ? -0.411  45.489 28.987  0.30 29.70 ? 125 GLU B CA    1 
ATOM   2869 C C     . GLU B  1 143 ? -1.799  45.521 29.644  1.00 29.82 ? 125 GLU B C     1 
ATOM   2870 O O     . GLU B  1 143 ? -2.793  45.768 28.964  1.00 28.46 ? 125 GLU B O     1 
ATOM   2871 C CB    A GLU B  1 143 ? 0.158   46.923 28.907  0.70 32.39 ? 125 GLU B CB    1 
ATOM   2872 C CB    B GLU B  1 143 ? 0.162   46.905 28.858  0.30 30.21 ? 125 GLU B CB    1 
ATOM   2873 C CG    A GLU B  1 143 ? 1.667   46.996 28.638  0.70 34.00 ? 125 GLU B CG    1 
ATOM   2874 C CG    B GLU B  1 143 ? 0.503   47.563 30.183  0.30 31.83 ? 125 GLU B CG    1 
ATOM   2875 C CD    A GLU B  1 143 ? 2.516   46.505 29.770  0.70 36.65 ? 125 GLU B CD    1 
ATOM   2876 O OE1   A GLU B  1 143 ? 2.158   46.705 30.958  0.70 39.67 ? 125 GLU B OE1   1 
ATOM   2877 O OE2   A GLU B  1 143 ? 3.577   45.933 29.468  0.70 38.42 ? 125 GLU B OE2   1 
ATOM   2878 N N     . PRO B  1 144 ? -1.883  45.285 30.973  1.00 31.03 ? 126 PRO B N     1 
ATOM   2879 C CA    . PRO B  1 144 ? -3.217  45.392 31.606  1.00 30.32 ? 126 PRO B CA    1 
ATOM   2880 C C     . PRO B  1 144 ? -3.921  46.735 31.366  1.00 29.69 ? 126 PRO B C     1 
ATOM   2881 O O     . PRO B  1 144 ? -3.267  47.785 31.256  1.00 28.99 ? 126 PRO B O     1 
ATOM   2882 C CB    . PRO B  1 144 ? -2.916  45.180 33.101  1.00 33.03 ? 126 PRO B CB    1 
ATOM   2883 C CG    . PRO B  1 144 ? -1.734  44.283 33.056  1.00 33.85 ? 126 PRO B CG    1 
ATOM   2884 C CD    . PRO B  1 144 ? -0.874  44.850 31.971  1.00 33.03 ? 126 PRO B CD    1 
ATOM   2885 N N     . ASP B  1 145 ? -5.248  46.673 31.261  1.00 29.00 ? 127 ASP B N     1 
ATOM   2886 C CA    . ASP B  1 145 ? -6.100  47.857 31.256  1.00 28.85 ? 127 ASP B CA    1 
ATOM   2887 C C     . ASP B  1 145 ? -5.713  48.843 30.146  1.00 27.06 ? 127 ASP B C     1 
ATOM   2888 O O     . ASP B  1 145 ? -5.654  50.048 30.359  1.00 26.85 ? 127 ASP B O     1 
ATOM   2889 C CB    . ASP B  1 145 ? -6.076  48.547 32.654  1.00 32.19 ? 127 ASP B CB    1 
ATOM   2890 C CG    . ASP B  1 145 ? -7.123  49.672 32.791  1.00 33.59 ? 127 ASP B CG    1 
ATOM   2891 O OD1   . ASP B  1 145 ? -8.219  49.578 32.185  1.00 33.01 ? 127 ASP B OD1   1 
ATOM   2892 O OD2   . ASP B  1 145 ? -6.850  50.682 33.525  1.00 36.49 ? 127 ASP B OD2   1 
ATOM   2893 N N     . SER B  1 146 ? -5.426  48.325 28.948  1.00 24.23 ? 128 SER B N     1 
ATOM   2894 C CA    . SER B  1 146 ? -4.887  49.164 27.874  1.00 23.31 ? 128 SER B CA    1 
ATOM   2895 C C     . SER B  1 146 ? -5.790  49.369 26.656  1.00 21.20 ? 128 SER B C     1 
ATOM   2896 O O     . SER B  1 146 ? -5.663  50.405 25.974  1.00 20.80 ? 128 SER B O     1 
ATOM   2897 C CB    . SER B  1 146 ? -3.545  48.587 27.383  1.00 23.49 ? 128 SER B CB    1 
ATOM   2898 O OG    . SER B  1 146 ? -2.648  48.608 28.491  1.00 25.94 ? 128 SER B OG    1 
ATOM   2899 N N     . TYR B  1 147 ? -6.606  48.364 26.325  1.00 19.44 ? 129 TYR B N     1 
ATOM   2900 C CA    . TYR B  1 147 ? -7.321  48.383 25.036  1.00 17.54 ? 129 TYR B CA    1 
ATOM   2901 C C     . TYR B  1 147 ? -8.820  48.282 25.145  1.00 17.05 ? 129 TYR B C     1 
ATOM   2902 O O     . TYR B  1 147 ? -9.330  47.464 25.863  1.00 17.40 ? 129 TYR B O     1 
ATOM   2903 C CB    . TYR B  1 147 ? -6.846  47.230 24.164  1.00 16.57 ? 129 TYR B CB    1 
ATOM   2904 C CG    . TYR B  1 147 ? -5.337  47.247 23.948  1.00 16.68 ? 129 TYR B CG    1 
ATOM   2905 C CD1   . TYR B  1 147 ? -4.737  48.253 23.211  1.00 16.34 ? 129 TYR B CD1   1 
ATOM   2906 C CD2   . TYR B  1 147 ? -4.503  46.282 24.555  1.00 17.34 ? 129 TYR B CD2   1 
ATOM   2907 C CE1   . TYR B  1 147 ? -3.356  48.287 23.046  1.00 16.65 ? 129 TYR B CE1   1 
ATOM   2908 C CE2   . TYR B  1 147 ? -3.134  46.299 24.376  1.00 17.62 ? 129 TYR B CE2   1 
ATOM   2909 C CZ    . TYR B  1 147 ? -2.559  47.303 23.609  1.00 17.23 ? 129 TYR B CZ    1 
ATOM   2910 O OH    . TYR B  1 147 ? -1.177  47.313 23.477  1.00 17.78 ? 129 TYR B OH    1 
ATOM   2911 N N     . ASP B  1 148 ? -9.533  49.118 24.392  1.00 16.12 ? 130 ASP B N     1 
ATOM   2912 C CA    . ASP B  1 148 ? -10.949 49.003 24.235  1.00 15.93 ? 130 ASP B CA    1 
ATOM   2913 C C     . ASP B  1 148 ? -11.314 47.878 23.310  1.00 15.26 ? 130 ASP B C     1 
ATOM   2914 O O     . ASP B  1 148 ? -12.342 47.221 23.516  1.00 15.53 ? 130 ASP B O     1 
ATOM   2915 C CB    . ASP B  1 148 ? -11.507 50.351 23.700  1.00 15.75 ? 130 ASP B CB    1 
ATOM   2916 C CG    . ASP B  1 148 ? -11.239 51.484 24.672  1.00 16.94 ? 130 ASP B CG    1 
ATOM   2917 O OD1   . ASP B  1 148 ? -11.794 51.422 25.809  1.00 17.84 ? 130 ASP B OD1   1 
ATOM   2918 O OD2   . ASP B  1 148 ? -10.428 52.404 24.325  1.00 17.25 ? 130 ASP B OD2   1 
ATOM   2919 N N     . VAL B  1 149 ? -10.506 47.666 22.263  1.00 14.58 ? 131 VAL B N     1 
ATOM   2920 C CA    . VAL B  1 149 ? -10.715 46.603 21.304  1.00 13.99 ? 131 VAL B CA    1 
ATOM   2921 C C     . VAL B  1 149 ? -9.397  45.921 21.015  1.00 13.87 ? 131 VAL B C     1 
ATOM   2922 O O     . VAL B  1 149 ? -8.429  46.599 20.701  1.00 13.44 ? 131 VAL B O     1 
ATOM   2923 C CB    . VAL B  1 149 ? -11.364 47.135 20.009  1.00 13.37 ? 131 VAL B CB    1 
ATOM   2924 C CG1   . VAL B  1 149 ? -11.428 46.066 18.939  1.00 12.90 ? 131 VAL B CG1   1 
ATOM   2925 C CG2   . VAL B  1 149 ? -12.760 47.656 20.360  1.00 13.72 ? 131 VAL B CG2   1 
ATOM   2926 N N     . ILE B  1 150 ? -9.410  44.582 21.039  1.00 13.93 ? 132 ILE B N     1 
ATOM   2927 C CA    . ILE B  1 150 ? -8.297  43.780 20.570  1.00 13.70 ? 132 ILE B CA    1 
ATOM   2928 C C     . ILE B  1 150 ? -8.795  42.996 19.375  1.00 13.14 ? 132 ILE B C     1 
ATOM   2929 O O     . ILE B  1 150 ? -9.724  42.220 19.508  1.00 13.64 ? 132 ILE B O     1 
ATOM   2930 C CB    . ILE B  1 150 ? -7.793  42.862 21.709  1.00 14.69 ? 132 ILE B CB    1 
ATOM   2931 C CG1   . ILE B  1 150 ? -7.332  43.736 22.870  1.00 15.53 ? 132 ILE B CG1   1 
ATOM   2932 C CG2   . ILE B  1 150 ? -6.700  41.934 21.204  1.00 14.72 ? 132 ILE B CG2   1 
ATOM   2933 C CD1   . ILE B  1 150 ? -6.973  42.995 24.143  1.00 16.70 ? 132 ILE B CD1   1 
ATOM   2934 N N     . TRP B  1 151 ? -8.219  43.268 18.210  1.00 12.24 ? 133 TRP B N     1 
ATOM   2935 C CA    . TRP B  1 151 ? -8.664  42.749 16.946  1.00 11.96 ? 133 TRP B CA    1 
ATOM   2936 C C     . TRP B  1 151 ? -7.668  41.678 16.506  1.00 12.23 ? 133 TRP B C     1 
ATOM   2937 O O     . TRP B  1 151 ? -6.494  41.961 16.386  1.00 12.19 ? 133 TRP B O     1 
ATOM   2938 C CB    . TRP B  1 151 ? -8.729  43.883 15.906  1.00 11.41 ? 133 TRP B CB    1 
ATOM   2939 C CG    . TRP B  1 151 ? -9.537  43.474 14.710  1.00 11.06 ? 133 TRP B CG    1 
ATOM   2940 C CD1   . TRP B  1 151 ? -9.092  42.767 13.572  1.00 10.99 ? 133 TRP B CD1   1 
ATOM   2941 C CD2   . TRP B  1 151 ? -10.922 43.632 14.552  1.00 11.23 ? 133 TRP B CD2   1 
ATOM   2942 N NE1   . TRP B  1 151 ? -10.118 42.547 12.740  1.00 11.23 ? 133 TRP B NE1   1 
ATOM   2943 C CE2   . TRP B  1 151 ? -11.267 43.058 13.281  1.00 11.19 ? 133 TRP B CE2   1 
ATOM   2944 C CE3   . TRP B  1 151 ? -11.915 44.269 15.302  1.00 11.44 ? 133 TRP B CE3   1 
ATOM   2945 C CZ2   . TRP B  1 151 ? -12.547 43.042 12.811  1.00 11.71 ? 133 TRP B CZ2   1 
ATOM   2946 C CZ3   . TRP B  1 151 ? -13.195 44.275 14.816  1.00 11.88 ? 133 TRP B CZ3   1 
ATOM   2947 C CH2   . TRP B  1 151 ? -13.498 43.688 13.564  1.00 12.04 ? 133 TRP B CH2   1 
ATOM   2948 N N     . ILE B  1 152 ? -8.145  40.449 16.289  1.00 12.53 ? 134 ILE B N     1 
ATOM   2949 C CA    . ILE B  1 152 ? -7.291  39.288 15.982  1.00 12.56 ? 134 ILE B CA    1 
ATOM   2950 C C     . ILE B  1 152 ? -7.831  38.644 14.700  1.00 12.43 ? 134 ILE B C     1 
ATOM   2951 O O     . ILE B  1 152 ? -8.825  37.899 14.742  1.00 13.07 ? 134 ILE B O     1 
ATOM   2952 C CB    . ILE B  1 152 ? -7.300  38.246 17.123  1.00 13.32 ? 134 ILE B CB    1 
ATOM   2953 C CG1   . ILE B  1 152 ? -7.022  38.935 18.503  1.00 13.78 ? 134 ILE B CG1   1 
ATOM   2954 C CG2   . ILE B  1 152 ? -6.257  37.186 16.872  1.00 13.84 ? 134 ILE B CG2   1 
ATOM   2955 C CD1   . ILE B  1 152 ? -7.268  38.003 19.650  1.00 14.62 ? 134 ILE B CD1   1 
ATOM   2956 N N     . GLN B  1 153 ? -7.210  38.926 13.546  1.00 11.92 ? 135 GLN B N     1 
ATOM   2957 C CA    . GLN B  1 153 ? -7.819  38.535 12.280  1.00 12.09 ? 135 GLN B CA    1 
ATOM   2958 C C     . GLN B  1 153 ? -6.784  37.782 11.419  1.00 12.03 ? 135 GLN B C     1 
ATOM   2959 O O     . GLN B  1 153 ? -5.653  38.271 11.230  1.00 11.91 ? 135 GLN B O     1 
ATOM   2960 C CB    . GLN B  1 153 ? -8.375  39.732 11.496  1.00 11.83 ? 135 GLN B CB    1 
ATOM   2961 C CG    . GLN B  1 153 ? -8.898  39.353 10.153  1.00 11.99 ? 135 GLN B CG    1 
ATOM   2962 C CD    . GLN B  1 153 ? -9.975  40.234 9.598   1.00 12.30 ? 135 GLN B CD    1 
ATOM   2963 O OE1   . GLN B  1 153 ? -10.352 41.219 10.220  1.00 12.35 ? 135 GLN B OE1   1 
ATOM   2964 N NE2   . GLN B  1 153 ? -10.446 39.904 8.414   1.00 12.71 ? 135 GLN B NE2   1 
ATOM   2965 N N     . TRP B  1 154 ? -7.178  36.614 10.935  1.00 12.78 ? 136 TRP B N     1 
ATOM   2966 C CA    . TRP B  1 154 ? -6.341  35.833 9.990   1.00 12.77 ? 136 TRP B CA    1 
ATOM   2967 C C     . TRP B  1 154 ? -4.962  35.565 10.582  1.00 13.16 ? 136 TRP B C     1 
ATOM   2968 O O     . TRP B  1 154 ? -3.917  35.623 9.895   1.00 13.53 ? 136 TRP B O     1 
ATOM   2969 C CB    . TRP B  1 154 ? -6.332  36.439 8.569   1.00 12.49 ? 136 TRP B CB    1 
ATOM   2970 C CG    . TRP B  1 154 ? -7.575  36.065 7.801   1.00 12.63 ? 136 TRP B CG    1 
ATOM   2971 C CD1   . TRP B  1 154 ? -8.193  34.871 7.804   1.00 13.51 ? 136 TRP B CD1   1 
ATOM   2972 C CD2   . TRP B  1 154 ? -8.347  36.916 6.940   1.00 12.44 ? 136 TRP B CD2   1 
ATOM   2973 N NE1   . TRP B  1 154 ? -9.323  34.903 7.013   1.00 14.09 ? 136 TRP B NE1   1 
ATOM   2974 C CE2   . TRP B  1 154 ? -9.430  36.152 6.453   1.00 13.31 ? 136 TRP B CE2   1 
ATOM   2975 C CE3   . TRP B  1 154 ? -8.207  38.241 6.487   1.00 12.03 ? 136 TRP B CE3   1 
ATOM   2976 C CZ2   . TRP B  1 154 ? -10.388 36.679 5.583   1.00 13.47 ? 136 TRP B CZ2   1 
ATOM   2977 C CZ3   . TRP B  1 154 ? -9.150  38.760 5.619   1.00 11.95 ? 136 TRP B CZ3   1 
ATOM   2978 C CH2   . TRP B  1 154 ? -10.218 38.001 5.176   1.00 12.96 ? 136 TRP B CH2   1 
ATOM   2979 N N     . VAL B  1 155 ? -4.961  35.195 11.884  1.00 13.15 ? 137 VAL B N     1 
ATOM   2980 C CA    . VAL B  1 155 ? -3.732  34.743 12.526  1.00 13.46 ? 137 VAL B CA    1 
ATOM   2981 C C     . VAL B  1 155 ? -3.942  33.642 13.565  1.00 14.12 ? 137 VAL B C     1 
ATOM   2982 O O     . VAL B  1 155 ? -2.973  33.010 13.944  1.00 14.67 ? 137 VAL B O     1 
ATOM   2983 C CB    . VAL B  1 155 ? -3.014  35.975 13.149  1.00 13.15 ? 137 VAL B CB    1 
ATOM   2984 C CG1   . VAL B  1 155 ? -3.790  36.554 14.325  1.00 13.33 ? 137 VAL B CG1   1 
ATOM   2985 C CG2   . VAL B  1 155 ? -1.575  35.636 13.570  1.00 13.75 ? 137 VAL B CG2   1 
ATOM   2986 N N     . ILE B  1 156 ? -5.182  33.401 14.049  1.00 14.28 ? 138 ILE B N     1 
ATOM   2987 C CA    . ILE B  1 156 ? -5.320  32.407 15.127  1.00 15.25 ? 138 ILE B CA    1 
ATOM   2988 C C     . ILE B  1 156 ? -4.855  31.024 14.708  1.00 15.93 ? 138 ILE B C     1 
ATOM   2989 O O     . ILE B  1 156 ? -4.506  30.201 15.551  1.00 16.72 ? 138 ILE B O     1 
ATOM   2990 C CB    . ILE B  1 156 ? -6.747  32.280 15.712  1.00 15.66 ? 138 ILE B CB    1 
ATOM   2991 C CG1   . ILE B  1 156 ? -7.765  31.654 14.771  1.00 16.05 ? 138 ILE B CG1   1 
ATOM   2992 C CG2   . ILE B  1 156 ? -7.179  33.636 16.233  1.00 14.85 ? 138 ILE B CG2   1 
ATOM   2993 C CD1   . ILE B  1 156 ? -9.062  31.237 15.463  1.00 17.14 ? 138 ILE B CD1   1 
ATOM   2994 N N     . GLY B  1 157 ? -4.894  30.726 13.428  1.00 15.69 ? 139 GLY B N     1 
ATOM   2995 C CA    . GLY B  1 157 ? -4.405  29.434 12.944  1.00 16.69 ? 139 GLY B CA    1 
ATOM   2996 C C     . GLY B  1 157 ? -2.904  29.209 13.039  1.00 16.85 ? 139 GLY B C     1 
ATOM   2997 O O     . GLY B  1 157 ? -2.433  28.092 12.815  1.00 17.89 ? 139 GLY B O     1 
ATOM   2998 N N     . HIS B  1 158 ? -2.171  30.266 13.409  1.00 16.26 ? 140 HIS B N     1 
ATOM   2999 C CA    . HIS B  1 158 ? -0.742  30.198 13.626  1.00 16.72 ? 140 HIS B CA    1 
ATOM   3000 C C     . HIS B  1 158 ? -0.340  29.872 15.044  1.00 18.19 ? 140 HIS B C     1 
ATOM   3001 O O     . HIS B  1 158 ? 0.830   29.695 15.296  1.00 18.17 ? 140 HIS B O     1 
ATOM   3002 C CB    . HIS B  1 158 ? -0.054  31.445 13.121  1.00 15.47 ? 140 HIS B CB    1 
ATOM   3003 C CG    . HIS B  1 158 ? 0.153   31.423 11.650  1.00 14.81 ? 140 HIS B CG    1 
ATOM   3004 N ND1   . HIS B  1 158 ? 0.914   30.455 11.045  1.00 15.28 ? 140 HIS B ND1   1 
ATOM   3005 C CD2   . HIS B  1 158 ? -0.344  32.195 10.644  1.00 13.76 ? 140 HIS B CD2   1 
ATOM   3006 C CE1   . HIS B  1 158 ? 0.913   30.649 9.734   1.00 14.88 ? 140 HIS B CE1   1 
ATOM   3007 N NE2   . HIS B  1 158 ? 0.184   31.718 9.469   1.00 14.07 ? 140 HIS B NE2   1 
ATOM   3008 N N     . LEU B  1 159 ? -1.344  29.747 15.923  1.00 19.26 ? 141 LEU B N     1 
ATOM   3009 C CA    . LEU B  1 159 ? -1.131  29.298 17.276  1.00 20.86 ? 141 LEU B CA    1 
ATOM   3010 C C     . LEU B  1 159 ? -1.678  27.930 17.545  1.00 21.81 ? 141 LEU B C     1 
ATOM   3011 O O     . LEU B  1 159 ? -2.719  27.566 17.033  1.00 21.79 ? 141 LEU B O     1 
ATOM   3012 C CB    . LEU B  1 159 ? -1.789  30.284 18.243  1.00 21.82 ? 141 LEU B CB    1 
ATOM   3013 C CG    . LEU B  1 159 ? -0.828  31.378 18.758  1.00 22.34 ? 141 LEU B CG    1 
ATOM   3014 C CD1   . LEU B  1 159 ? -0.293  32.201 17.663  1.00 21.72 ? 141 LEU B CD1   1 
ATOM   3015 C CD2   . LEU B  1 159 ? -1.559  32.305 19.734  1.00 23.33 ? 141 LEU B CD2   1 
ATOM   3016 N N     . THR B  1 160 ? -1.003  27.198 18.416  1.00 22.82 ? 142 THR B N     1 
ATOM   3017 C CA    . THR B  1 160 ? -1.540  25.911 18.956  1.00 24.34 ? 142 THR B CA    1 
ATOM   3018 C C     . THR B  1 160 ? -2.768  26.207 19.776  1.00 24.69 ? 142 THR B C     1 
ATOM   3019 O O     . THR B  1 160 ? -2.950  27.360 20.202  1.00 23.53 ? 142 THR B O     1 
ATOM   3020 C CB    . THR B  1 160 ? -0.536  25.184 19.876  1.00 26.01 ? 142 THR B CB    1 
ATOM   3021 O OG1   . THR B  1 160 ? -0.283  25.987 21.038  1.00 25.85 ? 142 THR B OG1   1 
ATOM   3022 C CG2   . THR B  1 160 ? 0.778   24.882 19.142  1.00 26.10 ? 142 THR B CG2   1 
ATOM   3023 N N     . ASP B  1 161 ? -3.619  25.200 19.983  1.00 26.15 ? 143 ASP B N     1 
ATOM   3024 C CA    . ASP B  1 161 ? -4.812  25.398 20.852  1.00 27.01 ? 143 ASP B CA    1 
ATOM   3025 C C     . ASP B  1 161 ? -4.437  25.962 22.220  1.00 27.83 ? 143 ASP B C     1 
ATOM   3026 O O     . ASP B  1 161 ? -5.064  26.913 22.709  1.00 27.13 ? 143 ASP B O     1 
ATOM   3027 C CB    . ASP B  1 161 ? -5.543  24.075 21.049  1.00 28.94 ? 143 ASP B CB    1 
ATOM   3028 C CG    . ASP B  1 161 ? -6.132  23.517 19.772  1.00 28.86 ? 143 ASP B CG    1 
ATOM   3029 O OD1   . ASP B  1 161 ? -6.324  24.290 18.782  1.00 27.65 ? 143 ASP B OD1   1 
ATOM   3030 O OD2   . ASP B  1 161 ? -6.415  22.301 19.771  1.00 30.44 ? 143 ASP B OD2   1 
ATOM   3031 N N     . GLN B  1 162 ? -3.440  25.346 22.864  1.00 29.61 ? 144 GLN B N     1 
ATOM   3032 C CA    . GLN B  1 162 ? -2.996  25.836 24.176  1.00 31.02 ? 144 GLN B CA    1 
ATOM   3033 C C     . GLN B  1 162 ? -2.485  27.279 24.124  1.00 28.66 ? 144 GLN B C     1 
ATOM   3034 O O     . GLN B  1 162 ? -2.860  28.126 24.964  1.00 28.06 ? 144 GLN B O     1 
ATOM   3035 C CB    . GLN B  1 162 ? -1.921  24.942 24.799  1.00 34.38 ? 144 GLN B CB    1 
ATOM   3036 C CG    . GLN B  1 162 ? -1.744  25.246 26.258  1.00 37.85 ? 144 GLN B CG    1 
ATOM   3037 C CD    . GLN B  1 162 ? -0.619  24.492 26.902  1.00 41.82 ? 144 GLN B CD    1 
ATOM   3038 O OE1   . GLN B  1 162 ? -0.182  23.445 26.431  1.00 46.72 ? 144 GLN B OE1   1 
ATOM   3039 N NE2   . GLN B  1 162 ? -0.157  25.005 28.009  1.00 44.56 ? 144 GLN B NE2   1 
ATOM   3040 N N     . HIS B  1 163 ? -1.663  27.593 23.146  1.00 26.94 ? 145 HIS B N     1 
ATOM   3041 C CA    . HIS B  1 163 ? -1.176  28.982 23.037  1.00 25.40 ? 145 HIS B CA    1 
ATOM   3042 C C     . HIS B  1 163 ? -2.239  29.971 22.720  1.00 23.72 ? 145 HIS B C     1 
ATOM   3043 O O     . HIS B  1 163 ? -2.201  31.098 23.225  1.00 23.33 ? 145 HIS B O     1 
ATOM   3044 C CB    . HIS B  1 163 ? 0.002   29.101 22.050  1.00 24.77 ? 145 HIS B CB    1 
ATOM   3045 C CG    . HIS B  1 163 ? 1.264   28.478 22.569  1.00 26.42 ? 145 HIS B CG    1 
ATOM   3046 N ND1   . HIS B  1 163 ? 2.273   28.038 21.742  1.00 26.54 ? 145 HIS B ND1   1 
ATOM   3047 C CD2   . HIS B  1 163 ? 1.695   28.270 23.836  1.00 28.11 ? 145 HIS B CD2   1 
ATOM   3048 C CE1   . HIS B  1 163 ? 3.267   27.577 22.476  1.00 28.37 ? 145 HIS B CE1   1 
ATOM   3049 N NE2   . HIS B  1 163 ? 2.920   27.667 23.756  1.00 29.46 ? 145 HIS B NE2   1 
ATOM   3050 N N     . LEU B  1 164 ? -3.217  29.572 21.922  1.00 22.92 ? 146 LEU B N     1 
ATOM   3051 C CA    . LEU B  1 164 ? -4.352  30.453 21.625  1.00 21.70 ? 146 LEU B CA    1 
ATOM   3052 C C     . LEU B  1 164 ? -5.207  30.732 22.869  1.00 22.50 ? 146 LEU B C     1 
ATOM   3053 O O     . LEU B  1 164 ? -5.538  31.893 23.142  1.00 21.77 ? 146 LEU B O     1 
ATOM   3054 C CB    . LEU B  1 164 ? -5.211  29.837 20.527  1.00 21.39 ? 146 LEU B CB    1 
ATOM   3055 C CG    . LEU B  1 164 ? -6.394  30.697 20.071  1.00 20.39 ? 146 LEU B CG    1 
ATOM   3056 C CD1   . LEU B  1 164 ? -5.991  32.111 19.616  1.00 19.14 ? 146 LEU B CD1   1 
ATOM   3057 C CD2   . LEU B  1 164 ? -7.110  29.911 18.971  1.00 20.41 ? 146 LEU B CD2   1 
ATOM   3058 N N     . ALA B  1 165 ? -5.507  29.681 23.617  1.00 23.96 ? 147 ALA B N     1 
ATOM   3059 C CA    . ALA B  1 165 ? -6.286  29.847 24.875  1.00 25.09 ? 147 ALA B CA    1 
ATOM   3060 C C     . ALA B  1 165 ? -5.523  30.742 25.845  1.00 25.25 ? 147 ALA B C     1 
ATOM   3061 O O     . ALA B  1 165 ? -6.122  31.648 26.434  1.00 24.99 ? 147 ALA B O     1 
ATOM   3062 C CB    . ALA B  1 165 ? -6.611  28.514 25.525  1.00 27.20 ? 147 ALA B CB    1 
ATOM   3063 N N     . GLU B  1 166 ? -4.206  30.518 25.980  1.00 25.78 ? 148 GLU B N     1 
ATOM   3064 C CA    . GLU B  1 166 ? -3.360  31.320 26.881  1.00 26.38 ? 148 GLU B CA    1 
ATOM   3065 C C     . GLU B  1 166 ? -3.283  32.777 26.423  1.00 24.88 ? 148 GLU B C     1 
ATOM   3066 O O     . GLU B  1 166 ? -3.366  33.733 27.281  1.00 25.21 ? 148 GLU B O     1 
ATOM   3067 C CB    . GLU B  1 166 ? -1.953  30.699 27.062  1.00 27.67 ? 148 GLU B CB    1 
ATOM   3068 C CG    . GLU B  1 166 ? -2.032  29.405 27.846  1.00 29.91 ? 148 GLU B CG    1 
ATOM   3069 C CD    . GLU B  1 166 ? -0.757  28.585 27.939  1.00 31.55 ? 148 GLU B CD    1 
ATOM   3070 O OE1   . GLU B  1 166 ? 0.195   28.807 27.188  1.00 31.11 ? 148 GLU B OE1   1 
ATOM   3071 O OE2   . GLU B  1 166 ? -0.737  27.668 28.765  1.00 33.45 ? 148 GLU B OE2   1 
ATOM   3072 N N     . PHE B  1 167 ? -3.120  32.952 25.099  1.00 23.26 ? 149 PHE B N     1 
ATOM   3073 C CA    . PHE B  1 167 ? -3.072  34.305 24.583  1.00 22.04 ? 149 PHE B CA    1 
ATOM   3074 C C     . PHE B  1 167 ? -4.405  35.069 24.833  1.00 21.52 ? 149 PHE B C     1 
ATOM   3075 O O     . PHE B  1 167 ? -4.426  36.264 25.218  1.00 21.41 ? 149 PHE B O     1 
ATOM   3076 C CB    . PHE B  1 167 ? -2.735  34.313 23.119  1.00 20.93 ? 149 PHE B CB    1 
ATOM   3077 C CG    . PHE B  1 167 ? -2.738  35.707 22.535  1.00 19.59 ? 149 PHE B CG    1 
ATOM   3078 C CD1   . PHE B  1 167 ? -1.804  36.635 22.925  1.00 19.76 ? 149 PHE B CD1   1 
ATOM   3079 C CD2   . PHE B  1 167 ? -3.649  36.069 21.577  1.00 18.58 ? 149 PHE B CD2   1 
ATOM   3080 C CE1   . PHE B  1 167 ? -1.816  37.919 22.393  1.00 18.94 ? 149 PHE B CE1   1 
ATOM   3081 C CE2   . PHE B  1 167 ? -3.647  37.348 21.023  1.00 17.58 ? 149 PHE B CE2   1 
ATOM   3082 C CZ    . PHE B  1 167 ? -2.717  38.274 21.410  1.00 17.75 ? 149 PHE B CZ    1 
ATOM   3083 N N     . LEU B  1 168 ? -5.511  34.397 24.572  1.00 21.44 ? 150 LEU B N     1 
ATOM   3084 C CA    . LEU B  1 168 ? -6.810  35.018 24.782  1.00 21.42 ? 150 LEU B CA    1 
ATOM   3085 C C     . LEU B  1 168 ? -7.001  35.401 26.241  1.00 22.70 ? 150 LEU B C     1 
ATOM   3086 O O     . LEU B  1 168 ? -7.591  36.455 26.519  1.00 22.54 ? 150 LEU B O     1 
ATOM   3087 C CB    . LEU B  1 168 ? -7.951  34.144 24.277  1.00 21.57 ? 150 LEU B CB    1 
ATOM   3088 C CG    . LEU B  1 168 ? -8.052  34.044 22.766  1.00 20.69 ? 150 LEU B CG    1 
ATOM   3089 C CD1   . LEU B  1 168 ? -8.992  32.906 22.354  1.00 21.46 ? 150 LEU B CD1   1 
ATOM   3090 C CD2   . LEU B  1 168 ? -8.452  35.374 22.122  1.00 19.21 ? 150 LEU B CD2   1 
ATOM   3091 N N     . ARG B  1 169 ? -6.539  34.580 27.171  1.00 24.38 ? 151 ARG B N     1 
ATOM   3092 C CA    A ARG B  1 169 ? -6.676  34.911 28.584  0.50 25.52 ? 151 ARG B CA    1 
ATOM   3093 C CA    B ARG B  1 169 ? -6.629  34.871 28.610  0.50 25.95 ? 151 ARG B CA    1 
ATOM   3094 C C     . ARG B  1 169 ? -5.834  36.131 28.915  1.00 25.31 ? 151 ARG B C     1 
ATOM   3095 O O     . ARG B  1 169 ? -6.299  37.029 29.650  1.00 24.98 ? 151 ARG B O     1 
ATOM   3096 C CB    A ARG B  1 169 ? -6.318  33.724 29.465  0.50 27.38 ? 151 ARG B CB    1 
ATOM   3097 C CB    B ARG B  1 169 ? -6.104  33.710 29.477  0.50 28.33 ? 151 ARG B CB    1 
ATOM   3098 C CG    A ARG B  1 169 ? -6.689  33.879 30.929  0.50 28.88 ? 151 ARG B CG    1 
ATOM   3099 C CG    B ARG B  1 169 ? -6.923  32.422 29.470  0.50 29.71 ? 151 ARG B CG    1 
ATOM   3100 C CD    A ARG B  1 169 ? -6.422  32.574 31.652  0.50 30.82 ? 151 ARG B CD    1 
ATOM   3101 C CD    B ARG B  1 169 ? -6.263  31.257 30.229  0.50 32.26 ? 151 ARG B CD    1 
ATOM   3102 N NE    A ARG B  1 169 ? -7.455  31.577 31.375  0.50 31.09 ? 151 ARG B NE    1 
ATOM   3103 N NE    B ARG B  1 169 ? -6.758  29.969 29.743  0.50 33.18 ? 151 ARG B NE    1 
ATOM   3104 C CZ    A ARG B  1 169 ? -8.618  31.570 32.031  0.50 31.57 ? 151 ARG B CZ    1 
ATOM   3105 C CZ    B ARG B  1 169 ? -6.049  28.858 29.711  0.50 34.83 ? 151 ARG B CZ    1 
ATOM   3106 N NH1   A ARG B  1 169 ? -8.808  32.490 32.932  0.50 31.85 ? 151 ARG B NH1   1 
ATOM   3107 N NH1   B ARG B  1 169 ? -6.598  27.741 29.247  0.50 35.53 ? 151 ARG B NH1   1 
ATOM   3108 N NH2   A ARG B  1 169 ? -9.569  30.693 31.768  0.50 31.93 ? 151 ARG B NH2   1 
ATOM   3109 N NH2   B ARG B  1 169 ? -4.801  28.848 30.173  0.50 35.65 ? 151 ARG B NH2   1 
ATOM   3110 N N     . ARG B  1 170 ? -4.631  36.210 28.342  1.00 24.63 ? 152 ARG B N     1 
ATOM   3111 C CA    . ARG B  1 170 ? -3.816  37.423 28.520  1.00 24.46 ? 152 ARG B CA    1 
ATOM   3112 C C     . ARG B  1 170 ? -4.524  38.644 27.945  1.00 23.05 ? 152 ARG B C     1 
ATOM   3113 O O     . ARG B  1 170 ? -4.509  39.702 28.549  1.00 23.22 ? 152 ARG B O     1 
ATOM   3114 C CB    . ARG B  1 170 ? -2.421  37.295 27.926  1.00 24.06 ? 152 ARG B CB    1 
ATOM   3115 C CG    . ARG B  1 170 ? -1.593  36.231 28.618  1.00 25.71 ? 152 ARG B CG    1 
ATOM   3116 C CD    . ARG B  1 170 ? -0.096  36.292 28.313  1.00 25.95 ? 152 ARG B CD    1 
ATOM   3117 N NE    . ARG B  1 170 ? 0.240   36.110 26.890  1.00 24.30 ? 152 ARG B NE    1 
ATOM   3118 C CZ    . ARG B  1 170 ? 0.358   34.942 26.258  1.00 24.34 ? 152 ARG B CZ    1 
ATOM   3119 N NH1   . ARG B  1 170 ? 0.180   33.767 26.890  1.00 25.98 ? 152 ARG B NH1   1 
ATOM   3120 N NH2   . ARG B  1 170 ? 0.672   34.929 24.964  1.00 23.12 ? 152 ARG B NH2   1 
ATOM   3121 N N     . CYS B  1 171 ? -5.158  38.491 26.796  1.00 21.71 ? 153 CYS B N     1 
ATOM   3122 C CA    . CYS B  1 171 ? -5.898  39.590 26.184  1.00 20.72 ? 153 CYS B CA    1 
ATOM   3123 C C     . CYS B  1 171 ? -7.018  40.108 27.074  1.00 21.19 ? 153 CYS B C     1 
ATOM   3124 O O     . CYS B  1 171 ? -7.228  41.349 27.184  1.00 21.03 ? 153 CYS B O     1 
ATOM   3125 C CB    . CYS B  1 171 ? -6.483  39.185 24.824  1.00 19.94 ? 153 CYS B CB    1 
ATOM   3126 S SG    . CYS B  1 171 ? -5.287  39.065 23.489  1.00 19.81 ? 153 CYS B SG    1 
ATOM   3127 N N     . LYS B  1 172 ? -7.721  39.183 27.716  1.00 21.96 ? 154 LYS B N     1 
ATOM   3128 C CA    . LYS B  1 172 ? -8.843  39.534 28.575  1.00 23.08 ? 154 LYS B CA    1 
ATOM   3129 C C     . LYS B  1 172 ? -8.380  40.501 29.652  1.00 24.11 ? 154 LYS B C     1 
ATOM   3130 O O     . LYS B  1 172 ? -9.088  41.481 29.936  1.00 23.75 ? 154 LYS B O     1 
ATOM   3131 C CB    . LYS B  1 172 ? -9.450  38.279 29.183  1.00 24.45 ? 154 LYS B CB    1 
ATOM   3132 C CG    . LYS B  1 172 ? -10.672 38.528 30.083  1.00 25.13 ? 154 LYS B CG    1 
ATOM   3133 C CD    . LYS B  1 172 ? -11.097 37.252 30.792  1.00 27.09 ? 154 LYS B CD    1 
ATOM   3134 N N     . GLY B  1 173 ? -7.202  40.212 30.241  1.00 25.38 ? 155 GLY B N     1 
ATOM   3135 C CA    . GLY B  1 173 ? -6.588  41.051 31.259  1.00 27.03 ? 155 GLY B CA    1 
ATOM   3136 C C     . GLY B  1 173 ? -6.178  42.445 30.805  1.00 26.57 ? 155 GLY B C     1 
ATOM   3137 O O     . GLY B  1 173 ? -5.935  43.305 31.630  1.00 27.69 ? 155 GLY B O     1 
ATOM   3138 N N     . SER B  1 174 ? -6.039  42.642 29.506  1.00 24.72 ? 156 SER B N     1 
ATOM   3139 C CA    . SER B  1 174 ? -5.592  43.925 28.955  1.00 24.28 ? 156 SER B CA    1 
ATOM   3140 C C     . SER B  1 174 ? -6.758  44.795 28.486  1.00 22.71 ? 156 SER B C     1 
ATOM   3141 O O     . SER B  1 174 ? -6.563  45.905 28.047  1.00 22.95 ? 156 SER B O     1 
ATOM   3142 C CB    . SER B  1 174 ? -4.560  43.732 27.863  1.00 24.02 ? 156 SER B CB    1 
ATOM   3143 O OG    . SER B  1 174 ? -5.110  43.401 26.706  1.00 23.08 ? 156 SER B OG    1 
ATOM   3144 N N     . LEU B  1 175 ? -7.978  44.286 28.572  1.00 22.16 ? 157 LEU B N     1 
ATOM   3145 C CA    . LEU B  1 175 ? -9.147  45.082 28.192  1.00 21.14 ? 157 LEU B CA    1 
ATOM   3146 C C     . LEU B  1 175 ? -9.439  46.183 29.216  1.00 22.02 ? 157 LEU B C     1 
ATOM   3147 O O     . LEU B  1 175 ? -9.444  45.979 30.462  1.00 23.26 ? 157 LEU B O     1 
ATOM   3148 C CB    . LEU B  1 175 ? -10.365 44.195 28.007  1.00 20.73 ? 157 LEU B CB    1 
ATOM   3149 C CG    . LEU B  1 175 ? -10.295 43.228 26.862  1.00 19.98 ? 157 LEU B CG    1 
ATOM   3150 C CD1   . LEU B  1 175 ? -11.476 42.278 26.941  1.00 20.60 ? 157 LEU B CD1   1 
ATOM   3151 C CD2   . LEU B  1 175 ? -10.255 43.986 25.541  1.00 18.62 ? 157 LEU B CD2   1 
ATOM   3152 N N     . ARG B  1 176 ? -9.742  47.352 28.685  1.00 21.82 ? 158 ARG B N     1 
ATOM   3153 C CA    . ARG B  1 176 ? -10.391 48.413 29.449  1.00 23.09 ? 158 ARG B CA    1 
ATOM   3154 C C     . ARG B  1 176 ? -11.865 48.028 29.785  1.00 22.85 ? 158 ARG B C     1 
ATOM   3155 O O     . ARG B  1 176 ? -12.452 47.093 29.192  1.00 21.77 ? 158 ARG B O     1 
ATOM   3156 C CB    . ARG B  1 176 ? -10.339 49.757 28.665  1.00 23.92 ? 158 ARG B CB    1 
ATOM   3157 C CG    . ARG B  1 176 ? -8.911  50.346 28.503  1.00 26.02 ? 158 ARG B CG    1 
ATOM   3158 C CD    . ARG B  1 176 ? -8.791  51.663 27.673  1.00 27.79 ? 158 ARG B CD    1 
ATOM   3159 N NE    . ARG B  1 176 ? -9.213  52.912 28.341  1.00 30.42 ? 158 ARG B NE    1 
ATOM   3160 C CZ    . ARG B  1 176 ? -8.615  53.472 29.398  1.00 34.01 ? 158 ARG B CZ    1 
ATOM   3161 N N     . PRO B  1 177 ? -12.496 48.777 30.706  1.00 23.61 ? 159 PRO B N     1 
ATOM   3162 C CA    . PRO B  1 177 ? -13.898 48.411 30.990  1.00 23.63 ? 159 PRO B CA    1 
ATOM   3163 C C     . PRO B  1 177 ? -14.742 48.486 29.731  1.00 21.86 ? 159 PRO B C     1 
ATOM   3164 O O     . PRO B  1 177 ? -14.571 49.420 28.920  1.00 21.37 ? 159 PRO B O     1 
ATOM   3165 C CB    . PRO B  1 177 ? -14.335 49.450 32.014  1.00 24.91 ? 159 PRO B CB    1 
ATOM   3166 C CG    . PRO B  1 177 ? -13.020 49.782 32.743  1.00 25.98 ? 159 PRO B CG    1 
ATOM   3167 C CD    . PRO B  1 177 ? -11.994 49.809 31.638  1.00 25.04 ? 159 PRO B CD    1 
ATOM   3168 N N     . ASN B  1 178 ? -15.623 47.508 29.586  1.00 21.56 ? 160 ASN B N     1 
ATOM   3169 C CA    . ASN B  1 178 ? -16.503 47.341 28.424  1.00 20.82 ? 160 ASN B CA    1 
ATOM   3170 C C     . ASN B  1 178 ? -15.768 46.987 27.142  1.00 19.08 ? 160 ASN B C     1 
ATOM   3171 O O     . ASN B  1 178 ? -16.404 46.864 26.130  1.00 18.22 ? 160 ASN B O     1 
ATOM   3172 C CB    . ASN B  1 178 ? -17.385 48.573 28.152  1.00 21.39 ? 160 ASN B CB    1 
ATOM   3173 C CG    . ASN B  1 178 ? -18.189 48.985 29.380  1.00 22.76 ? 160 ASN B CG    1 
ATOM   3174 O OD1   . ASN B  1 178 ? -18.551 48.175 30.196  1.00 24.15 ? 160 ASN B OD1   1 
ATOM   3175 N ND2   . ASN B  1 178 ? -18.488 50.266 29.493  1.00 23.73 ? 160 ASN B ND2   1 
ATOM   3176 N N     . GLY B  1 179 ? -14.470 46.734 27.232  1.00 18.27 ? 161 GLY B N     1 
ATOM   3177 C CA    . GLY B  1 179 ? -13.671 46.377 26.067  1.00 17.09 ? 161 GLY B CA    1 
ATOM   3178 C C     . GLY B  1 179 ? -14.055 45.022 25.554  1.00 16.81 ? 161 GLY B C     1 
ATOM   3179 O O     . GLY B  1 179 ? -14.668 44.218 26.317  1.00 17.87 ? 161 GLY B O     1 
ATOM   3180 N N     . ILE B  1 180 ? -13.716 44.767 24.295  1.00 15.71 ? 162 ILE B N     1 
ATOM   3181 C CA    . ILE B  1 180 ? -13.949 43.467 23.665  1.00 15.51 ? 162 ILE B CA    1 
ATOM   3182 C C     . ILE B  1 180 ? -12.746 42.976 22.889  1.00 15.17 ? 162 ILE B C     1 
ATOM   3183 O O     . ILE B  1 180 ? -11.913 43.782 22.399  1.00 14.84 ? 162 ILE B O     1 
ATOM   3184 C CB    . ILE B  1 180 ? -15.156 43.489 22.725  1.00 15.14 ? 162 ILE B CB    1 
ATOM   3185 C CG1   . ILE B  1 180 ? -14.933 44.423 21.532  1.00 14.19 ? 162 ILE B CG1   1 
ATOM   3186 C CG2   . ILE B  1 180 ? -16.420 43.842 23.499  1.00 15.89 ? 162 ILE B CG2   1 
ATOM   3187 C CD1   . ILE B  1 180 ? -16.021 44.372 20.463  1.00 13.94 ? 162 ILE B CD1   1 
ATOM   3188 N N     . ILE B  1 181 ? -12.727 41.653 22.713  1.00 15.45 ? 163 ILE B N     1 
ATOM   3189 C CA    . ILE B  1 181 ? -11.806 40.978 21.779  1.00 15.31 ? 163 ILE B CA    1 
ATOM   3190 C C     . ILE B  1 181 ? -12.644 40.551 20.585  1.00 14.82 ? 163 ILE B C     1 
ATOM   3191 O O     . ILE B  1 181 ? -13.755 40.010 20.755  1.00 15.51 ? 163 ILE B O     1 
ATOM   3192 C CB    . ILE B  1 181 ? -11.186 39.742 22.465  1.00 16.44 ? 163 ILE B CB    1 
ATOM   3193 C CG1   . ILE B  1 181 ? -10.267 40.185 23.627  1.00 17.29 ? 163 ILE B CG1   1 
ATOM   3194 C CG2   . ILE B  1 181 ? -10.403 38.919 21.469  1.00 16.26 ? 163 ILE B CG2   1 
ATOM   3195 C CD1   . ILE B  1 181 ? -10.058 39.159 24.702  1.00 18.82 ? 163 ILE B CD1   1 
ATOM   3196 N N     . VAL B  1 182 ? -12.131 40.769 19.382  1.00 14.25 ? 164 VAL B N     1 
ATOM   3197 C CA    . VAL B  1 182 ? -12.765 40.235 18.176  1.00 14.19 ? 164 VAL B CA    1 
ATOM   3198 C C     . VAL B  1 182 ? -11.789 39.266 17.522  1.00 13.97 ? 164 VAL B C     1 
ATOM   3199 O O     . VAL B  1 182 ? -10.603 39.634 17.251  1.00 13.63 ? 164 VAL B O     1 
ATOM   3200 C CB    . VAL B  1 182 ? -13.156 41.353 17.162  1.00 13.53 ? 164 VAL B CB    1 
ATOM   3201 C CG1   . VAL B  1 182 ? -13.742 40.744 15.910  1.00 13.76 ? 164 VAL B CG1   1 
ATOM   3202 C CG2   . VAL B  1 182 ? -14.188 42.280 17.812  1.00 13.81 ? 164 VAL B CG2   1 
ATOM   3203 N N     . ILE B  1 183 ? -12.284 38.068 17.249  1.00 14.50 ? 165 ILE B N     1 
ATOM   3204 C CA    . ILE B  1 183 ? -11.581 37.115 16.387  1.00 14.33 ? 165 ILE B CA    1 
ATOM   3205 C C     . ILE B  1 183 ? -12.292 37.078 15.061  1.00 14.34 ? 165 ILE B C     1 
ATOM   3206 O O     . ILE B  1 183 ? -13.484 36.898 15.017  1.00 14.86 ? 165 ILE B O     1 
ATOM   3207 C CB    . ILE B  1 183 ? -11.574 35.720 16.996  1.00 15.69 ? 165 ILE B CB    1 
ATOM   3208 C CG1   . ILE B  1 183 ? -10.751 35.707 18.318  1.00 16.20 ? 165 ILE B CG1   1 
ATOM   3209 C CG2   . ILE B  1 183 ? -11.057 34.699 16.007  1.00 16.04 ? 165 ILE B CG2   1 
ATOM   3210 C CD1   . ILE B  1 183 ? -10.862 34.434 19.105  1.00 17.69 ? 165 ILE B CD1   1 
ATOM   3211 N N     . LYS B  1 184 ? -11.557 37.213 13.974  1.00 13.65 ? 166 LYS B N     1 
ATOM   3212 C CA    . LYS B  1 184 ? -12.172 37.032 12.646  1.00 14.11 ? 166 LYS B CA    1 
ATOM   3213 C C     . LYS B  1 184 ? -11.216 36.144 11.841  1.00 14.34 ? 166 LYS B C     1 
ATOM   3214 O O     . LYS B  1 184 ? -10.020 36.452 11.680  1.00 13.71 ? 166 LYS B O     1 
ATOM   3215 C CB    . LYS B  1 184 ? -12.397 38.374 11.979  1.00 13.56 ? 166 LYS B CB    1 
ATOM   3216 C CG    . LYS B  1 184 ? -13.059 38.234 10.610  1.00 13.98 ? 166 LYS B CG    1 
ATOM   3217 C CD    . LYS B  1 184 ? -13.634 39.571 10.093  1.00 13.72 ? 166 LYS B CD    1 
ATOM   3218 C CE    . LYS B  1 184 ? -14.400 39.303 8.787   1.00 14.10 ? 166 LYS B CE    1 
ATOM   3219 N NZ    . LYS B  1 184 ? -14.956 40.597 8.314   1.00 14.19 ? 166 LYS B NZ    1 
ATOM   3220 N N     . ASP B  1 185 ? -11.715 35.003 11.396  1.00 15.05 ? 167 ASP B N     1 
ATOM   3221 C CA    . ASP B  1 185 ? -10.793 34.052 10.780  1.00 15.52 ? 167 ASP B CA    1 
ATOM   3222 C C     . ASP B  1 185 ? -11.497 32.979 10.002  1.00 16.45 ? 167 ASP B C     1 
ATOM   3223 O O     . ASP B  1 185 ? -12.741 32.889 9.988   1.00 17.20 ? 167 ASP B O     1 
ATOM   3224 C CB    . ASP B  1 185 ? -9.916  33.421 11.883  1.00 16.05 ? 167 ASP B CB    1 
ATOM   3225 C CG    . ASP B  1 185 ? -8.434  33.306 11.457  1.00 16.14 ? 167 ASP B CG    1 
ATOM   3226 O OD1   . ASP B  1 185 ? -8.200  32.689 10.396  1.00 17.03 ? 167 ASP B OD1   1 
ATOM   3227 O OD2   . ASP B  1 185 ? -7.559  33.793 12.188  1.00 16.12 ? 167 ASP B OD2   1 
ATOM   3228 N N     . ASN B  1 186 ? -10.670 32.191 9.304   1.00 16.47 ? 168 ASN B N     1 
ATOM   3229 C CA    . ASN B  1 186 ? -11.112 31.028 8.564   1.00 17.89 ? 168 ASN B CA    1 
ATOM   3230 C C     . ASN B  1 186 ? -11.633 29.967 9.524   1.00 19.34 ? 168 ASN B C     1 
ATOM   3231 O O     . ASN B  1 186 ? -11.056 29.800 10.583  1.00 19.13 ? 168 ASN B O     1 
ATOM   3232 C CB    . ASN B  1 186 ? -9.992  30.402 7.763   1.00 17.77 ? 168 ASN B CB    1 
ATOM   3233 C CG    . ASN B  1 186 ? -9.431  31.328 6.725   1.00 16.83 ? 168 ASN B CG    1 
ATOM   3234 O OD1   . ASN B  1 186 ? -10.130 32.203 6.183   1.00 16.43 ? 168 ASN B OD1   1 
ATOM   3235 N ND2   . ASN B  1 186 ? -8.142  31.155 6.447   1.00 16.35 ? 168 ASN B ND2   1 
ATOM   3236 N N     . MET B  1 187 ? -12.715 29.299 9.125   1.00 21.43 ? 169 MET B N     1 
ATOM   3237 C CA    . MET B  1 187 ? -13.302 28.208 9.884   1.00 23.73 ? 169 MET B CA    1 
ATOM   3238 C C     . MET B  1 187 ? -13.407 26.956 9.025   1.00 25.61 ? 169 MET B C     1 
ATOM   3239 O O     . MET B  1 187 ? -13.779 27.032 7.843   1.00 26.88 ? 169 MET B O     1 
ATOM   3240 C CB    . MET B  1 187 ? -14.693 28.630 10.398  1.00 24.78 ? 169 MET B CB    1 
ATOM   3241 C CG    . MET B  1 187 ? -14.671 29.846 11.330  1.00 23.70 ? 169 MET B CG    1 
ATOM   3242 S SD    . MET B  1 187 ? -13.889 29.490 12.915  1.00 24.73 ? 169 MET B SD    1 
ATOM   3243 C CE    . MET B  1 187 ? -12.890 30.927 13.174  1.00 23.46 ? 169 MET B CE    1 
ATOM   3244 N N     . ALA B  1 188 ? -13.054 25.795 9.580   1.00 26.46 ? 170 ALA B N     1 
ATOM   3245 C CA    . ALA B  1 188 ? -13.177 24.546 8.868   1.00 28.03 ? 170 ALA B CA    1 
ATOM   3246 C C     . ALA B  1 188 ? -14.587 24.010 9.011   1.00 29.98 ? 170 ALA B C     1 
ATOM   3247 O O     . ALA B  1 188 ? -15.230 24.278 10.024  1.00 30.22 ? 170 ALA B O     1 
ATOM   3248 C CB    . ALA B  1 188 ? -12.182 23.558 9.432   1.00 28.54 ? 170 ALA B CB    1 
ATOM   3249 N N     . GLN B  1 189 ? -15.058 23.227 8.030   1.00 31.68 ? 171 GLN B N     1 
ATOM   3250 C CA    . GLN B  1 189 ? -16.380 22.534 8.142   1.00 34.05 ? 171 GLN B CA    1 
ATOM   3251 C C     . GLN B  1 189 ? -16.345 21.593 9.329   1.00 35.46 ? 171 GLN B C     1 
ATOM   3252 O O     . GLN B  1 189 ? -17.290 21.534 10.119  1.00 36.43 ? 171 GLN B O     1 
ATOM   3253 C CB    . GLN B  1 189 ? -16.730 21.764 6.854   1.00 35.90 ? 171 GLN B CB    1 
ATOM   3254 N N     . GLU B  1 190 ? -15.243 20.880 9.509   1.00 35.82 ? 172 GLU B N     1 
ATOM   3255 C CA    . GLU B  1 190 ? -15.160 19.916 10.590  1.00 38.04 ? 172 GLU B CA    1 
ATOM   3256 C C     . GLU B  1 190 ? -13.716 19.615 11.021  1.00 36.86 ? 172 GLU B C     1 
ATOM   3257 O O     . GLU B  1 190 ? -12.828 19.455 10.189  1.00 36.31 ? 172 GLU B O     1 
ATOM   3258 C CB    . GLU B  1 190 ? -15.885 18.651 10.170  1.00 41.71 ? 172 GLU B CB    1 
ATOM   3259 C CG    . GLU B  1 190 ? -15.880 17.567 11.221  1.00 44.96 ? 172 GLU B CG    1 
ATOM   3260 C CD    . GLU B  1 190 ? -16.408 16.243 10.730  1.00 48.87 ? 172 GLU B CD    1 
ATOM   3261 O OE1   . GLU B  1 190 ? -17.129 15.586 11.492  1.00 51.84 ? 172 GLU B OE1   1 
ATOM   3262 O OE2   . GLU B  1 190 ? -16.066 15.787 9.610   1.00 51.20 ? 172 GLU B OE2   1 
ATOM   3263 N N     . GLY B  1 191 ? -13.496 19.575 12.337  1.00 36.15 ? 173 GLY B N     1 
ATOM   3264 C CA    . GLY B  1 191 ? -12.194 19.259 12.910  1.00 35.22 ? 173 GLY B CA    1 
ATOM   3265 C C     . GLY B  1 191 ? -11.164 20.367 12.757  1.00 32.13 ? 173 GLY B C     1 
ATOM   3266 O O     . GLY B  1 191 ? -11.499 21.566 12.703  1.00 30.20 ? 173 GLY B O     1 
ATOM   3267 N N     . VAL B  1 192 ? -9.902  19.945 12.699  1.00 31.46 ? 174 VAL B N     1 
ATOM   3268 C CA    . VAL B  1 192 ? -8.768  20.837 12.669  1.00 29.23 ? 174 VAL B CA    1 
ATOM   3269 C C     . VAL B  1 192 ? -7.879  20.350 11.523  1.00 29.29 ? 174 VAL B C     1 
ATOM   3270 O O     . VAL B  1 192 ? -7.507  19.175 11.490  1.00 30.58 ? 174 VAL B O     1 
ATOM   3271 C CB    . VAL B  1 192 ? -7.998  20.802 14.004  1.00 29.31 ? 174 VAL B CB    1 
ATOM   3272 C CG1   . VAL B  1 192 ? -6.744  21.663 13.932  1.00 27.55 ? 174 VAL B CG1   1 
ATOM   3273 C CG2   . VAL B  1 192 ? -8.897  21.221 15.142  1.00 29.39 ? 174 VAL B CG2   1 
ATOM   3274 N N     . ILE B  1 193 ? -7.571  21.250 10.586  1.00 27.67 ? 175 ILE B N     1 
ATOM   3275 C CA    . ILE B  1 193 ? -6.926  20.888 9.312   1.00 28.04 ? 175 ILE B CA    1 
ATOM   3276 C C     . ILE B  1 193 ? -5.638  21.689 9.227   1.00 26.10 ? 175 ILE B C     1 
ATOM   3277 O O     . ILE B  1 193 ? -5.674  22.913 9.314   1.00 24.54 ? 175 ILE B O     1 
ATOM   3278 C CB    . ILE B  1 193 ? -7.793  21.279 8.098   1.00 28.27 ? 175 ILE B CB    1 
ATOM   3279 C CG1   . ILE B  1 193 ? -9.157  20.543 8.122   1.00 30.86 ? 175 ILE B CG1   1 
ATOM   3280 C CG2   . ILE B  1 193 ? -7.060  20.967 6.780   1.00 28.29 ? 175 ILE B CG2   1 
ATOM   3281 C CD1   . ILE B  1 193 ? -10.188 21.319 7.325   1.00 30.75 ? 175 ILE B CD1   1 
ATOM   3282 N N     . LEU B  1 194 ? -4.522  20.975 9.045   1.00 26.97 ? 176 LEU B N     1 
ATOM   3283 C CA    . LEU B  1 194 ? -3.208  21.586 8.866   1.00 25.54 ? 176 LEU B CA    1 
ATOM   3284 C C     . LEU B  1 194 ? -3.006  21.966 7.381   1.00 24.76 ? 176 LEU B C     1 
ATOM   3285 O O     . LEU B  1 194 ? -3.208  21.146 6.465   1.00 25.35 ? 176 LEU B O     1 
ATOM   3286 C CB    . LEU B  1 194 ? -2.110  20.637 9.304   1.00 26.77 ? 176 LEU B CB    1 
ATOM   3287 C CG    . LEU B  1 194 ? -0.633  21.037 9.171   1.00 26.21 ? 176 LEU B CG    1 
ATOM   3288 C CD1   . LEU B  1 194 ? -0.291  22.167 10.139  1.00 25.11 ? 176 LEU B CD1   1 
ATOM   3289 C CD2   . LEU B  1 194 ? 0.320   19.859 9.342   1.00 27.90 ? 176 LEU B CD2   1 
ATOM   3290 N N     . ASP B  1 195 ? -2.609  23.208 7.192   1.00 23.06 ? 177 ASP B N     1 
ATOM   3291 C CA    . ASP B  1 195 ? -2.012  23.689 5.937   1.00 22.66 ? 177 ASP B CA    1 
ATOM   3292 C C     . ASP B  1 195 ? -0.459  23.665 6.034   1.00 22.74 ? 177 ASP B C     1 
ATOM   3293 O O     . ASP B  1 195 ? 0.147   24.500 6.666   1.00 21.29 ? 177 ASP B O     1 
ATOM   3294 C CB    . ASP B  1 195 ? -2.496  25.086 5.601   1.00 21.33 ? 177 ASP B CB    1 
ATOM   3295 C CG    . ASP B  1 195 ? -2.154  25.527 4.172   1.00 21.07 ? 177 ASP B CG    1 
ATOM   3296 O OD1   . ASP B  1 195 ? -1.335  24.874 3.570   1.00 21.68 ? 177 ASP B OD1   1 
ATOM   3297 O OD2   . ASP B  1 195 ? -2.695  26.594 3.700   1.00 20.28 ? 177 ASP B OD2   1 
ATOM   3298 N N     . ASP B  1 196 ? 0.163   22.696 5.373   1.00 24.69 ? 178 ASP B N     1 
ATOM   3299 C CA    . ASP B  1 196 ? 1.620   22.548 5.423   1.00 26.04 ? 178 ASP B CA    1 
ATOM   3300 C C     . ASP B  1 196 ? 2.363   23.580 4.521   1.00 25.81 ? 178 ASP B C     1 
ATOM   3301 O O     . ASP B  1 196 ? 3.600   23.693 4.555   1.00 27.58 ? 178 ASP B O     1 
ATOM   3302 C CB    . ASP B  1 196 ? 2.016   21.113 5.012   1.00 28.54 ? 178 ASP B CB    1 
ATOM   3303 C CG    . ASP B  1 196 ? 1.912   20.877 3.493   1.00 29.19 ? 178 ASP B CG    1 
ATOM   3304 N N     . VAL B  1 197 ? 1.626   24.299 3.707   1.00 24.79 ? 179 VAL B N     1 
ATOM   3305 C CA    . VAL B  1 197 ? 2.220   25.272 2.851   1.00 24.36 ? 179 VAL B CA    1 
ATOM   3306 C C     . VAL B  1 197 ? 2.638   26.524 3.650   1.00 21.70 ? 179 VAL B C     1 
ATOM   3307 O O     . VAL B  1 197 ? 3.781   26.960 3.522   1.00 21.09 ? 179 VAL B O     1 
ATOM   3308 C CB    . VAL B  1 197 ? 1.264   25.685 1.745   1.00 25.91 ? 179 VAL B CB    1 
ATOM   3309 C CG1   . VAL B  1 197 ? 1.950   26.748 0.879   1.00 26.41 ? 179 VAL B CG1   1 
ATOM   3310 C CG2   . VAL B  1 197 ? 0.841   24.477 0.932   1.00 27.88 ? 179 VAL B CG2   1 
ATOM   3311 N N     . ASP B  1 198 ? 1.739   27.063 4.481   1.00 19.77 ? 180 ASP B N     1 
ATOM   3312 C CA    . ASP B  1 198 ? 2.060   28.215 5.336   1.00 18.36 ? 180 ASP B CA    1 
ATOM   3313 C C     . ASP B  1 198 ? 2.220   27.910 6.838   1.00 18.03 ? 180 ASP B C     1 
ATOM   3314 O O     . ASP B  1 198 ? 2.579   28.782 7.623   1.00 17.31 ? 180 ASP B O     1 
ATOM   3315 C CB    . ASP B  1 198 ? 1.086   29.401 5.153   1.00 17.52 ? 180 ASP B CB    1 
ATOM   3316 C CG    . ASP B  1 198 ? -0.349  29.075 5.600   1.00 17.79 ? 180 ASP B CG    1 
ATOM   3317 O OD1   . ASP B  1 198 ? -0.553  27.943 6.097   1.00 18.08 ? 180 ASP B OD1   1 
ATOM   3318 O OD2   . ASP B  1 198 ? -1.244  29.952 5.432   1.00 17.75 ? 180 ASP B OD2   1 
ATOM   3319 N N     . SER B  1 199 ? 2.012   26.652 7.210   1.00 18.67 ? 181 SER B N     1 
ATOM   3320 C CA    . SER B  1 199 ? 2.287   26.194 8.588   1.00 18.86 ? 181 SER B CA    1 
ATOM   3321 C C     . SER B  1 199 ? 1.264   26.823 9.518   1.00 18.16 ? 181 SER B C     1 
ATOM   3322 O O     . SER B  1 199 ? 1.597   27.576 10.473  1.00 17.49 ? 181 SER B O     1 
ATOM   3323 C CB    . SER B  1 199 ? 3.724   26.490 9.055   1.00 18.88 ? 181 SER B CB    1 
ATOM   3324 O OG    . SER B  1 199 ? 4.022   25.602 10.167  1.00 20.09 ? 181 SER B OG    1 
ATOM   3325 N N     . SER B  1 200 ? 0.007   26.556 9.180   1.00 18.16 ? 182 SER B N     1 
ATOM   3326 C CA    . SER B  1 200 ? -1.169  27.068 9.915   1.00 17.83 ? 182 SER B CA    1 
ATOM   3327 C C     . SER B  1 200 ? -2.243  26.000 9.970   1.00 19.04 ? 182 SER B C     1 
ATOM   3328 O O     . SER B  1 200 ? -2.207  25.025 9.242   1.00 19.57 ? 182 SER B O     1 
ATOM   3329 C CB    . SER B  1 200 ? -1.817  28.303 9.251   1.00 16.71 ? 182 SER B CB    1 
ATOM   3330 O OG    . SER B  1 200 ? -2.435  27.975 8.018   1.00 17.15 ? 182 SER B OG    1 
ATOM   3331 N N     . VAL B  1 201 ? -3.195  26.177 10.907  1.00 19.21 ? 183 VAL B N     1 
ATOM   3332 C CA    . VAL B  1 201 ? -4.352  25.316 10.957  1.00 20.65 ? 183 VAL B CA    1 
ATOM   3333 C C     . VAL B  1 201 ? -5.637  26.120 10.764  1.00 20.07 ? 183 VAL B C     1 
ATOM   3334 O O     . VAL B  1 201 ? -5.644  27.302 11.024  1.00 18.79 ? 183 VAL B O     1 
ATOM   3335 C CB    . VAL B  1 201 ? -4.456  24.519 12.301  1.00 22.05 ? 183 VAL B CB    1 
ATOM   3336 C CG1   . VAL B  1 201 ? -3.229  23.675 12.504  1.00 23.11 ? 183 VAL B CG1   1 
ATOM   3337 C CG2   . VAL B  1 201 ? -4.636  25.447 13.505  1.00 21.53 ? 183 VAL B CG2   1 
ATOM   3338 N N     A CYS B  1 202 ? -6.689  25.404 10.362  0.50 21.13 ? 184 CYS B N     1 
ATOM   3339 N N     B CYS B  1 202 ? -6.723  25.530 10.265  0.50 21.27 ? 184 CYS B N     1 
ATOM   3340 C CA    A CYS B  1 202 ? -8.053  25.884 10.327  0.50 21.22 ? 184 CYS B CA    1 
ATOM   3341 C CA    B CYS B  1 202 ? -8.033  26.104 10.603  0.50 21.51 ? 184 CYS B CA    1 
ATOM   3342 C C     A CYS B  1 202 ? -8.881  25.002 11.255  0.50 22.88 ? 184 CYS B C     1 
ATOM   3343 C C     B CYS B  1 202 ? -8.901  25.060 11.235  0.50 23.09 ? 184 CYS B C     1 
ATOM   3344 O O     A CYS B  1 202 ? -8.694  23.778 11.238  0.50 24.34 ? 184 CYS B O     1 
ATOM   3345 O O     B CYS B  1 202 ? -8.791  23.846 10.991  0.50 24.52 ? 184 CYS B O     1 
ATOM   3346 C CB    A CYS B  1 202 ? -8.573  25.779 8.900   0.50 21.53 ? 184 CYS B CB    1 
ATOM   3347 C CB    B CYS B  1 202 ? -8.782  26.830 9.470   0.50 21.18 ? 184 CYS B CB    1 
ATOM   3348 S SG    A CYS B  1 202 ? -10.052 26.766 8.610   0.50 20.91 ? 184 CYS B SG    1 
ATOM   3349 S SG    B CYS B  1 202 ? -9.316  25.754 8.118   0.50 23.46 ? 184 CYS B SG    1 
ATOM   3350 N N     . ARG B  1 203 ? -9.775  25.608 12.060  1.00 22.89 ? 185 ARG B N     1 
ATOM   3351 C CA    . ARG B  1 203 ? -10.570 24.865 13.018  1.00 24.51 ? 185 ARG B CA    1 
ATOM   3352 C C     . ARG B  1 203 ? -12.053 25.059 12.792  1.00 25.43 ? 185 ARG B C     1 
ATOM   3353 O O     . ARG B  1 203 ? -12.509 26.135 12.372  1.00 24.07 ? 185 ARG B O     1 
ATOM   3354 C CB    . ARG B  1 203 ? -10.261 25.419 14.397  1.00 24.01 ? 185 ARG B CB    1 
ATOM   3355 C CG    . ARG B  1 203 ? -8.812  25.288 14.859  1.00 23.60 ? 185 ARG B CG    1 
ATOM   3356 C CD    . ARG B  1 203 ? -8.610  26.222 16.021  1.00 22.78 ? 185 ARG B CD    1 
ATOM   3357 N NE    . ARG B  1 203 ? -7.385  26.059 16.779  1.00 23.01 ? 185 ARG B NE    1 
ATOM   3358 C CZ    . ARG B  1 203 ? -6.323  26.869 16.701  1.00 21.85 ? 185 ARG B CZ    1 
ATOM   3359 N NH1   . ARG B  1 203 ? -6.308  27.859 15.839  1.00 20.16 ? 185 ARG B NH1   1 
ATOM   3360 N NH2   . ARG B  1 203 ? -5.271  26.652 17.474  1.00 22.42 ? 185 ARG B NH2   1 
ATOM   3361 N N     . ASP B  1 204 ? -12.842 24.069 13.174  1.00 27.55 ? 186 ASP B N     1 
ATOM   3362 C CA    . ASP B  1 204 ? -14.292 24.219 13.072  1.00 28.85 ? 186 ASP B CA    1 
ATOM   3363 C C     . ASP B  1 204 ? -14.842 25.075 14.215  1.00 28.84 ? 186 ASP B C     1 
ATOM   3364 O O     . ASP B  1 204 ? -14.107 25.451 15.127  1.00 27.84 ? 186 ASP B O     1 
ATOM   3365 C CB    . ASP B  1 204 ? -14.997 22.861 12.896  1.00 31.36 ? 186 ASP B CB    1 
ATOM   3366 C CG    . ASP B  1 204 ? -15.154 22.047 14.191  1.00 33.22 ? 186 ASP B CG    1 
ATOM   3367 O OD1   . ASP B  1 204 ? -15.207 22.560 15.318  1.00 33.30 ? 186 ASP B OD1   1 
ATOM   3368 O OD2   . ASP B  1 204 ? -15.242 20.833 14.053  1.00 35.08 ? 186 ASP B OD2   1 
ATOM   3369 N N     . LEU B  1 205 ? -16.105 25.458 14.080  1.00 29.84 ? 187 LEU B N     1 
ATOM   3370 C CA    . LEU B  1 205 ? -16.730 26.397 15.013  1.00 30.10 ? 187 LEU B CA    1 
ATOM   3371 C C     . LEU B  1 205 ? -16.731 25.867 16.443  1.00 31.44 ? 187 LEU B C     1 
ATOM   3372 O O     . LEU B  1 205 ? -16.464 26.630 17.376  1.00 30.51 ? 187 LEU B O     1 
ATOM   3373 C CB    . LEU B  1 205 ? -18.164 26.752 14.582  1.00 30.91 ? 187 LEU B CB    1 
ATOM   3374 C CG    . LEU B  1 205 ? -18.297 27.684 13.382  1.00 30.15 ? 187 LEU B CG    1 
ATOM   3375 C CD1   . LEU B  1 205 ? -19.766 27.748 12.900  1.00 31.69 ? 187 LEU B CD1   1 
ATOM   3376 C CD2   . LEU B  1 205 ? -17.800 29.079 13.715  1.00 28.26 ? 187 LEU B CD2   1 
ATOM   3377 N N     . ASP B  1 206 ? -16.987 24.568 16.596  1.00 33.88 ? 188 ASP B N     1 
ATOM   3378 C CA    . ASP B  1 206 ? -17.051 23.945 17.928  1.00 35.65 ? 188 ASP B CA    1 
ATOM   3379 C C     . ASP B  1 206 ? -15.701 24.065 18.630  1.00 33.98 ? 188 ASP B C     1 
ATOM   3380 O O     . ASP B  1 206 ? -15.649 24.418 19.815  1.00 33.92 ? 188 ASP B O     1 
ATOM   3381 C CB    . ASP B  1 206 ? -17.472 22.482 17.861  1.00 39.03 ? 188 ASP B CB    1 
ATOM   3382 C CG    . ASP B  1 206 ? -18.878 22.290 17.312  1.00 41.37 ? 188 ASP B CG    1 
ATOM   3383 O OD1   . ASP B  1 206 ? -19.795 23.107 17.569  1.00 42.30 ? 188 ASP B OD1   1 
ATOM   3384 O OD2   . ASP B  1 206 ? -19.084 21.265 16.662  1.00 44.48 ? 188 ASP B OD2   1 
ATOM   3385 N N     . VAL B  1 207 ? -14.612 23.815 17.887  1.00 32.47 ? 189 VAL B N     1 
ATOM   3386 C CA    . VAL B  1 207 ? -13.273 23.831 18.461  1.00 31.15 ? 189 VAL B CA    1 
ATOM   3387 C C     . VAL B  1 207 ? -12.950 25.264 18.911  1.00 29.00 ? 189 VAL B C     1 
ATOM   3388 O O     . VAL B  1 207 ? -12.403 25.468 19.981  1.00 28.64 ? 189 VAL B O     1 
ATOM   3389 C CB    . VAL B  1 207 ? -12.197 23.321 17.469  1.00 30.73 ? 189 VAL B CB    1 
ATOM   3390 C CG1   . VAL B  1 207 ? -10.803 23.488 18.051  1.00 29.93 ? 189 VAL B CG1   1 
ATOM   3391 C CG2   . VAL B  1 207 ? -12.445 21.871 17.092  1.00 32.74 ? 189 VAL B CG2   1 
ATOM   3392 N N     . VAL B  1 208 ? -13.256 26.245 18.064  1.00 27.43 ? 190 VAL B N     1 
ATOM   3393 C CA    . VAL B  1 208 ? -12.974 27.641 18.385  1.00 25.85 ? 190 VAL B CA    1 
ATOM   3394 C C     . VAL B  1 208 ? -13.778 28.075 19.615  1.00 26.77 ? 190 VAL B C     1 
ATOM   3395 O O     . VAL B  1 208 ? -13.246 28.685 20.515  1.00 25.96 ? 190 VAL B O     1 
ATOM   3396 C CB    . VAL B  1 208 ? -13.225 28.597 17.189  1.00 24.34 ? 190 VAL B CB    1 
ATOM   3397 C CG1   . VAL B  1 208 ? -13.032 30.050 17.585  1.00 22.96 ? 190 VAL B CG1   1 
ATOM   3398 C CG2   . VAL B  1 208 ? -12.227 28.274 16.071  1.00 23.64 ? 190 VAL B CG2   1 
ATOM   3399 N N     . ARG B  1 209 ? -15.045 27.732 19.633  1.00 28.47 ? 191 ARG B N     1 
ATOM   3400 C CA    . ARG B  1 209 ? -15.874 28.045 20.796  1.00 29.95 ? 191 ARG B CA    1 
ATOM   3401 C C     . ARG B  1 209 ? -15.356 27.425 22.067  1.00 30.68 ? 191 ARG B C     1 
ATOM   3402 O O     . ARG B  1 209 ? -15.426 28.066 23.115  1.00 30.92 ? 191 ARG B O     1 
ATOM   3403 C CB    . ARG B  1 209 ? -17.318 27.669 20.540  1.00 32.28 ? 191 ARG B CB    1 
ATOM   3404 C CG    . ARG B  1 209 ? -17.982 28.552 19.530  1.00 32.19 ? 191 ARG B CG    1 
ATOM   3405 C CD    . ARG B  1 209 ? -19.456 28.269 19.505  1.00 35.57 ? 191 ARG B CD    1 
ATOM   3406 N NE    . ARG B  1 209 ? -20.063 28.702 18.239  1.00 36.18 ? 191 ARG B NE    1 
ATOM   3407 C CZ    . ARG B  1 209 ? -20.634 27.888 17.353  1.00 37.82 ? 191 ARG B CZ    1 
ATOM   3408 N NH1   . ARG B  1 209 ? -21.162 28.399 16.247  1.00 37.60 ? 191 ARG B NH1   1 
ATOM   3409 N NH2   . ARG B  1 209 ? -20.682 26.569 17.547  1.00 39.37 ? 191 ARG B NH2   1 
ATOM   3410 N N     . ARG B  1 210 ? -14.894 26.179 22.001  1.00 31.76 ? 192 ARG B N     1 
ATOM   3411 C CA    A ARG B  1 210 ? -14.359 25.537 23.201  0.50 33.14 ? 192 ARG B CA    1 
ATOM   3412 C CA    B ARG B  1 210 ? -14.271 25.476 23.145  0.50 33.23 ? 192 ARG B CA    1 
ATOM   3413 C C     . ARG B  1 210 ? -13.094 26.258 23.684  1.00 31.76 ? 192 ARG B C     1 
ATOM   3414 O O     . ARG B  1 210 ? -12.899 26.381 24.883  1.00 32.06 ? 192 ARG B O     1 
ATOM   3415 C CB    A ARG B  1 210 ? -14.130 24.024 23.005  0.50 35.13 ? 192 ARG B CB    1 
ATOM   3416 C CB    B ARG B  1 210 ? -13.760 24.079 22.725  0.50 34.89 ? 192 ARG B CB    1 
ATOM   3417 C CG    A ARG B  1 210 ? -15.332 23.146 23.339  0.50 37.55 ? 192 ARG B CG    1 
ATOM   3418 C CG    B ARG B  1 210 ? -12.915 23.345 23.779  0.50 36.63 ? 192 ARG B CG    1 
ATOM   3419 C CD    A ARG B  1 210 ? -14.937 21.670 23.468  0.50 39.74 ? 192 ARG B CD    1 
ATOM   3420 C CD    B ARG B  1 210 ? -12.347 22.049 23.235  0.50 38.10 ? 192 ARG B CD    1 
ATOM   3421 N NE    A ARG B  1 210 ? -14.082 21.346 22.349  0.50 38.93 ? 192 ARG B NE    1 
ATOM   3422 N NE    B ARG B  1 210 ? -11.012 22.180 22.656  0.50 37.13 ? 192 ARG B NE    1 
ATOM   3423 C CZ    A ARG B  1 210 ? -14.515 20.815 21.222  0.50 39.30 ? 192 ARG B CZ    1 
ATOM   3424 C CZ    B ARG B  1 210 ? -9.958  22.683 23.299  0.50 36.82 ? 192 ARG B CZ    1 
ATOM   3425 N NH1   A ARG B  1 210 ? -13.663 20.589 20.244  0.50 38.48 ? 192 ARG B NH1   1 
ATOM   3426 N NH2   A ARG B  1 210 ? -15.787 20.470 21.107  0.50 40.80 ? 192 ARG B NH2   1 
ATOM   3427 N N     . ILE B  1 211 ? -12.264 26.728 22.759  1.00 29.92 ? 193 ILE B N     1 
ATOM   3428 C CA    . ILE B  1 211 ? -11.034 27.429 23.103  1.00 29.00 ? 193 ILE B CA    1 
ATOM   3429 C C     . ILE B  1 211 ? -11.378 28.775 23.751  1.00 28.20 ? 193 ILE B C     1 
ATOM   3430 O O     . ILE B  1 211 ? -10.780 29.153 24.757  1.00 28.75 ? 193 ILE B O     1 
ATOM   3431 C CB    . ILE B  1 211 ? -10.093 27.624 21.879  1.00 27.49 ? 193 ILE B CB    1 
ATOM   3432 C CG1   . ILE B  1 211 ? -9.537  26.245 21.476  1.00 28.89 ? 193 ILE B CG1   1 
ATOM   3433 C CG2   . ILE B  1 211 ? -8.926  28.547 22.245  1.00 26.40 ? 193 ILE B CG2   1 
ATOM   3434 C CD1   . ILE B  1 211 ? -8.779  26.237 20.184  1.00 27.98 ? 193 ILE B CD1   1 
ATOM   3435 N N     . ILE B  1 212 ? -12.396 29.432 23.219  1.00 27.47 ? 194 ILE B N     1 
ATOM   3436 C CA    . ILE B  1 212 ? -12.853 30.687 23.771  1.00 26.92 ? 194 ILE B CA    1 
ATOM   3437 C C     . ILE B  1 212 ? -13.332 30.471 25.199  1.00 29.01 ? 194 ILE B C     1 
ATOM   3438 O O     . ILE B  1 212 ? -12.998 31.226 26.096  1.00 28.61 ? 194 ILE B O     1 
ATOM   3439 C CB    . ILE B  1 212 ? -13.951 31.307 22.876  1.00 26.22 ? 194 ILE B CB    1 
ATOM   3440 C CG1   . ILE B  1 212 ? -13.351 31.805 21.569  1.00 24.59 ? 194 ILE B CG1   1 
ATOM   3441 C CG2   . ILE B  1 212 ? -14.659 32.445 23.584  1.00 25.95 ? 194 ILE B CG2   1 
ATOM   3442 C CD1   . ILE B  1 212 ? -14.398 32.030 20.500  1.00 24.36 ? 194 ILE B CD1   1 
ATOM   3443 N N     . CYS B  1 213 ? -14.114 29.427 25.390  1.00 31.48 ? 195 CYS B N     1 
ATOM   3444 C CA    . CYS B  1 213 ? -14.610 29.093 26.706  1.00 34.60 ? 195 CYS B CA    1 
ATOM   3445 C C     . CYS B  1 213 ? -13.463 28.790 27.700  1.00 34.96 ? 195 CYS B C     1 
ATOM   3446 O O     . CYS B  1 213 ? -13.485 29.282 28.846  1.00 35.09 ? 195 CYS B O     1 
ATOM   3447 C CB    . CYS B  1 213 ? -15.568 27.914 26.597  1.00 37.41 ? 195 CYS B CB    1 
ATOM   3448 S SG    . CYS B  1 213 ? -16.283 27.534 28.170  1.00 44.31 ? 195 CYS B SG    1 
ATOM   3449 N N     . SER B  1 214 ? -12.454 28.047 27.265  1.00 34.61 ? 196 SER B N     1 
ATOM   3450 C CA    . SER B  1 214 ? -11.319 27.726 28.150  1.00 36.14 ? 196 SER B CA    1 
ATOM   3451 C C     . SER B  1 214 ? -10.497 28.960 28.555  1.00 34.36 ? 196 SER B C     1 
ATOM   3452 O O     . SER B  1 214 ? -9.806  28.945 29.599  1.00 35.31 ? 196 SER B O     1 
ATOM   3453 C CB    . SER B  1 214 ? -10.401 26.647 27.552  1.00 36.77 ? 196 SER B CB    1 
ATOM   3454 O OG    . SER B  1 214 ? -9.971  27.079 26.331  1.00 36.41 ? 196 SER B OG    1 
ATOM   3455 N N     . ALA B  1 215 ? -10.552 29.997 27.727  1.00 31.96 ? 197 ALA B N     1 
ATOM   3456 C CA    . ALA B  1 215 ? -9.935  31.271 28.060  1.00 30.76 ? 197 ALA B CA    1 
ATOM   3457 C C     . ALA B  1 215 ? -10.735 32.142 29.072  1.00 30.84 ? 197 ALA B C     1 
ATOM   3458 O O     . ALA B  1 215 ? -10.260 33.217 29.455  1.00 30.37 ? 197 ALA B O     1 
ATOM   3459 C CB    . ALA B  1 215 ? -9.611  32.048 26.796  1.00 28.63 ? 197 ALA B CB    1 
ATOM   3460 N N     . GLY B  1 216 ? -11.928 31.701 29.482  1.00 31.84 ? 198 GLY B N     1 
ATOM   3461 C CA    . GLY B  1 216 ? -12.776 32.442 30.430  1.00 32.31 ? 198 GLY B CA    1 
ATOM   3462 C C     . GLY B  1 216 ? -13.472 33.618 29.764  1.00 30.52 ? 198 GLY B C     1 
ATOM   3463 O O     . GLY B  1 216 ? -13.810 34.618 30.412  1.00 30.58 ? 198 GLY B O     1 
ATOM   3464 N N     . LEU B  1 217 ? -13.689 33.501 28.464  1.00 28.52 ? 199 LEU B N     1 
ATOM   3465 C CA    . LEU B  1 217 ? -14.330 34.534 27.707  1.00 27.03 ? 199 LEU B CA    1 
ATOM   3466 C C     . LEU B  1 217 ? -15.733 34.126 27.406  1.00 27.42 ? 199 LEU B C     1 
ATOM   3467 O O     . LEU B  1 217 ? -16.047 32.931 27.341  1.00 28.27 ? 199 LEU B O     1 
ATOM   3468 C CB    . LEU B  1 217 ? -13.557 34.742 26.403  1.00 25.55 ? 199 LEU B CB    1 
ATOM   3469 C CG    . LEU B  1 217 ? -12.238 35.500 26.588  1.00 25.09 ? 199 LEU B CG    1 
ATOM   3470 C CD1   . LEU B  1 217 ? -11.418 35.487 25.304  1.00 23.85 ? 199 LEU B CD1   1 
ATOM   3471 C CD2   . LEU B  1 217 ? -12.511 36.939 26.992  1.00 25.08 ? 199 LEU B CD2   1 
ATOM   3472 N N     . SER B  1 218 ? -16.588 35.128 27.264  1.00 26.73 ? 200 SER B N     1 
ATOM   3473 C CA    . SER B  1 218 ? -17.973 34.937 26.893  1.00 27.53 ? 200 SER B CA    1 
ATOM   3474 C C     . SER B  1 218 ? -18.206 35.416 25.487  1.00 26.09 ? 200 SER B C     1 
ATOM   3475 O O     . SER B  1 218 ? -17.635 36.440 25.050  1.00 24.84 ? 200 SER B O     1 
ATOM   3476 C CB    . SER B  1 218 ? -18.887 35.744 27.817  1.00 28.43 ? 200 SER B CB    1 
ATOM   3477 O OG    . SER B  1 218 ? -18.865 35.180 29.106  1.00 30.56 ? 200 SER B OG    1 
ATOM   3478 N N     . LEU B  1 219 ? -19.072 34.712 24.785  1.00 26.94 ? 201 LEU B N     1 
ATOM   3479 C CA    . LEU B  1 219 ? -19.400 35.037 23.393  1.00 26.27 ? 201 LEU B CA    1 
ATOM   3480 C C     . LEU B  1 219 ? -20.521 36.073 23.322  1.00 25.37 ? 201 LEU B C     1 
ATOM   3481 O O     . LEU B  1 219 ? -21.647 35.836 23.776  1.00 26.05 ? 201 LEU B O     1 
ATOM   3482 C CB    . LEU B  1 219 ? -19.792 33.729 22.684  1.00 29.17 ? 201 LEU B CB    1 
ATOM   3483 C CG    . LEU B  1 219 ? -20.042 33.733 21.167  1.00 29.88 ? 201 LEU B CG    1 
ATOM   3484 C CD1   . LEU B  1 219 ? -19.036 34.484 20.351  1.00 28.57 ? 201 LEU B CD1   1 
ATOM   3485 C CD2   . LEU B  1 219 ? -20.111 32.283 20.696  1.00 31.99 ? 201 LEU B CD2   1 
ATOM   3486 N N     . LEU B  1 220 ? -20.206 37.265 22.809  1.00 23.24 ? 202 LEU B N     1 
ATOM   3487 C CA    . LEU B  1 220 ? -21.175 38.340 22.704  1.00 23.01 ? 202 LEU B CA    1 
ATOM   3488 C C     . LEU B  1 220 ? -21.906 38.331 21.381  1.00 23.06 ? 202 LEU B C     1 
ATOM   3489 O O     . LEU B  1 220 ? -23.107 38.696 21.323  1.00 23.80 ? 202 LEU B O     1 
ATOM   3490 C CB    . LEU B  1 220 ? -20.511 39.697 22.888  1.00 21.64 ? 202 LEU B CB    1 
ATOM   3491 C CG    . LEU B  1 220 ? -19.661 39.893 24.146  1.00 21.98 ? 202 LEU B CG    1 
ATOM   3492 C CD1   . LEU B  1 220 ? -18.863 41.212 24.109  1.00 20.96 ? 202 LEU B CD1   1 
ATOM   3493 C CD2   . LEU B  1 220 ? -20.506 39.786 25.415  1.00 23.75 ? 202 LEU B CD2   1 
ATOM   3494 N N     . ALA B  1 221 ? -21.232 37.956 20.311  1.00 22.08 ? 203 ALA B N     1 
ATOM   3495 C CA    . ALA B  1 221 ? -21.874 37.926 19.002  1.00 22.44 ? 203 ALA B CA    1 
ATOM   3496 C C     . ALA B  1 221 ? -21.008 37.057 18.109  1.00 22.23 ? 203 ALA B C     1 
ATOM   3497 O O     . ALA B  1 221 ? -19.781 36.947 18.293  1.00 20.82 ? 203 ALA B O     1 
ATOM   3498 C CB    . ALA B  1 221 ? -21.951 39.327 18.371  1.00 21.51 ? 203 ALA B CB    1 
ATOM   3499 N N     . GLU B  1 222 ? -21.669 36.467 17.141  1.00 23.34 ? 204 GLU B N     1 
ATOM   3500 C CA    . GLU B  1 222 ? -20.997 35.650 16.153  1.00 24.08 ? 204 GLU B CA    1 
ATOM   3501 C C     . GLU B  1 222 ? -21.650 35.981 14.819  1.00 23.60 ? 204 GLU B C     1 
ATOM   3502 O O     . GLU B  1 222 ? -22.886 36.079 14.732  1.00 24.32 ? 204 GLU B O     1 
ATOM   3503 C CB    . GLU B  1 222 ? -21.158 34.193 16.542  1.00 27.15 ? 204 GLU B CB    1 
ATOM   3504 C CG    . GLU B  1 222 ? -20.492 33.174 15.657  1.00 28.87 ? 204 GLU B CG    1 
ATOM   3505 C CD    . GLU B  1 222 ? -20.865 31.767 16.088  1.00 32.52 ? 204 GLU B CD    1 
ATOM   3506 O OE1   . GLU B  1 222 ? -20.650 31.424 17.287  1.00 34.31 ? 204 GLU B OE1   1 
ATOM   3507 O OE2   . GLU B  1 222 ? -21.434 31.028 15.242  1.00 35.52 ? 204 GLU B OE2   1 
ATOM   3508 N N     . GLU B  1 223 ? -20.831 36.090 13.768  1.00 22.22 ? 205 GLU B N     1 
ATOM   3509 C CA    . GLU B  1 223 ? -21.359 36.439 12.456  1.00 22.14 ? 205 GLU B CA    1 
ATOM   3510 C C     . GLU B  1 223 ? -20.546 35.845 11.330  1.00 21.68 ? 205 GLU B C     1 
ATOM   3511 O O     . GLU B  1 223 ? -19.345 35.986 11.332  1.00 20.15 ? 205 GLU B O     1 
ATOM   3512 C CB    . GLU B  1 223 ? -21.316 37.975 12.330  1.00 21.44 ? 205 GLU B CB    1 
ATOM   3513 C CG    . GLU B  1 223 ? -21.906 38.498 11.065  1.00 22.07 ? 205 GLU B CG    1 
ATOM   3514 C CD    . GLU B  1 223 ? -22.039 40.014 11.094  1.00 21.35 ? 205 GLU B CD    1 
ATOM   3515 O OE1   . GLU B  1 223 ? -22.969 40.524 11.740  1.00 22.02 ? 205 GLU B OE1   1 
ATOM   3516 O OE2   . GLU B  1 223 ? -21.140 40.650 10.576  1.00 20.68 ? 205 GLU B OE2   1 
ATOM   3517 N N     . ARG B  1 224 ? -21.233 35.225 10.367  1.00 22.53 ? 206 ARG B N     1 
ATOM   3518 C CA    . ARG B  1 224 ? -20.543 34.729 9.180   1.00 22.64 ? 206 ARG B CA    1 
ATOM   3519 C C     . ARG B  1 224 ? -20.327 35.837 8.160   1.00 21.53 ? 206 ARG B C     1 
ATOM   3520 O O     . ARG B  1 224 ? -21.236 36.586 7.878   1.00 22.10 ? 206 ARG B O     1 
ATOM   3521 C CB    . ARG B  1 224 ? -21.342 33.592 8.550   1.00 24.83 ? 206 ARG B CB    1 
ATOM   3522 C CG    . ARG B  1 224 ? -20.689 33.042 7.281   1.00 25.38 ? 206 ARG B CG    1 
ATOM   3523 C CD    . ARG B  1 224 ? -21.353 31.832 6.723   1.00 27.95 ? 206 ARG B CD    1 
ATOM   3524 N NE    . ARG B  1 224 ? -20.679 31.445 5.477   1.00 28.55 ? 206 ARG B NE    1 
ATOM   3525 C CZ    . ARG B  1 224 ? -21.167 30.600 4.576   1.00 30.60 ? 206 ARG B CZ    1 
ATOM   3526 N NH1   . ARG B  1 224 ? -22.331 29.989 4.771   1.00 33.02 ? 206 ARG B NH1   1 
ATOM   3527 N NH2   . ARG B  1 224 ? -20.488 30.353 3.460   1.00 30.96 ? 206 ARG B NH2   1 
ATOM   3528 N N     . GLN B  1 225 ? -19.126 35.909 7.586   1.00 20.17 ? 207 GLN B N     1 
ATOM   3529 C CA    . GLN B  1 225 ? -18.822 36.865 6.539   1.00 19.60 ? 207 GLN B CA    1 
ATOM   3530 C C     . GLN B  1 225 ? -19.556 36.499 5.229   1.00 21.05 ? 207 GLN B C     1 
ATOM   3531 O O     . GLN B  1 225 ? -19.397 35.394 4.681   1.00 21.97 ? 207 GLN B O     1 
ATOM   3532 C CB    . GLN B  1 225 ? -17.289 36.952 6.342   1.00 18.27 ? 207 GLN B CB    1 
ATOM   3533 C CG    . GLN B  1 225 ? -16.824 37.813 5.173   1.00 17.94 ? 207 GLN B CG    1 
ATOM   3534 C CD    . GLN B  1 225 ? -17.154 39.265 5.398   1.00 17.05 ? 207 GLN B CD    1 
ATOM   3535 O OE1   . GLN B  1 225 ? -16.766 39.828 6.403   1.00 16.65 ? 207 GLN B OE1   1 
ATOM   3536 N NE2   . GLN B  1 225 ? -17.853 39.861 4.489   1.00 17.67 ? 207 GLN B NE2   1 
ATOM   3537 N N     . GLU B  1 226 ? -20.305 37.462 4.704   1.00 21.55 ? 208 GLU B N     1 
ATOM   3538 C CA    . GLU B  1 226 ? -21.072 37.300 3.472   1.00 23.58 ? 208 GLU B CA    1 
ATOM   3539 C C     . GLU B  1 226 ? -20.211 37.679 2.246   1.00 23.50 ? 208 GLU B C     1 
ATOM   3540 O O     . GLU B  1 226 ? -19.165 38.309 2.366   1.00 22.15 ? 208 GLU B O     1 
ATOM   3541 C CB    . GLU B  1 226 ? -22.350 38.154 3.542   1.00 24.23 ? 208 GLU B CB    1 
ATOM   3542 C CG    . GLU B  1 226 ? -23.276 37.759 4.698   1.00 25.25 ? 208 GLU B CG    1 
ATOM   3543 N N     . ASN B  1 227 ? -20.673 37.291 1.066   1.00 25.58 ? 209 ASN B N     1 
ATOM   3544 C CA    . ASN B  1 227 ? -20.155 37.799 -0.194  1.00 26.48 ? 209 ASN B CA    1 
ATOM   3545 C C     . ASN B  1 227 ? -18.714 37.414 -0.495  1.00 25.73 ? 209 ASN B C     1 
ATOM   3546 O O     . ASN B  1 227 ? -17.991 38.168 -1.187  1.00 25.23 ? 209 ASN B O     1 
ATOM   3547 C CB    . ASN B  1 227 ? -20.363 39.328 -0.314  1.00 26.55 ? 209 ASN B CB    1 
ATOM   3548 C CG    . ASN B  1 227 ? -21.808 39.696 -0.320  1.00 28.78 ? 209 ASN B CG    1 
ATOM   3549 O OD1   . ASN B  1 227 ? -22.578 39.161 -1.094  1.00 31.98 ? 209 ASN B OD1   1 
ATOM   3550 N ND2   . ASN B  1 227 ? -22.202 40.541 0.564   1.00 28.61 ? 209 ASN B ND2   1 
ATOM   3551 N N     . LEU B  1 228 ? -18.298 36.248 0.002   1.00 25.43 ? 210 LEU B N     1 
ATOM   3552 C CA    . LEU B  1 228 ? -16.950 35.752 -0.286  1.00 24.94 ? 210 LEU B CA    1 
ATOM   3553 C C     . LEU B  1 228 ? -16.960 34.809 -1.457  1.00 26.44 ? 210 LEU B C     1 
ATOM   3554 O O     . LEU B  1 228 ? -17.965 34.217 -1.752  1.00 27.78 ? 210 LEU B O     1 
ATOM   3555 C CB    . LEU B  1 228 ? -16.397 35.007 0.918   1.00 24.21 ? 210 LEU B CB    1 
ATOM   3556 C CG    . LEU B  1 228 ? -16.189 35.832 2.197   1.00 22.96 ? 210 LEU B CG    1 
ATOM   3557 C CD1   . LEU B  1 228 ? -15.451 34.944 3.184   1.00 22.95 ? 210 LEU B CD1   1 
ATOM   3558 C CD2   . LEU B  1 228 ? -15.334 37.038 1.871   1.00 21.76 ? 210 LEU B CD2   1 
ATOM   3559 N N     . PRO B  1 229 ? -15.821 34.653 -2.115  1.00 26.19 ? 211 PRO B N     1 
ATOM   3560 C CA    . PRO B  1 229 ? -15.702 33.638 -3.161  1.00 27.93 ? 211 PRO B CA    1 
ATOM   3561 C C     . PRO B  1 229 ? -16.082 32.238 -2.664  1.00 28.81 ? 211 PRO B C     1 
ATOM   3562 O O     . PRO B  1 229 ? -15.777 31.866 -1.541  1.00 27.33 ? 211 PRO B O     1 
ATOM   3563 C CB    . PRO B  1 229 ? -14.218 33.701 -3.551  1.00 26.94 ? 211 PRO B CB    1 
ATOM   3564 C CG    . PRO B  1 229 ? -13.718 34.981 -3.053  1.00 25.46 ? 211 PRO B CG    1 
ATOM   3565 C CD    . PRO B  1 229 ? -14.574 35.408 -1.912  1.00 24.70 ? 211 PRO B CD    1 
ATOM   3566 N N     . ASP B  1 230 ? -16.764 31.479 -3.493  1.00 31.14 ? 212 ASP B N     1 
ATOM   3567 C CA    . ASP B  1 230 ? -17.250 30.162 -3.061  1.00 32.97 ? 212 ASP B CA    1 
ATOM   3568 C C     . ASP B  1 230 ? -16.129 29.187 -2.693  1.00 32.07 ? 212 ASP B C     1 
ATOM   3569 O O     . ASP B  1 230 ? -16.360 28.258 -1.931  1.00 32.60 ? 212 ASP B O     1 
ATOM   3570 C CB    . ASP B  1 230 ? -18.058 29.504 -4.174  1.00 36.73 ? 212 ASP B CB    1 
ATOM   3571 C CG    . ASP B  1 230 ? -19.412 30.126 -4.375  1.00 38.82 ? 212 ASP B CG    1 
ATOM   3572 O OD1   . ASP B  1 230 ? -19.817 31.003 -3.579  1.00 38.45 ? 212 ASP B OD1   1 
ATOM   3573 O OD2   . ASP B  1 230 ? -20.072 29.698 -5.373  1.00 42.66 ? 212 ASP B OD2   1 
ATOM   3574 N N     . GLU B  1 231 ? -14.944 29.340 -3.288  1.00 30.64 ? 213 GLU B N     1 
ATOM   3575 C CA    . GLU B  1 231 ? -13.905 28.310 -3.126  1.00 30.51 ? 213 GLU B CA    1 
ATOM   3576 C C     . GLU B  1 231 ? -13.127 28.371 -1.820  1.00 27.98 ? 213 GLU B C     1 
ATOM   3577 O O     . GLU B  1 231 ? -12.377 27.447 -1.523  1.00 27.92 ? 213 GLU B O     1 
ATOM   3578 C CB    . GLU B  1 231 ? -12.923 28.270 -4.314  1.00 31.38 ? 213 GLU B CB    1 
ATOM   3579 C CG    . GLU B  1 231 ? -11.958 29.437 -4.400  1.00 30.24 ? 213 GLU B CG    1 
ATOM   3580 C CD    . GLU B  1 231 ? -12.519 30.721 -4.944  1.00 30.64 ? 213 GLU B CD    1 
ATOM   3581 O OE1   . GLU B  1 231 ? -11.720 31.715 -5.043  1.00 30.31 ? 213 GLU B OE1   1 
ATOM   3582 O OE2   . GLU B  1 231 ? -13.727 30.756 -5.286  1.00 32.79 ? 213 GLU B OE2   1 
ATOM   3583 N N     . ILE B  1 232 ? -13.285 29.460 -1.061  1.00 25.63 ? 214 ILE B N     1 
ATOM   3584 C CA    . ILE B  1 232 ? -12.504 29.658 0.165   1.00 23.70 ? 214 ILE B CA    1 
ATOM   3585 C C     . ILE B  1 232 ? -13.211 29.189 1.444   1.00 23.60 ? 214 ILE B C     1 
ATOM   3586 O O     . ILE B  1 232 ? -14.441 29.068 1.473   1.00 24.54 ? 214 ILE B O     1 
ATOM   3587 C CB    . ILE B  1 232 ? -11.961 31.120 0.328   1.00 21.88 ? 214 ILE B CB    1 
ATOM   3588 C CG1   . ILE B  1 232 ? -13.069 32.129 0.593   1.00 21.50 ? 214 ILE B CG1   1 
ATOM   3589 C CG2   . ILE B  1 232 ? -11.107 31.518 -0.885  1.00 21.61 ? 214 ILE B CG2   1 
ATOM   3590 C CD1   . ILE B  1 232 ? -12.566 33.532 0.876   1.00 20.09 ? 214 ILE B CD1   1 
ATOM   3591 N N     . TYR B  1 233 ? -12.432 28.913 2.489   1.00 22.56 ? 215 TYR B N     1 
ATOM   3592 C CA    . TYR B  1 233 ? -13.008 28.592 3.798   1.00 22.64 ? 215 TYR B CA    1 
ATOM   3593 C C     . TYR B  1 233 ? -13.972 29.716 4.187   1.00 21.67 ? 215 TYR B C     1 
ATOM   3594 O O     . TYR B  1 233 ? -13.709 30.898 3.944   1.00 19.76 ? 215 TYR B O     1 
ATOM   3595 C CB    . TYR B  1 233 ? -11.928 28.482 4.894   1.00 22.13 ? 215 TYR B CB    1 
ATOM   3596 C CG    . TYR B  1 233 ? -11.111 27.203 4.819   1.00 23.62 ? 215 TYR B CG    1 
ATOM   3597 C CD1   . TYR B  1 233 ? -11.676 25.968 5.117   1.00 25.33 ? 215 TYR B CD1   1 
ATOM   3598 C CD2   . TYR B  1 233 ? -9.771  27.242 4.414   1.00 23.11 ? 215 TYR B CD2   1 
ATOM   3599 C CE1   . TYR B  1 233 ? -10.946 24.803 5.012   1.00 27.03 ? 215 TYR B CE1   1 
ATOM   3600 C CE2   . TYR B  1 233 ? -9.025  26.066 4.278   1.00 24.86 ? 215 TYR B CE2   1 
ATOM   3601 C CZ    . TYR B  1 233 ? -9.602  24.841 4.599   1.00 26.48 ? 215 TYR B CZ    1 
ATOM   3602 O OH    . TYR B  1 233 ? -8.896  23.670 4.482   1.00 28.55 ? 215 TYR B OH    1 
ATOM   3603 N N     . HIS B  1 234 ? -15.069 29.325 4.815   1.00 22.11 ? 216 HIS B N     1 
ATOM   3604 C CA    . HIS B  1 234 ? -15.957 30.291 5.429   1.00 21.74 ? 216 HIS B CA    1 
ATOM   3605 C C     . HIS B  1 234 ? -15.208 31.101 6.490   1.00 20.01 ? 216 HIS B C     1 
ATOM   3606 O O     . HIS B  1 234 ? -14.244 30.632 7.068   1.00 19.33 ? 216 HIS B O     1 
ATOM   3607 C CB    . HIS B  1 234 ? -17.159 29.597 6.029   1.00 23.50 ? 216 HIS B CB    1 
ATOM   3608 C CG    . HIS B  1 234 ? -17.935 28.766 5.061   1.00 25.48 ? 216 HIS B CG    1 
ATOM   3609 N ND1   . HIS B  1 234 ? -19.119 28.132 5.419   1.00 27.42 ? 216 HIS B ND1   1 
ATOM   3610 C CD2   . HIS B  1 234 ? -17.757 28.497 3.747   1.00 26.23 ? 216 HIS B CD2   1 
ATOM   3611 C CE1   . HIS B  1 234 ? -19.579 27.447 4.395   1.00 29.05 ? 216 HIS B CE1   1 
ATOM   3612 N NE2   . HIS B  1 234 ? -18.781 27.655 3.363   1.00 28.45 ? 216 HIS B NE2   1 
ATOM   3613 N N     . VAL B  1 235 ? -15.631 32.356 6.684   1.00 19.06 ? 217 VAL B N     1 
ATOM   3614 C CA    . VAL B  1 235 ? -15.001 33.256 7.602   1.00 17.80 ? 217 VAL B CA    1 
ATOM   3615 C C     . VAL B  1 235 ? -16.029 33.735 8.621   1.00 17.97 ? 217 VAL B C     1 
ATOM   3616 O O     . VAL B  1 235 ? -17.143 34.079 8.244   1.00 18.58 ? 217 VAL B O     1 
ATOM   3617 C CB    . VAL B  1 235 ? -14.383 34.461 6.843   1.00 16.69 ? 217 VAL B CB    1 
ATOM   3618 C CG1   . VAL B  1 235 ? -13.858 35.523 7.806   1.00 15.61 ? 217 VAL B CG1   1 
ATOM   3619 C CG2   . VAL B  1 235 ? -13.265 33.962 5.909   1.00 16.70 ? 217 VAL B CG2   1 
ATOM   3620 N N     . TYR B  1 236 ? -15.673 33.674 9.912   1.00 17.72 ? 218 TYR B N     1 
ATOM   3621 C CA    . TYR B  1 236 ? -16.584 34.107 10.989  1.00 18.05 ? 218 TYR B CA    1 
ATOM   3622 C C     . TYR B  1 236 ? -15.905 35.137 11.880  1.00 16.68 ? 218 TYR B C     1 
ATOM   3623 O O     . TYR B  1 236 ? -14.658 35.132 12.018  1.00 15.81 ? 218 TYR B O     1 
ATOM   3624 C CB    . TYR B  1 236 ? -17.011 32.942 11.866  1.00 19.50 ? 218 TYR B CB    1 
ATOM   3625 C CG    . TYR B  1 236 ? -18.111 32.076 11.276  1.00 21.61 ? 218 TYR B CG    1 
ATOM   3626 C CD1   . TYR B  1 236 ? -17.852 31.243 10.211  1.00 22.59 ? 218 TYR B CD1   1 
ATOM   3627 C CD2   . TYR B  1 236 ? -19.393 32.098 11.792  1.00 22.90 ? 218 TYR B CD2   1 
ATOM   3628 C CE1   . TYR B  1 236 ? -18.851 30.426 9.684   1.00 24.89 ? 218 TYR B CE1   1 
ATOM   3629 C CE2   . TYR B  1 236 ? -20.402 31.254 11.298  1.00 25.19 ? 218 TYR B CE2   1 
ATOM   3630 C CZ    . TYR B  1 236 ? -20.105 30.449 10.234  1.00 25.85 ? 218 TYR B CZ    1 
ATOM   3631 O OH    . TYR B  1 236 ? -21.023 29.659 9.652   1.00 28.56 ? 218 TYR B OH    1 
ATOM   3632 N N     . SER B  1 237 ? -16.729 36.054 12.414  1.00 16.50 ? 219 SER B N     1 
ATOM   3633 C CA    . SER B  1 237 ? -16.334 36.991 13.416  1.00 15.88 ? 219 SER B CA    1 
ATOM   3634 C C     . SER B  1 237 ? -16.998 36.623 14.747  1.00 17.08 ? 219 SER B C     1 
ATOM   3635 O O     . SER B  1 237 ? -18.171 36.255 14.772  1.00 17.99 ? 219 SER B O     1 
ATOM   3636 C CB    . SER B  1 237 ? -16.768 38.417 13.052  1.00 15.14 ? 219 SER B CB    1 
ATOM   3637 O OG    . SER B  1 237 ? -16.220 38.811 11.781  1.00 14.29 ? 219 SER B OG    1 
ATOM   3638 N N     . PHE B  1 238 ? -16.238 36.792 15.817  1.00 17.51 ? 220 PHE B N     1 
ATOM   3639 C CA    . PHE B  1 238 ? -16.636 36.506 17.194  1.00 19.06 ? 220 PHE B CA    1 
ATOM   3640 C C     . PHE B  1 238 ? -16.270 37.735 18.045  1.00 18.23 ? 220 PHE B C     1 
ATOM   3641 O O     . PHE B  1 238 ? -15.119 38.158 17.982  1.00 17.70 ? 220 PHE B O     1 
ATOM   3642 C CB    . PHE B  1 238 ? -15.891 35.309 17.787  1.00 20.62 ? 220 PHE B CB    1 
ATOM   3643 C CG    . PHE B  1 238 ? -16.034 34.044 17.007  1.00 22.64 ? 220 PHE B CG    1 
ATOM   3644 C CD1   . PHE B  1 238 ? -15.167 33.791 15.957  1.00 22.97 ? 220 PHE B CD1   1 
ATOM   3645 C CD2   . PHE B  1 238 ? -17.049 33.147 17.273  1.00 24.92 ? 220 PHE B CD2   1 
ATOM   3646 C CE1   . PHE B  1 238 ? -15.256 32.588 15.238  1.00 24.48 ? 220 PHE B CE1   1 
ATOM   3647 C CE2   . PHE B  1 238 ? -17.151 31.944 16.544  1.00 26.42 ? 220 PHE B CE2   1 
ATOM   3648 C CZ    . PHE B  1 238 ? -16.255 31.695 15.532  1.00 26.17 ? 220 PHE B CZ    1 
ATOM   3649 N N     . ALA B  1 239 ? -17.219 38.285 18.798  1.00 18.16 ? 221 ALA B N     1 
ATOM   3650 C CA    . ALA B  1 239 ? -16.950 39.381 19.770  1.00 17.54 ? 221 ALA B CA    1 
ATOM   3651 C C     . ALA B  1 239 ? -17.010 38.773 21.127  1.00 18.51 ? 221 ALA B C     1 
ATOM   3652 O O     . ALA B  1 239 ? -17.952 38.038 21.403  1.00 19.35 ? 221 ALA B O     1 
ATOM   3653 C CB    . ALA B  1 239 ? -17.937 40.503 19.634  1.00 17.20 ? 221 ALA B CB    1 
ATOM   3654 N N     . LEU B  1 240 ? -16.038 39.074 21.963  1.00 18.16 ? 222 LEU B N     1 
ATOM   3655 C CA    . LEU B  1 240 ? -15.849 38.334 23.207  1.00 19.76 ? 222 LEU B CA    1 
ATOM   3656 C C     . LEU B  1 240 ? -15.480 39.321 24.316  1.00 19.79 ? 222 LEU B C     1 
ATOM   3657 O O     . LEU B  1 240 ? -14.810 40.338 24.062  1.00 18.42 ? 222 LEU B O     1 
ATOM   3658 C CB    . LEU B  1 240 ? -14.679 37.372 23.074  1.00 20.16 ? 222 LEU B CB    1 
ATOM   3659 C CG    . LEU B  1 240 ? -14.564 36.547 21.799  1.00 20.16 ? 222 LEU B CG    1 
ATOM   3660 C CD1   . LEU B  1 240 ? -13.234 35.850 21.754  1.00 20.88 ? 222 LEU B CD1   1 
ATOM   3661 C CD2   . LEU B  1 240 ? -15.699 35.566 21.851  1.00 21.84 ? 222 LEU B CD2   1 
ATOM   3662 N N     . ARG B  1 241 ? -15.813 38.959 25.541  1.00 21.65 ? 223 ARG B N     1 
ATOM   3663 C CA    . ARG B  1 241 ? -15.161 39.595 26.708  1.00 22.73 ? 223 ARG B CA    1 
ATOM   3664 C C     . ARG B  1 241 ? -15.230 38.723 27.938  1.00 24.89 ? 223 ARG B C     1 
ATOM   3665 O O     . ARG B  1 241 ? -16.040 37.771 27.953  1.00 25.71 ? 223 ARG B O     1 
ATOM   3666 C CB    . ARG B  1 241 ? -15.715 40.983 27.010  1.00 22.60 ? 223 ARG B CB    1 
ATOM   3667 C CG    . ARG B  1 241 ? -17.017 41.079 27.728  1.00 23.80 ? 223 ARG B CG    1 
ATOM   3668 C CD    . ARG B  1 241 ? -17.255 42.474 28.320  1.00 24.11 ? 223 ARG B CD    1 
ATOM   3669 N NE    . ARG B  1 241 ? -17.387 43.565 27.309  1.00 22.76 ? 223 ARG B NE    1 
ATOM   3670 C CZ    . ARG B  1 241 ? -18.554 43.960 26.769  1.00 22.81 ? 223 ARG B CZ    1 
ATOM   3671 N NH1   . ARG B  1 241 ? -19.705 43.314 27.052  1.00 23.82 ? 223 ARG B NH1   1 
ATOM   3672 N NH2   . ARG B  1 241 ? -18.594 44.960 25.915  1.00 21.80 ? 223 ARG B NH2   1 
ATOM   3673 O OXT   . ARG B  1 241 ? -14.507 39.006 28.922  1.00 26.18 ? 223 ARG B OXT   1 
ATOM   3674 N N     . PRO C  2 1   ? 7.022   35.815 -16.280 1.00 15.83 ? 1   PRO D N     1 
ATOM   3675 C CA    . PRO C  2 1   ? 6.592   35.508 -14.896 1.00 14.56 ? 1   PRO D CA    1 
ATOM   3676 C C     . PRO C  2 1   ? 5.671   34.315 -14.916 1.00 14.17 ? 1   PRO D C     1 
ATOM   3677 O O     . PRO C  2 1   ? 5.253   33.874 -15.998 1.00 13.50 ? 1   PRO D O     1 
ATOM   3678 C CB    . PRO C  2 1   ? 5.783   36.771 -14.511 1.00 15.26 ? 1   PRO D CB    1 
ATOM   3679 C CG    . PRO C  2 1   ? 5.167   37.209 -15.808 1.00 15.44 ? 1   PRO D CG    1 
ATOM   3680 C CD    . PRO C  2 1   ? 6.238   36.933 -16.865 1.00 15.86 ? 1   PRO D CD    1 
ATOM   3681 N N     . PRO C  2 2   ? 5.274   33.812 -13.738 1.00 13.53 ? 2   PRO D N     1 
ATOM   3682 C CA    . PRO C  2 2   ? 4.116   32.922 -13.745 1.00 13.30 ? 2   PRO D CA    1 
ATOM   3683 C C     . PRO C  2 2   ? 2.959   33.613 -14.452 1.00 13.14 ? 2   PRO D C     1 
ATOM   3684 O O     . PRO C  2 2   ? 2.861   34.846 -14.356 1.00 13.07 ? 2   PRO D O     1 
ATOM   3685 C CB    . PRO C  2 2   ? 3.799   32.731 -12.243 1.00 13.71 ? 2   PRO D CB    1 
ATOM   3686 C CG    . PRO C  2 2   ? 4.402   33.885 -11.588 1.00 13.79 ? 2   PRO D CG    1 
ATOM   3687 C CD    . PRO C  2 2   ? 5.647   34.231 -12.375 1.00 13.77 ? 2   PRO D CD    1 
ATOM   3688 N N     . LYS C  2 3   ? 2.156   32.856 -15.190 1.00 13.34 ? 3   LYS D N     1 
ATOM   3689 C CA    . LYS C  2 3   ? 1.060   33.444 -15.980 1.00 14.26 ? 3   LYS D CA    1 
ATOM   3690 C C     . LYS C  2 3   ? -0.051  32.483 -16.354 1.00 15.80 ? 3   LYS D C     1 
ATOM   3691 O O     . LYS C  2 3   ? 0.148   31.262 -16.491 1.00 13.78 ? 3   LYS D O     1 
ATOM   3692 C CB    . LYS C  2 3   ? 1.630   34.127 -17.250 1.00 14.86 ? 3   LYS D CB    1 
ATOM   3693 C CG    . LYS C  2 3   ? 2.169   33.108 -18.241 1.00 14.91 ? 3   LYS D CG    1 
ATOM   3694 C CD    . LYS C  2 3   ? 2.626   33.729 -19.560 1.00 15.22 ? 3   LYS D CD    1 
ATOM   3695 C CE    . LYS C  2 3   ? 3.735   34.745 -19.391 1.00 14.58 ? 3   LYS D CE    1 
ATOM   3696 N NZ    . LYS C  2 3   ? 4.330   35.214 -20.675 1.00 14.57 ? 3   LYS D NZ    1 
ATOM   3697 N N     . ARG C  2 4   ? -1.246  33.060 -16.537 1.00 17.43 ? 4   ARG D N     1 
ATOM   3698 C CA    A ARG C  2 4   ? -2.411  32.297 -16.949 0.60 19.61 ? 4   ARG D CA    1 
ATOM   3699 C CA    B ARG C  2 4   ? -2.447  32.351 -16.989 0.40 19.16 ? 4   ARG D CA    1 
ATOM   3700 C C     . ARG C  2 4   ? -2.166  31.598 -18.297 1.00 20.48 ? 4   ARG D C     1 
ATOM   3701 O O     . ARG C  2 4   ? -1.575  32.173 -19.219 1.00 20.87 ? 4   ARG D O     1 
ATOM   3702 C CB    A ARG C  2 4   ? -3.642  33.199 -17.020 0.60 21.71 ? 4   ARG D CB    1 
ATOM   3703 C CB    B ARG C  2 4   ? -3.613  33.350 -17.209 0.40 20.27 ? 4   ARG D CB    1 
ATOM   3704 C CG    A ARG C  2 4   ? -4.944  32.468 -17.333 0.60 24.01 ? 4   ARG D CG    1 
ATOM   3705 C CG    B ARG C  2 4   ? -4.248  33.904 -15.936 0.40 21.38 ? 4   ARG D CG    1 
ATOM   3706 C CD    A ARG C  2 4   ? -6.082  33.460 -17.495 0.60 25.37 ? 4   ARG D CD    1 
ATOM   3707 C CD    B ARG C  2 4   ? -5.290  35.015 -16.159 0.40 22.12 ? 4   ARG D CD    1 
ATOM   3708 N NE    A ARG C  2 4   ? -6.381  34.044 -16.197 0.60 27.40 ? 4   ARG D NE    1 
ATOM   3709 N NE    B ARG C  2 4   ? -5.538  35.731 -14.901 0.40 22.91 ? 4   ARG D NE    1 
ATOM   3710 C CZ    A ARG C  2 4   ? -7.234  33.549 -15.299 0.60 28.76 ? 4   ARG D CZ    1 
ATOM   3711 C CZ    B ARG C  2 4   ? -6.436  35.373 -13.989 0.40 22.71 ? 4   ARG D CZ    1 
ATOM   3712 N NH1   A ARG C  2 4   ? -7.947  32.457 -15.547 0.60 29.86 ? 4   ARG D NH1   1 
ATOM   3713 N NH2   A ARG C  2 4   ? -7.389  34.178 -14.141 0.60 30.48 ? 4   ARG D NH2   1 
ATOM   3714 N N     . ILE C  2 5   ? -2.594  30.347 -18.380 1.00 20.00 ? 5   ILE D N     1 
ATOM   3715 C CA    . ILE C  2 5   ? -2.521  29.566 -19.613 1.00 24.57 ? 5   ILE D CA    1 
ATOM   3716 C C     . ILE C  2 5   ? -3.400  30.277 -20.629 1.00 26.24 ? 5   ILE D C     1 
ATOM   3717 O O     . ILE C  2 5   ? -4.576  30.539 -20.370 1.00 26.50 ? 5   ILE D O     1 
ATOM   3718 C CB    . ILE C  2 5   ? -2.988  28.109 -19.420 1.00 26.01 ? 5   ILE D CB    1 
ATOM   3719 C CG1   . ILE C  2 5   ? -2.042  27.371 -18.469 1.00 25.60 ? 5   ILE D CG1   1 
ATOM   3720 C CG2   . ILE C  2 5   ? -3.057  27.348 -20.746 1.00 27.80 ? 5   ILE D CG2   1 
ATOM   3721 C CD1   . ILE C  2 5   ? -2.518  25.989 -18.070 1.00 28.51 ? 5   ILE D CD1   1 
ATOM   3722 N N     . ALA C  2 6   ? -2.800  30.652 -21.754 1.00 26.55 ? 6   ALA D N     1 
ATOM   3723 C CA    . ALA C  2 6   ? -3.523  31.285 -22.859 1.00 28.01 ? 6   ALA D CA    1 
ATOM   3724 C C     . ALA C  2 6   ? -4.500  30.315 -23.501 1.00 28.06 ? 6   ALA D C     1 
ATOM   3725 O O     . ALA C  2 6   ? -4.285  29.107 -23.500 1.00 27.10 ? 6   ALA D O     1 
ATOM   3726 C CB    . ALA C  2 6   ? -2.538  31.780 -23.906 1.00 28.42 ? 6   ALA D CB    1 
ATOM   3727 O OXT   . ALA C  2 6   ? -5.528  30.747 -24.033 1.00 30.66 ? 6   ALA D OXT   1 
ATOM   3728 N N     . PRO D  2 1   ? -4.271  33.721 5.586   1.00 17.85 ? 1   PRO E N     1 
ATOM   3729 C CA    . PRO D  2 1   ? -5.118  34.602 4.788   1.00 16.20 ? 1   PRO E CA    1 
ATOM   3730 C C     . PRO D  2 1   ? -6.400  33.864 4.461   1.00 15.09 ? 1   PRO E C     1 
ATOM   3731 O O     . PRO D  2 1   ? -6.471  32.660 4.717   1.00 16.89 ? 1   PRO E O     1 
ATOM   3732 C CB    . PRO D  2 1   ? -4.277  34.815 3.528   1.00 16.61 ? 1   PRO E CB    1 
ATOM   3733 C CG    . PRO D  2 1   ? -3.512  33.556 3.391   1.00 17.92 ? 1   PRO E CG    1 
ATOM   3734 C CD    . PRO D  2 1   ? -3.177  33.125 4.778   1.00 17.34 ? 1   PRO E CD    1 
ATOM   3735 N N     . PRO D  2 2   ? -7.382  34.545 3.876   1.00 14.62 ? 2   PRO E N     1 
ATOM   3736 C CA    . PRO D  2 2   ? -8.418  33.787 3.170   1.00 15.28 ? 2   PRO E CA    1 
ATOM   3737 C C     . PRO D  2 2   ? -7.743  32.808 2.220   1.00 16.61 ? 2   PRO E C     1 
ATOM   3738 O O     . PRO D  2 2   ? -6.713  33.148 1.624   1.00 15.44 ? 2   PRO E O     1 
ATOM   3739 C CB    . PRO D  2 2   ? -9.142  34.839 2.355   1.00 15.78 ? 2   PRO E CB    1 
ATOM   3740 C CG    . PRO D  2 2   ? -8.196  35.963 2.253   1.00 15.78 ? 2   PRO E CG    1 
ATOM   3741 C CD    . PRO D  2 2   ? -7.418  35.982 3.524   1.00 14.50 ? 2   PRO E CD    1 
ATOM   3742 N N     . LYS D  2 3   ? -8.281  31.596 2.120   1.00 17.46 ? 3   LYS E N     1 
ATOM   3743 C CA    . LYS D  2 3   ? -7.639  30.608 1.245   1.00 18.43 ? 3   LYS E CA    1 
ATOM   3744 C C     . LYS D  2 3   ? -8.587  29.526 0.722   1.00 21.07 ? 3   LYS E C     1 
ATOM   3745 O O     . LYS D  2 3   ? -9.626  29.217 1.321   1.00 19.42 ? 3   LYS E O     1 
ATOM   3746 C CB    . LYS D  2 3   ? -6.456  29.978 1.963   1.00 18.25 ? 3   LYS E CB    1 
ATOM   3747 C CG    . LYS D  2 3   ? -6.863  29.184 3.201   1.00 17.63 ? 3   LYS E CG    1 
ATOM   3748 C CD    . LYS D  2 3   ? -5.745  28.427 3.857   1.00 17.70 ? 3   LYS E CD    1 
ATOM   3749 C CE    . LYS D  2 3   ? -4.656  29.319 4.410   1.00 17.31 ? 3   LYS E CE    1 
ATOM   3750 N NZ    . LYS D  2 3   ? -3.716  28.573 5.263   1.00 16.92 ? 3   LYS E NZ    1 
ATOM   3751 N N     . ARG D  2 4   ? -8.193  28.935 -0.409  1.00 22.88 ? 4   ARG E N     1 
ATOM   3752 C CA    A ARG D  2 4   ? -8.946  27.843 -1.027  0.50 25.57 ? 4   ARG E CA    1 
ATOM   3753 C CA    B ARG D  2 4   ? -8.983  27.860 -1.003  0.50 24.48 ? 4   ARG E CA    1 
ATOM   3754 C C     . ARG D  2 4   ? -9.110  26.686 -0.043  1.00 25.78 ? 4   ARG E C     1 
ATOM   3755 O O     . ARG D  2 4   ? -8.177  26.365 0.703   1.00 26.82 ? 4   ARG E O     1 
ATOM   3756 C CB    A ARG D  2 4   ? -8.214  27.374 -2.305  0.50 27.24 ? 4   ARG E CB    1 
ATOM   3757 C CB    B ARG D  2 4   ? -8.381  27.402 -2.342  0.50 24.71 ? 4   ARG E CB    1 
ATOM   3758 C CG    A ARG D  2 4   ? -9.039  26.554 -3.289  0.50 29.00 ? 4   ARG E CG    1 
ATOM   3759 C CG    B ARG D  2 4   ? -8.542  28.407 -3.473  0.50 24.59 ? 4   ARG E CG    1 
ATOM   3760 C CD    A ARG D  2 4   ? -8.307  26.403 -4.624  0.50 28.88 ? 4   ARG E CD    1 
ATOM   3761 N NE    A ARG D  2 4   ? -8.471  27.564 -5.498  0.50 29.68 ? 4   ARG E NE    1 
ATOM   3762 C CZ    A ARG D  2 4   ? -9.453  27.695 -6.388  0.50 29.24 ? 4   ARG E CZ    1 
ATOM   3763 N NH1   A ARG D  2 4   ? -10.358 26.740 -6.523  0.50 29.29 ? 4   ARG E NH1   1 
ATOM   3764 N NH2   A ARG D  2 4   ? -9.543  28.782 -7.133  0.50 28.89 ? 4   ARG E NH2   1 
ATOM   3765 N N     . ILE D  2 5   ? -10.286 26.055 -0.037  1.00 29.02 ? 5   ILE E N     1 
ATOM   3766 C CA    . ILE D  2 5   ? -10.505 24.885 0.816   1.00 33.53 ? 5   ILE E CA    1 
ATOM   3767 C C     . ILE D  2 5   ? -9.686  23.763 0.189   1.00 36.96 ? 5   ILE E C     1 
ATOM   3768 O O     . ILE D  2 5   ? -9.788  23.534 -1.022  1.00 35.17 ? 5   ILE E O     1 
ATOM   3769 C CB    . ILE D  2 5   ? -11.986 24.450 0.897   1.00 37.15 ? 5   ILE E CB    1 
ATOM   3770 C CG1   . ILE D  2 5   ? -12.813 25.573 1.540   1.00 39.34 ? 5   ILE E CG1   1 
ATOM   3771 C CG2   . ILE D  2 5   ? -12.103 23.124 1.668   1.00 39.05 ? 5   ILE E CG2   1 
ATOM   3772 C CD1   . ILE D  2 5   ? -14.242 25.204 1.923   1.00 42.65 ? 5   ILE E CD1   1 
ATOM   3773 N N     . ALA D  2 6   ? -8.866  23.108 1.005   1.00 40.35 ? 6   ALA E N     1 
ATOM   3774 C CA    . ALA D  2 6   ? -7.978  22.058 0.531   1.00 42.75 ? 6   ALA E CA    1 
ATOM   3775 C C     . ALA D  2 6   ? -8.799  20.843 0.098   1.00 46.49 ? 6   ALA E C     1 
ATOM   3776 O O     . ALA D  2 6   ? -9.899  20.604 0.620   1.00 44.75 ? 6   ALA E O     1 
ATOM   3777 C CB    . ALA D  2 6   ? -6.982  21.670 1.617   1.00 44.35 ? 6   ALA E CB    1 
ATOM   3778 O OXT   . ALA D  2 6   ? -8.385  20.104 -0.801  1.00 47.62 ? 6   ALA E OXT   1 
HETATM 3779 N N     . SAH E  3 .   ? 13.881  35.777 -12.210 1.00 11.15 ? 301 SAH A N     1 
HETATM 3780 C CA    . SAH E  3 .   ? 13.319  36.868 -11.353 1.00 11.39 ? 301 SAH A CA    1 
HETATM 3781 C CB    . SAH E  3 .   ? 12.603  37.954 -12.218 1.00 11.78 ? 301 SAH A CB    1 
HETATM 3782 C CG    . SAH E  3 .   ? 11.512  37.406 -13.125 1.00 11.69 ? 301 SAH A CG    1 
HETATM 3783 S SD    . SAH E  3 .   ? 10.790  38.643 -14.216 1.00 11.97 ? 301 SAH A SD    1 
HETATM 3784 C C     . SAH E  3 .   ? 12.340  36.297 -10.395 1.00 11.73 ? 301 SAH A C     1 
HETATM 3785 O O     . SAH E  3 .   ? 11.842  35.141 -10.549 1.00 10.52 ? 301 SAH A O     1 
HETATM 3786 O OXT   . SAH E  3 .   ? 11.970  37.048 -9.445  1.00 12.87 ? 301 SAH A OXT   1 
HETATM 3787 C "C5'" . SAH E  3 .   ? 11.774  38.413 -15.692 1.00 11.21 ? 301 SAH A "C5'" 1 
HETATM 3788 C "C4'" . SAH E  3 .   ? 13.067  39.164 -15.688 1.00 10.47 ? 301 SAH A "C4'" 1 
HETATM 3789 O "O4'" . SAH E  3 .   ? 13.763  38.852 -16.913 1.00 10.00 ? 301 SAH A "O4'" 1 
HETATM 3790 C "C3'" . SAH E  3 .   ? 12.937  40.704 -15.645 1.00 10.20 ? 301 SAH A "C3'" 1 
HETATM 3791 O "O3'" . SAH E  3 .   ? 13.782  41.220 -14.609 1.00 10.42 ? 301 SAH A "O3'" 1 
HETATM 3792 C "C2'" . SAH E  3 .   ? 13.463  41.133 -17.011 1.00 9.70  ? 301 SAH A "C2'" 1 
HETATM 3793 O "O2'" . SAH E  3 .   ? 14.156  42.375 -17.066 1.00 10.79 ? 301 SAH A "O2'" 1 
HETATM 3794 C "C1'" . SAH E  3 .   ? 14.429  40.025 -17.356 1.00 9.89  ? 301 SAH A "C1'" 1 
HETATM 3795 N N9    . SAH E  3 .   ? 14.730  39.817 -18.784 1.00 9.68  ? 301 SAH A N9    1 
HETATM 3796 C C8    . SAH E  3 .   ? 13.843  39.748 -19.798 1.00 9.80  ? 301 SAH A C8    1 
HETATM 3797 N N7    . SAH E  3 .   ? 14.481  39.432 -20.975 1.00 9.71  ? 301 SAH A N7    1 
HETATM 3798 C C5    . SAH E  3 .   ? 15.793  39.306 -20.659 1.00 9.68  ? 301 SAH A C5    1 
HETATM 3799 C C6    . SAH E  3 .   ? 17.025  38.995 -21.396 1.00 9.94  ? 301 SAH A C6    1 
HETATM 3800 N N6    . SAH E  3 .   ? 16.926  38.763 -22.723 1.00 9.83  ? 301 SAH A N6    1 
HETATM 3801 N N1    . SAH E  3 .   ? 18.198  38.940 -20.712 1.00 9.48  ? 301 SAH A N1    1 
HETATM 3802 C C2    . SAH E  3 .   ? 18.258  39.184 -19.383 1.00 10.46 ? 301 SAH A C2    1 
HETATM 3803 N N3    . SAH E  3 .   ? 17.172  39.487 -18.652 1.00 9.78  ? 301 SAH A N3    1 
HETATM 3804 C C4    . SAH E  3 .   ? 15.947  39.552 -19.228 1.00 10.11 ? 301 SAH A C4    1 
HETATM 3805 C C1    . GOL F  4 .   ? 7.769   32.667 -20.225 1.00 18.32 ? 302 GOL A C1    1 
HETATM 3806 O O1    . GOL F  4 .   ? 6.589   31.870 -20.051 1.00 15.84 ? 302 GOL A O1    1 
HETATM 3807 C C2    . GOL F  4 .   ? 8.275   33.253 -18.911 1.00 17.53 ? 302 GOL A C2    1 
HETATM 3808 O O2    . GOL F  4 .   ? 7.514   34.394 -18.529 1.00 18.16 ? 302 GOL A O2    1 
HETATM 3809 C C3    . GOL F  4 .   ? 9.752   33.626 -19.094 1.00 16.73 ? 302 GOL A C3    1 
HETATM 3810 O O3    . GOL F  4 .   ? 10.540  32.455 -19.270 1.00 13.23 ? 302 GOL A O3    1 
HETATM 3811 C C1    . GOL G  4 .   ? 35.876  39.711 -4.360  1.00 36.40 ? 303 GOL A C1    1 
HETATM 3812 O O1    . GOL G  4 .   ? 34.639  40.337 -3.952  1.00 30.39 ? 303 GOL A O1    1 
HETATM 3813 C C2    . GOL G  4 .   ? 35.681  38.865 -5.622  1.00 37.55 ? 303 GOL A C2    1 
HETATM 3814 O O2    . GOL G  4 .   ? 35.072  37.590 -5.284  1.00 34.59 ? 303 GOL A O2    1 
HETATM 3815 C C3    . GOL G  4 .   ? 36.969  38.665 -6.431  1.00 37.79 ? 303 GOL A C3    1 
HETATM 3816 O O3    . GOL G  4 .   ? 37.891  37.729 -5.845  1.00 40.14 ? 303 GOL A O3    1 
HETATM 3817 X UNK   . UNX H  5 .   ? 2.621   42.882 -14.012 1.00 28.12 ? 304 UNX A UNK   1 
HETATM 3818 X UNK   . UNX I  5 .   ? -3.382  36.121 -8.409  1.00 23.82 ? 305 UNX A UNK   1 
HETATM 3819 X UNK   . UNX J  5 .   ? 8.457   23.819 0.134   1.00 22.20 ? 306 UNX A UNK   1 
HETATM 3820 X UNK   . UNX K  5 .   ? 26.208  18.785 -6.768  1.00 19.42 ? 307 UNX A UNK   1 
HETATM 3821 X UNK   . UNX L  5 .   ? 17.914  51.911 -5.321  1.00 21.43 ? 308 UNX A UNK   1 
HETATM 3822 X UNK   . UNX M  5 .   ? 18.311  40.901 2.648   1.00 29.79 ? 309 UNX A UNK   1 
HETATM 3823 X UNK   . UNX N  5 .   ? 18.521  33.202 -32.497 1.00 10.99 ? 310 UNX A UNK   1 
HETATM 3824 X UNK   . UNX O  5 .   ? 16.897  23.434 -30.185 1.00 17.16 ? 311 UNX A UNK   1 
HETATM 3825 X UNK   . UNX P  5 .   ? 3.094   19.142 -16.348 1.00 24.61 ? 312 UNX A UNK   1 
HETATM 3826 X UNK   . UNX Q  5 .   ? 27.976  31.457 -27.602 1.00 8.84  ? 313 UNX A UNK   1 
HETATM 3827 X UNK   . UNX R  5 .   ? 20.091  41.162 -28.670 1.00 27.72 ? 314 UNX A UNK   1 
HETATM 3828 X UNK   . UNX S  5 .   ? -0.309  33.436 -1.123  1.00 27.15 ? 315 UNX A UNK   1 
HETATM 3829 X UNK   . UNX T  5 .   ? 9.559   40.481 -0.868  1.00 22.91 ? 316 UNX A UNK   1 
HETATM 3830 X UNK   . UNX U  5 .   ? 14.382  14.015 -11.020 1.00 25.44 ? 317 UNX A UNK   1 
HETATM 3831 X UNK   . UNX V  5 .   ? 18.940  38.249 2.348   1.00 22.78 ? 318 UNX A UNK   1 
HETATM 3832 X UNK   . UNX W  5 .   ? 27.278  31.788 3.225   1.00 32.29 ? 319 UNX A UNK   1 
HETATM 3833 X UNK   . UNX X  5 .   ? 7.895   16.356 -9.885  1.00 20.98 ? 320 UNX A UNK   1 
HETATM 3834 X UNK   . UNX Y  5 .   ? 32.307  26.263 -0.943  1.00 22.07 ? 321 UNX A UNK   1 
HETATM 3835 X UNK   . UNX Z  5 .   ? 30.398  24.714 -22.731 1.00 22.62 ? 322 UNX A UNK   1 
HETATM 3836 X UNK   . UNX AA 5 .   ? 24.126  36.372 -29.349 1.00 29.03 ? 323 UNX A UNK   1 
HETATM 3837 X UNK   . UNX BA 5 .   ? 1.155   48.260 -18.230 1.00 33.89 ? 324 UNX A UNK   1 
HETATM 3838 X UNK   . UNX CA 5 .   ? 22.139  14.027 -22.829 1.00 21.74 ? 325 UNX A UNK   1 
HETATM 3839 N N     . SAH DA 3 .   ? -4.289  40.395 10.053  1.00 11.20 ? 301 SAH B N     1 
HETATM 3840 C CA    . SAH DA 3 .   ? -3.718  41.071 8.867   1.00 11.25 ? 301 SAH B CA    1 
HETATM 3841 C CB    . SAH DA 3 .   ? -2.591  40.228 8.206   1.00 11.44 ? 301 SAH B CB    1 
HETATM 3842 C CG    . SAH DA 3 .   ? -3.016  38.812 7.835   1.00 12.02 ? 301 SAH B CG    1 
HETATM 3843 S SD    . SAH DA 3 .   ? -1.625  37.874 7.195   1.00 12.70 ? 301 SAH B SD    1 
HETATM 3844 C C     . SAH DA 3 .   ? -4.796  41.290 7.867   1.00 11.16 ? 301 SAH B C     1 
HETATM 3845 O O     . SAH DA 3 .   ? -4.567  42.083 6.933   1.00 11.02 ? 301 SAH B O     1 
HETATM 3846 O OXT   . SAH DA 3 .   ? -5.879  40.660 7.915   1.00 11.37 ? 301 SAH B OXT   1 
HETATM 3847 C "C5'" . SAH DA 3 .   ? -1.076  37.001 8.657   1.00 11.81 ? 301 SAH B "C5'" 1 
HETATM 3848 C "C4'" . SAH DA 3 .   ? -0.188  37.791 9.586   1.00 11.82 ? 301 SAH B "C4'" 1 
HETATM 3849 O "O4'" . SAH DA 3 .   ? 0.127   36.961 10.729  1.00 12.17 ? 301 SAH B "O4'" 1 
HETATM 3850 C "C3'" . SAH DA 3 .   ? 1.159   38.197 8.985   1.00 11.63 ? 301 SAH B "C3'" 1 
HETATM 3851 O "O3'" . SAH DA 3 .   ? 1.413   39.602 9.088   1.00 12.21 ? 301 SAH B "O3'" 1 
HETATM 3852 C "C2'" . SAH DA 3 .   ? 2.200   37.380 9.765   1.00 11.62 ? 301 SAH B "C2'" 1 
HETATM 3853 O "O2'" . SAH DA 3 .   ? 3.471   37.997 9.933   1.00 11.42 ? 301 SAH B "O2'" 1 
HETATM 3854 C "C1'" . SAH DA 3 .   ? 1.490   37.231 11.094  1.00 12.29 ? 301 SAH B "C1'" 1 
HETATM 3855 N N9    . SAH DA 3 .   ? 1.868   36.102 11.943  1.00 13.76 ? 301 SAH B N9    1 
HETATM 3856 C C8    . SAH DA 3 .   ? 1.977   34.794 11.601  1.00 14.15 ? 301 SAH B C8    1 
HETATM 3857 N N7    . SAH DA 3 .   ? 2.231   34.026 12.712  1.00 14.37 ? 301 SAH B N7    1 
HETATM 3858 C C5    . SAH DA 3 .   ? 2.271   34.890 13.741  1.00 14.35 ? 301 SAH B C5    1 
HETATM 3859 C C6    . SAH DA 3 .   ? 2.436   34.763 15.197  1.00 14.51 ? 301 SAH B C6    1 
HETATM 3860 N N6    . SAH DA 3 .   ? 2.677   33.568 15.709  1.00 14.89 ? 301 SAH B N6    1 
HETATM 3861 N N1    . SAH DA 3 .   ? 2.372   35.881 15.936  1.00 14.34 ? 301 SAH B N1    1 
HETATM 3862 C C2    . SAH DA 3 .   ? 2.153   37.112 15.443  1.00 14.11 ? 301 SAH B C2    1 
HETATM 3863 N N3    . SAH DA 3 .   ? 1.992   37.303 14.116  1.00 14.14 ? 301 SAH B N3    1 
HETATM 3864 C C4    . SAH DA 3 .   ? 1.997   36.227 13.270  1.00 14.73 ? 301 SAH B C4    1 
HETATM 3865 C C1    . GOL EA 4 .   ? -4.626  32.100 9.812   1.00 22.16 ? 302 GOL B C1    1 
HETATM 3866 O O1    . GOL EA 4 .   ? -5.422  32.054 11.018  1.00 18.80 ? 302 GOL B O1    1 
HETATM 3867 C C2    . GOL EA 4 .   ? -5.292  31.403 8.628   1.00 21.05 ? 302 GOL B C2    1 
HETATM 3868 O O2    . GOL EA 4 .   ? -4.541  31.672 7.439   1.00 22.25 ? 302 GOL B O2    1 
HETATM 3869 C C3    . GOL EA 4 .   ? -5.393  29.901 8.881   1.00 21.44 ? 302 GOL B C3    1 
HETATM 3870 O O3    . GOL EA 4 .   ? -6.445  29.336 8.102   1.00 19.36 ? 302 GOL B O3    1 
HETATM 3871 X UNK   . UNX FA 5 .   ? -20.887 44.949 4.692   1.00 27.77 ? 303 UNX B UNK   1 
HETATM 3872 X UNK   . UNX GA 5 .   ? -17.952 54.645 22.303  1.00 18.70 ? 304 UNX B UNK   1 
HETATM 3873 X UNK   . UNX HA 5 .   ? -21.877 52.951 28.376  1.00 25.48 ? 305 UNX B UNK   1 
HETATM 3874 X UNK   . UNX IA 5 .   ? -10.867 58.700 16.987  1.00 34.02 ? 306 UNX B UNK   1 
HETATM 3875 X UNK   . UNX JA 5 .   ? -0.887  64.409 10.841  0.80 24.96 ? 307 UNX B UNK   1 
HETATM 3876 X UNK   . UNX KA 5 .   ? 5.118   41.072 25.615  1.00 20.66 ? 308 UNX B UNK   1 
HETATM 3877 X UNK   . UNX LA 5 .   ? 1.307   24.500 22.687  1.00 21.42 ? 309 UNX B UNK   1 
HETATM 3878 X UNK   . UNX MA 5 .   ? 3.524   31.689 13.613  1.00 9.11  ? 310 UNX B UNK   1 
HETATM 3879 X UNK   . UNX NA 5 .   ? 5.116   20.154 12.657  1.00 28.22 ? 311 UNX B UNK   1 
HETATM 3880 X UNK   . UNX OA 5 .   ? -0.020  32.749 1.373   1.00 17.66 ? 312 UNX B UNK   1 
HETATM 3881 X UNK   . UNX PA 5 .   ? 5.685   47.049 -1.230  1.00 29.27 ? 313 UNX B UNK   1 
HETATM 3882 X UNK   . UNX QA 5 .   ? 2.818   44.622 25.549  1.00 16.99 ? 314 UNX B UNK   1 
HETATM 3883 X UNK   . UNX RA 5 .   ? 6.659   42.844 22.198  1.00 24.15 ? 315 UNX B UNK   1 
HETATM 3884 X UNK   . UNX SA 5 .   ? 2.409   28.993 13.182  1.00 13.08 ? 316 UNX B UNK   1 
HETATM 3885 X UNK   . UNX TA 5 .   ? -20.975 50.909 31.469  1.00 29.47 ? 317 UNX B UNK   1 
HETATM 3886 X UNK   . UNX UA 5 .   ? -16.198 59.244 21.209  1.00 23.27 ? 318 UNX B UNK   1 
HETATM 3887 X UNK   . UNX VA 5 .   ? 3.328   50.257 1.783   1.00 23.56 ? 319 UNX B UNK   1 
HETATM 3888 X UNK   . UNX WA 5 .   ? -0.169  35.115 2.083   1.00 26.59 ? 320 UNX B UNK   1 
HETATM 3889 X UNK   A UNX XA 5 .   ? -24.436 43.590 19.760  0.50 37.37 ? 321 UNX B UNK   1 
HETATM 3890 X UNK   . UNX YA 5 .   ? 9.209   36.497 -16.092 1.00 18.74 ? 101 UNX D UNK   1 
HETATM 3891 X UNK   . UNX ZA 5 .   ? -3.167  35.162 7.157   1.00 22.55 ? 101 UNX E UNK   1 
HETATM 3892 O O     . HOH AB 6 .   ? 14.764  52.608 -7.822  1.00 39.17 ? 401 HOH A O     1 
HETATM 3893 O O     . HOH AB 6 .   ? 9.902   36.159 -1.587  1.00 19.04 ? 402 HOH A O     1 
HETATM 3894 O O     . HOH AB 6 .   ? 30.618  20.689 -23.230 1.00 31.57 ? 403 HOH A O     1 
HETATM 3895 O O     . HOH AB 6 .   ? 31.091  16.312 -9.244  1.00 20.66 ? 404 HOH A O     1 
HETATM 3896 O O     . HOH AB 6 .   ? 10.122  46.759 -30.569 1.00 25.76 ? 405 HOH A O     1 
HETATM 3897 O O     . HOH AB 6 .   ? 14.498  23.449 2.894   1.00 27.96 ? 406 HOH A O     1 
HETATM 3898 O O     . HOH AB 6 .   ? 16.411  19.209 0.293   1.00 32.17 ? 407 HOH A O     1 
HETATM 3899 O O     . HOH AB 6 .   ? 33.634  26.703 -5.287  1.00 25.45 ? 408 HOH A O     1 
HETATM 3900 O O     . HOH AB 6 .   ? 34.040  23.627 -6.112  1.00 25.60 ? 409 HOH A O     1 
HETATM 3901 O O     . HOH AB 6 .   ? 33.000  34.424 -3.428  1.00 22.86 ? 410 HOH A O     1 
HETATM 3902 O O     . HOH AB 6 .   ? 21.874  46.756 -1.205  1.00 22.53 ? 411 HOH A O     1 
HETATM 3903 O O     . HOH AB 6 .   ? 6.133   21.644 -36.124 1.00 29.05 ? 412 HOH A O     1 
HETATM 3904 O O     . HOH AB 6 .   ? 1.871   42.482 -17.551 1.00 25.33 ? 413 HOH A O     1 
HETATM 3905 O O     . HOH AB 6 .   ? -1.547  28.112 -23.775 1.00 25.57 ? 414 HOH A O     1 
HETATM 3906 O O     . HOH AB 6 .   ? 4.714   37.525 -41.130 1.00 29.00 ? 415 HOH A O     1 
HETATM 3907 O O     . HOH AB 6 .   ? 14.196  31.246 -33.148 1.00 12.80 ? 416 HOH A O     1 
HETATM 3908 O O     . HOH AB 6 .   ? 38.966  35.911 -11.327 1.00 21.47 ? 417 HOH A O     1 
HETATM 3909 O O     . HOH AB 6 .   ? 3.611   46.477 -8.094  1.00 18.77 ? 418 HOH A O     1 
HETATM 3910 O O     . HOH AB 6 .   ? 31.214  31.593 -20.092 1.00 21.69 ? 419 HOH A O     1 
HETATM 3911 O O     . HOH AB 6 .   ? 29.557  20.612 -15.533 1.00 10.63 ? 420 HOH A O     1 
HETATM 3912 O O     . HOH AB 6 .   ? 2.811   51.226 -20.231 1.00 33.95 ? 421 HOH A O     1 
HETATM 3913 O O     . HOH AB 6 .   ? 9.438   26.395 -21.164 1.00 11.61 ? 422 HOH A O     1 
HETATM 3914 O O     . HOH AB 6 .   ? 11.453  21.248 -3.525  1.00 15.62 ? 423 HOH A O     1 
HETATM 3915 O O     . HOH AB 6 .   ? 9.722   22.563 -6.799  1.00 17.67 ? 424 HOH A O     1 
HETATM 3916 O O     . HOH AB 6 .   ? 5.156   28.376 -38.145 1.00 21.00 ? 425 HOH A O     1 
HETATM 3917 O O     . HOH AB 6 .   ? 24.391  46.756 -3.373  1.00 27.18 ? 426 HOH A O     1 
HETATM 3918 O O     . HOH AB 6 .   ? 30.413  24.199 -6.765  1.00 13.04 ? 427 HOH A O     1 
HETATM 3919 O O     . HOH AB 6 .   ? 5.980   21.337 -2.038  1.00 36.97 ? 428 HOH A O     1 
HETATM 3920 O O     . HOH AB 6 .   ? 1.513   24.074 -18.348 1.00 15.68 ? 429 HOH A O     1 
HETATM 3921 O O     . HOH AB 6 .   ? 16.001  37.385 -8.343  1.00 11.88 ? 430 HOH A O     1 
HETATM 3922 O O     . HOH AB 6 .   ? 32.835  12.879 -7.646  1.00 16.05 ? 431 HOH A O     1 
HETATM 3923 O O     . HOH AB 6 .   ? 5.473   17.256 -25.876 1.00 37.52 ? 432 HOH A O     1 
HETATM 3924 O O     . HOH AB 6 .   ? 10.491  32.293 -37.969 1.00 14.79 ? 433 HOH A O     1 
HETATM 3925 O O     . HOH AB 6 .   ? 16.357  34.473 -11.805 1.00 10.07 ? 434 HOH A O     1 
HETATM 3926 O O     . HOH AB 6 .   ? 14.706  51.897 -10.499 1.00 26.55 ? 435 HOH A O     1 
HETATM 3927 O O     . HOH AB 6 .   ? 29.367  38.232 -24.355 1.00 16.92 ? 436 HOH A O     1 
HETATM 3928 O O     . HOH AB 6 .   ? 9.772   23.199 -9.422  1.00 13.25 ? 437 HOH A O     1 
HETATM 3929 O O     . HOH AB 6 .   ? 25.473  28.042 2.794   1.00 19.16 ? 438 HOH A O     1 
HETATM 3930 O O     . HOH AB 6 .   ? 4.854   41.424 -14.938 1.00 22.46 ? 439 HOH A O     1 
HETATM 3931 O O     . HOH AB 6 .   ? 17.832  16.831 -21.527 1.00 22.47 ? 440 HOH A O     1 
HETATM 3932 O O     . HOH AB 6 .   ? -0.050  32.825 -25.976 1.00 15.18 ? 441 HOH A O     1 
HETATM 3933 O O     . HOH AB 6 .   ? 28.676  22.497 -23.863 1.00 20.02 ? 442 HOH A O     1 
HETATM 3934 O O     . HOH AB 6 .   ? 32.108  22.151 -13.091 1.00 21.38 ? 443 HOH A O     1 
HETATM 3935 O O     . HOH AB 6 .   ? 26.800  45.495 -3.690  1.00 21.63 ? 444 HOH A O     1 
HETATM 3936 O O     . HOH AB 6 .   ? 22.582  13.297 -20.244 1.00 15.39 ? 445 HOH A O     1 
HETATM 3937 O O     . HOH AB 6 .   ? 16.448  43.760 -30.750 1.00 16.40 ? 446 HOH A O     1 
HETATM 3938 O O     . HOH AB 6 .   ? 9.213   47.991 -28.524 1.00 21.91 ? 447 HOH A O     1 
HETATM 3939 O O     . HOH AB 6 .   ? 5.444   32.987 -22.231 1.00 13.75 ? 448 HOH A O     1 
HETATM 3940 O O     . HOH AB 6 .   ? 31.092  34.794 -25.809 1.00 17.90 ? 449 HOH A O     1 
HETATM 3941 O O     . HOH AB 6 .   ? 8.049   36.844 -19.544 1.00 13.79 ? 450 HOH A O     1 
HETATM 3942 O O     . HOH AB 6 .   ? 39.360  34.888 -14.896 1.00 19.95 ? 451 HOH A O     1 
HETATM 3943 O O     . HOH AB 6 .   ? 12.922  30.649 -6.537  1.00 12.59 ? 452 HOH A O     1 
HETATM 3944 O O     . HOH AB 6 .   ? 5.208   25.614 -37.946 1.00 31.74 ? 453 HOH A O     1 
HETATM 3945 O O     . HOH AB 6 .   ? 4.139   38.969 -18.502 1.00 19.67 ? 454 HOH A O     1 
HETATM 3946 O O     . HOH AB 6 .   ? 26.592  15.804 -2.076  1.00 18.22 ? 455 HOH A O     1 
HETATM 3947 O O     . HOH AB 6 .   ? 10.322  47.167 -4.760  1.00 24.63 ? 456 HOH A O     1 
HETATM 3948 O O     . HOH AB 6 .   ? 22.778  40.541 -29.649 1.00 39.06 ? 457 HOH A O     1 
HETATM 3949 O O     . HOH AB 6 .   ? 2.316   39.072 -38.449 1.00 32.55 ? 458 HOH A O     1 
HETATM 3950 O O     . HOH AB 6 .   ? 14.041  46.458 -20.193 1.00 17.40 ? 459 HOH A O     1 
HETATM 3951 O O     . HOH AB 6 .   ? 33.855  42.871 -4.572  1.00 19.58 ? 460 HOH A O     1 
HETATM 3952 O O     . HOH AB 6 .   ? 6.582   17.798 -7.394  1.00 23.22 ? 461 HOH A O     1 
HETATM 3953 O O     . HOH AB 6 .   ? 30.446  40.780 -2.744  1.00 22.39 ? 462 HOH A O     1 
HETATM 3954 O O     . HOH AB 6 .   ? 13.501  15.877 -25.651 1.00 19.35 ? 463 HOH A O     1 
HETATM 3955 O O     . HOH AB 6 .   ? 8.651   50.834 -21.952 1.00 21.04 ? 464 HOH A O     1 
HETATM 3956 O O     . HOH AB 6 .   ? 6.430   45.607 -25.776 1.00 20.01 ? 465 HOH A O     1 
HETATM 3957 O O     . HOH AB 6 .   ? 25.853  40.288 4.954   1.00 24.31 ? 466 HOH A O     1 
HETATM 3958 O O     . HOH AB 6 .   ? 13.107  18.991 -3.588  1.00 21.52 ? 467 HOH A O     1 
HETATM 3959 O O     . HOH AB 6 .   ? 12.374  24.840 2.107   1.00 15.44 ? 468 HOH A O     1 
HETATM 3960 O O     . HOH AB 6 .   ? 31.227  22.652 -16.312 1.00 15.19 ? 469 HOH A O     1 
HETATM 3961 O O     . HOH AB 6 .   ? 12.621  38.246 -25.461 1.00 10.02 ? 470 HOH A O     1 
HETATM 3962 O O     . HOH AB 6 .   ? 9.160   42.250 -39.386 1.00 34.01 ? 471 HOH A O     1 
HETATM 3963 O O     . HOH AB 6 .   ? 6.161   36.179 -33.803 1.00 13.34 ? 472 HOH A O     1 
HETATM 3964 O O     . HOH AB 6 .   ? 6.924   38.991 -29.892 1.00 17.91 ? 473 HOH A O     1 
HETATM 3965 O O     . HOH AB 6 .   ? 30.978  36.621 -14.586 1.00 11.53 ? 474 HOH A O     1 
HETATM 3966 O O     . HOH AB 6 .   ? 29.744  20.912 -12.773 1.00 11.21 ? 475 HOH A O     1 
HETATM 3967 O O     . HOH AB 6 .   ? 26.906  39.513 -27.962 1.00 31.16 ? 476 HOH A O     1 
HETATM 3968 O O     . HOH AB 6 .   ? 2.258   27.611 -31.047 1.00 20.36 ? 477 HOH A O     1 
HETATM 3969 O O     . HOH AB 6 .   ? -2.420  23.777 -9.467  1.00 32.76 ? 478 HOH A O     1 
HETATM 3970 O O     . HOH AB 6 .   ? 15.678  34.127 3.359   1.00 21.86 ? 479 HOH A O     1 
HETATM 3971 O O     . HOH AB 6 .   ? -1.025  25.550 -12.474 1.00 18.90 ? 480 HOH A O     1 
HETATM 3972 O O     . HOH AB 6 .   ? 22.170  43.003 -24.187 1.00 15.16 ? 481 HOH A O     1 
HETATM 3973 O O     . HOH AB 6 .   ? 3.652   32.257 -1.244  1.00 11.38 ? 482 HOH A O     1 
HETATM 3974 O O     . HOH AB 6 .   ? 0.829   23.549 -28.875 1.00 35.22 ? 483 HOH A O     1 
HETATM 3975 O O     . HOH AB 6 .   ? 37.450  32.583 -12.412 1.00 24.16 ? 484 HOH A O     1 
HETATM 3976 O O     . HOH AB 6 .   ? 20.560  16.100 -21.429 1.00 19.40 ? 485 HOH A O     1 
HETATM 3977 O O     . HOH AB 6 .   ? 3.034   29.890 -14.740 1.00 12.98 ? 486 HOH A O     1 
HETATM 3978 O O     . HOH AB 6 .   ? 28.262  13.983 -3.156  1.00 18.32 ? 487 HOH A O     1 
HETATM 3979 O O     . HOH AB 6 .   ? 32.840  36.952 -12.332 1.00 24.64 ? 488 HOH A O     1 
HETATM 3980 O O     . HOH AB 6 .   ? 2.451   25.423 -37.454 1.00 33.97 ? 489 HOH A O     1 
HETATM 3981 O O     . HOH AB 6 .   ? 0.987   32.061 -23.587 1.00 17.01 ? 490 HOH A O     1 
HETATM 3982 O O     . HOH AB 6 .   ? 0.133   21.024 -5.626  1.00 28.11 ? 491 HOH A O     1 
HETATM 3983 O O     . HOH AB 6 .   ? 5.381   19.563 -21.044 1.00 21.39 ? 492 HOH A O     1 
HETATM 3984 O O     . HOH AB 6 .   ? 13.616  46.072 -33.063 1.00 27.67 ? 493 HOH A O     1 
HETATM 3985 O O     . HOH AB 6 .   ? 22.387  32.833 6.197   1.00 35.49 ? 494 HOH A O     1 
HETATM 3986 O O     . HOH AB 6 .   ? 33.425  34.073 -8.672  1.00 19.98 ? 495 HOH A O     1 
HETATM 3987 O O     . HOH AB 6 .   ? 15.393  42.063 -24.862 1.00 16.65 ? 496 HOH A O     1 
HETATM 3988 O O     . HOH AB 6 .   ? 32.905  19.166 -11.362 1.00 21.80 ? 497 HOH A O     1 
HETATM 3989 O O     . HOH AB 6 .   ? 13.309  39.536 -8.875  1.00 10.72 ? 498 HOH A O     1 
HETATM 3990 O O     . HOH AB 6 .   ? 31.775  17.349 1.265   1.00 20.01 ? 499 HOH A O     1 
HETATM 3991 O O     . HOH AB 6 .   ? 17.898  48.586 -19.372 1.00 21.53 ? 500 HOH A O     1 
HETATM 3992 O O     . HOH AB 6 .   ? 30.974  38.037 1.016   1.00 23.99 ? 501 HOH A O     1 
HETATM 3993 O O     . HOH AB 6 .   ? 8.850   38.861 -33.812 1.00 14.57 ? 502 HOH A O     1 
HETATM 3994 O O     . HOH AB 6 .   ? 40.114  37.643 -7.551  1.00 24.57 ? 503 HOH A O     1 
HETATM 3995 O O     . HOH AB 6 .   ? 27.198  33.270 -31.470 1.00 16.74 ? 504 HOH A O     1 
HETATM 3996 O O     . HOH AB 6 .   ? 5.079   23.717 -2.496  1.00 25.33 ? 505 HOH A O     1 
HETATM 3997 O O     . HOH AB 6 .   ? 33.122  17.732 -2.306  1.00 34.54 ? 506 HOH A O     1 
HETATM 3998 O O     . HOH AB 6 .   ? 2.830   48.101 -16.066 1.00 30.44 ? 507 HOH A O     1 
HETATM 3999 O O     . HOH AB 6 .   ? 0.758   23.734 -11.366 1.00 24.02 ? 508 HOH A O     1 
HETATM 4000 O O     . HOH AB 6 .   ? 7.244   40.918 -34.502 1.00 26.70 ? 509 HOH A O     1 
HETATM 4001 O O     . HOH AB 6 .   ? 13.239  44.224 -37.568 1.00 36.59 ? 510 HOH A O     1 
HETATM 4002 O O     . HOH AB 6 .   ? 33.798  42.366 -9.299  1.00 15.47 ? 511 HOH A O     1 
HETATM 4003 O O     . HOH AB 6 .   ? 36.383  35.223 -6.073  1.00 37.43 ? 512 HOH A O     1 
HETATM 4004 O O     . HOH AB 6 .   ? 21.258  37.005 3.458   1.00 21.35 ? 513 HOH A O     1 
HETATM 4005 O O     . HOH AB 6 .   ? 14.376  39.678 -23.785 1.00 8.82  ? 514 HOH A O     1 
HETATM 4006 O O     . HOH AB 6 .   ? 20.315  46.102 -21.187 1.00 23.62 ? 515 HOH A O     1 
HETATM 4007 O O     . HOH AB 6 .   ? 3.440   23.336 -11.653 1.00 16.17 ? 516 HOH A O     1 
HETATM 4008 O O     . HOH AB 6 .   ? 12.374  14.441 -23.587 1.00 30.97 ? 517 HOH A O     1 
HETATM 4009 O O     . HOH AB 6 .   ? -0.121  36.742 -27.571 1.00 28.59 ? 518 HOH A O     1 
HETATM 4010 O O     . HOH AB 6 .   ? 2.967   44.595 -23.690 1.00 27.52 ? 519 HOH A O     1 
HETATM 4011 O O     . HOH AB 6 .   ? 2.292   16.443 -13.213 1.00 35.32 ? 520 HOH A O     1 
HETATM 4012 O O     . HOH AB 6 .   ? 18.875  46.257 5.342   1.00 36.35 ? 521 HOH A O     1 
HETATM 4013 O O     . HOH AB 6 .   ? 26.858  12.334 -4.847  1.00 24.44 ? 522 HOH A O     1 
HETATM 4014 O O     . HOH AB 6 .   ? 34.834  17.337 -7.724  1.00 33.31 ? 523 HOH A O     1 
HETATM 4015 O O     . HOH AB 6 .   ? 23.139  33.480 -26.068 1.00 9.96  ? 524 HOH A O     1 
HETATM 4016 O O     . HOH AB 6 .   ? 3.640   31.789 -23.901 1.00 12.86 ? 525 HOH A O     1 
HETATM 4017 O O     . HOH AB 6 .   ? 26.398  42.932 4.250   1.00 28.78 ? 526 HOH A O     1 
HETATM 4018 O O     . HOH AB 6 .   ? 6.510   25.646 -1.012  1.00 20.07 ? 527 HOH A O     1 
HETATM 4019 O O     . HOH AB 6 .   ? 17.985  30.305 1.437   1.00 13.36 ? 528 HOH A O     1 
HETATM 4020 O O     . HOH AB 6 .   ? 10.814  38.493 -40.816 1.00 18.28 ? 529 HOH A O     1 
HETATM 4021 O O     . HOH AB 6 .   ? 15.495  50.325 -17.191 1.00 17.30 ? 530 HOH A O     1 
HETATM 4022 O O     . HOH AB 6 .   ? 32.372  21.984 -3.043  1.00 31.18 ? 531 HOH A O     1 
HETATM 4023 O O     . HOH AB 6 .   ? 11.643  18.586 -29.559 1.00 36.87 ? 532 HOH A O     1 
HETATM 4024 O O     . HOH AB 6 .   ? -1.961  38.329 -12.731 1.00 30.08 ? 533 HOH A O     1 
HETATM 4025 O O     . HOH AB 6 .   ? 28.638  45.793 -10.864 1.00 19.18 ? 534 HOH A O     1 
HETATM 4026 O O     . HOH AB 6 .   ? 26.453  20.298 3.905   1.00 33.90 ? 535 HOH A O     1 
HETATM 4027 O O     . HOH AB 6 .   ? 35.805  24.604 -13.141 1.00 40.93 ? 536 HOH A O     1 
HETATM 4028 O O     . HOH AB 6 .   ? 1.188   23.463 -8.737  1.00 21.26 ? 537 HOH A O     1 
HETATM 4029 O O     . HOH AB 6 .   ? 19.260  17.436 -28.081 1.00 21.06 ? 538 HOH A O     1 
HETATM 4030 O O     . HOH AB 6 .   ? 20.141  14.169 -19.011 1.00 16.04 ? 539 HOH A O     1 
HETATM 4031 O O     . HOH AB 6 .   ? 12.037  24.429 -6.949  1.00 13.10 ? 540 HOH A O     1 
HETATM 4032 O O     . HOH AB 6 .   ? 25.275  45.805 -21.806 1.00 32.04 ? 541 HOH A O     1 
HETATM 4033 O O     . HOH AB 6 .   ? 1.919   45.046 -9.917  1.00 29.48 ? 542 HOH A O     1 
HETATM 4034 O O     . HOH AB 6 .   ? 13.387  48.065 -26.842 1.00 19.91 ? 543 HOH A O     1 
HETATM 4035 O O     . HOH AB 6 .   ? 12.505  47.663 -3.269  1.00 26.32 ? 544 HOH A O     1 
HETATM 4036 O O     . HOH AB 6 .   ? 12.432  26.772 3.921   1.00 16.86 ? 545 HOH A O     1 
HETATM 4037 O O     . HOH AB 6 .   ? 27.290  13.440 3.955   1.00 21.41 ? 546 HOH A O     1 
HETATM 4038 O O     . HOH AB 6 .   ? -0.787  29.451 -4.787  1.00 31.82 ? 547 HOH A O     1 
HETATM 4039 O O     . HOH AB 6 .   ? 24.883  47.831 -13.426 1.00 33.46 ? 548 HOH A O     1 
HETATM 4040 O O     . HOH AB 6 .   ? 0.157   34.283 -22.355 1.00 24.45 ? 549 HOH A O     1 
HETATM 4041 O O     . HOH AB 6 .   ? 21.338  12.932 -9.740  1.00 26.73 ? 550 HOH A O     1 
HETATM 4042 O O     . HOH AB 6 .   ? 2.185   45.800 -18.724 1.00 30.87 ? 551 HOH A O     1 
HETATM 4043 O O     . HOH AB 6 .   ? 4.901   43.726 -4.864  1.00 18.66 ? 552 HOH A O     1 
HETATM 4044 O O     . HOH AB 6 .   ? 10.502  28.660 -22.605 1.00 13.44 ? 553 HOH A O     1 
HETATM 4045 O O     . HOH AB 6 .   ? 7.221   22.173 -5.270  1.00 16.76 ? 554 HOH A O     1 
HETATM 4046 O O     . HOH AB 6 .   ? 30.026  18.076 -12.732 1.00 15.52 ? 555 HOH A O     1 
HETATM 4047 O O     . HOH AB 6 .   ? 8.783   44.749 -4.042  1.00 25.90 ? 556 HOH A O     1 
HETATM 4048 O O     . HOH AB 6 .   ? 11.026  48.952 -15.363 1.00 29.66 ? 557 HOH A O     1 
HETATM 4049 O O     . HOH AB 6 .   ? 2.647   24.651 -30.407 1.00 28.40 ? 558 HOH A O     1 
HETATM 4050 O O     . HOH AB 6 .   ? 31.315  18.448 -15.857 1.00 13.83 ? 559 HOH A O     1 
HETATM 4051 O O     . HOH AB 6 .   ? 23.689  33.333 -31.373 1.00 23.10 ? 560 HOH A O     1 
HETATM 4052 O O     . HOH AB 6 .   ? 6.648   17.356 -23.288 1.00 35.05 ? 561 HOH A O     1 
HETATM 4053 O O     . HOH AB 6 .   ? 25.587  16.011 4.499   1.00 30.12 ? 562 HOH A O     1 
HETATM 4054 O O     . HOH AB 6 .   ? 0.517   20.652 -8.447  1.00 37.35 ? 563 HOH A O     1 
HETATM 4055 O O     . HOH AB 6 .   ? 27.940  27.074 3.400   1.00 34.97 ? 564 HOH A O     1 
HETATM 4056 O O     . HOH AB 6 .   ? 24.491  33.735 -28.297 1.00 19.84 ? 565 HOH A O     1 
HETATM 4057 O O     . HOH AB 6 .   ? 8.932   29.627 -20.245 1.00 23.37 ? 566 HOH A O     1 
HETATM 4058 O O     . HOH AB 6 .   ? 0.067   23.398 -24.889 1.00 23.98 ? 567 HOH A O     1 
HETATM 4059 O O     . HOH AB 6 .   ? 24.508  29.507 4.846   1.00 28.26 ? 568 HOH A O     1 
HETATM 4060 O O     . HOH AB 6 .   ? 27.473  19.109 -10.230 1.00 18.43 ? 569 HOH A O     1 
HETATM 4061 O O     . HOH AB 6 .   ? 30.569  43.146 1.334   1.00 35.36 ? 570 HOH A O     1 
HETATM 4062 O O     . HOH AB 6 .   ? 25.481  16.911 -4.198  1.00 24.80 ? 571 HOH A O     1 
HETATM 4063 O O     . HOH AB 6 .   ? 6.325   15.414 -15.941 1.00 36.68 ? 572 HOH A O     1 
HETATM 4064 O O     . HOH AB 6 .   ? 20.113  46.058 -23.707 1.00 35.16 ? 573 HOH A O     1 
HETATM 4065 O O     . HOH AB 6 .   ? -1.597  26.943 -2.417  1.00 38.01 ? 574 HOH A O     1 
HETATM 4066 O O     . HOH AB 6 .   ? -2.586  23.069 -12.422 1.00 36.46 ? 575 HOH A O     1 
HETATM 4067 O O     . HOH AB 6 .   ? 31.875  29.313 0.877   1.00 41.49 ? 576 HOH A O     1 
HETATM 4068 O O     . HOH AB 6 .   ? 17.518  43.007 -26.274 1.00 23.22 ? 577 HOH A O     1 
HETATM 4069 O O     . HOH AB 6 .   ? 16.435  44.703 -28.145 1.00 21.68 ? 578 HOH A O     1 
HETATM 4070 O O     . HOH AB 6 .   ? 34.210  15.491 0.413   1.00 27.60 ? 579 HOH A O     1 
HETATM 4071 O O     . HOH AB 6 .   ? 13.450  49.717 -24.637 1.00 32.18 ? 580 HOH A O     1 
HETATM 4072 O O     . HOH AB 6 .   ? 31.238  28.470 -24.267 1.00 33.17 ? 581 HOH A O     1 
HETATM 4073 O O     . HOH AB 6 .   ? 5.027   46.687 -23.577 1.00 28.00 ? 582 HOH A O     1 
HETATM 4074 O O     . HOH AB 6 .   ? 16.186  15.193 -25.267 1.00 28.83 ? 583 HOH A O     1 
HETATM 4075 O O     . HOH AB 6 .   ? 35.834  19.202 -5.913  1.00 39.85 ? 584 HOH A O     1 
HETATM 4076 O O     . HOH AB 6 .   ? 8.987   53.098 -20.182 1.00 39.01 ? 585 HOH A O     1 
HETATM 4077 O O     . HOH AB 6 .   ? 10.366  26.709 5.635   1.00 18.77 ? 586 HOH A O     1 
HETATM 4078 O O     . HOH AB 6 .   ? 33.255  19.481 -19.948 1.00 30.58 ? 587 HOH A O     1 
HETATM 4079 O O     . HOH AB 6 .   ? 18.928  29.872 3.881   1.00 29.26 ? 588 HOH A O     1 
HETATM 4080 O O     . HOH AB 6 .   ? 34.174  33.745 -5.848  1.00 28.65 ? 589 HOH A O     1 
HETATM 4081 O O     . HOH AB 6 .   ? 15.654  42.484 -38.317 1.00 34.52 ? 590 HOH A O     1 
HETATM 4082 O O     . HOH AB 6 .   ? 27.273  15.185 -9.620  1.00 22.45 ? 591 HOH A O     1 
HETATM 4083 O O     . HOH AB 6 .   ? 13.129  46.058 -35.580 1.00 34.44 ? 592 HOH A O     1 
HETATM 4084 O O     . HOH AB 6 .   ? 32.389  23.663 -21.062 1.00 28.66 ? 593 HOH A O     1 
HETATM 4085 O O     . HOH AB 6 .   ? 31.293  40.769 -0.150  1.00 29.54 ? 594 HOH A O     1 
HETATM 4086 O O     . HOH AB 6 .   ? 28.977  16.958 -10.510 1.00 24.09 ? 595 HOH A O     1 
HETATM 4087 O O     . HOH AB 6 .   ? 26.168  19.792 6.660   1.00 39.30 ? 596 HOH A O     1 
HETATM 4088 O O     . HOH AB 6 .   ? 18.148  39.437 -35.960 1.00 36.32 ? 597 HOH A O     1 
HETATM 4089 O O     . HOH AB 6 .   ? 7.905   37.288 -31.863 1.00 17.30 ? 598 HOH A O     1 
HETATM 4090 O O     . HOH AB 6 .   ? 8.852   40.231 -41.520 1.00 29.17 ? 599 HOH A O     1 
HETATM 4091 O O     . HOH AB 6 .   ? 28.142  39.400 6.390   1.00 38.36 ? 600 HOH A O     1 
HETATM 4092 O O     . HOH AB 6 .   ? 32.760  22.078 -18.995 1.00 32.41 ? 601 HOH A O     1 
HETATM 4093 O O     . HOH AB 6 .   ? 10.645  51.772 -23.596 1.00 31.79 ? 602 HOH A O     1 
HETATM 4094 O O     . HOH AB 6 .   ? 16.859  14.299 -22.857 1.00 41.92 ? 603 HOH A O     1 
HETATM 4095 O O     . HOH AB 6 .   ? 15.175  48.970 -19.724 1.00 24.06 ? 604 HOH A O     1 
HETATM 4096 O O     . HOH AB 6 .   ? 11.919  52.586 -11.321 1.00 37.11 ? 605 HOH A O     1 
HETATM 4097 O O     . HOH AB 6 .   ? 19.773  44.141 -25.418 1.00 29.34 ? 606 HOH A O     1 
HETATM 4098 O O     . HOH AB 6 .   ? 33.402  31.357 -21.715 1.00 23.69 ? 607 HOH A O     1 
HETATM 4099 O O     . HOH AB 6 .   ? 12.303  47.506 -0.523  1.00 34.40 ? 608 HOH A O     1 
HETATM 4100 O O     . HOH AB 6 .   ? -0.501  37.111 -19.126 1.00 37.89 ? 609 HOH A O     1 
HETATM 4101 O O     . HOH AB 6 .   ? -1.464  35.068 -25.705 1.00 31.99 ? 610 HOH A O     1 
HETATM 4102 O O     . HOH AB 6 .   ? 1.647   45.404 -25.986 1.00 37.51 ? 611 HOH A O     1 
HETATM 4103 O O     . HOH AB 6 .   ? 6.152   51.427 -23.158 1.00 27.81 ? 612 HOH A O     1 
HETATM 4104 O O     . HOH AB 6 .   ? 16.821  46.139 -31.952 1.00 33.46 ? 613 HOH A O     1 
HETATM 4105 O O     A HOH AB 6 .   ? -0.270  27.568 -30.000 0.60 32.16 ? 614 HOH A O     1 
HETATM 4106 O O     . HOH AB 6 .   ? 20.355  35.342 5.625   1.00 40.52 ? 615 HOH A O     1 
HETATM 4107 O O     . HOH AB 6 .   ? 8.791   43.427 -1.539  1.00 23.98 ? 616 HOH A O     1 
HETATM 4108 O O     . HOH AB 6 .   ? -1.789  31.120 -27.341 1.00 21.03 ? 617 HOH A O     1 
HETATM 4109 O O     . HOH AB 6 .   ? 17.648  15.448 -27.584 1.00 26.57 ? 618 HOH A O     1 
HETATM 4110 O O     . HOH AB 6 .   ? 6.345   47.412 -27.866 1.00 23.17 ? 619 HOH A O     1 
HETATM 4111 O O     . HOH AB 6 .   ? 8.650   49.006 -3.776  1.00 32.91 ? 620 HOH A O     1 
HETATM 4112 O O     . HOH AB 6 .   ? 14.529  50.442 -21.901 1.00 34.83 ? 621 HOH A O     1 
HETATM 4113 O O     . HOH AB 6 .   ? 1.242   44.907 -21.454 1.00 35.50 ? 622 HOH A O     1 
HETATM 4114 O O     . HOH AB 6 .   ? 18.465  41.727 -30.989 1.00 27.15 ? 623 HOH A O     1 
HETATM 4115 O O     . HOH AB 6 .   ? 22.489  28.026 6.139   1.00 39.75 ? 624 HOH A O     1 
HETATM 4116 O O     . HOH AB 6 .   ? 31.123  38.245 3.603   1.00 34.97 ? 625 HOH A O     1 
HETATM 4117 O O     . HOH AB 6 .   ? 15.849  47.280 -27.930 1.00 23.81 ? 626 HOH A O     1 
HETATM 4118 O O     . HOH AB 6 .   ? 3.314   49.239 -8.223  1.00 29.53 ? 627 HOH A O     1 
HETATM 4119 O O     . HOH AB 6 .   ? 4.670   49.517 -24.067 1.00 34.43 ? 628 HOH A O     1 
HETATM 4120 O O     . HOH AB 6 .   ? 9.778   24.116 5.071   1.00 36.82 ? 629 HOH A O     1 
HETATM 4121 O O     . HOH AB 6 .   ? 24.706  25.211 2.752   1.00 38.38 ? 630 HOH A O     1 
HETATM 4122 O O     . HOH AB 6 .   ? 32.163  31.093 -24.083 1.00 36.88 ? 631 HOH A O     1 
HETATM 4123 O O     . HOH AB 6 .   ? 5.532   48.442 -3.921  1.00 31.19 ? 632 HOH A O     1 
HETATM 4124 O O     . HOH AB 6 .   ? 4.830   49.512 -26.967 1.00 36.00 ? 633 HOH A O     1 
HETATM 4125 O O     . HOH AB 6 .   ? 5.207   46.480 -30.125 1.00 39.15 ? 634 HOH A O     1 
HETATM 4126 O O     . HOH BB 6 .   ? -11.733 53.261 27.503  1.00 30.06 ? 401 HOH B O     1 
HETATM 4127 O O     . HOH BB 6 .   ? 3.308   47.794 0.346   1.00 27.67 ? 402 HOH B O     1 
HETATM 4128 O O     . HOH BB 6 .   ? -5.550  56.544 23.663  1.00 24.67 ? 403 HOH B O     1 
HETATM 4129 O O     . HOH BB 6 .   ? 2.839   37.269 30.671  1.00 32.80 ? 404 HOH B O     1 
HETATM 4130 O O     . HOH BB 6 .   ? 8.500   52.037 5.834   1.00 26.62 ? 405 HOH B O     1 
HETATM 4131 O O     . HOH BB 6 .   ? 2.521   18.873 18.539  1.00 37.81 ? 406 HOH B O     1 
HETATM 4132 O O     . HOH BB 6 .   ? -4.302  52.571 26.545  1.00 31.44 ? 407 HOH B O     1 
HETATM 4133 O O     . HOH BB 6 .   ? 11.892  25.753 10.177  1.00 24.43 ? 408 HOH B O     1 
HETATM 4134 O O     . HOH BB 6 .   ? -1.323  31.184 3.108   1.00 24.36 ? 409 HOH B O     1 
HETATM 4135 O O     . HOH BB 6 .   ? -0.986  21.608 19.882  1.00 30.91 ? 410 HOH B O     1 
HETATM 4136 O O     . HOH BB 6 .   ? -6.264  23.768 4.400   1.00 25.20 ? 411 HOH B O     1 
HETATM 4137 O O     . HOH BB 6 .   ? -4.520  49.466 0.415   1.00 23.59 ? 412 HOH B O     1 
HETATM 4138 O O     . HOH BB 6 .   ? 5.038   37.897 27.288  1.00 31.31 ? 413 HOH B O     1 
HETATM 4139 O O     . HOH BB 6 .   ? -0.259  57.485 19.390  1.00 25.18 ? 414 HOH B O     1 
HETATM 4140 O O     . HOH BB 6 .   ? -5.217  41.580 12.467  1.00 13.70 ? 415 HOH B O     1 
HETATM 4141 O O     . HOH BB 6 .   ? 1.835   41.785 -3.873  1.00 21.43 ? 416 HOH B O     1 
HETATM 4142 O O     . HOH BB 6 .   ? -14.716 56.388 16.896  1.00 14.70 ? 417 HOH B O     1 
HETATM 4143 O O     . HOH BB 6 .   ? -19.183 39.874 8.964   1.00 18.84 ? 418 HOH B O     1 
HETATM 4144 O O     . HOH BB 6 .   ? -4.908  27.200 7.447   1.00 17.29 ? 419 HOH B O     1 
HETATM 4145 O O     . HOH BB 6 .   ? -13.757 43.847 -1.800  1.00 20.63 ? 420 HOH B O     1 
HETATM 4146 O O     . HOH BB 6 .   ? -7.932  61.425 11.937  1.00 34.46 ? 421 HOH B O     1 
HETATM 4147 O O     . HOH BB 6 .   ? -23.257 48.490 12.437  1.00 17.90 ? 422 HOH B O     1 
HETATM 4148 O O     . HOH BB 6 .   ? -1.868  31.695 7.470   1.00 18.43 ? 423 HOH B O     1 
HETATM 4149 O O     . HOH BB 6 .   ? -10.546 28.346 12.769  1.00 22.18 ? 424 HOH B O     1 
HETATM 4150 O O     . HOH BB 6 .   ? -0.919  53.404 1.634   1.00 37.59 ? 425 HOH B O     1 
HETATM 4151 O O     . HOH BB 6 .   ? -3.909  45.111 9.915   1.00 13.02 ? 426 HOH B O     1 
HETATM 4152 O O     . HOH BB 6 .   ? -19.884 46.998 24.322  1.00 21.96 ? 427 HOH B O     1 
HETATM 4153 O O     . HOH BB 6 .   ? -25.224 39.256 12.433  1.00 32.81 ? 428 HOH B O     1 
HETATM 4154 O O     . HOH BB 6 .   ? -1.763  56.160 25.396  1.00 25.72 ? 429 HOH B O     1 
HETATM 4155 O O     . HOH BB 6 .   ? 3.280   56.996 2.924   1.00 36.29 ? 430 HOH B O     1 
HETATM 4156 O O     . HOH BB 6 .   ? -1.589  61.856 12.161  1.00 25.30 ? 431 HOH B O     1 
HETATM 4157 O O     . HOH BB 6 .   ? -6.314  48.754 3.980   1.00 16.83 ? 432 HOH B O     1 
HETATM 4158 O O     . HOH BB 6 .   ? -15.668 45.317 -2.971  1.00 34.04 ? 433 HOH B O     1 
HETATM 4159 O O     . HOH BB 6 .   ? 8.425   36.451 9.728   1.00 14.62 ? 434 HOH B O     1 
HETATM 4160 O O     . HOH BB 6 .   ? -17.657 37.791 9.741   1.00 16.65 ? 435 HOH B O     1 
HETATM 4161 O O     . HOH BB 6 .   ? -23.906 36.939 8.023   1.00 30.66 ? 436 HOH B O     1 
HETATM 4162 O O     . HOH BB 6 .   ? 3.379   43.284 28.988  1.00 33.36 ? 437 HOH B O     1 
HETATM 4163 O O     . HOH BB 6 .   ? 13.406  33.251 4.606   1.00 20.72 ? 438 HOH B O     1 
HETATM 4164 O O     . HOH BB 6 .   ? -22.470 47.504 23.062  1.00 18.05 ? 439 HOH B O     1 
HETATM 4165 O O     . HOH BB 6 .   ? 7.954   35.714 19.477  1.00 23.03 ? 440 HOH B O     1 
HETATM 4166 O O     . HOH BB 6 .   ? -11.628 53.777 6.397   1.00 24.35 ? 441 HOH B O     1 
HETATM 4167 O O     . HOH BB 6 .   ? 6.202   31.643 14.335  1.00 20.45 ? 442 HOH B O     1 
HETATM 4168 O O     . HOH BB 6 .   ? 2.938   56.198 9.421   1.00 20.73 ? 443 HOH B O     1 
HETATM 4169 O O     . HOH BB 6 .   ? -15.226 26.577 5.592   1.00 22.68 ? 444 HOH B O     1 
HETATM 4170 O O     . HOH BB 6 .   ? 0.447   46.187 25.344  1.00 25.51 ? 445 HOH B O     1 
HETATM 4171 O O     . HOH BB 6 .   ? -11.334 43.341 8.767   1.00 12.58 ? 446 HOH B O     1 
HETATM 4172 O O     . HOH BB 6 .   ? -16.195 56.572 22.650  1.00 22.32 ? 447 HOH B O     1 
HETATM 4173 O O     . HOH BB 6 .   ? 0.517   39.653 -5.266  1.00 19.49 ? 448 HOH B O     1 
HETATM 4174 O O     . HOH BB 6 .   ? 2.698   18.602 11.702  1.00 35.10 ? 449 HOH B O     1 
HETATM 4175 O O     . HOH BB 6 .   ? 5.740   26.859 1.623   1.00 21.74 ? 450 HOH B O     1 
HETATM 4176 O O     . HOH BB 6 .   ? -17.422 24.966 11.500  1.00 30.66 ? 451 HOH B O     1 
HETATM 4177 O O     . HOH BB 6 .   ? -7.740  47.494 1.891   1.00 19.28 ? 452 HOH B O     1 
HETATM 4178 O O     . HOH BB 6 .   ? -4.810  32.276 -0.258  1.00 15.64 ? 453 HOH B O     1 
HETATM 4179 O O     . HOH BB 6 .   ? -13.957 51.038 3.751   1.00 25.92 ? 454 HOH B O     1 
HETATM 4180 O O     . HOH BB 6 .   ? 10.154  27.581 16.742  1.00 22.44 ? 455 HOH B O     1 
HETATM 4181 O O     . HOH BB 6 .   ? -10.995 31.703 3.630   1.00 16.94 ? 456 HOH B O     1 
HETATM 4182 O O     . HOH BB 6 .   ? 7.957   27.984 5.491   1.00 17.18 ? 457 HOH B O     1 
HETATM 4183 O O     . HOH BB 6 .   ? -13.765 52.006 29.350  1.00 32.63 ? 458 HOH B O     1 
HETATM 4184 O O     . HOH BB 6 .   ? -14.179 43.931 29.004  1.00 21.10 ? 459 HOH B O     1 
HETATM 4185 O O     . HOH BB 6 .   ? -11.948 59.198 11.629  1.00 36.09 ? 460 HOH B O     1 
HETATM 4186 O O     . HOH BB 6 .   ? -4.467  18.241 8.720   1.00 28.33 ? 461 HOH B O     1 
HETATM 4187 O O     . HOH BB 6 .   ? -21.148 43.165 9.440   1.00 17.04 ? 462 HOH B O     1 
HETATM 4188 O O     . HOH BB 6 .   ? -4.659  32.904 -4.273  1.00 31.62 ? 463 HOH B O     1 
HETATM 4189 O O     . HOH BB 6 .   ? -15.703 45.200 31.096  1.00 24.42 ? 464 HOH B O     1 
HETATM 4190 O O     . HOH BB 6 .   ? -16.622 30.689 0.813   1.00 21.27 ? 465 HOH B O     1 
HETATM 4191 O O     . HOH BB 6 .   ? -17.496 32.567 -5.930  1.00 42.36 ? 466 HOH B O     1 
HETATM 4192 O O     . HOH BB 6 .   ? 11.696  23.071 9.522   1.00 47.30 ? 467 HOH B O     1 
HETATM 4193 O O     . HOH BB 6 .   ? -6.182  55.597 8.350   1.00 18.38 ? 468 HOH B O     1 
HETATM 4194 O O     . HOH BB 6 .   ? -14.040 49.820 26.232  1.00 15.05 ? 469 HOH B O     1 
HETATM 4195 O O     . HOH BB 6 .   ? -19.967 56.806 20.243  1.00 16.19 ? 470 HOH B O     1 
HETATM 4196 O O     . HOH BB 6 .   ? 13.374  33.011 14.541  1.00 38.89 ? 471 HOH B O     1 
HETATM 4197 O O     . HOH BB 6 .   ? -23.989 34.966 10.579  1.00 31.84 ? 472 HOH B O     1 
HETATM 4198 O O     . HOH BB 6 .   ? 9.679   40.018 20.626  1.00 32.76 ? 473 HOH B O     1 
HETATM 4199 O O     . HOH BB 6 .   ? -3.074  30.724 31.276  1.00 36.03 ? 474 HOH B O     1 
HETATM 4200 O O     . HOH BB 6 .   ? 9.230   38.043 15.832  1.00 30.47 ? 475 HOH B O     1 
HETATM 4201 O O     . HOH BB 6 .   ? -25.329 47.159 5.876   1.00 29.31 ? 476 HOH B O     1 
HETATM 4202 O O     . HOH BB 6 .   ? -17.639 31.067 26.026  1.00 29.51 ? 477 HOH B O     1 
HETATM 4203 O O     . HOH BB 6 .   ? -18.865 25.813 1.275   1.00 41.42 ? 478 HOH B O     1 
HETATM 4204 O O     . HOH BB 6 .   ? -6.135  40.417 -5.572  1.00 27.60 ? 479 HOH B O     1 
HETATM 4205 O O     . HOH BB 6 .   ? 1.341   31.141 26.184  1.00 23.71 ? 480 HOH B O     1 
HETATM 4206 O O     . HOH BB 6 .   ? 3.830   55.937 14.852  1.00 31.92 ? 481 HOH B O     1 
HETATM 4207 O O     . HOH BB 6 .   ? 0.245   32.210 23.979  1.00 20.24 ? 482 HOH B O     1 
HETATM 4208 O O     . HOH BB 6 .   ? -4.474  20.724 21.010  1.00 32.30 ? 483 HOH B O     1 
HETATM 4209 O O     . HOH BB 6 .   ? -3.937  38.270 -6.780  1.00 27.63 ? 484 HOH B O     1 
HETATM 4210 O O     . HOH BB 6 .   ? -19.030 44.022 2.853   1.00 16.93 ? 485 HOH B O     1 
HETATM 4211 O O     . HOH BB 6 .   ? -2.293  43.790 7.072   1.00 10.07 ? 486 HOH B O     1 
HETATM 4212 O O     . HOH BB 6 .   ? 9.595   46.139 4.582   1.00 25.47 ? 487 HOH B O     1 
HETATM 4213 O O     . HOH BB 6 .   ? -29.157 48.322 24.162  1.00 24.90 ? 488 HOH B O     1 
HETATM 4214 O O     . HOH BB 6 .   ? -7.816  28.296 13.517  1.00 22.68 ? 489 HOH B O     1 
HETATM 4215 O O     . HOH BB 6 .   ? 5.914   26.196 5.190   1.00 26.99 ? 490 HOH B O     1 
HETATM 4216 O O     . HOH BB 6 .   ? -0.583  60.058 4.294   1.00 29.69 ? 491 HOH B O     1 
HETATM 4217 O O     . HOH BB 6 .   ? -13.380 52.448 10.245  1.00 14.93 ? 492 HOH B O     1 
HETATM 4218 O O     . HOH BB 6 .   ? 10.678  39.280 12.313  1.00 18.47 ? 493 HOH B O     1 
HETATM 4219 O O     . HOH BB 6 .   ? -17.400 30.056 23.412  1.00 37.49 ? 494 HOH B O     1 
HETATM 4220 O O     . HOH BB 6 .   ? 11.711  27.337 8.031   1.00 23.80 ? 495 HOH B O     1 
HETATM 4221 O O     . HOH BB 6 .   ? -18.888 49.640 6.910   1.00 16.20 ? 496 HOH B O     1 
HETATM 4222 O O     . HOH BB 6 .   ? -20.411 32.522 25.965  1.00 37.26 ? 497 HOH B O     1 
HETATM 4223 O O     . HOH BB 6 .   ? -23.031 35.778 0.702   1.00 31.41 ? 498 HOH B O     1 
HETATM 4224 O O     . HOH BB 6 .   ? -2.775  32.924 29.924  1.00 32.34 ? 499 HOH B O     1 
HETATM 4225 O O     . HOH BB 6 .   ? -9.829  47.113 33.023  1.00 43.65 ? 500 HOH B O     1 
HETATM 4226 O O     . HOH BB 6 .   ? -18.070 32.936 5.132   1.00 19.84 ? 501 HOH B O     1 
HETATM 4227 O O     . HOH BB 6 .   ? -23.312 49.463 3.090   1.00 26.93 ? 502 HOH B O     1 
HETATM 4228 O O     . HOH BB 6 .   ? 1.734   21.538 19.239  1.00 32.68 ? 503 HOH B O     1 
HETATM 4229 O O     . HOH BB 6 .   ? -2.236  22.843 22.291  1.00 29.75 ? 504 HOH B O     1 
HETATM 4230 O O     . HOH BB 6 .   ? -18.256 48.656 32.977  1.00 39.65 ? 505 HOH B O     1 
HETATM 4231 O O     . HOH BB 6 .   ? -4.318  61.696 12.629  1.00 23.97 ? 506 HOH B O     1 
HETATM 4232 O O     . HOH BB 6 .   ? 11.944  30.693 11.273  1.00 22.41 ? 507 HOH B O     1 
HETATM 4233 O O     . HOH BB 6 .   ? -24.352 40.183 23.405  1.00 39.77 ? 508 HOH B O     1 
HETATM 4234 O O     . HOH BB 6 .   ? -1.144  21.077 3.430   1.00 28.73 ? 509 HOH B O     1 
HETATM 4235 O O     . HOH BB 6 .   ? 4.207   58.790 15.711  1.00 35.82 ? 510 HOH B O     1 
HETATM 4236 O O     . HOH BB 6 .   ? 5.697   19.086 19.339  1.00 32.94 ? 511 HOH B O     1 
HETATM 4237 O O     . HOH BB 6 .   ? -22.355 43.489 15.745  1.00 21.20 ? 512 HOH B O     1 
HETATM 4238 O O     . HOH BB 6 .   ? -0.816  16.174 10.235  1.00 39.77 ? 513 HOH B O     1 
HETATM 4239 O O     . HOH BB 6 .   ? -2.738  58.451 6.294   1.00 25.22 ? 514 HOH B O     1 
HETATM 4240 O O     . HOH BB 6 .   ? -18.532 46.307 1.000   1.00 27.74 ? 515 HOH B O     1 
HETATM 4241 O O     . HOH BB 6 .   ? -7.680  57.276 10.155  1.00 17.62 ? 516 HOH B O     1 
HETATM 4242 O O     . HOH BB 6 .   ? -22.973 43.402 11.644  1.00 29.52 ? 517 HOH B O     1 
HETATM 4243 O O     . HOH BB 6 .   ? -16.926 41.198 10.332  1.00 13.25 ? 518 HOH B O     1 
HETATM 4244 O O     . HOH BB 6 .   ? -0.205  33.190 29.687  1.00 25.52 ? 519 HOH B O     1 
HETATM 4245 O O     . HOH BB 6 .   ? 2.177   58.168 18.450  1.00 31.18 ? 520 HOH B O     1 
HETATM 4246 O O     . HOH BB 6 .   ? 8.684   20.940 19.221  1.00 36.37 ? 521 HOH B O     1 
HETATM 4247 O O     . HOH BB 6 .   ? -20.493 41.085 28.736  1.00 29.36 ? 522 HOH B O     1 
HETATM 4248 O O     . HOH BB 6 .   ? -19.523 53.339 10.180  1.00 14.27 ? 523 HOH B O     1 
HETATM 4249 O O     . HOH BB 6 .   ? 3.544   22.757 9.748   1.00 32.96 ? 524 HOH B O     1 
HETATM 4250 O O     . HOH BB 6 .   ? -19.090 45.325 29.904  1.00 33.71 ? 525 HOH B O     1 
HETATM 4251 O O     . HOH BB 6 .   ? -0.883  46.806 -1.213  1.00 20.60 ? 526 HOH B O     1 
HETATM 4252 O O     . HOH BB 6 .   ? -20.743 39.803 6.414   1.00 22.25 ? 527 HOH B O     1 
HETATM 4253 O O     . HOH BB 6 .   ? 2.351   52.508 25.554  1.00 29.97 ? 528 HOH B O     1 
HETATM 4254 O O     . HOH BB 6 .   ? -21.583 28.381 1.578   1.00 33.12 ? 529 HOH B O     1 
HETATM 4255 O O     . HOH BB 6 .   ? -5.852  24.737 7.018   1.00 20.60 ? 530 HOH B O     1 
HETATM 4256 O O     . HOH BB 6 .   ? -19.599 34.386 1.929   1.00 28.25 ? 531 HOH B O     1 
HETATM 4257 O O     . HOH BB 6 .   ? -8.055  29.835 11.090  1.00 23.73 ? 532 HOH B O     1 
HETATM 4258 O O     . HOH BB 6 .   ? -15.406 50.277 0.298   1.00 33.28 ? 533 HOH B O     1 
HETATM 4259 O O     . HOH BB 6 .   ? -1.674  44.614 -2.972  1.00 14.55 ? 534 HOH B O     1 
HETATM 4260 O O     . HOH BB 6 .   ? -10.723 45.561 -1.980  1.00 23.91 ? 535 HOH B O     1 
HETATM 4261 O O     . HOH BB 6 .   ? 6.999   51.156 18.708  1.00 28.91 ? 536 HOH B O     1 
HETATM 4262 O O     . HOH BB 6 .   ? -15.914 57.868 19.077  1.00 21.51 ? 537 HOH B O     1 
HETATM 4263 O O     . HOH BB 6 .   ? 7.590   30.244 19.305  1.00 36.30 ? 538 HOH B O     1 
HETATM 4264 O O     . HOH BB 6 .   ? -13.516 20.020 7.253   1.00 37.34 ? 539 HOH B O     1 
HETATM 4265 O O     . HOH BB 6 .   ? -18.152 31.963 2.575   1.00 26.03 ? 540 HOH B O     1 
HETATM 4266 O O     . HOH BB 6 .   ? 10.894  40.431 8.550   1.00 19.17 ? 541 HOH B O     1 
HETATM 4267 O O     . HOH BB 6 .   ? -17.540 53.893 26.438  1.00 37.96 ? 542 HOH B O     1 
HETATM 4268 O O     . HOH BB 6 .   ? -4.933  21.566 4.066   1.00 28.91 ? 543 HOH B O     1 
HETATM 4269 O O     . HOH BB 6 .   ? -24.660 36.546 17.358  1.00 35.72 ? 544 HOH B O     1 
HETATM 4270 O O     . HOH BB 6 .   ? 13.713  32.257 7.247   1.00 29.04 ? 545 HOH B O     1 
HETATM 4271 O O     . HOH BB 6 .   ? -12.184 44.655 31.114  1.00 28.99 ? 546 HOH B O     1 
HETATM 4272 O O     . HOH BB 6 .   ? -18.892 58.740 24.371  1.00 28.85 ? 547 HOH B O     1 
HETATM 4273 O O     . HOH BB 6 .   ? -11.580 52.866 3.827   1.00 33.73 ? 548 HOH B O     1 
HETATM 4274 O O     . HOH BB 6 .   ? 8.036   31.688 16.303  1.00 23.09 ? 549 HOH B O     1 
HETATM 4275 O O     . HOH BB 6 .   ? 12.423  33.040 9.741   1.00 33.26 ? 550 HOH B O     1 
HETATM 4276 O O     B HOH BB 6 .   ? -23.924 44.643 14.033  0.50 20.42 ? 551 HOH B O     1 
HETATM 4277 O O     . HOH BB 6 .   ? 9.977   30.061 15.631  1.00 25.69 ? 552 HOH B O     1 
HETATM 4278 O O     . HOH BB 6 .   ? -4.567  43.973 -3.315  1.00 29.03 ? 553 HOH B O     1 
HETATM 4279 O O     . HOH BB 6 .   ? -14.763 54.858 10.040  1.00 15.71 ? 554 HOH B O     1 
HETATM 4280 O O     . HOH BB 6 .   ? 14.289  29.273 10.712  1.00 34.02 ? 555 HOH B O     1 
HETATM 4281 O O     . HOH BB 6 .   ? -22.304 33.351 1.869   1.00 44.10 ? 556 HOH B O     1 
HETATM 4282 O O     . HOH BB 6 .   ? 1.438   48.839 26.039  1.00 32.96 ? 557 HOH B O     1 
HETATM 4283 O O     . HOH BB 6 .   ? -5.318  43.064 -5.604  1.00 33.05 ? 558 HOH B O     1 
HETATM 4284 O O     . HOH BB 6 .   ? -3.678  34.688 31.910  1.00 36.58 ? 559 HOH B O     1 
HETATM 4285 O O     . HOH BB 6 .   ? 0.223   44.017 -4.966  1.00 18.66 ? 560 HOH B O     1 
HETATM 4286 O O     . HOH BB 6 .   ? 10.715  37.889 9.891   1.00 20.70 ? 561 HOH B O     1 
HETATM 4287 O O     . HOH BB 6 .   ? -3.460  21.748 1.741   1.00 36.81 ? 562 HOH B O     1 
HETATM 4288 O O     . HOH BB 6 .   ? -6.697  47.653 -0.592  1.00 27.72 ? 563 HOH B O     1 
HETATM 4289 O O     . HOH BB 6 .   ? 6.081   44.412 -2.547  1.00 27.15 ? 564 HOH B O     1 
HETATM 4290 O O     . HOH BB 6 .   ? -18.777 59.060 21.486  1.00 21.30 ? 565 HOH B O     1 
HETATM 4291 O O     . HOH BB 6 .   ? 12.069  30.598 13.905  1.00 27.87 ? 566 HOH B O     1 
HETATM 4292 O O     . HOH BB 6 .   ? 2.002   52.367 0.344   1.00 32.02 ? 567 HOH B O     1 
HETATM 4293 O O     . HOH BB 6 .   ? 8.544   27.551 19.190  1.00 31.79 ? 568 HOH B O     1 
HETATM 4294 O O     . HOH BB 6 .   ? 10.013  37.362 20.438  1.00 36.49 ? 569 HOH B O     1 
HETATM 4295 O O     . HOH BB 6 .   ? 12.829  39.870 13.729  1.00 34.39 ? 570 HOH B O     1 
HETATM 4296 O O     . HOH BB 6 .   ? -29.982 46.559 26.076  1.00 38.06 ? 571 HOH B O     1 
HETATM 4297 O O     . HOH BB 6 .   ? 1.492   48.067 -1.731  1.00 23.54 ? 572 HOH B O     1 
HETATM 4298 O O     . HOH BB 6 .   ? 8.555   41.060 23.044  1.00 36.35 ? 573 HOH B O     1 
HETATM 4299 O O     . HOH BB 6 .   ? -2.989  48.460 -1.577  1.00 26.35 ? 574 HOH B O     1 
HETATM 4300 O O     . HOH BB 6 .   ? 13.986  28.604 14.734  1.00 37.95 ? 575 HOH B O     1 
HETATM 4301 O O     . HOH BB 6 .   ? 13.374  37.199 10.209  1.00 39.72 ? 576 HOH B O     1 
HETATM 4302 O O     . HOH CB 6 .   ? -3.310  36.668 -14.351 1.00 30.30 ? 201 HOH D O     1 
HETATM 4303 O O     . HOH CB 6 .   ? -1.288  34.527 -20.206 1.00 30.46 ? 202 HOH D O     1 
HETATM 4304 O O     . HOH CB 6 .   ? 1.161   36.809 -15.137 1.00 14.63 ? 203 HOH D O     1 
HETATM 4305 O O     . HOH CB 6 .   ? -1.289  35.989 -16.241 1.00 15.20 ? 204 HOH D O     1 
HETATM 4306 O O     . HOH CB 6 .   ? -2.110  28.274 -26.501 1.00 27.90 ? 205 HOH D O     1 
HETATM 4307 O O     . HOH CB 6 .   ? 1.802   37.679 -17.601 1.00 24.06 ? 206 HOH D O     1 
HETATM 4308 O O     . HOH DB 6 .   ? -5.698  29.971 -1.553  1.00 23.35 ? 201 HOH E O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 15  ? 0.4894 0.6526 0.4953 -0.1142 -0.0995 -0.0713 -3  VAL A N   
2    C CA  . VAL A 15  ? 0.4699 0.5993 0.4605 -0.1076 -0.0901 -0.0723 -3  VAL A CA  
3    C C   . VAL A 15  ? 0.4331 0.5651 0.4310 -0.0933 -0.0807 -0.0625 -3  VAL A C   
4    O O   . VAL A 15  ? 0.4393 0.5859 0.4381 -0.0816 -0.0819 -0.0576 -3  VAL A O   
5    C CB  . VAL A 15  ? 0.4858 0.5973 0.4521 -0.1029 -0.0933 -0.0795 -3  VAL A CB  
6    N N   . PRO A 16  ? 0.3873 0.5049 0.3898 -0.0944 -0.0718 -0.0596 -2  PRO A N   
7    C CA  . PRO A 16  ? 0.3492 0.4647 0.3551 -0.0816 -0.0633 -0.0519 -2  PRO A CA  
8    C C   . PRO A 16  ? 0.3148 0.4129 0.3035 -0.0702 -0.0605 -0.0526 -2  PRO A C   
9    O O   . PRO A 16  ? 0.3254 0.4042 0.2989 -0.0726 -0.0613 -0.0592 -2  PRO A O   
10   C CB  . PRO A 16  ? 0.3527 0.4510 0.3622 -0.0872 -0.0555 -0.0507 -2  PRO A CB  
11   C CG  . PRO A 16  ? 0.3837 0.4825 0.3975 -0.1039 -0.0601 -0.0555 -2  PRO A CG  
12   C CD  . PRO A 16  ? 0.4036 0.5081 0.4093 -0.1084 -0.0701 -0.0627 -2  PRO A CD  
13   N N   . ARG A 17  ? 0.2708 0.3746 0.2620 -0.0580 -0.0567 -0.0458 -1  ARG A N   
14   C CA  . ARG A 17  ? 0.2565 0.3447 0.2334 -0.0479 -0.0528 -0.0449 -1  ARG A CA  
15   C C   . ARG A 17  ? 0.2481 0.3143 0.2218 -0.0479 -0.0447 -0.0452 -1  ARG A C   
16   O O   . ARG A 17  ? 0.2368 0.3033 0.2214 -0.0506 -0.0406 -0.0421 -1  ARG A O   
17   C CB  . ARG A 17  ? 0.2454 0.3453 0.2257 -0.0363 -0.0520 -0.0374 -1  ARG A CB  
18   C CG  . ARG A 17  ? 0.2543 0.3719 0.2323 -0.0328 -0.0601 -0.0367 -1  ARG A CG  
19   C CD  . ARG A 17  ? 0.2602 0.4031 0.2535 -0.0377 -0.0663 -0.0361 -1  ARG A CD  
20   N NE  . ARG A 17  ? 0.2625 0.4233 0.2534 -0.0329 -0.0746 -0.0348 -1  ARG A NE  
21   C CZ  . ARG A 17  ? 0.2494 0.4252 0.2466 -0.0223 -0.0758 -0.0278 -1  ARG A CZ  
22   N NH1 . ARG A 17  ? 0.2287 0.4049 0.2356 -0.0158 -0.0691 -0.0221 -1  ARG A NH1 
23   N NH2 . ARG A 17  ? 0.2554 0.4459 0.2486 -0.0180 -0.0839 -0.0267 -1  ARG A NH2 
24   N N   . GLY A 18  ? 0.2393 0.2874 0.1984 -0.0443 -0.0421 -0.0484 0   GLY A N   
25   C CA  . GLY A 18  ? 0.2376 0.2662 0.1939 -0.0427 -0.0346 -0.0483 0   GLY A CA  
26   C C   . GLY A 18  ? 0.2258 0.2489 0.1775 -0.0324 -0.0293 -0.0439 0   GLY A C   
27   O O   . GLY A 18  ? 0.2396 0.2499 0.1904 -0.0300 -0.0235 -0.0429 0   GLY A O   
28   N N   . SER A 19  ? 0.2113 0.2444 0.1602 -0.0262 -0.0311 -0.0405 1   SER A N   
29   C CA  . SER A 19  ? 0.2093 0.2377 0.1549 -0.0180 -0.0262 -0.0356 1   SER A CA  
30   C C   . SER A 19  ? 0.1852 0.2257 0.1336 -0.0120 -0.0281 -0.0291 1   SER A C   
31   O O   . SER A 19  ? 0.1774 0.2305 0.1268 -0.0125 -0.0339 -0.0291 1   SER A O   
32   C CB  . SER A 19  ? 0.2371 0.2552 0.1685 -0.0154 -0.0242 -0.0391 1   SER A CB  
33   O OG  . SER A 19  ? 0.2661 0.2906 0.1883 -0.0145 -0.0287 -0.0407 1   SER A OG  
34   N N   . THR A 20  ? 0.1680 0.2034 0.1171 -0.0064 -0.0234 -0.0239 2   THR A N   
35   C CA  . THR A 20  ? 0.1555 0.1976 0.1052 -0.0002 -0.0248 -0.0176 2   THR A CA  
36   C C   . THR A 20  ? 0.1663 0.2117 0.1046 0.0022  -0.0285 -0.0169 2   THR A C   
37   O O   . THR A 20  ? 0.1590 0.2127 0.0977 0.0065  -0.0323 -0.0127 2   THR A O   
38   C CB  . THR A 20  ? 0.1458 0.1790 0.0963 0.0040  -0.0195 -0.0127 2   THR A CB  
39   O OG1 . THR A 20  ? 0.1438 0.1670 0.0865 0.0037  -0.0154 -0.0139 2   THR A OG1 
40   C CG2 . THR A 20  ? 0.1394 0.1725 0.1006 0.0031  -0.0172 -0.0121 2   THR A CG2 
41   N N   . SER A 21  ? 0.1765 0.2155 0.1037 0.0005  -0.0274 -0.0210 3   SER A N   
42   C CA  . SER A 21  ? 0.1952 0.2379 0.1098 0.0027  -0.0308 -0.0204 3   SER A CA  
43   C C   . SER A 21  ? 0.1973 0.2531 0.1121 0.0008  -0.0391 -0.0229 3   SER A C   
44   O O   . SER A 21  ? 0.2176 0.2783 0.1219 0.0034  -0.0430 -0.0216 3   SER A O   
45   C CB  . SER A 21  ? 0.2116 0.2457 0.1134 0.0017  -0.0272 -0.0252 3   SER A CB  
46   O OG  . SER A 21  ? 0.2263 0.2560 0.1282 -0.0036 -0.0280 -0.0338 3   SER A OG  
47   N N   . GLU A 22  ? 0.1878 0.2498 0.1135 -0.0046 -0.0420 -0.0269 4   GLU A N   
48   C CA  . GLU A 22  ? 0.1920 0.2703 0.1216 -0.0072 -0.0503 -0.0286 4   GLU A CA  
49   C C   . GLU A 22  ? 0.1812 0.2734 0.1223 -0.0016 -0.0527 -0.0217 4   GLU A C   
50   O O   . GLU A 22  ? 0.1845 0.2937 0.1288 -0.0012 -0.0601 -0.0214 4   GLU A O   
51   C CB  . GLU A 22  ? 0.1988 0.2783 0.1358 -0.0170 -0.0522 -0.0357 4   GLU A CB  
52   C CG  . GLU A 22  ? 0.2162 0.2810 0.1407 -0.0221 -0.0511 -0.0438 4   GLU A CG  
53   C CD  . GLU A 22  ? 0.2283 0.2900 0.1592 -0.0326 -0.0528 -0.0504 4   GLU A CD  
54   O OE1 . GLU A 22  ? 0.2430 0.2910 0.1764 -0.0338 -0.0466 -0.0510 4   GLU A OE1 
55   O OE2 . GLU A 22  ? 0.2452 0.3189 0.1793 -0.0389 -0.0602 -0.0537 4   GLU A OE2 
56   N N   . VAL A 23  ? 0.1671 0.2533 0.1142 0.0029  -0.0470 -0.0166 5   VAL A N   
57   C CA  . VAL A 23  ? 0.1623 0.2605 0.1205 0.0088  -0.0486 -0.0112 5   VAL A CA  
58   C C   . VAL A 23  ? 0.1602 0.2508 0.1123 0.0186  -0.0464 -0.0038 5   VAL A C   
59   O O   . VAL A 23  ? 0.1577 0.2576 0.1154 0.0257  -0.0490 0.0007  5   VAL A O   
60   C CB  . VAL A 23  ? 0.1576 0.2606 0.1315 0.0059  -0.0452 -0.0117 5   VAL A CB  
61   C CG1 . VAL A 23  ? 0.1666 0.2775 0.1468 -0.0049 -0.0481 -0.0182 5   VAL A CG1 
62   C CG2 . VAL A 23  ? 0.1509 0.2375 0.1242 0.0069  -0.0376 -0.0104 5   VAL A CG2 
63   N N   . ILE A 24  ? 0.1577 0.2318 0.0988 0.0191  -0.0418 -0.0024 6   ILE A N   
64   C CA  . ILE A 24  ? 0.1608 0.2252 0.0956 0.0265  -0.0398 0.0047  6   ILE A CA  
65   C C   . ILE A 24  ? 0.1762 0.2402 0.0968 0.0299  -0.0434 0.0083  6   ILE A C   
66   O O   . ILE A 24  ? 0.1774 0.2364 0.0875 0.0261  -0.0419 0.0062  6   ILE A O   
67   C CB  . ILE A 24  ? 0.1538 0.2017 0.0867 0.0242  -0.0324 0.0051  6   ILE A CB  
68   C CG1 . ILE A 24  ? 0.1416 0.1893 0.0873 0.0221  -0.0290 0.0027  6   ILE A CG1 
69   C CG2 . ILE A 24  ? 0.1609 0.1972 0.0860 0.0298  -0.0307 0.0125  6   ILE A CG2 
70   C CD1 . ILE A 24  ? 0.1357 0.1696 0.0806 0.0201  -0.0229 0.0029  6   ILE A CD1 
71   N N   . GLU A 25  ? 0.1863 0.2555 0.1053 0.0378  -0.0479 0.0140  7   GLU A N   
72   C CA  . GLU A 25  ? 0.2097 0.2791 0.1142 0.0415  -0.0520 0.0183  7   GLU A CA  
73   C C   . GLU A 25  ? 0.2134 0.2643 0.1047 0.0419  -0.0467 0.0238  7   GLU A C   
74   O O   . GLU A 25  ? 0.2160 0.2649 0.0935 0.0413  -0.0473 0.0256  7   GLU A O   
75   C CB  . GLU A 25  ? 0.2321 0.3105 0.1389 0.0516  -0.0581 0.0240  7   GLU A CB  
76   C CG  . GLU A 25  ? 0.2712 0.3502 0.1627 0.0569  -0.0633 0.0296  7   GLU A CG  
77   C CD  . GLU A 25  ? 0.3034 0.3962 0.1994 0.0673  -0.0706 0.0340  7   GLU A CD  
78   O OE1 . GLU A 25  ? 0.3625 0.4569 0.2466 0.0728  -0.0757 0.0390  7   GLU A OE1 
79   O OE2 . GLU A 25  ? 0.3103 0.4144 0.2222 0.0700  -0.0715 0.0321  7   GLU A OE2 
80   N N   . ASP A 26  ? 0.2108 0.2490 0.1061 0.0435  -0.0419 0.0270  8   ASP A N   
81   C CA  . ASP A 26  ? 0.2285 0.2496 0.1126 0.0437  -0.0377 0.0336  8   ASP A CA  
82   C C   . ASP A 26  ? 0.2231 0.2337 0.1151 0.0402  -0.0319 0.0322  8   ASP A C   
83   O O   . ASP A 26  ? 0.2211 0.2283 0.1207 0.0443  -0.0321 0.0328  8   ASP A O   
84   C CB  . ASP A 26  ? 0.2509 0.2665 0.1271 0.0529  -0.0420 0.0420  8   ASP A CB  
85   C CG  . ASP A 26  ? 0.2680 0.2636 0.1324 0.0528  -0.0383 0.0499  8   ASP A CG  
86   O OD1 . ASP A 26  ? 0.2701 0.2550 0.1376 0.0475  -0.0328 0.0494  8   ASP A OD1 
87   O OD2 . ASP A 26  ? 0.3006 0.2915 0.1533 0.0590  -0.0419 0.0572  8   ASP A OD2 
88   N N   . GLU A 27  ? 0.2225 0.2292 0.1131 0.0334  -0.0267 0.0301  9   GLU A N   
89   C CA  . GLU A 27  ? 0.2278 0.2275 0.1270 0.0296  -0.0218 0.0278  9   GLU A CA  
90   C C   . GLU A 27  ? 0.2270 0.2113 0.1237 0.0319  -0.0207 0.0339  9   GLU A C   
91   O O   . GLU A 27  ? 0.2160 0.1959 0.1205 0.0325  -0.0196 0.0320  9   GLU A O   
92   C CB  . GLU A 27  ? 0.2439 0.2432 0.1412 0.0232  -0.0167 0.0256  9   GLU A CB  
93   C CG  . GLU A 27  ? 0.2615 0.2558 0.1681 0.0197  -0.0126 0.0232  9   GLU A CG  
94   C CD  . GLU A 27  ? 0.2810 0.2770 0.1872 0.0148  -0.0076 0.0209  9   GLU A CD  
95   O OE1 . GLU A 27  ? 0.3119 0.3153 0.2167 0.0138  -0.0072 0.0159  9   GLU A OE1 
96   O OE2 . GLU A 27  ? 0.3132 0.3025 0.2202 0.0120  -0.0043 0.0245  9   GLU A OE2 
97   N N   . LYS A 28  ? 0.2484 0.2236 0.1330 0.0328  -0.0209 0.0412  10  LYS A N   
98   C CA  . LYS A 28  ? 0.2618 0.2187 0.1424 0.0340  -0.0202 0.0469  10  LYS A CA  
99   C C   . LYS A 28  ? 0.2642 0.2181 0.1482 0.0428  -0.0241 0.0466  10  LYS A C   
100  O O   . LYS A 28  ? 0.2682 0.2113 0.1556 0.0434  -0.0229 0.0457  10  LYS A O   
101  C CB  . LYS A 28  ? 0.2924 0.2381 0.1579 0.0337  -0.0203 0.0559  10  LYS A CB  
102  C CG  . LYS A 28  ? 0.3070 0.2556 0.1704 0.0247  -0.0149 0.0565  10  LYS A CG  
103  N N   . GLN A 29  ? 0.2638 0.2291 0.1478 0.0495  -0.0287 0.0465  11  GLN A N   
104  C CA  . GLN A 29  ? 0.2721 0.2391 0.1610 0.0594  -0.0322 0.0462  11  GLN A CA  
105  C C   . GLN A 29  ? 0.2442 0.2216 0.1482 0.0585  -0.0305 0.0388  11  GLN A C   
106  O O   . GLN A 29  ? 0.2351 0.2076 0.1426 0.0646  -0.0304 0.0383  11  GLN A O   
107  C CB  . GLN A 29  ? 0.3043 0.2837 0.1901 0.0672  -0.0381 0.0488  11  GLN A CB  
108  C CG  . GLN A 29  ? 0.3592 0.3241 0.2286 0.0724  -0.0406 0.0580  11  GLN A CG  
109  C CD  . GLN A 29  ? 0.4113 0.3903 0.2773 0.0806  -0.0471 0.0607  11  GLN A CD  
110  O OE1 . GLN A 29  ? 0.4772 0.4773 0.3545 0.0829  -0.0504 0.0557  11  GLN A OE1 
111  N NE2 . GLN A 29  ? 0.4592 0.4270 0.3093 0.0848  -0.0496 0.0692  11  GLN A NE2 
112  N N   . PHE A 30  ? 0.2186 0.2085 0.1298 0.0510  -0.0288 0.0333  12  PHE A N   
113  C CA  . PHE A 30  ? 0.2008 0.1988 0.1251 0.0485  -0.0265 0.0270  12  PHE A CA  
114  C C   . PHE A 30  ? 0.2001 0.1827 0.1246 0.0473  -0.0226 0.0269  12  PHE A C   
115  O O   . PHE A 30  ? 0.2011 0.1846 0.1318 0.0517  -0.0219 0.0248  12  PHE A O   
116  C CB  . PHE A 30  ? 0.1858 0.1941 0.1145 0.0402  -0.0251 0.0218  12  PHE A CB  
117  C CG  . PHE A 30  ? 0.1686 0.1819 0.1087 0.0363  -0.0222 0.0163  12  PHE A CG  
118  C CD1 . PHE A 30  ? 0.1629 0.1902 0.1132 0.0380  -0.0238 0.0135  12  PHE A CD1 
119  C CD2 . PHE A 30  ? 0.1647 0.1699 0.1055 0.0306  -0.0178 0.0144  12  PHE A CD2 
120  C CE1 . PHE A 30  ? 0.1529 0.1839 0.1124 0.0336  -0.0208 0.0092  12  PHE A CE1 
121  C CE2 . PHE A 30  ? 0.1541 0.1628 0.1037 0.0272  -0.0153 0.0100  12  PHE A CE2 
122  C CZ  . PHE A 30  ? 0.1463 0.1669 0.1048 0.0286  -0.0165 0.0076  12  PHE A CZ  
123  N N   . TYR A 31  ? 0.1997 0.1691 0.1169 0.0417  -0.0202 0.0293  13  TYR A N   
124  C CA  . TYR A 31  ? 0.2031 0.1580 0.1196 0.0397  -0.0176 0.0293  13  TYR A CA  
125  C C   . TYR A 31  ? 0.2177 0.1562 0.1263 0.0470  -0.0197 0.0332  13  TYR A C   
126  O O   . TYR A 31  ? 0.2217 0.1526 0.1319 0.0500  -0.0189 0.0307  13  TYR A O   
127  C CB  . TYR A 31  ? 0.2033 0.1521 0.1165 0.0308  -0.0147 0.0307  13  TYR A CB  
128  C CG  . TYR A 31  ? 0.1871 0.1485 0.1089 0.0250  -0.0119 0.0255  13  TYR A CG  
129  C CD1 . TYR A 31  ? 0.1765 0.1403 0.1066 0.0241  -0.0104 0.0209  13  TYR A CD1 
130  C CD2 . TYR A 31  ? 0.1847 0.1545 0.1047 0.0213  -0.0108 0.0254  13  TYR A CD2 
131  C CE1 . TYR A 31  ? 0.1665 0.1393 0.1031 0.0196  -0.0080 0.0168  13  TYR A CE1 
132  C CE2 . TYR A 31  ? 0.1750 0.1534 0.1014 0.0172  -0.0082 0.0204  13  TYR A CE2 
133  C CZ  . TYR A 31  ? 0.1614 0.1407 0.0962 0.0165  -0.0070 0.0164  13  TYR A CZ  
134  O OH  . TYR A 31  ? 0.1540 0.1398 0.0939 0.0133  -0.0046 0.0120  13  TYR A OH  
135  N N   . SER A 32  ? 0.2320 0.1638 0.1307 0.0506  -0.0222 0.0390  14  SER A N   
136  C CA  . SER A 32  ? 0.2542 0.1655 0.1430 0.0581  -0.0242 0.0432  14  SER A CA  
137  C C   . SER A 32  ? 0.2532 0.1702 0.1468 0.0700  -0.0259 0.0406  14  SER A C   
138  O O   . SER A 32  ? 0.2633 0.1642 0.1524 0.0760  -0.0257 0.0398  14  SER A O   
139  C CB  . SER A 32  ? 0.2758 0.1763 0.1515 0.0593  -0.0263 0.0510  14  SER A CB  
140  O OG  . SER A 32  ? 0.2816 0.1971 0.1575 0.0657  -0.0296 0.0528  14  SER A OG  
141  N N   . LYS A 33  ? 0.2362 0.1761 0.1388 0.0735  -0.0275 0.0386  15  LYS A N   
142  C CA  A LYS A 33  ? 0.2387 0.1890 0.1484 0.0843  -0.0285 0.0364  15  LYS A CA  
143  C CA  B LYS A 33  ? 0.2369 0.1877 0.1468 0.0843  -0.0286 0.0364  15  LYS A CA  
144  C C   . LYS A 33  ? 0.2253 0.1771 0.1431 0.0824  -0.0246 0.0305  15  LYS A C   
145  O O   . LYS A 33  ? 0.2289 0.1776 0.1469 0.0919  -0.0240 0.0292  15  LYS A O   
146  C CB  A LYS A 33  ? 0.2313 0.2084 0.1506 0.0867  -0.0315 0.0357  15  LYS A CB  
147  C CB  B LYS A 33  ? 0.2278 0.2057 0.1472 0.0863  -0.0316 0.0357  15  LYS A CB  
148  C CG  A LYS A 33  ? 0.2464 0.2237 0.1570 0.0921  -0.0365 0.0418  15  LYS A CG  
149  C CG  B LYS A 33  ? 0.2310 0.2231 0.1575 0.0990  -0.0338 0.0357  15  LYS A CG  
150  C CD  A LYS A 33  ? 0.2415 0.2466 0.1613 0.0925  -0.0404 0.0403  15  LYS A CD  
151  C CD  B LYS A 33  ? 0.2240 0.2434 0.1594 0.0997  -0.0381 0.0356  15  LYS A CD  
152  N N   . ALA A 34  ? 0.2087 0.1663 0.1326 0.0715  -0.0218 0.0269  16  ALA A N   
153  C CA  . ALA A 34  ? 0.2031 0.1611 0.1329 0.0693  -0.0181 0.0220  16  ALA A CA  
154  C C   . ALA A 34  ? 0.2218 0.1559 0.1414 0.0710  -0.0173 0.0221  16  ALA A C   
155  O O   . ALA A 34  ? 0.2193 0.1505 0.1394 0.0767  -0.0155 0.0190  16  ALA A O   
156  C CB  . ALA A 34  ? 0.1882 0.1542 0.1247 0.0578  -0.0158 0.0190  16  ALA A CB  
157  N N   . LYS A 35  ? 0.2379 0.1547 0.1477 0.0657  -0.0184 0.0256  17  LYS A N   
158  C CA  . LYS A 35  ? 0.2645 0.1561 0.1636 0.0650  -0.0184 0.0257  17  LYS A CA  
159  C C   . LYS A 35  ? 0.2811 0.1597 0.1720 0.0783  -0.0201 0.0264  17  LYS A C   
160  O O   . LYS A 35  ? 0.2873 0.1538 0.1738 0.0826  -0.0191 0.0225  17  LYS A O   
161  C CB  . LYS A 35  ? 0.2920 0.1694 0.1829 0.0563  -0.0194 0.0303  17  LYS A CB  
162  C CG  . LYS A 35  ? 0.3237 0.1788 0.2066 0.0510  -0.0195 0.0293  17  LYS A CG  
163  C CD  . LYS A 35  ? 0.3585 0.2026 0.2354 0.0404  -0.0200 0.0344  17  LYS A CD  
164  C CE  . LYS A 35  ? 0.3915 0.2132 0.2607 0.0348  -0.0210 0.0327  17  LYS A CE  
165  N NZ  . LYS A 35  ? 0.4086 0.2157 0.2700 0.0254  -0.0219 0.0387  17  LYS A NZ  
166  N N   . THR A 36  ? 0.2776 0.1592 0.1660 0.0863  -0.0226 0.0308  18  THR A N   
167  C CA  . THR A 36  ? 0.2987 0.1695 0.1797 0.1014  -0.0242 0.0319  18  THR A CA  
168  C C   . THR A 36  ? 0.2869 0.1745 0.1777 0.1104  -0.0217 0.0264  18  THR A C   
169  O O   . THR A 36  ? 0.2977 0.1713 0.1812 0.1208  -0.0209 0.0241  18  THR A O   
170  C CB  . THR A 36  ? 0.3084 0.1853 0.1871 0.1087  -0.0278 0.0381  18  THR A CB  
171  O OG1 . THR A 36  ? 0.3184 0.1790 0.1865 0.1005  -0.0294 0.0439  18  THR A OG1 
172  C CG2 . THR A 36  ? 0.3317 0.2008 0.2040 0.1269  -0.0298 0.0399  18  THR A CG2 
173  N N   . TYR A 37  ? 0.2582 0.1745 0.1642 0.1067  -0.0202 0.0245  19  TYR A N   
174  C CA  . TYR A 37  ? 0.2537 0.1890 0.1705 0.1132  -0.0171 0.0202  19  TYR A CA  
175  C C   . TYR A 37  ? 0.2539 0.1753 0.1657 0.1113  -0.0136 0.0153  19  TYR A C   
176  O O   . TYR A 37  ? 0.2700 0.1878 0.1784 0.1228  -0.0117 0.0129  19  TYR A O   
177  C CB  . TYR A 37  ? 0.2312 0.1963 0.1643 0.1059  -0.0160 0.0190  19  TYR A CB  
178  C CG  . TYR A 37  ? 0.2294 0.2124 0.1732 0.1089  -0.0118 0.0151  19  TYR A CG  
179  C CD1 . TYR A 37  ? 0.2404 0.2428 0.1923 0.1207  -0.0114 0.0156  19  TYR A CD1 
180  C CD2 . TYR A 37  ? 0.2234 0.2054 0.1696 0.1001  -0.0080 0.0115  19  TYR A CD2 
181  C CE1 . TYR A 37  ? 0.2391 0.2599 0.2014 0.1229  -0.0065 0.0127  19  TYR A CE1 
182  C CE2 . TYR A 37  ? 0.2234 0.2214 0.1782 0.1026  -0.0034 0.0086  19  TYR A CE2 
183  C CZ  . TYR A 37  ? 0.2322 0.2497 0.1950 0.1137  -0.0025 0.0094  19  TYR A CZ  
184  O OH  . TYR A 37  ? 0.2380 0.2726 0.2095 0.1153  0.0027  0.0073  19  TYR A OH  
185  N N   . TRP A 38  ? 0.2400 0.1544 0.1508 0.0983  -0.0128 0.0138  20  TRP A N   
186  C CA  . TRP A 38  ? 0.2448 0.1488 0.1514 0.0959  -0.0101 0.0090  20  TRP A CA  
187  C C   . TRP A 38  ? 0.2809 0.1548 0.1706 0.1017  -0.0118 0.0080  20  TRP A C   
188  O O   . TRP A 38  ? 0.2818 0.1481 0.1659 0.1070  -0.0097 0.0033  20  TRP A O   
189  C CB  . TRP A 38  ? 0.2291 0.1354 0.1398 0.0811  -0.0094 0.0078  20  TRP A CB  
190  C CG  . TRP A 38  ? 0.2082 0.1410 0.1337 0.0775  -0.0069 0.0071  20  TRP A CG  
191  C CD1 . TRP A 38  ? 0.1945 0.1411 0.1283 0.0706  -0.0077 0.0091  20  TRP A CD1 
192  C CD2 . TRP A 38  ? 0.2005 0.1479 0.1331 0.0810  -0.0030 0.0041  20  TRP A CD2 
193  N NE1 . TRP A 38  ? 0.1810 0.1482 0.1266 0.0685  -0.0050 0.0073  20  TRP A NE1 
194  C CE2 . TRP A 38  ? 0.1828 0.1513 0.1282 0.0744  -0.0018 0.0048  20  TRP A CE2 
195  C CE3 . TRP A 38  ? 0.2135 0.1572 0.1414 0.0888  0.0000  0.0010  20  TRP A CE3 
196  C CZ2 . TRP A 38  ? 0.1774 0.1633 0.1320 0.0744  0.0020  0.0032  20  TRP A CZ2 
197  C CZ3 . TRP A 38  ? 0.2043 0.1672 0.1414 0.0896  0.0043  -0.0004 20  TRP A CZ3 
198  C CH2 . TRP A 38  ? 0.1903 0.1742 0.1410 0.0822  0.0053  0.0010  20  TRP A CH2 
199  N N   . LYS A 39  ? 0.3010 0.1571 0.1815 0.1013  -0.0154 0.0123  21  LYS A N   
200  C CA  . LYS A 39  ? 0.3541 0.1776 0.2169 0.1063  -0.0174 0.0116  21  LYS A CA  
201  C C   . LYS A 39  ? 0.3673 0.1875 0.2250 0.1243  -0.0162 0.0092  21  LYS A C   
202  O O   . LYS A 39  ? 0.3986 0.1919 0.2410 0.1298  -0.0168 0.0058  21  LYS A O   
203  C CB  . LYS A 39  ? 0.3822 0.1880 0.2364 0.1018  -0.0211 0.0181  21  LYS A CB  
204  C CG  . LYS A 39  ? 0.4459 0.2161 0.2811 0.1062  -0.0239 0.0191  21  LYS A CG  
205  C CD  . LYS A 39  ? 0.4780 0.2252 0.3029 0.0994  -0.0244 0.0137  21  LYS A CD  
206  C CE  . LYS A 39  ? 0.5375 0.2470 0.3421 0.1067  -0.0275 0.0148  21  LYS A CE  
207  N NZ  . LYS A 39  ? 0.5656 0.2518 0.3597 0.0966  -0.0291 0.0096  21  LYS A NZ  
208  N N   . GLN A 40  ? 0.3498 0.1963 0.2195 0.1338  -0.0145 0.0104  22  GLN A N   
209  C CA  . GLN A 40  ? 0.3693 0.2168 0.2358 0.1525  -0.0127 0.0084  22  GLN A CA  
210  C C   . GLN A 40  ? 0.3481 0.2205 0.2258 0.1564  -0.0073 0.0037  22  GLN A C   
211  O O   . GLN A 40  ? 0.3628 0.2456 0.2426 0.1720  -0.0048 0.0026  22  GLN A O   
212  C CB  . GLN A 40  ? 0.3843 0.2392 0.2530 0.1636  -0.0155 0.0143  22  GLN A CB  
213  C CG  . GLN A 40  ? 0.3704 0.2597 0.2573 0.1593  -0.0163 0.0180  22  GLN A CG  
214  C CD  . GLN A 40  ? 0.3622 0.2856 0.2656 0.1663  -0.0125 0.0155  22  GLN A CD  
215  O OE1 . GLN A 40  ? 0.3873 0.3180 0.2916 0.1829  -0.0119 0.0159  22  GLN A OE1 
216  N NE2 . GLN A 40  ? 0.3398 0.2856 0.2572 0.1537  -0.0101 0.0138  22  GLN A NE2 
217  N N   . ILE A 41  ? 0.3203 0.2009 0.2040 0.1431  -0.0051 0.0010  23  ILE A N   
218  C CA  . ILE A 41  ? 0.3060 0.2057 0.1974 0.1449  0.0002  -0.0030 23  ILE A CA  
219  C C   . ILE A 41  ? 0.3272 0.2021 0.2021 0.1468  0.0016  -0.0089 23  ILE A C   
220  O O   . ILE A 41  ? 0.3304 0.1828 0.1953 0.1369  -0.0016 -0.0100 23  ILE A O   
221  C CB  . ILE A 41  ? 0.2763 0.1969 0.1819 0.1295  0.0014  -0.0020 23  ILE A CB  
222  C CG1 . ILE A 41  ? 0.2577 0.2046 0.1792 0.1285  0.0002  0.0024  23  ILE A CG1 
223  C CG2 . ILE A 41  ? 0.2702 0.2026 0.1795 0.1283  0.0068  -0.0058 23  ILE A CG2 
224  C CD1 . ILE A 41  ? 0.2555 0.2271 0.1873 0.1405  0.0033  0.0028  23  ILE A CD1 
225  N N   . PRO A 42  ? 0.3382 0.2199 0.2110 0.1588  0.0065  -0.0129 24  PRO A N   
226  C CA  . PRO A 42  ? 0.3563 0.2143 0.2118 0.1602  0.0074  -0.0193 24  PRO A CA  
227  C C   . PRO A 42  ? 0.3389 0.1988 0.1958 0.1448  0.0077  -0.0212 24  PRO A C   
228  O O   . PRO A 42  ? 0.3087 0.1945 0.1815 0.1363  0.0100  -0.0185 24  PRO A O   
229  C CB  . PRO A 42  ? 0.3701 0.2399 0.2244 0.1770  0.0136  -0.0227 24  PRO A CB  
230  C CG  . PRO A 42  ? 0.3490 0.2578 0.2260 0.1768  0.0172  -0.0180 24  PRO A CG  
231  C CD  . PRO A 42  ? 0.3338 0.2460 0.2197 0.1701  0.0116  -0.0120 24  PRO A CD  
232  N N   . PRO A 43  ? 0.3577 0.1892 0.1978 0.1400  0.0044  -0.0255 25  PRO A N   
233  C CA  . PRO A 43  ? 0.3451 0.1767 0.1855 0.1255  0.0032  -0.0270 25  PRO A CA  
234  C C   . PRO A 43  ? 0.3437 0.1874 0.1824 0.1290  0.0085  -0.0310 25  PRO A C   
235  O O   . PRO A 43  ? 0.3574 0.1837 0.1805 0.1284  0.0075  -0.0367 25  PRO A O   
236  C CB  . PRO A 43  ? 0.3700 0.1683 0.1937 0.1198  -0.0028 -0.0299 25  PRO A CB  
237  C CG  . PRO A 43  ? 0.4045 0.1819 0.2120 0.1354  -0.0023 -0.0339 25  PRO A CG  
238  C CD  . PRO A 43  ? 0.3982 0.1948 0.2177 0.1475  0.0009  -0.0292 25  PRO A CD  
239  N N   . THR A 44  ? 0.3230 0.1961 0.1767 0.1329  0.0142  -0.0281 26  THR A N   
240  C CA  . THR A 44  ? 0.3213 0.2096 0.1748 0.1374  0.0207  -0.0303 26  THR A CA  
241  C C   . THR A 44  ? 0.2946 0.2104 0.1660 0.1275  0.0238  -0.0255 26  THR A C   
242  O O   . THR A 44  ? 0.2679 0.1957 0.1539 0.1206  0.0219  -0.0208 26  THR A O   
243  C CB  . THR A 44  ? 0.3354 0.2340 0.1886 0.1552  0.0265  -0.0315 26  THR A CB  
244  O OG1 . THR A 44  ? 0.3119 0.2349 0.1844 0.1571  0.0277  -0.0257 26  THR A OG1 
245  C CG2 . THR A 44  ? 0.3696 0.2388 0.2035 0.1674  0.0240  -0.0365 26  THR A CG2 
246  N N   . VAL A 45  ? 0.2918 0.2182 0.1616 0.1274  0.0289  -0.0266 27  VAL A N   
247  C CA  . VAL A 45  ? 0.2703 0.2223 0.1568 0.1188  0.0326  -0.0215 27  VAL A CA  
248  C C   . VAL A 45  ? 0.2577 0.2354 0.1627 0.1221  0.0358  -0.0171 27  VAL A C   
249  O O   . VAL A 45  ? 0.2297 0.2213 0.1492 0.1124  0.0349  -0.0129 27  VAL A O   
250  C CB  . VAL A 45  ? 0.2798 0.2387 0.1601 0.1192  0.0383  -0.0224 27  VAL A CB  
251  C CG1 . VAL A 45  ? 0.2625 0.2476 0.1591 0.1119  0.0434  -0.0166 27  VAL A CG1 
252  C CG2 . VAL A 45  ? 0.2867 0.2255 0.1536 0.1115  0.0334  -0.0252 27  VAL A CG2 
253  N N   . ASP A 46  ? 0.2729 0.2570 0.1767 0.1364  0.0394  -0.0185 28  ASP A N   
254  C CA  . ASP A 46  ? 0.2695 0.2797 0.1914 0.1399  0.0415  -0.0144 28  ASP A CA  
255  C C   . ASP A 46  ? 0.2600 0.2643 0.1880 0.1355  0.0342  -0.0120 28  ASP A C   
256  O O   . ASP A 46  ? 0.2500 0.2756 0.1950 0.1300  0.0336  -0.0079 28  ASP A O   
257  C CB  . ASP A 46  ? 0.2955 0.3159 0.2156 0.1575  0.0469  -0.0161 28  ASP A CB  
258  C CG  . ASP A 46  ? 0.2929 0.3503 0.2350 0.1595  0.0512  -0.0113 28  ASP A CG  
259  O OD1 . ASP A 46  ? 0.2735 0.3517 0.2267 0.1502  0.0558  -0.0082 28  ASP A OD1 
260  O OD2 . ASP A 46  ? 0.3149 0.3800 0.2625 0.1706  0.0498  -0.0105 28  ASP A OD2 
261  N N   . GLY A 47  ? 0.2658 0.2417 0.1799 0.1367  0.0285  -0.0144 29  GLY A N   
262  C CA  . GLY A 47  ? 0.2599 0.2291 0.1780 0.1311  0.0220  -0.0116 29  GLY A CA  
263  C C   . GLY A 47  ? 0.2339 0.2090 0.1612 0.1144  0.0197  -0.0089 29  GLY A C   
264  O O   . GLY A 47  ? 0.2199 0.2084 0.1594 0.1097  0.0175  -0.0054 29  GLY A O   
265  N N   . MET A 48  ? 0.2232 0.1895 0.1445 0.1064  0.0203  -0.0108 30  MET A N   
266  C CA  . MET A 48  ? 0.2088 0.1795 0.1375 0.0923  0.0187  -0.0086 30  MET A CA  
267  C C   . MET A 48  ? 0.1926 0.1901 0.1379 0.0884  0.0223  -0.0054 30  MET A C   
268  O O   . MET A 48  ? 0.1839 0.1874 0.1380 0.0792  0.0200  -0.0032 30  MET A O   
269  C CB  . MET A 48  ? 0.2088 0.1689 0.1286 0.0866  0.0193  -0.0108 30  MET A CB  
270  C CG  . MET A 48  ? 0.2308 0.1648 0.1341 0.0880  0.0152  -0.0146 30  MET A CG  
271  S SD  . MET A 48  ? 0.2318 0.1487 0.1330 0.0813  0.0080  -0.0133 30  MET A SD  
272  C CE  . MET A 48  ? 0.2486 0.1567 0.1441 0.0941  0.0072  -0.0136 30  MET A CE  
273  N N   . LEU A 49  ? 0.1897 0.2031 0.1388 0.0953  0.0281  -0.0053 31  LEU A N   
274  C CA  . LEU A 49  ? 0.1745 0.2131 0.1388 0.0898  0.0321  -0.0021 31  LEU A CA  
275  C C   . LEU A 49  ? 0.1716 0.2319 0.1486 0.0961  0.0326  -0.0002 31  LEU A C   
276  O O   . LEU A 49  ? 0.1612 0.2455 0.1512 0.0937  0.0366  0.0021  31  LEU A O   
277  C CB  . LEU A 49  ? 0.1804 0.2248 0.1418 0.0895  0.0386  -0.0020 31  LEU A CB  
278  C CG  . LEU A 49  ? 0.1845 0.2109 0.1348 0.0824  0.0374  -0.0031 31  LEU A CG  
279  C CD1 . LEU A 49  ? 0.1922 0.2262 0.1394 0.0820  0.0443  -0.0019 31  LEU A CD1 
280  C CD2 . LEU A 49  ? 0.1750 0.1977 0.1314 0.0703  0.0330  -0.0013 31  LEU A CD2 
281  N N   . GLY A 50  ? 0.1781 0.2309 0.1519 0.1038  0.0281  -0.0008 32  GLY A N   
282  C CA  . GLY A 50  ? 0.1795 0.2544 0.1666 0.1089  0.0270  0.0015  32  GLY A CA  
283  C C   . GLY A 50  ? 0.1837 0.2835 0.1795 0.1185  0.0333  0.0022  32  GLY A C   
284  O O   . GLY A 50  ? 0.1820 0.3088 0.1940 0.1175  0.0336  0.0049  32  GLY A O   
285  N N   . GLY A 51  ? 0.1936 0.2849 0.1782 0.1288  0.0381  -0.0003 33  GLY A N   
286  C CA  . GLY A 51  ? 0.1980 0.3133 0.1896 0.1384  0.0456  0.0001  33  GLY A CA  
287  C C   . GLY A 51  ? 0.1907 0.3216 0.1882 0.1296  0.0527  0.0018  33  GLY A C   
288  O O   . GLY A 51  ? 0.1993 0.3527 0.2027 0.1373  0.0604  0.0028  33  GLY A O   
289  N N   . TYR A 52  ? 0.1780 0.2968 0.1726 0.1151  0.0509  0.0023  34  TYR A N   
290  C CA  . TYR A 52  ? 0.1749 0.3030 0.1726 0.1053  0.0569  0.0047  34  TYR A CA  
291  C C   . TYR A 52  ? 0.1813 0.2848 0.1596 0.1058  0.0583  0.0019  34  TYR A C   
292  O O   . TYR A 52  ? 0.1734 0.2729 0.1497 0.0952  0.0598  0.0037  34  TYR A O   
293  C CB  . TYR A 52  ? 0.1601 0.2944 0.1698 0.0886  0.0537  0.0078  34  TYR A CB  
294  C CG  . TYR A 52  ? 0.1535 0.3176 0.1834 0.0861  0.0533  0.0108  34  TYR A CG  
295  C CD1 . TYR A 52  ? 0.1544 0.3463 0.1979 0.0823  0.0599  0.0144  34  TYR A CD1 
296  C CD2 . TYR A 52  ? 0.1524 0.3169 0.1876 0.0871  0.0457  0.0101  34  TYR A CD2 
297  C CE1 . TYR A 52  ? 0.1481 0.3694 0.2112 0.0793  0.0589  0.0170  34  TYR A CE1 
298  C CE2 . TYR A 52  ? 0.1459 0.3384 0.1992 0.0847  0.0443  0.0125  34  TYR A CE2 
299  C CZ  . TYR A 52  ? 0.1448 0.3662 0.2126 0.0807  0.0505  0.0157  34  TYR A CZ  
300  O OH  . TYR A 52  ? 0.1411 0.3924 0.2281 0.0774  0.0482  0.0179  34  TYR A OH  
301  N N   . GLY A 53  ? 0.2005 0.2867 0.1633 0.1185  0.0578  -0.0025 35  GLY A N   
302  C CA  . GLY A 53  ? 0.2152 0.2782 0.1585 0.1188  0.0583  -0.0059 35  GLY A CA  
303  C C   . GLY A 53  ? 0.2192 0.2940 0.1610 0.1157  0.0661  -0.0035 35  GLY A C   
304  O O   . GLY A 53  ? 0.2212 0.2819 0.1523 0.1092  0.0655  -0.0038 35  GLY A O   
305  N N   . HIS A 54  ? 0.2215 0.3234 0.1743 0.1205  0.0736  -0.0007 36  HIS A N   
306  C CA  . HIS A 54  ? 0.2271 0.3439 0.1802 0.1170  0.0823  0.0028  36  HIS A CA  
307  C C   . HIS A 54  ? 0.2103 0.3272 0.1687 0.0999  0.0818  0.0079  36  HIS A C   
308  O O   . HIS A 54  ? 0.2169 0.3372 0.1689 0.0973  0.0881  0.0107  36  HIS A O   
309  C CB  . HIS A 54  ? 0.2385 0.3884 0.2056 0.1241  0.0907  0.0057  36  HIS A CB  
310  C CG  . HIS A 54  ? 0.2314 0.4057 0.2229 0.1152  0.0891  0.0104  36  HIS A CG  
311  N ND1 . HIS A 54  ? 0.2289 0.4220 0.2336 0.1012  0.0932  0.0166  36  HIS A ND1 
312  C CD2 . HIS A 54  ? 0.2333 0.4165 0.2374 0.1183  0.0837  0.0099  36  HIS A CD2 
313  C CE1 . HIS A 54  ? 0.2190 0.4312 0.2436 0.0952  0.0899  0.0190  36  HIS A CE1 
314  N NE2 . HIS A 54  ? 0.2221 0.4296 0.2467 0.1057  0.0841  0.0150  36  HIS A NE2 
315  N N   . ILE A 55  ? 0.1887 0.3033 0.1582 0.0891  0.0753  0.0095  37  ILE A N   
316  C CA  . ILE A 55  ? 0.1817 0.2926 0.1541 0.0740  0.0746  0.0137  37  ILE A CA  
317  C C   . ILE A 55  ? 0.1781 0.2609 0.1347 0.0710  0.0693  0.0114  37  ILE A C   
318  O O   . ILE A 55  ? 0.1740 0.2507 0.1317 0.0601  0.0678  0.0146  37  ILE A O   
319  C CB  . ILE A 55  ? 0.1706 0.2905 0.1610 0.0631  0.0698  0.0159  37  ILE A CB  
320  C CG1 . ILE A 55  ? 0.1709 0.2723 0.1585 0.0630  0.0604  0.0119  37  ILE A CG1 
321  C CG2 . ILE A 55  ? 0.1700 0.3200 0.1774 0.0659  0.0739  0.0180  37  ILE A CG2 
322  C CD1 . ILE A 55  ? 0.1604 0.2650 0.1603 0.0511  0.0557  0.0136  37  ILE A CD1 
323  N N   . SER A 56  ? 0.1798 0.2449 0.1215 0.0803  0.0660  0.0060  38  SER A N   
324  C CA  . SER A 56  ? 0.1784 0.2196 0.1081 0.0764  0.0594  0.0036  38  SER A CA  
325  C C   . SER A 56  ? 0.1803 0.2166 0.1011 0.0709  0.0620  0.0068  38  SER A C   
326  O O   . SER A 56  ? 0.1760 0.2003 0.0951 0.0633  0.0570  0.0078  38  SER A O   
327  C CB  . SER A 56  ? 0.1924 0.2153 0.1066 0.0865  0.0556  -0.0028 38  SER A CB  
328  O OG  . SER A 56  ? 0.1929 0.1951 0.0986 0.0809  0.0482  -0.0048 38  SER A OG  
329  N N   . SER A 57  ? 0.1910 0.2362 0.1049 0.0758  0.0697  0.0084  39  SER A N   
330  C CA  . SER A 57  ? 0.1979 0.2374 0.1004 0.0718  0.0722  0.0119  39  SER A CA  
331  C C   . SER A 57  ? 0.1915 0.2383 0.1059 0.0593  0.0740  0.0193  39  SER A C   
332  O O   . SER A 57  ? 0.1919 0.2262 0.0996 0.0535  0.0713  0.0220  39  SER A O   
333  C CB  . SER A 57  ? 0.2132 0.2604 0.1039 0.0803  0.0804  0.0120  39  SER A CB  
334  O OG  . SER A 57  ? 0.2197 0.2584 0.0956 0.0780  0.0816  0.0148  39  SER A OG  
335  N N   . ILE A 58  ? 0.1858 0.2522 0.1173 0.0554  0.0783  0.0226  40  ILE A N   
336  C CA  . ILE A 58  ? 0.1817 0.2528 0.1251 0.0423  0.0790  0.0287  40  ILE A CA  
337  C C   . ILE A 58  ? 0.1737 0.2271 0.1181 0.0366  0.0700  0.0267  40  ILE A C   
338  O O   . ILE A 58  ? 0.1742 0.2170 0.1158 0.0293  0.0687  0.0303  40  ILE A O   
339  C CB  . ILE A 58  ? 0.1771 0.2726 0.1402 0.0391  0.0826  0.0305  40  ILE A CB  
340  C CG1 . ILE A 58  ? 0.1883 0.3044 0.1522 0.0429  0.0928  0.0343  40  ILE A CG1 
341  C CG2 . ILE A 58  ? 0.1712 0.2674 0.1469 0.0248  0.0804  0.0345  40  ILE A CG2 
342  C CD1 . ILE A 58  ? 0.1833 0.3272 0.1663 0.0428  0.0964  0.0353  40  ILE A CD1 
343  N N   . ASP A 59  ? 0.1669 0.2165 0.1149 0.0406  0.0639  0.0211  41  ASP A N   
344  C CA  . ASP A 59  ? 0.1612 0.1968 0.1108 0.0361  0.0561  0.0189  41  ASP A CA  
345  C C   . ASP A 59  ? 0.1687 0.1858 0.1041 0.0367  0.0525  0.0184  41  ASP A C   
346  O O   . ASP A 59  ? 0.1693 0.1777 0.1057 0.0301  0.0497  0.0207  41  ASP A O   
347  C CB  . ASP A 59  ? 0.1554 0.1901 0.1087 0.0417  0.0510  0.0135  41  ASP A CB  
348  C CG  . ASP A 59  ? 0.1512 0.1713 0.1035 0.0382  0.0436  0.0113  41  ASP A CG  
349  O OD1 . ASP A 59  ? 0.1443 0.1642 0.1045 0.0298  0.0420  0.0133  41  ASP A OD1 
350  O OD2 . ASP A 59  ? 0.1552 0.1628 0.0980 0.0431  0.0394  0.0075  41  ASP A OD2 
351  N N   . ILE A 60  ? 0.1780 0.1889 0.1000 0.0447  0.0522  0.0153  42  ILE A N   
352  C CA  . ILE A 60  ? 0.1851 0.1803 0.0938 0.0454  0.0476  0.0142  42  ILE A CA  
353  C C   . ILE A 60  ? 0.1910 0.1846 0.0941 0.0413  0.0509  0.0204  42  ILE A C   
354  O O   . ILE A 60  ? 0.1910 0.1741 0.0912 0.0382  0.0461  0.0216  42  ILE A O   
355  C CB  . ILE A 60  ? 0.2001 0.1882 0.0939 0.0543  0.0462  0.0089  42  ILE A CB  
356  C CG1 . ILE A 60  ? 0.2012 0.1850 0.0979 0.0579  0.0417  0.0032  42  ILE A CG1 
357  C CG2 . ILE A 60  ? 0.2105 0.1853 0.0899 0.0542  0.0415  0.0083  42  ILE A CG2 
358  C CD1 . ILE A 60  ? 0.1998 0.1724 0.0989 0.0531  0.0336  0.0013  42  ILE A CD1 
359  N N   . ASN A 61  ? 0.1932 0.1974 0.0953 0.0416  0.0588  0.0246  43  ASN A N   
360  C CA  . ASN A 61  ? 0.2042 0.2059 0.0999 0.0373  0.0625  0.0317  43  ASN A CA  
361  C C   . ASN A 61  ? 0.1981 0.1947 0.1039 0.0281  0.0602  0.0355  43  ASN A C   
362  O O   . ASN A 61  ? 0.2053 0.1899 0.1035 0.0261  0.0580  0.0393  43  ASN A O   
363  C CB  . ASN A 61  ? 0.2124 0.2281 0.1068 0.0378  0.0724  0.0364  43  ASN A CB  
364  C CG  . ASN A 61  ? 0.2288 0.2444 0.1057 0.0478  0.0751  0.0338  43  ASN A CG  
365  O OD1 . ASN A 61  ? 0.2316 0.2343 0.0956 0.0527  0.0691  0.0293  43  ASN A OD1 
366  N ND2 . ASN A 61  ? 0.2380 0.2687 0.1146 0.0503  0.0842  0.0364  43  ASN A ND2 
367  N N   . SER A 62  ? 0.1881 0.1934 0.1094 0.0232  0.0609  0.0348  44  SER A N   
368  C CA  . SER A 62  ? 0.1879 0.1871 0.1176 0.0145  0.0586  0.0373  44  SER A CA  
369  C C   . SER A 62  ? 0.1851 0.1702 0.1130 0.0157  0.0506  0.0337  44  SER A C   
370  O O   . SER A 62  ? 0.1896 0.1633 0.1150 0.0124  0.0488  0.0368  44  SER A O   
371  C CB  . SER A 62  ? 0.1804 0.1930 0.1265 0.0084  0.0604  0.0367  44  SER A CB  
372  O OG  . SER A 62  ? 0.1892 0.2158 0.1388 0.0051  0.0681  0.0416  44  SER A OG  
373  N N   . SER A 63  ? 0.1743 0.1597 0.1024 0.0210  0.0460  0.0277  45  SER A N   
374  C CA  . SER A 63  ? 0.1733 0.1482 0.1003 0.0219  0.0389  0.0246  45  SER A CA  
375  C C   . SER A 63  ? 0.1837 0.1487 0.0984 0.0247  0.0367  0.0268  45  SER A C   
376  O O   . SER A 63  ? 0.1845 0.1415 0.0997 0.0236  0.0327  0.0277  45  SER A O   
377  C CB  . SER A 63  ? 0.1661 0.1425 0.0939 0.0265  0.0349  0.0184  45  SER A CB  
378  O OG  . SER A 63  ? 0.1600 0.1449 0.0995 0.0244  0.0355  0.0165  45  SER A OG  
379  N N   . ARG A 64  ? 0.1935 0.1597 0.0968 0.0291  0.0392  0.0278  46  ARG A N   
380  C CA  . ARG A 64  ? 0.2072 0.1651 0.0976 0.0321  0.0363  0.0300  46  ARG A CA  
381  C C   . ARG A 64  ? 0.2169 0.1684 0.1061 0.0285  0.0383  0.0373  46  ARG A C   
382  O O   . ARG A 64  ? 0.2204 0.1638 0.1056 0.0300  0.0336  0.0389  46  ARG A O   
383  C CB  . ARG A 64  ? 0.2222 0.1824 0.0985 0.0376  0.0390  0.0295  46  ARG A CB  
384  C CG  . ARG A 64  ? 0.2359 0.1883 0.0972 0.0410  0.0349  0.0314  46  ARG A CG  
385  C CD  . ARG A 64  ? 0.2536 0.2078 0.0991 0.0465  0.0378  0.0302  46  ARG A CD  
386  N NE  . ARG A 64  ? 0.2500 0.2045 0.0946 0.0500  0.0346  0.0217  46  ARG A NE  
387  C CZ  . ARG A 64  ? 0.2559 0.2160 0.0995 0.0537  0.0395  0.0182  46  ARG A CZ  
388  N NH1 . ARG A 64  ? 0.2603 0.2299 0.1047 0.0541  0.0487  0.0225  46  ARG A NH1 
389  N NH2 . ARG A 64  ? 0.2546 0.2106 0.0966 0.0569  0.0352  0.0107  46  ARG A NH2 
390  N N   . LYS A 65  ? 0.2236 0.1789 0.1154 0.0241  0.0453  0.0421  47  LYS A N   
391  C CA  . LYS A 65  ? 0.2423 0.1888 0.1319 0.0198  0.0476  0.0494  47  LYS A CA  
392  C C   . LYS A 65  ? 0.2366 0.1748 0.1351 0.0168  0.0431  0.0479  47  LYS A C   
393  O O   . LYS A 65  ? 0.2443 0.1702 0.1373 0.0175  0.0412  0.0521  47  LYS A O   
394  C CB  . LYS A 65  ? 0.2591 0.2129 0.1530 0.0131  0.0561  0.0543  47  LYS A CB  
395  C CG  . LYS A 65  ? 0.2829 0.2254 0.1716 0.0077  0.0595  0.0632  47  LYS A CG  
396  C CD  . LYS A 65  ? 0.3045 0.2561 0.1976 -0.0004 0.0683  0.0688  47  LYS A CD  
397  N N   . PHE A 66  ? 0.2252 0.1697 0.1361 0.0139  0.0421  0.0427  48  PHE A N   
398  C CA  . PHE A 66  ? 0.2226 0.1606 0.1414 0.0115  0.0382  0.0401  48  PHE A CA  
399  C C   . PHE A 66  ? 0.2294 0.1610 0.1439 0.0178  0.0318  0.0383  48  PHE A C   
400  O O   . PHE A 66  ? 0.2283 0.1496 0.1419 0.0185  0.0299  0.0401  48  PHE A O   
401  C CB  . PHE A 66  ? 0.2092 0.1569 0.1401 0.0087  0.0375  0.0344  48  PHE A CB  
402  C CG  . PHE A 66  ? 0.2037 0.1452 0.1418 0.0055  0.0345  0.0316  48  PHE A CG  
403  C CD1 . PHE A 66  ? 0.2146 0.1491 0.1551 -0.0013 0.0369  0.0342  48  PHE A CD1 
404  C CD2 . PHE A 66  ? 0.1938 0.1366 0.1357 0.0087  0.0296  0.0264  48  PHE A CD2 
405  C CE1 . PHE A 66  ? 0.2141 0.1419 0.1594 -0.0037 0.0341  0.0306  48  PHE A CE1 
406  C CE2 . PHE A 66  ? 0.1894 0.1275 0.1366 0.0065  0.0276  0.0236  48  PHE A CE2 
407  C CZ  . PHE A 66  ? 0.2002 0.1307 0.1486 0.0006  0.0298  0.0253  48  PHE A CZ  
408  N N   . LEU A 67  ? 0.2261 0.1640 0.1384 0.0223  0.0285  0.0344  49  LEU A N   
409  C CA  . LEU A 67  ? 0.2335 0.1691 0.1434 0.0271  0.0221  0.0325  49  LEU A CA  
410  C C   . LEU A 67  ? 0.2575 0.1862 0.1568 0.0311  0.0206  0.0378  49  LEU A C   
411  O O   . LEU A 67  ? 0.2489 0.1737 0.1489 0.0344  0.0164  0.0385  49  LEU A O   
412  C CB  . LEU A 67  ? 0.2344 0.1770 0.1433 0.0292  0.0191  0.0272  49  LEU A CB  
413  C CG  . LEU A 67  ? 0.2421 0.1851 0.1497 0.0323  0.0121  0.0248  49  LEU A CG  
414  C CD1 . LEU A 67  ? 0.2367 0.1798 0.1549 0.0311  0.0100  0.0236  49  LEU A CD1 
415  C CD2 . LEU A 67  ? 0.2461 0.1930 0.1514 0.0328  0.0096  0.0194  49  LEU A CD2 
416  N N   . GLN A 68  ? 0.2781 0.2057 0.1672 0.0316  0.0243  0.0420  50  GLN A N   
417  C CA  . GLN A 68  ? 0.3182 0.2392 0.1949 0.0362  0.0225  0.0478  50  GLN A CA  
418  C C   . GLN A 68  ? 0.3320 0.2410 0.2083 0.0365  0.0229  0.0535  50  GLN A C   
419  O O   . GLN A 68  ? 0.3385 0.2426 0.2073 0.0423  0.0189  0.0572  50  GLN A O   
420  C CB  . GLN A 68  ? 0.3599 0.2822 0.2240 0.0366  0.0274  0.0517  50  GLN A CB  
421  C CG  . GLN A 68  ? 0.3738 0.3040 0.2329 0.0398  0.0245  0.0457  50  GLN A CG  
422  C CD  . GLN A 68  ? 0.4191 0.3520 0.2662 0.0409  0.0302  0.0481  50  GLN A CD  
423  O OE1 . GLN A 68  ? 0.4468 0.3805 0.2948 0.0372  0.0380  0.0531  50  GLN A OE1 
424  N NE2 . GLN A 68  ? 0.4549 0.3893 0.2898 0.0458  0.0264  0.0450  50  GLN A NE2 
425  N N   . ARG A 69  ? 0.3408 0.2453 0.2253 0.0309  0.0268  0.0536  51  ARG A N   
426  C CA  A ARG A 69  ? 0.3465 0.2369 0.2318 0.0305  0.0271  0.0570  51  ARG A CA  
427  C CA  B ARG A 69  ? 0.3556 0.2459 0.2400 0.0310  0.0269  0.0573  51  ARG A CA  
428  C C   . ARG A 69  ? 0.3424 0.2321 0.2298 0.0382  0.0203  0.0547  51  ARG A C   
429  O O   . ARG A 69  ? 0.3723 0.2504 0.2537 0.0435  0.0188  0.0595  51  ARG A O   
430  C CB  A ARG A 69  ? 0.3485 0.2370 0.2445 0.0227  0.0303  0.0537  51  ARG A CB  
431  C CB  B ARG A 69  ? 0.3693 0.2567 0.2633 0.0232  0.0305  0.0549  51  ARG A CB  
432  C CG  A ARG A 69  ? 0.3532 0.2455 0.2521 0.0134  0.0368  0.0555  51  ARG A CG  
433  C CG  B ARG A 69  ? 0.4011 0.2701 0.2923 0.0218  0.0316  0.0589  51  ARG A CG  
434  C CD  A ARG A 69  ? 0.3507 0.2428 0.2612 0.0075  0.0367  0.0502  51  ARG A CD  
435  C CD  B ARG A 69  ? 0.4045 0.2724 0.3055 0.0216  0.0291  0.0521  51  ARG A CD  
436  N NE  A ARG A 69  ? 0.3605 0.2583 0.2778 -0.0019 0.0412  0.0502  51  ARG A NE  
437  N NE  B ARG A 69  ? 0.4251 0.2739 0.3215 0.0244  0.0284  0.0543  51  ARG A NE  
438  C CZ  A ARG A 69  ? 0.3805 0.2689 0.3014 -0.0095 0.0424  0.0503  51  ARG A CZ  
439  C CZ  B ARG A 69  ? 0.4450 0.2810 0.3425 0.0175  0.0310  0.0538  51  ARG A CZ  
440  N NH1 A ARG A 69  ? 0.3858 0.2827 0.3145 -0.0188 0.0457  0.0500  51  ARG A NH1 
441  N NH1 B ARG A 69  ? 0.4417 0.2854 0.3461 0.0074  0.0339  0.0513  51  ARG A NH1 
442  N NH2 A ARG A 69  ? 0.3968 0.2670 0.3130 -0.0076 0.0400  0.0506  51  ARG A NH2 
443  N NH2 B ARG A 69  ? 0.4728 0.2885 0.3640 0.0208  0.0304  0.0555  51  ARG A NH2 
444  N N   . PHE A 70  ? 0.2867 0.1887 0.1827 0.0389  0.0167  0.0479  52  PHE A N   
445  C CA  . PHE A 70  ? 0.2765 0.1822 0.1783 0.0445  0.0113  0.0450  52  PHE A CA  
446  C C   . PHE A 70  ? 0.2894 0.2024 0.1862 0.0507  0.0054  0.0462  52  PHE A C   
447  O O   . PHE A 70  ? 0.2672 0.1852 0.1689 0.0556  0.0009  0.0451  52  PHE A O   
448  C CB  . PHE A 70  ? 0.2527 0.1673 0.1666 0.0407  0.0108  0.0378  52  PHE A CB  
449  C CG  . PHE A 70  ? 0.2493 0.1569 0.1675 0.0350  0.0154  0.0366  52  PHE A CG  
450  C CD1 . PHE A 70  ? 0.2655 0.1619 0.1844 0.0366  0.0162  0.0372  52  PHE A CD1 
451  C CD2 . PHE A 70  ? 0.2432 0.1554 0.1641 0.0283  0.0188  0.0348  52  PHE A CD2 
452  C CE1 . PHE A 70  ? 0.2689 0.1573 0.1902 0.0300  0.0199  0.0359  52  PHE A CE1 
453  C CE2 . PHE A 70  ? 0.2435 0.1510 0.1687 0.0222  0.0224  0.0338  52  PHE A CE2 
454  C CZ  . PHE A 70  ? 0.2593 0.1545 0.1843 0.0224  0.0227  0.0342  52  PHE A CZ  
455  N N   . LEU A 71  ? 0.3177 0.2323 0.2044 0.0503  0.0056  0.0484  53  LEU A N   
456  C CA  . LEU A 71  ? 0.3439 0.2655 0.2235 0.0553  -0.0005 0.0490  53  LEU A CA  
457  C C   . LEU A 71  ? 0.3614 0.2759 0.2290 0.0615  -0.0020 0.0566  53  LEU A C   
458  O O   . LEU A 71  ? 0.3888 0.3103 0.2503 0.0659  -0.0083 0.0570  53  LEU A O   
459  C CB  . LEU A 71  ? 0.3490 0.2769 0.2230 0.0520  -0.0004 0.0453  53  LEU A CB  
460  C CG  . LEU A 71  ? 0.3350 0.2697 0.2198 0.0469  -0.0001 0.0379  53  LEU A CG  
461  C CD1 . LEU A 71  ? 0.3464 0.2844 0.2241 0.0451  0.0002  0.0339  53  LEU A CD1 
462  C CD2 . LEU A 71  ? 0.3412 0.2842 0.2366 0.0472  -0.0060 0.0335  53  LEU A CD2 
463  N N   . ARG A 72  ? 0.3546 0.2546 0.2179 0.0620  0.0027  0.0627  54  ARG A N   
464  C CA  . ARG A 72  ? 0.3756 0.2653 0.2266 0.0685  0.0017  0.0712  54  ARG A CA  
465  C C   . ARG A 72  ? 0.3552 0.2496 0.2095 0.0778  -0.0056 0.0718  54  ARG A C   
466  O O   . ARG A 72  ? 0.3251 0.2250 0.1929 0.0787  -0.0072 0.0669  54  ARG A O   
467  C CB  . ARG A 72  ? 0.4165 0.2870 0.2636 0.0659  0.0084  0.0771  54  ARG A CB  
468  C CG  . ARG A 72  ? 0.4416 0.3086 0.2853 0.0565  0.0162  0.0786  54  ARG A CG  
469  C CD  . ARG A 72  ? 0.4764 0.3231 0.3149 0.0534  0.0217  0.0858  54  ARG A CD  
470  N NE  . ARG A 72  ? 0.4866 0.3290 0.3379 0.0498  0.0225  0.0803  54  ARG A NE  
471  C CZ  . ARG A 72  ? 0.5225 0.3464 0.3728 0.0461  0.0261  0.0832  54  ARG A CZ  
472  N NH1 . ARG A 72  ? 0.5380 0.3454 0.3761 0.0440  0.0299  0.0922  54  ARG A NH1 
473  N NH2 . ARG A 72  ? 0.5414 0.3632 0.4028 0.0435  0.0258  0.0764  54  ARG A NH2 
474  N N   . GLU A 73  ? 0.3533 0.2459 0.1955 0.0852  -0.0098 0.0782  55  GLU A N   
475  C CA  . GLU A 73  ? 0.3544 0.2535 0.2004 0.0953  -0.0170 0.0797  55  GLU A CA  
476  C C   . GLU A 73  ? 0.3532 0.2376 0.2035 0.0997  -0.0137 0.0823  55  GLU A C   
477  O O   . GLU A 73  ? 0.3707 0.2352 0.2126 0.0974  -0.0077 0.0872  55  GLU A O   
478  C CB  . GLU A 73  ? 0.3799 0.2786 0.2105 0.1030  -0.0222 0.0871  55  GLU A CB  
479  C CG  . GLU A 73  ? 0.3881 0.2995 0.2112 0.0994  -0.0261 0.0842  55  GLU A CG  
480  C CD  . GLU A 73  ? 0.3852 0.3178 0.2213 0.0977  -0.0334 0.0757  55  GLU A CD  
481  O OE1 . GLU A 73  ? 0.4172 0.3556 0.2528 0.0901  -0.0331 0.0695  55  GLU A OE1 
482  O OE2 . GLU A 73  ? 0.3784 0.3215 0.2253 0.1034  -0.0390 0.0752  55  GLU A OE2 
483  N N   . GLY A 74  ? 0.3369 0.2306 0.1980 0.1070  -0.0181 0.0799  56  GLY A N   
484  C CA  . GLY A 74  ? 0.3399 0.2198 0.2037 0.1141  -0.0157 0.0817  56  GLY A CA  
485  C C   . GLY A 74  ? 0.3141 0.2103 0.1956 0.1156  -0.0174 0.0741  56  GLY A C   
486  O O   . GLY A 74  ? 0.2935 0.2104 0.1845 0.1107  -0.0206 0.0687  56  GLY A O   
487  N N   . PRO A 75  ? 0.3176 0.2035 0.2028 0.1224  -0.0149 0.0737  57  PRO A N   
488  C CA  A PRO A 75  ? 0.3033 0.2059 0.2041 0.1267  -0.0162 0.0677  57  PRO A CA  
489  C CA  B PRO A 75  ? 0.3039 0.2053 0.2044 0.1270  -0.0160 0.0678  57  PRO A CA  
490  C C   . PRO A 75  ? 0.2777 0.1909 0.1895 0.1155  -0.0135 0.0597  57  PRO A C   
491  O O   . PRO A 75  ? 0.2704 0.2051 0.1954 0.1165  -0.0161 0.0554  57  PRO A O   
492  C CB  A PRO A 75  ? 0.3232 0.2050 0.2204 0.1366  -0.0126 0.0692  57  PRO A CB  
493  C CB  B PRO A 75  ? 0.3231 0.2016 0.2192 0.1353  -0.0117 0.0690  57  PRO A CB  
494  C CG  A PRO A 75  ? 0.3481 0.2081 0.2283 0.1410  -0.0128 0.0781  57  PRO A CG  
495  C CG  B PRO A 75  ? 0.3370 0.1880 0.2190 0.1279  -0.0069 0.0726  57  PRO A CG  
496  C CD  A PRO A 75  ? 0.3430 0.2005 0.2162 0.1278  -0.0112 0.0794  57  PRO A CD  
497  C CD  B PRO A 75  ? 0.3412 0.1973 0.2144 0.1256  -0.0102 0.0787  57  PRO A CD  
498  N N   . ASN A 76  ? 0.2664 0.1667 0.1735 0.1045  -0.0086 0.0579  58  ASN A N   
499  C CA  . ASN A 76  ? 0.2430 0.1521 0.1598 0.0947  -0.0061 0.0506  58  ASN A CA  
500  C C   . ASN A 76  ? 0.2250 0.1446 0.1420 0.0849  -0.0073 0.0488  58  ASN A C   
501  O O   . ASN A 76  ? 0.2069 0.1295 0.1291 0.0763  -0.0047 0.0438  58  ASN A O   
502  C CB  . ASN A 76  ? 0.2495 0.1387 0.1633 0.0898  0.0001  0.0486  58  ASN A CB  
503  C CG  . ASN A 76  ? 0.2658 0.1422 0.1782 0.1000  0.0013  0.0490  58  ASN A CG  
504  O OD1 . ASN A 76  ? 0.2597 0.1493 0.1811 0.1068  -0.0001 0.0458  58  ASN A OD1 
505  N ND2 . ASN A 76  ? 0.2892 0.1410 0.1897 0.1018  0.0037  0.0535  58  ASN A ND2 
506  N N   . LYS A 77  ? 0.2292 0.1535 0.1390 0.0871  -0.0116 0.0529  59  LYS A N   
507  C CA  . LYS A 77  ? 0.2246 0.1551 0.1308 0.0791  -0.0125 0.0512  59  LYS A CA  
508  C C   . LYS A 77  ? 0.2042 0.1508 0.1223 0.0732  -0.0143 0.0442  59  LYS A C   
509  O O   . LYS A 77  ? 0.1965 0.1581 0.1235 0.0764  -0.0189 0.0426  59  LYS A O   
510  C CB  . LYS A 77  ? 0.2366 0.1730 0.1334 0.0838  -0.0186 0.0556  59  LYS A CB  
511  C CG  . LYS A 77  ? 0.2341 0.1764 0.1255 0.0765  -0.0199 0.0526  59  LYS A CG  
512  C CD  . LYS A 77  ? 0.2491 0.1985 0.1308 0.0812  -0.0271 0.0557  59  LYS A CD  
513  N N   . THR A 78  ? 0.1962 0.1403 0.1146 0.0647  -0.0106 0.0404  60  THR A N   
514  C CA  . THR A 78  ? 0.1840 0.1402 0.1111 0.0584  -0.0121 0.0344  60  THR A CA  
515  C C   . THR A 78  ? 0.1881 0.1540 0.1107 0.0575  -0.0185 0.0337  60  THR A C   
516  O O   . THR A 78  ? 0.1965 0.1567 0.1069 0.0583  -0.0190 0.0362  60  THR A O   
517  C CB  . THR A 78  ? 0.1794 0.1287 0.1066 0.0512  -0.0066 0.0314  60  THR A CB  
518  O OG1 . THR A 78  ? 0.1828 0.1242 0.1143 0.0517  -0.0021 0.0313  60  THR A OG1 
519  C CG2 . THR A 78  ? 0.1673 0.1257 0.1006 0.0456  -0.0081 0.0261  60  THR A CG2 
520  N N   . GLY A 79  ? 0.1831 0.1629 0.1148 0.0553  -0.0231 0.0302  61  GLY A N   
521  C CA  . GLY A 79  ? 0.1932 0.1819 0.1214 0.0528  -0.0301 0.0285  61  GLY A CA  
522  C C   . GLY A 79  ? 0.1959 0.1781 0.1165 0.0462  -0.0290 0.0244  61  GLY A C   
523  O O   . GLY A 79  ? 0.1909 0.1648 0.1114 0.0432  -0.0229 0.0227  61  GLY A O   
524  N N   . THR A 80  ? 0.2099 0.1966 0.1241 0.0442  -0.0356 0.0223  62  THR A N   
525  C CA  . THR A 80  ? 0.2204 0.1995 0.1246 0.0398  -0.0352 0.0180  62  THR A CA  
526  C C   . THR A 80  ? 0.2204 0.2059 0.1272 0.0334  -0.0423 0.0127  62  THR A C   
527  O O   . THR A 80  ? 0.2288 0.2079 0.1235 0.0309  -0.0451 0.0088  62  THR A O   
528  C CB  . THR A 80  ? 0.2439 0.2158 0.1309 0.0439  -0.0353 0.0201  62  THR A CB  
529  O OG1 . THR A 80  ? 0.2561 0.2355 0.1394 0.0477  -0.0425 0.0229  62  THR A OG1 
530  C CG2 . THR A 80  ? 0.2563 0.2191 0.1396 0.0476  -0.0270 0.0251  62  THR A CG2 
531  N N   . SER A 81  ? 0.2059 0.2033 0.1270 0.0306  -0.0451 0.0127  63  SER A N   
532  C CA  A SER A 81  ? 0.2103 0.2145 0.1353 0.0228  -0.0518 0.0086  63  SER A CA  
533  C CA  B SER A 81  ? 0.2099 0.2141 0.1353 0.0227  -0.0517 0.0086  63  SER A CA  
534  C C   . SER A 81  ? 0.2042 0.1991 0.1304 0.0163  -0.0482 0.0045  63  SER A C   
535  O O   . SER A 81  ? 0.2108 0.2002 0.1307 0.0105  -0.0525 0.0001  63  SER A O   
536  C CB  A SER A 81  ? 0.2055 0.2293 0.1463 0.0220  -0.0561 0.0110  63  SER A CB  
537  C CB  B SER A 81  ? 0.2041 0.2274 0.1458 0.0216  -0.0553 0.0108  63  SER A CB  
538  O OG  A SER A 81  ? 0.1932 0.2206 0.1468 0.0221  -0.0499 0.0123  63  SER A OG  
539  O OG  B SER A 81  ? 0.2130 0.2458 0.1525 0.0269  -0.0611 0.0138  63  SER A OG  
540  N N   . CYS A 82  ? 0.1921 0.1845 0.1256 0.0173  -0.0410 0.0058  64  CYS A N   
541  C CA  . CYS A 82  ? 0.1899 0.1755 0.1253 0.0117  -0.0384 0.0027  64  CYS A CA  
542  C C   . CYS A 82  ? 0.1784 0.1583 0.1165 0.0149  -0.0301 0.0039  64  CYS A C   
543  O O   . CYS A 82  ? 0.1655 0.1507 0.1108 0.0187  -0.0265 0.0071  64  CYS A O   
544  C CB  . CYS A 82  ? 0.1972 0.1941 0.1451 0.0049  -0.0416 0.0027  64  CYS A CB  
545  S SG  . CYS A 82  ? 0.2306 0.2161 0.1763 -0.0035 -0.0414 -0.0008 64  CYS A SG  
546  N N   . ALA A 83  ? 0.1698 0.1384 0.1012 0.0139  -0.0273 0.0013  65  ALA A N   
547  C CA  . ALA A 83  ? 0.1634 0.1285 0.0982 0.0155  -0.0207 0.0019  65  ALA A CA  
548  C C   . ALA A 83  ? 0.1623 0.1236 0.0997 0.0109  -0.0205 -0.0001 65  ALA A C   
549  O O   . ALA A 83  ? 0.1765 0.1321 0.1085 0.0072  -0.0246 -0.0028 65  ALA A O   
550  C CB  . ALA A 83  ? 0.1681 0.1256 0.0934 0.0199  -0.0168 0.0018  65  ALA A CB  
551  N N   . LEU A 84  ? 0.1543 0.1165 0.0977 0.0116  -0.0156 0.0008  66  LEU A N   
552  C CA  . LEU A 84  ? 0.1550 0.1133 0.1000 0.0085  -0.0148 -0.0002 66  LEU A CA  
553  C C   . LEU A 84  ? 0.1516 0.1044 0.0933 0.0125  -0.0102 -0.0008 66  LEU A C   
554  O O   . LEU A 84  ? 0.1482 0.1051 0.0939 0.0149  -0.0064 0.0006  66  LEU A O   
555  C CB  . LEU A 84  ? 0.1480 0.1148 0.1033 0.0058  -0.0135 0.0017  66  LEU A CB  
556  C CG  . LEU A 84  ? 0.1505 0.1135 0.1067 0.0033  -0.0120 0.0016  66  LEU A CG  
557  C CD1 . LEU A 84  ? 0.1616 0.1172 0.1131 -0.0018 -0.0160 0.0008  66  LEU A CD1 
558  C CD2 . LEU A 84  ? 0.1463 0.1191 0.1114 0.0021  -0.0095 0.0037  66  LEU A CD2 
559  N N   . ASP A 85  ? 0.1580 0.1018 0.0925 0.0133  -0.0108 -0.0030 67  ASP A N   
560  C CA  . ASP A 85  ? 0.1579 0.0993 0.0906 0.0176  -0.0067 -0.0035 67  ASP A CA  
561  C C   . ASP A 85  ? 0.1545 0.0949 0.0911 0.0161  -0.0063 -0.0030 67  ASP A C   
562  O O   . ASP A 85  ? 0.1614 0.0934 0.0935 0.0142  -0.0092 -0.0039 67  ASP A O   
563  C CB  . ASP A 85  ? 0.1715 0.1040 0.0928 0.0215  -0.0072 -0.0064 67  ASP A CB  
564  C CG  . ASP A 85  ? 0.1774 0.1111 0.0976 0.0273  -0.0024 -0.0066 67  ASP A CG  
565  O OD1 . ASP A 85  ? 0.1775 0.1187 0.1062 0.0273  0.0005  -0.0046 67  ASP A OD1 
566  O OD2 . ASP A 85  ? 0.1838 0.1112 0.0940 0.0320  -0.0019 -0.0092 67  ASP A OD2 
567  N N   . CYS A 86  ? 0.1440 0.0919 0.0879 0.0167  -0.0030 -0.0014 68  CYS A N   
568  C CA  . CYS A 86  ? 0.1423 0.0912 0.0898 0.0154  -0.0028 -0.0004 68  CYS A CA  
569  C C   . CYS A 86  ? 0.1447 0.0924 0.0905 0.0200  -0.0011 -0.0008 68  CYS A C   
570  O O   . CYS A 86  ? 0.1466 0.1002 0.0946 0.0231  0.0017  -0.0011 68  CYS A O   
571  C CB  . CYS A 86  ? 0.1325 0.0905 0.0880 0.0134  -0.0008 0.0009  68  CYS A CB  
572  S SG  . CYS A 86  ? 0.1460 0.1083 0.1052 0.0098  -0.0024 0.0018  68  CYS A SG  
573  N N   . GLY A 87  ? 0.1491 0.0901 0.0912 0.0207  -0.0029 -0.0005 69  GLY A N   
574  C CA  . GLY A 87  ? 0.1514 0.0906 0.0908 0.0270  -0.0020 -0.0009 69  GLY A CA  
575  C C   . GLY A 87  ? 0.1609 0.0952 0.0938 0.0320  -0.0011 -0.0034 69  GLY A C   
576  O O   . GLY A 87  ? 0.1604 0.1011 0.0947 0.0376  0.0018  -0.0038 69  GLY A O   
577  N N   . ALA A 88  ? 0.1685 0.0925 0.0941 0.0299  -0.0037 -0.0051 70  ALA A N   
578  C CA  . ALA A 88  ? 0.1775 0.0967 0.0948 0.0339  -0.0031 -0.0080 70  ALA A CA  
579  C C   . ALA A 88  ? 0.1937 0.1048 0.1027 0.0423  -0.0020 -0.0103 70  ALA A C   
580  O O   . ALA A 88  ? 0.1983 0.1096 0.1016 0.0476  0.0002  -0.0125 70  ALA A O   
581  C CB  . ALA A 88  ? 0.1859 0.0961 0.0970 0.0287  -0.0074 -0.0096 70  ALA A CB  
582  N N   . GLY A 89  ? 0.1972 0.1012 0.1047 0.0445  -0.0035 -0.0095 71  GLY A N   
583  C CA  . GLY A 89  ? 0.2179 0.1112 0.1159 0.0539  -0.0031 -0.0118 71  GLY A CA  
584  C C   . GLY A 89  ? 0.2335 0.1096 0.1171 0.0550  -0.0053 -0.0164 71  GLY A C   
585  O O   . GLY A 89  ? 0.2387 0.1042 0.1177 0.0470  -0.0098 -0.0172 71  GLY A O   
586  N N   . ILE A 90  ? 0.2434 0.1175 0.1195 0.0649  -0.0023 -0.0195 72  ILE A N   
587  C CA  . ILE A 90  ? 0.2677 0.1250 0.1277 0.0673  -0.0041 -0.0249 72  ILE A CA  
588  C C   . ILE A 90  ? 0.2604 0.1235 0.1189 0.0619  -0.0045 -0.0263 72  ILE A C   
589  O O   . ILE A 90  ? 0.2842 0.1333 0.1282 0.0626  -0.0071 -0.0311 72  ILE A O   
590  C CB  . ILE A 90  ? 0.2849 0.1369 0.1349 0.0816  -0.0003 -0.0286 72  ILE A CB  
591  C CG1 . ILE A 90  ? 0.2774 0.1530 0.1358 0.0870  0.0067  -0.0271 72  ILE A CG1 
592  C CG2 . ILE A 90  ? 0.2934 0.1375 0.1430 0.0885  -0.0008 -0.0272 72  ILE A CG2 
593  C CD1 . ILE A 90  ? 0.2980 0.1716 0.1464 0.1010  0.0113  -0.0309 72  ILE A CD1 
594  N N   . GLY A 91  ? 0.2406 0.1222 0.1122 0.0568  -0.0023 -0.0222 73  GLY A N   
595  C CA  . GLY A 91  ? 0.2352 0.1231 0.1062 0.0524  -0.0026 -0.0222 73  GLY A CA  
596  C C   . GLY A 91  ? 0.2327 0.1312 0.1015 0.0586  0.0032  -0.0221 73  GLY A C   
597  O O   . GLY A 91  ? 0.2436 0.1408 0.1043 0.0577  0.0025  -0.0235 73  GLY A O   
598  N N   . ARG A 92  ? 0.2234 0.1342 0.1001 0.0641  0.0090  -0.0199 74  ARG A N   
599  C CA  . ARG A 92  ? 0.2210 0.1457 0.0990 0.0685  0.0157  -0.0183 74  ARG A CA  
600  C C   . ARG A 92  ? 0.2122 0.1442 0.0939 0.0612  0.0159  -0.0149 74  ARG A C   
601  O O   . ARG A 92  ? 0.2201 0.1535 0.0932 0.0632  0.0183  -0.0149 74  ARG A O   
602  C CB  . ARG A 92  ? 0.2066 0.1475 0.0984 0.0716  0.0206  -0.0151 74  ARG A CB  
603  C CG  . ARG A 92  ? 0.2054 0.1628 0.0999 0.0756  0.0283  -0.0129 74  ARG A CG  
604  C CD  . ARG A 92  ? 0.1947 0.1699 0.1047 0.0768  0.0319  -0.0098 74  ARG A CD  
605  N NE  . ARG A 92  ? 0.1765 0.1578 0.0993 0.0667  0.0297  -0.0061 74  ARG A NE  
606  C CZ  . ARG A 92  ? 0.1682 0.1598 0.0982 0.0599  0.0326  -0.0023 74  ARG A CZ  
607  N NH1 . ARG A 92  ? 0.1735 0.1715 0.0999 0.0611  0.0380  -0.0006 74  ARG A NH1 
608  N NH2 . ARG A 92  ? 0.1540 0.1478 0.0936 0.0517  0.0300  -0.0001 74  ARG A NH2 
609  N N   . ILE A 93  ? 0.1979 0.1341 0.0912 0.0537  0.0135  -0.0118 75  ILE A N   
610  C CA  . ILE A 93  ? 0.1920 0.1341 0.0893 0.0480  0.0137  -0.0082 75  ILE A CA  
611  C C   . ILE A 93  ? 0.2010 0.1333 0.0889 0.0452  0.0078  -0.0101 75  ILE A C   
612  O O   . ILE A 93  ? 0.2047 0.1387 0.0876 0.0448  0.0081  -0.0085 75  ILE A O   
613  C CB  . ILE A 93  ? 0.1826 0.1321 0.0948 0.0420  0.0133  -0.0048 75  ILE A CB  
614  C CG1 . ILE A 93  ? 0.1780 0.1385 0.0995 0.0438  0.0180  -0.0033 75  ILE A CG1 
615  C CG2 . ILE A 93  ? 0.1818 0.1349 0.0966 0.0375  0.0137  -0.0013 75  ILE A CG2 
616  C CD1 . ILE A 93  ? 0.1675 0.1329 0.1010 0.0387  0.0166  -0.0016 75  ILE A CD1 
617  N N   . THR A 94  ? 0.2039 0.1264 0.0896 0.0428  0.0021  -0.0131 76  THR A N   
618  C CA  . THR A 94  ? 0.2172 0.1311 0.0942 0.0393  -0.0044 -0.0156 76  THR A CA  
619  C C   . THR A 94  ? 0.2365 0.1448 0.0974 0.0443  -0.0041 -0.0187 76  THR A C   
620  O O   . THR A 94  ? 0.2365 0.1460 0.0921 0.0425  -0.0069 -0.0181 76  THR A O   
621  C CB  . THR A 94  ? 0.2247 0.1282 0.1016 0.0351  -0.0099 -0.0182 76  THR A CB  
622  O OG1 . THR A 94  ? 0.2218 0.1335 0.1128 0.0295  -0.0104 -0.0144 76  THR A OG1 
623  C CG2 . THR A 94  ? 0.2366 0.1306 0.1037 0.0306  -0.0172 -0.0216 76  THR A CG2 
624  N N   . LYS A 95  ? 0.2470 0.1503 0.0998 0.0515  -0.0003 -0.0218 77  LYS A N   
625  C CA  . LYS A 95  ? 0.2732 0.1701 0.1084 0.0572  0.0002  -0.0257 77  LYS A CA  
626  C C   . LYS A 95  ? 0.2718 0.1803 0.1057 0.0590  0.0053  -0.0214 77  LYS A C   
627  O O   . LYS A 95  ? 0.2769 0.1822 0.0984 0.0592  0.0026  -0.0226 77  LYS A O   
628  C CB  . LYS A 95  ? 0.2927 0.1826 0.1197 0.0664  0.0043  -0.0299 77  LYS A CB  
629  C CG  . LYS A 95  ? 0.3274 0.2073 0.1330 0.0730  0.0044  -0.0356 77  LYS A CG  
630  C CD  . LYS A 95  ? 0.3543 0.2270 0.1518 0.0838  0.0088  -0.0400 77  LYS A CD  
631  C CE  . LYS A 95  ? 0.4010 0.2622 0.1759 0.0916  0.0094  -0.0466 77  LYS A CE  
632  N NZ  . LYS A 95  ? 0.4333 0.2723 0.1925 0.0874  0.0000  -0.0534 77  LYS A NZ  
633  N N   . ARG A 96  ? 0.2626 0.1842 0.1079 0.0605  0.0126  -0.0166 78  ARG A N   
634  C CA  . ARG A 96  ? 0.2749 0.2060 0.1168 0.0630  0.0190  -0.0126 78  ARG A CA  
635  C C   . ARG A 96  ? 0.2562 0.1938 0.1062 0.0567  0.0186  -0.0062 78  ARG A C   
636  O O   . ARG A 96  ? 0.2643 0.2044 0.1065 0.0578  0.0212  -0.0030 78  ARG A O   
637  C CB  . ARG A 96  ? 0.2851 0.2281 0.1343 0.0673  0.0278  -0.0102 78  ARG A CB  
638  C CG  A ARG A 96  ? 0.3063 0.2459 0.1499 0.0759  0.0301  -0.0155 78  ARG A CG  
639  C CG  B ARG A 96  ? 0.2922 0.2328 0.1411 0.0741  0.0292  -0.0149 78  ARG A CG  
640  C CD  A ARG A 96  ? 0.3380 0.2687 0.1610 0.0828  0.0306  -0.0203 78  ARG A CD  
641  C CD  B ARG A 96  ? 0.3126 0.2464 0.1429 0.0831  0.0315  -0.0198 78  ARG A CD  
642  N NE  A ARG A 96  ? 0.3555 0.2811 0.1723 0.0927  0.0330  -0.0259 78  ARG A NE  
643  C CZ  A ARG A 96  ? 0.3839 0.2980 0.1807 0.1004  0.0330  -0.0321 78  ARG A CZ  
644  N NH1 A ARG A 96  ? 0.3923 0.2995 0.1737 0.0986  0.0301  -0.0336 78  ARG A NH1 
645  N NH2 A ARG A 96  ? 0.3995 0.3076 0.1909 0.1104  0.0353  -0.0371 78  ARG A NH2 
646  N N   . LEU A 97  ? 0.2357 0.1752 0.0999 0.0508  0.0155  -0.0044 79  LEU A N   
647  C CA  . LEU A 97  ? 0.2238 0.1677 0.0957 0.0459  0.0150  0.0011  79  LEU A CA  
648  C C   . LEU A 97  ? 0.2196 0.1586 0.0901 0.0427  0.0069  0.0002  79  LEU A C   
649  O O   . LEU A 97  ? 0.2270 0.1662 0.0923 0.0426  0.0051  0.0033  79  LEU A O   
650  C CB  . LEU A 97  ? 0.2085 0.1590 0.0971 0.0420  0.0176  0.0036  79  LEU A CB  
651  C CG  . LEU A 97  ? 0.2051 0.1575 0.1010 0.0375  0.0173  0.0086  79  LEU A CG  
652  C CD1 . LEU A 97  ? 0.2172 0.1717 0.1080 0.0381  0.0225  0.0139  79  LEU A CD1 
653  C CD2 . LEU A 97  ? 0.1971 0.1538 0.1079 0.0336  0.0182  0.0089  79  LEU A CD2 
654  N N   . LEU A 98  ? 0.2126 0.1480 0.0880 0.0400  0.0019  -0.0034 80  LEU A N   
655  C CA  . LEU A 98  ? 0.2083 0.1437 0.0878 0.0355  -0.0050 -0.0031 80  LEU A CA  
656  C C   . LEU A 98  ? 0.2217 0.1517 0.0888 0.0353  -0.0121 -0.0066 80  LEU A C   
657  O O   . LEU A 98  ? 0.2210 0.1547 0.0874 0.0343  -0.0162 -0.0044 80  LEU A O   
658  C CB  . LEU A 98  ? 0.2022 0.1380 0.0932 0.0315  -0.0066 -0.0044 80  LEU A CB  
659  C CG  . LEU A 98  ? 0.1885 0.1306 0.0926 0.0305  -0.0016 -0.0013 80  LEU A CG  
660  C CD1 . LEU A 98  ? 0.1868 0.1284 0.0992 0.0271  -0.0036 -0.0029 80  LEU A CD1 
661  C CD2 . LEU A 98  ? 0.1868 0.1342 0.0969 0.0294  -0.0006 0.0031  80  LEU A CD2 
662  N N   . LEU A 99  ? 0.2306 0.1514 0.0876 0.0364  -0.0140 -0.0123 81  LEU A N   
663  C CA  . LEU A 99  ? 0.2483 0.1624 0.0918 0.0353  -0.0215 -0.0166 81  LEU A CA  
664  C C   . LEU A 99  ? 0.2608 0.1778 0.0928 0.0388  -0.0219 -0.0145 81  LEU A C   
665  O O   . LEU A 99  ? 0.2677 0.1860 0.0950 0.0363  -0.0296 -0.0152 81  LEU A O   
666  C CB  . LEU A 99  ? 0.2648 0.1645 0.0959 0.0368  -0.0230 -0.0237 81  LEU A CB  
667  C CG  . LEU A 99  ? 0.2634 0.1568 0.1019 0.0308  -0.0272 -0.0261 81  LEU A CG  
668  C CD1 . LEU A 99  ? 0.2790 0.1560 0.1055 0.0345  -0.0265 -0.0320 81  LEU A CD1 
669  C CD2 . LEU A 99  ? 0.2688 0.1638 0.1099 0.0225  -0.0362 -0.0268 81  LEU A CD2 
670  N N   . PRO A 100 ? 0.2658 0.1852 0.0934 0.0444  -0.0139 -0.0114 82  PRO A N   
671  C CA  . PRO A 100 ? 0.2791 0.2007 0.0947 0.0476  -0.0140 -0.0083 82  PRO A CA  
672  C C   . PRO A 100 ? 0.2746 0.2038 0.0980 0.0456  -0.0170 -0.0020 82  PRO A C   
673  O O   . PRO A 100 ? 0.2856 0.2157 0.0977 0.0479  -0.0202 0.0000  82  PRO A O   
674  C CB  . PRO A 100 ? 0.2824 0.2060 0.0935 0.0531  -0.0034 -0.0055 82  PRO A CB  
675  C CG  . PRO A 100 ? 0.2803 0.2000 0.0945 0.0544  -0.0003 -0.0106 82  PRO A CG  
676  C CD  . PRO A 100 ? 0.2642 0.1834 0.0934 0.0484  -0.0053 -0.0117 82  PRO A CD  
677  N N   . LEU A 101 ? 0.2603 0.1946 0.1013 0.0423  -0.0158 0.0010  83  LEU A N   
678  C CA  . LEU A 101 ? 0.2590 0.1996 0.1084 0.0420  -0.0168 0.0072  83  LEU A CA  
679  C C   . LEU A 101 ? 0.2496 0.1958 0.1095 0.0383  -0.0246 0.0062  83  LEU A C   
680  O O   . LEU A 101 ? 0.2514 0.2034 0.1147 0.0398  -0.0275 0.0106  83  LEU A O   
681  C CB  . LEU A 101 ? 0.2538 0.1959 0.1148 0.0416  -0.0087 0.0115  83  LEU A CB  
682  C CG  . LEU A 101 ? 0.2642 0.2047 0.1181 0.0444  -0.0002 0.0156  83  LEU A CG  
683  C CD1 . LEU A 101 ? 0.2578 0.2004 0.1249 0.0418  0.0063  0.0183  83  LEU A CD1 
684  C CD2 . LEU A 101 ? 0.2906 0.2300 0.1342 0.0475  -0.0010 0.0216  83  LEU A CD2 
685  N N   . PHE A 102 ? 0.2371 0.1821 0.1023 0.0337  -0.0276 0.0009  84  PHE A N   
686  C CA  . PHE A 102 ? 0.2260 0.1784 0.1035 0.0288  -0.0337 0.0004  84  PHE A CA  
687  C C   . PHE A 102 ? 0.2343 0.1844 0.1051 0.0243  -0.0420 -0.0050 84  PHE A C   
688  O O   . PHE A 102 ? 0.2415 0.1806 0.1013 0.0238  -0.0417 -0.0100 84  PHE A O   
689  C CB  . PHE A 102 ? 0.2122 0.1658 0.1042 0.0255  -0.0296 0.0003  84  PHE A CB  
690  C CG  . PHE A 102 ? 0.2047 0.1608 0.1041 0.0287  -0.0228 0.0051  84  PHE A CG  
691  C CD1 . PHE A 102 ? 0.2063 0.1569 0.1019 0.0311  -0.0157 0.0059  84  PHE A CD1 
692  C CD2 . PHE A 102 ? 0.2027 0.1665 0.1124 0.0294  -0.0236 0.0088  84  PHE A CD2 
693  C CE1 . PHE A 102 ? 0.2030 0.1547 0.1046 0.0325  -0.0100 0.0101  84  PHE A CE1 
694  C CE2 . PHE A 102 ? 0.2048 0.1674 0.1186 0.0324  -0.0176 0.0128  84  PHE A CE2 
695  C CZ  . PHE A 102 ? 0.2039 0.1597 0.1133 0.0332  -0.0111 0.0135  84  PHE A CZ  
696  N N   . ARG A 103 ? 0.2275 0.1879 0.1042 0.0212  -0.0495 -0.0041 85  ARG A N   
697  C CA  A ARG A 103 ? 0.2403 0.1994 0.1105 0.0154  -0.0586 -0.0092 85  ARG A CA  
698  C CA  B ARG A 103 ? 0.2403 0.1995 0.1104 0.0154  -0.0586 -0.0092 85  ARG A CA  
699  C C   . ARG A 103 ? 0.2392 0.1896 0.1120 0.0084  -0.0588 -0.0140 85  ARG A C   
700  O O   . ARG A 103 ? 0.2521 0.1903 0.1117 0.0052  -0.0633 -0.0201 85  ARG A O   
701  C CB  A ARG A 103 ? 0.2387 0.2149 0.1187 0.0127  -0.0666 -0.0067 85  ARG A CB  
702  C CB  B ARG A 103 ? 0.2391 0.2152 0.1187 0.0128  -0.0667 -0.0067 85  ARG A CB  
703  C CG  A ARG A 103 ? 0.2536 0.2309 0.1290 0.0045  -0.0771 -0.0120 85  ARG A CG  
704  C CG  B ARG A 103 ? 0.2471 0.2298 0.1198 0.0201  -0.0691 -0.0025 85  ARG A CG  
705  N N   . GLU A 104 ? 0.2227 0.1778 0.1108 0.0061  -0.0545 -0.0114 86  GLU A N   
706  C CA  . GLU A 104 ? 0.2283 0.1746 0.1193 0.0001  -0.0537 -0.0143 86  GLU A CA  
707  C C   . GLU A 104 ? 0.2126 0.1574 0.1107 0.0040  -0.0447 -0.0117 86  GLU A C   
708  O O   . GLU A 104 ? 0.1979 0.1519 0.1042 0.0084  -0.0402 -0.0072 86  GLU A O   
709  C CB  . GLU A 104 ? 0.2323 0.1889 0.1357 -0.0092 -0.0595 -0.0137 86  GLU A CB  
710  C CG  . GLU A 104 ? 0.2554 0.2160 0.1538 -0.0149 -0.0696 -0.0165 86  GLU A CG  
711  C CD  . GLU A 104 ? 0.2579 0.2312 0.1709 -0.0255 -0.0747 -0.0152 86  GLU A CD  
712  O OE1 . GLU A 104 ? 0.2513 0.2454 0.1784 -0.0249 -0.0757 -0.0108 86  GLU A OE1 
713  O OE2 . GLU A 104 ? 0.2756 0.2377 0.1850 -0.0344 -0.0778 -0.0186 86  GLU A OE2 
714  N N   . VAL A 105 ? 0.2124 0.1455 0.1080 0.0021  -0.0425 -0.0142 87  VAL A N   
715  C CA  . VAL A 105 ? 0.2015 0.1342 0.1043 0.0048  -0.0352 -0.0119 87  VAL A CA  
716  C C   . VAL A 105 ? 0.2009 0.1283 0.1080 -0.0014 -0.0364 -0.0126 87  VAL A C   
717  O O   . VAL A 105 ? 0.2158 0.1309 0.1137 -0.0054 -0.0410 -0.0164 87  VAL A O   
718  C CB  . VAL A 105 ? 0.2083 0.1315 0.1010 0.0123  -0.0296 -0.0136 87  VAL A CB  
719  C CG1 . VAL A 105 ? 0.2011 0.1253 0.1015 0.0146  -0.0231 -0.0115 87  VAL A CG1 
720  C CG2 . VAL A 105 ? 0.2118 0.1395 0.0987 0.0180  -0.0277 -0.0121 87  VAL A CG2 
721  N N   . ASP A 106 ? 0.1873 0.1219 0.1062 -0.0022 -0.0323 -0.0091 88  ASP A N   
722  C CA  . ASP A 106 ? 0.1912 0.1200 0.1127 -0.0070 -0.0320 -0.0087 88  ASP A CA  
723  C C   . ASP A 106 ? 0.1876 0.1104 0.1073 -0.0007 -0.0261 -0.0085 88  ASP A C   
724  O O   . ASP A 106 ? 0.1832 0.1135 0.1068 0.0047  -0.0215 -0.0069 88  ASP A O   
725  C CB  . ASP A 106 ? 0.1828 0.1263 0.1188 -0.0124 -0.0316 -0.0047 88  ASP A CB  
726  C CG  . ASP A 106 ? 0.1933 0.1445 0.1335 -0.0203 -0.0378 -0.0045 88  ASP A CG  
727  O OD1 . ASP A 106 ? 0.2063 0.1498 0.1376 -0.0234 -0.0435 -0.0078 88  ASP A OD1 
728  O OD2 . ASP A 106 ? 0.1854 0.1522 0.1385 -0.0234 -0.0366 -0.0009 88  ASP A OD2 
729  N N   . MET A 107 ? 0.1976 0.1073 0.1116 -0.0015 -0.0263 -0.0096 89  MET A N   
730  C CA  . MET A 107 ? 0.1974 0.1033 0.1106 0.0045  -0.0215 -0.0090 89  MET A CA  
731  C C   . MET A 107 ? 0.1964 0.1021 0.1153 0.0003  -0.0210 -0.0058 89  MET A C   
732  O O   . MET A 107 ? 0.2043 0.1032 0.1213 -0.0067 -0.0247 -0.0053 89  MET A O   
733  C CB  . MET A 107 ? 0.2213 0.1105 0.1205 0.0101  -0.0220 -0.0130 89  MET A CB  
734  C CG  . MET A 107 ? 0.2304 0.1202 0.1223 0.0153  -0.0214 -0.0161 89  MET A CG  
735  S SD  . MET A 107 ? 0.2644 0.1330 0.1372 0.0214  -0.0229 -0.0221 89  MET A SD  
736  C CE  . MET A 107 ? 0.2611 0.1300 0.1367 0.0304  -0.0168 -0.0205 89  MET A CE  
737  N N   . VAL A 108 ? 0.1802 0.0924 0.1047 0.0044  -0.0166 -0.0037 90  VAL A N   
738  C CA  . VAL A 108 ? 0.1783 0.0893 0.1054 0.0020  -0.0158 -0.0006 90  VAL A CA  
739  C C   . VAL A 108 ? 0.1784 0.0859 0.1026 0.0096  -0.0131 -0.0006 90  VAL A C   
740  O O   . VAL A 108 ? 0.1690 0.0857 0.0972 0.0149  -0.0099 -0.0013 90  VAL A O   
741  C CB  . VAL A 108 ? 0.1678 0.0941 0.1061 -0.0021 -0.0139 0.0025  90  VAL A CB  
742  C CG1 . VAL A 108 ? 0.1593 0.0981 0.1044 0.0018  -0.0105 0.0022  90  VAL A CG1 
743  C CG2 . VAL A 108 ? 0.1710 0.0954 0.1097 -0.0048 -0.0131 0.0060  90  VAL A CG2 
744  N N   . ASP A 109 ? 0.1907 0.0859 0.1088 0.0100  -0.0145 0.0005  91  ASP A N   
745  C CA  . ASP A 109 ? 0.1928 0.0861 0.1086 0.0182  -0.0126 0.0011  91  ASP A CA  
746  C C   . ASP A 109 ? 0.2043 0.0865 0.1151 0.0167  -0.0143 0.0045  91  ASP A C   
747  O O   . ASP A 109 ? 0.2145 0.0828 0.1189 0.0105  -0.0173 0.0053  91  ASP A O   
748  C CB  . ASP A 109 ? 0.2057 0.0890 0.1126 0.0263  -0.0126 -0.0027 91  ASP A CB  
749  C CG  . ASP A 109 ? 0.2037 0.0943 0.1130 0.0360  -0.0095 -0.0024 91  ASP A CG  
750  O OD1 . ASP A 109 ? 0.1914 0.0972 0.1081 0.0382  -0.0063 -0.0031 91  ASP A OD1 
751  O OD2 . ASP A 109 ? 0.2133 0.0942 0.1170 0.0412  -0.0105 -0.0012 91  ASP A OD2 
752  N N   . ILE A 110 ? 0.2033 0.0903 0.1159 0.0221  -0.0127 0.0068  92  ILE A N   
753  C CA  . ILE A 110 ? 0.2200 0.0958 0.1263 0.0219  -0.0144 0.0109  92  ILE A CA  
754  C C   . ILE A 110 ? 0.2395 0.0933 0.1329 0.0281  -0.0166 0.0103  92  ILE A C   
755  O O   . ILE A 110 ? 0.2471 0.0860 0.1328 0.0262  -0.0186 0.0140  92  ILE A O   
756  C CB  . ILE A 110 ? 0.2215 0.1111 0.1334 0.0257  -0.0127 0.0139  92  ILE A CB  
757  C CG1 . ILE A 110 ? 0.2456 0.1295 0.1533 0.0210  -0.0137 0.0193  92  ILE A CG1 
758  C CG2 . ILE A 110 ? 0.2219 0.1146 0.1335 0.0369  -0.0123 0.0124  92  ILE A CG2 
759  C CD1 . ILE A 110 ? 0.2514 0.1500 0.1636 0.0239  -0.0126 0.0217  92  ILE A CD1 
760  N N   . THR A 111 ? 0.2402 0.0913 0.1306 0.0358  -0.0160 0.0057  93  THR A N   
761  C CA  . THR A 111 ? 0.2640 0.0958 0.1421 0.0451  -0.0174 0.0044  93  THR A CA  
762  C C   . THR A 111 ? 0.2911 0.1009 0.1572 0.0416  -0.0202 0.0004  93  THR A C   
763  O O   . THR A 111 ? 0.2838 0.0966 0.1493 0.0428  -0.0195 -0.0045 93  THR A O   
764  C CB  . THR A 111 ? 0.2581 0.1015 0.1394 0.0580  -0.0145 0.0020  93  THR A CB  
765  O OG1 . THR A 111 ? 0.2396 0.1030 0.1317 0.0602  -0.0130 0.0057  93  THR A OG1 
766  C CG2 . THR A 111 ? 0.2804 0.1042 0.1488 0.0695  -0.0155 0.0007  93  THR A CG2 
767  N N   . GLU A 112 ? 0.3202 0.1080 0.1763 0.0365  -0.0236 0.0026  94  GLU A N   
768  C CA  A GLU A 112 ? 0.3518 0.1176 0.1964 0.0300  -0.0274 -0.0011 94  GLU A CA  
769  C CA  B GLU A 112 ? 0.3440 0.1110 0.1892 0.0298  -0.0273 -0.0012 94  GLU A CA  
770  C C   . GLU A 112 ? 0.3625 0.1166 0.1962 0.0411  -0.0272 -0.0080 94  GLU A C   
771  O O   . GLU A 112 ? 0.3587 0.1087 0.1880 0.0373  -0.0289 -0.0135 94  GLU A O   
772  C CB  A GLU A 112 ? 0.3958 0.1357 0.2292 0.0240  -0.0309 0.0029  94  GLU A CB  
773  C CB  B GLU A 112 ? 0.3725 0.1155 0.2079 0.0213  -0.0310 0.0027  94  GLU A CB  
774  C CG  A GLU A 112 ? 0.4441 0.1585 0.2646 0.0155  -0.0357 -0.0011 94  GLU A CG  
775  C CG  B GLU A 112 ? 0.3987 0.1206 0.2237 0.0113  -0.0358 -0.0013 94  GLU A CG  
776  C CD  A GLU A 112 ? 0.4885 0.1777 0.2990 0.0072  -0.0389 0.0041  94  GLU A CD  
777  C CD  B GLU A 112 ? 0.3864 0.1263 0.2226 -0.0019 -0.0369 -0.0020 94  GLU A CD  
778  O OE1 A GLU A 112 ? 0.5177 0.2078 0.3297 0.0087  -0.0372 0.0113  94  GLU A OE1 
779  O OE1 B GLU A 112 ? 0.3888 0.1336 0.2247 -0.0009 -0.0379 -0.0081 94  GLU A OE1 
780  O OE2 A GLU A 112 ? 0.5378 0.2059 0.3383 -0.0016 -0.0432 0.0013  94  GLU A OE2 
781  O OE2 B GLU A 112 ? 0.3845 0.1342 0.2296 -0.0128 -0.0367 0.0037  94  GLU A OE2 
782  N N   . ASP A 113 ? 0.3692 0.1188 0.1983 0.0552  -0.0253 -0.0078 95  ASP A N   
783  C CA  . ASP A 113 ? 0.3953 0.1331 0.2127 0.0678  -0.0243 -0.0145 95  ASP A CA  
784  C C   . ASP A 113 ? 0.3668 0.1250 0.1908 0.0698  -0.0210 -0.0191 95  ASP A C   
785  O O   . ASP A 113 ? 0.3750 0.1217 0.1873 0.0743  -0.0213 -0.0256 95  ASP A O   
786  C CB  . ASP A 113 ? 0.4178 0.1529 0.2319 0.0844  -0.0221 -0.0129 95  ASP A CB  
787  C CG  . ASP A 113 ? 0.4681 0.1738 0.2687 0.0864  -0.0257 -0.0095 95  ASP A CG  
788  O OD1 . ASP A 113 ? 0.5075 0.1893 0.2980 0.0751  -0.0299 -0.0091 95  ASP A OD1 
789  O OD2 . ASP A 113 ? 0.4888 0.1947 0.2882 0.1000  -0.0244 -0.0068 95  ASP A OD2 
790  N N   . PHE A 114 ? 0.3282 0.1152 0.1694 0.0660  -0.0181 -0.0159 96  PHE A N   
791  C CA  . PHE A 114 ? 0.3094 0.1152 0.1568 0.0665  -0.0148 -0.0191 96  PHE A CA  
792  C C   . PHE A 114 ? 0.3122 0.1122 0.1556 0.0553  -0.0183 -0.0221 96  PHE A C   
793  O O   . PHE A 114 ? 0.3092 0.1097 0.1467 0.0580  -0.0175 -0.0268 96  PHE A O   
794  C CB  . PHE A 114 ? 0.2771 0.1125 0.1430 0.0653  -0.0110 -0.0148 96  PHE A CB  
795  C CG  . PHE A 114 ? 0.2720 0.1180 0.1435 0.0758  -0.0080 -0.0123 96  PHE A CG  
796  C CD1 . PHE A 114 ? 0.2873 0.1222 0.1492 0.0893  -0.0071 -0.0143 96  PHE A CD1 
797  C CD2 . PHE A 114 ? 0.2462 0.1145 0.1329 0.0729  -0.0063 -0.0080 96  PHE A CD2 
798  C CE1 . PHE A 114 ? 0.2845 0.1337 0.1537 0.0995  -0.0046 -0.0117 96  PHE A CE1 
799  C CE2 . PHE A 114 ? 0.2443 0.1252 0.1372 0.0818  -0.0044 -0.0058 96  PHE A CE2 
800  C CZ  . PHE A 114 ? 0.2598 0.1328 0.1451 0.0951  -0.0037 -0.0072 96  PHE A CZ  
801  N N   . LEU A 115 ? 0.3133 0.1104 0.1605 0.0427  -0.0221 -0.0190 97  LEU A N   
802  C CA  . LEU A 115 ? 0.3204 0.1147 0.1656 0.0316  -0.0262 -0.0213 97  LEU A CA  
803  C C   . LEU A 115 ? 0.3512 0.1176 0.1770 0.0322  -0.0307 -0.0275 97  LEU A C   
804  O O   . LEU A 115 ? 0.3595 0.1248 0.1799 0.0286  -0.0333 -0.0321 97  LEU A O   
805  C CB  . LEU A 115 ? 0.3191 0.1189 0.1740 0.0184  -0.0286 -0.0161 97  LEU A CB  
806  C CG  . LEU A 115 ? 0.2989 0.1256 0.1711 0.0177  -0.0245 -0.0115 97  LEU A CG  
807  C CD1 . LEU A 115 ? 0.3086 0.1399 0.1887 0.0060  -0.0262 -0.0065 97  LEU A CD1 
808  C CD2 . LEU A 115 ? 0.2844 0.1294 0.1636 0.0189  -0.0223 -0.0133 97  LEU A CD2 
809  N N   . VAL A 116 ? 0.3687 0.1121 0.1833 0.0369  -0.0318 -0.0278 98  VAL A N   
810  C CA  . VAL A 116 ? 0.4052 0.1184 0.1987 0.0395  -0.0358 -0.0347 98  VAL A CA  
811  C C   . VAL A 116 ? 0.4085 0.1249 0.1942 0.0527  -0.0322 -0.0410 98  VAL A C   
812  O O   . VAL A 116 ? 0.4193 0.1250 0.1925 0.0508  -0.0354 -0.0476 98  VAL A O   
813  C CB  . VAL A 116 ? 0.4334 0.1192 0.2152 0.0440  -0.0373 -0.0333 98  VAL A CB  
814  C CG1 . VAL A 116 ? 0.4749 0.1262 0.2329 0.0474  -0.0414 -0.0414 98  VAL A CG1 
815  C CG2 . VAL A 116 ? 0.4350 0.1166 0.2228 0.0297  -0.0405 -0.0265 98  VAL A CG2 
816  N N   . GLN A 117 ? 0.3923 0.1243 0.1851 0.0655  -0.0258 -0.0389 99  GLN A N   
817  C CA  . GLN A 117 ? 0.3978 0.1370 0.1850 0.0778  -0.0211 -0.0439 99  GLN A CA  
818  C C   . GLN A 117 ? 0.3790 0.1352 0.1703 0.0716  -0.0208 -0.0455 99  GLN A C   
819  O O   . GLN A 117 ? 0.3875 0.1376 0.1655 0.0768  -0.0203 -0.0517 99  GLN A O   
820  C CB  . GLN A 117 ? 0.3927 0.1506 0.1899 0.0909  -0.0142 -0.0405 99  GLN A CB  
821  C CG  . GLN A 117 ? 0.4136 0.1765 0.2030 0.1051  -0.0087 -0.0456 99  GLN A CG  
822  C CD  . GLN A 117 ? 0.4604 0.1923 0.2269 0.1154  -0.0103 -0.0527 99  GLN A CD  
823  O OE1 . GLN A 117 ? 0.5063 0.2164 0.2658 0.1178  -0.0135 -0.0519 99  GLN A OE1 
824  N NE2 . GLN A 117 ? 0.4835 0.2113 0.2364 0.1224  -0.0081 -0.0594 99  GLN A NE2 
825  N N   . ALA A 118 ? 0.3512 0.1274 0.1595 0.0609  -0.0212 -0.0400 100 ALA A N   
826  C CA  . ALA A 118 ? 0.3396 0.1319 0.1527 0.0549  -0.0214 -0.0403 100 ALA A CA  
827  C C   . ALA A 118 ? 0.3638 0.1395 0.1608 0.0501  -0.0274 -0.0467 100 ALA A C   
828  O O   . ALA A 118 ? 0.3619 0.1454 0.1546 0.0516  -0.0267 -0.0492 100 ALA A O   
829  C CB  . ALA A 118 ? 0.3116 0.1220 0.1431 0.0436  -0.0224 -0.0340 100 ALA A CB  
830  N N   . LYS A 119 ? 0.3895 0.1424 0.1774 0.0434  -0.0337 -0.0490 101 LYS A N   
831  C CA  . LYS A 119 ? 0.4214 0.1590 0.1945 0.0367  -0.0407 -0.0554 101 LYS A CA  
832  C C   . LYS A 119 ? 0.4413 0.1667 0.1943 0.0494  -0.0385 -0.0633 101 LYS A C   
833  O O   . LYS A 119 ? 0.4563 0.1816 0.1992 0.0473  -0.0417 -0.0682 101 LYS A O   
834  C CB  . LYS A 119 ? 0.4510 0.1642 0.2176 0.0257  -0.0480 -0.0563 101 LYS A CB  
835  C CG  . LYS A 119 ? 0.4397 0.1695 0.2267 0.0128  -0.0492 -0.0482 101 LYS A CG  
836  N N   . THR A 120 ? 0.4460 0.1633 0.1934 0.0631  -0.0331 -0.0643 102 THR A N   
837  C CA  . THR A 120 ? 0.4685 0.1782 0.1987 0.0771  -0.0292 -0.0711 102 THR A CA  
838  C C   . THR A 120 ? 0.4428 0.1826 0.1827 0.0835  -0.0215 -0.0681 102 THR A C   
839  O O   . THR A 120 ? 0.4478 0.1895 0.1759 0.0863  -0.0209 -0.0726 102 THR A O   
840  C CB  . THR A 120 ? 0.4943 0.1837 0.2143 0.0906  -0.0263 -0.0735 102 THR A CB  
841  O OG1 . THR A 120 ? 0.5227 0.1795 0.2295 0.0838  -0.0340 -0.0768 102 THR A OG1 
842  C CG2 . THR A 120 ? 0.5218 0.2050 0.2238 0.1068  -0.0213 -0.0809 102 THR A CG2 
843  N N   . TYR A 121 ? 0.4118 0.1738 0.1718 0.0852  -0.0159 -0.0606 103 TYR A N   
844  C CA  . TYR A 121 ? 0.3939 0.1839 0.1649 0.0902  -0.0082 -0.0567 103 TYR A CA  
845  C C   . TYR A 121 ? 0.3876 0.1889 0.1591 0.0821  -0.0101 -0.0560 103 TYR A C   
846  O O   . TYR A 121 ? 0.3813 0.1932 0.1473 0.0880  -0.0052 -0.0567 103 TYR A O   
847  C CB  . TYR A 121 ? 0.3698 0.1798 0.1634 0.0888  -0.0044 -0.0487 103 TYR A CB  
848  C CG  . TYR A 121 ? 0.3525 0.1896 0.1585 0.0918  0.0029  -0.0442 103 TYR A CG  
849  C CD1 . TYR A 121 ? 0.3680 0.2137 0.1703 0.1047  0.0105  -0.0455 103 TYR A CD1 
850  C CD2 . TYR A 121 ? 0.3331 0.1872 0.1534 0.0820  0.0027  -0.0388 103 TYR A CD2 
851  C CE1 . TYR A 121 ? 0.3528 0.2237 0.1665 0.1057  0.0175  -0.0408 103 TYR A CE1 
852  C CE2 . TYR A 121 ? 0.3200 0.1966 0.1506 0.0838  0.0094  -0.0345 103 TYR A CE2 
853  C CZ  . TYR A 121 ? 0.3355 0.2202 0.1627 0.0949  0.0167  -0.0354 103 TYR A CZ  
854  O OH  . TYR A 121 ? 0.3417 0.2482 0.1787 0.0949  0.0234  -0.0306 103 TYR A OH  
855  N N   . LEU A 122 ? 0.3795 0.1785 0.1564 0.0689  -0.0174 -0.0544 104 LEU A N   
856  C CA  . LEU A 122 ? 0.3761 0.1878 0.1557 0.0615  -0.0199 -0.0527 104 LEU A CA  
857  C C   . LEU A 122 ? 0.4083 0.2068 0.1665 0.0620  -0.0247 -0.0599 104 LEU A C   
858  O O   . LEU A 122 ? 0.4040 0.2138 0.1612 0.0592  -0.0258 -0.0585 104 LEU A O   
859  C CB  . LEU A 122 ? 0.3602 0.1785 0.1549 0.0484  -0.0255 -0.0481 104 LEU A CB  
860  C CG  . LEU A 122 ? 0.3425 0.1759 0.1575 0.0475  -0.0208 -0.0411 104 LEU A CG  
861  C CD1 . LEU A 122 ? 0.3368 0.1741 0.1636 0.0351  -0.0265 -0.0377 104 LEU A CD1 
862  C CD2 . LEU A 122 ? 0.3300 0.1845 0.1541 0.0518  -0.0138 -0.0366 104 LEU A CD2 
863  N N   . GLY A 123 ? 0.4422 0.2158 0.1824 0.0650  -0.0282 -0.0674 105 GLY A N   
864  C CA  . GLY A 123 ? 0.4786 0.2374 0.1957 0.0656  -0.0334 -0.0756 105 GLY A CA  
865  C C   . GLY A 123 ? 0.4819 0.2439 0.2008 0.0516  -0.0431 -0.0754 105 GLY A C   
866  O O   . GLY A 123 ? 0.4589 0.2259 0.1934 0.0406  -0.0474 -0.0711 105 GLY A O   
867  N N   . GLU A 124 ? 0.5014 0.2632 0.2047 0.0528  -0.0461 -0.0797 106 GLU A N   
868  C CA  . GLU A 124 ? 0.5200 0.2841 0.2215 0.0410  -0.0564 -0.0809 106 GLU A CA  
869  C C   . GLU A 124 ? 0.4702 0.2612 0.1960 0.0337  -0.0565 -0.0713 106 GLU A C   
870  O O   . GLU A 124 ? 0.4546 0.2491 0.1891 0.0220  -0.0645 -0.0701 106 GLU A O   
871  C CB  . GLU A 124 ? 0.5657 0.3279 0.2450 0.0466  -0.0580 -0.0864 106 GLU A CB  
872  C CG  . GLU A 124 ? 0.6114 0.3748 0.2854 0.0352  -0.0703 -0.0890 106 GLU A CG  
873  C CD  . GLU A 124 ? 0.6672 0.4061 0.3310 0.0250  -0.0809 -0.0972 106 GLU A CD  
874  O OE1 . GLU A 124 ? 0.7129 0.4282 0.3678 0.0284  -0.0789 -0.1022 106 GLU A OE1 
875  O OE2 . GLU A 124 ? 0.7210 0.4640 0.3856 0.0130  -0.0918 -0.0985 106 GLU A OE2 
876  N N   . GLU A 125 ? 0.4409 0.2498 0.1768 0.0410  -0.0473 -0.0647 107 GLU A N   
877  C CA  . GLU A 125 ? 0.4118 0.2436 0.1690 0.0362  -0.0463 -0.0557 107 GLU A CA  
878  C C   . GLU A 125 ? 0.3808 0.2150 0.1575 0.0283  -0.0475 -0.0520 107 GLU A C   
879  O O   . GLU A 125 ? 0.3525 0.2015 0.1450 0.0214  -0.0500 -0.0467 107 GLU A O   
880  C CB  . GLU A 125 ? 0.4030 0.2497 0.1658 0.0452  -0.0356 -0.0497 107 GLU A CB  
881  C CG  . GLU A 125 ? 0.4371 0.2852 0.1816 0.0518  -0.0341 -0.0513 107 GLU A CG  
882  C CD  . GLU A 125 ? 0.4442 0.2995 0.1862 0.0458  -0.0425 -0.0499 107 GLU A CD  
883  O OE1 . GLU A 125 ? 0.4289 0.3004 0.1857 0.0433  -0.0418 -0.0421 107 GLU A OE1 
884  O OE2 . GLU A 125 ? 0.4864 0.3308 0.2110 0.0438  -0.0506 -0.0568 107 GLU A OE2 
885  N N   . GLY A 126 ? 0.3800 0.1997 0.1548 0.0303  -0.0452 -0.0546 108 GLY A N   
886  C CA  . GLY A 126 ? 0.3630 0.1820 0.1529 0.0232  -0.0463 -0.0512 108 GLY A CA  
887  C C   . GLY A 126 ? 0.3660 0.1815 0.1586 0.0097  -0.0561 -0.0523 108 GLY A C   
888  O O   . GLY A 126 ? 0.3490 0.1702 0.1570 0.0024  -0.0566 -0.0477 108 GLY A O   
889  N N   . LYS A 127 ? 0.3792 0.1883 0.1577 0.0062  -0.0637 -0.0579 109 LYS A N   
890  C CA  . LYS A 127 ? 0.3888 0.1988 0.1713 -0.0076 -0.0738 -0.0587 109 LYS A CA  
891  C C   . LYS A 127 ? 0.3591 0.1976 0.1639 -0.0124 -0.0739 -0.0508 109 LYS A C   
892  O O   . LYS A 127 ? 0.3586 0.2039 0.1743 -0.0241 -0.0800 -0.0490 109 LYS A O   
893  C CB  . LYS A 127 ? 0.4214 0.2195 0.1837 -0.0102 -0.0823 -0.0667 109 LYS A CB  
894  C CG  . LYS A 127 ? 0.4628 0.2286 0.2033 -0.0075 -0.0834 -0.0752 109 LYS A CG  
895  N N   . ARG A 128 ? 0.3313 0.1854 0.1428 -0.0036 -0.0669 -0.0459 110 ARG A N   
896  C CA  . ARG A 128 ? 0.3054 0.1837 0.1368 -0.0061 -0.0660 -0.0385 110 ARG A CA  
897  C C   . ARG A 128 ? 0.2834 0.1686 0.1324 -0.0062 -0.0592 -0.0328 110 ARG A C   
898  O O   . ARG A 128 ? 0.2652 0.1691 0.1303 -0.0074 -0.0577 -0.0271 110 ARG A O   
899  C CB  . ARG A 128 ? 0.2995 0.1900 0.1280 0.0017  -0.0637 -0.0358 110 ARG A CB  
900  C CG  . ARG A 128 ? 0.3187 0.2067 0.1314 0.0004  -0.0723 -0.0404 110 ARG A CG  
901  C CD  . ARG A 128 ? 0.3164 0.2159 0.1248 0.0081  -0.0705 -0.0368 110 ARG A CD  
902  N NE  . ARG A 128 ? 0.3181 0.2108 0.1161 0.0184  -0.0612 -0.0365 110 ARG A NE  
903  C CZ  . ARG A 128 ? 0.3027 0.2038 0.1113 0.0237  -0.0520 -0.0301 110 ARG A CZ  
904  N NH1 . ARG A 128 ? 0.2790 0.1935 0.1071 0.0210  -0.0508 -0.0240 110 ARG A NH1 
905  N NH2 . ARG A 128 ? 0.3092 0.2054 0.1079 0.0319  -0.0441 -0.0302 110 ARG A NH2 
906  N N   . VAL A 129 ? 0.2834 0.1538 0.1288 -0.0045 -0.0554 -0.0345 111 VAL A N   
907  C CA  . VAL A 129 ? 0.2714 0.1473 0.1322 -0.0068 -0.0509 -0.0295 111 VAL A CA  
908  C C   . VAL A 129 ? 0.2755 0.1525 0.1432 -0.0192 -0.0573 -0.0288 111 VAL A C   
909  O O   . VAL A 129 ? 0.3042 0.1646 0.1606 -0.0255 -0.0637 -0.0336 111 VAL A O   
910  C CB  . VAL A 129 ? 0.2755 0.1369 0.1307 -0.0006 -0.0454 -0.0307 111 VAL A CB  
911  C CG1 . VAL A 129 ? 0.2624 0.1287 0.1316 -0.0038 -0.0421 -0.0256 111 VAL A CG1 
912  C CG2 . VAL A 129 ? 0.2735 0.1393 0.1250 0.0107  -0.0385 -0.0304 111 VAL A CG2 
913  N N   . ARG A 130 ? 0.2550 0.1508 0.1403 -0.0230 -0.0560 -0.0232 112 ARG A N   
914  C CA  . ARG A 130 ? 0.2638 0.1664 0.1581 -0.0349 -0.0614 -0.0216 112 ARG A CA  
915  C C   . ARG A 130 ? 0.2622 0.1553 0.1598 -0.0394 -0.0584 -0.0192 112 ARG A C   
916  O O   . ARG A 130 ? 0.2864 0.1596 0.1736 -0.0449 -0.0619 -0.0222 112 ARG A O   
917  C CB  . ARG A 130 ? 0.2507 0.1796 0.1613 -0.0351 -0.0613 -0.0170 112 ARG A CB  
918  C CG  . ARG A 130 ? 0.2572 0.1998 0.1809 -0.0468 -0.0656 -0.0142 112 ARG A CG  
919  C CD  . ARG A 130 ? 0.2491 0.2182 0.1882 -0.0437 -0.0647 -0.0098 112 ARG A CD  
920  N NE  . ARG A 130 ? 0.2380 0.2139 0.1854 -0.0360 -0.0561 -0.0059 112 ARG A NE  
921  C CZ  . ARG A 130 ? 0.2396 0.2361 0.2004 -0.0323 -0.0538 -0.0019 112 ARG A CZ  
922  N NH1 . ARG A 130 ? 0.2523 0.2656 0.2197 -0.0342 -0.0595 -0.0010 112 ARG A NH1 
923  N NH2 . ARG A 130 ? 0.2344 0.2340 0.2010 -0.0263 -0.0463 0.0007  112 ARG A NH2 
924  N N   . ASN A 131 ? 0.2416 0.1459 0.1510 -0.0357 -0.0516 -0.0143 113 ASN A N   
925  C CA  . ASN A 131 ? 0.2395 0.1377 0.1521 -0.0391 -0.0485 -0.0111 113 ASN A CA  
926  C C   . ASN A 131 ? 0.2390 0.1242 0.1438 -0.0289 -0.0429 -0.0119 113 ASN A C   
927  O O   . ASN A 131 ? 0.2231 0.1167 0.1305 -0.0198 -0.0382 -0.0116 113 ASN A O   
928  C CB  . ASN A 131 ? 0.2200 0.1404 0.1500 -0.0411 -0.0446 -0.0053 113 ASN A CB  
929  C CG  . ASN A 131 ? 0.2212 0.1590 0.1618 -0.0506 -0.0494 -0.0037 113 ASN A CG  
930  O OD1 . ASN A 131 ? 0.2377 0.1691 0.1764 -0.0614 -0.0544 -0.0040 113 ASN A OD1 
931  N ND2 . ASN A 131 ? 0.2035 0.1632 0.1561 -0.0470 -0.0476 -0.0013 113 ASN A ND2 
932  N N   . TYR A 132 ? 0.2603 0.1252 0.1557 -0.0308 -0.0438 -0.0126 114 TYR A N   
933  C CA  . TYR A 132 ? 0.2651 0.1203 0.1557 -0.0217 -0.0387 -0.0120 114 TYR A CA  
934  C C   . TYR A 132 ? 0.2537 0.1117 0.1519 -0.0263 -0.0364 -0.0061 114 TYR A C   
935  O O   . TYR A 132 ? 0.2770 0.1218 0.1708 -0.0347 -0.0394 -0.0046 114 TYR A O   
936  C CB  . TYR A 132 ? 0.2974 0.1256 0.1702 -0.0185 -0.0414 -0.0167 114 TYR A CB  
937  C CG  . TYR A 132 ? 0.3179 0.1395 0.1790 -0.0124 -0.0432 -0.0232 114 TYR A CG  
938  C CD1 . TYR A 132 ? 0.3439 0.1582 0.1972 -0.0198 -0.0501 -0.0275 114 TYR A CD1 
939  C CD2 . TYR A 132 ? 0.3261 0.1484 0.1829 0.0004  -0.0380 -0.0250 114 TYR A CD2 
940  C CE1 . TYR A 132 ? 0.3631 0.1697 0.2027 -0.0135 -0.0517 -0.0339 114 TYR A CE1 
941  C CE2 . TYR A 132 ? 0.3447 0.1602 0.1891 0.0065  -0.0388 -0.0307 114 TYR A CE2 
942  C CZ  . TYR A 132 ? 0.3578 0.1652 0.1931 0.0000  -0.0454 -0.0351 114 TYR A CZ  
943  O OH  . TYR A 132 ? 0.3976 0.1986 0.2186 0.0068  -0.0460 -0.0410 114 TYR A OH  
944  N N   . PHE A 133 ? 0.2335 0.1086 0.1425 -0.0221 -0.0312 -0.0028 115 PHE A N   
945  C CA  . PHE A 133 ? 0.2283 0.1093 0.1443 -0.0258 -0.0285 0.0026  115 PHE A CA  
946  C C   . PHE A 133 ? 0.2299 0.1005 0.1397 -0.0178 -0.0256 0.0036  115 PHE A C   
947  O O   . PHE A 133 ? 0.2213 0.0987 0.1329 -0.0086 -0.0223 0.0022  115 PHE A O   
948  C CB  . PHE A 133 ? 0.2057 0.1107 0.1357 -0.0254 -0.0248 0.0051  115 PHE A CB  
949  C CG  . PHE A 133 ? 0.2001 0.1197 0.1387 -0.0321 -0.0272 0.0052  115 PHE A CG  
950  C CD1 . PHE A 133 ? 0.2106 0.1344 0.1541 -0.0429 -0.0293 0.0084  115 PHE A CD1 
951  C CD2 . PHE A 133 ? 0.1909 0.1224 0.1341 -0.0275 -0.0271 0.0031  115 PHE A CD2 
952  C CE1 . PHE A 133 ? 0.2029 0.1436 0.1562 -0.0486 -0.0315 0.0090  115 PHE A CE1 
953  C CE2 . PHE A 133 ? 0.1876 0.1343 0.1395 -0.0325 -0.0296 0.0039  115 PHE A CE2 
954  C CZ  . PHE A 133 ? 0.1914 0.1438 0.1489 -0.0425 -0.0318 0.0066  115 PHE A CZ  
955  N N   . CYS A 134 ? 0.2463 0.1017 0.1494 -0.0215 -0.0268 0.0066  116 CYS A N   
956  C CA  . CYS A 134 ? 0.2557 0.1024 0.1531 -0.0130 -0.0245 0.0085  116 CYS A CA  
957  C C   . CYS A 134 ? 0.2455 0.1046 0.1503 -0.0157 -0.0214 0.0145  116 CYS A C   
958  O O   . CYS A 134 ? 0.2572 0.1100 0.1598 -0.0236 -0.0222 0.0191  116 CYS A O   
959  C CB  . CYS A 134 ? 0.2878 0.1072 0.1703 -0.0123 -0.0278 0.0079  116 CYS A CB  
960  S SG  . CYS A 134 ? 0.3028 0.1129 0.1785 0.0004  -0.0255 0.0105  116 CYS A SG  
961  N N   A CYS A 135 ? 0.2267 0.1029 0.1394 -0.0097 -0.0179 0.0143  117 CYS A N   
962  N N   B CYS A 135 ? 0.2263 0.1030 0.1393 -0.0100 -0.0178 0.0145  117 CYS A N   
963  C CA  A CYS A 135 ? 0.2184 0.1091 0.1382 -0.0119 -0.0148 0.0184  117 CYS A CA  
964  C CA  B CYS A 135 ? 0.2201 0.1066 0.1371 -0.0107 -0.0150 0.0192  117 CYS A CA  
965  C C   A CYS A 135 ? 0.2030 0.1062 0.1275 -0.0033 -0.0120 0.0168  117 CYS A C   
966  C C   B CYS A 135 ? 0.2035 0.1052 0.1271 -0.0031 -0.0122 0.0170  117 CYS A C   
967  O O   A CYS A 135 ? 0.1990 0.1061 0.1259 0.0014  -0.0117 0.0127  117 CYS A O   
968  O O   B CYS A 135 ? 0.1975 0.1033 0.1238 0.0009  -0.0119 0.0128  117 CYS A O   
969  C CB  A CYS A 135 ? 0.2099 0.1153 0.1394 -0.0200 -0.0143 0.0185  117 CYS A CB  
970  C CB  B CYS A 135 ? 0.2150 0.1140 0.1397 -0.0204 -0.0137 0.0222  117 CYS A CB  
971  S SG  A CYS A 135 ? 0.2044 0.1277 0.1419 -0.0243 -0.0101 0.0233  117 CYS A SG  
972  S SG  B CYS A 135 ? 0.1943 0.1147 0.1316 -0.0198 -0.0120 0.0182  117 CYS A SG  
973  N N   . GLY A 136 ? 0.1991 0.1088 0.1245 -0.0020 -0.0101 0.0201  118 GLY A N   
974  C CA  . GLY A 136 ? 0.1862 0.1099 0.1175 0.0033  -0.0080 0.0180  118 GLY A CA  
975  C C   . GLY A 136 ? 0.1705 0.1087 0.1109 0.0000  -0.0058 0.0161  118 GLY A C   
976  O O   . GLY A 136 ? 0.1797 0.1221 0.1229 -0.0062 -0.0050 0.0179  118 GLY A O   
977  N N   . LEU A 137 ? 0.1564 0.1030 0.1017 0.0042  -0.0045 0.0127  119 LEU A N   
978  C CA  . LEU A 137 ? 0.1486 0.1065 0.1013 0.0023  -0.0024 0.0108  119 LEU A CA  
979  C C   . LEU A 137 ? 0.1455 0.1115 0.0998 -0.0003 -0.0002 0.0127  119 LEU A C   
980  O O   . LEU A 137 ? 0.1404 0.1137 0.0994 -0.0030 0.0013  0.0128  119 LEU A O   
981  C CB  . LEU A 137 ? 0.1411 0.1043 0.0974 0.0065  -0.0012 0.0076  119 LEU A CB  
982  C CG  . LEU A 137 ? 0.1491 0.1070 0.1038 0.0099  -0.0021 0.0057  119 LEU A CG  
983  C CD1 . LEU A 137 ? 0.1460 0.1107 0.1052 0.0123  -0.0001 0.0035  119 LEU A CD1 
984  C CD2 . LEU A 137 ? 0.1545 0.1066 0.1073 0.0075  -0.0037 0.0053  119 LEU A CD2 
985  N N   . GLN A 138 ? 0.1519 0.1171 0.1017 0.0012  -0.0002 0.0145  120 GLN A N   
986  C CA  . GLN A 138 ? 0.1525 0.1251 0.1014 -0.0005 0.0020  0.0162  120 GLN A CA  
987  C C   . GLN A 138 ? 0.1636 0.1367 0.1121 -0.0064 0.0032  0.0204  120 GLN A C   
988  O O   . GLN A 138 ? 0.1642 0.1464 0.1135 -0.0081 0.0064  0.0216  120 GLN A O   
989  C CB  . GLN A 138 ? 0.1625 0.1340 0.1051 0.0024  0.0008  0.0176  120 GLN A CB  
990  C CG  . GLN A 138 ? 0.1791 0.1395 0.1142 0.0028  -0.0014 0.0223  120 GLN A CG  
991  C CD  . GLN A 138 ? 0.1850 0.1362 0.1186 0.0075  -0.0043 0.0213  120 GLN A CD  
992  O OE1 . GLN A 138 ? 0.1724 0.1254 0.1111 0.0093  -0.0043 0.0174  120 GLN A OE1 
993  N NE2 . GLN A 138 ? 0.2125 0.1541 0.1383 0.0103  -0.0065 0.0250  120 GLN A NE2 
994  N N   . ASP A 139 ? 0.1650 0.1287 0.1119 -0.0100 0.0010  0.0225  121 ASP A N   
995  C CA  . ASP A 139 ? 0.1802 0.1441 0.1278 -0.0176 0.0015  0.0266  121 ASP A CA  
996  C C   . ASP A 139 ? 0.1683 0.1361 0.1232 -0.0214 0.0003  0.0248  121 ASP A C   
997  O O   . ASP A 139 ? 0.1707 0.1396 0.1274 -0.0289 0.0000  0.0280  121 ASP A O   
998  C CB  . ASP A 139 ? 0.2044 0.1513 0.1425 -0.0202 -0.0010 0.0309  121 ASP A CB  
999  C CG  . ASP A 139 ? 0.2264 0.1708 0.1568 -0.0170 -0.0001 0.0343  121 ASP A CG  
1000 O OD1 . ASP A 139 ? 0.2345 0.1903 0.1657 -0.0180 0.0031  0.0360  121 ASP A OD1 
1001 O OD2 . ASP A 139 ? 0.2495 0.1812 0.1725 -0.0125 -0.0028 0.0351  121 ASP A OD2 
1002 N N   . PHE A 140 ? 0.1533 0.1238 0.1121 -0.0168 -0.0002 0.0202  122 PHE A N   
1003 C CA  . PHE A 140 ? 0.1516 0.1243 0.1155 -0.0192 -0.0024 0.0184  122 PHE A CA  
1004 C C   . PHE A 140 ? 0.1381 0.1277 0.1112 -0.0177 0.0001  0.0173  122 PHE A C   
1005 O O   . PHE A 140 ? 0.1258 0.1197 0.1001 -0.0117 0.0027  0.0149  122 PHE A O   
1006 C CB  . PHE A 140 ? 0.1552 0.1185 0.1155 -0.0140 -0.0049 0.0145  122 PHE A CB  
1007 C CG  . PHE A 140 ? 0.1596 0.1231 0.1220 -0.0159 -0.0079 0.0125  122 PHE A CG  
1008 C CD1 . PHE A 140 ? 0.1761 0.1343 0.1368 -0.0232 -0.0114 0.0138  122 PHE A CD1 
1009 C CD2 . PHE A 140 ? 0.1581 0.1263 0.1233 -0.0111 -0.0076 0.0096  122 PHE A CD2 
1010 C CE1 . PHE A 140 ? 0.1776 0.1367 0.1395 -0.0254 -0.0151 0.0116  122 PHE A CE1 
1011 C CE2 . PHE A 140 ? 0.1613 0.1304 0.1274 -0.0125 -0.0109 0.0082  122 PHE A CE2 
1012 C CZ  . PHE A 140 ? 0.1715 0.1366 0.1359 -0.0196 -0.0148 0.0090  122 PHE A CZ  
1013 N N   . THR A 141 ? 0.1345 0.1332 0.1141 -0.0232 -0.0006 0.0191  123 THR A N   
1014 C CA  . THR A 141 ? 0.1266 0.1421 0.1156 -0.0206 0.0013  0.0183  123 THR A CA  
1015 C C   . THR A 141 ? 0.1299 0.1471 0.1227 -0.0217 -0.0031 0.0169  123 THR A C   
1016 O O   . THR A 141 ? 0.1327 0.1557 0.1297 -0.0290 -0.0056 0.0191  123 THR A O   
1017 C CB  . THR A 141 ? 0.1276 0.1582 0.1228 -0.0247 0.0048  0.0221  123 THR A CB  
1018 O OG1 . THR A 141 ? 0.1274 0.1554 0.1167 -0.0237 0.0087  0.0236  123 THR A OG1 
1019 C CG2 . THR A 141 ? 0.1221 0.1704 0.1267 -0.0193 0.0075  0.0209  123 THR A CG2 
1020 N N   . PRO A 142 ? 0.1304 0.1436 0.1215 -0.0150 -0.0039 0.0137  124 PRO A N   
1021 C CA  . PRO A 142 ? 0.1389 0.1538 0.1318 -0.0154 -0.0085 0.0126  124 PRO A CA  
1022 C C   . PRO A 142 ? 0.1380 0.1720 0.1417 -0.0164 -0.0087 0.0144  124 PRO A C   
1023 O O   . PRO A 142 ? 0.1290 0.1754 0.1390 -0.0130 -0.0043 0.0156  124 PRO A O   
1024 C CB  . PRO A 142 ? 0.1326 0.1399 0.1208 -0.0078 -0.0080 0.0098  124 PRO A CB  
1025 C CG  . PRO A 142 ? 0.1322 0.1401 0.1207 -0.0033 -0.0030 0.0094  124 PRO A CG  
1026 C CD  . PRO A 142 ? 0.1306 0.1375 0.1176 -0.0079 -0.0014 0.0112  124 PRO A CD  
1027 N N   . GLU A 143 ? 0.1420 0.1794 0.1478 -0.0213 -0.0143 0.0146  125 GLU A N   
1028 C CA  . GLU A 143 ? 0.1404 0.1988 0.1579 -0.0228 -0.0158 0.0166  125 GLU A CA  
1029 C C   . GLU A 143 ? 0.1365 0.2045 0.1587 -0.0118 -0.0135 0.0161  125 GLU A C   
1030 O O   . GLU A 143 ? 0.1290 0.1866 0.1446 -0.0060 -0.0148 0.0141  125 GLU A O   
1031 C CB  . GLU A 143 ? 0.1500 0.2088 0.1673 -0.0295 -0.0236 0.0159  125 GLU A CB  
1032 C CG  . GLU A 143 ? 0.1490 0.2322 0.1798 -0.0323 -0.0263 0.0183  125 GLU A CG  
1033 C CD  . GLU A 143 ? 0.1630 0.2481 0.1934 -0.0391 -0.0351 0.0171  125 GLU A CD  
1034 O OE1 . GLU A 143 ? 0.1626 0.2694 0.2041 -0.0389 -0.0385 0.0186  125 GLU A OE1 
1035 O OE2 . GLU A 143 ? 0.1856 0.2503 0.2040 -0.0439 -0.0387 0.0143  125 GLU A OE2 
1036 N N   . PRO A 144 ? 0.1386 0.2258 0.1714 -0.0091 -0.0101 0.0182  126 PRO A N   
1037 C CA  . PRO A 144 ? 0.1393 0.2334 0.1753 0.0021  -0.0083 0.0177  126 PRO A CA  
1038 C C   . PRO A 144 ? 0.1411 0.2359 0.1766 0.0052  -0.0144 0.0175  126 PRO A C   
1039 O O   . PRO A 144 ? 0.1334 0.2363 0.1726 -0.0018 -0.0204 0.0184  126 PRO A O   
1040 C CB  . PRO A 144 ? 0.1442 0.2624 0.1931 0.0032  -0.0049 0.0202  126 PRO A CB  
1041 C CG  . PRO A 144 ? 0.1478 0.2650 0.1957 -0.0043 -0.0008 0.0214  126 PRO A CG  
1042 C CD  . PRO A 144 ? 0.1502 0.2509 0.1903 -0.0144 -0.0059 0.0210  126 PRO A CD  
1043 N N   . ASP A 145 ? 0.1458 0.2331 0.1766 0.0154  -0.0132 0.0166  127 ASP A N   
1044 C CA  . ASP A 145 ? 0.1561 0.2465 0.1865 0.0205  -0.0184 0.0175  127 ASP A CA  
1045 C C   . ASP A 145 ? 0.1521 0.2342 0.1752 0.0133  -0.0251 0.0164  127 ASP A C   
1046 O O   . ASP A 145 ? 0.1570 0.2510 0.1841 0.0111  -0.0317 0.0174  127 ASP A O   
1047 C CB  . ASP A 145 ? 0.1761 0.2925 0.2203 0.0245  -0.0200 0.0202  127 ASP A CB  
1048 C CG  . ASP A 145 ? 0.1989 0.3195 0.2425 0.0323  -0.0253 0.0217  127 ASP A CG  
1049 O OD1 . ASP A 145 ? 0.2016 0.3050 0.2346 0.0392  -0.0246 0.0214  127 ASP A OD1 
1050 O OD2 . ASP A 145 ? 0.2183 0.3611 0.2724 0.0316  -0.0306 0.0239  127 ASP A OD2 
1051 N N   . SER A 146 ? 0.1439 0.2067 0.1565 0.0097  -0.0237 0.0142  128 SER A N   
1052 C CA  . SER A 146 ? 0.1516 0.2043 0.1557 0.0033  -0.0291 0.0123  128 SER A CA  
1053 C C   . SER A 146 ? 0.1528 0.1877 0.1437 0.0076  -0.0289 0.0107  128 SER A C   
1054 O O   . SER A 146 ? 0.1642 0.1935 0.1472 0.0049  -0.0342 0.0092  128 SER A O   
1055 C CB  . SER A 146 ? 0.1559 0.2019 0.1587 -0.0061 -0.0283 0.0112  128 SER A CB  
1056 O OG  . SER A 146 ? 0.1642 0.2273 0.1781 -0.0128 -0.0303 0.0131  128 SER A OG  
1057 N N   . TYR A 147 ? 0.1433 0.1689 0.1308 0.0133  -0.0231 0.0108  129 TYR A N   
1058 C CA  . TYR A 147 ? 0.1432 0.1529 0.1191 0.0156  -0.0219 0.0096  129 TYR A CA  
1059 C C   . TYR A 147 ? 0.1468 0.1535 0.1201 0.0238  -0.0194 0.0118  129 TYR A C   
1060 O O   . TYR A 147 ? 0.1395 0.1487 0.1180 0.0279  -0.0157 0.0130  129 TYR A O   
1061 C CB  . TYR A 147 ? 0.1427 0.1416 0.1153 0.0132  -0.0174 0.0078  129 TYR A CB  
1062 C CG  . TYR A 147 ? 0.1441 0.1422 0.1172 0.0057  -0.0196 0.0063  129 TYR A CG  
1063 C CD1 . TYR A 147 ? 0.1555 0.1466 0.1208 0.0021  -0.0243 0.0042  129 TYR A CD1 
1064 C CD2 . TYR A 147 ? 0.1419 0.1445 0.1215 0.0024  -0.0171 0.0069  129 TYR A CD2 
1065 C CE1 . TYR A 147 ? 0.1608 0.1472 0.1247 -0.0049 -0.0266 0.0029  129 TYR A CE1 
1066 C CE2 . TYR A 147 ? 0.1453 0.1448 0.1239 -0.0046 -0.0190 0.0064  129 TYR A CE2 
1067 C CZ  . TYR A 147 ? 0.1578 0.1479 0.1286 -0.0084 -0.0237 0.0044  129 TYR A CZ  
1068 O OH  . TYR A 147 ? 0.1609 0.1447 0.1295 -0.0157 -0.0256 0.0041  129 TYR A OH  
1069 N N   . ASP A 148 ? 0.1481 0.1478 0.1118 0.0259  -0.0213 0.0124  130 ASP A N   
1070 C CA  . ASP A 148 ? 0.1531 0.1454 0.1113 0.0324  -0.0184 0.0151  130 ASP A CA  
1071 C C   . ASP A 148 ? 0.1510 0.1317 0.1057 0.0317  -0.0122 0.0144  130 ASP A C   
1072 O O   . ASP A 148 ? 0.1541 0.1294 0.1087 0.0353  -0.0084 0.0163  130 ASP A O   
1073 C CB  . ASP A 148 ? 0.1629 0.1526 0.1106 0.0344  -0.0226 0.0164  130 ASP A CB  
1074 C CG  . ASP A 148 ? 0.1681 0.1712 0.1197 0.0354  -0.0297 0.0174  130 ASP A CG  
1075 O OD1 . ASP A 148 ? 0.1633 0.1756 0.1229 0.0405  -0.0301 0.0201  130 ASP A OD1 
1076 O OD2 . ASP A 148 ? 0.1758 0.1812 0.1231 0.0307  -0.0353 0.0149  130 ASP A OD2 
1077 N N   . VAL A 149 ? 0.1445 0.1207 0.0958 0.0273  -0.0114 0.0117  131 VAL A N   
1078 C CA  . VAL A 149 ? 0.1455 0.1143 0.0951 0.0262  -0.0063 0.0109  131 VAL A CA  
1079 C C   . VAL A 149 ? 0.1417 0.1115 0.0947 0.0218  -0.0061 0.0079  131 VAL A C   
1080 O O   . VAL A 149 ? 0.1436 0.1136 0.0942 0.0192  -0.0095 0.0061  131 VAL A O   
1081 C CB  . VAL A 149 ? 0.1548 0.1168 0.0945 0.0274  -0.0046 0.0118  131 VAL A CB  
1082 C CG1 . VAL A 149 ? 0.1523 0.1104 0.0921 0.0256  0.0002  0.0108  131 VAL A CG1 
1083 C CG2 . VAL A 149 ? 0.1626 0.1216 0.0978 0.0317  -0.0040 0.0160  131 VAL A CG2 
1084 N N   . ILE A 150 ? 0.1335 0.1029 0.0915 0.0209  -0.0024 0.0073  132 ILE A N   
1085 C CA  . ILE A 150 ? 0.1342 0.1036 0.0942 0.0176  -0.0018 0.0052  132 ILE A CA  
1086 C C   . ILE A 150 ? 0.1355 0.1004 0.0931 0.0180  0.0018  0.0049  132 ILE A C   
1087 O O   . ILE A 150 ? 0.1384 0.1026 0.0983 0.0185  0.0047  0.0056  132 ILE A O   
1088 C CB  . ILE A 150 ? 0.1305 0.1053 0.0976 0.0163  -0.0009 0.0050  132 ILE A CB  
1089 C CG1 . ILE A 150 ? 0.1278 0.1107 0.0991 0.0156  -0.0042 0.0059  132 ILE A CG1 
1090 C CG2 . ILE A 150 ? 0.1273 0.1009 0.0946 0.0133  -0.0003 0.0036  132 ILE A CG2 
1091 C CD1 . ILE A 150 ? 0.1280 0.1189 0.1065 0.0152  -0.0025 0.0061  132 ILE A CD1 
1092 N N   . TRP A 151 ? 0.1363 0.0984 0.0892 0.0180  0.0015  0.0036  133 TRP A N   
1093 C CA  . TRP A 151 ? 0.1404 0.1015 0.0916 0.0192  0.0050  0.0036  133 TRP A CA  
1094 C C   . TRP A 151 ? 0.1380 0.1006 0.0925 0.0183  0.0054  0.0021  133 TRP A C   
1095 O O   . TRP A 151 ? 0.1439 0.1035 0.0955 0.0184  0.0029  0.0008  133 TRP A O   
1096 C CB  . TRP A 151 ? 0.1487 0.1065 0.0914 0.0220  0.0051  0.0033  133 TRP A CB  
1097 C CG  . TRP A 151 ? 0.1481 0.1080 0.0902 0.0234  0.0097  0.0044  133 TRP A CG  
1098 C CD1 . TRP A 151 ? 0.1478 0.1108 0.0914 0.0247  0.0121  0.0033  133 TRP A CD1 
1099 C CD2 . TRP A 151 ? 0.1531 0.1133 0.0933 0.0235  0.0131  0.0076  133 TRP A CD2 
1100 N NE1 . TRP A 151 ? 0.1469 0.1145 0.0913 0.0250  0.0167  0.0054  133 TRP A NE1 
1101 C CE2 . TRP A 151 ? 0.1512 0.1164 0.0934 0.0236  0.0176  0.0082  133 TRP A CE2 
1102 C CE3 . TRP A 151 ? 0.1584 0.1156 0.0959 0.0236  0.0126  0.0103  133 TRP A CE3 
1103 C CZ2 . TRP A 151 ? 0.1560 0.1226 0.0968 0.0226  0.0220  0.0118  133 TRP A CZ2 
1104 C CZ3 . TRP A 151 ? 0.1641 0.1203 0.0990 0.0233  0.0167  0.0139  133 TRP A CZ3 
1105 C CH2 . TRP A 151 ? 0.1613 0.1222 0.0979 0.0221  0.0216  0.0147  133 TRP A CH2 
1106 N N   . ILE A 152 ? 0.1305 0.0968 0.0900 0.0172  0.0079  0.0024  134 ILE A N   
1107 C CA  . ILE A 152 ? 0.1260 0.0953 0.0886 0.0167  0.0077  0.0013  134 ILE A CA  
1108 C C   . ILE A 152 ? 0.1289 0.1034 0.0937 0.0177  0.0104  0.0015  134 ILE A C   
1109 O O   . ILE A 152 ? 0.1286 0.1067 0.0978 0.0150  0.0123  0.0020  134 ILE A O   
1110 C CB  . ILE A 152 ? 0.1217 0.0933 0.0888 0.0140  0.0073  0.0009  134 ILE A CB  
1111 C CG1 . ILE A 152 ? 0.1220 0.0920 0.0888 0.0134  0.0057  0.0013  134 ILE A CG1 
1112 C CG2 . ILE A 152 ? 0.1232 0.0976 0.0915 0.0138  0.0063  0.0003  134 ILE A CG2 
1113 C CD1 . ILE A 152 ? 0.1193 0.0918 0.0896 0.0121  0.0065  0.0007  134 ILE A CD1 
1114 N N   . GLN A 153 ? 0.1254 0.1004 0.0874 0.0215  0.0106  0.0010  135 GLN A N   
1115 C CA  . GLN A 153 ? 0.1258 0.1090 0.0909 0.0233  0.0139  0.0016  135 GLN A CA  
1116 C C   . GLN A 153 ? 0.1284 0.1163 0.0953 0.0272  0.0130  0.0009  135 GLN A C   
1117 O O   . GLN A 153 ? 0.1319 0.1124 0.0926 0.0313  0.0109  -0.0001 135 GLN A O   
1118 C CB  . GLN A 153 ? 0.1321 0.1140 0.0917 0.0261  0.0166  0.0023  135 GLN A CB  
1119 C CG  . GLN A 153 ? 0.1335 0.1265 0.0969 0.0282  0.0210  0.0034  135 GLN A CG  
1120 C CD  . GLN A 153 ? 0.1435 0.1373 0.1024 0.0288  0.0252  0.0054  135 GLN A CD  
1121 O OE1 . GLN A 153 ? 0.1516 0.1370 0.1038 0.0278  0.0246  0.0061  135 GLN A OE1 
1122 N NE2 . GLN A 153 ? 0.1425 0.1484 0.1056 0.0304  0.0298  0.0067  135 GLN A NE2 
1123 N N   . TRP A 154 ? 0.1256 0.1247 0.1003 0.0257  0.0139  0.0014  136 TRP A N   
1124 C CA  . TRP A 154 ? 0.1240 0.1307 0.1017 0.0301  0.0130  0.0013  136 TRP A CA  
1125 C C   . TRP A 154 ? 0.1308 0.1295 0.1042 0.0319  0.0088  0.0008  136 TRP A C   
1126 O O   . TRP A 154 ? 0.1344 0.1301 0.1038 0.0383  0.0076  0.0009  136 TRP A O   
1127 C CB  . TRP A 154 ? 0.1294 0.1413 0.1058 0.0372  0.0162  0.0015  136 TRP A CB  
1128 C CG  . TRP A 154 ? 0.1274 0.1546 0.1122 0.0347  0.0203  0.0030  136 TRP A CG  
1129 C CD1 . TRP A 154 ? 0.1236 0.1636 0.1187 0.0292  0.0199  0.0038  136 TRP A CD1 
1130 C CD2 . TRP A 154 ? 0.1311 0.1631 0.1147 0.0368  0.0255  0.0041  136 TRP A CD2 
1131 N NE1 . TRP A 154 ? 0.1232 0.1756 0.1245 0.0264  0.0245  0.0058  136 TRP A NE1 
1132 C CE2 . TRP A 154 ? 0.1299 0.1785 0.1244 0.0316  0.0285  0.0063  136 TRP A CE2 
1133 C CE3 . TRP A 154 ? 0.1389 0.1633 0.1126 0.0423  0.0280  0.0035  136 TRP A CE3 
1134 C CZ2 . TRP A 154 ? 0.1313 0.1891 0.1276 0.0311  0.0344  0.0087  136 TRP A CZ2 
1135 C CZ3 . TRP A 154 ? 0.1426 0.1768 0.1170 0.0434  0.0340  0.0054  136 TRP A CZ3 
1136 C CH2 . TRP A 154 ? 0.1390 0.1899 0.1250 0.0374  0.0374  0.0084  136 TRP A CH2 
1137 N N   . VAL A 155 ? 0.1223 0.1170 0.0957 0.0264  0.0070  0.0007  137 VAL A N   
1138 C CA  . VAL A 155 ? 0.1286 0.1171 0.0981 0.0268  0.0038  0.0011  137 VAL A CA  
1139 C C   . VAL A 155 ? 0.1293 0.1214 0.1017 0.0217  0.0026  0.0009  137 VAL A C   
1140 O O   . VAL A 155 ? 0.1248 0.1153 0.0944 0.0223  0.0004  0.0017  137 VAL A O   
1141 C CB  . VAL A 155 ? 0.1343 0.1095 0.0963 0.0267  0.0028  0.0011  137 VAL A CB  
1142 C CG1 . VAL A 155 ? 0.1297 0.1030 0.0926 0.0218  0.0037  0.0007  137 VAL A CG1 
1143 C CG2 . VAL A 155 ? 0.1435 0.1113 0.1007 0.0270  0.0000  0.0025  137 VAL A CG2 
1144 N N   . ILE A 156 ? 0.1289 0.1247 0.1054 0.0170  0.0041  -0.0002 138 ILE A N   
1145 C CA  . ILE A 156 ? 0.1234 0.1201 0.1001 0.0132  0.0030  -0.0014 138 ILE A CA  
1146 C C   . ILE A 156 ? 0.1195 0.1245 0.0978 0.0135  0.0004  -0.0017 138 ILE A C   
1147 O O   . ILE A 156 ? 0.1175 0.1218 0.0928 0.0117  -0.0010 -0.0024 138 ILE A O   
1148 C CB  . ILE A 156 ? 0.1312 0.1273 0.1105 0.0086  0.0048  -0.0031 138 ILE A CB  
1149 C CG1 . ILE A 156 ? 0.1315 0.1355 0.1166 0.0058  0.0054  -0.0037 138 ILE A CG1 
1150 C CG2 . ILE A 156 ? 0.1375 0.1259 0.1146 0.0090  0.0068  -0.0023 138 ILE A CG2 
1151 C CD1 . ILE A 156 ? 0.1345 0.1349 0.1204 0.0001  0.0064  -0.0057 138 ILE A CD1 
1152 N N   . GLY A 157 ? 0.1129 0.1269 0.0956 0.0161  0.0000  -0.0010 139 GLY A N   
1153 C CA  . GLY A 157 ? 0.1163 0.1405 0.1012 0.0172  -0.0033 -0.0009 139 GLY A CA  
1154 C C   . GLY A 157 ? 0.1187 0.1378 0.0967 0.0222  -0.0058 0.0012  139 GLY A C   
1155 O O   . GLY A 157 ? 0.1216 0.1474 0.0990 0.0234  -0.0090 0.0018  139 GLY A O   
1156 N N   . HIS A 158 ? 0.1239 0.1307 0.0960 0.0243  -0.0046 0.0027  140 HIS A N   
1157 C CA  . HIS A 158 ? 0.1307 0.1295 0.0951 0.0275  -0.0067 0.0055  140 HIS A CA  
1158 C C   . HIS A 158 ? 0.1361 0.1300 0.0955 0.0229  -0.0068 0.0061  140 HIS A C   
1159 O O   . HIS A 158 ? 0.1398 0.1274 0.0924 0.0243  -0.0081 0.0092  140 HIS A O   
1160 C CB  . HIS A 158 ? 0.1372 0.1241 0.0969 0.0317  -0.0059 0.0069  140 HIS A CB  
1161 C CG  . HIS A 158 ? 0.1397 0.1305 0.1008 0.0395  -0.0064 0.0074  140 HIS A CG  
1162 N ND1 . HIS A 158 ? 0.1467 0.1414 0.1063 0.0453  -0.0093 0.0097  140 HIS A ND1 
1163 C CD2 . HIS A 158 ? 0.1412 0.1340 0.1049 0.0433  -0.0041 0.0060  140 HIS A CD2 
1164 C CE1 . HIS A 158 ? 0.1516 0.1508 0.1136 0.0531  -0.0088 0.0096  140 HIS A CE1 
1165 N NE2 . HIS A 158 ? 0.1483 0.1464 0.1126 0.0519  -0.0053 0.0072  140 HIS A NE2 
1166 N N   . LEU A 159 ? 0.1350 0.1317 0.0972 0.0179  -0.0051 0.0033  141 LEU A N   
1167 C CA  . LEU A 159 ? 0.1440 0.1383 0.1017 0.0146  -0.0043 0.0034  141 LEU A CA  
1168 C C   . LEU A 159 ? 0.1344 0.1365 0.0919 0.0127  -0.0056 0.0006  141 LEU A C   
1169 O O   . LEU A 159 ? 0.1262 0.1339 0.0889 0.0111  -0.0061 -0.0023 141 LEU A O   
1170 C CB  . LEU A 159 ? 0.1582 0.1484 0.1176 0.0116  -0.0013 0.0021  141 LEU A CB  
1171 C CG  . LEU A 159 ? 0.1962 0.1793 0.1556 0.0118  -0.0004 0.0039  141 LEU A CG  
1172 C CD1 . LEU A 159 ? 0.2073 0.1896 0.1681 0.0089  0.0017  0.0033  141 LEU A CD1 
1173 C CD2 . LEU A 159 ? 0.2102 0.1866 0.1643 0.0131  -0.0020 0.0075  141 LEU A CD2 
1174 N N   . THR A 160 ? 0.1301 0.1320 0.0808 0.0122  -0.0060 0.0016  142 THR A N   
1175 C CA  . THR A 160 ? 0.1346 0.1421 0.0823 0.0101  -0.0072 -0.0020 142 THR A CA  
1176 C C   . THR A 160 ? 0.1289 0.1337 0.0790 0.0070  -0.0042 -0.0065 142 THR A C   
1177 O O   . THR A 160 ? 0.1263 0.1262 0.0793 0.0070  -0.0011 -0.0056 142 THR A O   
1178 C CB  . THR A 160 ? 0.1440 0.1510 0.0819 0.0107  -0.0071 0.0001  142 THR A CB  
1179 O OG1 . THR A 160 ? 0.1464 0.1485 0.0830 0.0094  -0.0027 0.0015  142 THR A OG1 
1180 C CG2 . THR A 160 ? 0.1489 0.1558 0.0822 0.0143  -0.0102 0.0056  142 THR A CG2 
1181 N N   . ASP A 161 ? 0.1358 0.1427 0.0838 0.0047  -0.0053 -0.0113 143 ASP A N   
1182 C CA  . ASP A 161 ? 0.1371 0.1385 0.0855 0.0028  -0.0026 -0.0157 143 ASP A CA  
1183 C C   . ASP A 161 ? 0.1370 0.1348 0.0814 0.0049  0.0014  -0.0148 143 ASP A C   
1184 O O   . ASP A 161 ? 0.1362 0.1297 0.0843 0.0055  0.0044  -0.0150 143 ASP A O   
1185 C CB  . ASP A 161 ? 0.1456 0.1472 0.0895 -0.0001 -0.0049 -0.0216 143 ASP A CB  
1186 C CG  . ASP A 161 ? 0.1450 0.1522 0.0947 -0.0040 -0.0091 -0.0232 143 ASP A CG  
1187 O OD1 . ASP A 161 ? 0.1415 0.1517 0.0996 -0.0040 -0.0089 -0.0201 143 ASP A OD1 
1188 O OD2 . ASP A 161 ? 0.1508 0.1605 0.0958 -0.0070 -0.0126 -0.0276 143 ASP A OD2 
1189 N N   . GLN A 162 ? 0.1446 0.1455 0.0822 0.0062  0.0017  -0.0128 144 GLN A N   
1190 C CA  . GLN A 162 ? 0.1480 0.1487 0.0831 0.0078  0.0064  -0.0114 144 GLN A CA  
1191 C C   . GLN A 162 ? 0.1480 0.1477 0.0901 0.0077  0.0079  -0.0066 144 GLN A C   
1192 O O   . GLN A 162 ? 0.1398 0.1395 0.0854 0.0085  0.0111  -0.0069 144 GLN A O   
1193 C CB  . GLN A 162 ? 0.1553 0.1603 0.0813 0.0085  0.0069  -0.0092 144 GLN A CB  
1194 C CG  . GLN A 162 ? 0.1575 0.1656 0.0813 0.0096  0.0123  -0.0071 144 GLN A CG  
1195 C CD  . GLN A 162 ? 0.1611 0.1687 0.0826 0.0122  0.0157  -0.0132 144 GLN A CD  
1196 O OE1 . GLN A 162 ? 0.1655 0.1698 0.0808 0.0127  0.0140  -0.0192 144 GLN A OE1 
1197 N NE2 . GLN A 162 ? 0.1593 0.1705 0.0854 0.0141  0.0206  -0.0117 144 GLN A NE2 
1198 N N   . HIS A 163 ? 0.1447 0.1436 0.0884 0.0071  0.0054  -0.0025 145 HIS A N   
1199 C CA  . HIS A 163 ? 0.1519 0.1481 0.1002 0.0065  0.0062  0.0013  145 HIS A CA  
1200 C C   . HIS A 163 ? 0.1321 0.1256 0.0873 0.0068  0.0063  -0.0008 145 HIS A C   
1201 O O   . HIS A 163 ? 0.1271 0.1199 0.0859 0.0064  0.0077  0.0005  145 HIS A O   
1202 C CB  . HIS A 163 ? 0.1748 0.1677 0.1212 0.0068  0.0033  0.0054  145 HIS A CB  
1203 C CG  . HIS A 163 ? 0.2201 0.2131 0.1591 0.0061  0.0036  0.0097  145 HIS A CG  
1204 N ND1 . HIS A 163 ? 0.2416 0.2306 0.1758 0.0076  0.0006  0.0136  145 HIS A ND1 
1205 C CD2 . HIS A 163 ? 0.2660 0.2627 0.2014 0.0044  0.0068  0.0115  145 HIS A CD2 
1206 C CE1 . HIS A 163 ? 0.2751 0.2635 0.2020 0.0062  0.0017  0.0180  145 HIS A CE1 
1207 N NE2 . HIS A 163 ? 0.2995 0.2938 0.2272 0.0039  0.0058  0.0168  145 HIS A NE2 
1208 N N   . LEU A 164 ? 0.1238 0.1167 0.0807 0.0070  0.0048  -0.0039 146 LEU A N   
1209 C CA  . LEU A 164 ? 0.1192 0.1090 0.0813 0.0070  0.0055  -0.0054 146 LEU A CA  
1210 C C   . LEU A 164 ? 0.1183 0.1064 0.0808 0.0078  0.0083  -0.0077 146 LEU A C   
1211 O O   . LEU A 164 ? 0.1160 0.1023 0.0819 0.0088  0.0094  -0.0066 146 LEU A O   
1212 C CB  . LEU A 164 ? 0.1230 0.1137 0.0872 0.0059  0.0037  -0.0076 146 LEU A CB  
1213 C CG  . LEU A 164 ? 0.1248 0.1121 0.0934 0.0053  0.0049  -0.0082 146 LEU A CG  
1214 C CD1 . LEU A 164 ? 0.1246 0.1099 0.0951 0.0071  0.0054  -0.0051 146 LEU A CD1 
1215 C CD2 . LEU A 164 ? 0.1307 0.1212 0.1021 0.0028  0.0035  -0.0098 146 LEU A CD2 
1216 N N   . ALA A 165 ? 0.1180 0.1065 0.0762 0.0082  0.0092  -0.0110 147 ALA A N   
1217 C CA  . ALA A 165 ? 0.1229 0.1090 0.0803 0.0107  0.0123  -0.0135 147 ALA A CA  
1218 C C   . ALA A 165 ? 0.1179 0.1097 0.0782 0.0126  0.0145  -0.0100 147 ALA A C   
1219 O O   . ALA A 165 ? 0.1185 0.1099 0.0829 0.0149  0.0158  -0.0096 147 ALA A O   
1220 C CB  . ALA A 165 ? 0.1313 0.1163 0.0816 0.0116  0.0131  -0.0182 147 ALA A CB  
1221 N N   . GLU A 166 ? 0.1172 0.1148 0.0758 0.0111  0.0147  -0.0070 148 GLU A N   
1222 C CA  . GLU A 166 ? 0.1175 0.1221 0.0799 0.0110  0.0168  -0.0032 148 GLU A CA  
1223 C C   . GLU A 166 ? 0.1109 0.1142 0.0796 0.0094  0.0147  -0.0003 148 GLU A C   
1224 O O   . GLU A 166 ? 0.1087 0.1173 0.0827 0.0105  0.0159  0.0007  148 GLU A O   
1225 C CB  . GLU A 166 ? 0.1253 0.1347 0.0839 0.0083  0.0174  0.0004  148 GLU A CB  
1226 C CG  . GLU A 166 ? 0.1374 0.1504 0.0888 0.0103  0.0202  -0.0018 148 GLU A CG  
1227 C CD  . GLU A 166 ? 0.1549 0.1737 0.1018 0.0079  0.0219  0.0027  148 GLU A CD  
1228 O OE1 . GLU A 166 ? 0.1671 0.1907 0.1192 0.0047  0.0230  0.0078  148 GLU A OE1 
1229 O OE2 . GLU A 166 ? 0.1538 0.1738 0.0919 0.0089  0.0228  0.0016  148 GLU A OE2 
1230 N N   . PHE A 167 ? 0.1129 0.1102 0.0806 0.0076  0.0117  0.0004  149 PHE A N   
1231 C CA  . PHE A 167 ? 0.1114 0.1059 0.0826 0.0065  0.0095  0.0022  149 PHE A CA  
1232 C C   . PHE A 167 ? 0.1087 0.1023 0.0833 0.0094  0.0101  0.0004  149 PHE A C   
1233 O O   . PHE A 167 ? 0.1063 0.1028 0.0845 0.0095  0.0094  0.0019  149 PHE A O   
1234 C CB  . PHE A 167 ? 0.1161 0.1042 0.0847 0.0059  0.0069  0.0026  149 PHE A CB  
1235 C CG  . PHE A 167 ? 0.1182 0.1021 0.0879 0.0055  0.0050  0.0036  149 PHE A CG  
1236 C CD1 . PHE A 167 ? 0.1249 0.1092 0.0952 0.0025  0.0037  0.0061  149 PHE A CD1 
1237 C CD2 . PHE A 167 ? 0.1194 0.0997 0.0893 0.0074  0.0045  0.0021  149 PHE A CD2 
1238 C CE1 . PHE A 167 ? 0.1328 0.1127 0.1027 0.0018  0.0013  0.0062  149 PHE A CE1 
1239 C CE2 . PHE A 167 ? 0.1285 0.1049 0.0976 0.0076  0.0029  0.0027  149 PHE A CE2 
1240 C CZ  . PHE A 167 ? 0.1273 0.1029 0.0958 0.0050  0.0009  0.0043  149 PHE A CZ  
1241 N N   . LEU A 168 ? 0.1124 0.1019 0.0854 0.0113  0.0110  -0.0025 150 LEU A N   
1242 C CA  . LEU A 168 ? 0.1181 0.1039 0.0925 0.0143  0.0117  -0.0036 150 LEU A CA  
1243 C C   . LEU A 168 ? 0.1202 0.1117 0.0972 0.0179  0.0137  -0.0035 150 LEU A C   
1244 O O   . LEU A 168 ? 0.1212 0.1131 0.1009 0.0206  0.0132  -0.0022 150 LEU A O   
1245 C CB  . LEU A 168 ? 0.1281 0.1065 0.0994 0.0143  0.0124  -0.0068 150 LEU A CB  
1246 C CG  . LEU A 168 ? 0.1285 0.1045 0.0997 0.0113  0.0107  -0.0063 150 LEU A CG  
1247 C CD1 . LEU A 168 ? 0.1379 0.1092 0.1074 0.0093  0.0109  -0.0092 150 LEU A CD1 
1248 C CD2 . LEU A 168 ? 0.1312 0.1049 0.1039 0.0118  0.0100  -0.0038 150 LEU A CD2 
1249 N N   . ARG A 169 ? 0.1191 0.1163 0.0951 0.0189  0.0161  -0.0046 151 ARG A N   
1250 C CA  . ARG A 169 ? 0.1203 0.1263 0.0999 0.0232  0.0186  -0.0041 151 ARG A CA  
1251 C C   . ARG A 169 ? 0.1160 0.1323 0.1029 0.0210  0.0170  0.0001  151 ARG A C   
1252 O O   . ARG A 169 ? 0.1163 0.1397 0.1086 0.0248  0.0171  0.0012  151 ARG A O   
1253 C CB  . ARG A 169 ? 0.1274 0.1395 0.1040 0.0243  0.0221  -0.0057 151 ARG A CB  
1254 C CG  . ARG A 169 ? 0.1379 0.1406 0.1066 0.0267  0.0234  -0.0109 151 ARG A CG  
1255 C CD  . ARG A 169 ? 0.1480 0.1574 0.1120 0.0287  0.0271  -0.0127 151 ARG A CD  
1256 N NE  . ARG A 169 ? 0.1629 0.1611 0.1175 0.0301  0.0271  -0.0186 151 ARG A NE  
1257 C CZ  . ARG A 169 ? 0.1655 0.1601 0.1138 0.0259  0.0250  -0.0203 151 ARG A CZ  
1258 N NH1 . ARG A 169 ? 0.1622 0.1638 0.1108 0.0216  0.0239  -0.0164 151 ARG A NH1 
1259 N NH2 . ARG A 169 ? 0.1761 0.1600 0.1174 0.0260  0.0238  -0.0258 151 ARG A NH2 
1260 N N   . ARG A 170 ? 0.1078 0.1253 0.0944 0.0149  0.0152  0.0024  152 ARG A N   
1261 C CA  . ARG A 170 ? 0.1098 0.1342 0.1017 0.0109  0.0128  0.0059  152 ARG A CA  
1262 C C   . ARG A 170 ? 0.1128 0.1327 0.1059 0.0119  0.0092  0.0060  152 ARG A C   
1263 O O   . ARG A 170 ? 0.1182 0.1469 0.1171 0.0119  0.0074  0.0077  152 ARG A O   
1264 C CB  . ARG A 170 ? 0.1073 0.1298 0.0965 0.0040  0.0116  0.0084  152 ARG A CB  
1265 C CG  . ARG A 170 ? 0.1082 0.1367 0.0954 0.0030  0.0154  0.0095  152 ARG A CG  
1266 C CD  . ARG A 170 ? 0.1120 0.1403 0.0975 -0.0040 0.0145  0.0137  152 ARG A CD  
1267 N NE  . ARG A 170 ? 0.1144 0.1284 0.0934 -0.0057 0.0110  0.0136  152 ARG A NE  
1268 C CZ  . ARG A 170 ? 0.1191 0.1261 0.0913 -0.0039 0.0111  0.0126  152 ARG A CZ  
1269 N NH1 . ARG A 170 ? 0.1199 0.1313 0.0893 -0.0012 0.0141  0.0112  152 ARG A NH1 
1270 N NH2 . ARG A 170 ? 0.1200 0.1163 0.0876 -0.0045 0.0080  0.0129  152 ARG A NH2 
1271 N N   . CYS A 171 ? 0.1177 0.1257 0.1055 0.0126  0.0082  0.0043  153 CYS A N   
1272 C CA  . CYS A 171 ? 0.1267 0.1293 0.1135 0.0144  0.0057  0.0044  153 CYS A CA  
1273 C C   . CYS A 171 ? 0.1296 0.1356 0.1191 0.0202  0.0064  0.0046  153 CYS A C   
1274 O O   . CYS A 171 ? 0.1266 0.1363 0.1183 0.0213  0.0036  0.0063  153 CYS A O   
1275 C CB  . CYS A 171 ? 0.1305 0.1219 0.1116 0.0142  0.0058  0.0029  153 CYS A CB  
1276 S SG  . CYS A 171 ? 0.1465 0.1331 0.1238 0.0097  0.0037  0.0033  153 CYS A SG  
1277 N N   . LYS A 172 ? 0.1290 0.1334 0.1178 0.0245  0.0098  0.0027  154 LYS A N   
1278 C CA  . LYS A 172 ? 0.1383 0.1437 0.1286 0.0317  0.0107  0.0029  154 LYS A CA  
1279 C C   . LYS A 172 ? 0.1349 0.1565 0.1333 0.0336  0.0095  0.0053  154 LYS A C   
1280 O O   . LYS A 172 ? 0.1341 0.1582 0.1344 0.0384  0.0075  0.0070  154 LYS A O   
1281 C CB  . LYS A 172 ? 0.1506 0.1512 0.1378 0.0358  0.0147  -0.0002 154 LYS A CB  
1282 C CG  . LYS A 172 ? 0.1658 0.1625 0.1522 0.0447  0.0161  -0.0006 154 LYS A CG  
1283 C CD  . LYS A 172 ? 0.1880 0.1771 0.1691 0.0489  0.0199  -0.0049 154 LYS A CD  
1284 C CE  . LYS A 172 ? 0.2203 0.2049 0.2002 0.0594  0.0213  -0.0050 154 LYS A CE  
1285 N NZ  . LYS A 172 ? 0.2432 0.2175 0.2160 0.0645  0.0250  -0.0101 154 LYS A NZ  
1286 N N   . GLY A 173 ? 0.1282 0.1619 0.1314 0.0298  0.0107  0.0059  155 GLY A N   
1287 C CA  . GLY A 173 ? 0.1379 0.1900 0.1505 0.0295  0.0099  0.0085  155 GLY A CA  
1288 C C   . GLY A 173 ? 0.1420 0.1980 0.1575 0.0243  0.0040  0.0109  155 GLY A C   
1289 O O   . GLY A 173 ? 0.1698 0.2418 0.1938 0.0248  0.0019  0.0131  155 GLY A O   
1290 N N   . SER A 174 ? 0.1339 0.1761 0.1423 0.0201  0.0013  0.0101  156 SER A N   
1291 C CA  . SER A 174 ? 0.1330 0.1758 0.1412 0.0150  -0.0043 0.0113  156 SER A CA  
1292 C C   . SER A 174 ? 0.1361 0.1730 0.1400 0.0203  -0.0071 0.0114  156 SER A C   
1293 O O   . SER A 174 ? 0.1420 0.1787 0.1438 0.0172  -0.0122 0.0118  156 SER A O   
1294 C CB  A SER A 174 ? 0.1404 0.1726 0.1426 0.0076  -0.0055 0.0104  156 SER A CB  
1295 C CB  B SER A 174 ? 0.1327 0.1632 0.1340 0.0081  -0.0051 0.0102  156 SER A CB  
1296 C CB  C SER A 174 ? 0.1334 0.1646 0.1350 0.0079  -0.0053 0.0103  156 SER A CB  
1297 O OG  A SER A 174 ? 0.1485 0.1661 0.1426 0.0101  -0.0044 0.0086  156 SER A OG  
1298 O OG  B SER A 174 ? 0.1345 0.1608 0.1323 0.0037  -0.0103 0.0101  156 SER A OG  
1299 O OG  C SER A 174 ? 0.1314 0.1682 0.1363 0.0029  -0.0030 0.0113  156 SER A OG  
1300 N N   . LEU A 175 ? 0.1330 0.1627 0.1338 0.0278  -0.0041 0.0110  157 LEU A N   
1301 C CA  . LEU A 175 ? 0.1341 0.1565 0.1293 0.0328  -0.0063 0.0122  157 LEU A CA  
1302 C C   . LEU A 175 ? 0.1371 0.1733 0.1383 0.0378  -0.0099 0.0147  157 LEU A C   
1303 O O   . LEU A 175 ? 0.1352 0.1844 0.1448 0.0423  -0.0083 0.0155  157 LEU A O   
1304 C CB  . LEU A 175 ? 0.1401 0.1493 0.1299 0.0383  -0.0021 0.0117  157 LEU A CB  
1305 C CG  . LEU A 175 ? 0.1372 0.1335 0.1210 0.0337  0.0004  0.0096  157 LEU A CG  
1306 C CD1 . LEU A 175 ? 0.1463 0.1312 0.1263 0.0381  0.0043  0.0088  157 LEU A CD1 
1307 C CD2 . LEU A 175 ? 0.1405 0.1307 0.1186 0.0298  -0.0017 0.0099  157 LEU A CD2 
1308 N N   . ARG A 176 ? 0.1422 0.1770 0.1388 0.0378  -0.0149 0.0161  158 ARG A N   
1309 C CA  . ARG A 176 ? 0.1500 0.1954 0.1497 0.0442  -0.0191 0.0190  158 ARG A CA  
1310 C C   . ARG A 176 ? 0.1567 0.1928 0.1523 0.0548  -0.0158 0.0209  158 ARG A C   
1311 O O   . ARG A 176 ? 0.1482 0.1682 0.1375 0.0550  -0.0111 0.0197  158 ARG A O   
1312 C CB  A ARG A 176 ? 0.1583 0.2002 0.1499 0.0415  -0.0253 0.0196  158 ARG A CB  
1313 C CB  B ARG A 176 ? 0.1570 0.2020 0.1505 0.0407  -0.0258 0.0195  158 ARG A CB  
1314 C CG  A ARG A 176 ? 0.1584 0.2067 0.1517 0.0314  -0.0300 0.0175  158 ARG A CG  
1315 C CG  B ARG A 176 ? 0.1552 0.2091 0.1533 0.0303  -0.0296 0.0174  158 ARG A CG  
1316 C CD  A ARG A 176 ? 0.1601 0.2311 0.1656 0.0300  -0.0350 0.0188  158 ARG A CD  
1317 C CD  B ARG A 176 ? 0.1648 0.2231 0.1590 0.0268  -0.0377 0.0173  158 ARG A CD  
1318 N NE  A ARG A 176 ? 0.1711 0.2486 0.1742 0.0350  -0.0413 0.0210  158 ARG A NE  
1319 N NE  B ARG A 176 ? 0.1646 0.2389 0.1690 0.0183  -0.0418 0.0165  158 ARG A NE  
1320 N N   . PRO A 177 ? 0.1678 0.2140 0.1673 0.0633  -0.0185 0.0239  159 PRO A N   
1321 C CA  . PRO A 177 ? 0.1806 0.2138 0.1736 0.0738  -0.0161 0.0262  159 PRO A CA  
1322 C C   . PRO A 177 ? 0.1829 0.1955 0.1621 0.0717  -0.0157 0.0274  159 PRO A C   
1323 O O   . PRO A 177 ? 0.1778 0.1907 0.1516 0.0672  -0.0199 0.0282  159 PRO A O   
1324 C CB  . PRO A 177 ? 0.1902 0.2388 0.1880 0.0826  -0.0213 0.0301  159 PRO A CB  
1325 C CG  . PRO A 177 ? 0.1824 0.2573 0.1951 0.0776  -0.0239 0.0288  159 PRO A CG  
1326 C CD  . PRO A 177 ? 0.1732 0.2430 0.1830 0.0641  -0.0244 0.0257  159 PRO A CD  
1327 N N   . ASN A 178 ? 0.1854 0.1797 0.1583 0.0746  -0.0104 0.0273  160 ASN A N   
1328 C CA  . ASN A 178 ? 0.1883 0.1628 0.1490 0.0719  -0.0085 0.0289  160 ASN A CA  
1329 C C   . ASN A 178 ? 0.1739 0.1456 0.1330 0.0613  -0.0069 0.0258  160 ASN A C   
1330 O O   . ASN A 178 ? 0.1737 0.1334 0.1241 0.0582  -0.0052 0.0271  160 ASN A O   
1331 C CB  . ASN A 178 ? 0.2026 0.1734 0.1543 0.0764  -0.0124 0.0342  160 ASN A CB  
1332 C CG  . ASN A 178 ? 0.2213 0.1908 0.1720 0.0883  -0.0137 0.0384  160 ASN A CG  
1333 O OD1 . ASN A 178 ? 0.2272 0.1929 0.1814 0.0940  -0.0106 0.0373  160 ASN A OD1 
1334 N ND2 . ASN A 178 ? 0.2373 0.2069 0.1808 0.0928  -0.0181 0.0433  160 ASN A ND2 
1335 N N   . GLY A 179 ? 0.1559 0.1389 0.1231 0.0558  -0.0072 0.0220  161 GLY A N   
1336 C CA  . GLY A 179 ? 0.1493 0.1291 0.1147 0.0473  -0.0059 0.0192  161 GLY A CA  
1337 C C   . GLY A 179 ? 0.1489 0.1163 0.1119 0.0447  -0.0005 0.0175  161 GLY A C   
1338 O O   . GLY A 179 ? 0.1534 0.1152 0.1171 0.0484  0.0021  0.0171  161 GLY A O   
1339 N N   . ILE A 180 ? 0.1441 0.1075 0.1039 0.0388  0.0005  0.0162  162 ILE A N   
1340 C CA  . ILE A 180 ? 0.1471 0.1020 0.1058 0.0351  0.0048  0.0145  162 ILE A CA  
1341 C C   . ILE A 180 ? 0.1416 0.1014 0.1030 0.0293  0.0049  0.0114  162 ILE A C   
1342 O O   . ILE A 180 ? 0.1305 0.0956 0.0914 0.0276  0.0021  0.0110  162 ILE A O   
1343 C CB  . ILE A 180 ? 0.1591 0.1027 0.1102 0.0345  0.0071  0.0175  162 ILE A CB  
1344 C CG1 . ILE A 180 ? 0.1626 0.1091 0.1088 0.0327  0.0058  0.0186  162 ILE A CG1 
1345 C CG2 . ILE A 180 ? 0.1736 0.1084 0.1200 0.0404  0.0073  0.0213  162 ILE A CG2 
1346 C CD1 . ILE A 180 ? 0.1760 0.1138 0.1152 0.0311  0.0094  0.0218  162 ILE A CD1 
1347 N N   . ILE A 181 ? 0.1397 0.0966 0.1031 0.0266  0.0077  0.0092  163 ILE A N   
1348 C CA  . ILE A 181 ? 0.1338 0.0934 0.0986 0.0220  0.0082  0.0070  163 ILE A CA  
1349 C C   . ILE A 181 ? 0.1410 0.0950 0.1029 0.0195  0.0109  0.0077  163 ILE A C   
1350 O O   . ILE A 181 ? 0.1425 0.0896 0.1034 0.0189  0.0130  0.0083  163 ILE A O   
1351 C CB  . ILE A 181 ? 0.1324 0.0954 0.1015 0.0206  0.0090  0.0041  163 ILE A CB  
1352 C CG1 . ILE A 181 ? 0.1305 0.1018 0.1035 0.0223  0.0072  0.0041  163 ILE A CG1 
1353 C CG2 . ILE A 181 ? 0.1298 0.0949 0.0996 0.0167  0.0092  0.0025  163 ILE A CG2 
1354 C CD1 . ILE A 181 ? 0.1330 0.1073 0.1088 0.0232  0.0090  0.0020  163 ILE A CD1 
1355 N N   . VAL A 182 ? 0.1395 0.0965 0.1004 0.0177  0.0109  0.0075  164 VAL A N   
1356 C CA  . VAL A 182 ? 0.1448 0.1008 0.1050 0.0152  0.0139  0.0084  164 VAL A CA  
1357 C C   . VAL A 182 ? 0.1418 0.1039 0.1061 0.0131  0.0138  0.0058  164 VAL A C   
1358 O O   . VAL A 182 ? 0.1409 0.1061 0.1048 0.0144  0.0118  0.0046  164 VAL A O   
1359 C CB  . VAL A 182 ? 0.1507 0.1062 0.1051 0.0168  0.0150  0.0109  164 VAL A CB  
1360 C CG1 . VAL A 182 ? 0.1554 0.1139 0.1112 0.0138  0.0189  0.0119  164 VAL A CG1 
1361 C CG2 . VAL A 182 ? 0.1598 0.1089 0.1088 0.0193  0.0147  0.0143  164 VAL A CG2 
1362 N N   . ILE A 183 ? 0.1423 0.1055 0.1102 0.0095  0.0154  0.0050  165 ILE A N   
1363 C CA  . ILE A 183 ? 0.1359 0.1064 0.1078 0.0079  0.0152  0.0034  165 ILE A CA  
1364 C C   . ILE A 183 ? 0.1380 0.1132 0.1117 0.0058  0.0182  0.0053  165 ILE A C   
1365 O O   . ILE A 183 ? 0.1415 0.1136 0.1155 0.0021  0.0204  0.0069  165 ILE A O   
1366 C CB  . ILE A 183 ? 0.1386 0.1096 0.1137 0.0047  0.0142  0.0007  165 ILE A CB  
1367 C CG1 . ILE A 183 ? 0.1386 0.1077 0.1123 0.0069  0.0122  -0.0008 165 ILE A CG1 
1368 C CG2 . ILE A 183 ? 0.1360 0.1162 0.1154 0.0028  0.0135  -0.0004 165 ILE A CG2 
1369 C CD1 . ILE A 183 ? 0.1444 0.1121 0.1185 0.0048  0.0118  -0.0038 165 ILE A CD1 
1370 N N   . LYS A 184 ? 0.1337 0.1166 0.1086 0.0082  0.0186  0.0051  166 LYS A N   
1371 C CA  . LYS A 184 ? 0.1326 0.1244 0.1110 0.0069  0.0220  0.0069  166 LYS A CA  
1372 C C   . LYS A 184 ? 0.1289 0.1314 0.1128 0.0085  0.0206  0.0051  166 LYS A C   
1373 O O   . LYS A 184 ? 0.1282 0.1299 0.1090 0.0141  0.0187  0.0039  166 LYS A O   
1374 C CB  . LYS A 184 ? 0.1372 0.1281 0.1096 0.0110  0.0247  0.0089  166 LYS A CB  
1375 C CG  . LYS A 184 ? 0.1367 0.1382 0.1125 0.0099  0.0295  0.0114  166 LYS A CG  
1376 C CD  . LYS A 184 ? 0.1422 0.1409 0.1096 0.0131  0.0330  0.0141  166 LYS A CD  
1377 C CE  . LYS A 184 ? 0.1455 0.1562 0.1169 0.0110  0.0389  0.0174  166 LYS A CE  
1378 N NZ  . LYS A 184 ? 0.1527 0.1615 0.1142 0.0148  0.0430  0.0202  166 LYS A NZ  
1379 N N   . ASP A 185 ? 0.1281 0.1403 0.1197 0.0038  0.0211  0.0051  167 ASP A N   
1380 C CA  . ASP A 185 ? 0.1258 0.1489 0.1226 0.0059  0.0186  0.0036  167 ASP A CA  
1381 C C   . ASP A 185 ? 0.1239 0.1616 0.1304 0.0004  0.0195  0.0043  167 ASP A C   
1382 O O   . ASP A 185 ? 0.1229 0.1601 0.1318 -0.0066 0.0215  0.0055  167 ASP A O   
1383 C CB  . ASP A 185 ? 0.1283 0.1443 0.1222 0.0060  0.0141  0.0011  167 ASP A CB  
1384 C CG  . ASP A 185 ? 0.1315 0.1497 0.1235 0.0126  0.0116  0.0006  167 ASP A CG  
1385 O OD1 . ASP A 185 ? 0.1425 0.1729 0.1396 0.0153  0.0114  0.0011  167 ASP A OD1 
1386 O OD2 . ASP A 185 ? 0.1419 0.1501 0.1276 0.0152  0.0101  0.0002  167 ASP A OD2 
1387 N N   . ASN A 186 ? 0.1270 0.1779 0.1391 0.0035  0.0172  0.0035  168 ASN A N   
1388 C CA  . ASN A 186 ? 0.1315 0.1996 0.1542 -0.0014 0.0164  0.0037  168 ASN A CA  
1389 C C   . ASN A 186 ? 0.1356 0.1986 0.1587 -0.0102 0.0126  0.0011  168 ASN A C   
1390 O O   . ASN A 186 ? 0.1473 0.1984 0.1632 -0.0085 0.0094  -0.0012 168 ASN A O   
1391 C CB  . ASN A 186 ? 0.1270 0.2085 0.1538 0.0056  0.0133  0.0033  168 ASN A CB  
1392 C CG  . ASN A 186 ? 0.1322 0.2181 0.1577 0.0159  0.0166  0.0050  168 ASN A CG  
1393 O OD1 . ASN A 186 ? 0.1272 0.2146 0.1527 0.0162  0.0219  0.0067  168 ASN A OD1 
1394 N ND2 . ASN A 186 ? 0.1325 0.2191 0.1556 0.0246  0.0137  0.0045  168 ASN A ND2 
1395 N N   . MET A 187 ? 0.1411 0.2124 0.1716 -0.0194 0.0132  0.0015  169 MET A N   
1396 C CA  . MET A 187 ? 0.1504 0.2168 0.1809 -0.0288 0.0094  -0.0017 169 MET A CA  
1397 C C   . MET A 187 ? 0.1539 0.2423 0.1961 -0.0344 0.0062  -0.0022 169 MET A C   
1398 O O   . MET A 187 ? 0.1553 0.2608 0.2075 -0.0363 0.0092  0.0009  169 MET A O   
1399 C CB  . MET A 187 ? 0.1640 0.2155 0.1909 -0.0365 0.0125  -0.0008 169 MET A CB  
1400 C CG  . MET A 187 ? 0.1737 0.2060 0.1900 -0.0307 0.0151  0.0000  169 MET A CG  
1401 S SD  . MET A 187 ? 0.1848 0.2016 0.1913 -0.0263 0.0111  -0.0045 169 MET A SD  
1402 C CE  . MET A 187 ? 0.1918 0.2025 0.1923 -0.0159 0.0134  -0.0020 169 MET A CE  
1403 N N   . ALA A 188 ? 0.1491 0.2386 0.1904 -0.0376 0.0001  -0.0062 170 ALA A N   
1404 C CA  . ALA A 188 ? 0.1482 0.2580 0.1998 -0.0442 -0.0044 -0.0075 170 ALA A CA  
1405 C C   . ALA A 188 ? 0.1608 0.2659 0.2149 -0.0588 -0.0046 -0.0090 170 ALA A C   
1406 O O   . ALA A 188 ? 0.1663 0.2482 0.2104 -0.0623 -0.0034 -0.0109 170 ALA A O   
1407 C CB  . ALA A 188 ? 0.1475 0.2581 0.1940 -0.0415 -0.0114 -0.0114 170 ALA A CB  
1408 N N   . GLN A 189 ? 0.1627 0.2899 0.2302 -0.0673 -0.0062 -0.0079 171 GLN A N   
1409 C CA  . GLN A 189 ? 0.1801 0.3032 0.2503 -0.0831 -0.0075 -0.0096 171 GLN A CA  
1410 C C   . GLN A 189 ? 0.1900 0.2956 0.2489 -0.0877 -0.0143 -0.0169 171 GLN A C   
1411 O O   . GLN A 189 ? 0.2005 0.2846 0.2517 -0.0961 -0.0138 -0.0193 171 GLN A O   
1412 C CB  . GLN A 189 ? 0.1822 0.3367 0.2705 -0.0920 -0.0093 -0.0076 171 GLN A CB  
1413 C CG  . GLN A 189 ? 0.2049 0.3540 0.2958 -0.1110 -0.0118 -0.0097 171 GLN A CG  
1414 N N   . GLU A 190 ? 0.1880 0.3018 0.2445 -0.0813 -0.0202 -0.0201 172 GLU A N   
1415 C CA  . GLU A 190 ? 0.2020 0.3024 0.2473 -0.0855 -0.0266 -0.0272 172 GLU A CA  
1416 C C   . GLU A 190 ? 0.1895 0.2938 0.2282 -0.0729 -0.0299 -0.0282 172 GLU A C   
1417 O O   . GLU A 190 ? 0.1788 0.3053 0.2260 -0.0671 -0.0320 -0.0253 172 GLU A O   
1418 C CB  . GLU A 190 ? 0.2351 0.3490 0.2878 -0.1001 -0.0337 -0.0311 172 GLU A CB  
1419 C CG  . GLU A 190 ? 0.2677 0.3617 0.3052 -0.1049 -0.0395 -0.0394 172 GLU A CG  
1420 C CD  . GLU A 190 ? 0.3054 0.4047 0.3470 -0.1216 -0.0462 -0.0442 172 GLU A CD  
1421 O OE1 . GLU A 190 ? 0.3554 0.4287 0.3841 -0.1289 -0.0476 -0.0503 172 GLU A OE1 
1422 O OE2 . GLU A 190 ? 0.3090 0.4375 0.3655 -0.1267 -0.0506 -0.0425 172 GLU A OE2 
1423 N N   . GLY A 191 ? 0.1836 0.2661 0.2072 -0.0688 -0.0299 -0.0319 173 GLY A N   
1424 C CA  . GLY A 191 ? 0.1808 0.2641 0.1956 -0.0591 -0.0331 -0.0332 173 GLY A CA  
1425 C C   . GLY A 191 ? 0.1589 0.2405 0.1719 -0.0462 -0.0285 -0.0281 173 GLY A C   
1426 O O   . GLY A 191 ? 0.1505 0.2216 0.1635 -0.0436 -0.0223 -0.0252 173 GLY A O   
1427 N N   . VAL A 192 ? 0.1536 0.2449 0.1640 -0.0385 -0.0322 -0.0269 174 VAL A N   
1428 C CA  . VAL A 192 ? 0.1425 0.2296 0.1488 -0.0264 -0.0287 -0.0223 174 VAL A CA  
1429 C C   . VAL A 192 ? 0.1380 0.2457 0.1513 -0.0203 -0.0326 -0.0187 174 VAL A C   
1430 O O   . VAL A 192 ? 0.1430 0.2612 0.1544 -0.0211 -0.0392 -0.0205 174 VAL A O   
1431 C CB  . VAL A 192 ? 0.1490 0.2203 0.1401 -0.0222 -0.0288 -0.0242 174 VAL A CB  
1432 C CG1 . VAL A 192 ? 0.1429 0.2103 0.1311 -0.0119 -0.0256 -0.0189 174 VAL A CG1 
1433 C CG2 . VAL A 192 ? 0.1560 0.2079 0.1405 -0.0270 -0.0251 -0.0281 174 VAL A CG2 
1434 N N   . ILE A 193 ? 0.1258 0.2405 0.1472 -0.0143 -0.0288 -0.0140 175 ILE A N   
1435 C CA  . ILE A 193 ? 0.1253 0.2615 0.1556 -0.0077 -0.0318 -0.0105 175 ILE A CA  
1436 C C   . ILE A 193 ? 0.1222 0.2507 0.1460 0.0049  -0.0298 -0.0063 175 ILE A C   
1437 O O   . ILE A 193 ? 0.1164 0.2331 0.1384 0.0082  -0.0240 -0.0046 175 ILE A O   
1438 C CB  . ILE A 193 ? 0.1220 0.2749 0.1679 -0.0105 -0.0284 -0.0085 175 ILE A CB  
1439 C CG1 A ILE A 193 ? 0.1279 0.2868 0.1807 -0.0252 -0.0301 -0.0121 175 ILE A CG1 
1440 C CG1 B ILE A 193 ? 0.1272 0.2838 0.1795 -0.0252 -0.0292 -0.0120 175 ILE A CG1 
1441 C CG2 . ILE A 193 ? 0.1215 0.2998 0.1778 -0.0020 -0.0315 -0.0050 175 ILE A CG2 
1442 C CD1 A ILE A 193 ? 0.1251 0.2983 0.1923 -0.0301 -0.0254 -0.0095 175 ILE A CD1 
1443 C CD1 B ILE A 193 ? 0.1344 0.3077 0.1911 -0.0324 -0.0375 -0.0152 175 ILE A CD1 
1444 N N   . LEU A 194 ? 0.1277 0.2627 0.1475 0.0120  -0.0350 -0.0044 176 LEU A N   
1445 C CA  . LEU A 194 ? 0.1344 0.2608 0.1469 0.0240  -0.0340 0.0000  176 LEU A CA  
1446 C C   . LEU A 194 ? 0.1366 0.2771 0.1589 0.0335  -0.0327 0.0036  176 LEU A C   
1447 O O   . LEU A 194 ? 0.1285 0.2923 0.1617 0.0344  -0.0364 0.0040  176 LEU A O   
1448 C CB  . LEU A 194 ? 0.1454 0.2719 0.1480 0.0281  -0.0402 0.0013  176 LEU A CB  
1449 C CG  . LEU A 194 ? 0.1546 0.2708 0.1479 0.0399  -0.0402 0.0068  176 LEU A CG  
1450 C CD1 . LEU A 194 ? 0.1566 0.2485 0.1405 0.0389  -0.0344 0.0072  176 LEU A CD1 
1451 C CD2 . LEU A 194 ? 0.1659 0.2858 0.1502 0.0439  -0.0468 0.0091  176 LEU A CD2 
1452 N N   . ASP A 195 ? 0.1419 0.2681 0.1598 0.0401  -0.0276 0.0056  177 ASP A N   
1453 C CA  . ASP A 195 ? 0.1615 0.2944 0.1831 0.0524  -0.0262 0.0089  177 ASP A CA  
1454 C C   . ASP A 195 ? 0.1821 0.2996 0.1902 0.0625  -0.0290 0.0124  177 ASP A C   
1455 O O   . ASP A 195 ? 0.1748 0.2692 0.1716 0.0631  -0.0263 0.0130  177 ASP A O   
1456 C CB  . ASP A 195 ? 0.1598 0.2849 0.1830 0.0535  -0.0190 0.0084  177 ASP A CB  
1457 C CG  . ASP A 195 ? 0.1736 0.3059 0.1999 0.0675  -0.0169 0.0110  177 ASP A CG  
1458 O OD1 . ASP A 195 ? 0.1936 0.3261 0.2157 0.0780  -0.0207 0.0136  177 ASP A OD1 
1459 O OD2 . ASP A 195 ? 0.1673 0.3023 0.1982 0.0681  -0.0111 0.0102  177 ASP A OD2 
1460 N N   . ASP A 196 ? 0.2133 0.3441 0.2228 0.0700  -0.0346 0.0151  178 ASP A N   
1461 C CA  . ASP A 196 ? 0.2512 0.3664 0.2464 0.0786  -0.0378 0.0192  178 ASP A CA  
1462 C C   . ASP A 196 ? 0.2636 0.3672 0.2539 0.0925  -0.0355 0.0225  178 ASP A C   
1463 O O   . ASP A 196 ? 0.3007 0.3882 0.2781 0.1003  -0.0380 0.0267  178 ASP A O   
1464 C CB  . ASP A 196 ? 0.2813 0.4132 0.2769 0.0804  -0.0457 0.0211  178 ASP A CB  
1465 C CG  . ASP A 196 ? 0.3240 0.4380 0.3023 0.0867  -0.0491 0.0260  178 ASP A CG  
1466 O OD1 . ASP A 196 ? 0.3585 0.4490 0.3242 0.0817  -0.0463 0.0264  178 ASP A OD1 
1467 O OD2 . ASP A 196 ? 0.3635 0.4879 0.3415 0.0974  -0.0543 0.0300  178 ASP A OD2 
1468 N N   . VAL A 197 ? 0.2392 0.3497 0.2383 0.0958  -0.0307 0.0208  179 VAL A N   
1469 C CA  . VAL A 197 ? 0.2477 0.3459 0.2413 0.1088  -0.0277 0.0223  179 VAL A CA  
1470 C C   . VAL A 197 ? 0.2302 0.2997 0.2123 0.1042  -0.0232 0.0207  179 VAL A C   
1471 O O   . VAL A 197 ? 0.2493 0.2956 0.2176 0.1101  -0.0242 0.0231  179 VAL A O   
1472 C CB  . VAL A 197 ? 0.2540 0.3749 0.2620 0.1149  -0.0240 0.0209  179 VAL A CB  
1473 C CG1 . VAL A 197 ? 0.2797 0.3869 0.2804 0.1295  -0.0203 0.0215  179 VAL A CG1 
1474 C CG2 . VAL A 197 ? 0.2621 0.4147 0.2832 0.1197  -0.0291 0.0230  179 VAL A CG2 
1475 N N   . ASP A 198 ? 0.1950 0.2651 0.1819 0.0933  -0.0190 0.0170  180 ASP A N   
1476 C CA  . ASP A 198 ? 0.1870 0.2318 0.1634 0.0882  -0.0157 0.0155  180 ASP A CA  
1477 C C   . ASP A 198 ? 0.1761 0.2094 0.1460 0.0773  -0.0176 0.0159  180 ASP A C   
1478 O O   . ASP A 198 ? 0.1764 0.1904 0.1379 0.0731  -0.0159 0.0154  180 ASP A O   
1479 C CB  . ASP A 198 ? 0.1793 0.2257 0.1605 0.0853  -0.0099 0.0121  180 ASP A CB  
1480 C CG  . ASP A 198 ? 0.1619 0.2223 0.1534 0.0731  -0.0083 0.0100  180 ASP A CG  
1481 O OD1 . ASP A 198 ? 0.1550 0.2235 0.1499 0.0667  -0.0117 0.0102  180 ASP A OD1 
1482 O OD2 . ASP A 198 ? 0.1542 0.2168 0.1495 0.0707  -0.0034 0.0081  180 ASP A OD2 
1483 N N   . SER A 199 ? 0.1704 0.2173 0.1441 0.0735  -0.0214 0.0165  181 SER A N   
1484 C CA  . SER A 199 ? 0.1650 0.2041 0.1322 0.0646  -0.0230 0.0167  181 SER A CA  
1485 C C   . SER A 199 ? 0.1517 0.1866 0.1215 0.0541  -0.0190 0.0129  181 SER A C   
1486 O O   . SER A 199 ? 0.1503 0.1686 0.1127 0.0502  -0.0170 0.0130  181 SER A O   
1487 C CB  . SER A 199 ? 0.1820 0.2001 0.1347 0.0684  -0.0244 0.0209  181 SER A CB  
1488 O OG  . SER A 199 ? 0.1852 0.2022 0.1322 0.0622  -0.0265 0.0222  181 SER A OG  
1489 N N   . SER A 200 ? 0.1414 0.1923 0.1218 0.0489  -0.0184 0.0099  182 SER A N   
1490 C CA  . SER A 200 ? 0.1366 0.1845 0.1202 0.0396  -0.0147 0.0065  182 SER A CA  
1491 C C   . SER A 200 ? 0.1336 0.1976 0.1255 0.0325  -0.0166 0.0037  182 SER A C   
1492 O O   . SER A 200 ? 0.1401 0.2204 0.1376 0.0350  -0.0203 0.0043  182 SER A O   
1493 C CB  . SER A 200 ? 0.1362 0.1824 0.1239 0.0410  -0.0100 0.0056  182 SER A CB  
1494 O OG  . SER A 200 ? 0.1333 0.1973 0.1311 0.0443  -0.0093 0.0057  182 SER A OG  
1495 N N   . VAL A 201 ? 0.1288 0.1879 0.1212 0.0240  -0.0143 0.0007  183 VAL A N   
1496 C CA  . VAL A 201 ? 0.1292 0.1997 0.1286 0.0162  -0.0157 -0.0023 183 VAL A CA  
1497 C C   . VAL A 201 ? 0.1305 0.2003 0.1363 0.0110  -0.0110 -0.0034 183 VAL A C   
1498 O O   . VAL A 201 ? 0.1260 0.1843 0.1284 0.0129  -0.0071 -0.0025 183 VAL A O   
1499 C CB  . VAL A 201 ? 0.1317 0.1956 0.1239 0.0103  -0.0179 -0.0053 183 VAL A CB  
1500 C CG1 . VAL A 201 ? 0.1411 0.2066 0.1257 0.0149  -0.0224 -0.0035 183 VAL A CG1 
1501 C CG2 . VAL A 201 ? 0.1316 0.1784 0.1175 0.0078  -0.0138 -0.0064 183 VAL A CG2 
1502 N N   . CYS A 202 ? 0.1370 0.2197 0.1515 0.0043  -0.0120 -0.0051 184 CYS A N   
1503 C CA  . CYS A 202 ? 0.1515 0.2341 0.1717 -0.0024 -0.0080 -0.0057 184 CYS A CA  
1504 C C   . CYS A 202 ? 0.1492 0.2264 0.1670 -0.0123 -0.0105 -0.0098 184 CYS A C   
1505 O O   . CYS A 202 ? 0.1644 0.2530 0.1851 -0.0160 -0.0156 -0.0118 184 CYS A O   
1506 C CB  . CYS A 202 ? 0.1701 0.2753 0.2039 -0.0026 -0.0072 -0.0036 184 CYS A CB  
1507 S SG  . CYS A 202 ? 0.2338 0.3354 0.2716 -0.0097 -0.0009 -0.0026 184 CYS A SG  
1508 N N   . ARG A 203 ? 0.1370 0.1979 0.1497 -0.0165 -0.0074 -0.0112 185 ARG A N   
1509 C CA  . ARG A 203 ? 0.1382 0.1893 0.1460 -0.0243 -0.0092 -0.0157 185 ARG A CA  
1510 C C   . ARG A 203 ? 0.1419 0.1899 0.1544 -0.0329 -0.0065 -0.0158 185 ARG A C   
1511 O O   . ARG A 203 ? 0.1344 0.1811 0.1499 -0.0315 -0.0017 -0.0121 185 ARG A O   
1512 C CB  . ARG A 203 ? 0.1386 0.1710 0.1354 -0.0208 -0.0072 -0.0170 185 ARG A CB  
1513 C CG  . ARG A 203 ? 0.1351 0.1681 0.1260 -0.0133 -0.0089 -0.0161 185 ARG A CG  
1514 C CD  . ARG A 203 ? 0.1357 0.1537 0.1191 -0.0101 -0.0056 -0.0160 185 ARG A CD  
1515 N NE  . ARG A 203 ? 0.1335 0.1493 0.1096 -0.0053 -0.0066 -0.0154 185 ARG A NE  
1516 C CZ  . ARG A 203 ? 0.1285 0.1427 0.1032 0.0000  -0.0053 -0.0116 185 ARG A CZ  
1517 N NH1 . ARG A 203 ? 0.1225 0.1376 0.1019 0.0024  -0.0036 -0.0088 185 ARG A NH1 
1518 N NH2 . ARG A 203 ? 0.1309 0.1418 0.0987 0.0027  -0.0055 -0.0107 185 ARG A NH2 
1519 N N   . ASP A 204 ? 0.1512 0.1971 0.1633 -0.0422 -0.0097 -0.0199 186 ASP A N   
1520 C CA  . ASP A 204 ? 0.1641 0.2027 0.1787 -0.0518 -0.0073 -0.0198 186 ASP A CA  
1521 C C   . ASP A 204 ? 0.1732 0.1878 0.1781 -0.0497 -0.0030 -0.0197 186 ASP A C   
1522 O O   . ASP A 204 ? 0.1609 0.1657 0.1575 -0.0419 -0.0025 -0.0209 186 ASP A O   
1523 C CB  . ASP A 204 ? 0.1779 0.2211 0.1955 -0.0637 -0.0123 -0.0240 186 ASP A CB  
1524 C CG  . ASP A 204 ? 0.1953 0.2205 0.2002 -0.0664 -0.0158 -0.0309 186 ASP A CG  
1525 O OD1 . ASP A 204 ? 0.2005 0.2059 0.1948 -0.0615 -0.0131 -0.0323 186 ASP A OD1 
1526 O OD2 . ASP A 204 ? 0.2056 0.2376 0.2113 -0.0739 -0.0218 -0.0354 186 ASP A OD2 
1527 N N   . LEU A 205 ? 0.1873 0.1936 0.1935 -0.0566 0.0000  -0.0178 187 LEU A N   
1528 C CA  . LEU A 205 ? 0.1991 0.1835 0.1963 -0.0536 0.0038  -0.0168 187 LEU A CA  
1529 C C   . LEU A 205 ? 0.2073 0.1732 0.1929 -0.0521 0.0015  -0.0229 187 LEU A C   
1530 O O   . LEU A 205 ? 0.2077 0.1615 0.1862 -0.0441 0.0038  -0.0226 187 LEU A O   
1531 C CB  . LEU A 205 ? 0.2162 0.1928 0.2152 -0.0621 0.0071  -0.0134 187 LEU A CB  
1532 C CG  . LEU A 205 ? 0.2152 0.2059 0.2225 -0.0616 0.0117  -0.0065 187 LEU A CG  
1533 C CD1 . LEU A 205 ? 0.2315 0.2186 0.2420 -0.0734 0.0143  -0.0031 187 LEU A CD1 
1534 C CD2 . LEU A 205 ? 0.2098 0.1953 0.2121 -0.0504 0.0152  -0.0032 187 LEU A CD2 
1535 N N   . ASP A 206 ? 0.2212 0.1856 0.2049 -0.0596 -0.0028 -0.0283 188 ASP A N   
1536 C CA  . ASP A 206 ? 0.2400 0.1870 0.2112 -0.0579 -0.0048 -0.0350 188 ASP A CA  
1537 C C   . ASP A 206 ? 0.2166 0.1690 0.1835 -0.0471 -0.0051 -0.0363 188 ASP A C   
1538 O O   . ASP A 206 ? 0.2175 0.1563 0.1755 -0.0403 -0.0030 -0.0381 188 ASP A O   
1539 C CB  . ASP A 206 ? 0.2744 0.2191 0.2432 -0.0685 -0.0101 -0.0413 188 ASP A CB  
1540 C CG  . ASP A 206 ? 0.3187 0.2516 0.2891 -0.0803 -0.0094 -0.0404 188 ASP A CG  
1541 O OD1 . ASP A 206 ? 0.3438 0.2592 0.3100 -0.0788 -0.0050 -0.0373 188 ASP A OD1 
1542 O OD2 . ASP A 206 ? 0.3670 0.3087 0.3429 -0.0918 -0.0136 -0.0424 188 ASP A OD2 
1543 N N   . VAL A 207 ? 0.1918 0.1643 0.1655 -0.0450 -0.0071 -0.0342 189 VAL A N   
1544 C CA  . VAL A 207 ? 0.1782 0.1560 0.1479 -0.0357 -0.0073 -0.0340 189 VAL A CA  
1545 C C   . VAL A 207 ? 0.1699 0.1423 0.1392 -0.0277 -0.0024 -0.0295 189 VAL A C   
1546 O O   . VAL A 207 ? 0.1678 0.1336 0.1303 -0.0214 -0.0008 -0.0306 189 VAL A O   
1547 C CB  . VAL A 207 ? 0.1694 0.1677 0.1453 -0.0349 -0.0109 -0.0322 189 VAL A CB  
1548 C CG1 . VAL A 207 ? 0.1597 0.1608 0.1307 -0.0258 -0.0105 -0.0305 189 VAL A CG1 
1549 C CG2 . VAL A 207 ? 0.1838 0.1881 0.1587 -0.0424 -0.0169 -0.0373 189 VAL A CG2 
1550 N N   . VAL A 208 ? 0.1597 0.1359 0.1362 -0.0277 0.0001  -0.0244 190 VAL A N   
1551 C CA  . VAL A 208 ? 0.1553 0.1275 0.1311 -0.0208 0.0037  -0.0205 190 VAL A CA  
1552 C C   . VAL A 208 ? 0.1672 0.1219 0.1359 -0.0190 0.0060  -0.0221 190 VAL A C   
1553 O O   . VAL A 208 ? 0.1652 0.1170 0.1306 -0.0120 0.0076  -0.0216 190 VAL A O   
1554 C CB  . VAL A 208 ? 0.1482 0.1274 0.1312 -0.0213 0.0059  -0.0153 190 VAL A CB  
1555 C CG1 . VAL A 208 ? 0.1482 0.1217 0.1289 -0.0148 0.0089  -0.0120 190 VAL A CG1 
1556 C CG2 . VAL A 208 ? 0.1402 0.1367 0.1296 -0.0199 0.0040  -0.0138 190 VAL A CG2 
1557 N N   . ARG A 209 ? 0.1813 0.1246 0.1479 -0.0248 0.0063  -0.0237 191 ARG A N   
1558 C CA  . ARG A 209 ? 0.2044 0.1290 0.1631 -0.0216 0.0083  -0.0252 191 ARG A CA  
1559 C C   . ARG A 209 ? 0.2052 0.1252 0.1562 -0.0165 0.0076  -0.0307 191 ARG A C   
1560 O O   . ARG A 209 ? 0.2048 0.1164 0.1511 -0.0093 0.0099  -0.0309 191 ARG A O   
1561 C CB  . ARG A 209 ? 0.2358 0.1458 0.1919 -0.0295 0.0084  -0.0261 191 ARG A CB  
1562 C CG  . ARG A 209 ? 0.2575 0.1692 0.2192 -0.0333 0.0108  -0.0196 191 ARG A CG  
1563 C CD  . ARG A 209 ? 0.3034 0.1973 0.2609 -0.0420 0.0111  -0.0202 191 ARG A CD  
1564 N NE  . ARG A 209 ? 0.3375 0.2378 0.3019 -0.0497 0.0130  -0.0144 191 ARG A NE  
1565 C CZ  . ARG A 209 ? 0.3556 0.2635 0.3263 -0.0614 0.0115  -0.0147 191 ARG A CZ  
1566 N NH1 . ARG A 209 ? 0.3672 0.2828 0.3444 -0.0668 0.0147  -0.0083 191 ARG A NH1 
1567 N NH2 . ARG A 209 ? 0.3688 0.2766 0.3387 -0.0683 0.0070  -0.0211 191 ARG A NH2 
1568 N N   . ARG A 210 ? 0.2029 0.1292 0.1522 -0.0200 0.0043  -0.0351 192 ARG A N   
1569 C CA  . ARG A 210 ? 0.2116 0.1353 0.1524 -0.0152 0.0040  -0.0402 192 ARG A CA  
1570 C C   . ARG A 210 ? 0.1916 0.1253 0.1343 -0.0069 0.0064  -0.0367 192 ARG A C   
1571 O O   . ARG A 210 ? 0.1932 0.1224 0.1305 -0.0001 0.0090  -0.0384 192 ARG A O   
1572 C CB  . ARG A 210 ? 0.2254 0.1560 0.1635 -0.0210 -0.0006 -0.0450 192 ARG A CB  
1573 C CG  . ARG A 210 ? 0.2486 0.1770 0.1759 -0.0162 -0.0008 -0.0506 192 ARG A CG  
1574 C CD  . ARG A 210 ? 0.2649 0.2047 0.1904 -0.0210 -0.0060 -0.0534 192 ARG A CD  
1575 N NE  . ARG A 210 ? 0.2625 0.2200 0.1947 -0.0178 -0.0062 -0.0475 192 ARG A NE  
1576 C CZ  . ARG A 210 ? 0.2802 0.2523 0.2171 -0.0211 -0.0106 -0.0457 192 ARG A CZ  
1577 N NH1 . ARG A 210 ? 0.2926 0.2680 0.2322 -0.0292 -0.0153 -0.0486 192 ARG A NH1 
1578 N NH2 . ARG A 210 ? 0.2798 0.2637 0.2202 -0.0162 -0.0100 -0.0401 192 ARG A NH2 
1579 N N   . ILE A 211 ? 0.1695 0.1172 0.1199 -0.0074 0.0056  -0.0318 193 ILE A N   
1580 C CA  . ILE A 211 ? 0.1589 0.1151 0.1112 -0.0016 0.0072  -0.0282 193 ILE A CA  
1581 C C   . ILE A 211 ? 0.1586 0.1095 0.1124 0.0035  0.0105  -0.0253 193 ILE A C   
1582 O O   . ILE A 211 ? 0.1531 0.1064 0.1055 0.0090  0.0126  -0.0248 193 ILE A O   
1583 C CB  . ILE A 211 ? 0.1468 0.1156 0.1054 -0.0030 0.0053  -0.0239 193 ILE A CB  
1584 C CG1 . ILE A 211 ? 0.1517 0.1276 0.1080 -0.0061 0.0016  -0.0265 193 ILE A CG1 
1585 C CG2 . ILE A 211 ? 0.1398 0.1135 0.0996 0.0018  0.0070  -0.0199 193 ILE A CG2 
1586 C CD1 . ILE A 211 ? 0.1450 0.1328 0.1073 -0.0067 -0.0007 -0.0227 193 ILE A CD1 
1587 N N   . ILE A 212 ? 0.1607 0.1055 0.1175 0.0016  0.0110  -0.0230 194 ILE A N   
1588 C CA  . ILE A 212 ? 0.1658 0.1055 0.1232 0.0065  0.0133  -0.0201 194 ILE A CA  
1589 C C   . ILE A 212 ? 0.1782 0.1082 0.1295 0.0120  0.0152  -0.0234 194 ILE A C   
1590 O O   . ILE A 212 ? 0.1774 0.1109 0.1298 0.0186  0.0169  -0.0217 194 ILE A O   
1591 C CB  . ILE A 212 ? 0.1712 0.1041 0.1304 0.0031  0.0136  -0.0171 194 ILE A CB  
1592 C CG1 . ILE A 212 ? 0.1628 0.1068 0.1280 0.0005  0.0128  -0.0132 194 ILE A CG1 
1593 C CG2 . ILE A 212 ? 0.1771 0.1007 0.1340 0.0086  0.0155  -0.0146 194 ILE A CG2 
1594 C CD1 . ILE A 212 ? 0.1690 0.1099 0.1362 -0.0044 0.0136  -0.0107 194 ILE A CD1 
1595 N N   . CYS A 213 ? 0.1936 0.1115 0.1384 0.0095  0.0147  -0.0284 195 CYS A N   
1596 C CA  . CYS A 213 ? 0.2174 0.1239 0.1543 0.0156  0.0166  -0.0328 195 CYS A CA  
1597 C C   . CYS A 213 ? 0.2044 0.1222 0.1399 0.0213  0.0182  -0.0348 195 CYS A C   
1598 O O   . CYS A 213 ? 0.1979 0.1156 0.1322 0.0298  0.0211  -0.0349 195 CYS A O   
1599 C CB  . CYS A 213 ? 0.2499 0.1402 0.1785 0.0104  0.0151  -0.0387 195 CYS A CB  
1600 S SG  . CYS A 213 ? 0.3254 0.1977 0.2411 0.0184  0.0172  -0.0459 195 CYS A SG  
1601 N N   . SER A 214 ? 0.1892 0.1178 0.1252 0.0171  0.0165  -0.0356 196 SER A N   
1602 C CA  A SER A 214 ? 0.1910 0.1302 0.1245 0.0215  0.0184  -0.0367 196 SER A CA  
1603 C CA  B SER A 214 ? 0.1856 0.1254 0.1193 0.0211  0.0182  -0.0365 196 SER A CA  
1604 C C   . SER A 214 ? 0.1745 0.1263 0.1158 0.0258  0.0206  -0.0308 196 SER A C   
1605 O O   . SER A 214 ? 0.1761 0.1355 0.1162 0.0309  0.0236  -0.0312 196 SER A O   
1606 C CB  A SER A 214 ? 0.1932 0.1408 0.1245 0.0164  0.0158  -0.0377 196 SER A CB  
1607 C CB  B SER A 214 ? 0.1799 0.1287 0.1126 0.0154  0.0153  -0.0368 196 SER A CB  
1608 O OG  A SER A 214 ? 0.1856 0.1427 0.1253 0.0129  0.0140  -0.0319 196 SER A OG  
1609 O OG  B SER A 214 ? 0.1874 0.1277 0.1130 0.0107  0.0123  -0.0428 196 SER A OG  
1610 N N   . ALA A 215 ? 0.1643 0.1186 0.1132 0.0234  0.0191  -0.0258 197 ALA A N   
1611 C CA  . ALA A 215 ? 0.1553 0.1205 0.1115 0.0263  0.0202  -0.0206 197 ALA A CA  
1612 C C   . ALA A 215 ? 0.1626 0.1250 0.1203 0.0333  0.0222  -0.0199 197 ALA A C   
1613 O O   . ALA A 215 ? 0.1588 0.1309 0.1232 0.0354  0.0223  -0.0158 197 ALA A O   
1614 C CB  . ALA A 215 ? 0.1418 0.1104 0.1034 0.0216  0.0176  -0.0162 197 ALA A CB  
1615 N N   . GLY A 216 ? 0.1748 0.1230 0.1263 0.0369  0.0232  -0.0238 198 GLY A N   
1616 C CA  . GLY A 216 ? 0.1865 0.1307 0.1384 0.0455  0.0250  -0.0229 198 GLY A CA  
1617 C C   . GLY A 216 ? 0.1847 0.1234 0.1398 0.0446  0.0229  -0.0183 198 GLY A C   
1618 O O   . GLY A 216 ? 0.1902 0.1307 0.1480 0.0515  0.0233  -0.0155 198 GLY A O   
1619 N N   . LEU A 217 ? 0.1758 0.1083 0.1302 0.0367  0.0207  -0.0174 199 LEU A N   
1620 C CA  . LEU A 217 ? 0.1743 0.1012 0.1300 0.0352  0.0193  -0.0130 199 LEU A CA  
1621 C C   . LEU A 217 ? 0.1834 0.0908 0.1323 0.0324  0.0195  -0.0143 199 LEU A C   
1622 O O   . LEU A 217 ? 0.1888 0.0875 0.1325 0.0293  0.0197  -0.0192 199 LEU A O   
1623 C CB  . LEU A 217 ? 0.1651 0.1019 0.1258 0.0285  0.0174  -0.0102 199 LEU A CB  
1624 C CG  . LEU A 217 ? 0.1572 0.1099 0.1238 0.0298  0.0167  -0.0080 199 LEU A CG  
1625 C CD1 . LEU A 217 ? 0.1537 0.1128 0.1229 0.0235  0.0148  -0.0065 199 LEU A CD1 
1626 C CD2 . LEU A 217 ? 0.1591 0.1149 0.1284 0.0349  0.0159  -0.0042 199 LEU A CD2 
1627 N N   . SER A 218 ? 0.1821 0.0821 0.1301 0.0335  0.0193  -0.0097 200 SER A N   
1628 C CA  . SER A 218 ? 0.2019 0.0824 0.1432 0.0304  0.0198  -0.0092 200 SER A CA  
1629 C C   . SER A 218 ? 0.2013 0.0840 0.1449 0.0242  0.0193  -0.0039 200 SER A C   
1630 O O   . SER A 218 ? 0.1855 0.0796 0.1332 0.0265  0.0185  -0.0001 200 SER A O   
1631 C CB  . SER A 218 ? 0.2173 0.0834 0.1526 0.0395  0.0208  -0.0077 200 SER A CB  
1632 O OG  . SER A 218 ? 0.2219 0.0845 0.1537 0.0467  0.0220  -0.0133 200 SER A OG  
1633 N N   . LEU A 219 ? 0.2188 0.0893 0.1589 0.0167  0.0199  -0.0037 201 LEU A N   
1634 C CA  A LEU A 219 ? 0.2200 0.0934 0.1621 0.0108  0.0205  0.0016  201 LEU A CA  
1635 C CA  B LEU A 219 ? 0.2211 0.0943 0.1631 0.0108  0.0205  0.0016  201 LEU A CA  
1636 C C   . LEU A 219 ? 0.2345 0.0956 0.1705 0.0152  0.0216  0.0076  201 LEU A C   
1637 O O   . LEU A 219 ? 0.2497 0.0913 0.1783 0.0165  0.0223  0.0079  201 LEU A O   
1638 C CB  A LEU A 219 ? 0.2313 0.1012 0.1742 -0.0004 0.0210  0.0004  201 LEU A CB  
1639 C CB  B LEU A 219 ? 0.2345 0.1029 0.1767 -0.0002 0.0209  0.0000  201 LEU A CB  
1640 C CG  A LEU A 219 ? 0.2215 0.1084 0.1718 -0.0058 0.0196  -0.0031 201 LEU A CG  
1641 C CG  B LEU A 219 ? 0.2248 0.1104 0.1744 -0.0050 0.0194  -0.0036 201 LEU A CG  
1642 C CD1 A LEU A 219 ? 0.2233 0.1101 0.1722 -0.0036 0.0179  -0.0096 201 LEU A CD1 
1643 C CD1 B LEU A 219 ? 0.2413 0.1192 0.1897 -0.0147 0.0187  -0.0072 201 LEU A CD1 
1644 C CD2 A LEU A 219 ? 0.2289 0.1155 0.1817 -0.0169 0.0202  -0.0019 201 LEU A CD2 
1645 C CD2 B LEU A 219 ? 0.2139 0.1134 0.1687 -0.0062 0.0204  0.0014  201 LEU A CD2 
1646 N N   . LEU A 220 ? 0.2254 0.0966 0.1632 0.0169  0.0215  0.0125  202 LEU A N   
1647 C CA  . LEU A 220 ? 0.2406 0.1025 0.1720 0.0194  0.0224  0.0192  202 LEU A CA  
1648 C C   . LEU A 220 ? 0.2484 0.1066 0.1781 0.0100  0.0252  0.0233  202 LEU A C   
1649 O O   . LEU A 220 ? 0.2662 0.1090 0.1882 0.0092  0.0269  0.0289  202 LEU A O   
1650 C CB  . LEU A 220 ? 0.2345 0.1098 0.1673 0.0262  0.0205  0.0222  202 LEU A CB  
1651 C CG  . LEU A 220 ? 0.2370 0.1184 0.1723 0.0357  0.0178  0.0200  202 LEU A CG  
1652 C CD1 . LEU A 220 ? 0.2367 0.1336 0.1746 0.0389  0.0152  0.0221  202 LEU A CD1 
1653 C CD2 . LEU A 220 ? 0.2594 0.1250 0.1880 0.0436  0.0179  0.0222  202 LEU A CD2 
1654 N N   . ALA A 221 ? 0.2349 0.1078 0.1717 0.0034  0.0257  0.0213  203 ALA A N   
1655 C CA  . ALA A 221 ? 0.2482 0.1230 0.1858 -0.0053 0.0288  0.0251  203 ALA A CA  
1656 C C   . ALA A 221 ? 0.2340 0.1260 0.1812 -0.0112 0.0285  0.0209  203 ALA A C   
1657 O O   . ALA A 221 ? 0.2168 0.1196 0.1685 -0.0074 0.0262  0.0166  203 ALA A O   
1658 C CB  . ALA A 221 ? 0.2524 0.1315 0.1856 -0.0015 0.0303  0.0313  203 ALA A CB  
1659 N N   . GLU A 222 ? 0.2498 0.1443 0.2003 -0.0208 0.0310  0.0227  204 GLU A N   
1660 C CA  . GLU A 222 ? 0.2466 0.1591 0.2070 -0.0263 0.0307  0.0194  204 GLU A CA  
1661 C C   . GLU A 222 ? 0.2444 0.1650 0.2076 -0.0330 0.0351  0.0251  204 GLU A C   
1662 O O   . GLU A 222 ? 0.2613 0.1692 0.2199 -0.0389 0.0378  0.0298  204 GLU A O   
1663 C CB  . GLU A 222 ? 0.2804 0.1873 0.2432 -0.0327 0.0281  0.0139  204 GLU A CB  
1664 C CG  . GLU A 222 ? 0.3061 0.2299 0.2786 -0.0393 0.0267  0.0106  204 GLU A CG  
1665 C CD  . GLU A 222 ? 0.3492 0.2638 0.3211 -0.0464 0.0235  0.0050  204 GLU A CD  
1666 O OE1 . GLU A 222 ? 0.3657 0.2696 0.3320 -0.0417 0.0209  0.0001  204 GLU A OE1 
1667 O OE2 . GLU A 222 ? 0.4021 0.3214 0.3793 -0.0573 0.0235  0.0052  204 GLU A OE2 
1668 N N   . GLU A 223 ? 0.2195 0.1600 0.1892 -0.0317 0.0364  0.0252  205 GLU A N   
1669 C CA  . GLU A 223 ? 0.2291 0.1799 0.2015 -0.0366 0.0416  0.0308  205 GLU A CA  
1670 C C   . GLU A 223 ? 0.2029 0.1772 0.1866 -0.0375 0.0418  0.0283  205 GLU A C   
1671 O O   . GLU A 223 ? 0.1828 0.1643 0.1673 -0.0296 0.0394  0.0248  205 GLU A O   
1672 C CB  . GLU A 223 ? 0.2490 0.1972 0.2123 -0.0289 0.0442  0.0354  205 GLU A CB  
1673 C CG  . GLU A 223 ? 0.2751 0.2333 0.2382 -0.0319 0.0505  0.0416  205 GLU A CG  
1674 C CD  . GLU A 223 ? 0.2977 0.2506 0.2487 -0.0230 0.0518  0.0451  205 GLU A CD  
1675 O OE1 . GLU A 223 ? 0.3448 0.2803 0.2861 -0.0226 0.0518  0.0492  205 GLU A OE1 
1676 O OE2 . GLU A 223 ? 0.2825 0.2470 0.2330 -0.0159 0.0520  0.0430  205 GLU A OE2 
1677 N N   . ARG A 224 ? 0.2017 0.1874 0.1935 -0.0469 0.0448  0.0310  206 ARG A N   
1678 C CA  . ARG A 224 ? 0.1933 0.2044 0.1967 -0.0470 0.0459  0.0300  206 ARG A CA  
1679 C C   . ARG A 224 ? 0.1889 0.2113 0.1898 -0.0394 0.0513  0.0338  206 ARG A C   
1680 O O   . ARG A 224 ? 0.1984 0.2153 0.1929 -0.0412 0.0563  0.0397  206 ARG A O   
1681 C CB  . ARG A 224 ? 0.2076 0.2299 0.2217 -0.0602 0.0475  0.0321  206 ARG A CB  
1682 C CG  . ARG A 224 ? 0.2046 0.2554 0.2328 -0.0594 0.0468  0.0299  206 ARG A CG  
1683 C CD  . ARG A 224 ? 0.2236 0.2884 0.2643 -0.0731 0.0467  0.0310  206 ARG A CD  
1684 N NE  . ARG A 224 ? 0.2249 0.3207 0.2789 -0.0695 0.0480  0.0311  206 ARG A NE  
1685 C CZ  . ARG A 224 ? 0.2440 0.3622 0.3125 -0.0795 0.0490  0.0331  206 ARG A CZ  
1686 N NH1 . ARG A 224 ? 0.2704 0.3819 0.3416 -0.0953 0.0484  0.0346  206 ARG A NH1 
1687 N NH2 . ARG A 224 ? 0.2386 0.3865 0.3191 -0.0737 0.0508  0.0337  206 ARG A NH2 
1688 N N   . GLN A 225 ? 0.1785 0.2154 0.1833 -0.0310 0.0503  0.0306  207 GLN A N   
1689 C CA  . GLN A 225 ? 0.1781 0.2269 0.1804 -0.0229 0.0554  0.0328  207 GLN A CA  
1690 C C   . GLN A 225 ? 0.1833 0.2537 0.1961 -0.0291 0.0616  0.0373  207 GLN A C   
1691 O O   . GLN A 225 ? 0.1785 0.2663 0.2049 -0.0336 0.0602  0.0359  207 GLN A O   
1692 C CB  . GLN A 225 ? 0.1680 0.2241 0.1713 -0.0121 0.0521  0.0277  207 GLN A CB  
1693 C CG  . GLN A 225 ? 0.1692 0.2359 0.1687 -0.0027 0.0571  0.0287  207 GLN A CG  
1694 C CD  . GLN A 225 ? 0.1782 0.2303 0.1625 0.0015  0.0594  0.0307  207 GLN A CD  
1695 O OE1 . GLN A 225 ? 0.1773 0.2117 0.1526 0.0044  0.0545  0.0283  207 GLN A OE1 
1696 N NE2 . GLN A 225 ? 0.1871 0.2479 0.1682 0.0025  0.0666  0.0352  207 GLN A NE2 
1697 N N   . GLU A 226 ? 0.1965 0.2676 0.2031 -0.0292 0.0684  0.0431  208 GLU A N   
1698 C CA  . GLU A 226 ? 0.2095 0.3029 0.2252 -0.0345 0.0759  0.0484  208 GLU A CA  
1699 C C   . GLU A 226 ? 0.1949 0.3089 0.2123 -0.0224 0.0802  0.0472  208 GLU A C   
1700 O O   . GLU A 226 ? 0.1757 0.2824 0.1845 -0.0106 0.0775  0.0427  208 GLU A O   
1701 C CB  A GLU A 226 ? 0.2443 0.3275 0.2510 -0.0412 0.0820  0.0562  208 GLU A CB  
1702 C CB  B GLU A 226 ? 0.2258 0.3092 0.2328 -0.0414 0.0821  0.0563  208 GLU A CB  
1703 C CG  A GLU A 226 ? 0.2720 0.3303 0.2736 -0.0512 0.0784  0.0579  208 GLU A CG  
1704 C CG  B GLU A 226 ? 0.2373 0.2963 0.2395 -0.0518 0.0785  0.0581  208 GLU A CG  
1705 C CD  A GLU A 226 ? 0.3142 0.3606 0.3049 -0.0565 0.0845  0.0666  208 GLU A CD  
1706 C CD  B GLU A 226 ? 0.2434 0.3098 0.2593 -0.0673 0.0781  0.0595  208 GLU A CD  
1707 O OE1 A GLU A 226 ? 0.3559 0.4008 0.3516 -0.0700 0.0869  0.0715  208 GLU A OE1 
1708 O OE1 B GLU A 226 ? 0.2429 0.3360 0.2727 -0.0717 0.0817  0.0611  208 GLU A OE1 
1709 O OE2 A GLU A 226 ? 0.3451 0.3837 0.3216 -0.0475 0.0870  0.0689  208 GLU A OE2 
1710 O OE2 B GLU A 226 ? 0.2547 0.2999 0.2670 -0.0752 0.0738  0.0588  208 GLU A OE2 
1711 N N   . ASN A 227 ? 0.1914 0.3317 0.2210 -0.0263 0.0867  0.0513  209 ASN A N   
1712 C CA  . ASN A 227 ? 0.1969 0.3585 0.2280 -0.0150 0.0930  0.0514  209 ASN A CA  
1713 C C   . ASN A 227 ? 0.1894 0.3592 0.2250 -0.0028 0.0882  0.0445  209 ASN A C   
1714 O O   . ASN A 227 ? 0.1877 0.3632 0.2173 0.0103  0.0915  0.0425  209 ASN A O   
1715 C CB  . ASN A 227 ? 0.2077 0.3565 0.2196 -0.0071 0.0983  0.0536  209 ASN A CB  
1716 C CG  . ASN A 227 ? 0.2237 0.3681 0.2312 -0.0182 0.1044  0.0620  209 ASN A CG  
1717 O OD1 . ASN A 227 ? 0.2293 0.3951 0.2478 -0.0259 0.1113  0.0677  209 ASN A OD1 
1718 N ND2 . ASN A 227 ? 0.2382 0.3551 0.2295 -0.0192 0.1018  0.0633  209 ASN A ND2 
1719 N N   . LEU A 228 ? 0.1816 0.3504 0.2264 -0.0071 0.0804  0.0408  210 LEU A N   
1720 C CA  . LEU A 228 ? 0.1763 0.3552 0.2272 0.0030  0.0757  0.0355  210 LEU A CA  
1721 C C   . LEU A 228 ? 0.1729 0.3866 0.2436 0.0020  0.0782  0.0373  210 LEU A C   
1722 O O   . LEU A 228 ? 0.1703 0.3992 0.2527 -0.0108 0.0813  0.0419  210 LEU A O   
1723 C CB  . LEU A 228 ? 0.1759 0.3378 0.2262 -0.0009 0.0658  0.0310  210 LEU A CB  
1724 C CG  . LEU A 228 ? 0.1834 0.3137 0.2166 0.0009  0.0621  0.0287  210 LEU A CG  
1725 C CD1 . LEU A 228 ? 0.1818 0.3003 0.2161 -0.0016 0.0533  0.0243  210 LEU A CD1 
1726 C CD2 . LEU A 228 ? 0.1899 0.3124 0.2103 0.0149  0.0637  0.0264  210 LEU A CD2 
1727 N N   . PRO A 229 ? 0.1698 0.3961 0.2440 0.0158  0.0767  0.0339  211 PRO A N   
1728 C CA  . PRO A 229 ? 0.1715 0.4323 0.2655 0.0169  0.0775  0.0351  211 PRO A CA  
1729 C C   . PRO A 229 ? 0.1688 0.4365 0.2765 0.0015  0.0707  0.0353  211 PRO A C   
1730 O O   . PRO A 229 ? 0.1600 0.4044 0.2604 -0.0022 0.0630  0.0318  211 PRO A O   
1731 C CB  . PRO A 229 ? 0.1703 0.4305 0.2603 0.0348  0.0740  0.0304  211 PRO A CB  
1732 C CG  . PRO A 229 ? 0.1758 0.4070 0.2438 0.0443  0.0755  0.0276  211 PRO A CG  
1733 C CD  . PRO A 229 ? 0.1734 0.3807 0.2330 0.0308  0.0734  0.0287  211 PRO A CD  
1734 N N   . ASP A 230 ? 0.1747 0.4742 0.3016 -0.0071 0.0735  0.0393  212 ASP A N   
1735 C CA  A ASP A 230 ? 0.1794 0.4867 0.3194 -0.0234 0.0670  0.0393  212 ASP A CA  
1736 C CA  B ASP A 230 ? 0.1744 0.4812 0.3142 -0.0237 0.0670  0.0392  212 ASP A CA  
1737 C C   . ASP A 230 ? 0.1679 0.4754 0.3112 -0.0190 0.0563  0.0339  212 ASP A C   
1738 O O   . ASP A 230 ? 0.1629 0.4624 0.3083 -0.0315 0.0489  0.0317  212 ASP A O   
1739 C CB  A ASP A 230 ? 0.1951 0.5410 0.3569 -0.0333 0.0718  0.0445  212 ASP A CB  
1740 C CB  B ASP A 230 ? 0.1816 0.5261 0.3429 -0.0343 0.0719  0.0447  212 ASP A CB  
1741 C CG  A ASP A 230 ? 0.2151 0.5582 0.3756 -0.0470 0.0804  0.0509  212 ASP A CG  
1742 C CG  B ASP A 230 ? 0.1855 0.5337 0.3581 -0.0548 0.0653  0.0446  212 ASP A CG  
1743 O OD1 A ASP A 230 ? 0.2385 0.5485 0.3810 -0.0494 0.0816  0.0511  212 ASP A OD1 
1744 O OD1 B ASP A 230 ? 0.1952 0.5160 0.3577 -0.0674 0.0642  0.0449  212 ASP A OD1 
1745 O OD2 A ASP A 230 ? 0.2283 0.6030 0.4061 -0.0556 0.0857  0.0561  212 ASP A OD2 
1746 O OD2 B ASP A 230 ? 0.1839 0.5622 0.3748 -0.0578 0.0607  0.0441  212 ASP A OD2 
1747 N N   . GLU A 231 ? 0.1542 0.4692 0.2963 -0.0012 0.0554  0.0318  213 GLU A N   
1748 C CA  . GLU A 231 ? 0.1489 0.4690 0.2954 0.0037  0.0459  0.0282  213 GLU A CA  
1749 C C   . GLU A 231 ? 0.1369 0.4226 0.2662 0.0066  0.0387  0.0235  213 GLU A C   
1750 O O   . GLU A 231 ? 0.1289 0.4176 0.2606 0.0089  0.0307  0.0210  213 GLU A O   
1751 C CB  . GLU A 231 ? 0.1582 0.5021 0.3116 0.0219  0.0475  0.0286  213 GLU A CB  
1752 C CG  . GLU A 231 ? 0.1695 0.4896 0.3043 0.0398  0.0498  0.0262  213 GLU A CG  
1753 C CD  . GLU A 231 ? 0.1877 0.5091 0.3168 0.0468  0.0607  0.0282  213 GLU A CD  
1754 O OE1 . GLU A 231 ? 0.2129 0.5182 0.3279 0.0629  0.0618  0.0255  213 GLU A OE1 
1755 O OE2 . GLU A 231 ? 0.1913 0.5305 0.3296 0.0374  0.0680  0.0325  213 GLU A OE2 
1756 N N   . ILE A 232 ? 0.1278 0.3832 0.2401 0.0073  0.0417  0.0227  214 ILE A N   
1757 C CA  . ILE A 232 ? 0.1258 0.3507 0.2224 0.0110  0.0358  0.0187  214 ILE A CA  
1758 C C   . ILE A 232 ? 0.1216 0.3280 0.2140 -0.0037 0.0318  0.0172  214 ILE A C   
1759 O O   . ILE A 232 ? 0.1165 0.3258 0.2141 -0.0167 0.0344  0.0193  214 ILE A O   
1760 C CB  . ILE A 232 ? 0.1288 0.3308 0.2084 0.0220  0.0399  0.0179  214 ILE A CB  
1761 C CG1 . ILE A 232 ? 0.1357 0.3250 0.2081 0.0149  0.0461  0.0201  214 ILE A CG1 
1762 C CG2 . ILE A 232 ? 0.1348 0.3509 0.2155 0.0383  0.0437  0.0183  214 ILE A CG2 
1763 C CD1 . ILE A 232 ? 0.1403 0.3057 0.1949 0.0245  0.0482  0.0186  214 ILE A CD1 
1764 N N   . TYR A 233 ? 0.1221 0.3088 0.2046 -0.0013 0.0255  0.0136  215 TYR A N   
1765 C CA  . TYR A 233 ? 0.1264 0.2935 0.2029 -0.0130 0.0221  0.0115  215 TYR A CA  
1766 C C   . TYR A 233 ? 0.1285 0.2780 0.1970 -0.0177 0.0278  0.0134  215 TYR A C   
1767 O O   . TYR A 233 ? 0.1277 0.2692 0.1881 -0.0093 0.0324  0.0148  215 TYR A O   
1768 C CB  . TYR A 233 ? 0.1292 0.2767 0.1942 -0.0077 0.0163  0.0078  215 TYR A CB  
1769 C CG  . TYR A 233 ? 0.1344 0.2949 0.2047 -0.0057 0.0092  0.0059  215 TYR A CG  
1770 C CD1 . TYR A 233 ? 0.1419 0.3085 0.2176 -0.0169 0.0042  0.0038  215 TYR A CD1 
1771 C CD2 . TYR A 233 ? 0.1408 0.3053 0.2088 0.0074  0.0073  0.0062  215 TYR A CD2 
1772 C CE1 . TYR A 233 ? 0.1496 0.3291 0.2292 -0.0152 -0.0028 0.0021  215 TYR A CE1 
1773 C CE2 . TYR A 233 ? 0.1419 0.3182 0.2137 0.0101  0.0004  0.0052  215 TYR A CE2 
1774 C CZ  . TYR A 233 ? 0.1469 0.3317 0.2245 -0.0011 -0.0047 0.0032  215 TYR A CZ  
1775 O OH  . TYR A 233 ? 0.1530 0.3513 0.2338 0.0013  -0.0120 0.0024  215 TYR A OH  
1776 N N   . HIS A 234 ? 0.1341 0.2749 0.2027 -0.0308 0.0270  0.0133  216 HIS A N   
1777 C CA  . HIS A 234 ? 0.1441 0.2645 0.2031 -0.0348 0.0315  0.0155  216 HIS A CA  
1778 C C   . HIS A 234 ? 0.1380 0.2345 0.1823 -0.0262 0.0298  0.0131  216 HIS A C   
1779 O O   . HIS A 234 ? 0.1327 0.2240 0.1737 -0.0215 0.0246  0.0094  216 HIS A O   
1780 C CB  . HIS A 234 ? 0.1583 0.2703 0.2188 -0.0499 0.0300  0.0153  216 HIS A CB  
1781 C CG  . HIS A 234 ? 0.1695 0.3046 0.2450 -0.0610 0.0312  0.0179  216 HIS A CG  
1782 N ND1 . HIS A 234 ? 0.1892 0.3177 0.2668 -0.0765 0.0299  0.0180  216 HIS A ND1 
1783 C CD2 . HIS A 234 ? 0.1701 0.3351 0.2593 -0.0594 0.0340  0.0207  216 HIS A CD2 
1784 C CE1 . HIS A 234 ? 0.1906 0.3449 0.2835 -0.0853 0.0313  0.0209  216 HIS A CE1 
1785 N NE2 . HIS A 234 ? 0.1778 0.3565 0.2789 -0.0747 0.0341  0.0227  216 HIS A NE2 
1786 N N   . VAL A 235 ? 0.1360 0.2195 0.1713 -0.0235 0.0345  0.0156  217 VAL A N   
1787 C CA  . VAL A 235 ? 0.1318 0.1960 0.1546 -0.0158 0.0328  0.0137  217 VAL A CA  
1788 C C   . VAL A 235 ? 0.1396 0.1841 0.1545 -0.0216 0.0340  0.0153  217 VAL A C   
1789 O O   . VAL A 235 ? 0.1416 0.1862 0.1569 -0.0274 0.0386  0.0195  217 VAL A O   
1790 C CB  . VAL A 235 ? 0.1297 0.1969 0.1474 -0.0050 0.0365  0.0151  217 VAL A CB  
1791 C CG1 . VAL A 235 ? 0.1318 0.1790 0.1364 0.0006  0.0351  0.0138  217 VAL A CG1 
1792 C CG2 . VAL A 235 ? 0.1253 0.2087 0.1492 0.0026  0.0350  0.0133  217 VAL A CG2 
1793 N N   . TYR A 236 ? 0.1404 0.1684 0.1481 -0.0198 0.0300  0.0123  218 TYR A N   
1794 C CA  . TYR A 236 ? 0.1495 0.1584 0.1493 -0.0231 0.0307  0.0136  218 TYR A CA  
1795 C C   . TYR A 236 ? 0.1419 0.1387 0.1326 -0.0148 0.0292  0.0125  218 TYR A C   
1796 O O   . TYR A 236 ? 0.1280 0.1273 0.1183 -0.0091 0.0261  0.0095  218 TYR A O   
1797 C CB  . TYR A 236 ? 0.1605 0.1605 0.1611 -0.0302 0.0270  0.0101  218 TYR A CB  
1798 C CG  . TYR A 236 ? 0.1747 0.1801 0.1821 -0.0416 0.0282  0.0115  218 TYR A CG  
1799 C CD1 . TYR A 236 ? 0.1731 0.2000 0.1920 -0.0455 0.0275  0.0111  218 TYR A CD1 
1800 C CD2 . TYR A 236 ? 0.1999 0.1887 0.2025 -0.0491 0.0297  0.0135  218 TYR A CD2 
1801 C CE1 . TYR A 236 ? 0.1871 0.2211 0.2136 -0.0576 0.0281  0.0124  218 TYR A CE1 
1802 C CE2 . TYR A 236 ? 0.2092 0.2011 0.2176 -0.0614 0.0303  0.0147  218 TYR A CE2 
1803 C CZ  . TYR A 236 ? 0.2049 0.2207 0.2259 -0.0662 0.0297  0.0144  218 TYR A CZ  
1804 O OH  . TYR A 236 ? 0.2209 0.2423 0.2492 -0.0797 0.0300  0.0157  218 TYR A OH  
1805 N N   . SER A 237 ? 0.1469 0.1305 0.1301 -0.0147 0.0309  0.0154  219 SER A N   
1806 C CA  . SER A 237 ? 0.1495 0.1220 0.1246 -0.0078 0.0289  0.0147  219 SER A CA  
1807 C C   . SER A 237 ? 0.1570 0.1145 0.1287 -0.0100 0.0271  0.0138  219 SER A C   
1808 O O   . SER A 237 ? 0.1637 0.1137 0.1346 -0.0159 0.0290  0.0160  219 SER A O   
1809 C CB  . SER A 237 ? 0.1581 0.1276 0.1258 -0.0042 0.0319  0.0191  219 SER A CB  
1810 O OG  . SER A 237 ? 0.1578 0.1402 0.1272 -0.0014 0.0343  0.0195  219 SER A OG  
1811 N N   . PHE A 238 ? 0.1623 0.1155 0.1316 -0.0049 0.0239  0.0110  220 PHE A N   
1812 C CA  . PHE A 238 ? 0.1732 0.1135 0.1390 -0.0043 0.0226  0.0097  220 PHE A CA  
1813 C C   . PHE A 238 ? 0.1673 0.1048 0.1286 0.0033  0.0211  0.0108  220 PHE A C   
1814 O O   . PHE A 238 ? 0.1635 0.1091 0.1261 0.0066  0.0193  0.0096  220 PHE A O   
1815 C CB  . PHE A 238 ? 0.1805 0.1228 0.1494 -0.0051 0.0199  0.0044  220 PHE A CB  
1816 C CG  . PHE A 238 ? 0.1985 0.1467 0.1725 -0.0121 0.0196  0.0022  220 PHE A CG  
1817 C CD1 . PHE A 238 ? 0.2007 0.1639 0.1804 -0.0122 0.0189  0.0018  220 PHE A CD1 
1818 C CD2 . PHE A 238 ? 0.2333 0.1720 0.2059 -0.0181 0.0194  0.0004  220 PHE A CD2 
1819 C CE1 . PHE A 238 ? 0.2183 0.1901 0.2038 -0.0183 0.0179  0.0000  220 PHE A CE1 
1820 C CE2 . PHE A 238 ? 0.2423 0.1890 0.2204 -0.0257 0.0180  -0.0020 220 PHE A CE2 
1821 C CZ  . PHE A 238 ? 0.2320 0.1966 0.2172 -0.0254 0.0173  -0.0017 220 PHE A CZ  
1822 N N   . ALA A 239 ? 0.1673 0.0932 0.1230 0.0057  0.0216  0.0134  221 ALA A N   
1823 C CA  . ALA A 239 ? 0.1672 0.0920 0.1199 0.0130  0.0194  0.0143  221 ALA A CA  
1824 C C   . ALA A 239 ? 0.1712 0.0896 0.1241 0.0159  0.0183  0.0115  221 ALA A C   
1825 O O   . ALA A 239 ? 0.1768 0.0834 0.1269 0.0139  0.0197  0.0112  221 ALA A O   
1826 C CB  . ALA A 239 ? 0.1794 0.0966 0.1249 0.0157  0.0204  0.0197  221 ALA A CB  
1827 N N   . LEU A 240 ? 0.1664 0.0927 0.1224 0.0202  0.0161  0.0093  222 LEU A N   
1828 C CA  . LEU A 240 ? 0.1735 0.0979 0.1306 0.0232  0.0158  0.0059  222 LEU A CA  
1829 C C   . LEU A 240 ? 0.1689 0.0980 0.1269 0.0308  0.0141  0.0072  222 LEU A C   
1830 O O   . LEU A 240 ? 0.1617 0.1000 0.1215 0.0319  0.0120  0.0092  222 LEU A O   
1831 C CB  . LEU A 240 ? 0.1728 0.1071 0.1346 0.0201  0.0151  0.0019  222 LEU A CB  
1832 C CG  . LEU A 240 ? 0.1771 0.1132 0.1404 0.0131  0.0157  0.0005  222 LEU A CG  
1833 C CD1 . LEU A 240 ? 0.1823 0.1282 0.1491 0.0119  0.0144  -0.0024 222 LEU A CD1 
1834 C CD2 . LEU A 240 ? 0.1956 0.1196 0.1558 0.0095  0.0171  -0.0008 222 LEU A CD2 
1835 N N   . ARG A 241 ? 0.1770 0.1009 0.1340 0.0363  0.0149  0.0056  223 ARG A N   
1836 C CA  . ARG A 241 ? 0.1756 0.1095 0.1365 0.0437  0.0136  0.0060  223 ARG A CA  
1837 C C   . ARG A 241 ? 0.1781 0.1107 0.1393 0.0478  0.0156  0.0019  223 ARG A C   
1838 O O   . ARG A 241 ? 0.1904 0.1102 0.1466 0.0449  0.0175  -0.0014 223 ARG A O   
1839 C CB  . ARG A 241 ? 0.1925 0.1238 0.1509 0.0504  0.0120  0.0107  223 ARG A CB  
1840 C CG  . ARG A 241 ? 0.2158 0.1276 0.1659 0.0523  0.0136  0.0127  223 ARG A CG  
1841 C CD  . ARG A 241 ? 0.2333 0.1334 0.1797 0.0590  0.0153  0.0109  223 ARG A CD  
1842 N NE  . ARG A 241 ? 0.2332 0.1440 0.1841 0.0697  0.0145  0.0107  223 ARG A NE  
1843 C CZ  . ARG A 241 ? 0.2411 0.1440 0.1894 0.0772  0.0167  0.0076  223 ARG A CZ  
1844 N NH1 . ARG A 241 ? 0.2342 0.1515 0.1886 0.0866  0.0167  0.0071  223 ARG A NH1 
1845 N NH2 . ARG A 241 ? 0.2500 0.1307 0.1895 0.0752  0.0188  0.0051  223 ARG A NH2 
1846 O OXT . ARG A 241 ? 0.1676 0.1117 0.1335 0.0539  0.0155  0.0019  223 ARG A OXT 
1847 C CA  . PRO B 16  ? 0.8789 0.3712 0.9796 -0.0433 0.3047  -0.0430 -2  PRO B CA  
1848 C C   . PRO B 16  ? 0.8826 0.3598 0.9562 -0.0224 0.3170  -0.0099 -2  PRO B C   
1849 O O   . PRO B 16  ? 0.9046 0.3622 0.9879 -0.0263 0.3384  0.0015  -2  PRO B O   
1850 N N   . ARG B 17  ? 0.8563 0.3447 0.8970 -0.0001 0.3036  0.0045  -1  ARG B N   
1851 C CA  . ARG B 17  ? 0.8496 0.3263 0.8608 0.0234  0.3130  0.0348  -1  ARG B CA  
1852 C C   . ARG B 17  ? 0.8019 0.3078 0.8088 0.0233  0.3041  0.0441  -1  ARG B C   
1853 O O   . ARG B 17  ? 0.7656 0.3080 0.7832 0.0113  0.2834  0.0297  -1  ARG B O   
1854 C CB  . ARG B 17  ? 0.8536 0.3370 0.8346 0.0467  0.3002  0.0437  -1  ARG B CB  
1855 N N   . GLY B 18  ? 0.7984 0.2878 0.7883 0.0381  0.3202  0.0684  0   GLY B N   
1856 C CA  . GLY B 18  ? 0.7580 0.2679 0.7468 0.0363  0.3182  0.0772  0   GLY B CA  
1857 C C   . GLY B 18  ? 0.7128 0.2524 0.6717 0.0551  0.2994  0.0902  0   GLY B C   
1858 O O   . GLY B 18  ? 0.6919 0.2492 0.6500 0.0532  0.2964  0.0951  0   GLY B O   
1859 N N   . SER B 19  ? 0.6922 0.2386 0.6281 0.0728  0.2866  0.0944  1   SER B N   
1860 C CA  . SER B 19  ? 0.6668 0.2397 0.5749 0.0920  0.2703  0.1062  1   SER B CA  
1861 C C   . SER B 19  ? 0.6432 0.2315 0.5385 0.1034  0.2522  0.1018  1   SER B C   
1862 O O   . SER B 19  ? 0.6566 0.2265 0.5574 0.1026  0.2575  0.0956  1   SER B O   
1863 C CB  . SER B 19  ? 0.7051 0.2564 0.5876 0.1147  0.2886  0.1318  1   SER B CB  
1864 O OG  . SER B 19  ? 0.7379 0.2581 0.6080 0.1306  0.3030  0.1420  1   SER B OG  
1865 N N   . THR B 20  ? 0.6102 0.2308 0.4887 0.1146  0.2326  0.1050  2   THR B N   
1866 C CA  . THR B 20  ? 0.5971 0.2363 0.4662 0.1247  0.2152  0.1001  2   THR B CA  
1867 C C   . THR B 20  ? 0.6437 0.2599 0.4938 0.1479  0.2270  0.1144  2   THR B C   
1868 O O   . THR B 20  ? 0.6426 0.2588 0.4932 0.1520  0.2219  0.1083  2   THR B O   
1869 C CB  . THR B 20  ? 0.5583 0.2381 0.4171 0.1305  0.1920  0.0986  2   THR B CB  
1870 O OG1 . THR B 20  ? 0.5627 0.2457 0.4004 0.1476  0.1952  0.1148  2   THR B OG1 
1871 C CG2 . THR B 20  ? 0.5222 0.2248 0.3998 0.1089  0.1790  0.0831  2   THR B CG2 
1872 N N   . SER B 21  ? 0.6896 0.2847 0.5226 0.1639  0.2442  0.1339  3   SER B N   
1873 C CA  . SER B 21  ? 0.7386 0.3149 0.5493 0.1904  0.2543  0.1498  3   SER B CA  
1874 C C   . SER B 21  ? 0.7740 0.3106 0.5960 0.1859  0.2733  0.1471  3   SER B C   
1875 O O   . SER B 21  ? 0.8062 0.3287 0.6138 0.2058  0.2790  0.1557  3   SER B O   
1876 C CB  . SER B 21  ? 0.7728 0.3379 0.5590 0.2110  0.2679  0.1723  3   SER B CB  
1877 O OG  . SER B 21  ? 0.8214 0.3456 0.6154 0.2036  0.2959  0.1805  3   SER B OG  
1878 N N   . GLU B 22  ? 0.7779 0.2986 0.6263 0.1600  0.2823  0.1339  4   GLU B N   
1879 C CA  . GLU B 22  ? 0.8102 0.2971 0.6752 0.1500  0.2977  0.1248  4   GLU B CA  
1880 C C   . GLU B 22  ? 0.7766 0.2821 0.6534 0.1401  0.2791  0.1033  4   GLU B C   
1881 O O   . GLU B 22  ? 0.7796 0.2598 0.6592 0.1427  0.2890  0.0991  4   GLU B O   
1882 C CB  . GLU B 22  ? 0.8372 0.3016 0.7283 0.1258  0.3154  0.1175  4   GLU B CB  
1883 C CG  . GLU B 22  ? 0.8918 0.3204 0.7730 0.1366  0.3441  0.1400  4   GLU B CG  
1884 C CD  . GLU B 22  ? 0.9116 0.3305 0.8197 0.1124  0.3580  0.1337  4   GLU B CD  
1885 O OE1 . GLU B 22  ? 0.9026 0.3558 0.8214 0.0984  0.3415  0.1240  4   GLU B OE1 
1886 O OE2 . GLU B 22  ? 0.9736 0.3503 0.8923 0.1082  0.3871  0.1396  4   GLU B OE2 
1887 N N   . VAL B 23  ? 0.7188 0.2658 0.6019 0.1296  0.2543  0.0904  5   VAL B N   
1888 C CA  . VAL B 23  ? 0.6988 0.2639 0.5919 0.1207  0.2379  0.0709  5   VAL B CA  
1889 C C   . VAL B 23  ? 0.6761 0.2702 0.5522 0.1386  0.2199  0.0746  5   VAL B C   
1890 O O   . VAL B 23  ? 0.6710 0.2719 0.5511 0.1375  0.2120  0.0631  5   VAL B O   
1891 C CB  . VAL B 23  ? 0.6695 0.2567 0.5859 0.0943  0.2252  0.0501  5   VAL B CB  
1892 C CG1 . VAL B 23  ? 0.6988 0.2591 0.6365 0.0761  0.2436  0.0439  5   VAL B CG1 
1893 C CG2 . VAL B 23  ? 0.6365 0.2603 0.5486 0.0929  0.2078  0.0527  5   VAL B CG2 
1894 N N   . ILE B 24  ? 0.6578 0.2700 0.5164 0.1547  0.2137  0.0895  6   ILE B N   
1895 C CA  . ILE B 24  ? 0.6354 0.2771 0.4807 0.1717  0.1974  0.0926  6   ILE B CA  
1896 C C   . ILE B 24  ? 0.6763 0.2967 0.5036 0.1979  0.2100  0.1077  6   ILE B C   
1897 O O   . ILE B 24  ? 0.7071 0.3120 0.5179 0.2143  0.2222  0.1257  6   ILE B O   
1898 C CB  . ILE B 24  ? 0.6081 0.2845 0.4459 0.1748  0.1820  0.0970  6   ILE B CB  
1899 C CG1 . ILE B 24  ? 0.5667 0.2616 0.4227 0.1498  0.1708  0.0818  6   ILE B CG1 
1900 C CG2 . ILE B 24  ? 0.5976 0.3052 0.4242 0.1929  0.1665  0.0994  6   ILE B CG2 
1901 C CD1 . ILE B 24  ? 0.5453 0.2706 0.3966 0.1495  0.1571  0.0838  6   ILE B CD1 
1902 N N   . GLU B 25  ? 0.6724 0.2914 0.5021 0.2026  0.2079  0.1009  7   GLU B N   
1903 C CA  . GLU B 25  ? 0.7125 0.3148 0.5262 0.2286  0.2180  0.1137  7   GLU B CA  
1904 C C   . GLU B 25  ? 0.7040 0.3402 0.5001 0.2528  0.2047  0.1253  7   GLU B C   
1905 O O   . GLU B 25  ? 0.7409 0.3628 0.5180 0.2784  0.2154  0.1424  7   GLU B O   
1906 C CB  . GLU B 25  ? 0.7158 0.3093 0.5384 0.2257  0.2188  0.1009  7   GLU B CB  
1907 N N   . ASP B 26  ? 0.6504 0.3306 0.4532 0.2455  0.1824  0.1157  8   ASP B N   
1908 C CA  . ASP B 26  ? 0.6318 0.3510 0.4248 0.2650  0.1667  0.1204  8   ASP B CA  
1909 C C   . ASP B 26  ? 0.5866 0.3425 0.3875 0.2505  0.1482  0.1116  8   ASP B C   
1910 O O   . ASP B 26  ? 0.5424 0.3178 0.3606 0.2315  0.1362  0.0962  8   ASP B O   
1911 C CB  . ASP B 26  ? 0.6326 0.3675 0.4323 0.2714  0.1596  0.1127  8   ASP B CB  
1912 C CG  . ASP B 26  ? 0.6298 0.4058 0.4228 0.2930  0.1449  0.1167  8   ASP B CG  
1913 O OD1 . ASP B 26  ? 0.6052 0.4148 0.3990 0.2918  0.1302  0.1144  8   ASP B OD1 
1914 O OD2 . ASP B 26  ? 0.6703 0.4471 0.4594 0.3115  0.1476  0.1203  8   ASP B OD2 
1915 N N   . GLU B 27  ? 0.5802 0.3449 0.3676 0.2601  0.1462  0.1213  9   GLU B N   
1916 C CA  . GLU B 27  ? 0.5460 0.3397 0.3401 0.2458  0.1312  0.1131  9   GLU B CA  
1917 C C   . GLU B 27  ? 0.5067 0.3456 0.3107 0.2453  0.1101  0.1016  9   GLU B C   
1918 O O   . GLU B 27  ? 0.4646 0.3220 0.2836 0.2254  0.0992  0.0892  9   GLU B O   
1919 C CB  . GLU B 27  ? 0.5683 0.3608 0.3432 0.2591  0.1346  0.1260  9   GLU B CB  
1920 C CG  . GLU B 27  ? 0.5445 0.3606 0.3248 0.2443  0.1221  0.1181  9   GLU B CG  
1921 C CD  . GLU B 27  ? 0.5786 0.3903 0.3375 0.2586  0.1276  0.1313  9   GLU B CD  
1922 O OE1 . GLU B 27  ? 0.6065 0.3824 0.3582 0.2588  0.1471  0.1426  9   GLU B OE1 
1923 O OE2 . GLU B 27  ? 0.5786 0.4233 0.3290 0.2694  0.1129  0.1293  9   GLU B OE2 
1924 N N   . LYS B 28  ? 0.5173 0.3748 0.3133 0.2681  0.1052  0.1064  10  LYS B N   
1925 C CA  . LYS B 28  ? 0.4919 0.3930 0.3012 0.2673  0.0869  0.0948  10  LYS B CA  
1926 C C   . LYS B 28  ? 0.4634 0.3651 0.2945 0.2451  0.0847  0.0810  10  LYS B C   
1927 O O   . LYS B 28  ? 0.4309 0.3591 0.2771 0.2298  0.0724  0.0693  10  LYS B O   
1928 C CB  . LYS B 28  ? 0.5172 0.4363 0.3185 0.2952  0.0840  0.1009  10  LYS B CB  
1929 C CG  . LYS B 28  ? 0.4947 0.4641 0.3123 0.2934  0.0645  0.0880  10  LYS B CG  
1930 N N   . GLN B 29  ? 0.4827 0.3540 0.3141 0.2442  0.0976  0.0827  11  GLN B N   
1931 C CA  . GLN B 29  ? 0.4673 0.3376 0.3151 0.2268  0.0967  0.0703  11  GLN B CA  
1932 C C   . GLN B 29  ? 0.4374 0.2989 0.2939 0.2015  0.0959  0.0620  11  GLN B C   
1933 O O   . GLN B 29  ? 0.4053 0.2819 0.2751 0.1866  0.0884  0.0508  11  GLN B O   
1934 C CB  . GLN B 29  ? 0.5137 0.3544 0.3586 0.2335  0.1102  0.0722  11  GLN B CB  
1935 C CG  . GLN B 29  ? 0.5530 0.4085 0.3942 0.2568  0.1092  0.0769  11  GLN B CG  
1936 C CD  . GLN B 29  ? 0.6013 0.4283 0.4420 0.2607  0.1220  0.0758  11  GLN B CD  
1937 O OE1 . GLN B 29  ? 0.6502 0.4806 0.5027 0.2477  0.1200  0.0640  11  GLN B OE1 
1938 N NE2 . GLN B 29  ? 0.6552 0.4528 0.4816 0.2785  0.1360  0.0877  11  GLN B NE2 
1939 N N   . PHE B 30  ? 0.4379 0.2752 0.2870 0.1975  0.1045  0.0681  12  PHE B N   
1940 C CA  . PHE B 30  ? 0.4162 0.2496 0.2745 0.1748  0.1028  0.0605  12  PHE B CA  
1941 C C   . PHE B 30  ? 0.3777 0.2466 0.2437 0.1663  0.0866  0.0534  12  PHE B C   
1942 O O   . PHE B 30  ? 0.3575 0.2341 0.2355 0.1491  0.0813  0.0432  12  PHE B O   
1943 C CB  . PHE B 30  ? 0.4363 0.2430 0.2859 0.1745  0.1148  0.0697  12  PHE B CB  
1944 C CG  . PHE B 30  ? 0.4171 0.2238 0.2765 0.1534  0.1127  0.0628  12  PHE B CG  
1945 C CD1 . PHE B 30  ? 0.4118 0.2036 0.2842 0.1356  0.1172  0.0526  12  PHE B CD1 
1946 C CD2 . PHE B 30  ? 0.4076 0.2286 0.2622 0.1529  0.1070  0.0664  12  PHE B CD2 
1947 C CE1 . PHE B 30  ? 0.3958 0.1897 0.2777 0.1180  0.1151  0.0465  12  PHE B CE1 
1948 C CE2 . PHE B 30  ? 0.3911 0.2122 0.2550 0.1347  0.1057  0.0606  12  PHE B CE2 
1949 C CZ  . PHE B 30  ? 0.3861 0.1945 0.2639 0.1178  0.1097  0.0511  12  PHE B CZ  
1950 N N   . TYR B 31  ? 0.3712 0.2618 0.2303 0.1789  0.0792  0.0583  13  TYR B N   
1951 C CA  . TYR B 31  ? 0.3410 0.2642 0.2090 0.1713  0.0649  0.0504  13  TYR B CA  
1952 C C   . TYR B 31  ? 0.3208 0.2697 0.2029 0.1694  0.0565  0.0416  13  TYR B C   
1953 O O   . TYR B 31  ? 0.2928 0.2558 0.1878 0.1539  0.0500  0.0325  13  TYR B O   
1954 C CB  . TYR B 31  ? 0.3503 0.2898 0.2068 0.1853  0.0591  0.0560  13  TYR B CB  
1955 C CG  . TYR B 31  ? 0.3579 0.2795 0.2036 0.1820  0.0650  0.0622  13  TYR B CG  
1956 C CD1 . TYR B 31  ? 0.3400 0.2610 0.1944 0.1625  0.0627  0.0556  13  TYR B CD1 
1957 C CD2 . TYR B 31  ? 0.3879 0.2923 0.2141 0.2000  0.0746  0.0758  13  TYR B CD2 
1958 C CE1 . TYR B 31  ? 0.3467 0.2535 0.1922 0.1604  0.0687  0.0613  13  TYR B CE1 
1959 C CE2 . TYR B 31  ? 0.3976 0.2855 0.2142 0.1975  0.0820  0.0824  13  TYR B CE2 
1960 C CZ  . TYR B 31  ? 0.3753 0.2652 0.2023 0.1774  0.0788  0.0747  13  TYR B CZ  
1961 O OH  . TYR B 31  ? 0.3847 0.2599 0.2031 0.1754  0.0868  0.0813  13  TYR B OH  
1962 N N   . SER B 32  ? 0.3310 0.2842 0.2111 0.1853  0.0584  0.0448  14  SER B N   
1963 C CA  . SER B 32  ? 0.3140 0.2954 0.2094 0.1843  0.0510  0.0367  14  SER B CA  
1964 C C   . SER B 32  ? 0.3026 0.2730 0.2076 0.1686  0.0551  0.0296  14  SER B C   
1965 O O   . SER B 32  ? 0.2808 0.2713 0.1997 0.1582  0.0494  0.0218  14  SER B O   
1966 C CB  . SER B 32  ? 0.3306 0.3240 0.2233 0.2064  0.0514  0.0413  14  SER B CB  
1967 O OG  . SER B 32  ? 0.3538 0.3162 0.2365 0.2154  0.0641  0.0480  14  SER B OG  
1968 N N   . LYS B 33  ? 0.3213 0.2595 0.2188 0.1673  0.0657  0.0320  15  LYS B N   
1969 C CA  . LYS B 33  ? 0.3150 0.2428 0.2189 0.1538  0.0690  0.0239  15  LYS B CA  
1970 C C   . LYS B 33  ? 0.2873 0.2218 0.1981 0.1350  0.0633  0.0176  15  LYS B C   
1971 O O   . LYS B 33  ? 0.2675 0.2113 0.1862 0.1255  0.0608  0.0106  15  LYS B O   
1972 C CB  . LYS B 33  ? 0.3475 0.2390 0.2432 0.1549  0.0811  0.0253  15  LYS B CB  
1973 C CG  . LYS B 33  ? 0.3819 0.2642 0.2722 0.1722  0.0884  0.0295  15  LYS B CG  
1974 C CD  . LYS B 33  ? 0.4168 0.2599 0.3006 0.1721  0.1019  0.0292  15  LYS B CD  
1975 C CE  . LYS B 33  ? 0.4565 0.2864 0.3328 0.1920  0.1109  0.0355  15  LYS B CE  
1976 N N   . ALA B 34  ? 0.2826 0.2120 0.1892 0.1306  0.0619  0.0209  16  ALA B N   
1977 C CA  . ALA B 34  ? 0.2624 0.1961 0.1748 0.1142  0.0575  0.0156  16  ALA B CA  
1978 C C   . ALA B 34  ? 0.2443 0.2075 0.1667 0.1107  0.0484  0.0117  16  ALA B C   
1979 O O   . ALA B 34  ? 0.2274 0.1965 0.1568 0.0990  0.0460  0.0062  16  ALA B O   
1980 C CB  . ALA B 34  ? 0.2680 0.1897 0.1739 0.1116  0.0592  0.0204  16  ALA B CB  
1981 N N   . LYS B 35  ? 0.2477 0.2297 0.1713 0.1216  0.0437  0.0140  17  LYS B N   
1982 C CA  . LYS B 35  ? 0.2345 0.2458 0.1713 0.1173  0.0356  0.0084  17  LYS B CA  
1983 C C   . LYS B 35  ? 0.2217 0.2424 0.1701 0.1136  0.0376  0.0037  17  LYS B C   
1984 O O   . LYS B 35  ? 0.2063 0.2361 0.1647 0.1020  0.0363  -0.0009 17  LYS B O   
1985 C CB  . LYS B 35  ? 0.2526 0.2851 0.1898 0.1305  0.0294  0.0095  17  LYS B CB  
1986 C CG  . LYS B 35  ? 0.2541 0.3169 0.2085 0.1238  0.0214  0.0011  17  LYS B CG  
1987 C CD  . LYS B 35  ? 0.2766 0.3645 0.2319 0.1359  0.0127  -0.0008 17  LYS B CD  
1988 C CE  . LYS B 35  ? 0.2751 0.3964 0.2539 0.1285  0.0056  -0.0122 17  LYS B CE  
1989 N NZ  . LYS B 35  ? 0.2913 0.4396 0.2709 0.1403  -0.0045 -0.0167 17  LYS B NZ  
1990 N N   . THR B 36  ? 0.2256 0.2403 0.1707 0.1239  0.0426  0.0060  18  THR B N   
1991 C CA  . THR B 36  ? 0.2229 0.2427 0.1755 0.1223  0.0464  0.0024  18  THR B CA  
1992 C C   . THR B 36  ? 0.2175 0.2221 0.1671 0.1096  0.0499  -0.0008 18  THR B C   
1993 O O   . THR B 36  ? 0.2098 0.2255 0.1676 0.1031  0.0509  -0.0041 18  THR B O   
1994 C CB  . THR B 36  ? 0.2387 0.2497 0.1852 0.1368  0.0522  0.0054  18  THR B CB  
1995 O OG1 . THR B 36  ? 0.2424 0.2728 0.1923 0.1512  0.0483  0.0085  18  THR B OG1 
1996 C CG2 . THR B 36  ? 0.2388 0.2517 0.1900 0.1357  0.0575  0.0015  18  THR B CG2 
1997 N N   . TYR B 37  ? 0.2277 0.2081 0.1661 0.1070  0.0525  0.0000  19  TYR B N   
1998 C CA  . TYR B 37  ? 0.2273 0.1962 0.1627 0.0965  0.0543  -0.0044 19  TYR B CA  
1999 C C   . TYR B 37  ? 0.2101 0.1927 0.1524 0.0859  0.0501  -0.0061 19  TYR B C   
2000 O O   . TYR B 37  ? 0.2008 0.1876 0.1447 0.0817  0.0519  -0.0088 19  TYR B O   
2001 C CB  . TYR B 37  ? 0.2423 0.1869 0.1693 0.0930  0.0568  -0.0047 19  TYR B CB  
2002 C CG  . TYR B 37  ? 0.2448 0.1822 0.1701 0.0832  0.0572  -0.0116 19  TYR B CG  
2003 C CD1 . TYR B 37  ? 0.2612 0.1905 0.1825 0.0858  0.0611  -0.0173 19  TYR B CD1 
2004 C CD2 . TYR B 37  ? 0.2382 0.1800 0.1655 0.0730  0.0530  -0.0129 19  TYR B CD2 
2005 C CE1 . TYR B 37  ? 0.2647 0.1916 0.1834 0.0791  0.0601  -0.0249 19  TYR B CE1 
2006 C CE2 . TYR B 37  ? 0.2414 0.1804 0.1665 0.0666  0.0523  -0.0195 19  TYR B CE2 
2007 C CZ  . TYR B 37  ? 0.2568 0.1892 0.1772 0.0701  0.0555  -0.0257 19  TYR B CZ  
2008 O OH  . TYR B 37  ? 0.2728 0.2053 0.1890 0.0663  0.0540  -0.0339 19  TYR B OH  
2009 N N   . TRP B 38  ? 0.2039 0.1914 0.1486 0.0823  0.0456  -0.0041 20  TRP B N   
2010 C CA  . TRP B 38  ? 0.1927 0.1885 0.1429 0.0723  0.0427  -0.0056 20  TRP B CA  
2011 C C   . TRP B 38  ? 0.1873 0.2039 0.1507 0.0710  0.0426  -0.0070 20  TRP B C   
2012 O O   . TRP B 38  ? 0.1757 0.1951 0.1432 0.0634  0.0442  -0.0080 20  TRP B O   
2013 C CB  . TRP B 38  ? 0.1946 0.1881 0.1427 0.0692  0.0385  -0.0039 20  TRP B CB  
2014 C CG  . TRP B 38  ? 0.2020 0.1760 0.1412 0.0661  0.0405  -0.0032 20  TRP B CG  
2015 C CD1 . TRP B 38  ? 0.2185 0.1781 0.1507 0.0710  0.0432  -0.0002 20  TRP B CD1 
2016 C CD2 . TRP B 38  ? 0.2037 0.1711 0.1415 0.0579  0.0411  -0.0062 20  TRP B CD2 
2017 N NE1 . TRP B 38  ? 0.2210 0.1663 0.1505 0.0643  0.0456  -0.0020 20  TRP B NE1 
2018 C CE2 . TRP B 38  ? 0.2137 0.1653 0.1467 0.0565  0.0433  -0.0063 20  TRP B CE2 
2019 C CE3 . TRP B 38  ? 0.1961 0.1704 0.1366 0.0523  0.0405  -0.0083 20  TRP B CE3 
2020 C CZ2 . TRP B 38  ? 0.2158 0.1615 0.1485 0.0493  0.0432  -0.0105 20  TRP B CZ2 
2021 C CZ3 . TRP B 38  ? 0.2007 0.1683 0.1374 0.0473  0.0403  -0.0109 20  TRP B CZ3 
2022 C CH2 . TRP B 38  ? 0.2126 0.1680 0.1465 0.0454  0.0407  -0.0129 20  TRP B CH2 
2023 N N   . LYS B 39  ? 0.1925 0.2236 0.1633 0.0788  0.0416  -0.0071 21  LYS B N   
2024 C CA  . LYS B 39  ? 0.1937 0.2468 0.1815 0.0772  0.0431  -0.0097 21  LYS B CA  
2025 C C   . LYS B 39  ? 0.1902 0.2399 0.1782 0.0746  0.0507  -0.0094 21  LYS B C   
2026 O O   . LYS B 39  ? 0.1882 0.2503 0.1894 0.0690  0.0546  -0.0104 21  LYS B O   
2027 C CB  . LYS B 39  ? 0.2123 0.2827 0.2076 0.0884  0.0408  -0.0104 21  LYS B CB  
2028 C CG  . LYS B 39  ? 0.2213 0.3190 0.2388 0.0867  0.0418  -0.0147 21  LYS B CG  
2029 C CD  . LYS B 39  ? 0.2405 0.3586 0.2654 0.0996  0.0377  -0.0160 21  LYS B CD  
2030 C CE  . LYS B 39  ? 0.2513 0.4024 0.3036 0.0956  0.0363  -0.0232 21  LYS B CE  
2031 N N   . GLN B 40  ? 0.1870 0.2205 0.1611 0.0793  0.0537  -0.0083 22  GLN B N   
2032 C CA  . GLN B 40  ? 0.1907 0.2212 0.1609 0.0800  0.0606  -0.0086 22  GLN B CA  
2033 C C   . GLN B 40  ? 0.1913 0.2096 0.1510 0.0736  0.0614  -0.0087 22  GLN B C   
2034 O O   . GLN B 40  ? 0.1980 0.2129 0.1499 0.0764  0.0665  -0.0092 22  GLN B O   
2035 C CB  . GLN B 40  ? 0.1981 0.2204 0.1598 0.0903  0.0633  -0.0095 22  GLN B CB  
2036 C CG  . GLN B 40  ? 0.1963 0.2332 0.1684 0.0994  0.0629  -0.0085 22  GLN B CG  
2037 C CD  . GLN B 40  ? 0.2097 0.2349 0.1724 0.1116  0.0655  -0.0083 22  GLN B CD  
2038 O OE1 . GLN B 40  ? 0.2095 0.2479 0.1797 0.1214  0.0668  -0.0072 22  GLN B OE1 
2039 N NE2 . GLN B 40  ? 0.2181 0.2188 0.1655 0.1111  0.0667  -0.0102 22  GLN B NE2 
2040 N N   . ILE B 41  ? 0.1878 0.2003 0.1454 0.0669  0.0565  -0.0085 23  ILE B N   
2041 C CA  . ILE B 41  ? 0.1919 0.1947 0.1397 0.0621  0.0561  -0.0088 23  ILE B CA  
2042 C C   . ILE B 41  ? 0.1932 0.2038 0.1482 0.0569  0.0598  -0.0055 23  ILE B C   
2043 O O   . ILE B 41  ? 0.1878 0.2067 0.1555 0.0525  0.0588  -0.0050 23  ILE B O   
2044 C CB  . ILE B 41  ? 0.1903 0.1825 0.1333 0.0584  0.0501  -0.0102 23  ILE B CB  
2045 C CG1 . ILE B 41  ? 0.1998 0.1791 0.1347 0.0627  0.0498  -0.0138 23  ILE B CG1 
2046 C CG2 . ILE B 41  ? 0.1883 0.1776 0.1272 0.0527  0.0488  -0.0098 23  ILE B CG2 
2047 C CD1 . ILE B 41  ? 0.2086 0.1815 0.1337 0.0643  0.0514  -0.0190 23  ILE B CD1 
2048 N N   . PRO B 42  ? 0.2042 0.2118 0.1507 0.0580  0.0646  -0.0036 24  PRO B N   
2049 C CA  . PRO B 42  ? 0.2057 0.2164 0.1578 0.0539  0.0704  0.0011  24  PRO B CA  
2050 C C   . PRO B 42  ? 0.1922 0.1990 0.1471 0.0471  0.0658  0.0013  24  PRO B C   
2051 O O   . PRO B 42  ? 0.1918 0.1917 0.1383 0.0466  0.0591  -0.0007 24  PRO B O   
2052 C CB  . PRO B 42  ? 0.2220 0.2281 0.1584 0.0599  0.0759  0.0040  24  PRO B CB  
2053 C CG  . PRO B 42  ? 0.2298 0.2300 0.1528 0.0639  0.0687  -0.0018 24  PRO B CG  
2054 C CD  . PRO B 42  ? 0.2199 0.2208 0.1504 0.0640  0.0652  -0.0060 24  PRO B CD  
2055 N N   . PRO B 43  ? 0.1893 0.2009 0.1579 0.0413  0.0698  0.0030  25  PRO B N   
2056 C CA  . PRO B 43  ? 0.1825 0.1902 0.1545 0.0349  0.0656  0.0022  25  PRO B CA  
2057 C C   . PRO B 43  ? 0.1903 0.1882 0.1516 0.0356  0.0691  0.0070  25  PRO B C   
2058 O O   . PRO B 43  ? 0.1963 0.1910 0.1640 0.0318  0.0759  0.0103  25  PRO B O   
2059 C CB  . PRO B 43  ? 0.1842 0.2018 0.1771 0.0284  0.0696  0.0000  25  PRO B CB  
2060 C CG  . PRO B 43  ? 0.1925 0.2139 0.1905 0.0304  0.0806  0.0037  25  PRO B CG  
2061 C CD  . PRO B 43  ? 0.1952 0.2169 0.1800 0.0393  0.0782  0.0040  25  PRO B CD  
2062 N N   . THR B 44  ? 0.1927 0.1860 0.1388 0.0406  0.0646  0.0067  26  THR B N   
2063 C CA  . THR B 44  ? 0.2030 0.1905 0.1366 0.0445  0.0663  0.0107  26  THR B CA  
2064 C C   . THR B 44  ? 0.1979 0.1836 0.1258 0.0438  0.0567  0.0064  26  THR B C   
2065 O O   . THR B 44  ? 0.1827 0.1691 0.1130 0.0419  0.0508  0.0012  26  THR B O   
2066 C CB  . THR B 44  ? 0.2187 0.2072 0.1387 0.0534  0.0707  0.0131  26  THR B CB  
2067 O OG1 . THR B 44  ? 0.2151 0.2060 0.1298 0.0559  0.0637  0.0061  26  THR B OG1 
2068 C CG2 . THR B 44  ? 0.2312 0.2222 0.1580 0.0544  0.0816  0.0175  26  THR B CG2 
2069 N N   . VAL B 45  ? 0.2002 0.1835 0.1203 0.0465  0.0560  0.0089  27  VAL B N   
2070 C CA  . VAL B 45  ? 0.2024 0.1868 0.1191 0.0460  0.0477  0.0042  27  VAL B CA  
2071 C C   . VAL B 45  ? 0.2057 0.1936 0.1165 0.0489  0.0427  -0.0027 27  VAL B C   
2072 O O   . VAL B 45  ? 0.2030 0.1900 0.1182 0.0448  0.0373  -0.0086 27  VAL B O   
2073 C CB  . VAL B 45  ? 0.2133 0.1980 0.1227 0.0507  0.0479  0.0080  27  VAL B CB  
2074 C CG1 . VAL B 45  ? 0.2125 0.2027 0.1202 0.0510  0.0393  0.0017  27  VAL B CG1 
2075 C CG2 . VAL B 45  ? 0.2136 0.1917 0.1300 0.0467  0.0527  0.0131  27  VAL B CG2 
2076 N N   . ASP B 46  ? 0.2168 0.2073 0.1178 0.0560  0.0457  -0.0023 28  ASP B N   
2077 C CA  . ASP B 46  ? 0.2279 0.2212 0.1231 0.0589  0.0411  -0.0110 28  ASP B CA  
2078 C C   . ASP B 46  ? 0.2236 0.2121 0.1269 0.0545  0.0413  -0.0146 28  ASP B C   
2079 O O   . ASP B 46  ? 0.2284 0.2147 0.1324 0.0529  0.0371  -0.0227 28  ASP B O   
2080 C CB  . ASP B 46  ? 0.2498 0.2475 0.1304 0.0691  0.0442  -0.0104 28  ASP B CB  
2081 C CG  . ASP B 46  ? 0.2675 0.2708 0.1397 0.0730  0.0368  -0.0226 28  ASP B CG  
2082 O OD1 . ASP B 46  ? 0.2702 0.2780 0.1454 0.0701  0.0290  -0.0303 28  ASP B OD1 
2083 O OD2 . ASP B 46  ? 0.2850 0.2891 0.1486 0.0788  0.0390  -0.0257 28  ASP B OD2 
2084 N N   . GLY B 47  ? 0.2124 0.1998 0.1235 0.0525  0.0463  -0.0090 29  GLY B N   
2085 C CA  . GLY B 47  ? 0.2089 0.1938 0.1275 0.0504  0.0460  -0.0113 29  GLY B CA  
2086 C C   . GLY B 47  ? 0.2040 0.1843 0.1288 0.0447  0.0413  -0.0130 29  GLY B C   
2087 O O   . GLY B 47  ? 0.2049 0.1792 0.1303 0.0447  0.0398  -0.0171 29  GLY B O   
2088 N N   . MET B 48  ? 0.1961 0.1773 0.1246 0.0408  0.0402  -0.0097 30  MET B N   
2089 C CA  . MET B 48  ? 0.1982 0.1754 0.1312 0.0363  0.0368  -0.0104 30  MET B CA  
2090 C C   . MET B 48  ? 0.2083 0.1812 0.1387 0.0353  0.0341  -0.0163 30  MET B C   
2091 O O   . MET B 48  ? 0.2236 0.1898 0.1574 0.0330  0.0340  -0.0178 30  MET B O   
2092 C CB  . MET B 48  ? 0.1952 0.1739 0.1306 0.0332  0.0365  -0.0071 30  MET B CB  
2093 C CG  . MET B 48  ? 0.1958 0.1778 0.1371 0.0319  0.0398  -0.0034 30  MET B CG  
2094 S SD  . MET B 48  ? 0.1914 0.1775 0.1407 0.0315  0.0387  -0.0048 30  MET B SD  
2095 C CE  . MET B 48  ? 0.1982 0.1898 0.1496 0.0355  0.0429  -0.0046 30  MET B CE  
2096 N N   . LEU B 49  ? 0.2016 0.1790 0.1267 0.0374  0.0324  -0.0200 31  LEU B N   
2097 C CA  . LEU B 49  ? 0.2069 0.1846 0.1332 0.0351  0.0287  -0.0282 31  LEU B CA  
2098 C C   . LEU B 49  ? 0.2098 0.1858 0.1324 0.0374  0.0283  -0.0366 31  LEU B C   
2099 O O   . LEU B 49  ? 0.2087 0.1881 0.1326 0.0358  0.0247  -0.0463 31  LEU B O   
2100 C CB  . LEU B 49  ? 0.2091 0.1966 0.1331 0.0365  0.0252  -0.0285 31  LEU B CB  
2101 C CG  . LEU B 49  ? 0.2049 0.1924 0.1331 0.0340  0.0261  -0.0215 31  LEU B CG  
2102 C CD1 . LEU B 49  ? 0.2121 0.2091 0.1383 0.0370  0.0229  -0.0221 31  LEU B CD1 
2103 C CD2 . LEU B 49  ? 0.2058 0.1863 0.1427 0.0277  0.0268  -0.0220 31  LEU B CD2 
2104 N N   . GLY B 50  ? 0.2091 0.1807 0.1282 0.0413  0.0320  -0.0346 32  GLY B N   
2105 C CA  . GLY B 50  ? 0.2215 0.1882 0.1376 0.0433  0.0326  -0.0433 32  GLY B CA  
2106 C C   . GLY B 50  ? 0.2284 0.2034 0.1364 0.0470  0.0287  -0.0527 32  GLY B C   
2107 O O   . GLY B 50  ? 0.2384 0.2104 0.1475 0.0455  0.0269  -0.0647 32  GLY B O   
2108 N N   . GLY B 51  ? 0.2276 0.2128 0.1272 0.0526  0.0280  -0.0475 33  GLY B N   
2109 C CA  . GLY B 51  ? 0.2419 0.2378 0.1295 0.0598  0.0242  -0.0542 33  GLY B CA  
2110 C C   . GLY B 51  ? 0.2450 0.2518 0.1348 0.0584  0.0173  -0.0590 33  GLY B C   
2111 O O   . GLY B 51  ? 0.2544 0.2736 0.1337 0.0659  0.0124  -0.0654 33  GLY B O   
2112 N N   . TYR B 52  ? 0.2371 0.2411 0.1397 0.0503  0.0166  -0.0563 34  TYR B N   
2113 C CA  . TYR B 52  ? 0.2417 0.2572 0.1492 0.0488  0.0108  -0.0598 34  TYR B CA  
2114 C C   . TYR B 52  ? 0.2427 0.2601 0.1475 0.0517  0.0130  -0.0466 34  TYR B C   
2115 O O   . TYR B 52  ? 0.2279 0.2496 0.1407 0.0484  0.0108  -0.0457 34  TYR B O   
2116 C CB  . TYR B 52  ? 0.2373 0.2491 0.1623 0.0377  0.0096  -0.0676 34  TYR B CB  
2117 C CG  . TYR B 52  ? 0.2524 0.2638 0.1823 0.0342  0.0072  -0.0836 34  TYR B CG  
2118 C CD1 . TYR B 52  ? 0.2639 0.2928 0.1965 0.0351  -0.0008 -0.0987 34  TYR B CD1 
2119 C CD2 . TYR B 52  ? 0.2596 0.2538 0.1920 0.0306  0.0130  -0.0852 34  TYR B CD2 
2120 C CE1 . TYR B 52  ? 0.2799 0.3082 0.2186 0.0308  -0.0029 -0.1161 34  TYR B CE1 
2121 C CE2 . TYR B 52  ? 0.2784 0.2689 0.2156 0.0272  0.0123  -0.1006 34  TYR B CE2 
2122 C CZ  . TYR B 52  ? 0.2866 0.2941 0.2276 0.0264  0.0042  -0.1169 34  TYR B CZ  
2123 O OH  . TYR B 52  ? 0.3096 0.3131 0.2574 0.0217  0.0037  -0.1350 34  TYR B OH  
2124 N N   . GLY B 53  ? 0.2544 0.2683 0.1490 0.0581  0.0185  -0.0364 35  GLY B N   
2125 C CA  . GLY B 53  ? 0.2617 0.2748 0.1543 0.0607  0.0223  -0.0245 35  GLY B CA  
2126 C C   . GLY B 53  ? 0.2715 0.2967 0.1598 0.0669  0.0175  -0.0251 35  GLY B C   
2127 O O   . GLY B 53  ? 0.2733 0.2966 0.1658 0.0658  0.0193  -0.0183 35  GLY B O   
2128 N N   . HIS B 54  ? 0.2887 0.3273 0.1690 0.0741  0.0111  -0.0343 36  HIS B N   
2129 C CA  . HIS B 54  ? 0.3063 0.3614 0.1822 0.0823  0.0047  -0.0367 36  HIS B CA  
2130 C C   . HIS B 54  ? 0.2861 0.3478 0.1799 0.0738  -0.0003 -0.0424 36  HIS B C   
2131 O O   . HIS B 54  ? 0.2968 0.3725 0.1891 0.0811  -0.0044 -0.0417 36  HIS B O   
2132 C CB  . HIS B 54  ? 0.3412 0.4126 0.2051 0.0921  -0.0026 -0.0483 36  HIS B CB  
2133 C CG  . HIS B 54  ? 0.3678 0.4439 0.2440 0.0826  -0.0093 -0.0666 36  HIS B CG  
2134 N ND1 . HIS B 54  ? 0.3950 0.4597 0.2697 0.0786  -0.0062 -0.0715 36  HIS B ND1 
2135 C CD2 . HIS B 54  ? 0.3872 0.4775 0.2781 0.0766  -0.0178 -0.0816 36  HIS B CD2 
2136 C CE1 . HIS B 54  ? 0.4091 0.4788 0.2961 0.0708  -0.0122 -0.0888 36  HIS B CE1 
2137 N NE2 . HIS B 54  ? 0.4129 0.4980 0.3114 0.0682  -0.0190 -0.0954 36  HIS B NE2 
2138 N N   . ILE B 55  ? 0.2553 0.3079 0.1650 0.0603  0.0007  -0.0470 37  ILE B N   
2139 C CA  . ILE B 55  ? 0.2441 0.3019 0.1711 0.0523  -0.0015 -0.0509 37  ILE B CA  
2140 C C   . ILE B 55  ? 0.2211 0.2671 0.1507 0.0496  0.0047  -0.0379 37  ILE B C   
2141 O O   . ILE B 55  ? 0.2124 0.2600 0.1547 0.0435  0.0048  -0.0391 37  ILE B O   
2142 C CB  . ILE B 55  ? 0.2498 0.3044 0.1935 0.0398  -0.0024 -0.0630 37  ILE B CB  
2143 C CG1 . ILE B 55  ? 0.2532 0.2860 0.1987 0.0327  0.0053  -0.0562 37  ILE B CG1 
2144 C CG2 . ILE B 55  ? 0.2684 0.3333 0.2105 0.0414  -0.0085 -0.0785 37  ILE B CG2 
2145 C CD1 . ILE B 55  ? 0.2663 0.2912 0.2272 0.0217  0.0078  -0.0640 37  ILE B CD1 
2146 N N   . SER B 56  ? 0.2131 0.2474 0.1322 0.0536  0.0108  -0.0265 38  SER B N   
2147 C CA  . SER B 56  ? 0.2032 0.2247 0.1265 0.0490  0.0168  -0.0174 38  SER B CA  
2148 C C   . SER B 56  ? 0.2028 0.2310 0.1289 0.0523  0.0159  -0.0145 38  SER B C   
2149 O O   . SER B 56  ? 0.1925 0.2160 0.1278 0.0459  0.0178  -0.0133 38  SER B O   
2150 C CB  . SER B 56  ? 0.2045 0.2145 0.1191 0.0518  0.0237  -0.0081 38  SER B CB  
2151 O OG  . SER B 56  ? 0.1933 0.1930 0.1140 0.0462  0.0281  -0.0028 38  SER B OG  
2152 N N   . SER B 57  ? 0.2143 0.2538 0.1314 0.0637  0.0135  -0.0127 39  SER B N   
2153 C CA  A SER B 57  ? 0.2179 0.2639 0.1376 0.0687  0.0133  -0.0090 39  SER B CA  
2154 C CA  B SER B 57  ? 0.2153 0.2611 0.1349 0.0686  0.0134  -0.0090 39  SER B CA  
2155 C C   . SER B 57  ? 0.2097 0.2698 0.1458 0.0624  0.0075  -0.0189 39  SER B C   
2156 O O   . SER B 57  ? 0.2014 0.2603 0.1450 0.0602  0.0099  -0.0160 39  SER B O   
2157 C CB  A SER B 57  ? 0.2374 0.2940 0.1432 0.0847  0.0120  -0.0046 39  SER B CB  
2158 C CB  B SER B 57  ? 0.2314 0.2859 0.1365 0.0848  0.0130  -0.0032 39  SER B CB  
2159 O OG  A SER B 57  ? 0.2530 0.2932 0.1457 0.0896  0.0207  0.0064  39  SER B OG  
2160 O OG  B SER B 57  ? 0.2385 0.3125 0.1393 0.0916  0.0045  -0.0123 39  SER B OG  
2161 N N   . ILE B 58  ? 0.2053 0.2784 0.1478 0.0593  0.0010  -0.0311 40  ILE B N   
2162 C CA  . ILE B 58  ? 0.2023 0.2890 0.1644 0.0515  -0.0029 -0.0419 40  ILE B CA  
2163 C C   . ILE B 58  ? 0.1854 0.2552 0.1578 0.0396  0.0042  -0.0382 40  ILE B C   
2164 O O   . ILE B 58  ? 0.1731 0.2471 0.1576 0.0360  0.0062  -0.0381 40  ILE B O   
2165 C CB  . ILE B 58  ? 0.2123 0.3115 0.1813 0.0475  -0.0096 -0.0576 40  ILE B CB  
2166 C CG1 A ILE B 58  ? 0.2275 0.3505 0.1875 0.0609  -0.0188 -0.0639 40  ILE B CG1 
2167 C CG1 B ILE B 58  ? 0.2245 0.3475 0.1845 0.0610  -0.0188 -0.0639 40  ILE B CG1 
2168 C CG2 . ILE B 58  ? 0.2134 0.3193 0.2068 0.0347  -0.0098 -0.0690 40  ILE B CG2 
2169 C CD1 A ILE B 58  ? 0.2367 0.3679 0.1954 0.0599  -0.0250 -0.0784 40  ILE B CD1 
2170 C CD1 B ILE B 58  ? 0.2247 0.3718 0.1932 0.0679  -0.0241 -0.0662 40  ILE B CD1 
2171 N N   . ASP B 59  ? 0.1786 0.2304 0.1453 0.0348  0.0082  -0.0354 41  ASP B N   
2172 C CA  . ASP B 59  ? 0.1731 0.2087 0.1454 0.0262  0.0148  -0.0313 41  ASP B CA  
2173 C C   . ASP B 59  ? 0.1702 0.1995 0.1390 0.0287  0.0190  -0.0216 41  ASP B C   
2174 O O   . ASP B 59  ? 0.1638 0.1921 0.1412 0.0246  0.0222  -0.0209 41  ASP B O   
2175 C CB  . ASP B 59  ? 0.1752 0.1955 0.1396 0.0241  0.0174  -0.0290 41  ASP B CB  
2176 C CG  . ASP B 59  ? 0.1744 0.1795 0.1392 0.0196  0.0233  -0.0228 41  ASP B CG  
2177 O OD1 . ASP B 59  ? 0.1755 0.1774 0.1498 0.0137  0.0265  -0.0247 41  ASP B OD1 
2178 O OD2 . ASP B 59  ? 0.1771 0.1737 0.1327 0.0222  0.0253  -0.0160 41  ASP B OD2 
2179 N N   . ILE B 60  ? 0.1758 0.2004 0.1323 0.0358  0.0199  -0.0146 42  ILE B N   
2180 C CA  . ILE B 60  ? 0.1802 0.1953 0.1333 0.0373  0.0247  -0.0068 42  ILE B CA  
2181 C C   . ILE B 60  ? 0.1757 0.2014 0.1348 0.0411  0.0244  -0.0067 42  ILE B C   
2182 O O   . ILE B 60  ? 0.1692 0.1891 0.1311 0.0391  0.0284  -0.0039 42  ILE B O   
2183 C CB  . ILE B 60  ? 0.1960 0.2024 0.1371 0.0433  0.0277  0.0000  42  ILE B CB  
2184 C CG1 . ILE B 60  ? 0.1986 0.1952 0.1369 0.0386  0.0293  0.0000  42  ILE B CG1 
2185 C CG2 . ILE B 60  ? 0.2016 0.1995 0.1406 0.0458  0.0328  0.0059  42  ILE B CG2 
2186 C CD1 . ILE B 60  ? 0.2004 0.1874 0.1420 0.0321  0.0318  0.0003  42  ILE B CD1 
2187 N N   . ASN B 61  ? 0.1760 0.2180 0.1354 0.0483  0.0195  -0.0095 43  ASN B N   
2188 C CA  . ASN B 61  ? 0.1782 0.2333 0.1439 0.0540  0.0188  -0.0092 43  ASN B CA  
2189 C C   . ASN B 61  ? 0.1679 0.2306 0.1512 0.0452  0.0195  -0.0152 43  ASN B C   
2190 O O   . ASN B 61  ? 0.1706 0.2351 0.1589 0.0468  0.0230  -0.0123 43  ASN B O   
2191 C CB  . ASN B 61  ? 0.1911 0.2656 0.1534 0.0651  0.0125  -0.0117 43  ASN B CB  
2192 C CG  . ASN B 61  ? 0.2088 0.2733 0.1521 0.0766  0.0155  -0.0020 43  ASN B CG  
2193 O OD1 . ASN B 61  ? 0.2153 0.2604 0.1517 0.0769  0.0231  0.0066  43  ASN B OD1 
2194 N ND2 . ASN B 61  ? 0.2217 0.2993 0.1567 0.0862  0.0102  -0.0040 43  ASN B ND2 
2195 N N   . SER B 62  ? 0.1592 0.2238 0.1516 0.0361  0.0179  -0.0230 44  SER B N   
2196 C CA  . SER B 62  ? 0.1562 0.2242 0.1661 0.0268  0.0216  -0.0277 44  SER B CA  
2197 C C   . SER B 62  ? 0.1505 0.1983 0.1553 0.0230  0.0297  -0.0200 44  SER B C   
2198 O O   . SER B 62  ? 0.1495 0.1993 0.1625 0.0215  0.0349  -0.0182 44  SER B O   
2199 C CB  . SER B 62  ? 0.1585 0.2304 0.1795 0.0181  0.0195  -0.0382 44  SER B CB  
2200 O OG  . SER B 62  ? 0.1635 0.2587 0.1916 0.0216  0.0109  -0.0485 44  SER B OG  
2201 N N   . SER B 63  ? 0.1501 0.1810 0.1414 0.0226  0.0306  -0.0156 45  SER B N   
2202 C CA  . SER B 63  ? 0.1521 0.1666 0.1365 0.0209  0.0365  -0.0095 45  SER B CA  
2203 C C   . SER B 63  ? 0.1537 0.1675 0.1342 0.0263  0.0392  -0.0046 45  SER B C   
2204 O O   . SER B 63  ? 0.1570 0.1648 0.1376 0.0251  0.0447  -0.0019 45  SER B O   
2205 C CB  . SER B 63  ? 0.1545 0.1556 0.1266 0.0210  0.0358  -0.0067 45  SER B CB  
2206 O OG  . SER B 63  ? 0.1554 0.1540 0.1306 0.0164  0.0351  -0.0106 45  SER B OG  
2207 N N   . ARG B 64  ? 0.1572 0.1746 0.1321 0.0333  0.0365  -0.0027 46  ARG B N   
2208 C CA  . ARG B 64  ? 0.1664 0.1798 0.1365 0.0392  0.0400  0.0017  46  ARG B CA  
2209 C C   . ARG B 64  ? 0.1647 0.1909 0.1466 0.0403  0.0424  0.0005  46  ARG B C   
2210 O O   . ARG B 64  ? 0.1640 0.1839 0.1437 0.0418  0.0478  0.0033  46  ARG B O   
2211 C CB  . ARG B 64  ? 0.1768 0.1898 0.1387 0.0477  0.0385  0.0051  46  ARG B CB  
2212 C CG  . ARG B 64  ? 0.1908 0.1930 0.1464 0.0530  0.0439  0.0097  46  ARG B CG  
2213 C CD  . ARG B 64  ? 0.2033 0.2036 0.1514 0.0627  0.0448  0.0145  46  ARG B CD  
2214 N NE  . ARG B 64  ? 0.2105 0.2010 0.1514 0.0608  0.0449  0.0160  46  ARG B NE  
2215 C CZ  . ARG B 64  ? 0.2146 0.2130 0.1528 0.0638  0.0411  0.0162  46  ARG B CZ  
2216 N NH1 . ARG B 64  ? 0.2141 0.2319 0.1556 0.0697  0.0356  0.0139  46  ARG B NH1 
2217 N NH2 . ARG B 64  ? 0.2196 0.2074 0.1512 0.0622  0.0433  0.0184  46  ARG B NH2 
2218 N N   . LYS B 65  ? 0.1608 0.2060 0.1559 0.0398  0.0386  -0.0046 47  LYS B N   
2219 C CA  . LYS B 65  ? 0.1682 0.2288 0.1782 0.0402  0.0412  -0.0067 47  LYS B CA  
2220 C C   . LYS B 65  ? 0.1638 0.2165 0.1802 0.0320  0.0489  -0.0062 47  LYS B C   
2221 O O   . LYS B 65  ? 0.1635 0.2175 0.1838 0.0336  0.0551  -0.0037 47  LYS B O   
2222 C CB  . LYS B 65  ? 0.1740 0.2596 0.2001 0.0399  0.0348  -0.0150 47  LYS B CB  
2223 C CG  . LYS B 65  ? 0.1914 0.2882 0.2094 0.0522  0.0280  -0.0140 47  LYS B CG  
2224 C CD  . LYS B 65  ? 0.2082 0.3332 0.2403 0.0535  0.0196  -0.0242 47  LYS B CD  
2225 C CE  . LYS B 65  ? 0.2315 0.3618 0.2473 0.0678  0.0132  -0.0209 47  LYS B CE  
2226 N NZ  . LYS B 65  ? 0.2516 0.4102 0.2751 0.0722  0.0030  -0.0313 47  LYS B NZ  
2227 N N   . PHE B 66  ? 0.1606 0.2044 0.1770 0.0242  0.0493  -0.0082 48  PHE B N   
2228 C CA  . PHE B 66  ? 0.1658 0.1987 0.1847 0.0181  0.0579  -0.0058 48  PHE B CA  
2229 C C   . PHE B 66  ? 0.1717 0.1897 0.1746 0.0229  0.0629  0.0011  48  PHE B C   
2230 O O   . PHE B 66  ? 0.1796 0.1957 0.1849 0.0231  0.0710  0.0042  48  PHE B O   
2231 C CB  . PHE B 66  ? 0.1676 0.1911 0.1859 0.0115  0.0571  -0.0083 48  PHE B CB  
2232 C CG  . PHE B 66  ? 0.1746 0.1853 0.1954 0.0065  0.0677  -0.0048 48  PHE B CG  
2233 C CD1 . PHE B 66  ? 0.1808 0.1988 0.2223 -0.0002 0.0750  -0.0081 48  PHE B CD1 
2234 C CD2 . PHE B 66  ? 0.1801 0.1729 0.1835 0.0091  0.0703  0.0013  48  PHE B CD2 
2235 C CE1 . PHE B 66  ? 0.1924 0.1959 0.2354 -0.0039 0.0869  -0.0033 48  PHE B CE1 
2236 C CE2 . PHE B 66  ? 0.1921 0.1724 0.1948 0.0074  0.0806  0.0062  48  PHE B CE2 
2237 C CZ  . PHE B 66  ? 0.1983 0.1822 0.2201 0.0008  0.0895  0.0044  48  PHE B CZ  
2238 N N   . LEU B 67  ? 0.1689 0.1772 0.1561 0.0269  0.0583  0.0029  49  LEU B N   
2239 C CA  . LEU B 67  ? 0.1759 0.1708 0.1480 0.0307  0.0614  0.0066  49  LEU B CA  
2240 C C   . LEU B 67  ? 0.1799 0.1775 0.1504 0.0372  0.0642  0.0080  49  LEU B C   
2241 O O   . LEU B 67  ? 0.1835 0.1745 0.1466 0.0399  0.0697  0.0100  49  LEU B O   
2242 C CB  . LEU B 67  ? 0.1788 0.1641 0.1389 0.0313  0.0558  0.0060  49  LEU B CB  
2243 C CG  . LEU B 67  ? 0.1887 0.1627 0.1350 0.0344  0.0569  0.0065  49  LEU B CG  
2244 C CD1 . LEU B 67  ? 0.2010 0.1701 0.1410 0.0348  0.0614  0.0085  49  LEU B CD1 
2245 C CD2 . LEU B 67  ? 0.1909 0.1596 0.1322 0.0331  0.0516  0.0044  49  LEU B CD2 
2246 N N   . GLN B 68  ? 0.1765 0.1831 0.1519 0.0411  0.0608  0.0070  50  GLN B N   
2247 C CA  . GLN B 68  ? 0.1818 0.1892 0.1549 0.0490  0.0641  0.0089  50  GLN B CA  
2248 C C   . GLN B 68  ? 0.1817 0.1965 0.1626 0.0501  0.0713  0.0099  50  GLN B C   
2249 O O   . GLN B 68  ? 0.1848 0.1937 0.1585 0.0560  0.0763  0.0115  50  GLN B O   
2250 C CB  . GLN B 68  ? 0.1830 0.2007 0.1602 0.0553  0.0598  0.0091  50  GLN B CB  
2251 C CG  . GLN B 68  ? 0.1865 0.1927 0.1522 0.0575  0.0564  0.0104  50  GLN B CG  
2252 C CD  . GLN B 68  ? 0.2010 0.1897 0.1552 0.0624  0.0612  0.0125  50  GLN B CD  
2253 O OE1 . GLN B 68  ? 0.2033 0.1821 0.1522 0.0602  0.0647  0.0108  50  GLN B OE1 
2254 N NE2 . GLN B 68  ? 0.2110 0.1950 0.1606 0.0694  0.0617  0.0156  50  GLN B NE2 
2255 N N   . ARG B 69  ? 0.1763 0.2028 0.1726 0.0441  0.0734  0.0086  51  ARG B N   
2256 C CA  A ARG B 69  ? 0.1821 0.2156 0.1881 0.0444  0.0826  0.0102  51  ARG B CA  
2257 C CA  B ARG B 69  ? 0.1819 0.2145 0.1877 0.0437  0.0828  0.0102  51  ARG B CA  
2258 C C   . ARG B 69  ? 0.1918 0.2078 0.1806 0.0468  0.0900  0.0144  51  ARG B C   
2259 O O   . ARG B 69  ? 0.1942 0.2115 0.1817 0.0520  0.0973  0.0166  51  ARG B O   
2260 C CB  A ARG B 69  ? 0.1810 0.2305 0.2112 0.0358  0.0850  0.0067  51  ARG B CB  
2261 C CB  B ARG B 69  ? 0.1814 0.2219 0.2051 0.0339  0.0857  0.0079  51  ARG B CB  
2262 C CG  A ARG B 69  ? 0.1754 0.2496 0.2243 0.0365  0.0776  0.0004  51  ARG B CG  
2263 C CG  B ARG B 69  ? 0.1916 0.2339 0.2250 0.0319  0.0986  0.0111  51  ARG B CG  
2264 C CD  A ARG B 69  ? 0.1776 0.2737 0.2558 0.0296  0.0823  -0.0048 51  ARG B CD  
2265 C CD  B ARG B 69  ? 0.2032 0.2258 0.2236 0.0293  0.1055  0.0162  51  ARG B CD  
2266 N NE  A ARG B 69  ? 0.1836 0.2836 0.2700 0.0316  0.0945  -0.0008 51  ARG B NE  
2267 N NE  B ARG B 69  ? 0.2142 0.2393 0.2483 0.0258  0.1198  0.0196  51  ARG B NE  
2268 C CZ  A ARG B 69  ? 0.1927 0.2962 0.2977 0.0229  0.1056  -0.0014 51  ARG B CZ  
2269 C CZ  B ARG B 69  ? 0.2153 0.2462 0.2715 0.0159  0.1246  0.0167  51  ARG B CZ  
2270 N NH1 A ARG B 69  ? 0.1933 0.2972 0.3119 0.0117  0.1056  -0.0067 51  ARG B NH1 
2271 N NH1 B ARG B 69  ? 0.2079 0.2428 0.2721 0.0094  0.1151  0.0098  51  ARG B NH1 
2272 N NH2 A ARG B 69  ? 0.2005 0.3055 0.3107 0.0251  0.1182  0.0034  51  ARG B NH2 
2273 N NH2 B ARG B 69  ? 0.2247 0.2565 0.2951 0.0123  0.1397  0.0203  51  ARG B NH2 
2274 N N   . PHE B 70  ? 0.1896 0.1915 0.1651 0.0441  0.0879  0.0150  52  PHE B N   
2275 C CA  . PHE B 70  ? 0.1995 0.1877 0.1566 0.0482  0.0928  0.0178  52  PHE B CA  
2276 C C   . PHE B 70  ? 0.2031 0.1832 0.1444 0.0548  0.0895  0.0152  52  PHE B C   
2277 O O   . PHE B 70  ? 0.2129 0.1871 0.1418 0.0606  0.0946  0.0158  52  PHE B O   
2278 C CB  . PHE B 70  ? 0.2028 0.1814 0.1514 0.0446  0.0905  0.0188  52  PHE B CB  
2279 C CG  . PHE B 70  ? 0.2043 0.1853 0.1660 0.0386  0.0969  0.0218  52  PHE B CG  
2280 C CD1 . PHE B 70  ? 0.2210 0.1977 0.1809 0.0407  0.1093  0.0279  52  PHE B CD1 
2281 C CD2 . PHE B 70  ? 0.1977 0.1848 0.1742 0.0311  0.0919  0.0183  52  PHE B CD2 
2282 C CE1 . PHE B 70  ? 0.2236 0.1996 0.1979 0.0341  0.1177  0.0307  52  PHE B CE1 
2283 C CE2 . PHE B 70  ? 0.1992 0.1869 0.1901 0.0243  0.0990  0.0193  52  PHE B CE2 
2284 C CZ  . PHE B 70  ? 0.2132 0.1952 0.2048 0.0252  0.1124  0.0254  52  PHE B CZ  
2285 N N   . LEU B 71  ? 0.1969 0.1764 0.1394 0.0541  0.0820  0.0119  53  LEU B N   
2286 C CA  . LEU B 71  ? 0.2053 0.1740 0.1352 0.0588  0.0801  0.0083  53  LEU B CA  
2287 C C   . LEU B 71  ? 0.2111 0.1818 0.1429 0.0661  0.0853  0.0088  53  LEU B C   
2288 O O   . LEU B 71  ? 0.2209 0.1803 0.1414 0.0707  0.0867  0.0051  53  LEU B O   
2289 C CB  . LEU B 71  ? 0.2038 0.1680 0.1343 0.0557  0.0730  0.0058  53  LEU B CB  
2290 C CG  . LEU B 71  ? 0.1984 0.1611 0.1278 0.0492  0.0673  0.0049  53  LEU B CG  
2291 C CD1 . LEU B 71  ? 0.1981 0.1562 0.1284 0.0475  0.0629  0.0031  53  LEU B CD1 
2292 C CD2 . LEU B 71  ? 0.2104 0.1665 0.1268 0.0500  0.0675  0.0024  53  LEU B CD2 
2293 N N   . ARG B 72  ? 0.2031 0.1886 0.1499 0.0675  0.0882  0.0120  54  ARG B N   
2294 C CA  . ARG B 72  ? 0.2061 0.1960 0.1562 0.0762  0.0929  0.0130  54  ARG B CA  
2295 C C   . ARG B 72  ? 0.2114 0.2122 0.1689 0.0794  0.1020  0.0155  54  ARG B C   
2296 O O   . ARG B 72  ? 0.2113 0.2147 0.1694 0.0878  0.1071  0.0162  54  ARG B O   
2297 C CB  . ARG B 72  ? 0.1993 0.2007 0.1611 0.0791  0.0885  0.0142  54  ARG B CB  
2298 C CG  . ARG B 72  ? 0.1947 0.1875 0.1511 0.0760  0.0813  0.0133  54  ARG B CG  
2299 C CD  . ARG B 72  ? 0.2055 0.1762 0.1466 0.0776  0.0824  0.0110  54  ARG B CD  
2300 N NE  . ARG B 72  ? 0.1991 0.1623 0.1370 0.0715  0.0768  0.0098  54  ARG B NE  
2301 C CZ  . ARG B 72  ? 0.2064 0.1529 0.1352 0.0688  0.0768  0.0060  54  ARG B CZ  
2302 N NH1 . ARG B 72  ? 0.2038 0.1472 0.1330 0.0633  0.0724  0.0055  54  ARG B NH1 
2303 N NH2 . ARG B 72  ? 0.2200 0.1539 0.1404 0.0716  0.0813  0.0016  54  ARG B NH2 
2304 N N   . GLU B 73  ? 0.2108 0.2169 0.1743 0.0732  0.1054  0.0175  55  GLU B N   
2305 C CA  . GLU B 73  ? 0.2209 0.2376 0.1947 0.0748  0.1160  0.0208  55  GLU B CA  
2306 C C   . GLU B 73  ? 0.2421 0.2457 0.1978 0.0778  0.1242  0.0234  55  GLU B C   
2307 O O   . GLU B 73  ? 0.2488 0.2426 0.1939 0.0740  0.1226  0.0243  55  GLU B O   
2308 C CB  . GLU B 73  ? 0.2107 0.2437 0.2083 0.0658  0.1170  0.0213  55  GLU B CB  
2309 C CG  . GLU B 73  ? 0.1980 0.2486 0.2133 0.0645  0.1083  0.0174  55  GLU B CG  
2310 C CD  . GLU B 73  ? 0.1926 0.2597 0.2319 0.0544  0.1077  0.0145  55  GLU B CD  
2311 O OE1 . GLU B 73  ? 0.1912 0.2547 0.2362 0.0477  0.1168  0.0166  55  GLU B OE1 
2312 O OE2 . GLU B 73  ? 0.1796 0.2623 0.2312 0.0534  0.0984  0.0096  55  GLU B OE2 
2313 N N   . GLY B 74  ? 0.2607 0.2646 0.2111 0.0862  0.1326  0.0247  56  GLY B N   
2314 C CA  . GLY B 74  ? 0.2863 0.2812 0.2195 0.0914  0.1421  0.0279  56  GLY B CA  
2315 C C   . GLY B 74  ? 0.2980 0.3048 0.2484 0.0894  0.1555  0.0346  56  GLY B C   
2316 O O   . GLY B 74  ? 0.2913 0.3138 0.2680 0.0823  0.1554  0.0346  56  GLY B O   
2317 N N   A PRO B 75  ? 0.3216 0.3220 0.2579 0.0958  0.1677  0.0399  57  PRO B N   
2318 N N   B PRO B 75  ? 0.3195 0.3201 0.2558 0.0961  0.1677  0.0397  57  PRO B N   
2319 C CA  A PRO B 75  ? 0.3441 0.3281 0.2475 0.1048  0.1663  0.0383  57  PRO B CA  
2320 C CA  B PRO B 75  ? 0.3413 0.3282 0.2469 0.1075  0.1686  0.0378  57  PRO B CA  
2321 C C   A PRO B 75  ? 0.3475 0.3215 0.2392 0.1001  0.1575  0.0377  57  PRO B C   
2322 C C   B PRO B 75  ? 0.3515 0.3241 0.2330 0.1080  0.1598  0.0351  57  PRO B C   
2323 O O   A PRO B 75  ? 0.3357 0.3130 0.2434 0.0906  0.1560  0.0404  57  PRO B O   
2324 O O   B PRO B 75  ? 0.3688 0.3324 0.2258 0.1169  0.1577  0.0303  57  PRO B O   
2325 C CB  A PRO B 75  ? 0.3657 0.3487 0.2602 0.1128  0.1837  0.0466  57  PRO B CB  
2326 C CB  B PRO B 75  ? 0.3603 0.3492 0.2624 0.1145  0.1868  0.0461  57  PRO B CB  
2327 C CG  A PRO B 75  ? 0.3580 0.3577 0.2816 0.1099  0.1940  0.0499  57  PRO B CG  
2328 C CG  B PRO B 75  ? 0.3528 0.3476 0.2764 0.1043  0.1943  0.0533  57  PRO B CG  
2329 C CD  A PRO B 75  ? 0.3309 0.3424 0.2828 0.0972  0.1844  0.0464  57  PRO B CD  
2330 C CD  B PRO B 75  ? 0.3273 0.3356 0.2793 0.0933  0.1836  0.0476  57  PRO B CD  
2331 N N   A ASN B 76  ? 0.3684 0.3314 0.2330 0.1073  0.1518  0.0332  58  ASN B N   
2332 N N   B ASN B 76  ? 0.3437 0.3154 0.2327 0.0991  0.1546  0.0371  58  ASN B N   
2333 C CA  A ASN B 76  ? 0.3714 0.3274 0.2241 0.1049  0.1430  0.0320  58  ASN B CA  
2334 C CA  B ASN B 76  ? 0.3537 0.3146 0.2212 0.1008  0.1475  0.0356  58  ASN B CA  
2335 C C   A ASN B 76  ? 0.3391 0.2978 0.2094 0.0933  0.1308  0.0275  58  ASN B C   
2336 C C   B ASN B 76  ? 0.3321 0.2920 0.2058 0.0924  0.1317  0.0283  58  ASN B C   
2337 O O   A ASN B 76  ? 0.3346 0.2931 0.2121 0.0866  0.1284  0.0307  58  ASN B O   
2338 O O   B ASN B 76  ? 0.3285 0.2864 0.2043 0.0869  0.1276  0.0303  58  ASN B O   
2339 C CB  A ASN B 76  ? 0.3901 0.3429 0.2385 0.1063  0.1535  0.0429  58  ASN B CB  
2340 C CB  B ASN B 76  ? 0.3666 0.3236 0.2320 0.1004  0.1574  0.0459  58  ASN B CB  
2341 C CG  A ASN B 76  ? 0.4193 0.3698 0.2523 0.1182  0.1691  0.0502  58  ASN B CG  
2342 C CG  B ASN B 76  ? 0.3899 0.3471 0.2524 0.1077  0.1765  0.0555  58  ASN B CG  
2343 O OD1 A ASN B 76  ? 0.4435 0.3929 0.2586 0.1283  0.1693  0.0452  58  ASN B OD1 
2344 O OD1 B ASN B 76  ? 0.3937 0.3530 0.2744 0.1018  0.1884  0.0636  58  ASN B OD1 
2345 N ND2 A ASN B 76  ? 0.4301 0.3792 0.2713 0.1168  0.1839  0.0619  58  ASN B ND2 
2346 N ND2 B ASN B 76  ? 0.4102 0.3648 0.2504 0.1205  0.1805  0.0542  58  ASN B ND2 
2347 N N   . LYS B 77  ? 0.3243 0.2847 0.2010 0.0921  0.1244  0.0205  59  LYS B N   
2348 C CA  . LYS B 77  ? 0.3051 0.2664 0.1935 0.0839  0.1132  0.0161  59  LYS B CA  
2349 C C   . LYS B 77  ? 0.2934 0.2472 0.1687 0.0819  0.1036  0.0113  59  LYS B C   
2350 O O   . LYS B 77  ? 0.3038 0.2518 0.1601 0.0880  0.1017  0.0062  59  LYS B O   
2351 C CB  . LYS B 77  ? 0.3197 0.2794 0.2101 0.0870  0.1110  0.0105  59  LYS B CB  
2352 C CG  . LYS B 77  ? 0.3223 0.2816 0.2228 0.0814  0.1025  0.0074  59  LYS B CG  
2353 C CD  . LYS B 77  ? 0.3354 0.2911 0.2381 0.0864  0.1033  0.0043  59  LYS B CD  
2354 C CE  . LYS B 77  ? 0.3766 0.3187 0.2620 0.0923  0.1048  -0.0030 59  LYS B CE  
2355 N NZ  . LYS B 77  ? 0.3962 0.3273 0.2744 0.0873  0.0968  -0.0111 59  LYS B NZ  
2356 N N   . THR B 78  ? 0.2686 0.2243 0.1545 0.0738  0.0972  0.0119  60  THR B N   
2357 C CA  . THR B 78  ? 0.2657 0.2169 0.1434 0.0714  0.0876  0.0068  60  THR B CA  
2358 C C   . THR B 78  ? 0.2638 0.2103 0.1403 0.0701  0.0807  -0.0023 60  THR B C   
2359 O O   . THR B 78  ? 0.2554 0.2021 0.1430 0.0681  0.0812  -0.0024 60  THR B O   
2360 C CB  . THR B 78  ? 0.2482 0.2027 0.1389 0.0633  0.0843  0.0106  60  THR B CB  
2361 O OG1 . THR B 78  ? 0.2534 0.2088 0.1452 0.0642  0.0928  0.0186  60  THR B OG1 
2362 C CG2 . THR B 78  ? 0.2450 0.1966 0.1296 0.0609  0.0750  0.0060  60  THR B CG2 
2363 N N   . GLY B 79  ? 0.2693 0.2122 0.1330 0.0718  0.0748  -0.0103 61  GLY B N   
2364 C CA  . GLY B 79  ? 0.2748 0.2120 0.1393 0.0690  0.0694  -0.0209 61  GLY B CA  
2365 C C   . GLY B 79  ? 0.2595 0.1964 0.1371 0.0604  0.0639  -0.0215 61  GLY B C   
2366 O O   . GLY B 79  ? 0.2408 0.1827 0.1257 0.0567  0.0625  -0.0148 61  GLY B O   
2367 N N   . THR B 80  ? 0.2641 0.1936 0.1449 0.0573  0.0621  -0.0300 62  THR B N   
2368 C CA  . THR B 80  ? 0.2590 0.1861 0.1518 0.0500  0.0594  -0.0302 62  THR B CA  
2369 C C   . THR B 80  ? 0.2682 0.1924 0.1625 0.0449  0.0546  -0.0425 62  THR B C   
2370 O O   . THR B 80  ? 0.2720 0.1895 0.1765 0.0393  0.0559  -0.0441 62  THR B O   
2371 C CB  . THR B 80  ? 0.2619 0.1815 0.1626 0.0507  0.0653  -0.0254 62  THR B CB  
2372 O OG1 . THR B 80  ? 0.2798 0.1892 0.1753 0.0549  0.0702  -0.0313 62  THR B OG1 
2373 C CG2 . THR B 80  ? 0.2521 0.1804 0.1565 0.0542  0.0679  -0.0147 62  THR B CG2 
2374 N N   A SER B 81  ? 0.2782 0.2084 0.1626 0.0476  0.0497  -0.0512 63  SER B N   
2375 N N   B SER B 81  ? 0.2779 0.2081 0.1626 0.0474  0.0496  -0.0512 63  SER B N   
2376 C CA  A SER B 81  ? 0.2891 0.2211 0.1773 0.0426  0.0439  -0.0661 63  SER B CA  
2377 C CA  B SER B 81  ? 0.2877 0.2191 0.1768 0.0421  0.0442  -0.0658 63  SER B CA  
2378 C C   A SER B 81  ? 0.2768 0.2179 0.1745 0.0369  0.0382  -0.0648 63  SER B C   
2379 C C   B SER B 81  ? 0.2769 0.2187 0.1743 0.0370  0.0378  -0.0656 63  SER B C   
2380 O O   A SER B 81  ? 0.2810 0.2205 0.1917 0.0291  0.0374  -0.0721 63  SER B O   
2381 O O   B SER B 81  ? 0.2814 0.2237 0.1906 0.0296  0.0356  -0.0751 63  SER B O   
2382 C CB  A SER B 81  ? 0.3070 0.2459 0.1807 0.0491  0.0390  -0.0781 63  SER B CB  
2383 C CB  B SER B 81  ? 0.3053 0.2419 0.1806 0.0483  0.0402  -0.0779 63  SER B CB  
2384 O OG  A SER B 81  ? 0.3075 0.2595 0.1690 0.0562  0.0339  -0.0736 63  SER B OG  
2385 O OG  B SER B 81  ? 0.3182 0.2438 0.1871 0.0526  0.0469  -0.0796 63  SER B OG  
2386 N N   . CYS B 82  ? 0.2669 0.2166 0.1591 0.0407  0.0357  -0.0554 64  CYS B N   
2387 C CA  . CYS B 82  ? 0.2612 0.2213 0.1589 0.0381  0.0296  -0.0557 64  CYS B CA  
2388 C C   . CYS B 82  ? 0.2416 0.2041 0.1362 0.0411  0.0307  -0.0421 64  CYS B C   
2389 O O   . CYS B 82  ? 0.2462 0.2084 0.1292 0.0481  0.0335  -0.0354 64  CYS B O   
2390 C CB  . CYS B 82  ? 0.2823 0.2557 0.1726 0.0425  0.0211  -0.0679 64  CYS B CB  
2391 S SG  . CYS B 82  ? 0.3065 0.2944 0.2102 0.0375  0.0134  -0.0734 64  CYS B SG  
2392 N N   . ALA B 83  ? 0.2241 0.1886 0.1294 0.0358  0.0296  -0.0384 65  ALA B N   
2393 C CA  . ALA B 83  ? 0.2168 0.1827 0.1210 0.0376  0.0305  -0.0277 65  ALA B CA  
2394 C C   . ALA B 83  ? 0.2175 0.1925 0.1254 0.0370  0.0249  -0.0302 65  ALA B C   
2395 O O   . ALA B 83  ? 0.2187 0.1987 0.1353 0.0326  0.0214  -0.0390 65  ALA B O   
2396 C CB  . ALA B 83  ? 0.2080 0.1677 0.1208 0.0332  0.0353  -0.0202 65  ALA B CB  
2397 N N   . LEU B 84  ? 0.2143 0.1910 0.1162 0.0419  0.0250  -0.0228 66  LEU B N   
2398 C CA  . LEU B 84  ? 0.2127 0.1971 0.1172 0.0433  0.0207  -0.0230 66  LEU B CA  
2399 C C   . LEU B 84  ? 0.2028 0.1811 0.1134 0.0398  0.0245  -0.0147 66  LEU B C   
2400 O O   . LEU B 84  ? 0.2092 0.1802 0.1157 0.0414  0.0296  -0.0073 66  LEU B O   
2401 C CB  . LEU B 84  ? 0.2261 0.2162 0.1160 0.0546  0.0183  -0.0210 66  LEU B CB  
2402 C CG  . LEU B 84  ? 0.2280 0.2264 0.1190 0.0590  0.0143  -0.0198 66  LEU B CG  
2403 C CD1 . LEU B 84  ? 0.2247 0.2385 0.1277 0.0555  0.0065  -0.0315 66  LEU B CD1 
2404 C CD2 . LEU B 84  ? 0.2465 0.2466 0.1195 0.0730  0.0145  -0.0140 66  LEU B CD2 
2405 N N   . ASP B 85  ? 0.1902 0.1722 0.1111 0.0352  0.0227  -0.0167 67  ASP B N   
2406 C CA  . ASP B 85  ? 0.1843 0.1616 0.1101 0.0325  0.0256  -0.0108 67  ASP B CA  
2407 C C   . ASP B 85  ? 0.1867 0.1690 0.1105 0.0375  0.0232  -0.0095 67  ASP B C   
2408 O O   . ASP B 85  ? 0.1827 0.1751 0.1120 0.0376  0.0191  -0.0147 67  ASP B O   
2409 C CB  . ASP B 85  ? 0.1795 0.1567 0.1157 0.0258  0.0265  -0.0131 67  ASP B CB  
2410 C CG  . ASP B 85  ? 0.1823 0.1558 0.1212 0.0242  0.0290  -0.0082 67  ASP B CG  
2411 O OD1 . ASP B 85  ? 0.1868 0.1580 0.1219 0.0267  0.0296  -0.0047 67  ASP B OD1 
2412 O OD2 . ASP B 85  ? 0.1774 0.1501 0.1217 0.0209  0.0309  -0.0083 67  ASP B OD2 
2413 N N   . CYS B 86  ? 0.1907 0.1659 0.1078 0.0418  0.0268  -0.0028 68  CYS B N   
2414 C CA  . CYS B 86  ? 0.1971 0.1738 0.1095 0.0493  0.0262  0.0001  68  CYS B CA  
2415 C C   . CYS B 86  ? 0.1941 0.1665 0.1132 0.0460  0.0284  0.0018  68  CYS B C   
2416 O O   . CYS B 86  ? 0.1919 0.1557 0.1144 0.0408  0.0324  0.0036  68  CYS B O   
2417 C CB  . CYS B 86  ? 0.2134 0.1809 0.1133 0.0571  0.0315  0.0075  68  CYS B CB  
2418 S SG  . CYS B 86  ? 0.2254 0.1979 0.1128 0.0639  0.0296  0.0061  68  CYS B SG  
2419 N N   . GLY B 87  ? 0.1913 0.1712 0.1129 0.0498  0.0255  0.0002  69  GLY B N   
2420 C CA  . GLY B 87  ? 0.1856 0.1628 0.1135 0.0466  0.0273  0.0003  69  GLY B CA  
2421 C C   . GLY B 87  ? 0.1730 0.1525 0.1093 0.0379  0.0270  -0.0031 69  GLY B C   
2422 O O   . GLY B 87  ? 0.1735 0.1477 0.1116 0.0349  0.0294  -0.0025 69  GLY B O   
2423 N N   . ALA B 88  ? 0.1683 0.1559 0.1094 0.0351  0.0244  -0.0072 70  ALA B N   
2424 C CA  . ALA B 88  ? 0.1659 0.1522 0.1129 0.0281  0.0261  -0.0089 70  ALA B CA  
2425 C C   . ALA B 88  ? 0.1644 0.1524 0.1173 0.0260  0.0285  -0.0087 70  ALA B C   
2426 O O   . ALA B 88  ? 0.1646 0.1486 0.1183 0.0230  0.0314  -0.0073 70  ALA B O   
2427 C CB  . ALA B 88  ? 0.1665 0.1589 0.1183 0.0255  0.0242  -0.0142 70  ALA B CB  
2428 N N   . GLY B 89  ? 0.1646 0.1590 0.1205 0.0291  0.0277  -0.0095 71  GLY B N   
2429 C CA  . GLY B 89  ? 0.1662 0.1628 0.1271 0.0280  0.0311  -0.0091 71  GLY B CA  
2430 C C   . GLY B 89  ? 0.1635 0.1640 0.1341 0.0225  0.0342  -0.0111 71  GLY B C   
2431 O O   . GLY B 89  ? 0.1623 0.1693 0.1404 0.0197  0.0323  -0.0159 71  GLY B O   
2432 N N   . ILE B 90  ? 0.1654 0.1610 0.1353 0.0213  0.0396  -0.0078 72  ILE B N   
2433 C CA  . ILE B 90  ? 0.1724 0.1672 0.1507 0.0166  0.0460  -0.0076 72  ILE B CA  
2434 C C   . ILE B 90  ? 0.1788 0.1651 0.1544 0.0140  0.0468  -0.0071 72  ILE B C   
2435 O O   . ILE B 90  ? 0.1854 0.1671 0.1672 0.0105  0.0534  -0.0065 72  ILE B O   
2436 C CB  . ILE B 90  ? 0.1790 0.1704 0.1545 0.0189  0.0534  -0.0022 72  ILE B CB  
2437 C CG1 . ILE B 90  ? 0.1848 0.1684 0.1457 0.0233  0.0525  0.0019  72  ILE B CG1 
2438 C CG2 . ILE B 90  ? 0.1803 0.1804 0.1599 0.0216  0.0540  -0.0032 72  ILE B CG2 
2439 C CD1 . ILE B 90  ? 0.1980 0.1788 0.1523 0.0280  0.0595  0.0074  72  ILE B CD1 
2440 N N   . GLY B 91  ? 0.1739 0.1568 0.1407 0.0160  0.0417  -0.0069 73  GLY B N   
2441 C CA  . GLY B 91  ? 0.1770 0.1527 0.1407 0.0148  0.0426  -0.0062 73  GLY B CA  
2442 C C   . GLY B 91  ? 0.1777 0.1470 0.1334 0.0181  0.0451  -0.0006 73  GLY B C   
2443 O O   . GLY B 91  ? 0.1800 0.1426 0.1348 0.0182  0.0489  0.0012  73  GLY B O   
2444 N N   . ARG B 92  ? 0.1711 0.1427 0.1207 0.0217  0.0428  0.0010  74  ARG B N   
2445 C CA  . ARG B 92  ? 0.1746 0.1449 0.1169 0.0259  0.0429  0.0041  74  ARG B CA  
2446 C C   . ARG B 92  ? 0.1766 0.1449 0.1182 0.0256  0.0411  0.0038  74  ARG B C   
2447 O O   . ARG B 92  ? 0.1928 0.1587 0.1315 0.0289  0.0437  0.0071  74  ARG B O   
2448 C CB  . ARG B 92  ? 0.1736 0.1485 0.1118 0.0283  0.0391  0.0022  74  ARG B CB  
2449 C CG  . ARG B 92  ? 0.1778 0.1565 0.1098 0.0330  0.0371  0.0024  74  ARG B CG  
2450 C CD  . ARG B 92  ? 0.1779 0.1606 0.1090 0.0331  0.0330  -0.0028 74  ARG B CD  
2451 N NE  . ARG B 92  ? 0.1726 0.1535 0.1093 0.0284  0.0306  -0.0063 74  ARG B NE  
2452 C CZ  . ARG B 92  ? 0.1717 0.1555 0.1118 0.0269  0.0285  -0.0087 74  ARG B CZ  
2453 N NH1 . ARG B 92  ? 0.1737 0.1649 0.1126 0.0302  0.0267  -0.0092 74  ARG B NH1 
2454 N NH2 . ARG B 92  ? 0.1722 0.1521 0.1172 0.0229  0.0289  -0.0103 74  ARG B NH2 
2455 N N   . ILE B 93  ? 0.1707 0.1400 0.1141 0.0231  0.0376  0.0008  75  ILE B N   
2456 C CA  . ILE B 93  ? 0.1728 0.1409 0.1156 0.0231  0.0368  0.0006  75  ILE B CA  
2457 C C   . ILE B 93  ? 0.1782 0.1413 0.1222 0.0218  0.0394  0.0000  75  ILE B C   
2458 O O   . ILE B 93  ? 0.1830 0.1433 0.1257 0.0236  0.0413  0.0013  75  ILE B O   
2459 C CB  . ILE B 93  ? 0.1718 0.1409 0.1146 0.0219  0.0344  -0.0010 75  ILE B CB  
2460 C CG1 . ILE B 93  ? 0.1754 0.1471 0.1189 0.0220  0.0329  -0.0020 75  ILE B CG1 
2461 C CG2 . ILE B 93  ? 0.1765 0.1448 0.1191 0.0222  0.0353  -0.0005 75  ILE B CG2 
2462 C CD1 . ILE B 93  ? 0.1788 0.1474 0.1226 0.0211  0.0332  -0.0026 75  ILE B CD1 
2463 N N   . THR B 94  ? 0.1785 0.1417 0.1262 0.0190  0.0394  -0.0032 76  THR B N   
2464 C CA  . THR B 94  ? 0.1930 0.1519 0.1442 0.0164  0.0419  -0.0067 76  THR B CA  
2465 C C   . THR B 94  ? 0.1998 0.1504 0.1519 0.0172  0.0486  -0.0031 76  THR B C   
2466 O O   . THR B 94  ? 0.2051 0.1489 0.1562 0.0178  0.0514  -0.0038 76  THR B O   
2467 C CB  . THR B 94  ? 0.1949 0.1595 0.1535 0.0127  0.0401  -0.0130 76  THR B CB  
2468 O OG1 . THR B 94  ? 0.2024 0.1734 0.1567 0.0149  0.0341  -0.0159 76  THR B OG1 
2469 C CG2 . THR B 94  ? 0.2007 0.1615 0.1665 0.0084  0.0432  -0.0191 76  THR B CG2 
2470 N N   . LYS B 95  ? 0.2045 0.1545 0.1565 0.0188  0.0521  0.0015  77  LYS B N   
2471 C CA  . LYS B 95  ? 0.2276 0.1685 0.1779 0.0221  0.0602  0.0071  77  LYS B CA  
2472 C C   . LYS B 95  ? 0.2258 0.1650 0.1682 0.0290  0.0600  0.0116  77  LYS B C   
2473 O O   . LYS B 95  ? 0.2300 0.1593 0.1716 0.0313  0.0658  0.0138  77  LYS B O   
2474 C CB  . LYS B 95  ? 0.2410 0.1828 0.1893 0.0250  0.0642  0.0124  77  LYS B CB  
2475 C CG  . LYS B 95  ? 0.2831 0.2133 0.2285 0.0295  0.0752  0.0200  77  LYS B CG  
2476 C CD  . LYS B 95  ? 0.3048 0.2369 0.2475 0.0326  0.0800  0.0250  77  LYS B CD  
2477 C CE  . LYS B 95  ? 0.3587 0.2775 0.2977 0.0381  0.0935  0.0344  77  LYS B CE  
2478 N NZ  . LYS B 95  ? 0.3729 0.2784 0.3257 0.0296  0.1038  0.0321  77  LYS B NZ  
2479 N N   . ARG B 96  ? 0.2182 0.1673 0.1559 0.0329  0.0540  0.0127  78  ARG B N   
2480 C CA  . ARG B 96  ? 0.2312 0.1834 0.1635 0.0405  0.0536  0.0166  78  ARG B CA  
2481 C C   . ARG B 96  ? 0.2165 0.1730 0.1510 0.0399  0.0499  0.0136  78  ARG B C   
2482 O O   . ARG B 96  ? 0.2273 0.1855 0.1596 0.0464  0.0511  0.0166  78  ARG B O   
2483 C CB  . ARG B 96  ? 0.2517 0.2148 0.1790 0.0461  0.0496  0.0181  78  ARG B CB  
2484 C CG  . ARG B 96  ? 0.2876 0.2467 0.2089 0.0507  0.0550  0.0233  78  ARG B CG  
2485 C CD  . ARG B 96  ? 0.3089 0.2814 0.2241 0.0563  0.0490  0.0220  78  ARG B CD  
2486 N NE  . ARG B 96  ? 0.3314 0.3139 0.2421 0.0651  0.0452  0.0228  78  ARG B NE  
2487 C CZ  . ARG B 96  ? 0.3502 0.3476 0.2560 0.0717  0.0389  0.0198  78  ARG B CZ  
2488 N NH1 . ARG B 96  ? 0.3472 0.3485 0.2499 0.0705  0.0364  0.0162  78  ARG B NH1 
2489 N NH2 . ARG B 96  ? 0.3661 0.3753 0.2693 0.0809  0.0354  0.0203  78  ARG B NH2 
2490 N N   . LEU B 97  ? 0.1988 0.1576 0.1370 0.0338  0.0462  0.0086  79  LEU B N   
2491 C CA  . LEU B 97  ? 0.1943 0.1564 0.1341 0.0334  0.0445  0.0067  79  LEU B CA  
2492 C C   . LEU B 97  ? 0.1960 0.1495 0.1351 0.0312  0.0472  0.0040  79  LEU B C   
2493 O O   . LEU B 97  ? 0.2017 0.1524 0.1395 0.0343  0.0498  0.0045  79  LEU B O   
2494 C CB  . LEU B 97  ? 0.1883 0.1577 0.1310 0.0299  0.0404  0.0041  79  LEU B CB  
2495 C CG  . LEU B 97  ? 0.1875 0.1592 0.1324 0.0293  0.0411  0.0032  79  LEU B CG  
2496 C CD1 . LEU B 97  ? 0.1911 0.1708 0.1402 0.0334  0.0419  0.0045  79  LEU B CD1 
2497 C CD2 . LEU B 97  ? 0.1870 0.1603 0.1340 0.0255  0.0398  0.0017  79  LEU B CD2 
2498 N N   . LEU B 98  ? 0.1901 0.1410 0.1299 0.0266  0.0460  0.0001  80  LEU B N   
2499 C CA  . LEU B 98  ? 0.1903 0.1380 0.1287 0.0251  0.0459  -0.0049 80  LEU B CA  
2500 C C   . LEU B 98  ? 0.1977 0.1356 0.1380 0.0237  0.0503  -0.0086 80  LEU B C   
2501 O O   . LEU B 98  ? 0.2003 0.1331 0.1378 0.0256  0.0525  -0.0112 80  LEU B O   
2502 C CB  . LEU B 98  ? 0.1880 0.1410 0.1261 0.0224  0.0413  -0.0087 80  LEU B CB  
2503 C CG  . LEU B 98  ? 0.1842 0.1428 0.1201 0.0238  0.0388  -0.0054 80  LEU B CG  
2504 C CD1 . LEU B 98  ? 0.1880 0.1503 0.1224 0.0235  0.0353  -0.0078 80  LEU B CD1 
2505 C CD2 . LEU B 98  ? 0.1865 0.1450 0.1185 0.0267  0.0407  -0.0037 80  LEU B CD2 
2506 N N   . LEU B 99  ? 0.1960 0.1300 0.1418 0.0204  0.0532  -0.0090 81  LEU B N   
2507 C CA  . LEU B 99  ? 0.2096 0.1317 0.1604 0.0175  0.0598  -0.0131 81  LEU B CA  
2508 C C   . LEU B 99  ? 0.2193 0.1300 0.1655 0.0233  0.0663  -0.0087 81  LEU B C   
2509 O O   . LEU B 99  ? 0.2271 0.1275 0.1747 0.0221  0.0705  -0.0143 81  LEU B O   
2510 C CB  . LEU B 99  ? 0.2112 0.1295 0.1707 0.0130  0.0649  -0.0125 81  LEU B CB  
2511 C CG  . LEU B 99  ? 0.2102 0.1385 0.1787 0.0059  0.0601  -0.0215 81  LEU B CG  
2512 C CD1 . LEU B 99  ? 0.2102 0.1377 0.1875 0.0025  0.0658  -0.0184 81  LEU B CD1 
2513 C CD2 . LEU B 99  ? 0.2233 0.1492 0.1987 0.0005  0.0600  -0.0340 81  LEU B CD2 
2514 N N   . PRO B 100 ? 0.2186 0.1319 0.1598 0.0304  0.0671  0.0005  82  PRO B N   
2515 C CA  . PRO B 100 ? 0.2328 0.1370 0.1700 0.0378  0.0733  0.0050  82  PRO B CA  
2516 C C   . PRO B 100 ? 0.2350 0.1418 0.1692 0.0400  0.0710  0.0011  82  PRO B C   
2517 O O   . PRO B 100 ? 0.2502 0.1477 0.1819 0.0455  0.0768  0.0027  82  PRO B O   
2518 C CB  . PRO B 100 ? 0.2314 0.1445 0.1644 0.0460  0.0720  0.0143  82  PRO B CB  
2519 C CG  . PRO B 100 ? 0.2240 0.1423 0.1589 0.0418  0.0695  0.0149  82  PRO B CG  
2520 C CD  . PRO B 100 ? 0.2123 0.1353 0.1520 0.0329  0.0639  0.0065  82  PRO B CD  
2521 N N   . LEU B 101 ? 0.2221 0.1405 0.1557 0.0372  0.0641  -0.0025 83  LEU B N   
2522 C CA  . LEU B 101 ? 0.2239 0.1460 0.1536 0.0402  0.0631  -0.0045 83  LEU B CA  
2523 C C   . LEU B 101 ? 0.2307 0.1497 0.1570 0.0368  0.0615  -0.0139 83  LEU B C   
2524 O O   . LEU B 101 ? 0.2404 0.1580 0.1615 0.0409  0.0634  -0.0159 83  LEU B O   
2525 C CB  . LEU B 101 ? 0.2120 0.1489 0.1425 0.0411  0.0586  -0.0007 83  LEU B CB  
2526 C CG  . LEU B 101 ? 0.2084 0.1538 0.1428 0.0454  0.0582  0.0057  83  LEU B CG  
2527 C CD1 . LEU B 101 ? 0.2000 0.1585 0.1385 0.0425  0.0537  0.0058  83  LEU B CD1 
2528 C CD2 . LEU B 101 ? 0.2180 0.1637 0.1522 0.0536  0.0626  0.0090  83  LEU B CD2 
2529 N N   . PHE B 102 ? 0.2239 0.1438 0.1529 0.0307  0.0580  -0.0200 84  PHE B N   
2530 C CA  . PHE B 102 ? 0.2284 0.1505 0.1537 0.0289  0.0542  -0.0303 84  PHE B CA  
2531 C C   . PHE B 102 ? 0.2385 0.1522 0.1716 0.0228  0.0563  -0.0403 84  PHE B C   
2532 O O   . PHE B 102 ? 0.2357 0.1465 0.1780 0.0179  0.0587  -0.0385 84  PHE B O   
2533 C CB  . PHE B 102 ? 0.2216 0.1562 0.1447 0.0282  0.0473  -0.0300 84  PHE B CB  
2534 C CG  . PHE B 102 ? 0.2142 0.1544 0.1318 0.0329  0.0474  -0.0215 84  PHE B CG  
2535 C CD1 . PHE B 102 ? 0.2234 0.1654 0.1317 0.0379  0.0480  -0.0223 84  PHE B CD1 
2536 C CD2 . PHE B 102 ? 0.2083 0.1519 0.1310 0.0321  0.0479  -0.0135 84  PHE B CD2 
2537 C CE1 . PHE B 102 ? 0.2220 0.1680 0.1280 0.0413  0.0507  -0.0143 84  PHE B CE1 
2538 C CE2 . PHE B 102 ? 0.2042 0.1531 0.1257 0.0348  0.0490  -0.0076 84  PHE B CE2 
2539 C CZ  . PHE B 102 ? 0.2120 0.1614 0.1263 0.0389  0.0513  -0.0076 84  PHE B CZ  
2540 N N   . ARG B 103 ? 0.2493 0.1596 0.1792 0.0228  0.0560  -0.0515 85  ARG B N   
2541 C CA  . ARG B 103 ? 0.2618 0.1639 0.2020 0.0155  0.0587  -0.0640 85  ARG B CA  
2542 C C   . ARG B 103 ? 0.2537 0.1678 0.2048 0.0082  0.0530  -0.0701 85  ARG B C   
2543 O O   . ARG B 103 ? 0.2516 0.1590 0.2168 0.0006  0.0582  -0.0734 85  ARG B O   
2544 C CB  . ARG B 103 ? 0.2801 0.1787 0.2141 0.0172  0.0579  -0.0778 85  ARG B CB  
2545 C CG  . ARG B 103 ? 0.2944 0.1798 0.2201 0.0245  0.0654  -0.0713 85  ARG B CG  
2546 N N   . GLU B 104 ? 0.2456 0.1768 0.1903 0.0113  0.0437  -0.0703 86  GLU B N   
2547 C CA  . GLU B 104 ? 0.2423 0.1876 0.1959 0.0069  0.0376  -0.0747 86  GLU B CA  
2548 C C   . GLU B 104 ? 0.2251 0.1804 0.1707 0.0125  0.0331  -0.0631 86  GLU B C   
2549 O O   . GLU B 104 ? 0.2208 0.1749 0.1532 0.0196  0.0331  -0.0555 86  GLU B O   
2550 C CB  . GLU B 104 ? 0.2547 0.2133 0.2093 0.0062  0.0294  -0.0920 86  GLU B CB  
2551 C CG  . GLU B 104 ? 0.2787 0.2284 0.2442 -0.0009 0.0334  -0.1074 86  GLU B CG  
2552 C CD  . GLU B 104 ? 0.2931 0.2609 0.2597 -0.0010 0.0230  -0.1271 86  GLU B CD  
2553 O OE1 . GLU B 104 ? 0.3087 0.2810 0.2579 0.0077  0.0179  -0.1313 86  GLU B OE1 
2554 O OE2 . GLU B 104 ? 0.2994 0.2784 0.2842 -0.0090 0.0200  -0.1387 86  GLU B OE2 
2555 N N   . VAL B 105 ? 0.2165 0.1798 0.1716 0.0088  0.0311  -0.0618 87  VAL B N   
2556 C CA  . VAL B 105 ? 0.2083 0.1796 0.1581 0.0131  0.0275  -0.0527 87  VAL B CA  
2557 C C   . VAL B 105 ? 0.2087 0.1967 0.1650 0.0126  0.0205  -0.0599 87  VAL B C   
2558 O O   . VAL B 105 ? 0.2121 0.2045 0.1838 0.0055  0.0209  -0.0688 87  VAL B O   
2559 C CB  . VAL B 105 ? 0.2011 0.1648 0.1541 0.0116  0.0333  -0.0407 87  VAL B CB  
2560 C CG1 . VAL B 105 ? 0.1969 0.1673 0.1449 0.0156  0.0300  -0.0328 87  VAL B CG1 
2561 C CG2 . VAL B 105 ? 0.2051 0.1563 0.1523 0.0140  0.0391  -0.0342 87  VAL B CG2 
2562 N N   . ASP B 106 ? 0.2067 0.2037 0.1520 0.0206  0.0150  -0.0560 88  ASP B N   
2563 C CA  . ASP B 106 ? 0.2086 0.2221 0.1581 0.0232  0.0086  -0.0595 88  ASP B CA  
2564 C C   . ASP B 106 ? 0.1985 0.2084 0.1463 0.0252  0.0113  -0.0470 88  ASP B C   
2565 O O   . ASP B 106 ? 0.2001 0.1987 0.1382 0.0279  0.0153  -0.0370 88  ASP B O   
2566 C CB  . ASP B 106 ? 0.2178 0.2436 0.1530 0.0341  0.0009  -0.0635 88  ASP B CB  
2567 C CG  . ASP B 106 ? 0.2325 0.2677 0.1691 0.0335  -0.0044 -0.0798 88  ASP B CG  
2568 O OD1 . ASP B 106 ? 0.2351 0.2687 0.1882 0.0230  -0.0025 -0.0897 88  ASP B OD1 
2569 O OD2 . ASP B 106 ? 0.2393 0.2840 0.1602 0.0443  -0.0105 -0.0834 88  ASP B OD2 
2570 N N   . MET B 107 ? 0.1938 0.2139 0.1526 0.0235  0.0094  -0.0488 89  MET B N   
2571 C CA  . MET B 107 ? 0.1888 0.2064 0.1459 0.0260  0.0116  -0.0390 89  MET B CA  
2572 C C   . MET B 107 ? 0.1921 0.2236 0.1460 0.0344  0.0057  -0.0400 89  MET B C   
2573 O O   . MET B 107 ? 0.1972 0.2456 0.1601 0.0346  0.0001  -0.0500 89  MET B O   
2574 C CB  . MET B 107 ? 0.1867 0.2021 0.1582 0.0182  0.0168  -0.0381 89  MET B CB  
2575 C CG  . MET B 107 ? 0.1920 0.1925 0.1641 0.0126  0.0236  -0.0350 89  MET B CG  
2576 S SD  . MET B 107 ? 0.2035 0.2009 0.1908 0.0052  0.0316  -0.0339 89  MET B SD  
2577 C CE  . MET B 107 ? 0.1918 0.1890 0.1727 0.0102  0.0324  -0.0243 89  MET B CE  
2578 N N   . VAL B 108 ? 0.1910 0.2160 0.1341 0.0413  0.0075  -0.0302 90  VAL B N   
2579 C CA  . VAL B 108 ? 0.1956 0.2310 0.1348 0.0512  0.0037  -0.0287 90  VAL B CA  
2580 C C   . VAL B 108 ? 0.1894 0.2168 0.1301 0.0514  0.0084  -0.0209 90  VAL B C   
2581 O O   . VAL B 108 ? 0.1921 0.2033 0.1274 0.0490  0.0140  -0.0140 90  VAL B O   
2582 C CB  . VAL B 108 ? 0.2094 0.2464 0.1305 0.0639  0.0009  -0.0259 90  VAL B CB  
2583 C CG1 . VAL B 108 ? 0.2177 0.2345 0.1255 0.0655  0.0082  -0.0154 90  VAL B CG1 
2584 C CG2 . VAL B 108 ? 0.2193 0.2677 0.1357 0.0765  -0.0026 -0.0236 90  VAL B CG2 
2585 N N   . ASP B 109 ? 0.1868 0.2267 0.1364 0.0537  0.0063  -0.0234 91  ASP B N   
2586 C CA  . ASP B 109 ? 0.1843 0.2168 0.1341 0.0552  0.0109  -0.0170 91  ASP B CA  
2587 C C   . ASP B 109 ? 0.1902 0.2390 0.1444 0.0641  0.0073  -0.0188 91  ASP B C   
2588 O O   . ASP B 109 ? 0.1871 0.2566 0.1517 0.0645  0.0014  -0.0272 91  ASP B O   
2589 C CB  . ASP B 109 ? 0.1743 0.2026 0.1353 0.0447  0.0154  -0.0179 91  ASP B CB  
2590 C CG  . ASP B 109 ? 0.1742 0.1909 0.1311 0.0459  0.0203  -0.0119 91  ASP B CG  
2591 O OD1 . ASP B 109 ? 0.1762 0.1783 0.1256 0.0436  0.0234  -0.0081 91  ASP B OD1 
2592 O OD2 . ASP B 109 ? 0.1783 0.2017 0.1401 0.0495  0.0210  -0.0121 91  ASP B OD2 
2593 N N   . ILE B 110 ? 0.1977 0.2381 0.1452 0.0713  0.0109  -0.0118 92  ILE B N   
2594 C CA  . ILE B 110 ? 0.2048 0.2602 0.1556 0.0818  0.0082  -0.0124 92  ILE B CA  
2595 C C   . ILE B 110 ? 0.1973 0.2669 0.1670 0.0759  0.0088  -0.0178 92  ILE B C   
2596 O O   . ILE B 110 ? 0.1924 0.2823 0.1704 0.0834  0.0051  -0.0212 92  ILE B O   
2597 C CB  . ILE B 110 ? 0.2232 0.2619 0.1601 0.0926  0.0136  -0.0028 92  ILE B CB  
2598 C CG1 . ILE B 110 ? 0.2431 0.2969 0.1773 0.1086  0.0101  -0.0015 92  ILE B CG1 
2599 C CG2 . ILE B 110 ? 0.2203 0.2440 0.1606 0.0861  0.0207  -0.0006 92  ILE B CG2 
2600 C CD1 . ILE B 110 ? 0.2668 0.3004 0.1851 0.1212  0.0172  0.0091  92  ILE B CD1 
2601 N N   . THR B 111 ? 0.1845 0.2441 0.1602 0.0643  0.0141  -0.0179 93  THR B N   
2602 C CA  . THR B 111 ? 0.1818 0.2499 0.1724 0.0594  0.0180  -0.0204 93  THR B CA  
2603 C C   . THR B 111 ? 0.1791 0.2612 0.1881 0.0491  0.0176  -0.0283 93  THR B C   
2604 O O   . THR B 111 ? 0.1760 0.2470 0.1853 0.0399  0.0212  -0.0281 93  THR B O   
2605 C CB  . THR B 111 ? 0.1763 0.2248 0.1596 0.0561  0.0252  -0.0148 93  THR B CB  
2606 O OG1 . THR B 111 ? 0.1796 0.2156 0.1493 0.0651  0.0262  -0.0097 93  THR B OG1 
2607 C CG2 . THR B 111 ? 0.1757 0.2322 0.1713 0.0532  0.0308  -0.0161 93  THR B CG2 
2608 N N   . GLU B 112 ? 0.1919 0.2986 0.2174 0.0508  0.0139  -0.0357 94  GLU B N   
2609 C CA  . GLU B 112 ? 0.2021 0.3230 0.2489 0.0398  0.0141  -0.0455 94  GLU B CA  
2610 C C   . GLU B 112 ? 0.1942 0.3022 0.2487 0.0286  0.0251  -0.0425 94  GLU B C   
2611 O O   . GLU B 112 ? 0.1830 0.2846 0.2433 0.0188  0.0280  -0.0458 94  GLU B O   
2612 C CB  . GLU B 112 ? 0.2253 0.3777 0.2932 0.0428  0.0093  -0.0550 94  GLU B CB  
2613 C CG  . GLU B 112 ? 0.2516 0.4201 0.3469 0.0294  0.0108  -0.0674 94  GLU B CG  
2614 C CD  A GLU B 112 ? 0.2854 0.4545 0.3802 0.0240  0.0044  -0.0767 94  GLU B CD  
2615 O OE1 A GLU B 112 ? 0.3314 0.4900 0.4038 0.0313  -0.0013 -0.0730 94  GLU B OE1 
2616 O OE2 A GLU B 112 ? 0.3373 0.5170 0.4552 0.0120  0.0061  -0.0886 94  GLU B OE2 
2617 N N   . ASP B 113 ? 0.1943 0.2972 0.2472 0.0313  0.0322  -0.0358 95  ASP B N   
2618 C CA  . ASP B 113 ? 0.1982 0.2906 0.2563 0.0235  0.0434  -0.0320 95  ASP B CA  
2619 C C   . ASP B 113 ? 0.1882 0.2575 0.2308 0.0197  0.0461  -0.0265 95  ASP B C   
2620 O O   . ASP B 113 ? 0.1896 0.2510 0.2379 0.0126  0.0549  -0.0247 95  ASP B O   
2621 C CB  . ASP B 113 ? 0.2184 0.3101 0.2739 0.0294  0.0503  -0.0259 95  ASP B CB  
2622 C CG  . ASP B 113 ? 0.2430 0.3585 0.3192 0.0312  0.0515  -0.0308 95  ASP B CG  
2623 O OD1 . ASP B 113 ? 0.2511 0.3864 0.3493 0.0254  0.0491  -0.0399 95  ASP B OD1 
2624 O OD2 . ASP B 113 ? 0.2719 0.3883 0.3438 0.0388  0.0553  -0.0265 95  ASP B OD2 
2625 N N   . PHE B 114 ? 0.1774 0.2360 0.2016 0.0245  0.0396  -0.0239 96  PHE B N   
2626 C CA  . PHE B 114 ? 0.1712 0.2112 0.1825 0.0217  0.0414  -0.0195 96  PHE B CA  
2627 C C   . PHE B 114 ? 0.1727 0.2129 0.1911 0.0146  0.0401  -0.0246 96  PHE B C   
2628 O O   . PHE B 114 ? 0.1741 0.2026 0.1915 0.0098  0.0460  -0.0220 96  PHE B O   
2629 C CB  . PHE B 114 ? 0.1688 0.1982 0.1618 0.0278  0.0363  -0.0157 96  PHE B CB  
2630 C CG  . PHE B 114 ? 0.1706 0.1948 0.1549 0.0338  0.0383  -0.0117 96  PHE B CG  
2631 C CD1 . PHE B 114 ? 0.1731 0.1994 0.1611 0.0344  0.0446  -0.0100 96  PHE B CD1 
2632 C CD2 . PHE B 114 ? 0.1741 0.1896 0.1462 0.0389  0.0349  -0.0098 96  PHE B CD2 
2633 C CE1 . PHE B 114 ? 0.1815 0.2024 0.1599 0.0406  0.0460  -0.0079 96  PHE B CE1 
2634 C CE2 . PHE B 114 ? 0.1809 0.1898 0.1457 0.0440  0.0371  -0.0080 96  PHE B CE2 
2635 C CZ  . PHE B 114 ? 0.1803 0.1922 0.1478 0.0447  0.0421  -0.0076 96  PHE B CZ  
2636 N N   . LEU B 115 ? 0.1765 0.2310 0.2027 0.0148  0.0330  -0.0327 97  LEU B N   
2637 C CA  . LEU B 115 ? 0.1796 0.2356 0.2134 0.0081  0.0314  -0.0404 97  LEU B CA  
2638 C C   . LEU B 115 ? 0.1797 0.2397 0.2354 -0.0019 0.0397  -0.0455 97  LEU B C   
2639 O O   . LEU B 115 ? 0.1833 0.2329 0.2433 -0.0091 0.0444  -0.0479 97  LEU B O   
2640 C CB  . LEU B 115 ? 0.1861 0.2586 0.2198 0.0131  0.0202  -0.0488 97  LEU B CB  
2641 C CG  . LEU B 115 ? 0.1930 0.2583 0.2042 0.0235  0.0145  -0.0425 97  LEU B CG  
2642 C CD1 . LEU B 115 ? 0.2068 0.2890 0.2156 0.0310  0.0048  -0.0494 97  LEU B CD1 
2643 C CD2 . LEU B 115 ? 0.1993 0.2445 0.1971 0.0211  0.0172  -0.0374 97  LEU B CD2 
2644 N N   . VAL B 116 ? 0.1761 0.2500 0.2469 -0.0024 0.0431  -0.0469 98  VAL B N   
2645 C CA  . VAL B 116 ? 0.1816 0.2572 0.2742 -0.0120 0.0544  -0.0497 98  VAL B CA  
2646 C C   . VAL B 116 ? 0.1907 0.2423 0.2727 -0.0133 0.0665  -0.0381 98  VAL B C   
2647 O O   . VAL B 116 ? 0.1952 0.2353 0.2859 -0.0213 0.0759  -0.0387 98  VAL B O   
2648 C CB  . VAL B 116 ? 0.1810 0.2771 0.2911 -0.0108 0.0569  -0.0518 98  VAL B CB  
2649 C CG1 . VAL B 116 ? 0.1909 0.2850 0.3224 -0.0205 0.0725  -0.0513 98  VAL B CG1 
2650 C CG2 . VAL B 116 ? 0.1812 0.3051 0.3045 -0.0088 0.0444  -0.0649 98  VAL B CG2 
2651 N N   . GLN B 117 ? 0.1910 0.2342 0.2538 -0.0048 0.0670  -0.0277 99  GLN B N   
2652 C CA  . GLN B 117 ? 0.2076 0.2309 0.2573 -0.0033 0.0766  -0.0170 99  GLN B CA  
2653 C C   . GLN B 117 ? 0.2034 0.2112 0.2435 -0.0052 0.0756  -0.0161 99  GLN B C   
2654 O O   . GLN B 117 ? 0.2114 0.2047 0.2500 -0.0068 0.0862  -0.0103 99  GLN B O   
2655 C CB  . GLN B 117 ? 0.2207 0.2401 0.2504 0.0066  0.0747  -0.0090 99  GLN B CB  
2656 C CG  . GLN B 117 ? 0.2461 0.2507 0.2641 0.0097  0.0851  0.0007  99  GLN B CG  
2657 C CD  . GLN B 117 ? 0.2635 0.2694 0.2959 0.0066  0.0998  0.0038  99  GLN B CD  
2658 O OE1 . GLN B 117 ? 0.3047 0.3250 0.3528 0.0047  0.1017  0.0000  99  GLN B OE1 
2659 N NE2 . GLN B 117 ? 0.2855 0.2766 0.3136 0.0066  0.1111  0.0112  99  GLN B NE2 
2660 N N   . ALA B 118 ? 0.1914 0.2016 0.2244 -0.0038 0.0643  -0.0210 100 ALA B N   
2661 C CA  . ALA B 118 ? 0.1958 0.1930 0.2202 -0.0049 0.0633  -0.0205 100 ALA B CA  
2662 C C   . ALA B 118 ? 0.2044 0.1944 0.2433 -0.0133 0.0720  -0.0249 100 ALA B C   
2663 O O   . ALA B 118 ? 0.2075 0.1809 0.2388 -0.0128 0.0778  -0.0199 100 ALA B O   
2664 C CB  . ALA B 118 ? 0.1940 0.1969 0.2106 -0.0021 0.0511  -0.0259 100 ALA B CB  
2665 N N   . LYS B 119 ? 0.2087 0.2109 0.2696 -0.0209 0.0737  -0.0346 101 LYS B N   
2666 C CA  . LYS B 119 ? 0.2297 0.2242 0.3081 -0.0309 0.0829  -0.0412 101 LYS B CA  
2667 C C   . LYS B 119 ? 0.2417 0.2159 0.3180 -0.0308 0.0999  -0.0290 101 LYS B C   
2668 O O   . LYS B 119 ? 0.2554 0.2115 0.3327 -0.0340 0.1089  -0.0278 101 LYS B O   
2669 C CB  . LYS B 119 ? 0.2384 0.2534 0.3458 -0.0404 0.0823  -0.0558 101 LYS B CB  
2670 C CG  A LYS B 119 ? 0.2414 0.2765 0.3463 -0.0372 0.0647  -0.0673 101 LYS B CG  
2671 C CG  B LYS B 119 ? 0.2291 0.2688 0.3392 -0.0381 0.0654  -0.0682 101 LYS B CG  
2672 C CD  A LYS B 119 ? 0.2523 0.3134 0.3843 -0.0444 0.0596  -0.0848 101 LYS B CD  
2673 C CD  B LYS B 119 ? 0.2288 0.2945 0.3677 -0.0443 0.0649  -0.0800 101 LYS B CD  
2674 C CE  A LYS B 119 ? 0.2530 0.3340 0.3753 -0.0365 0.0416  -0.0933 101 LYS B CE  
2675 C CE  B LYS B 119 ? 0.2196 0.3121 0.3557 -0.0362 0.0482  -0.0873 101 LYS B CE  
2676 N NZ  A LYS B 119 ? 0.2443 0.3281 0.3459 -0.0235 0.0355  -0.0811 101 LYS B NZ  
2677 N NZ  B LYS B 119 ? 0.2236 0.3319 0.3661 -0.0381 0.0362  -0.1045 101 LYS B NZ  
2678 N N   . THR B 120 ? 0.2344 0.2110 0.3062 -0.0256 0.1050  -0.0195 102 THR B N   
2679 C CA  . THR B 120 ? 0.2456 0.2045 0.3096 -0.0215 0.1207  -0.0058 102 THR B CA  
2680 C C   . THR B 120 ? 0.2447 0.1902 0.2809 -0.0105 0.1174  0.0045  102 THR B C   
2681 O O   . THR B 120 ? 0.2552 0.1820 0.2847 -0.0081 0.1274  0.0117  102 THR B O   
2682 C CB  . THR B 120 ? 0.2470 0.2152 0.3146 -0.0186 0.1269  -0.0003 102 THR B CB  
2683 O OG1 . THR B 120 ? 0.2491 0.2283 0.3467 -0.0297 0.1338  -0.0093 102 THR B OG1 
2684 C CG2 . THR B 120 ? 0.2676 0.2180 0.3207 -0.0107 0.1425  0.0153  102 THR B CG2 
2685 N N   . TYR B 121 ? 0.2309 0.1862 0.2522 -0.0037 0.1042  0.0048  103 TYR B N   
2686 C CA  . TYR B 121 ? 0.2362 0.1843 0.2339 0.0064  0.0998  0.0128  103 TYR B CA  
2687 C C   . TYR B 121 ? 0.2411 0.1778 0.2342 0.0062  0.0988  0.0123  103 TYR B C   
2688 O O   . TYR B 121 ? 0.2530 0.1785 0.2325 0.0138  0.1034  0.0210  103 TYR B O   
2689 C CB  . TYR B 121 ? 0.2247 0.1856 0.2133 0.0103  0.0855  0.0094  103 TYR B CB  
2690 C CG  . TYR B 121 ? 0.2277 0.1848 0.1969 0.0188  0.0800  0.0145  103 TYR B CG  
2691 C CD1 . TYR B 121 ? 0.2471 0.2015 0.2031 0.0275  0.0847  0.0225  103 TYR B CD1 
2692 C CD2 . TYR B 121 ? 0.2260 0.1846 0.1906 0.0187  0.0704  0.0106  103 TYR B CD2 
2693 C CE1 . TYR B 121 ? 0.2474 0.2022 0.1880 0.0352  0.0786  0.0249  103 TYR B CE1 
2694 C CE2 . TYR B 121 ? 0.2273 0.1853 0.1784 0.0253  0.0657  0.0138  103 TYR B CE2 
2695 C CZ  . TYR B 121 ? 0.2395 0.1967 0.1796 0.0332  0.0691  0.0200  103 TYR B CZ  
2696 O OH  . TYR B 121 ? 0.2458 0.2062 0.1749 0.0396  0.0634  0.0209  103 TYR B OH  
2697 N N   . LEU B 122 ? 0.2343 0.1751 0.2381 -0.0012 0.0925  0.0017  104 LEU B N   
2698 C CA  . LEU B 122 ? 0.2393 0.1697 0.2390 -0.0014 0.0915  -0.0002 104 LEU B CA  
2699 C C   . LEU B 122 ? 0.2626 0.1749 0.2697 -0.0047 0.1057  0.0016  104 LEU B C   
2700 O O   . LEU B 122 ? 0.2718 0.1724 0.2724 -0.0022 0.1070  0.0026  104 LEU B O   
2701 C CB  . LEU B 122 ? 0.2319 0.1730 0.2378 -0.0066 0.0801  -0.0126 104 LEU B CB  
2702 C CG  . LEU B 122 ? 0.2210 0.1760 0.2176 -0.0020 0.0676  -0.0132 104 LEU B CG  
2703 C CD1 . LEU B 122 ? 0.2164 0.1813 0.2181 -0.0054 0.0586  -0.0243 104 LEU B CD1 
2704 C CD2 . LEU B 122 ? 0.2188 0.1689 0.1979 0.0060  0.0645  -0.0053 104 LEU B CD2 
2705 N N   . GLY B 123 ? 0.2686 0.1773 0.2908 -0.0107 0.1177  0.0019  105 GLY B N   
2706 C CA  . GLY B 123 ? 0.2939 0.1815 0.3236 -0.0137 0.1347  0.0054  105 GLY B CA  
2707 C C   . GLY B 123 ? 0.3004 0.1795 0.3406 -0.0216 0.1347  -0.0061 105 GLY B C   
2708 O O   . GLY B 123 ? 0.2828 0.1763 0.3324 -0.0284 0.1231  -0.0204 105 GLY B O   
2709 N N   . GLU B 124 ? 0.3180 0.1735 0.3545 -0.0188 0.1478  0.0001  106 GLU B N   
2710 C CA  . GLU B 124 ? 0.3361 0.1801 0.3829 -0.0264 0.1500  -0.0116 106 GLU B CA  
2711 C C   . GLU B 124 ? 0.3163 0.1710 0.3528 -0.0238 0.1330  -0.0200 106 GLU B C   
2712 O O   . GLU B 124 ? 0.3132 0.1721 0.3620 -0.0327 0.1281  -0.0363 106 GLU B O   
2713 C CB  . GLU B 124 ? 0.3731 0.1868 0.4146 -0.0213 0.1682  -0.0013 106 GLU B CB  
2714 C CG  A GLU B 124 ? 0.4090 0.2063 0.4660 -0.0269 0.1898  0.0042  106 GLU B CG  
2715 C CD  A GLU B 124 ? 0.4214 0.2218 0.5108 -0.0459 0.1940  -0.0144 106 GLU B CD  
2716 O OE1 A GLU B 124 ? 0.4496 0.2580 0.5562 -0.0532 0.2009  -0.0150 106 GLU B OE1 
2717 O OE2 A GLU B 124 ? 0.4330 0.2321 0.5302 -0.0528 0.1883  -0.0297 106 GLU B OE2 
2718 N N   . GLU B 125 ? 0.3020 0.1621 0.3171 -0.0118 0.1244  -0.0101 107 GLU B N   
2719 C CA  . GLU B 125 ? 0.2914 0.1605 0.2972 -0.0090 0.1107  -0.0165 107 GLU B CA  
2720 C C   . GLU B 125 ? 0.2673 0.1588 0.2799 -0.0150 0.0970  -0.0284 107 GLU B C   
2721 O O   . GLU B 125 ? 0.2600 0.1577 0.2695 -0.0154 0.0879  -0.0375 107 GLU B O   
2722 C CB  . GLU B 125 ? 0.2934 0.1653 0.2788 0.0037  0.1054  -0.0045 107 GLU B CB  
2723 C CG  . GLU B 125 ? 0.3168 0.1695 0.2924 0.0133  0.1170  0.0072  107 GLU B CG  
2724 C CD  . GLU B 125 ? 0.3389 0.1766 0.3157 0.0126  0.1214  0.0014  107 GLU B CD  
2725 O OE1 . GLU B 125 ? 0.3365 0.1827 0.3065 0.0153  0.1114  -0.0030 107 GLU B OE1 
2726 O OE2 . GLU B 125 ? 0.3555 0.1720 0.3398 0.0098  0.1358  0.0015  107 GLU B OE2 
2727 N N   . GLY B 126 ? 0.2522 0.1557 0.2727 -0.0180 0.0960  -0.0276 108 GLY B N   
2728 C CA  . GLY B 126 ? 0.2346 0.1601 0.2633 -0.0225 0.0843  -0.0383 108 GLY B CA  
2729 C C   . GLY B 126 ? 0.2400 0.1722 0.2858 -0.0321 0.0814  -0.0565 108 GLY B C   
2730 O O   . GLY B 126 ? 0.2326 0.1848 0.2806 -0.0325 0.0692  -0.0659 108 GLY B O   
2731 N N   . LYS B 127 ? 0.2533 0.1694 0.3107 -0.0390 0.0925  -0.0619 109 LYS B N   
2732 C CA  . LYS B 127 ? 0.2635 0.1849 0.3379 -0.0487 0.0899  -0.0818 109 LYS B CA  
2733 C C   . LYS B 127 ? 0.2603 0.1888 0.3195 -0.0430 0.0765  -0.0896 109 LYS B C   
2734 O O   . LYS B 127 ? 0.2702 0.2119 0.3391 -0.0481 0.0688  -0.1077 109 LYS B O   
2735 C CB  . LYS B 127 ? 0.2880 0.1859 0.3774 -0.0572 0.1066  -0.0857 109 LYS B CB  
2736 C CG  . LYS B 127 ? 0.2953 0.1904 0.4068 -0.0658 0.1206  -0.0830 109 LYS B CG  
2737 C CD  . LYS B 127 ? 0.3253 0.1895 0.4480 -0.0720 0.1417  -0.0816 109 LYS B CD  
2738 C CE  . LYS B 127 ? 0.3382 0.1981 0.4851 -0.0815 0.1586  -0.0789 109 LYS B CE  
2739 N NZ  . LYS B 127 ? 0.3698 0.1952 0.5239 -0.0852 0.1815  -0.0738 109 LYS B NZ  
2740 N N   . ARG B 128 ? 0.2530 0.1741 0.2896 -0.0324 0.0742  -0.0770 110 ARG B N   
2741 C CA  . ARG B 128 ? 0.2515 0.1789 0.2724 -0.0259 0.0635  -0.0818 110 ARG B CA  
2742 C C   . ARG B 128 ? 0.2381 0.1870 0.2493 -0.0196 0.0504  -0.0798 110 ARG B C   
2743 O O   . ARG B 128 ? 0.2388 0.1931 0.2354 -0.0128 0.0427  -0.0816 110 ARG B O   
2744 C CB  . ARG B 128 ? 0.2577 0.1670 0.2624 -0.0181 0.0690  -0.0709 110 ARG B CB  
2745 C CG  . ARG B 128 ? 0.2790 0.1657 0.2905 -0.0221 0.0813  -0.0749 110 ARG B CG  
2746 C CD  . ARG B 128 ? 0.2876 0.1575 0.2837 -0.0129 0.0868  -0.0654 110 ARG B CD  
2747 N NE  . ARG B 128 ? 0.2844 0.1509 0.2715 -0.0052 0.0906  -0.0469 110 ARG B NE  
2748 C CZ  . ARG B 128 ? 0.2726 0.1497 0.2459 0.0032  0.0832  -0.0376 110 ARG B CZ  
2749 N NH1 . ARG B 128 ? 0.2643 0.1545 0.2297 0.0058  0.0729  -0.0425 110 ARG B NH1 
2750 N NH2 . ARG B 128 ? 0.2702 0.1449 0.2377 0.0098  0.0870  -0.0232 110 ARG B NH2 
2751 N N   . VAL B 129 ? 0.2259 0.1860 0.2442 -0.0209 0.0491  -0.0755 111 VAL B N   
2752 C CA  . VAL B 129 ? 0.2202 0.2001 0.2323 -0.0154 0.0376  -0.0762 111 VAL B CA  
2753 C C   . VAL B 129 ? 0.2329 0.2305 0.2552 -0.0187 0.0294  -0.0947 111 VAL B C   
2754 O O   . VAL B 129 ? 0.2417 0.2454 0.2856 -0.0280 0.0321  -0.1056 111 VAL B O   
2755 C CB  . VAL B 129 ? 0.2093 0.1964 0.2254 -0.0146 0.0383  -0.0674 111 VAL B CB  
2756 C CG1 . VAL B 129 ? 0.1999 0.2068 0.2100 -0.0079 0.0269  -0.0694 111 VAL B CG1 
2757 C CG2 . VAL B 129 ? 0.2049 0.1778 0.2078 -0.0095 0.0438  -0.0512 111 VAL B CG2 
2758 N N   . ARG B 130 ? 0.2431 0.2500 0.2503 -0.0106 0.0197  -0.0987 112 ARG B N   
2759 C CA  . ARG B 130 ? 0.2648 0.2894 0.2780 -0.0114 0.0107  -0.1181 112 ARG B CA  
2760 C C   . ARG B 130 ? 0.2662 0.3170 0.2853 -0.0077 0.0012  -0.1221 112 ARG B C   
2761 O O   . ARG B 130 ? 0.2722 0.3400 0.3119 -0.0144 -0.0022 -0.1374 112 ARG B O   
2762 C CB  . ARG B 130 ? 0.2802 0.3008 0.2716 -0.0026 0.0064  -0.1203 112 ARG B CB  
2763 C CG  . ARG B 130 ? 0.3028 0.3435 0.2915 0.0014  -0.0049 -0.1389 112 ARG B CG  
2764 C CD  . ARG B 130 ? 0.3194 0.3534 0.2814 0.0128  -0.0068 -0.1358 112 ARG B CD  
2765 N NE  . ARG B 130 ? 0.3145 0.3533 0.2564 0.0257  -0.0099 -0.1200 112 ARG B NE  
2766 C CZ  . ARG B 130 ? 0.3358 0.3750 0.2538 0.0384  -0.0124 -0.1160 112 ARG B CZ  
2767 N NH1 . ARG B 130 ? 0.3490 0.3852 0.2575 0.0410  -0.0132 -0.1266 112 ARG B NH1 
2768 N NH2 . ARG B 130 ? 0.3324 0.3738 0.2354 0.0489  -0.0129 -0.1015 112 ARG B NH2 
2769 N N   . ASN B 131 ? 0.2652 0.3192 0.2682 0.0027  -0.0020 -0.1085 113 ASN B N   
2770 C CA  . ASN B 131 ? 0.2701 0.3470 0.2759 0.0091  -0.0101 -0.1094 113 ASN B CA  
2771 C C   . ASN B 131 ? 0.2609 0.3301 0.2644 0.0110  -0.0047 -0.0929 113 ASN B C   
2772 O O   . ASN B 131 ? 0.2607 0.3117 0.2491 0.0142  0.0003  -0.0793 113 ASN B O   
2773 C CB  . ASN B 131 ? 0.2841 0.3727 0.2675 0.0243  -0.0200 -0.1099 113 ASN B CB  
2774 C CG  . ASN B 131 ? 0.3069 0.4059 0.2881 0.0253  -0.0271 -0.1277 113 ASN B CG  
2775 O OD1 . ASN B 131 ? 0.3361 0.4261 0.2966 0.0325  -0.0275 -0.1258 113 ASN B OD1 
2776 N ND2 . ASN B 131 ? 0.3134 0.4329 0.3162 0.0187  -0.0329 -0.1460 113 ASN B ND2 
2777 N N   . TYR B 132 ? 0.2557 0.3394 0.2756 0.0086  -0.0053 -0.0949 114 TYR B N   
2778 C CA  . TYR B 132 ? 0.2559 0.3371 0.2719 0.0132  -0.0024 -0.0814 114 TYR B CA  
2779 C C   . TYR B 132 ? 0.2568 0.3592 0.2671 0.0254  -0.0121 -0.0833 114 TYR B C   
2780 O O   . TYR B 132 ? 0.3002 0.4264 0.3268 0.0244  -0.0181 -0.0959 114 TYR B O   
2781 C CB  . TYR B 132 ? 0.2570 0.3414 0.2958 0.0036  0.0046  -0.0824 114 TYR B CB  
2782 C CG  . TYR B 132 ? 0.2629 0.3264 0.3084 -0.0069 0.0163  -0.0789 114 TYR B CG  
2783 C CD1 . TYR B 132 ? 0.2810 0.3437 0.3434 -0.0174 0.0199  -0.0909 114 TYR B CD1 
2784 C CD2 . TYR B 132 ? 0.2690 0.3140 0.3042 -0.0056 0.0240  -0.0642 114 TYR B CD2 
2785 C CE1 . TYR B 132 ? 0.2932 0.3340 0.3603 -0.0252 0.0326  -0.0858 114 TYR B CE1 
2786 C CE2 . TYR B 132 ? 0.2709 0.2980 0.3100 -0.0123 0.0349  -0.0597 114 TYR B CE2 
2787 C CZ  . TYR B 132 ? 0.2857 0.3098 0.3405 -0.0217 0.0400  -0.0694 114 TYR B CZ  
2788 O OH  . TYR B 132 ? 0.3061 0.3094 0.3631 -0.0265 0.0527  -0.0630 114 TYR B OH  
2789 N N   . PHE B 133 ? 0.2373 0.3323 0.2258 0.0371  -0.0132 -0.0717 115 PHE B N   
2790 C CA  . PHE B 133 ? 0.2311 0.3430 0.2101 0.0516  -0.0211 -0.0714 115 PHE B CA  
2791 C C   . PHE B 133 ? 0.2225 0.3301 0.2019 0.0554  -0.0166 -0.0601 115 PHE B C   
2792 O O   . PHE B 133 ? 0.2155 0.3012 0.1842 0.0551  -0.0094 -0.0480 115 PHE B O   
2793 C CB  . PHE B 133 ? 0.2384 0.3395 0.1907 0.0631  -0.0221 -0.0639 115 PHE B CB  
2794 C CG  . PHE B 133 ? 0.2447 0.3487 0.1916 0.0621  -0.0263 -0.0744 115 PHE B CG  
2795 C CD1 . PHE B 133 ? 0.2580 0.3882 0.2095 0.0667  -0.0370 -0.0902 115 PHE B CD1 
2796 C CD2 . PHE B 133 ? 0.2471 0.3299 0.1828 0.0588  -0.0202 -0.0688 115 PHE B CD2 
2797 C CE1 . PHE B 133 ? 0.2680 0.4009 0.2123 0.0671  -0.0413 -0.1011 115 PHE B CE1 
2798 C CE2 . PHE B 133 ? 0.2575 0.3422 0.1863 0.0595  -0.0235 -0.0783 115 PHE B CE2 
2799 C CZ  . PHE B 133 ? 0.2682 0.3770 0.2005 0.0636  -0.0339 -0.0946 115 PHE B CZ  
2800 N N   . CYS B 134 ? 0.2179 0.3474 0.2100 0.0594  -0.0209 -0.0652 116 CYS B N   
2801 C CA  . CYS B 134 ? 0.2172 0.3441 0.2083 0.0656  -0.0170 -0.0553 116 CYS B CA  
2802 C C   . CYS B 134 ? 0.2318 0.3633 0.2037 0.0841  -0.0216 -0.0491 116 CYS B C   
2803 O O   . CYS B 134 ? 0.2359 0.3935 0.2116 0.0937  -0.0303 -0.0567 116 CYS B O   
2804 C CB  . CYS B 134 ? 0.2138 0.3609 0.2300 0.0603  -0.0170 -0.0626 116 CYS B CB  
2805 S SG  . CYS B 134 ? 0.2151 0.3541 0.2279 0.0675  -0.0102 -0.0500 116 CYS B SG  
2806 N N   . CYS B 135 ? 0.2369 0.3436 0.1886 0.0898  -0.0154 -0.0357 117 CYS B N   
2807 C CA  . CYS B 135 ? 0.2577 0.3621 0.1876 0.1082  -0.0166 -0.0273 117 CYS B CA  
2808 C C   . CYS B 135 ? 0.2553 0.3293 0.1721 0.1091  -0.0058 -0.0131 117 CYS B C   
2809 O O   . CYS B 135 ? 0.2448 0.3008 0.1636 0.0966  -0.0001 -0.0112 117 CYS B O   
2810 C CB  . CYS B 135 ? 0.2746 0.3827 0.1902 0.1135  -0.0216 -0.0309 117 CYS B CB  
2811 S SG  . CYS B 135 ? 0.3212 0.4357 0.2102 0.1398  -0.0247 -0.0227 117 CYS B SG  
2812 N N   . GLY B 136 ? 0.2653 0.3333 0.1692 0.1242  -0.0026 -0.0035 118 GLY B N   
2813 C CA  . GLY B 136 ? 0.2718 0.3093 0.1634 0.1250  0.0085  0.0086  118 GLY B CA  
2814 C C   . GLY B 136 ? 0.2795 0.3059 0.1549 0.1278  0.0110  0.0131  118 GLY B C   
2815 O O   . GLY B 136 ? 0.2930 0.3346 0.1579 0.1389  0.0045  0.0108  118 GLY B O   
2816 N N   . LEU B 137 ? 0.2782 0.2806 0.1512 0.1190  0.0201  0.0189  119 LEU B N   
2817 C CA  . LEU B 137 ? 0.2821 0.2748 0.1413 0.1216  0.0240  0.0236  119 LEU B CA  
2818 C C   . LEU B 137 ? 0.3090 0.2973 0.1462 0.1424  0.0280  0.0342  119 LEU B C   
2819 O O   . LEU B 137 ? 0.3161 0.3090 0.1390 0.1507  0.0266  0.0354  119 LEU B O   
2820 C CB  . LEU B 137 ? 0.2787 0.2482 0.1415 0.1093  0.0340  0.0280  119 LEU B CB  
2821 C CG  . LEU B 137 ? 0.2563 0.2276 0.1368 0.0915  0.0315  0.0199  119 LEU B CG  
2822 C CD1 . LEU B 137 ? 0.2543 0.2059 0.1374 0.0824  0.0408  0.0240  119 LEU B CD1 
2823 C CD2 . LEU B 137 ? 0.2454 0.2335 0.1309 0.0863  0.0229  0.0104  119 LEU B CD2 
2824 N N   . GLN B 138 ? 0.3222 0.3010 0.1559 0.1517  0.0338  0.0419  120 GLN B N   
2825 C CA  . GLN B 138 ? 0.3531 0.3269 0.1655 0.1743  0.0387  0.0536  120 GLN B CA  
2826 C C   . GLN B 138 ? 0.3655 0.3694 0.1671 0.1910  0.0259  0.0488  120 GLN B C   
2827 O O   . GLN B 138 ? 0.3892 0.3908 0.1679 0.2110  0.0293  0.0584  120 GLN B O   
2828 C CB  . GLN B 138 ? 0.3650 0.3238 0.1779 0.1811  0.0468  0.0613  120 GLN B CB  
2829 C CG  . GLN B 138 ? 0.3583 0.3387 0.1827 0.1845  0.0373  0.0540  120 GLN B CG  
2830 C CD  . GLN B 138 ? 0.3323 0.3149 0.1802 0.1637  0.0346  0.0437  120 GLN B CD  
2831 O OE1 . GLN B 138 ? 0.3103 0.2849 0.1666 0.1465  0.0360  0.0395  120 GLN B OE1 
2832 N NE2 . GLN B 138 ? 0.3373 0.3305 0.1944 0.1674  0.0316  0.0407  120 GLN B NE2 
2833 N N   . ASP B 139 ? 0.3478 0.3799 0.1660 0.1828  0.0119  0.0334  121 ASP B N   
2834 C CA  . ASP B 139 ? 0.3608 0.4258 0.1747 0.1947  -0.0020 0.0239  121 ASP B CA  
2835 C C   . ASP B 139 ? 0.3485 0.4264 0.1666 0.1839  -0.0100 0.0108  121 ASP B C   
2836 O O   . ASP B 139 ? 0.3539 0.4616 0.1721 0.1908  -0.0230 -0.0013 121 ASP B O   
2837 C CB  . ASP B 139 ? 0.3537 0.4448 0.1868 0.1949  -0.0115 0.0143  121 ASP B CB  
2838 C CG  . ASP B 139 ? 0.3750 0.4573 0.2016 0.2100  -0.0049 0.0262  121 ASP B CG  
2839 O OD1 . ASP B 139 ? 0.4063 0.4828 0.2092 0.2320  -0.0009 0.0379  121 ASP B OD1 
2840 O OD2 . ASP B 139 ? 0.3574 0.4362 0.2012 0.2007  -0.0023 0.0246  121 ASP B OD2 
2841 N N   . PHE B 140 ? 0.3375 0.3945 0.1593 0.1679  -0.0026 0.0124  122 PHE B N   
2842 C CA  . PHE B 140 ? 0.3214 0.3875 0.1517 0.1547  -0.0088 -0.0004 122 PHE B CA  
2843 C C   . PHE B 140 ? 0.3410 0.3969 0.1497 0.1618  -0.0044 0.0046  122 PHE B C   
2844 O O   . PHE B 140 ? 0.3444 0.3751 0.1417 0.1641  0.0084  0.0188  122 PHE B O   
2845 C CB  . PHE B 140 ? 0.2960 0.3478 0.1463 0.1326  -0.0038 -0.0026 122 PHE B CB  
2846 C CG  . PHE B 140 ? 0.2843 0.3425 0.1450 0.1189  -0.0085 -0.0151 122 PHE B CG  
2847 C CD1 . PHE B 140 ? 0.2799 0.3629 0.1551 0.1146  -0.0194 -0.0310 122 PHE B CD1 
2848 C CD2 . PHE B 140 ? 0.2829 0.3224 0.1408 0.1102  -0.0012 -0.0113 122 PHE B CD2 
2849 C CE1 . PHE B 140 ? 0.2742 0.3594 0.1596 0.1016  -0.0219 -0.0425 122 PHE B CE1 
2850 C CE2 . PHE B 140 ? 0.2768 0.3200 0.1430 0.0991  -0.0045 -0.0221 122 PHE B CE2 
2851 C CZ  . PHE B 140 ? 0.2737 0.3382 0.1531 0.0948  -0.0144 -0.0376 122 PHE B CZ  
2852 N N   . THR B 141 ? 0.3537 0.4299 0.1579 0.1653  -0.0147 -0.0079 123 THR B N   
2853 C CA  . THR B 141 ? 0.3756 0.4460 0.1592 0.1725  -0.0119 -0.0059 123 THR B CA  
2854 C C   . THR B 141 ? 0.3710 0.4444 0.1695 0.1545  -0.0160 -0.0204 123 THR B C   
2855 O O   . THR B 141 ? 0.3719 0.4681 0.1790 0.1522  -0.0279 -0.0375 123 THR B O   
2856 C CB  . THR B 141 ? 0.4003 0.4940 0.1620 0.1954  -0.0215 -0.0100 123 THR B CB  
2857 O OG1 . THR B 141 ? 0.4189 0.5083 0.1644 0.2150  -0.0164 0.0053  123 THR B OG1 
2858 C CG2 . THR B 141 ? 0.4171 0.5062 0.1566 0.2031  -0.0189 -0.0096 123 THR B CG2 
2859 N N   . PRO B 142 ? 0.3735 0.4240 0.1757 0.1423  -0.0055 -0.0140 124 PRO B N   
2860 C CA  . PRO B 142 ? 0.3675 0.4188 0.1799 0.1288  -0.0081 -0.0262 124 PRO B CA  
2861 C C   . PRO B 142 ? 0.3936 0.4555 0.1867 0.1402  -0.0132 -0.0341 124 PRO B C   
2862 O O   . PRO B 142 ? 0.4094 0.4690 0.1774 0.1579  -0.0095 -0.0244 124 PRO B O   
2863 C CB  . PRO B 142 ? 0.3607 0.3869 0.1778 0.1180  0.0045  -0.0151 124 PRO B CB  
2864 C CG  . PRO B 142 ? 0.3773 0.3893 0.1796 0.1292  0.0147  0.0020  124 PRO B CG  
2865 C CD  . PRO B 142 ? 0.3809 0.4049 0.1802 0.1402  0.0089  0.0030  124 PRO B CD  
2866 N N   . GLU B 143 ? 0.3988 0.4731 0.2029 0.1315  -0.0216 -0.0524 125 GLU B N   
2867 C CA  A GLU B 143 ? 0.4279 0.5156 0.2151 0.1420  -0.0286 -0.0642 125 GLU B CA  
2868 C CA  B GLU B 143 ? 0.4177 0.5056 0.2050 0.1421  -0.0287 -0.0643 125 GLU B CA  
2869 C C   . GLU B 143 ? 0.4323 0.5010 0.1995 0.1473  -0.0178 -0.0543 125 GLU B C   
2870 O O   . GLU B 143 ? 0.4185 0.4673 0.1956 0.1346  -0.0079 -0.0476 125 GLU B O   
2871 C CB  A GLU B 143 ? 0.4403 0.5428 0.2475 0.1289  -0.0385 -0.0880 125 GLU B CB  
2872 C CB  B GLU B 143 ? 0.4125 0.5146 0.2204 0.1284  -0.0383 -0.0877 125 GLU B CB  
2873 C CG  A GLU B 143 ? 0.4455 0.5749 0.2714 0.1268  -0.0510 -0.1022 125 GLU B CG  
2874 C CG  B GLU B 143 ? 0.4313 0.5534 0.2247 0.1393  -0.0490 -0.1054 125 GLU B CG  
2875 C CD  A GLU B 143 ? 0.4759 0.6327 0.2837 0.1477  -0.0627 -0.1087 125 GLU B CD  
2876 O OE1 A GLU B 143 ? 0.5206 0.6824 0.3043 0.1611  -0.0658 -0.1131 125 GLU B OE1 
2877 O OE2 A GLU B 143 ? 0.4890 0.6642 0.3064 0.1518  -0.0693 -0.1098 125 GLU B OE2 
2878 N N   . PRO B 144 ? 0.4549 0.5308 0.1933 0.1669  -0.0192 -0.0534 126 PRO B N   
2879 C CA  . PRO B 144 ? 0.4577 0.5159 0.1782 0.1716  -0.0075 -0.0443 126 PRO B CA  
2880 C C   . PRO B 144 ? 0.4476 0.4985 0.1816 0.1559  -0.0063 -0.0560 126 PRO B C   
2881 O O   . PRO B 144 ? 0.4298 0.4934 0.1780 0.1470  -0.0169 -0.0760 126 PRO B O   
2882 C CB  . PRO B 144 ? 0.4981 0.5712 0.1856 0.1961  -0.0124 -0.0466 126 PRO B CB  
2883 C CG  . PRO B 144 ? 0.5040 0.5930 0.1890 0.2072  -0.0202 -0.0440 126 PRO B CG  
2884 C CD  . PRO B 144 ? 0.4787 0.5788 0.1975 0.1880  -0.0302 -0.0586 126 PRO B CD  
2885 N N   . ASP B 145 ? 0.4467 0.4769 0.1780 0.1527  0.0075  -0.0434 127 ASP B N   
2886 C CA  . ASP B 145 ? 0.4456 0.4674 0.1831 0.1432  0.0108  -0.0514 127 ASP B CA  
2887 C C   . ASP B 145 ? 0.4130 0.4349 0.1800 0.1234  0.0053  -0.0641 127 ASP B C   
2888 O O   . ASP B 145 ? 0.4079 0.4323 0.1799 0.1180  0.0010  -0.0802 127 ASP B O   
2889 C CB  . ASP B 145 ? 0.4923 0.5244 0.2063 0.1568  0.0057  -0.0644 127 ASP B CB  
2890 C CG  . ASP B 145 ? 0.5133 0.5335 0.2294 0.1502  0.0120  -0.0703 127 ASP B CG  
2891 O OD1 . ASP B 145 ? 0.5085 0.5117 0.2339 0.1427  0.0243  -0.0573 127 ASP B OD1 
2892 O OD2 . ASP B 145 ? 0.5495 0.5784 0.2585 0.1531  0.0044  -0.0894 127 ASP B OD2 
2893 N N   . SER B 146 ? 0.3721 0.3902 0.1581 0.1132  0.0065  -0.0567 128 SER B N   
2894 C CA  . SER B 146 ? 0.3514 0.3705 0.1637 0.0965  0.0020  -0.0672 128 SER B CA  
2895 C C   . SER B 146 ? 0.3249 0.3266 0.1537 0.0835  0.0114  -0.0580 128 SER B C   
2896 O O   . SER B 146 ? 0.3154 0.3136 0.1611 0.0718  0.0107  -0.0667 128 SER B O   
2897 C CB  . SER B 146 ? 0.3453 0.3790 0.1681 0.0954  -0.0062 -0.0701 128 SER B CB  
2898 O OG  . SER B 146 ? 0.3737 0.4280 0.1838 0.1074  -0.0170 -0.0823 128 SER B OG  
2899 N N   . TYR B 147 ? 0.3070 0.2989 0.1324 0.0857  0.0200  -0.0411 129 TYR B N   
2900 C CA  . TYR B 147 ? 0.2811 0.2616 0.1236 0.0742  0.0266  -0.0334 129 TYR B CA  
2901 C C   . TYR B 147 ? 0.2798 0.2493 0.1186 0.0755  0.0371  -0.0235 129 TYR B C   
2902 O O   . TYR B 147 ? 0.2893 0.2566 0.1150 0.0842  0.0430  -0.0146 129 TYR B O   
2903 C CB  . TYR B 147 ? 0.2662 0.2472 0.1161 0.0719  0.0265  -0.0249 129 TYR B CB  
2904 C CG  . TYR B 147 ? 0.2611 0.2550 0.1174 0.0708  0.0168  -0.0338 129 TYR B CG  
2905 C CD1 . TYR B 147 ? 0.2501 0.2470 0.1234 0.0601  0.0128  -0.0441 129 TYR B CD1 
2906 C CD2 . TYR B 147 ? 0.2700 0.2736 0.1152 0.0817  0.0124  -0.0317 129 TYR B CD2 
2907 C CE1 . TYR B 147 ? 0.2465 0.2573 0.1288 0.0584  0.0048  -0.0530 129 TYR B CE1 
2908 C CE2 . TYR B 147 ? 0.2659 0.2847 0.1189 0.0814  0.0032  -0.0405 129 TYR B CE2 
2909 C CZ  . TYR B 147 ? 0.2527 0.2760 0.1258 0.0688  -0.0005 -0.0517 129 TYR B CZ  
2910 O OH  . TYR B 147 ? 0.2503 0.2912 0.1339 0.0681  -0.0088 -0.0611 129 TYR B OH  
2911 N N   . ASP B 148 ? 0.2660 0.2290 0.1175 0.0672  0.0404  -0.0245 130 ASP B N   
2912 C CA  . ASP B 148 ? 0.2650 0.2212 0.1189 0.0670  0.0498  -0.0155 130 ASP B CA  
2913 C C   . ASP B 148 ? 0.2536 0.2082 0.1179 0.0626  0.0535  -0.0052 130 ASP B C   
2914 O O   . ASP B 148 ? 0.2580 0.2099 0.1220 0.0647  0.0619  0.0033  130 ASP B O   
2915 C CB  . ASP B 148 ? 0.2611 0.2124 0.1248 0.0616  0.0512  -0.0207 130 ASP B CB  
2916 C CG  . ASP B 148 ? 0.2797 0.2300 0.1337 0.0655  0.0489  -0.0325 130 ASP B CG  
2917 O OD1 . ASP B 148 ? 0.2961 0.2465 0.1351 0.0745  0.0526  -0.0318 130 ASP B OD1 
2918 O OD2 . ASP B 148 ? 0.2815 0.2308 0.1430 0.0597  0.0439  -0.0432 130 ASP B OD2 
2919 N N   . VAL B 149 ? 0.2408 0.1975 0.1156 0.0561  0.0482  -0.0067 131 VAL B N   
2920 C CA  . VAL B 149 ? 0.2304 0.1859 0.1149 0.0517  0.0505  0.0005  131 VAL B CA  
2921 C C   . VAL B 149 ? 0.2280 0.1867 0.1120 0.0518  0.0447  -0.0006 131 VAL B C   
2922 O O   . VAL B 149 ? 0.2200 0.1831 0.1075 0.0490  0.0381  -0.0081 131 VAL B O   
2923 C CB  . VAL B 149 ? 0.2177 0.1728 0.1173 0.0441  0.0511  0.0003  131 VAL B CB  
2924 C CG1 . VAL B 149 ? 0.2082 0.1641 0.1177 0.0395  0.0515  0.0046  131 VAL B CG1 
2925 C CG2 . VAL B 149 ? 0.2220 0.1762 0.1228 0.0460  0.0575  0.0026  131 VAL B CG2 
2926 N N   . ILE B 150 ? 0.2306 0.1863 0.1122 0.0544  0.0485  0.0067  132 ILE B N   
2927 C CA  . ILE B 150 ? 0.2267 0.1842 0.1095 0.0548  0.0445  0.0071  132 ILE B CA  
2928 C C   . ILE B 150 ? 0.2171 0.1697 0.1124 0.0478  0.0482  0.0111  132 ILE B C   
2929 O O   . ILE B 150 ? 0.2250 0.1713 0.1218 0.0476  0.0561  0.0171  132 ILE B O   
2930 C CB  . ILE B 150 ? 0.2449 0.2017 0.1115 0.0664  0.0463  0.0121  132 ILE B CB  
2931 C CG1 . ILE B 150 ? 0.2571 0.2221 0.1107 0.0740  0.0407  0.0054  132 ILE B CG1 
2932 C CG2 . ILE B 150 ? 0.2443 0.2025 0.1124 0.0683  0.0431  0.0136  132 ILE B CG2 
2933 C CD1 . ILE B 150 ? 0.2783 0.2446 0.1114 0.0889  0.0423  0.0104  132 ILE B CD1 
2934 N N   . TRP B 151 ? 0.2012 0.1574 0.1062 0.0419  0.0431  0.0069  133 TRP B N   
2935 C CA  . TRP B 151 ? 0.1946 0.1489 0.1108 0.0355  0.0447  0.0080  133 TRP B CA  
2936 C C   . TRP B 151 ? 0.1987 0.1513 0.1145 0.0369  0.0435  0.0091  133 TRP B C   
2937 O O   . TRP B 151 ? 0.1968 0.1549 0.1113 0.0386  0.0381  0.0059  133 TRP B O   
2938 C CB  . TRP B 151 ? 0.1835 0.1424 0.1077 0.0303  0.0409  0.0035  133 TRP B CB  
2939 C CG  . TRP B 151 ? 0.1756 0.1352 0.1093 0.0258  0.0423  0.0040  133 TRP B CG  
2940 C CD1 . TRP B 151 ? 0.1729 0.1332 0.1112 0.0234  0.0404  0.0027  133 TRP B CD1 
2941 C CD2 . TRP B 151 ? 0.1750 0.1368 0.1149 0.0239  0.0453  0.0045  133 TRP B CD2 
2942 N NE1 . TRP B 151 ? 0.1724 0.1358 0.1185 0.0202  0.0413  0.0014  133 TRP B NE1 
2943 C CE2 . TRP B 151 ? 0.1702 0.1358 0.1189 0.0202  0.0440  0.0024  133 TRP B CE2 
2944 C CE3 . TRP B 151 ? 0.1774 0.1401 0.1170 0.0255  0.0487  0.0058  133 TRP B CE3 
2945 C CZ2 . TRP B 151 ? 0.1714 0.1438 0.1296 0.0180  0.0452  0.0007  133 TRP B CZ2 
2946 C CZ3 . TRP B 151 ? 0.1776 0.1464 0.1273 0.0233  0.0508  0.0054  133 TRP B CZ3 
2947 C CH2 . TRP B 151 ? 0.1744 0.1492 0.1339 0.0196  0.0484  0.0024  133 TRP B CH2 
2948 N N   . ILE B 152 ? 0.2041 0.1492 0.1226 0.0362  0.0493  0.0130  134 ILE B N   
2949 C CA  . ILE B 152 ? 0.2067 0.1468 0.1236 0.0389  0.0501  0.0148  134 ILE B CA  
2950 C C   . ILE B 152 ? 0.2023 0.1392 0.1308 0.0316  0.0520  0.0120  134 ILE B C   
2951 O O   . ILE B 152 ? 0.2108 0.1406 0.1451 0.0282  0.0591  0.0134  134 ILE B O   
2952 C CB  . ILE B 152 ? 0.2231 0.1530 0.1297 0.0471  0.0577  0.0225  134 ILE B CB  
2953 C CG1 . ILE B 152 ? 0.2318 0.1670 0.1245 0.0558  0.0557  0.0244  134 ILE B CG1 
2954 C CG2 . ILE B 152 ? 0.2326 0.1575 0.1358 0.0524  0.0583  0.0247  134 ILE B CG2 
2955 C CD1 . ILE B 152 ? 0.2502 0.1748 0.1302 0.0655  0.0651  0.0338  134 ILE B CD1 
2956 N N   . GLN B 153 ? 0.1925 0.1352 0.1252 0.0290  0.0463  0.0073  135 GLN B N   
2957 C CA  . GLN B 153 ? 0.1913 0.1344 0.1334 0.0229  0.0464  0.0027  135 GLN B CA  
2958 C C   . GLN B 153 ? 0.1915 0.1324 0.1328 0.0245  0.0449  0.0006  135 GLN B C   
2959 O O   . GLN B 153 ? 0.1895 0.1359 0.1270 0.0278  0.0408  0.0006  135 GLN B O   
2960 C CB  . GLN B 153 ? 0.1830 0.1365 0.1296 0.0195  0.0417  -0.0009 135 GLN B CB  
2961 C CG  . GLN B 153 ? 0.1814 0.1388 0.1351 0.0158  0.0400  -0.0066 135 GLN B CG  
2962 C CD  . GLN B 153 ? 0.1803 0.1479 0.1391 0.0141  0.0373  -0.0093 135 GLN B CD  
2963 O OE1 . GLN B 153 ? 0.1806 0.1506 0.1378 0.0154  0.0375  -0.0062 135 GLN B OE1 
2964 N NE2 . GLN B 153 ? 0.1815 0.1558 0.1453 0.0124  0.0344  -0.0155 135 GLN B NE2 
2965 N N   . TRP B 154 ? 0.2021 0.1351 0.1483 0.0218  0.0491  -0.0018 136 TRP B N   
2966 C CA  . TRP B 154 ? 0.2032 0.1329 0.1488 0.0233  0.0485  -0.0052 136 TRP B CA  
2967 C C   . TRP B 154 ? 0.2120 0.1390 0.1491 0.0316  0.0487  0.0000  136 TRP B C   
2968 O O   . TRP B 154 ? 0.2154 0.1475 0.1509 0.0346  0.0454  -0.0016 136 TRP B O   
2969 C CB  . TRP B 154 ? 0.1953 0.1359 0.1434 0.0208  0.0424  -0.0117 136 TRP B CB  
2970 C CG  . TRP B 154 ? 0.1933 0.1360 0.1502 0.0146  0.0423  -0.0195 136 TRP B CG  
2971 C CD1 . TRP B 154 ? 0.2050 0.1385 0.1695 0.0103  0.0475  -0.0241 136 TRP B CD1 
2972 C CD2 . TRP B 154 ? 0.1855 0.1417 0.1455 0.0127  0.0368  -0.0243 136 TRP B CD2 
2973 N NE1 . TRP B 154 ? 0.2059 0.1489 0.1804 0.0045  0.0445  -0.0334 136 TRP B NE1 
2974 C CE2 . TRP B 154 ? 0.1923 0.1503 0.1628 0.0071  0.0373  -0.0333 136 TRP B CE2 
2975 C CE3 . TRP B 154 ? 0.1784 0.1450 0.1333 0.0158  0.0321  -0.0221 136 TRP B CE3 
2976 C CZ2 . TRP B 154 ? 0.1875 0.1610 0.1629 0.0058  0.0316  -0.0403 136 TRP B CZ2 
2977 C CZ3 . TRP B 154 ? 0.1726 0.1511 0.1302 0.0156  0.0280  -0.0269 136 TRP B CZ3 
2978 C CH2 . TRP B 154 ? 0.1804 0.1641 0.1477 0.0114  0.0268  -0.0361 136 TRP B CH2 
2979 N N   . VAL B 155 ? 0.2161 0.1358 0.1475 0.0367  0.0534  0.0068  137 VAL B N   
2980 C CA  . VAL B 155 ? 0.2235 0.1416 0.1460 0.0469  0.0538  0.0119  137 VAL B CA  
2981 C C   . VAL B 155 ? 0.2397 0.1417 0.1551 0.0538  0.0632  0.0198  137 VAL B C   
2982 O O   . VAL B 155 ? 0.2504 0.1491 0.1579 0.0641  0.0646  0.0244  137 VAL B O   
2983 C CB  . VAL B 155 ? 0.2156 0.1496 0.1344 0.0505  0.0462  0.0122  137 VAL B CB  
2984 C CG1 . VAL B 155 ? 0.2193 0.1536 0.1335 0.0510  0.0473  0.0153  137 VAL B CG1 
2985 C CG2 . VAL B 155 ? 0.2231 0.1631 0.1361 0.0611  0.0437  0.0144  137 VAL B CG2 
2986 N N   . ILE B 156 ? 0.2440 0.1362 0.1622 0.0492  0.0706  0.0221  138 ILE B N   
2987 C CA  . ILE B 156 ? 0.2648 0.1400 0.1745 0.0573  0.0819  0.0319  138 ILE B CA  
2988 C C   . ILE B 156 ? 0.2792 0.1370 0.1888 0.0611  0.0898  0.0336  138 ILE B C   
2989 O O   . ILE B 156 ? 0.2976 0.1414 0.1962 0.0724  0.0985  0.0434  138 ILE B O   
2990 C CB  . ILE B 156 ? 0.2713 0.1373 0.1862 0.0513  0.0917  0.0348  138 ILE B CB  
2991 C CG1 . ILE B 156 ? 0.2730 0.1308 0.2059 0.0381  0.0975  0.0274  138 ILE B CG1 
2992 C CG2 . ILE B 156 ? 0.2564 0.1382 0.1694 0.0497  0.0848  0.0338  138 ILE B CG2 
2993 C CD1 . ILE B 156 ? 0.2881 0.1345 0.2286 0.0330  0.1107  0.0314  138 ILE B CD1 
2994 N N   . GLY B 157 ? 0.2729 0.1298 0.1932 0.0528  0.0878  0.0244  139 GLY B N   
2995 C CA  . GLY B 157 ? 0.2914 0.1310 0.2118 0.0564  0.0952  0.0243  139 GLY B CA  
2996 C C   . GLY B 157 ? 0.2961 0.1391 0.2049 0.0704  0.0917  0.0289  139 GLY B C   
2997 O O   . GLY B 157 ? 0.3155 0.1421 0.2218 0.0764  0.0993  0.0308  139 GLY B O   
2998 N N   . HIS B 158 ? 0.2834 0.1478 0.1865 0.0756  0.0810  0.0300  140 HIS B N   
2999 C CA  . HIS B 158 ? 0.2887 0.1627 0.1836 0.0890  0.0763  0.0334  140 HIS B CA  
3000 C C   . HIS B 158 ? 0.3132 0.1845 0.1932 0.1049  0.0799  0.0446  140 HIS B C   
3001 O O   . HIS B 158 ? 0.3122 0.1928 0.1854 0.1180  0.0762  0.0475  140 HIS B O   
3002 C CB  . HIS B 158 ? 0.2624 0.1623 0.1628 0.0854  0.0634  0.0263  140 HIS B CB  
3003 C CG  . HIS B 158 ? 0.2503 0.1524 0.1598 0.0780  0.0612  0.0181  140 HIS B CG  
3004 N ND1 . HIS B 158 ? 0.2592 0.1538 0.1676 0.0844  0.0650  0.0178  140 HIS B ND1 
3005 C CD2 . HIS B 158 ? 0.2317 0.1415 0.1496 0.0664  0.0567  0.0102  140 HIS B CD2 
3006 C CE1 . HIS B 158 ? 0.2504 0.1491 0.1658 0.0768  0.0624  0.0095  140 HIS B CE1 
3007 N NE2 . HIS B 158 ? 0.2351 0.1436 0.1557 0.0664  0.0571  0.0052  140 HIS B NE2 
3008 N N   . LEU B 159 ? 0.3325 0.1915 0.2075 0.1043  0.0878  0.0510  141 LEU B N   
3009 C CA  . LEU B 159 ? 0.3608 0.2131 0.2184 0.1209  0.0941  0.0634  141 LEU B CA  
3010 C C   . LEU B 159 ? 0.3850 0.2054 0.2380 0.1253  0.1124  0.0731  141 LEU B C   
3011 O O   . LEU B 159 ? 0.3860 0.1904 0.2515 0.1114  0.1210  0.0697  141 LEU B O   
3012 C CB  . LEU B 159 ? 0.3713 0.2341 0.2236 0.1196  0.0907  0.0647  141 LEU B CB  
3013 C CG  . LEU B 159 ? 0.3702 0.2621 0.2165 0.1270  0.0754  0.0604  141 LEU B CG  
3014 C CD1 . LEU B 159 ? 0.3511 0.2612 0.2127 0.1159  0.0637  0.0482  141 LEU B CD1 
3015 C CD2 . LEU B 159 ? 0.3824 0.2817 0.2223 0.1259  0.0733  0.0607  141 LEU B CD2 
3016 N N   . THR B 160 ? 0.4066 0.2185 0.2420 0.1454  0.1188  0.0853  142 THR B N   
3017 C CA  . THR B 160 ? 0.4398 0.2175 0.2672 0.1529  0.1398  0.0984  142 THR B CA  
3018 C C   . THR B 160 ? 0.4473 0.2177 0.2731 0.1475  0.1483  0.1037  142 THR B C   
3019 O O   . THR B 160 ? 0.4257 0.2188 0.2495 0.1448  0.1369  0.0998  142 THR B O   
3020 C CB  . THR B 160 ? 0.4706 0.2427 0.2748 0.1800  0.1449  0.1130  142 THR B CB  
3021 O OG1 . THR B 160 ? 0.4669 0.2607 0.2543 0.1929  0.1362  0.1177  142 THR B OG1 
3022 C CG2 . THR B 160 ? 0.4678 0.2500 0.2735 0.1880  0.1366  0.1085  142 THR B CG2 
3023 N N   . ASP B 161 ? 0.4754 0.2142 0.3036 0.1451  0.1689  0.1118  143 ASP B N   
3024 C CA  . ASP B 161 ? 0.4895 0.2201 0.3164 0.1412  0.1802  0.1186  143 ASP B CA  
3025 C C   . ASP B 161 ? 0.5041 0.2482 0.3051 0.1610  0.1763  0.1296  143 ASP B C   
3026 O O   . ASP B 161 ? 0.4903 0.2493 0.2909 0.1560  0.1711  0.1272  143 ASP B O   
3027 C CB  . ASP B 161 ? 0.5255 0.2177 0.3564 0.1403  0.2063  0.1288  143 ASP B CB  
3028 C CG  . ASP B 161 ? 0.5194 0.1983 0.3785 0.1186  0.2112  0.1153  143 ASP B CG  
3029 O OD1 . ASP B 161 ? 0.4910 0.1921 0.3674 0.1020  0.1950  0.0983  143 ASP B OD1 
3030 O OD2 . ASP B 161 ? 0.5491 0.1948 0.4126 0.1187  0.2320  0.1214  143 ASP B OD2 
3031 N N   . GLN B 162 ? 0.5358 0.2748 0.3142 0.1850  0.1793  0.1417  144 GLN B N   
3032 C CA  . GLN B 162 ? 0.5575 0.3122 0.3087 0.2067  0.1741  0.1509  144 GLN B CA  
3033 C C   . GLN B 162 ? 0.5135 0.3081 0.2671 0.2027  0.1488  0.1363  144 GLN B C   
3034 O O   . GLN B 162 ? 0.5046 0.3133 0.2483 0.2055  0.1441  0.1362  144 GLN B O   
3035 C CB  . GLN B 162 ? 0.6110 0.3579 0.3373 0.2354  0.1793  0.1653  144 GLN B CB  
3036 C CG  . GLN B 162 ? 0.6615 0.4191 0.3574 0.2593  0.1788  0.1769  144 GLN B CG  
3037 C CD  . GLN B 162 ? 0.7209 0.4776 0.3902 0.2907  0.1808  0.1902  144 GLN B CD  
3038 O OE1 . GLN B 162 ? 0.7896 0.5251 0.4602 0.2970  0.1909  0.1968  144 GLN B OE1 
3039 N NE2 . GLN B 162 ? 0.7564 0.5362 0.4004 0.3121  0.1713  0.1941  144 GLN B NE2 
3040 N N   . HIS B 163 ? 0.4815 0.2935 0.2486 0.1957  0.1338  0.1237  145 HIS B N   
3041 C CA  . HIS B 163 ? 0.4483 0.2959 0.2209 0.1899  0.1119  0.1094  145 HIS B CA  
3042 C C   . HIS B 163 ? 0.4200 0.2729 0.2081 0.1688  0.1086  0.0999  145 HIS B C   
3043 O O   . HIS B 163 ? 0.4090 0.2837 0.1934 0.1687  0.0969  0.0934  145 HIS B O   
3044 C CB  . HIS B 163 ? 0.4303 0.2955 0.2150 0.1877  0.0985  0.0989  145 HIS B CB  
3045 C CG  . HIS B 163 ? 0.4543 0.3271 0.2224 0.2122  0.0960  0.1061  145 HIS B CG  
3046 N ND1 . HIS B 163 ? 0.4513 0.3294 0.2277 0.2149  0.0916  0.1024  145 HIS B ND1 
3047 C CD2 . HIS B 163 ? 0.4819 0.3608 0.2251 0.2365  0.0965  0.1163  145 HIS B CD2 
3048 C CE1 . HIS B 163 ? 0.4771 0.3648 0.2359 0.2397  0.0895  0.1100  145 HIS B CE1 
3049 N NE2 . HIS B 163 ? 0.4981 0.3856 0.2355 0.2539  0.0927  0.1190  145 HIS B NE2 
3050 N N   . LEU B 164 ? 0.4104 0.2442 0.2159 0.1516  0.1188  0.0983  146 LEU B N   
3051 C CA  . LEU B 164 ? 0.3883 0.2272 0.2088 0.1329  0.1169  0.0901  146 LEU B CA  
3052 C C   . LEU B 164 ? 0.4041 0.2391 0.2116 0.1389  0.1252  0.0985  146 LEU B C   
3053 O O   . LEU B 164 ? 0.3888 0.2412 0.1971 0.1340  0.1160  0.0918  146 LEU B O   
3054 C CB  . LEU B 164 ? 0.3829 0.2044 0.2252 0.1150  0.1260  0.0858  146 LEU B CB  
3055 C CG  . LEU B 164 ? 0.3616 0.1912 0.2217 0.0963  0.1232  0.0765  146 LEU B CG  
3056 C CD1 . LEU B 164 ? 0.3352 0.1920 0.1998 0.0905  0.1042  0.0648  146 LEU B CD1 
3057 C CD2 . LEU B 164 ? 0.3598 0.1745 0.2413 0.0809  0.1313  0.0708  146 LEU B CD2 
3058 N N   . ALA B 165 ? 0.4347 0.2463 0.2293 0.1505  0.1433  0.1135  147 ALA B N   
3059 C CA  . ALA B 165 ? 0.4561 0.2622 0.2350 0.1591  0.1539  0.1239  147 ALA B CA  
3060 C C   . ALA B 165 ? 0.4576 0.2881 0.2137 0.1757  0.1395  0.1226  147 ALA B C   
3061 O O   . ALA B 165 ? 0.4520 0.2931 0.2041 0.1738  0.1366  0.1196  147 ALA B O   
3062 C CB  . ALA B 165 ? 0.4972 0.2720 0.2641 0.1712  0.1780  0.1422  147 ALA B CB  
3063 N N   . GLU B 166 ? 0.4650 0.3063 0.2079 0.1917  0.1299  0.1232  148 GLU B N   
3064 C CA  . GLU B 166 ? 0.4701 0.3387 0.1934 0.2080  0.1144  0.1191  148 GLU B CA  
3065 C C   . GLU B 166 ? 0.4370 0.3320 0.1762 0.1921  0.0956  0.1001  148 GLU B C   
3066 O O   . GLU B 166 ? 0.4395 0.3511 0.1671 0.1973  0.0877  0.0949  148 GLU B O   
3067 C CB  . GLU B 166 ? 0.4883 0.3656 0.1974 0.2287  0.1081  0.1228  148 GLU B CB  
3068 C CG  . GLU B 166 ? 0.5331 0.3847 0.2186 0.2506  0.1276  0.1440  148 GLU B CG  
3069 C CD  . GLU B 166 ? 0.5572 0.4122 0.2291 0.2726  0.1250  0.1505  148 GLU B CD  
3070 O OE1 . GLU B 166 ? 0.5408 0.4149 0.2262 0.2684  0.1100  0.1390  148 GLU B OE1 
3071 O OE2 . GLU B 166 ? 0.5956 0.4324 0.2427 0.2951  0.1398  0.1687  148 GLU B OE2 
3072 N N   . PHE B 167 ? 0.4072 0.3049 0.1715 0.1738  0.0892  0.0899  149 PHE B N   
3073 C CA  . PHE B 167 ? 0.3795 0.2982 0.1594 0.1587  0.0742  0.0737  149 PHE B CA  
3074 C C   . PHE B 167 ? 0.3731 0.2873 0.1570 0.1476  0.0790  0.0720  149 PHE B C   
3075 O O   . PHE B 167 ? 0.3666 0.2975 0.1491 0.1455  0.0690  0.0625  149 PHE B O   
3076 C CB  . PHE B 167 ? 0.3572 0.2775 0.1604 0.1431  0.0691  0.0654  149 PHE B CB  
3077 C CG  . PHE B 167 ? 0.3290 0.2673 0.1478 0.1281  0.0565  0.0508  149 PHE B CG  
3078 C CD1 . PHE B 167 ? 0.3239 0.2862 0.1405 0.1325  0.0425  0.0409  149 PHE B CD1 
3079 C CD2 . PHE B 167 ? 0.3127 0.2441 0.1491 0.1101  0.0591  0.0466  149 PHE B CD2 
3080 C CE1 . PHE B 167 ? 0.3043 0.2793 0.1360 0.1184  0.0336  0.0282  149 PHE B CE1 
3081 C CE2 . PHE B 167 ? 0.2911 0.2364 0.1402 0.0983  0.0493  0.0350  149 PHE B CE2 
3082 C CZ  . PHE B 167 ? 0.2873 0.2525 0.1343 0.1019  0.0375  0.0263  149 PHE B CZ  
3083 N N   . LEU B 168 ? 0.3769 0.2695 0.1681 0.1399  0.0944  0.0799  150 LEU B N   
3084 C CA  . LEU B 168 ? 0.3757 0.2652 0.1728 0.1302  0.1002  0.0790  150 LEU B CA  
3085 C C   . LEU B 168 ? 0.3985 0.2920 0.1719 0.1455  0.1027  0.0844  150 LEU B C   
3086 O O   . LEU B 168 ? 0.3929 0.2955 0.1678 0.1402  0.0988  0.0778  150 LEU B O   
3087 C CB  . LEU B 168 ? 0.3798 0.2477 0.1920 0.1192  0.1169  0.0855  150 LEU B CB  
3088 C CG  . LEU B 168 ? 0.3601 0.2280 0.1978 0.1014  0.1126  0.0762  150 LEU B CG  
3089 C CD1 . LEU B 168 ? 0.3724 0.2186 0.2242 0.0928  0.1296  0.0816  150 LEU B CD1 
3090 C CD2 . LEU B 168 ? 0.3309 0.2161 0.1828 0.0880  0.1006  0.0636  150 LEU B CD2 
3091 N N   . ARG B 169 ? 0.4300 0.3163 0.1799 0.1655  0.1098  0.0964  151 ARG B N   
3092 C CA  A ARG B 169 ? 0.4517 0.3429 0.1750 0.1829  0.1121  0.1017  151 ARG B CA  
3093 C CA  B ARG B 169 ? 0.4575 0.3486 0.1798 0.1839  0.1121  0.1021  151 ARG B CA  
3094 C C   . ARG B 169 ? 0.4417 0.3613 0.1586 0.1869  0.0912  0.0863  151 ARG B C   
3095 O O   . ARG B 169 ? 0.4378 0.3657 0.1455 0.1891  0.0887  0.0814  151 ARG B O   
3096 C CB  A ARG B 169 ? 0.4885 0.3657 0.1859 0.2061  0.1248  0.1192  151 ARG B CB  
3097 C CB  B ARG B 169 ? 0.5004 0.3800 0.1961 0.2082  0.1226  0.1187  151 ARG B CB  
3098 C CG  A ARG B 169 ? 0.5176 0.3949 0.1849 0.2256  0.1321  0.1283  151 ARG B CG  
3099 C CG  B ARG B 169 ? 0.5282 0.3754 0.2252 0.2084  0.1476  0.1364  151 ARG B CG  
3100 C CD  A ARG B 169 ? 0.5567 0.4150 0.1991 0.2487  0.1484  0.1487  151 ARG B CD  
3101 C CD  B ARG B 169 ? 0.5742 0.4076 0.2440 0.2342  0.1586  0.1539  151 ARG B CD  
3102 N NE  A ARG B 169 ? 0.5671 0.3929 0.2210 0.2402  0.1735  0.1632  151 ARG B NE  
3103 N NE  B ARG B 169 ? 0.5928 0.3937 0.2738 0.2287  0.1803  0.1666  151 ARG B NE  
3104 C CZ  A ARG B 169 ? 0.5793 0.3918 0.2282 0.2402  0.1912  0.1726  151 ARG B CZ  
3105 C CZ  B ARG B 169 ? 0.6222 0.4076 0.2933 0.2425  0.1880  0.1776  151 ARG B CZ  
3106 N NH1 A ARG B 169 ? 0.5835 0.4121 0.2144 0.2493  0.1851  0.1690  151 ARG B NH1 
3107 N NH1 B ARG B 169 ? 0.6374 0.3909 0.3215 0.2350  0.2091  0.1873  151 ARG B NH1 
3108 N NH2 A ARG B 169 ? 0.5881 0.3729 0.2520 0.2305  0.2146  0.1840  151 ARG B NH2 
3109 N NH2 B ARG B 169 ? 0.6345 0.4365 0.2833 0.2646  0.1754  0.1786  151 ARG B NH2 
3110 N N   . ARG B 170 ? 0.4257 0.3603 0.1498 0.1865  0.0768  0.0774  152 ARG B N   
3111 C CA  . ARG B 170 ? 0.4139 0.3763 0.1390 0.1863  0.0573  0.0599  152 ARG B CA  
3112 C C   . ARG B 170 ? 0.3885 0.3540 0.1334 0.1657  0.0531  0.0478  152 ARG B C   
3113 O O   . ARG B 170 ? 0.3879 0.3671 0.1272 0.1670  0.0449  0.0371  152 ARG B O   
3114 C CB  . ARG B 170 ? 0.4002 0.3792 0.1344 0.1876  0.0442  0.0521  152 ARG B CB  
3115 C CG  . ARG B 170 ? 0.4278 0.4088 0.1400 0.2117  0.0458  0.0628  152 ARG B CG  
3116 C CD  . ARG B 170 ? 0.4201 0.4264 0.1392 0.2170  0.0300  0.0525  152 ARG B CD  
3117 N NE  . ARG B 170 ? 0.3917 0.3940 0.1375 0.2000  0.0290  0.0488  152 ARG B NE  
3118 C CZ  . ARG B 170 ? 0.3971 0.3818 0.1457 0.2020  0.0386  0.0601  152 ARG B CZ  
3119 N NH1 . ARG B 170 ? 0.4310 0.3974 0.1586 0.2201  0.0518  0.0773  152 ARG B NH1 
3120 N NH2 . ARG B 170 ? 0.3741 0.3581 0.1461 0.1866  0.0362  0.0543  152 ARG B NH2 
3121 N N   . CYS B 171 ? 0.3684 0.3210 0.1354 0.1481  0.0591  0.0492  153 CYS B N   
3122 C CA  . CYS B 171 ? 0.3493 0.3038 0.1342 0.1306  0.0564  0.0397  153 CYS B CA  
3123 C C   . CYS B 171 ? 0.3602 0.3100 0.1347 0.1333  0.0638  0.0422  153 CYS B C   
3124 O O   . CYS B 171 ? 0.3539 0.3128 0.1321 0.1277  0.0569  0.0311  153 CYS B O   
3125 C CB  . CYS B 171 ? 0.3357 0.2782 0.1435 0.1141  0.0622  0.0420  153 CYS B CB  
3126 S SG  . CYS B 171 ? 0.3257 0.2762 0.1505 0.1062  0.0519  0.0346  153 CYS B SG  
3127 N N   . LYS B 172 ? 0.3792 0.3141 0.1411 0.1423  0.0788  0.0567  154 LYS B N   
3128 C CA  . LYS B 172 ? 0.3984 0.3278 0.1504 0.1458  0.0888  0.0612  154 LYS B CA  
3129 C C   . LYS B 172 ? 0.4130 0.3582 0.1447 0.1580  0.0786  0.0521  154 LYS B C   
3130 O O   . LYS B 172 ? 0.4072 0.3551 0.1398 0.1538  0.0785  0.0458  154 LYS B O   
3131 C CB  . LYS B 172 ? 0.4261 0.3367 0.1660 0.1560  0.1081  0.0795  154 LYS B CB  
3132 C CG  . LYS B 172 ? 0.4400 0.3441 0.1705 0.1602  0.1217  0.0862  154 LYS B CG  
3133 C CD  . LYS B 172 ? 0.4762 0.3607 0.1922 0.1727  0.1427  0.1057  154 LYS B CD  
3134 N N   . GLY B 173 ? 0.4314 0.3877 0.1452 0.1736  0.0700  0.0506  155 GLY B N   
3135 C CA  . GLY B 173 ? 0.4524 0.4276 0.1470 0.1862  0.0578  0.0390  155 GLY B CA  
3136 C C   . GLY B 173 ? 0.4355 0.4265 0.1472 0.1725  0.0423  0.0180  155 GLY B C   
3137 O O   . GLY B 173 ? 0.4494 0.4538 0.1488 0.1794  0.0339  0.0058  155 GLY B O   
3138 N N   . SER B 174 ? 0.4037 0.3928 0.1428 0.1542  0.0390  0.0135  156 SER B N   
3139 C CA  . SER B 174 ? 0.3881 0.3889 0.1452 0.1406  0.0269  -0.0045 156 SER B CA  
3140 C C   . SER B 174 ? 0.3675 0.3573 0.1378 0.1268  0.0330  -0.0064 156 SER B C   
3141 O O   . SER B 174 ? 0.3642 0.3590 0.1484 0.1161  0.0262  -0.0194 156 SER B O   
3142 C CB  . SER B 174 ? 0.3759 0.3837 0.1528 0.1315  0.0191  -0.0091 156 SER B CB  
3143 O OG  . SER B 174 ? 0.3627 0.3570 0.1571 0.1186  0.0262  -0.0019 156 SER B OG  
3144 N N   . LEU B 175 ? 0.3666 0.3415 0.1337 0.1273  0.0469  0.0068  157 LEU B N   
3145 C CA  . LEU B 175 ? 0.3521 0.3195 0.1314 0.1165  0.0528  0.0055  157 LEU B CA  
3146 C C   . LEU B 175 ? 0.3664 0.3383 0.1319 0.1229  0.0508  -0.0039 157 LEU B C   
3147 O O   . LEU B 175 ? 0.3894 0.3640 0.1303 0.1386  0.0529  -0.0018 157 LEU B O   
3148 C CB  . LEU B 175 ? 0.3502 0.3038 0.1334 0.1149  0.0682  0.0208  157 LEU B CB  
3149 C CG  . LEU B 175 ? 0.3370 0.2845 0.1374 0.1058  0.0710  0.0276  157 LEU B CG  
3150 C CD1 . LEU B 175 ? 0.3482 0.2828 0.1516 0.1054  0.0874  0.0412  157 LEU B CD1 
3151 C CD2 . LEU B 175 ? 0.3111 0.2619 0.1344 0.0903  0.0638  0.0188  157 LEU B CD2 
3152 N N   . ARG B 176 ? 0.3592 0.3304 0.1392 0.1118  0.0479  -0.0137 158 ARG B N   
3153 C CA  . ARG B 176 ? 0.3787 0.3487 0.1498 0.1154  0.0500  -0.0211 158 ARG B CA  
3154 C C   . ARG B 176 ? 0.3805 0.3406 0.1470 0.1193  0.0652  -0.0074 158 ARG B C   
3155 O O   . ARG B 176 ? 0.3654 0.3192 0.1423 0.1150  0.0739  0.0056  158 ARG B O   
3156 C CB  . ARG B 176 ? 0.3834 0.3520 0.1733 0.1023  0.0449  -0.0338 158 ARG B CB  
3157 C CG  . ARG B 176 ? 0.4045 0.3833 0.2007 0.0978  0.0316  -0.0499 158 ARG B CG  
3158 C CD  . ARG B 176 ? 0.4219 0.3957 0.2380 0.0844  0.0295  -0.0613 158 ARG B CD  
3159 N NE  . ARG B 176 ? 0.4586 0.4276 0.2693 0.0859  0.0308  -0.0731 158 ARG B NE  
3160 C CZ  . ARG B 176 ? 0.5054 0.4826 0.3041 0.0919  0.0238  -0.0892 158 ARG B CZ  
3161 N N   . PRO B 177 ? 0.3949 0.3540 0.1479 0.1268  0.0692  -0.0116 159 PRO B N   
3162 C CA  . PRO B 177 ? 0.3981 0.3496 0.1498 0.1300  0.0848  0.0014  159 PRO B CA  
3163 C C   . PRO B 177 ? 0.3679 0.3151 0.1473 0.1157  0.0895  0.0060  159 PRO B C   
3164 O O   . PRO B 177 ? 0.3567 0.3045 0.1507 0.1062  0.0823  -0.0032 159 PRO B O   
3165 C CB  . PRO B 177 ? 0.4197 0.3717 0.1550 0.1389  0.0865  -0.0069 159 PRO B CB  
3166 C CG  . PRO B 177 ? 0.4362 0.3977 0.1531 0.1471  0.0728  -0.0211 159 PRO B CG  
3167 C CD  . PRO B 177 ? 0.4161 0.3817 0.1533 0.1341  0.0611  -0.0277 159 PRO B CD  
3168 N N   . ASN B 178 ? 0.3630 0.3063 0.1497 0.1147  0.1018  0.0198  160 ASN B N   
3169 C CA  . ASN B 178 ? 0.3448 0.2877 0.1584 0.1023  0.1064  0.0242  160 ASN B CA  
3170 C C   . ASN B 178 ? 0.3169 0.2611 0.1468 0.0912  0.0972  0.0220  160 ASN B C   
3171 O O   . ASN B 178 ? 0.2985 0.2443 0.1492 0.0819  0.0991  0.0239  160 ASN B O   
3172 C CB  . ASN B 178 ? 0.3479 0.2929 0.1716 0.0992  0.1072  0.0185  160 ASN B CB  
3173 C CG  . ASN B 178 ? 0.3708 0.3146 0.1791 0.1104  0.1171  0.0202  160 ASN B CG  
3174 O OD1 . ASN B 178 ? 0.3926 0.3345 0.1902 0.1180  0.1278  0.0297  160 ASN B OD1 
3175 N ND2 . ASN B 178 ? 0.3835 0.3272 0.1906 0.1121  0.1149  0.0115  160 ASN B ND2 
3176 N N   . GLY B 179 ? 0.3096 0.2547 0.1297 0.0936  0.0881  0.0182  161 GLY B N   
3177 C CA  . GLY B 179 ? 0.2896 0.2362 0.1235 0.0845  0.0801  0.0161  161 GLY B CA  
3178 C C   . GLY B 179 ? 0.2840 0.2263 0.1280 0.0806  0.0878  0.0266  161 GLY B C   
3179 O O   . GLY B 179 ? 0.3016 0.2386 0.1384 0.0867  0.0998  0.0362  161 GLY B O   
3180 N N   . ILE B 180 ? 0.2642 0.2078 0.1245 0.0708  0.0824  0.0245  162 ILE B N   
3181 C CA  . ILE B 180 ? 0.2594 0.1986 0.1311 0.0657  0.0883  0.0315  162 ILE B CA  
3182 C C   . ILE B 180 ? 0.2543 0.1936 0.1282 0.0628  0.0799  0.0290  162 ILE B C   
3183 O O   . ILE B 180 ? 0.2479 0.1930 0.1229 0.0604  0.0692  0.0209  162 ILE B O   
3184 C CB  . ILE B 180 ? 0.2461 0.1887 0.1403 0.0557  0.0925  0.0313  162 ILE B CB  
3185 C CG1 . ILE B 180 ? 0.2281 0.1778 0.1332 0.0490  0.0817  0.0231  162 ILE B CG1 
3186 C CG2 . ILE B 180 ? 0.2550 0.1989 0.1497 0.0589  0.1026  0.0347  162 ILE B CG2 
3187 C CD1 . ILE B 180 ? 0.2156 0.1722 0.1419 0.0411  0.0835  0.0220  162 ILE B CD1 
3188 N N   . ILE B 181 ? 0.2593 0.1912 0.1362 0.0622  0.0865  0.0358  163 ILE B N   
3189 C CA  . ILE B 181 ? 0.2561 0.1868 0.1388 0.0584  0.0810  0.0342  163 ILE B CA  
3190 C C   . ILE B 181 ? 0.2427 0.1730 0.1471 0.0468  0.0840  0.0327  163 ILE B C   
3191 O O   . ILE B 181 ? 0.2499 0.1762 0.1632 0.0437  0.0947  0.0368  163 ILE B O   
3192 C CB  . ILE B 181 ? 0.2780 0.1989 0.1475 0.0677  0.0872  0.0427  163 ILE B CB  
3193 C CG1 . ILE B 181 ? 0.2947 0.2208 0.1414 0.0814  0.0816  0.0424  163 ILE B CG1 
3194 C CG2 . ILE B 181 ? 0.2743 0.1921 0.1514 0.0638  0.0839  0.0416  163 ILE B CG2 
3195 C CD1 . ILE B 181 ? 0.3235 0.2403 0.1513 0.0954  0.0909  0.0536  163 ILE B CD1 
3196 N N   . VAL B 182 ? 0.2308 0.1664 0.1442 0.0406  0.0751  0.0263  164 VAL B N   
3197 C CA  . VAL B 182 ? 0.2234 0.1603 0.1551 0.0311  0.0763  0.0233  164 VAL B CA  
3198 C C   . VAL B 182 ? 0.2226 0.1539 0.1542 0.0304  0.0741  0.0228  164 VAL B C   
3199 O O   . VAL B 182 ? 0.2196 0.1540 0.1440 0.0334  0.0658  0.0203  164 VAL B O   
3200 C CB  . VAL B 182 ? 0.2080 0.1567 0.1493 0.0261  0.0683  0.0164  164 VAL B CB  
3201 C CG1 . VAL B 182 ? 0.2038 0.1570 0.1618 0.0183  0.0678  0.0118  164 VAL B CG1 
3202 C CG2 . VAL B 182 ? 0.2097 0.1633 0.1517 0.0279  0.0715  0.0172  164 VAL B CG2 
3203 N N   . ILE B 183 ? 0.2288 0.1519 0.1700 0.0261  0.0822  0.0242  165 ILE B N   
3204 C CA  . ILE B 183 ? 0.2274 0.1447 0.1721 0.0238  0.0809  0.0217  165 ILE B CA  
3205 C C   . ILE B 183 ? 0.2190 0.1443 0.1816 0.0138  0.0775  0.0127  165 ILE B C   
3206 O O   . ILE B 183 ? 0.2199 0.1481 0.1965 0.0077  0.0829  0.0104  165 ILE B O   
3207 C CB  . ILE B 183 ? 0.2513 0.1510 0.1937 0.0266  0.0936  0.0288  165 ILE B CB  
3208 C CG1 . ILE B 183 ? 0.2671 0.1605 0.1876 0.0402  0.0961  0.0385  165 ILE B CG1 
3209 C CG2 . ILE B 183 ? 0.2561 0.1483 0.2051 0.0230  0.0937  0.0246  165 ILE B CG2 
3210 C CD1 . ILE B 183 ? 0.2943 0.1685 0.2090 0.0460  0.1112  0.0487  165 ILE B CD1 
3211 N N   . LYS B 184 ? 0.2085 0.1388 0.1710 0.0129  0.0688  0.0071  166 LYS B N   
3212 C CA  . LYS B 184 ? 0.2067 0.1454 0.1837 0.0053  0.0651  -0.0022 166 LYS B CA  
3213 C C   . LYS B 184 ? 0.2127 0.1443 0.1875 0.0056  0.0635  -0.0055 166 LYS B C   
3214 O O   . LYS B 184 ? 0.2085 0.1402 0.1721 0.0112  0.0584  -0.0034 166 LYS B O   
3215 C CB  . LYS B 184 ? 0.1946 0.1490 0.1717 0.0059  0.0559  -0.0057 166 LYS B CB  
3216 C CG  . LYS B 184 ? 0.1919 0.1580 0.1810 0.0010  0.0509  -0.0155 166 LYS B CG  
3217 C CD  . LYS B 184 ? 0.1833 0.1651 0.1728 0.0035  0.0443  -0.0170 166 LYS B CD  
3218 C CE  . LYS B 184 ? 0.1793 0.1758 0.1802 0.0006  0.0389  -0.0274 166 LYS B CE  
3219 N NZ  . LYS B 184 ? 0.1762 0.1874 0.1752 0.0059  0.0332  -0.0270 166 LYS B NZ  
3220 N N   . ASP B 185 ? 0.2199 0.1451 0.2065 -0.0004 0.0689  -0.0111 167 ASP B N   
3221 C CA  . ASP B 185 ? 0.2305 0.1455 0.2137 0.0008  0.0693  -0.0137 167 ASP B CA  
3222 C C   . ASP B 185 ? 0.2382 0.1493 0.2374 -0.0077 0.0733  -0.0245 167 ASP B C   
3223 O O   . ASP B 185 ? 0.2401 0.1575 0.2558 -0.0157 0.0762  -0.0303 167 ASP B O   
3224 C CB  . ASP B 185 ? 0.2470 0.1448 0.2178 0.0087  0.0771  -0.0028 167 ASP B CB  
3225 C CG  . ASP B 185 ? 0.2526 0.1489 0.2116 0.0161  0.0719  -0.0017 167 ASP B CG  
3226 O OD1 . ASP B 185 ? 0.2631 0.1572 0.2266 0.0135  0.0706  -0.0092 167 ASP B OD1 
3227 O OD2 . ASP B 185 ? 0.2557 0.1542 0.2024 0.0245  0.0694  0.0055  167 ASP B OD2 
3228 N N   . ASN B 186 ? 0.2425 0.1450 0.2381 -0.0062 0.0730  -0.0285 168 ASN B N   
3229 C CA  . ASN B 186 ? 0.2585 0.1534 0.2678 -0.0138 0.0774  -0.0402 168 ASN B CA  
3230 C C   . ASN B 186 ? 0.2807 0.1547 0.2994 -0.0181 0.0933  -0.0359 168 ASN B C   
3231 O O   . ASN B 186 ? 0.2869 0.1466 0.2933 -0.0103 0.1008  -0.0222 168 ASN B O   
3232 C CB  . ASN B 186 ? 0.2626 0.1494 0.2630 -0.0092 0.0753  -0.0438 168 ASN B CB  
3233 C CG  . ASN B 186 ? 0.2476 0.1528 0.2389 -0.0047 0.0623  -0.0476 168 ASN B CG  
3234 O OD1 . ASN B 186 ? 0.2348 0.1591 0.2301 -0.0072 0.0542  -0.0530 168 ASN B OD1 
3235 N ND2 . ASN B 186 ? 0.2477 0.1472 0.2262 0.0030  0.0612  -0.0440 168 ASN B ND2 
3236 N N   . MET B 187 ? 0.2998 0.1738 0.3404 -0.0299 0.0983  -0.0481 169 MET B N   
3237 C CA  . MET B 187 ? 0.3317 0.1841 0.3857 -0.0362 0.1160  -0.0457 169 MET B CA  
3238 C C   . MET B 187 ? 0.3547 0.1944 0.4236 -0.0448 0.1214  -0.0606 169 MET B C   
3239 O O   . MET B 187 ? 0.3613 0.2186 0.4412 -0.0514 0.1107  -0.0783 169 MET B O   
3240 C CB  . MET B 187 ? 0.3345 0.1996 0.4071 -0.0447 0.1200  -0.0470 169 MET B CB  
3241 C CG  . MET B 187 ? 0.3223 0.1978 0.3803 -0.0361 0.1163  -0.0330 169 MET B CG  
3242 S SD  . MET B 187 ? 0.3513 0.2003 0.3877 -0.0238 0.1306  -0.0110 169 MET B SD  
3243 C CE  . MET B 187 ? 0.3388 0.2033 0.3492 -0.0106 0.1150  -0.0027 169 MET B CE  
3244 N N   . ALA B 188 ? 0.3761 0.1849 0.4442 -0.0436 0.1379  -0.0541 170 ALA B N   
3245 C CA  . ALA B 188 ? 0.3965 0.1885 0.4799 -0.0523 0.1458  -0.0685 170 ALA B CA  
3246 C C   . ALA B 188 ? 0.4110 0.2016 0.5264 -0.0690 0.1573  -0.0792 170 ALA B C   
3247 O O   . ALA B 188 ? 0.4125 0.2023 0.5332 -0.0704 0.1666  -0.0682 170 ALA B O   
3248 C CB  . ALA B 188 ? 0.4194 0.1769 0.4880 -0.0425 0.1602  -0.0556 170 ALA B CB  
3249 N N   . GLN B 189 ? 0.4252 0.2156 0.5627 -0.0818 0.1577  -0.1014 171 GLN B N   
3250 C CA  . GLN B 189 ? 0.4441 0.2316 0.6179 -0.1000 0.1710  -0.1145 171 GLN B CA  
3251 C C   . GLN B 189 ? 0.4744 0.2226 0.6501 -0.0998 0.1978  -0.0980 171 GLN B C   
3252 O O   . GLN B 189 ? 0.4813 0.2273 0.6755 -0.1078 0.2116  -0.0932 171 GLN B O   
3253 C CB  . GLN B 189 ? 0.4585 0.2508 0.6546 -0.1131 0.1664  -0.1435 171 GLN B CB  
3254 N N   . GLU B 190 ? 0.4963 0.2133 0.6514 -0.0889 0.2064  -0.0874 172 GLU B N   
3255 C CA  . GLU B 190 ? 0.5381 0.2150 0.6922 -0.0859 0.2332  -0.0705 172 GLU B CA  
3256 C C   . GLU B 190 ? 0.5431 0.1952 0.6622 -0.0650 0.2369  -0.0509 172 GLU B C   
3257 O O   . GLU B 190 ? 0.5401 0.1922 0.6472 -0.0591 0.2263  -0.0582 172 GLU B O   
3258 C CB  . GLU B 190 ? 0.5805 0.2357 0.7683 -0.1042 0.2506  -0.0886 172 GLU B CB  
3259 C CG  . GLU B 190 ? 0.6366 0.2459 0.8258 -0.1022 0.2821  -0.0714 172 GLU B CG  
3260 C CD  . GLU B 190 ? 0.6843 0.2663 0.9059 -0.1199 0.3008  -0.0900 172 GLU B CD  
3261 O OE1 . GLU B 190 ? 0.7235 0.2809 0.9652 -0.1286 0.3269  -0.0835 172 GLU B OE1 
3262 O OE2 . GLU B 190 ? 0.7123 0.2939 0.9391 -0.1248 0.2918  -0.1110 172 GLU B OE2 
3263 N N   . GLY B 191 ? 0.5458 0.1794 0.6481 -0.0526 0.2516  -0.0261 173 GLY B N   
3264 C CA  . GLY B 191 ? 0.5522 0.1639 0.6220 -0.0308 0.2564  -0.0061 173 GLY B CA  
3265 C C   . GLY B 191 ? 0.5127 0.1525 0.5555 -0.0160 0.2323  -0.0010 173 GLY B C   
3266 O O   . GLY B 191 ? 0.4773 0.1499 0.5202 -0.0188 0.2157  -0.0039 173 GLY B O   
3267 N N   . VAL B 192 ? 0.5161 0.1420 0.5370 -0.0001 0.2318  0.0068  174 VAL B N   
3268 C CA  . VAL B 192 ? 0.4886 0.1371 0.4848 0.0152  0.2127  0.0133  174 VAL B CA  
3269 C C   . VAL B 192 ? 0.4913 0.1365 0.4849 0.0175  0.2057  0.0017  174 VAL B C   
3270 O O   . VAL B 192 ? 0.5186 0.1324 0.5109 0.0222  0.2209  0.0039  174 VAL B O   
3271 C CB  . VAL B 192 ? 0.5025 0.1392 0.4718 0.0370  0.2207  0.0381  174 VAL B CB  
3272 C CG1 . VAL B 192 ? 0.4791 0.1408 0.4267 0.0519  0.2008  0.0421  174 VAL B CG1 
3273 C CG2 . VAL B 192 ? 0.5028 0.1409 0.4729 0.0357  0.2293  0.0494  174 VAL B CG2 
3274 N N   . ILE B 193 ? 0.4608 0.1369 0.4534 0.0148  0.1842  -0.0100 175 ILE B N   
3275 C CA  . ILE B 193 ? 0.4651 0.1425 0.4579 0.0144  0.1766  -0.0245 175 ILE B CA  
3276 C C   . ILE B 193 ? 0.4407 0.1386 0.4122 0.0297  0.1616  -0.0166 175 ILE B C   
3277 O O   . ILE B 193 ? 0.4129 0.1389 0.3806 0.0294  0.1475  -0.0149 175 ILE B O   
3278 C CB  . ILE B 193 ? 0.4542 0.1533 0.4664 -0.0029 0.1644  -0.0477 175 ILE B CB  
3279 C CG1 . ILE B 193 ? 0.4828 0.1676 0.5222 -0.0208 0.1779  -0.0594 175 ILE B CG1 
3280 C CG2 . ILE B 193 ? 0.4548 0.1569 0.4630 -0.0009 0.1560  -0.0621 175 ILE B CG2 
3281 C CD1 . ILE B 193 ? 0.4645 0.1815 0.5220 -0.0356 0.1631  -0.0778 175 ILE B CD1 
3282 N N   . LEU B 194 ? 0.4607 0.1438 0.4200 0.0427  0.1658  -0.0125 176 LEU B N   
3283 C CA  . LEU B 194 ? 0.4417 0.1442 0.3843 0.0570  0.1531  -0.0069 176 LEU B CA  
3284 C C   . LEU B 194 ? 0.4239 0.1453 0.3712 0.0503  0.1396  -0.0245 176 LEU B C   
3285 O O   . LEU B 194 ? 0.4334 0.1412 0.3886 0.0441  0.1440  -0.0386 176 LEU B O   
3286 C CB  . LEU B 194 ? 0.4694 0.1499 0.3978 0.0753  0.1639  0.0050  176 LEU B CB  
3287 C CG  . LEU B 194 ? 0.4610 0.1600 0.3746 0.0919  0.1534  0.0109  176 LEU B CG  
3288 C CD1 . LEU B 194 ? 0.4417 0.1663 0.3461 0.0993  0.1433  0.0228  176 LEU B CD1 
3289 C CD2 . LEU B 194 ? 0.4942 0.1686 0.3971 0.1092  0.1657  0.0191  176 LEU B CD2 
3290 N N   . ASP B 195 ? 0.3941 0.1459 0.3360 0.0522  0.1243  -0.0232 177 ASP B N   
3291 C CA  . ASP B 195 ? 0.3834 0.1545 0.3229 0.0526  0.1124  -0.0336 177 ASP B CA  
3292 C C   . ASP B 195 ? 0.3875 0.1630 0.3136 0.0694  0.1110  -0.0241 177 ASP B C   
3293 O O   . ASP B 195 ? 0.3653 0.1583 0.2852 0.0765  0.1046  -0.0139 177 ASP B O   
3294 C CB  . ASP B 195 ? 0.3558 0.1562 0.2985 0.0449  0.0986  -0.0375 177 ASP B CB  
3295 C CG  . ASP B 195 ? 0.3473 0.1650 0.2881 0.0439  0.0886  -0.0493 177 ASP B CG  
3296 O OD1 . ASP B 195 ? 0.3594 0.1696 0.2947 0.0509  0.0914  -0.0525 177 ASP B OD1 
3297 O OD2 . ASP B 195 ? 0.3293 0.1685 0.2726 0.0376  0.0786  -0.0540 177 ASP B OD2 
3298 N N   . ASP B 196 ? 0.4181 0.1786 0.3412 0.0756  0.1169  -0.0291 178 ASP B N   
3299 C CA  . ASP B 196 ? 0.4372 0.2022 0.3497 0.0923  0.1168  -0.0208 178 ASP B CA  
3300 C C   . ASP B 196 ? 0.4248 0.2202 0.3356 0.0934  0.1040  -0.0253 178 ASP B C   
3301 O O   . ASP B 196 ? 0.4454 0.2518 0.3507 0.1060  0.1024  -0.0189 178 ASP B O   
3302 C CB  . ASP B 196 ? 0.4794 0.2156 0.3892 0.0995  0.1293  -0.0245 178 ASP B CB  
3303 C CG  . ASP B 196 ? 0.4863 0.2234 0.3994 0.0926  0.1262  -0.0431 178 ASP B CG  
3304 N N   . VAL B 197 ? 0.4056 0.2144 0.3215 0.0812  0.0962  -0.0359 179 VAL B N   
3305 C CA  . VAL B 197 ? 0.3927 0.2266 0.3062 0.0823  0.0868  -0.0388 179 VAL B CA  
3306 C C   . VAL B 197 ? 0.3513 0.2076 0.2653 0.0841  0.0798  -0.0277 179 VAL B C   
3307 O O   . VAL B 197 ? 0.3390 0.2109 0.2512 0.0922  0.0772  -0.0233 179 VAL B O   
3308 C CB  . VAL B 197 ? 0.4087 0.2505 0.3253 0.0709  0.0808  -0.0526 179 VAL B CB  
3309 C CG1 . VAL B 197 ? 0.4084 0.2746 0.3202 0.0742  0.0734  -0.0526 179 VAL B CG1 
3310 C CG2 . VAL B 197 ? 0.4398 0.2620 0.3573 0.0682  0.0865  -0.0669 179 VAL B CG2 
3311 N N   . ASP B 198 ? 0.3251 0.1829 0.2428 0.0767  0.0776  -0.0241 180 ASP B N   
3312 C CA  . ASP B 198 ? 0.3009 0.1775 0.2191 0.0780  0.0714  -0.0152 180 ASP B CA  
3313 C C   . ASP B 198 ? 0.3001 0.1698 0.2149 0.0854  0.0751  -0.0040 180 ASP B C   
3314 O O   . ASP B 198 ? 0.2858 0.1716 0.2003 0.0880  0.0696  0.0018  180 ASP B O   
3315 C CB  . ASP B 198 ? 0.2845 0.1740 0.2072 0.0665  0.0645  -0.0187 180 ASP B CB  
3316 C CG  . ASP B 198 ? 0.2908 0.1672 0.2178 0.0575  0.0675  -0.0211 180 ASP B CG  
3317 O OD1 . ASP B 198 ? 0.3014 0.1571 0.2282 0.0595  0.0761  -0.0194 180 ASP B OD1 
3318 O OD2 . ASP B 198 ? 0.2855 0.1721 0.2167 0.0489  0.0622  -0.0244 180 ASP B OD2 
3319 N N   . SER B 199 ? 0.3174 0.1627 0.2291 0.0900  0.0851  -0.0014 181 SER B N   
3320 C CA  . SER B 199 ? 0.3253 0.1615 0.2297 0.1013  0.0907  0.0110  181 SER B CA  
3321 C C   . SER B 199 ? 0.3155 0.1532 0.2210 0.0941  0.0896  0.0148  181 SER B C   
3322 O O   . SER B 199 ? 0.3035 0.1565 0.2045 0.0997  0.0841  0.0218  181 SER B O   
3323 C CB  . SER B 199 ? 0.3209 0.1762 0.2202 0.1162  0.0856  0.0179  181 SER B CB  
3324 O OG  . SER B 199 ? 0.3445 0.1850 0.2337 0.1313  0.0936  0.0294  181 SER B OG  
3325 N N   . SER B 200 ? 0.3177 0.1418 0.2304 0.0814  0.0942  0.0086  182 SER B N   
3326 C CA  . SER B 200 ? 0.3122 0.1363 0.2286 0.0728  0.0949  0.0108  182 SER B CA  
3327 C C   . SER B 200 ? 0.3342 0.1318 0.2573 0.0656  0.1080  0.0086  182 SER B C   
3328 O O   . SER B 200 ? 0.3451 0.1263 0.2721 0.0640  0.1144  0.0019  182 SER B O   
3329 C CB  . SER B 200 ? 0.2884 0.1333 0.2129 0.0602  0.0841  0.0020  182 SER B CB  
3330 O OG  . SER B 200 ? 0.2922 0.1337 0.2255 0.0503  0.0840  -0.0106 182 SER B OG  
3331 N N   . VAL B 201 ? 0.3372 0.1300 0.2625 0.0615  0.1131  0.0142  183 VAL B N   
3332 C CA  . VAL B 201 ? 0.3590 0.1298 0.2956 0.0516  0.1261  0.0110  183 VAL B CA  
3333 C C   . VAL B 201 ? 0.3422 0.1275 0.2927 0.0364  0.1210  0.0029  183 VAL B C   
3334 O O   . VAL B 201 ? 0.3202 0.1267 0.2669 0.0369  0.1106  0.0051  183 VAL B O   
3335 C CB  . VAL B 201 ? 0.3877 0.1340 0.3160 0.0612  0.1426  0.0266  183 VAL B CB  
3336 C CG1 . VAL B 201 ? 0.4106 0.1426 0.3246 0.0785  0.1483  0.0355  183 VAL B CG1 
3337 C CG2 . VAL B 201 ? 0.3797 0.1396 0.2986 0.0667  0.1392  0.0377  183 VAL B CG2 
3338 N N   A CYS B 202 ? 0.3544 0.1267 0.3216 0.0238  0.1295  -0.0065 184 CYS B N   
3339 N N   B CYS B 202 ? 0.3548 0.1304 0.3227 0.0229  0.1276  -0.0078 184 CYS B N   
3340 C CA  A CYS B 202 ? 0.3465 0.1295 0.3302 0.0099  0.1284  -0.0138 184 CYS B CA  
3341 C CA  B CYS B 202 ? 0.3503 0.1356 0.3312 0.0117  0.1278  -0.0103 184 CYS B CA  
3342 C C   A CYS B 202 ? 0.3726 0.1314 0.3652 0.0060  0.1475  -0.0074 184 CYS B C   
3343 C C   B CYS B 202 ? 0.3747 0.1350 0.3675 0.0058  0.1468  -0.0077 184 CYS B C   
3344 O O   A CYS B 202 ? 0.3993 0.1312 0.3942 0.0071  0.1613  -0.0069 184 CYS B O   
3345 O O   B CYS B 202 ? 0.3993 0.1349 0.3973 0.0045  0.1589  -0.0108 184 CYS B O   
3346 C CB  A CYS B 202 ? 0.3419 0.1350 0.3410 -0.0021 0.1211  -0.0339 184 CYS B CB  
3347 C CB  B CYS B 202 ? 0.3336 0.1429 0.3282 -0.0003 0.1149  -0.0268 184 CYS B CB  
3348 S SG  A CYS B 202 ? 0.3192 0.1390 0.3362 -0.0157 0.1124  -0.0444 184 CYS B SG  
3349 S SG  B CYS B 202 ? 0.3586 0.1605 0.3721 -0.0126 0.1173  -0.0481 184 CYS B SG  
3350 N N   . ARG B 203 ? 0.3685 0.1352 0.3659 0.0022  0.1500  -0.0019 185 ARG B N   
3351 C CA  . ARG B 203 ? 0.3937 0.1384 0.3992 -0.0007 0.1699  0.0062  185 ARG B CA  
3352 C C   . ARG B 203 ? 0.3928 0.1485 0.4248 -0.0180 0.1721  -0.0051 185 ARG B C   
3353 O O   . ARG B 203 ? 0.3643 0.1485 0.4016 -0.0230 0.1573  -0.0128 185 ARG B O   
3354 C CB  . ARG B 203 ? 0.3941 0.1391 0.3789 0.0133  0.1727  0.0254  185 ARG B CB  
3355 C CG  . ARG B 203 ? 0.3999 0.1383 0.3583 0.0328  0.1704  0.0379  185 ARG B CG  
3356 C CD  . ARG B 203 ? 0.3913 0.1425 0.3314 0.0445  0.1659  0.0506  185 ARG B CD  
3357 N NE  . ARG B 203 ? 0.4042 0.1506 0.3194 0.0648  0.1657  0.0640  185 ARG B NE  
3358 C CZ  . ARG B 203 ? 0.3865 0.1545 0.2891 0.0737  0.1490  0.0630  185 ARG B CZ  
3359 N NH1 . ARG B 203 ? 0.3541 0.1459 0.2657 0.0640  0.1329  0.0506  185 ARG B NH1 
3360 N NH2 . ARG B 203 ? 0.4014 0.1673 0.2831 0.0928  0.1493  0.0744  185 ARG B NH2 
3361 N N   . ASP B 204 ? 0.4213 0.1549 0.4705 -0.0263 0.1919  -0.0049 186 ASP B N   
3362 C CA  . ASP B 204 ? 0.4241 0.1700 0.5020 -0.0430 0.1957  -0.0156 186 ASP B CA  
3363 C C   . ASP B 204 ? 0.4226 0.1787 0.4945 -0.0385 0.1986  -0.0018 186 ASP B C   
3364 O O   . ASP B 204 ? 0.4205 0.1715 0.4658 -0.0226 0.1989  0.0154  186 ASP B O   
3365 C CB  . ASP B 204 ? 0.4552 0.1762 0.5601 -0.0570 0.2158  -0.0246 186 ASP B CB  
3366 C CG  . ASP B 204 ? 0.4911 0.1781 0.5928 -0.0521 0.2431  -0.0053 186 ASP B CG  
3367 O OD1 . ASP B 204 ? 0.4972 0.1845 0.5835 -0.0418 0.2483  0.0127  186 ASP B OD1 
3368 O OD2 . ASP B 204 ? 0.5200 0.1778 0.6350 -0.0584 0.2608  -0.0089 186 ASP B OD2 
3369 N N   . LEU B 205 ? 0.4207 0.1954 0.5176 -0.0519 0.1984  -0.0116 187 LEU B N   
3370 C CA  . LEU B 205 ? 0.4205 0.2093 0.5138 -0.0484 0.1992  -0.0014 187 LEU B CA  
3371 C C   . LEU B 205 ? 0.4503 0.2121 0.5318 -0.0396 0.2218  0.0194  187 LEU B C   
3372 O O   . LEU B 205 ? 0.4446 0.2112 0.5033 -0.0265 0.2196  0.0336  187 LEU B O   
3373 C CB  . LEU B 205 ? 0.4114 0.2250 0.5377 -0.0645 0.1972  -0.0163 187 LEU B CB  
3374 C CG  . LEU B 205 ? 0.3887 0.2364 0.5205 -0.0682 0.1729  -0.0331 187 LEU B CG  
3375 C CD1 . LEU B 205 ? 0.3878 0.2596 0.5564 -0.0841 0.1727  -0.0499 187 LEU B CD1 
3376 C CD2 . LEU B 205 ? 0.3678 0.2320 0.4737 -0.0549 0.1582  -0.0231 187 LEU B CD2 
3377 N N   . ASP B 206 ? 0.4862 0.2190 0.5817 -0.0457 0.2436  0.0208  188 ASP B N   
3378 C CA  . ASP B 206 ? 0.5222 0.2256 0.6065 -0.0365 0.2688  0.0420  188 ASP B CA  
3379 C C   . ASP B 206 ? 0.5188 0.2103 0.5618 -0.0128 0.2653  0.0604  188 ASP B C   
3380 O O   . ASP B 206 ? 0.5263 0.2144 0.5481 0.0009  0.2723  0.0780  188 ASP B O   
3381 C CB  . ASP B 206 ? 0.5684 0.2388 0.6755 -0.0472 0.2943  0.0402  188 ASP B CB  
3382 C CG  . ASP B 206 ? 0.5788 0.2620 0.7310 -0.0714 0.3003  0.0213  188 ASP B CG  
3383 O OD1 . ASP B 206 ? 0.5776 0.2867 0.7426 -0.0770 0.2966  0.0190  188 ASP B OD1 
3384 O OD2 . ASP B 206 ? 0.6155 0.2823 0.7919 -0.0848 0.3102  0.0083  188 ASP B OD2 
3385 N N   . VAL B 207 ? 0.5045 0.1928 0.5362 -0.0076 0.2534  0.0553  189 VAL B N   
3386 C CA  . VAL B 207 ? 0.5026 0.1821 0.4987 0.0145  0.2495  0.0705  189 VAL B CA  
3387 C C   . VAL B 207 ? 0.4720 0.1812 0.4484 0.0243  0.2303  0.0741  189 VAL B C   
3388 O O   . VAL B 207 ? 0.4777 0.1829 0.4273 0.0422  0.2330  0.0901  189 VAL B O   
3389 C CB  . VAL B 207 ? 0.5007 0.1744 0.4922 0.0171  0.2401  0.0624  189 VAL B CB  
3390 C CG1 . VAL B 207 ? 0.5025 0.1749 0.4596 0.0404  0.2333  0.0767  189 VAL B CG1 
3391 C CG2 . VAL B 207 ? 0.5315 0.1720 0.5404 0.0088  0.2604  0.0587  189 VAL B CG2 
3392 N N   . VAL B 208 ? 0.4381 0.1768 0.4273 0.0133  0.2108  0.0586  190 VAL B N   
3393 C CA  . VAL B 208 ? 0.4146 0.1795 0.3881 0.0207  0.1932  0.0600  190 VAL B CA  
3394 C C   . VAL B 208 ? 0.4275 0.1934 0.3960 0.0248  0.2038  0.0712  190 VAL B C   
3395 O O   . VAL B 208 ? 0.4240 0.1948 0.3676 0.0396  0.1996  0.0813  190 VAL B O   
3396 C CB  . VAL B 208 ? 0.3809 0.1745 0.3694 0.0087  0.1729  0.0423  190 VAL B CB  
3397 C CG1 . VAL B 208 ? 0.3605 0.1772 0.3346 0.0155  0.1581  0.0443  190 VAL B CG1 
3398 C CG2 . VAL B 208 ? 0.3727 0.1663 0.3591 0.0088  0.1619  0.0335  190 VAL B CG2 
3399 N N   . ARG B 209 ? 0.4422 0.2041 0.4352 0.0116  0.2176  0.0681  191 ARG B N   
3400 C CA  . ARG B 209 ? 0.4623 0.2235 0.4521 0.0153  0.2307  0.0793  191 ARG B CA  
3401 C C   . ARG B 209 ? 0.4890 0.2251 0.4515 0.0339  0.2477  0.1002  191 ARG B C   
3402 O O   . ARG B 209 ? 0.4967 0.2386 0.4394 0.0460  0.2491  0.1107  191 ARG B O   
3403 C CB  . ARG B 209 ? 0.4797 0.2416 0.5051 -0.0030 0.2445  0.0717  191 ARG B CB  
3404 C CG  . ARG B 209 ? 0.4604 0.2539 0.5087 -0.0169 0.2265  0.0531  191 ARG B CG  
3405 C CD  . ARG B 209 ? 0.4898 0.2886 0.5730 -0.0328 0.2405  0.0466  191 ARG B CD  
3406 N NE  . ARG B 209 ? 0.4790 0.3059 0.5896 -0.0476 0.2243  0.0252  191 ARG B NE  
3407 C CZ  . ARG B 209 ? 0.4890 0.3164 0.6316 -0.0641 0.2282  0.0096  191 ARG B CZ  
3408 N NH1 . ARG B 209 ? 0.4693 0.3265 0.6326 -0.0742 0.2112  -0.0095 191 ARG B NH1 
3409 N NH2 . ARG B 209 ? 0.5144 0.3127 0.6686 -0.0701 0.2493  0.0122  191 ARG B NH2 
3410 N N   . ARG B 210 ? 0.5126 0.2206 0.4732 0.0371  0.2617  0.1063  192 ARG B N   
3411 C CA  A ARG B 210 ? 0.5481 0.2312 0.4798 0.0580  0.2788  0.1279  192 ARG B CA  
3412 C CA  B ARG B 210 ? 0.5498 0.2318 0.4810 0.0583  0.2784  0.1278  192 ARG B CA  
3413 C C   . ARG B 210 ? 0.5377 0.2350 0.4338 0.0791  0.2603  0.1337  192 ARG B C   
3414 O O   . ARG B 210 ? 0.5519 0.2448 0.4211 0.0976  0.2672  0.1491  192 ARG B O   
3415 C CB  A ARG B 210 ? 0.5835 0.2305 0.5207 0.0580  0.2993  0.1339  192 ARG B CB  
3416 C CB  B ARG B 210 ? 0.5801 0.2307 0.5148 0.0590  0.2922  0.1308  192 ARG B CB  
3417 C CG  A ARG B 210 ? 0.6145 0.2368 0.5753 0.0465  0.3293  0.1394  192 ARG B CG  
3418 C CG  B ARG B 210 ? 0.6222 0.2465 0.5229 0.0847  0.3070  0.1534  192 ARG B CG  
3419 C CD  A ARG B 210 ? 0.6575 0.2378 0.6146 0.0529  0.3534  0.1509  192 ARG B CD  
3420 C CD  B ARG B 210 ? 0.6496 0.2437 0.5541 0.0857  0.3187  0.1548  192 ARG B CD  
3421 N NE  A ARG B 210 ? 0.6458 0.2264 0.6069 0.0493  0.3385  0.1376  192 ARG B NE  
3422 N NE  B ARG B 210 ? 0.6388 0.2438 0.5280 0.0958  0.2980  0.1495  192 ARG B NE  
3423 C CZ  A ARG B 210 ? 0.6408 0.2172 0.6352 0.0278  0.3393  0.1190  192 ARG B CZ  
3424 C CZ  B ARG B 210 ? 0.6412 0.2598 0.4980 0.1183  0.2851  0.1588  192 ARG B CZ  
3425 N NH1 A ARG B 210 ? 0.6301 0.2081 0.6235 0.0272  0.3249  0.1076  192 ARG B NH1 
3426 N NH2 A ARG B 210 ? 0.6502 0.2210 0.6789 0.0077  0.3556  0.1116  192 ARG B NH2 
3427 N N   . ILE B 211 ? 0.5082 0.2234 0.4052 0.0763  0.2375  0.1207  193 ILE B N   
3428 C CA  . ILE B 211 ? 0.5002 0.2320 0.3696 0.0935  0.2192  0.1230  193 ILE B CA  
3429 C C   . ILE B 211 ? 0.4849 0.2409 0.3455 0.0960  0.2083  0.1213  193 ILE B C   
3430 O O   . ILE B 211 ? 0.4992 0.2608 0.3322 0.1146  0.2048  0.1300  193 ILE B O   
3431 C CB  . ILE B 211 ? 0.4744 0.2196 0.3505 0.0882  0.1993  0.1090  193 ILE B CB  
3432 C CG1 . ILE B 211 ? 0.5006 0.2195 0.3775 0.0919  0.2110  0.1132  193 ILE B CG1 
3433 C CG2 . ILE B 211 ? 0.4606 0.2284 0.3140 0.1029  0.1798  0.1088  193 ILE B CG2 
3434 C CD1 . ILE B 211 ? 0.4828 0.2108 0.3694 0.0850  0.1958  0.0994  193 ILE B CD1 
3435 N N   . ILE B 212 ? 0.4634 0.2329 0.3474 0.0783  0.2045  0.1101  194 ILE B N   
3436 C CA  . ILE B 212 ? 0.4514 0.2413 0.3298 0.0795  0.1962  0.1079  194 ILE B CA  
3437 C C   . ILE B 212 ? 0.4880 0.2657 0.3482 0.0929  0.2143  0.1241  194 ILE B C   
3438 O O   . ILE B 212 ? 0.4873 0.2759 0.3237 0.1070  0.2078  0.1281  194 ILE B O   
3439 C CB  . ILE B 212 ? 0.4274 0.2327 0.3361 0.0590  0.1910  0.0939  194 ILE B CB  
3440 C CG1 . ILE B 212 ? 0.3980 0.2194 0.3168 0.0503  0.1704  0.0789  194 ILE B CG1 
3441 C CG2 . ILE B 212 ? 0.4202 0.2411 0.3245 0.0609  0.1886  0.0942  194 ILE B CG2 
3442 C CD1 . ILE B 212 ? 0.3810 0.2139 0.3304 0.0314  0.1674  0.0655  194 ILE B CD1 
3443 N N   . CYS B 213 ? 0.5231 0.2779 0.3950 0.0885  0.2378  0.1328  195 CYS B N   
3444 C CA  . CYS B 213 ? 0.5733 0.3128 0.4282 0.1016  0.2591  0.1503  195 CYS B CA  
3445 C C   . CYS B 213 ? 0.5943 0.3247 0.4091 0.1288  0.2600  0.1652  195 CYS B C   
3446 O O   . CYS B 213 ? 0.6029 0.3386 0.3917 0.1452  0.2622  0.1742  195 CYS B O   
3447 C CB  . CYS B 213 ? 0.6096 0.3233 0.4884 0.0902  0.2862  0.1565  195 CYS B CB  
3448 S SG  . CYS B 213 ? 0.7098 0.4039 0.5699 0.1054  0.3157  0.1792  195 CYS B SG  
3449 N N   . SER B 214 ? 0.5954 0.3152 0.4042 0.1347  0.2569  0.1666  196 SER B N   
3450 C CA  . SER B 214 ? 0.6290 0.3435 0.4006 0.1621  0.2564  0.1801  196 SER B CA  
3451 C C   . SER B 214 ? 0.6029 0.3490 0.3533 0.1739  0.2311  0.1724  196 SER B C   
3452 O O   . SER B 214 ? 0.6253 0.3738 0.3423 0.1986  0.2304  0.1828  196 SER B O   
3453 C CB  . SER B 214 ? 0.6428 0.3398 0.4141 0.1667  0.2588  0.1830  196 SER B CB  
3454 O OG  . SER B 214 ? 0.6258 0.3403 0.4171 0.1514  0.2383  0.1646  196 SER B OG  
3455 N N   . ALA B 215 ? 0.5583 0.3282 0.3279 0.1569  0.2109  0.1539  197 ALA B N   
3456 C CA  . ALA B 215 ? 0.5382 0.3368 0.2937 0.1637  0.1888  0.1442  197 ALA B CA  
3457 C C   . ALA B 215 ? 0.5402 0.3475 0.2838 0.1684  0.1918  0.1460  197 ALA B C   
3458 O O   . ALA B 215 ? 0.5311 0.3606 0.2620 0.1746  0.1747  0.1372  197 ALA B O   
3459 C CB  . ALA B 215 ? 0.4971 0.3149 0.2757 0.1456  0.1681  0.1252  197 ALA B CB  
3460 N N   . GLY B 216 ? 0.5566 0.3469 0.3060 0.1649  0.2138  0.1563  198 GLY B N   
3461 C CA  . GLY B 216 ? 0.5639 0.3606 0.3029 0.1697  0.2197  0.1592  198 GLY B CA  
3462 C C   . GLY B 216 ? 0.5267 0.3428 0.2901 0.1502  0.2072  0.1427  198 GLY B C   
3463 O O   . GLY B 216 ? 0.5265 0.3559 0.2793 0.1549  0.2024  0.1391  198 GLY B O   
3464 N N   . LEU B 217 ? 0.4905 0.3079 0.2853 0.1297  0.2021  0.1325  199 LEU B N   
3465 C CA  . LEU B 217 ? 0.4579 0.2930 0.2760 0.1127  0.1907  0.1179  199 LEU B CA  
3466 C C   . LEU B 217 ? 0.4561 0.2840 0.3016 0.0980  0.2076  0.1197  199 LEU B C   
3467 O O   . LEU B 217 ? 0.4702 0.2784 0.3253 0.0948  0.2254  0.1282  199 LEU B O   
3468 C CB  . LEU B 217 ? 0.4309 0.2759 0.2638 0.1016  0.1720  0.1045  199 LEU B CB  
3469 C CG  . LEU B 217 ? 0.4269 0.2866 0.2398 0.1123  0.1522  0.0981  199 LEU B CG  
3470 C CD1 . LEU B 217 ? 0.4042 0.2703 0.2316 0.1026  0.1379  0.0878  199 LEU B CD1 
3471 C CD2 . LEU B 217 ? 0.4226 0.2996 0.2304 0.1127  0.1420  0.0896  199 LEU B CD2 
3472 N N   . SER B 218 ? 0.4377 0.2815 0.2964 0.0895  0.2028  0.1115  200 SER B N   
3473 C CA  . SER B 218 ? 0.4373 0.2820 0.3264 0.0746  0.2155  0.1099  200 SER B CA  
3474 C C   . SER B 218 ? 0.4043 0.2654 0.3215 0.0573  0.2002  0.0937  200 SER B C   
3475 O O   . SER B 218 ? 0.3856 0.2614 0.2966 0.0580  0.1805  0.0842  200 SER B O   
3476 C CB  . SER B 218 ? 0.4480 0.3008 0.3313 0.0801  0.2228  0.1133  200 SER B CB  
3477 O OG  . SER B 218 ? 0.4886 0.3252 0.3472 0.0962  0.2408  0.1296  200 SER B OG  
3478 N N   . LEU B 219 ? 0.4053 0.2645 0.3535 0.0423  0.2097  0.0901  201 LEU B N   
3479 C CA  . LEU B 219 ? 0.3821 0.2583 0.3577 0.0267  0.1961  0.0744  201 LEU B CA  
3480 C C   . LEU B 219 ? 0.3585 0.2560 0.3494 0.0219  0.1931  0.0681  201 LEU B C   
3481 O O   . LEU B 219 ? 0.3613 0.2601 0.3683 0.0179  0.2090  0.0716  201 LEU B O   
3482 C CB  . LEU B 219 ? 0.4134 0.2790 0.4159 0.0132  0.2073  0.0712  201 LEU B CB  
3483 C CG  . LEU B 219 ? 0.4080 0.2891 0.4379 -0.0020 0.1942  0.0541  201 LEU B CG  
3484 C CD1 . LEU B 219 ? 0.3923 0.2840 0.4092 0.0011  0.1715  0.0464  201 LEU B CD1 
3485 C CD2 . LEU B 219 ? 0.4342 0.2982 0.4831 -0.0122 0.2066  0.0518  201 LEU B CD2 
3486 N N   . LEU B 220 ? 0.3279 0.2417 0.3132 0.0234  0.1741  0.0596  202 LEU B N   
3487 C CA  . LEU B 220 ? 0.3146 0.2480 0.3116 0.0213  0.1702  0.0540  202 LEU B CA  
3488 C C   . LEU B 220 ? 0.2988 0.2499 0.3273 0.0079  0.1633  0.0416  202 LEU B C   
3489 O O   . LEU B 220 ? 0.2958 0.2632 0.3450 0.0037  0.1674  0.0380  202 LEU B O   
3490 C CB  . LEU B 220 ? 0.3027 0.2423 0.2770 0.0310  0.1553  0.0517  202 LEU B CB  
3491 C CG  . LEU B 220 ? 0.3223 0.2494 0.2635 0.0456  0.1573  0.0601  202 LEU B CG  
3492 C CD1 . LEU B 220 ? 0.3127 0.2468 0.2366 0.0518  0.1405  0.0536  202 LEU B CD1 
3493 C CD2 . LEU B 220 ? 0.3483 0.2708 0.2832 0.0528  0.1750  0.0699  202 LEU B CD2 
3494 N N   . ALA B 221 ? 0.2851 0.2359 0.3177 0.0023  0.1525  0.0343  203 ALA B N   
3495 C CA  . ALA B 221 ? 0.2743 0.2438 0.3343 -0.0086 0.1444  0.0212  203 ALA B CA  
3496 C C   . ALA B 221 ? 0.2745 0.2350 0.3351 -0.0138 0.1386  0.0160  203 ALA B C   
3497 O O   . ALA B 221 ? 0.2693 0.2148 0.3067 -0.0070 0.1347  0.0212  203 ALA B O   
3498 C CB  . ALA B 221 ? 0.2574 0.2461 0.3137 -0.0043 0.1282  0.0152  203 ALA B CB  
3499 N N   . GLU B 222 ? 0.2757 0.2473 0.3635 -0.0253 0.1377  0.0046  204 GLU B N   
3500 C CA  . GLU B 222 ? 0.2860 0.2515 0.3773 -0.0310 0.1318  -0.0031 204 GLU B CA  
3501 C C   . GLU B 222 ? 0.2642 0.2562 0.3762 -0.0376 0.1187  -0.0189 204 GLU B C   
3502 O O   . GLU B 222 ? 0.2586 0.2698 0.3955 -0.0436 0.1217  -0.0255 204 GLU B O   
3503 C CB  . GLU B 222 ? 0.3273 0.2729 0.4313 -0.0386 0.1496  -0.0009 204 GLU B CB  
3504 C CG  . GLU B 222 ? 0.3514 0.2858 0.4594 -0.0445 0.1472  -0.0086 204 GLU B CG  
3505 C CD  . GLU B 222 ? 0.3990 0.3124 0.5240 -0.0530 0.1680  -0.0068 204 GLU B CD  
3506 O OE1 . GLU B 222 ? 0.4336 0.3253 0.5444 -0.0460 0.1837  0.0089  204 GLU B OE1 
3507 O OE2 . GLU B 222 ? 0.4258 0.3448 0.5789 -0.0664 0.1694  -0.0217 204 GLU B OE2 
3508 N N   . GLU B 223 ? 0.2490 0.2435 0.3516 -0.0359 0.1048  -0.0252 205 GLU B N   
3509 C CA  . GLU B 223 ? 0.2346 0.2548 0.3516 -0.0390 0.0914  -0.0395 205 GLU B CA  
3510 C C   . GLU B 223 ? 0.2314 0.2478 0.3443 -0.0411 0.0828  -0.0483 205 GLU B C   
3511 O O   . GLU B 223 ? 0.2247 0.2263 0.3143 -0.0344 0.0792  -0.0414 205 GLU B O   
3512 C CB  . GLU B 223 ? 0.2263 0.2603 0.3278 -0.0281 0.0802  -0.0353 205 GLU B CB  
3513 C CG  . GLU B 223 ? 0.2217 0.2831 0.3338 -0.0271 0.0669  -0.0472 205 GLU B CG  
3514 C CD  . GLU B 223 ? 0.2134 0.2855 0.3121 -0.0155 0.0601  -0.0410 205 GLU B CD  
3515 O OE1 . GLU B 223 ? 0.2156 0.2975 0.3234 -0.0139 0.0651  -0.0382 205 GLU B OE1 
3516 O OE2 . GLU B 223 ? 0.2134 0.2805 0.2919 -0.0082 0.0520  -0.0379 205 GLU B OE2 
3517 N N   . ARG B 224 ? 0.2290 0.2613 0.3654 -0.0500 0.0790  -0.0646 206 ARG B N   
3518 C CA  . ARG B 224 ? 0.2321 0.2640 0.3639 -0.0508 0.0696  -0.0749 206 ARG B CA  
3519 C C   . ARG B 224 ? 0.2160 0.2680 0.3338 -0.0409 0.0528  -0.0779 206 ARG B C   
3520 O O   . ARG B 224 ? 0.2120 0.2886 0.3390 -0.0383 0.0465  -0.0821 206 ARG B O   
3521 C CB  . ARG B 224 ? 0.2467 0.2875 0.4090 -0.0642 0.0721  -0.0935 206 ARG B CB  
3522 C CG  . ARG B 224 ? 0.2553 0.2965 0.4125 -0.0647 0.0622  -0.1065 206 ARG B CG  
3523 C CD  . ARG B 224 ? 0.2763 0.3224 0.4631 -0.0787 0.0656  -0.1265 206 ARG B CD  
3524 N NE  . ARG B 224 ? 0.2865 0.3342 0.4638 -0.0767 0.0546  -0.1391 206 ARG B NE  
3525 C CZ  . ARG B 224 ? 0.3015 0.3609 0.5002 -0.0862 0.0509  -0.1617 206 ARG B CZ  
3526 N NH1 . ARG B 224 ? 0.3165 0.3868 0.5510 -0.1004 0.0579  -0.1753 206 ARG B NH1 
3527 N NH2 . ARG B 224 ? 0.3100 0.3708 0.4953 -0.0818 0.0405  -0.1720 206 ARG B NH2 
3528 N N   . GLN B 225 ? 0.2096 0.2510 0.3056 -0.0347 0.0466  -0.0752 207 GLN B N   
3529 C CA  . GLN B 225 ? 0.2021 0.2590 0.2835 -0.0248 0.0331  -0.0770 207 GLN B CA  
3530 C C   . GLN B 225 ? 0.2070 0.2892 0.3033 -0.0272 0.0231  -0.0959 207 GLN B C   
3531 O O   . GLN B 225 ? 0.2173 0.2954 0.3219 -0.0343 0.0233  -0.1080 207 GLN B O   
3532 C CB  . GLN B 225 ? 0.2000 0.2379 0.2562 -0.0183 0.0316  -0.0688 207 GLN B CB  
3533 C CG  . GLN B 225 ? 0.1971 0.2471 0.2373 -0.0082 0.0204  -0.0697 207 GLN B CG  
3534 C CD  . GLN B 225 ? 0.1853 0.2447 0.2176 0.0002  0.0177  -0.0607 207 GLN B CD  
3535 O OE1 . GLN B 225 ? 0.1873 0.2335 0.2116 0.0019  0.0233  -0.0489 207 GLN B OE1 
3536 N NE2 . GLN B 225 ? 0.1852 0.2670 0.2190 0.0065  0.0094  -0.0664 207 GLN B NE2 
3537 N N   . GLU B 226 ? 0.2043 0.3126 0.3019 -0.0198 0.0140  -0.0986 208 GLU B N   
3538 C CA  . GLU B 226 ? 0.2159 0.3542 0.3256 -0.0187 0.0023  -0.1165 208 GLU B CA  
3539 C C   . GLU B 226 ? 0.2223 0.3632 0.3070 -0.0068 -0.0079 -0.1172 208 GLU B C   
3540 O O   . GLU B 226 ? 0.2193 0.3423 0.2799 0.0008  -0.0059 -0.1026 208 GLU B O   
3541 C CB  . GLU B 226 ? 0.2099 0.3774 0.3331 -0.0139 -0.0020 -0.1183 208 GLU B CB  
3542 C CG  . GLU B 226 ? 0.2138 0.3814 0.3639 -0.0256 0.0092  -0.1184 208 GLU B CG  
3543 N N   . ASN B 227 ? 0.2386 0.4032 0.3299 -0.0053 -0.0185 -0.1350 209 ASN B N   
3544 C CA  . ASN B 227 ? 0.2545 0.4292 0.3222 0.0090  -0.0290 -0.1362 209 ASN B CA  
3545 C C   . ASN B 227 ? 0.2608 0.4095 0.3070 0.0104  -0.0257 -0.1306 209 ASN B C   
3546 O O   . ASN B 227 ? 0.2634 0.4109 0.2843 0.0239  -0.0292 -0.1221 209 ASN B O   
3547 C CB  . ASN B 227 ? 0.2571 0.4432 0.3083 0.0253  -0.0328 -0.1224 209 ASN B CB  
3548 C CG  . ASN B 227 ? 0.2681 0.4863 0.3389 0.0275  -0.0388 -0.1304 209 ASN B CG  
3549 O OD1 . ASN B 227 ? 0.2941 0.5406 0.3800 0.0266  -0.0484 -0.1497 209 ASN B OD1 
3550 N ND2 . ASN B 227 ? 0.2661 0.4816 0.3392 0.0299  -0.0331 -0.1175 209 ASN B ND2 
3551 N N   . LEU B 228 ? 0.2605 0.3884 0.3170 -0.0024 -0.0178 -0.1349 210 LEU B N   
3552 C CA  . LEU B 228 ? 0.2681 0.3728 0.3067 -0.0009 -0.0144 -0.1311 210 LEU B CA  
3553 C C   . LEU B 228 ? 0.2832 0.3973 0.3241 -0.0021 -0.0212 -0.1513 210 LEU B C   
3554 O O   . LEU B 228 ? 0.2867 0.4192 0.3493 -0.0094 -0.0258 -0.1699 210 LEU B O   
3555 C CB  . LEU B 228 ? 0.2666 0.3415 0.3117 -0.0115 -0.0013 -0.1230 210 LEU B CB  
3556 C CG  . LEU B 228 ? 0.2568 0.3189 0.2967 -0.0100 0.0061  -0.1033 210 LEU B CG  
3557 C CD1 . LEU B 228 ? 0.2658 0.2991 0.3068 -0.0170 0.0179  -0.0965 210 LEU B CD1 
3558 C CD2 . LEU B 228 ? 0.2500 0.3112 0.2653 0.0027  0.0026  -0.0901 210 LEU B CD2 
3559 N N   . PRO B 229 ? 0.2910 0.3931 0.3107 0.0047  -0.0216 -0.1488 211 PRO B N   
3560 C CA  . PRO B 229 ? 0.3114 0.4180 0.3317 0.0034  -0.0266 -0.1685 211 PRO B CA  
3561 C C   . PRO B 229 ? 0.3180 0.4120 0.3644 -0.0137 -0.0196 -0.1828 211 PRO B C   
3562 O O   . PRO B 229 ? 0.3051 0.3744 0.3588 -0.0218 -0.0075 -0.1719 211 PRO B O   
3563 C CB  . PRO B 229 ? 0.3142 0.4015 0.3080 0.0125  -0.0230 -0.1575 211 PRO B CB  
3564 C CG  . PRO B 229 ? 0.3020 0.3844 0.2808 0.0209  -0.0198 -0.1349 211 PRO B CG  
3565 C CD  . PRO B 229 ? 0.2861 0.3704 0.2818 0.0138  -0.0167 -0.1284 211 PRO B CD  
3566 N N   . ASP B 230 ? 0.3372 0.4482 0.3978 -0.0186 -0.0268 -0.2076 212 ASP B N   
3567 C CA  . ASP B 230 ? 0.3545 0.4538 0.4443 -0.0365 -0.0188 -0.2232 212 ASP B CA  
3568 C C   . ASP B 230 ? 0.3581 0.4191 0.4410 -0.0407 -0.0060 -0.2175 212 ASP B C   
3569 O O   . ASP B 230 ? 0.3646 0.4056 0.4683 -0.0541 0.0060  -0.2205 212 ASP B O   
3570 C CB  . ASP B 230 ? 0.3881 0.5135 0.4936 -0.0408 -0.0299 -0.2543 212 ASP B CB  
3571 C CG  . ASP B 230 ? 0.3955 0.5605 0.5190 -0.0407 -0.0411 -0.2650 212 ASP B CG  
3572 O OD1 . ASP B 230 ? 0.3881 0.5582 0.5146 -0.0388 -0.0385 -0.2483 212 ASP B OD1 
3573 O OD2 . ASP B 230 ? 0.4309 0.6238 0.5659 -0.0419 -0.0531 -0.2921 212 ASP B OD2 
3574 N N   . GLU B 231 ? 0.3526 0.4040 0.4075 -0.0286 -0.0079 -0.2104 213 GLU B N   
3575 C CA  . GLU B 231 ? 0.3637 0.3825 0.4130 -0.0310 0.0028  -0.2086 213 GLU B CA  
3576 C C   . GLU B 231 ? 0.3429 0.3331 0.3869 -0.0311 0.0162  -0.1842 213 GLU B C   
3577 O O   . GLU B 231 ? 0.3519 0.3148 0.3942 -0.0330 0.0265  -0.1819 213 GLU B O   
3578 C CB  . GLU B 231 ? 0.3829 0.4027 0.4066 -0.0183 -0.0032 -0.2130 213 GLU B CB  
3579 C CG  . GLU B 231 ? 0.3771 0.3988 0.3730 -0.0031 -0.0051 -0.1910 213 GLU B CG  
3580 C CD  . GLU B 231 ? 0.3753 0.4270 0.3618 0.0065  -0.0166 -0.1881 213 GLU B CD  
3581 O OE1 . GLU B 231 ? 0.3786 0.4297 0.3433 0.0185  -0.0163 -0.1699 213 GLU B OE1 
3582 O OE2 . GLU B 231 ? 0.3896 0.4654 0.3906 0.0028  -0.0253 -0.2037 213 GLU B OE2 
3583 N N   . ILE B 232 ? 0.3121 0.3092 0.3525 -0.0277 0.0158  -0.1666 214 ILE B N   
3584 C CA  . ILE B 232 ? 0.2978 0.2722 0.3303 -0.0256 0.0263  -0.1441 214 ILE B CA  
3585 C C   . ILE B 232 ? 0.2942 0.2553 0.3470 -0.0366 0.0379  -0.1396 214 ILE B C   
3586 O O   . ILE B 232 ? 0.2943 0.2690 0.3691 -0.0461 0.0370  -0.1511 214 ILE B O   
3587 C CB  . ILE B 232 ? 0.2780 0.2622 0.2909 -0.0142 0.0211  -0.1259 214 ILE B CB  
3588 C CG1 . ILE B 232 ? 0.2633 0.2689 0.2846 -0.0153 0.0157  -0.1241 214 ILE B CG1 
3589 C CG2 . ILE B 232 ? 0.2788 0.2713 0.2707 -0.0026 0.0136  -0.1273 214 ILE B CG2 
3590 C CD1 . ILE B 232 ? 0.2496 0.2599 0.2538 -0.0053 0.0132  -0.1064 214 ILE B CD1 
3591 N N   . TYR B 233 ? 0.2919 0.2278 0.3373 -0.0345 0.0491  -0.1231 215 TYR B N   
3592 C CA  . TYR B 233 ? 0.2929 0.2150 0.3522 -0.0416 0.0615  -0.1147 215 TYR B CA  
3593 C C   . TYR B 233 ? 0.2708 0.2154 0.3368 -0.0428 0.0561  -0.1108 215 TYR B C   
3594 O O   . TYR B 233 ? 0.2463 0.2067 0.2978 -0.0342 0.0463  -0.1041 215 TYR B O   
3595 C CB  . TYR B 233 ? 0.2999 0.1978 0.3430 -0.0338 0.0712  -0.0942 215 TYR B CB  
3596 C CG  . TYR B 233 ? 0.3289 0.1999 0.3685 -0.0324 0.0809  -0.0955 215 TYR B CG  
3597 C CD1 . TYR B 233 ? 0.3515 0.2019 0.4090 -0.0420 0.0946  -0.1023 215 TYR B CD1 
3598 C CD2 . TYR B 233 ? 0.3308 0.1969 0.3503 -0.0212 0.0773  -0.0901 215 TYR B CD2 
3599 C CE1 . TYR B 233 ? 0.3832 0.2068 0.4370 -0.0398 0.1044  -0.1035 215 TYR B CE1 
3600 C CE2 . TYR B 233 ? 0.3621 0.2042 0.3781 -0.0185 0.0861  -0.0918 215 TYR B CE2 
3601 C CZ  . TYR B 233 ? 0.3848 0.2042 0.4168 -0.0272 0.0999  -0.0980 215 TYR B CZ  
3602 O OH  . TYR B 233 ? 0.4212 0.2140 0.4497 -0.0238 0.1101  -0.0992 215 TYR B OH  
3603 N N   . HIS B 234 ? 0.2690 0.2132 0.3577 -0.0534 0.0642  -0.1146 216 HIS B N   
3604 C CA  . HIS B 234 ? 0.2563 0.2177 0.3519 -0.0540 0.0624  -0.1084 216 HIS B CA  
3605 C C   . HIS B 234 ? 0.2449 0.1958 0.3193 -0.0441 0.0655  -0.0863 216 HIS B C   
3606 O O   . HIS B 234 ? 0.2483 0.1762 0.3098 -0.0396 0.0731  -0.0757 216 HIS B O   
3607 C CB  . HIS B 234 ? 0.2695 0.2290 0.3942 -0.0672 0.0740  -0.1149 216 HIS B CB  
3608 C CG  . HIS B 234 ? 0.2822 0.2534 0.4323 -0.0789 0.0714  -0.1394 216 HIS B CG  
3609 N ND1 . HIS B 234 ? 0.2947 0.2691 0.4777 -0.0933 0.0813  -0.1497 216 HIS B ND1 
3610 C CD2 . HIS B 234 ? 0.2882 0.2712 0.4372 -0.0786 0.0599  -0.1573 216 HIS B CD2 
3611 C CE1 . HIS B 234 ? 0.3050 0.2913 0.5074 -0.1024 0.0760  -0.1739 216 HIS B CE1 
3612 N NE2 . HIS B 234 ? 0.3025 0.2946 0.4835 -0.0931 0.0624  -0.1791 216 HIS B NE2 
3613 N N   . VAL B 235 ? 0.2280 0.1974 0.2985 -0.0396 0.0586  -0.0806 217 VAL B N   
3614 C CA  . VAL B 235 ? 0.2203 0.1834 0.2723 -0.0308 0.0597  -0.0632 217 VAL B CA  
3615 C C   . VAL B 235 ? 0.2172 0.1860 0.2795 -0.0335 0.0656  -0.0574 217 VAL B C   
3616 O O   . VAL B 235 ? 0.2126 0.2021 0.2911 -0.0378 0.0615  -0.0662 217 VAL B O   
3617 C CB  . VAL B 235 ? 0.2074 0.1847 0.2420 -0.0214 0.0469  -0.0610 217 VAL B CB  
3618 C CG1 . VAL B 235 ? 0.2002 0.1733 0.2196 -0.0141 0.0478  -0.0458 217 VAL B CG1 
3619 C CG2 . VAL B 235 ? 0.2136 0.1841 0.2368 -0.0177 0.0431  -0.0651 217 VAL B CG2 
3620 N N   . TYR B 236 ? 0.2229 0.1740 0.2762 -0.0303 0.0757  -0.0433 218 TYR B N   
3621 C CA  . TYR B 236 ? 0.2238 0.1781 0.2840 -0.0313 0.0831  -0.0365 218 TYR B CA  
3622 C C   . TYR B 236 ? 0.2150 0.1656 0.2529 -0.0207 0.0813  -0.0227 218 TYR B C   
3623 O O   . TYR B 236 ? 0.2139 0.1532 0.2333 -0.0138 0.0791  -0.0165 218 TYR B O   
3624 C CB  . TYR B 236 ? 0.2445 0.1799 0.3166 -0.0375 0.1004  -0.0329 218 TYR B CB  
3625 C CG  . TYR B 236 ? 0.2587 0.2009 0.3614 -0.0511 0.1054  -0.0478 218 TYR B CG  
3626 C CD1 . TYR B 236 ? 0.2692 0.2092 0.3797 -0.0568 0.1018  -0.0613 218 TYR B CD1 
3627 C CD2 . TYR B 236 ? 0.2644 0.2162 0.3891 -0.0583 0.1138  -0.0496 218 TYR B CD2 
3628 C CE1 . TYR B 236 ? 0.2859 0.2330 0.4267 -0.0703 0.1060  -0.0777 218 TYR B CE1 
3629 C CE2 . TYR B 236 ? 0.2802 0.2396 0.4374 -0.0724 0.1193  -0.0650 218 TYR B CE2 
3630 C CZ  . TYR B 236 ? 0.2865 0.2440 0.4514 -0.0784 0.1145  -0.0797 218 TYR B CZ  
3631 O OH  . TYR B 236 ? 0.3069 0.2739 0.5042 -0.0926 0.1177  -0.0982 218 TYR B OH  
3632 N N   . SER B 237 ? 0.2078 0.1702 0.2489 -0.0194 0.0814  -0.0197 219 SER B N   
3633 C CA  . SER B 237 ? 0.2071 0.1659 0.2304 -0.0108 0.0817  -0.0087 219 SER B CA  
3634 C C   . SER B 237 ? 0.2243 0.1738 0.2508 -0.0110 0.0960  -0.0006 219 SER B C   
3635 O O   . SER B 237 ? 0.2267 0.1827 0.2739 -0.0184 0.1031  -0.0046 219 SER B O   
3636 C CB  . SER B 237 ? 0.1919 0.1691 0.2140 -0.0073 0.0722  -0.0107 219 SER B CB  
3637 O OG  . SER B 237 ? 0.1797 0.1653 0.1978 -0.0058 0.0607  -0.0168 219 SER B OG  
3638 N N   . PHE B 238 ? 0.2407 0.1775 0.2467 -0.0023 0.0996  0.0100  220 PHE B N   
3639 C CA  . PHE B 238 ? 0.2657 0.1916 0.2667 0.0015  0.1135  0.0201  220 PHE B CA  
3640 C C   . PHE B 238 ? 0.2606 0.1904 0.2414 0.0117  0.1085  0.0257  220 PHE B C   
3641 O O   . PHE B 238 ? 0.2598 0.1882 0.2245 0.0177  0.0993  0.0260  220 PHE B O   
3642 C CB  . PHE B 238 ? 0.2964 0.2000 0.2869 0.0057  0.1238  0.0283  220 PHE B CB  
3643 C CG  . PHE B 238 ? 0.3193 0.2138 0.3269 -0.0034 0.1297  0.0226  220 PHE B CG  
3644 C CD1 . PHE B 238 ? 0.3240 0.2187 0.3299 -0.0046 0.1196  0.0156  220 PHE B CD1 
3645 C CD2 . PHE B 238 ? 0.3444 0.2309 0.3715 -0.0115 0.1457  0.0230  220 PHE B CD2 
3646 C CE1 . PHE B 238 ? 0.3415 0.2262 0.3622 -0.0127 0.1252  0.0089  220 PHE B CE1 
3647 C CE2 . PHE B 238 ? 0.3609 0.2371 0.4055 -0.0211 0.1518  0.0156  220 PHE B CE2 
3648 C CZ  . PHE B 238 ? 0.3595 0.2349 0.3998 -0.0213 0.1409  0.0082  220 PHE B CZ  
3649 N N   . ALA B 239 ? 0.2572 0.1922 0.2405 0.0133  0.1146  0.0288  221 ALA B N   
3650 C CA  . ALA B 239 ? 0.2555 0.1920 0.2190 0.0234  0.1120  0.0333  221 ALA B CA  
3651 C C   . ALA B 239 ? 0.2765 0.1996 0.2271 0.0308  0.1259  0.0440  221 ALA B C   
3652 O O   . ALA B 239 ? 0.2840 0.2028 0.2480 0.0266  0.1399  0.0478  221 ALA B O   
3653 C CB  . ALA B 239 ? 0.2431 0.1946 0.2156 0.0221  0.1092  0.0292  221 ALA B CB  
3654 N N   . LEU B 240 ? 0.2821 0.1996 0.2079 0.0422  0.1226  0.0485  222 LEU B N   
3655 C CA  . LEU B 240 ? 0.3130 0.2166 0.2212 0.0526  0.1351  0.0599  222 LEU B CA  
3656 C C   . LEU B 240 ? 0.3200 0.2277 0.2040 0.0653  0.1309  0.0613  222 LEU B C   
3657 O O   . LEU B 240 ? 0.3013 0.2187 0.1795 0.0663  0.1163  0.0531  222 LEU B O   
3658 C CB  . LEU B 240 ? 0.3250 0.2173 0.2234 0.0570  0.1339  0.0633  222 LEU B CB  
3659 C CG  . LEU B 240 ? 0.3197 0.2086 0.2375 0.0458  0.1324  0.0582  222 LEU B CG  
3660 C CD1 . LEU B 240 ? 0.3366 0.2163 0.2404 0.0532  0.1290  0.0613  222 LEU B CD1 
3661 C CD2 . LEU B 240 ? 0.3384 0.2172 0.2742 0.0383  0.1499  0.0623  222 LEU B CD2 
3662 N N   . ARG B 241 ? 0.3514 0.2508 0.2204 0.0756  0.1440  0.0715  223 ARG B N   
3663 C CA  . ARG B 241 ? 0.3740 0.2756 0.2137 0.0912  0.1397  0.0729  223 ARG B CA  
3664 C C   . ARG B 241 ? 0.4127 0.3012 0.2317 0.1055  0.1555  0.0872  223 ARG B C   
3665 O O   . ARG B 241 ? 0.4233 0.2997 0.2538 0.1015  0.1730  0.0965  223 ARG B O   
3666 C CB  . ARG B 241 ? 0.3691 0.2821 0.2075 0.0915  0.1345  0.0657  223 ARG B CB  
3667 C CG  . ARG B 241 ? 0.3842 0.2957 0.2243 0.0937  0.1496  0.0719  223 ARG B CG  
3668 C CD  . ARG B 241 ? 0.3888 0.3094 0.2178 0.0995  0.1438  0.0650  223 ARG B CD  
3669 N NE  . ARG B 241 ? 0.3624 0.2934 0.2087 0.0891  0.1313  0.0530  223 ARG B NE  
3670 C CZ  . ARG B 241 ? 0.3538 0.2912 0.2215 0.0811  0.1355  0.0513  223 ARG B CZ  
3671 N NH1 . ARG B 241 ? 0.3630 0.2993 0.2424 0.0795  0.1515  0.0593  223 ARG B NH1 
3672 N NH2 . ARG B 241 ? 0.3346 0.2801 0.2134 0.0750  0.1247  0.0421  223 ARG B NH2 
3673 O OXT . ARG B 241 ? 0.4377 0.3282 0.2287 0.1213  0.1513  0.0888  223 ARG B OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -17 ?   ?   ?   A . n 
A 1 2   GLY 2   -16 ?   ?   ?   A . n 
A 1 3   SER 3   -15 ?   ?   ?   A . n 
A 1 4   SER 4   -14 ?   ?   ?   A . n 
A 1 5   HIS 5   -13 ?   ?   ?   A . n 
A 1 6   HIS 6   -12 ?   ?   ?   A . n 
A 1 7   HIS 7   -11 ?   ?   ?   A . n 
A 1 8   HIS 8   -10 ?   ?   ?   A . n 
A 1 9   HIS 9   -9  ?   ?   ?   A . n 
A 1 10  HIS 10  -8  ?   ?   ?   A . n 
A 1 11  SER 11  -7  ?   ?   ?   A . n 
A 1 12  SER 12  -6  ?   ?   ?   A . n 
A 1 13  GLY 13  -5  ?   ?   ?   A . n 
A 1 14  LEU 14  -4  ?   ?   ?   A . n 
A 1 15  VAL 15  -3  -3  VAL VAL A . n 
A 1 16  PRO 16  -2  -2  PRO PRO A . n 
A 1 17  ARG 17  -1  -1  ARG ARG A . n 
A 1 18  GLY 18  0   0   GLY GLY A . n 
A 1 19  SER 19  1   1   SER SER A . n 
A 1 20  THR 20  2   2   THR THR A . n 
A 1 21  SER 21  3   3   SER SER A . n 
A 1 22  GLU 22  4   4   GLU GLU A . n 
A 1 23  VAL 23  5   5   VAL VAL A . n 
A 1 24  ILE 24  6   6   ILE ILE A . n 
A 1 25  GLU 25  7   7   GLU GLU A . n 
A 1 26  ASP 26  8   8   ASP ASP A . n 
A 1 27  GLU 27  9   9   GLU GLU A . n 
A 1 28  LYS 28  10  10  LYS LYS A . n 
A 1 29  GLN 29  11  11  GLN GLN A . n 
A 1 30  PHE 30  12  12  PHE PHE A . n 
A 1 31  TYR 31  13  13  TYR TYR A . n 
A 1 32  SER 32  14  14  SER SER A . n 
A 1 33  LYS 33  15  15  LYS LYS A . n 
A 1 34  ALA 34  16  16  ALA ALA A . n 
A 1 35  LYS 35  17  17  LYS LYS A . n 
A 1 36  THR 36  18  18  THR THR A . n 
A 1 37  TYR 37  19  19  TYR TYR A . n 
A 1 38  TRP 38  20  20  TRP TRP A . n 
A 1 39  LYS 39  21  21  LYS LYS A . n 
A 1 40  GLN 40  22  22  GLN GLN A . n 
A 1 41  ILE 41  23  23  ILE ILE A . n 
A 1 42  PRO 42  24  24  PRO PRO A . n 
A 1 43  PRO 43  25  25  PRO PRO A . n 
A 1 44  THR 44  26  26  THR THR A . n 
A 1 45  VAL 45  27  27  VAL VAL A . n 
A 1 46  ASP 46  28  28  ASP ASP A . n 
A 1 47  GLY 47  29  29  GLY GLY A . n 
A 1 48  MET 48  30  30  MET MET A . n 
A 1 49  LEU 49  31  31  LEU LEU A . n 
A 1 50  GLY 50  32  32  GLY GLY A . n 
A 1 51  GLY 51  33  33  GLY GLY A . n 
A 1 52  TYR 52  34  34  TYR TYR A . n 
A 1 53  GLY 53  35  35  GLY GLY A . n 
A 1 54  HIS 54  36  36  HIS HIS A . n 
A 1 55  ILE 55  37  37  ILE ILE A . n 
A 1 56  SER 56  38  38  SER SER A . n 
A 1 57  SER 57  39  39  SER SER A . n 
A 1 58  ILE 58  40  40  ILE ILE A . n 
A 1 59  ASP 59  41  41  ASP ASP A . n 
A 1 60  ILE 60  42  42  ILE ILE A . n 
A 1 61  ASN 61  43  43  ASN ASN A . n 
A 1 62  SER 62  44  44  SER SER A . n 
A 1 63  SER 63  45  45  SER SER A . n 
A 1 64  ARG 64  46  46  ARG ARG A . n 
A 1 65  LYS 65  47  47  LYS LYS A . n 
A 1 66  PHE 66  48  48  PHE PHE A . n 
A 1 67  LEU 67  49  49  LEU LEU A . n 
A 1 68  GLN 68  50  50  GLN GLN A . n 
A 1 69  ARG 69  51  51  ARG ARG A . n 
A 1 70  PHE 70  52  52  PHE PHE A . n 
A 1 71  LEU 71  53  53  LEU LEU A . n 
A 1 72  ARG 72  54  54  ARG ARG A . n 
A 1 73  GLU 73  55  55  GLU GLU A . n 
A 1 74  GLY 74  56  56  GLY GLY A . n 
A 1 75  PRO 75  57  57  PRO PRO A . n 
A 1 76  ASN 76  58  58  ASN ASN A . n 
A 1 77  LYS 77  59  59  LYS LYS A . n 
A 1 78  THR 78  60  60  THR THR A . n 
A 1 79  GLY 79  61  61  GLY GLY A . n 
A 1 80  THR 80  62  62  THR THR A . n 
A 1 81  SER 81  63  63  SER SER A . n 
A 1 82  CYS 82  64  64  CYS CYS A . n 
A 1 83  ALA 83  65  65  ALA ALA A . n 
A 1 84  LEU 84  66  66  LEU LEU A . n 
A 1 85  ASP 85  67  67  ASP ASP A . n 
A 1 86  CYS 86  68  68  CYS CYS A . n 
A 1 87  GLY 87  69  69  GLY GLY A . n 
A 1 88  ALA 88  70  70  ALA ALA A . n 
A 1 89  GLY 89  71  71  GLY GLY A . n 
A 1 90  ILE 90  72  72  ILE ILE A . n 
A 1 91  GLY 91  73  73  GLY GLY A . n 
A 1 92  ARG 92  74  74  ARG ARG A . n 
A 1 93  ILE 93  75  75  ILE ILE A . n 
A 1 94  THR 94  76  76  THR THR A . n 
A 1 95  LYS 95  77  77  LYS LYS A . n 
A 1 96  ARG 96  78  78  ARG ARG A . n 
A 1 97  LEU 97  79  79  LEU LEU A . n 
A 1 98  LEU 98  80  80  LEU LEU A . n 
A 1 99  LEU 99  81  81  LEU LEU A . n 
A 1 100 PRO 100 82  82  PRO PRO A . n 
A 1 101 LEU 101 83  83  LEU LEU A . n 
A 1 102 PHE 102 84  84  PHE PHE A . n 
A 1 103 ARG 103 85  85  ARG ARG A . n 
A 1 104 GLU 104 86  86  GLU GLU A . n 
A 1 105 VAL 105 87  87  VAL VAL A . n 
A 1 106 ASP 106 88  88  ASP ASP A . n 
A 1 107 MET 107 89  89  MET MET A . n 
A 1 108 VAL 108 90  90  VAL VAL A . n 
A 1 109 ASP 109 91  91  ASP ASP A . n 
A 1 110 ILE 110 92  92  ILE ILE A . n 
A 1 111 THR 111 93  93  THR THR A . n 
A 1 112 GLU 112 94  94  GLU GLU A . n 
A 1 113 ASP 113 95  95  ASP ASP A . n 
A 1 114 PHE 114 96  96  PHE PHE A . n 
A 1 115 LEU 115 97  97  LEU LEU A . n 
A 1 116 VAL 116 98  98  VAL VAL A . n 
A 1 117 GLN 117 99  99  GLN GLN A . n 
A 1 118 ALA 118 100 100 ALA ALA A . n 
A 1 119 LYS 119 101 101 LYS LYS A . n 
A 1 120 THR 120 102 102 THR THR A . n 
A 1 121 TYR 121 103 103 TYR TYR A . n 
A 1 122 LEU 122 104 104 LEU LEU A . n 
A 1 123 GLY 123 105 105 GLY GLY A . n 
A 1 124 GLU 124 106 106 GLU GLU A . n 
A 1 125 GLU 125 107 107 GLU GLU A . n 
A 1 126 GLY 126 108 108 GLY GLY A . n 
A 1 127 LYS 127 109 109 LYS LYS A . n 
A 1 128 ARG 128 110 110 ARG ARG A . n 
A 1 129 VAL 129 111 111 VAL VAL A . n 
A 1 130 ARG 130 112 112 ARG ARG A . n 
A 1 131 ASN 131 113 113 ASN ASN A . n 
A 1 132 TYR 132 114 114 TYR TYR A . n 
A 1 133 PHE 133 115 115 PHE PHE A . n 
A 1 134 CYS 134 116 116 CYS CYS A . n 
A 1 135 CYS 135 117 117 CYS CYS A . n 
A 1 136 GLY 136 118 118 GLY GLY A . n 
A 1 137 LEU 137 119 119 LEU LEU A . n 
A 1 138 GLN 138 120 120 GLN GLN A . n 
A 1 139 ASP 139 121 121 ASP ASP A . n 
A 1 140 PHE 140 122 122 PHE PHE A . n 
A 1 141 THR 141 123 123 THR THR A . n 
A 1 142 PRO 142 124 124 PRO PRO A . n 
A 1 143 GLU 143 125 125 GLU GLU A . n 
A 1 144 PRO 144 126 126 PRO PRO A . n 
A 1 145 ASP 145 127 127 ASP ASP A . n 
A 1 146 SER 146 128 128 SER SER A . n 
A 1 147 TYR 147 129 129 TYR TYR A . n 
A 1 148 ASP 148 130 130 ASP ASP A . n 
A 1 149 VAL 149 131 131 VAL VAL A . n 
A 1 150 ILE 150 132 132 ILE ILE A . n 
A 1 151 TRP 151 133 133 TRP TRP A . n 
A 1 152 ILE 152 134 134 ILE ILE A . n 
A 1 153 GLN 153 135 135 GLN GLN A . n 
A 1 154 TRP 154 136 136 TRP TRP A . n 
A 1 155 VAL 155 137 137 VAL VAL A . n 
A 1 156 ILE 156 138 138 ILE ILE A . n 
A 1 157 GLY 157 139 139 GLY GLY A . n 
A 1 158 HIS 158 140 140 HIS HIS A . n 
A 1 159 LEU 159 141 141 LEU LEU A . n 
A 1 160 THR 160 142 142 THR THR A . n 
A 1 161 ASP 161 143 143 ASP ASP A . n 
A 1 162 GLN 162 144 144 GLN GLN A . n 
A 1 163 HIS 163 145 145 HIS HIS A . n 
A 1 164 LEU 164 146 146 LEU LEU A . n 
A 1 165 ALA 165 147 147 ALA ALA A . n 
A 1 166 GLU 166 148 148 GLU GLU A . n 
A 1 167 PHE 167 149 149 PHE PHE A . n 
A 1 168 LEU 168 150 150 LEU LEU A . n 
A 1 169 ARG 169 151 151 ARG ARG A . n 
A 1 170 ARG 170 152 152 ARG ARG A . n 
A 1 171 CYS 171 153 153 CYS CYS A . n 
A 1 172 LYS 172 154 154 LYS LYS A . n 
A 1 173 GLY 173 155 155 GLY GLY A . n 
A 1 174 SER 174 156 156 SER SER A . n 
A 1 175 LEU 175 157 157 LEU LEU A . n 
A 1 176 ARG 176 158 158 ARG ARG A . n 
A 1 177 PRO 177 159 159 PRO PRO A . n 
A 1 178 ASN 178 160 160 ASN ASN A . n 
A 1 179 GLY 179 161 161 GLY GLY A . n 
A 1 180 ILE 180 162 162 ILE ILE A . n 
A 1 181 ILE 181 163 163 ILE ILE A . n 
A 1 182 VAL 182 164 164 VAL VAL A . n 
A 1 183 ILE 183 165 165 ILE ILE A . n 
A 1 184 LYS 184 166 166 LYS LYS A . n 
A 1 185 ASP 185 167 167 ASP ASP A . n 
A 1 186 ASN 186 168 168 ASN ASN A . n 
A 1 187 MET 187 169 169 MET MET A . n 
A 1 188 ALA 188 170 170 ALA ALA A . n 
A 1 189 GLN 189 171 171 GLN GLN A . n 
A 1 190 GLU 190 172 172 GLU GLU A . n 
A 1 191 GLY 191 173 173 GLY GLY A . n 
A 1 192 VAL 192 174 174 VAL VAL A . n 
A 1 193 ILE 193 175 175 ILE ILE A . n 
A 1 194 LEU 194 176 176 LEU LEU A . n 
A 1 195 ASP 195 177 177 ASP ASP A . n 
A 1 196 ASP 196 178 178 ASP ASP A . n 
A 1 197 VAL 197 179 179 VAL VAL A . n 
A 1 198 ASP 198 180 180 ASP ASP A . n 
A 1 199 SER 199 181 181 SER SER A . n 
A 1 200 SER 200 182 182 SER SER A . n 
A 1 201 VAL 201 183 183 VAL VAL A . n 
A 1 202 CYS 202 184 184 CYS CYS A . n 
A 1 203 ARG 203 185 185 ARG ARG A . n 
A 1 204 ASP 204 186 186 ASP ASP A . n 
A 1 205 LEU 205 187 187 LEU LEU A . n 
A 1 206 ASP 206 188 188 ASP ASP A . n 
A 1 207 VAL 207 189 189 VAL VAL A . n 
A 1 208 VAL 208 190 190 VAL VAL A . n 
A 1 209 ARG 209 191 191 ARG ARG A . n 
A 1 210 ARG 210 192 192 ARG ARG A . n 
A 1 211 ILE 211 193 193 ILE ILE A . n 
A 1 212 ILE 212 194 194 ILE ILE A . n 
A 1 213 CYS 213 195 195 CYS CYS A . n 
A 1 214 SER 214 196 196 SER SER A . n 
A 1 215 ALA 215 197 197 ALA ALA A . n 
A 1 216 GLY 216 198 198 GLY GLY A . n 
A 1 217 LEU 217 199 199 LEU LEU A . n 
A 1 218 SER 218 200 200 SER SER A . n 
A 1 219 LEU 219 201 201 LEU LEU A . n 
A 1 220 LEU 220 202 202 LEU LEU A . n 
A 1 221 ALA 221 203 203 ALA ALA A . n 
A 1 222 GLU 222 204 204 GLU GLU A . n 
A 1 223 GLU 223 205 205 GLU GLU A . n 
A 1 224 ARG 224 206 206 ARG ARG A . n 
A 1 225 GLN 225 207 207 GLN GLN A . n 
A 1 226 GLU 226 208 208 GLU GLU A . n 
A 1 227 ASN 227 209 209 ASN ASN A . n 
A 1 228 LEU 228 210 210 LEU LEU A . n 
A 1 229 PRO 229 211 211 PRO PRO A . n 
A 1 230 ASP 230 212 212 ASP ASP A . n 
A 1 231 GLU 231 213 213 GLU GLU A . n 
A 1 232 ILE 232 214 214 ILE ILE A . n 
A 1 233 TYR 233 215 215 TYR TYR A . n 
A 1 234 HIS 234 216 216 HIS HIS A . n 
A 1 235 VAL 235 217 217 VAL VAL A . n 
A 1 236 TYR 236 218 218 TYR TYR A . n 
A 1 237 SER 237 219 219 SER SER A . n 
A 1 238 PHE 238 220 220 PHE PHE A . n 
A 1 239 ALA 239 221 221 ALA ALA A . n 
A 1 240 LEU 240 222 222 LEU LEU A . n 
A 1 241 ARG 241 223 223 ARG ARG A . n 
B 1 1   MET 1   -17 ?   ?   ?   B . n 
B 1 2   GLY 2   -16 ?   ?   ?   B . n 
B 1 3   SER 3   -15 ?   ?   ?   B . n 
B 1 4   SER 4   -14 ?   ?   ?   B . n 
B 1 5   HIS 5   -13 ?   ?   ?   B . n 
B 1 6   HIS 6   -12 ?   ?   ?   B . n 
B 1 7   HIS 7   -11 ?   ?   ?   B . n 
B 1 8   HIS 8   -10 ?   ?   ?   B . n 
B 1 9   HIS 9   -9  ?   ?   ?   B . n 
B 1 10  HIS 10  -8  ?   ?   ?   B . n 
B 1 11  SER 11  -7  ?   ?   ?   B . n 
B 1 12  SER 12  -6  ?   ?   ?   B . n 
B 1 13  GLY 13  -5  ?   ?   ?   B . n 
B 1 14  LEU 14  -4  ?   ?   ?   B . n 
B 1 15  VAL 15  -3  ?   ?   ?   B . n 
B 1 16  PRO 16  -2  -2  PRO PRO B . n 
B 1 17  ARG 17  -1  -1  ARG ARG B . n 
B 1 18  GLY 18  0   0   GLY GLY B . n 
B 1 19  SER 19  1   1   SER SER B . n 
B 1 20  THR 20  2   2   THR THR B . n 
B 1 21  SER 21  3   3   SER SER B . n 
B 1 22  GLU 22  4   4   GLU GLU B . n 
B 1 23  VAL 23  5   5   VAL VAL B . n 
B 1 24  ILE 24  6   6   ILE ILE B . n 
B 1 25  GLU 25  7   7   GLU GLU B . n 
B 1 26  ASP 26  8   8   ASP ASP B . n 
B 1 27  GLU 27  9   9   GLU GLU B . n 
B 1 28  LYS 28  10  10  LYS LYS B . n 
B 1 29  GLN 29  11  11  GLN GLN B . n 
B 1 30  PHE 30  12  12  PHE PHE B . n 
B 1 31  TYR 31  13  13  TYR TYR B . n 
B 1 32  SER 32  14  14  SER SER B . n 
B 1 33  LYS 33  15  15  LYS LYS B . n 
B 1 34  ALA 34  16  16  ALA ALA B . n 
B 1 35  LYS 35  17  17  LYS LYS B . n 
B 1 36  THR 36  18  18  THR THR B . n 
B 1 37  TYR 37  19  19  TYR TYR B . n 
B 1 38  TRP 38  20  20  TRP TRP B . n 
B 1 39  LYS 39  21  21  LYS LYS B . n 
B 1 40  GLN 40  22  22  GLN GLN B . n 
B 1 41  ILE 41  23  23  ILE ILE B . n 
B 1 42  PRO 42  24  24  PRO PRO B . n 
B 1 43  PRO 43  25  25  PRO PRO B . n 
B 1 44  THR 44  26  26  THR THR B . n 
B 1 45  VAL 45  27  27  VAL VAL B . n 
B 1 46  ASP 46  28  28  ASP ASP B . n 
B 1 47  GLY 47  29  29  GLY GLY B . n 
B 1 48  MET 48  30  30  MET MET B . n 
B 1 49  LEU 49  31  31  LEU LEU B . n 
B 1 50  GLY 50  32  32  GLY GLY B . n 
B 1 51  GLY 51  33  33  GLY GLY B . n 
B 1 52  TYR 52  34  34  TYR TYR B . n 
B 1 53  GLY 53  35  35  GLY GLY B . n 
B 1 54  HIS 54  36  36  HIS HIS B . n 
B 1 55  ILE 55  37  37  ILE ILE B . n 
B 1 56  SER 56  38  38  SER SER B . n 
B 1 57  SER 57  39  39  SER SER B . n 
B 1 58  ILE 58  40  40  ILE ILE B . n 
B 1 59  ASP 59  41  41  ASP ASP B . n 
B 1 60  ILE 60  42  42  ILE ILE B . n 
B 1 61  ASN 61  43  43  ASN ASN B . n 
B 1 62  SER 62  44  44  SER SER B . n 
B 1 63  SER 63  45  45  SER SER B . n 
B 1 64  ARG 64  46  46  ARG ARG B . n 
B 1 65  LYS 65  47  47  LYS LYS B . n 
B 1 66  PHE 66  48  48  PHE PHE B . n 
B 1 67  LEU 67  49  49  LEU LEU B . n 
B 1 68  GLN 68  50  50  GLN GLN B . n 
B 1 69  ARG 69  51  51  ARG ARG B . n 
B 1 70  PHE 70  52  52  PHE PHE B . n 
B 1 71  LEU 71  53  53  LEU LEU B . n 
B 1 72  ARG 72  54  54  ARG ARG B . n 
B 1 73  GLU 73  55  55  GLU GLU B . n 
B 1 74  GLY 74  56  56  GLY GLY B . n 
B 1 75  PRO 75  57  57  PRO PRO B . n 
B 1 76  ASN 76  58  58  ASN ASN B . n 
B 1 77  LYS 77  59  59  LYS LYS B . n 
B 1 78  THR 78  60  60  THR THR B . n 
B 1 79  GLY 79  61  61  GLY GLY B . n 
B 1 80  THR 80  62  62  THR THR B . n 
B 1 81  SER 81  63  63  SER SER B . n 
B 1 82  CYS 82  64  64  CYS CYS B . n 
B 1 83  ALA 83  65  65  ALA ALA B . n 
B 1 84  LEU 84  66  66  LEU LEU B . n 
B 1 85  ASP 85  67  67  ASP ASP B . n 
B 1 86  CYS 86  68  68  CYS CYS B . n 
B 1 87  GLY 87  69  69  GLY GLY B . n 
B 1 88  ALA 88  70  70  ALA ALA B . n 
B 1 89  GLY 89  71  71  GLY GLY B . n 
B 1 90  ILE 90  72  72  ILE ILE B . n 
B 1 91  GLY 91  73  73  GLY GLY B . n 
B 1 92  ARG 92  74  74  ARG ARG B . n 
B 1 93  ILE 93  75  75  ILE ILE B . n 
B 1 94  THR 94  76  76  THR THR B . n 
B 1 95  LYS 95  77  77  LYS LYS B . n 
B 1 96  ARG 96  78  78  ARG ARG B . n 
B 1 97  LEU 97  79  79  LEU LEU B . n 
B 1 98  LEU 98  80  80  LEU LEU B . n 
B 1 99  LEU 99  81  81  LEU LEU B . n 
B 1 100 PRO 100 82  82  PRO PRO B . n 
B 1 101 LEU 101 83  83  LEU LEU B . n 
B 1 102 PHE 102 84  84  PHE PHE B . n 
B 1 103 ARG 103 85  85  ARG ARG B . n 
B 1 104 GLU 104 86  86  GLU GLU B . n 
B 1 105 VAL 105 87  87  VAL VAL B . n 
B 1 106 ASP 106 88  88  ASP ASP B . n 
B 1 107 MET 107 89  89  MET MET B . n 
B 1 108 VAL 108 90  90  VAL VAL B . n 
B 1 109 ASP 109 91  91  ASP ASP B . n 
B 1 110 ILE 110 92  92  ILE ILE B . n 
B 1 111 THR 111 93  93  THR THR B . n 
B 1 112 GLU 112 94  94  GLU GLU B . n 
B 1 113 ASP 113 95  95  ASP ASP B . n 
B 1 114 PHE 114 96  96  PHE PHE B . n 
B 1 115 LEU 115 97  97  LEU LEU B . n 
B 1 116 VAL 116 98  98  VAL VAL B . n 
B 1 117 GLN 117 99  99  GLN GLN B . n 
B 1 118 ALA 118 100 100 ALA ALA B . n 
B 1 119 LYS 119 101 101 LYS LYS B . n 
B 1 120 THR 120 102 102 THR THR B . n 
B 1 121 TYR 121 103 103 TYR TYR B . n 
B 1 122 LEU 122 104 104 LEU LEU B . n 
B 1 123 GLY 123 105 105 GLY GLY B . n 
B 1 124 GLU 124 106 106 GLU GLU B . n 
B 1 125 GLU 125 107 107 GLU GLU B . n 
B 1 126 GLY 126 108 108 GLY GLY B . n 
B 1 127 LYS 127 109 109 LYS LYS B . n 
B 1 128 ARG 128 110 110 ARG ARG B . n 
B 1 129 VAL 129 111 111 VAL VAL B . n 
B 1 130 ARG 130 112 112 ARG ARG B . n 
B 1 131 ASN 131 113 113 ASN ASN B . n 
B 1 132 TYR 132 114 114 TYR TYR B . n 
B 1 133 PHE 133 115 115 PHE PHE B . n 
B 1 134 CYS 134 116 116 CYS CYS B . n 
B 1 135 CYS 135 117 117 CYS CYS B . n 
B 1 136 GLY 136 118 118 GLY GLY B . n 
B 1 137 LEU 137 119 119 LEU LEU B . n 
B 1 138 GLN 138 120 120 GLN GLN B . n 
B 1 139 ASP 139 121 121 ASP ASP B . n 
B 1 140 PHE 140 122 122 PHE PHE B . n 
B 1 141 THR 141 123 123 THR THR B . n 
B 1 142 PRO 142 124 124 PRO PRO B . n 
B 1 143 GLU 143 125 125 GLU GLU B . n 
B 1 144 PRO 144 126 126 PRO PRO B . n 
B 1 145 ASP 145 127 127 ASP ASP B . n 
B 1 146 SER 146 128 128 SER SER B . n 
B 1 147 TYR 147 129 129 TYR TYR B . n 
B 1 148 ASP 148 130 130 ASP ASP B . n 
B 1 149 VAL 149 131 131 VAL VAL B . n 
B 1 150 ILE 150 132 132 ILE ILE B . n 
B 1 151 TRP 151 133 133 TRP TRP B . n 
B 1 152 ILE 152 134 134 ILE ILE B . n 
B 1 153 GLN 153 135 135 GLN GLN B . n 
B 1 154 TRP 154 136 136 TRP TRP B . n 
B 1 155 VAL 155 137 137 VAL VAL B . n 
B 1 156 ILE 156 138 138 ILE ILE B . n 
B 1 157 GLY 157 139 139 GLY GLY B . n 
B 1 158 HIS 158 140 140 HIS HIS B . n 
B 1 159 LEU 159 141 141 LEU LEU B . n 
B 1 160 THR 160 142 142 THR THR B . n 
B 1 161 ASP 161 143 143 ASP ASP B . n 
B 1 162 GLN 162 144 144 GLN GLN B . n 
B 1 163 HIS 163 145 145 HIS HIS B . n 
B 1 164 LEU 164 146 146 LEU LEU B . n 
B 1 165 ALA 165 147 147 ALA ALA B . n 
B 1 166 GLU 166 148 148 GLU GLU B . n 
B 1 167 PHE 167 149 149 PHE PHE B . n 
B 1 168 LEU 168 150 150 LEU LEU B . n 
B 1 169 ARG 169 151 151 ARG ARG B . n 
B 1 170 ARG 170 152 152 ARG ARG B . n 
B 1 171 CYS 171 153 153 CYS CYS B . n 
B 1 172 LYS 172 154 154 LYS LYS B . n 
B 1 173 GLY 173 155 155 GLY GLY B . n 
B 1 174 SER 174 156 156 SER SER B . n 
B 1 175 LEU 175 157 157 LEU LEU B . n 
B 1 176 ARG 176 158 158 ARG ARG B . n 
B 1 177 PRO 177 159 159 PRO PRO B . n 
B 1 178 ASN 178 160 160 ASN ASN B . n 
B 1 179 GLY 179 161 161 GLY GLY B . n 
B 1 180 ILE 180 162 162 ILE ILE B . n 
B 1 181 ILE 181 163 163 ILE ILE B . n 
B 1 182 VAL 182 164 164 VAL VAL B . n 
B 1 183 ILE 183 165 165 ILE ILE B . n 
B 1 184 LYS 184 166 166 LYS LYS B . n 
B 1 185 ASP 185 167 167 ASP ASP B . n 
B 1 186 ASN 186 168 168 ASN ASN B . n 
B 1 187 MET 187 169 169 MET MET B . n 
B 1 188 ALA 188 170 170 ALA ALA B . n 
B 1 189 GLN 189 171 171 GLN GLN B . n 
B 1 190 GLU 190 172 172 GLU GLU B . n 
B 1 191 GLY 191 173 173 GLY GLY B . n 
B 1 192 VAL 192 174 174 VAL VAL B . n 
B 1 193 ILE 193 175 175 ILE ILE B . n 
B 1 194 LEU 194 176 176 LEU LEU B . n 
B 1 195 ASP 195 177 177 ASP ASP B . n 
B 1 196 ASP 196 178 178 ASP ASP B . n 
B 1 197 VAL 197 179 179 VAL VAL B . n 
B 1 198 ASP 198 180 180 ASP ASP B . n 
B 1 199 SER 199 181 181 SER SER B . n 
B 1 200 SER 200 182 182 SER SER B . n 
B 1 201 VAL 201 183 183 VAL VAL B . n 
B 1 202 CYS 202 184 184 CYS CYS B . n 
B 1 203 ARG 203 185 185 ARG ARG B . n 
B 1 204 ASP 204 186 186 ASP ASP B . n 
B 1 205 LEU 205 187 187 LEU LEU B . n 
B 1 206 ASP 206 188 188 ASP ASP B . n 
B 1 207 VAL 207 189 189 VAL VAL B . n 
B 1 208 VAL 208 190 190 VAL VAL B . n 
B 1 209 ARG 209 191 191 ARG ARG B . n 
B 1 210 ARG 210 192 192 ARG ARG B . n 
B 1 211 ILE 211 193 193 ILE ILE B . n 
B 1 212 ILE 212 194 194 ILE ILE B . n 
B 1 213 CYS 213 195 195 CYS CYS B . n 
B 1 214 SER 214 196 196 SER SER B . n 
B 1 215 ALA 215 197 197 ALA ALA B . n 
B 1 216 GLY 216 198 198 GLY GLY B . n 
B 1 217 LEU 217 199 199 LEU LEU B . n 
B 1 218 SER 218 200 200 SER SER B . n 
B 1 219 LEU 219 201 201 LEU LEU B . n 
B 1 220 LEU 220 202 202 LEU LEU B . n 
B 1 221 ALA 221 203 203 ALA ALA B . n 
B 1 222 GLU 222 204 204 GLU GLU B . n 
B 1 223 GLU 223 205 205 GLU GLU B . n 
B 1 224 ARG 224 206 206 ARG ARG B . n 
B 1 225 GLN 225 207 207 GLN GLN B . n 
B 1 226 GLU 226 208 208 GLU GLU B . n 
B 1 227 ASN 227 209 209 ASN ASN B . n 
B 1 228 LEU 228 210 210 LEU LEU B . n 
B 1 229 PRO 229 211 211 PRO PRO B . n 
B 1 230 ASP 230 212 212 ASP ASP B . n 
B 1 231 GLU 231 213 213 GLU GLU B . n 
B 1 232 ILE 232 214 214 ILE ILE B . n 
B 1 233 TYR 233 215 215 TYR TYR B . n 
B 1 234 HIS 234 216 216 HIS HIS B . n 
B 1 235 VAL 235 217 217 VAL VAL B . n 
B 1 236 TYR 236 218 218 TYR TYR B . n 
B 1 237 SER 237 219 219 SER SER B . n 
B 1 238 PHE 238 220 220 PHE PHE B . n 
B 1 239 ALA 239 221 221 ALA ALA B . n 
B 1 240 LEU 240 222 222 LEU LEU B . n 
B 1 241 ARG 241 223 223 ARG ARG B . n 
C 2 1   PRO 1   1   1   PRO PRO D . n 
C 2 2   PRO 2   2   2   PRO PRO D . n 
C 2 3   LYS 3   3   3   LYS LYS D . n 
C 2 4   ARG 4   4   4   ARG ARG D . n 
C 2 5   ILE 5   5   5   ILE ILE D . n 
C 2 6   ALA 6   6   6   ALA ALA D . n 
D 2 1   PRO 1   1   1   PRO PRO E . n 
D 2 2   PRO 2   2   2   PRO PRO E . n 
D 2 3   LYS 3   3   3   LYS LYS E . n 
D 2 4   ARG 4   4   4   ARG ARG E . n 
D 2 5   ILE 5   5   5   ILE ILE E . n 
D 2 6   ALA 6   6   6   ALA ALA E . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E  3 SAH 1   301 1   SAH SAH A . 
F  4 GOL 1   302 4   GOL GOL A . 
G  4 GOL 1   303 5   GOL GOL A . 
H  5 UNX 1   304 1   UNX UNX A . 
I  5 UNX 1   305 2   UNX UNX A . 
J  5 UNX 1   306 3   UNX UNX A . 
K  5 UNX 1   307 4   UNX UNX A . 
L  5 UNX 1   308 5   UNX UNX A . 
M  5 UNX 1   309 6   UNX UNX A . 
N  5 UNX 1   310 7   UNX UNX A . 
O  5 UNX 1   311 8   UNX UNX A . 
P  5 UNX 1   312 9   UNX UNX A . 
Q  5 UNX 1   313 17  UNX UNX A . 
R  5 UNX 1   314 18  UNX UNX A . 
S  5 UNX 1   315 23  UNX UNX A . 
T  5 UNX 1   316 24  UNX UNX A . 
U  5 UNX 1   317 25  UNX UNX A . 
V  5 UNX 1   318 31  UNX UNX A . 
W  5 UNX 1   319 32  UNX UNX A . 
X  5 UNX 1   320 33  UNX UNX A . 
Y  5 UNX 1   321 34  UNX UNX A . 
Z  5 UNX 1   322 38  UNX UNX A . 
AA 5 UNX 1   323 40  UNX UNX A . 
BA 5 UNX 1   324 44  UNX UNX A . 
CA 5 UNX 1   325 45  UNX UNX A . 
DA 3 SAH 1   301 2   SAH SAH B . 
EA 4 GOL 1   302 2   GOL GOL B . 
FA 5 UNX 1   303 10  UNX UNX B . 
GA 5 UNX 1   304 11  UNX UNX B . 
HA 5 UNX 1   305 12  UNX UNX B . 
IA 5 UNX 1   306 13  UNX UNX B . 
JA 5 UNX 1   307 14  UNX UNX B . 
KA 5 UNX 1   308 15  UNX UNX B . 
LA 5 UNX 1   309 16  UNX UNX B . 
MA 5 UNX 1   310 35  UNX UNX B . 
NA 5 UNX 1   311 36  UNX UNX B . 
OA 5 UNX 1   312 37  UNX UNX B . 
PA 5 UNX 1   313 39  UNX UNX B . 
QA 5 UNX 1   314 41  UNX UNX B . 
RA 5 UNX 1   315 42  UNX UNX B . 
SA 5 UNX 1   316 43  UNX UNX B . 
TA 5 UNX 1   317 46  UNX UNX B . 
UA 5 UNX 1   318 47  UNX UNX B . 
VA 5 UNX 1   319 48  UNX UNX B . 
WA 5 UNX 1   320 49  UNX UNX B . 
XA 5 UNX 1   321 588 UNX UNX B . 
YA 5 UNX 1   101 21  UNX UNX D . 
ZA 5 UNX 1   101 22  UNX UNX E . 
AB 6 HOH 1   401 483 HOH HOH A . 
AB 6 HOH 2   402 216 HOH HOH A . 
AB 6 HOH 3   403 337 HOH HOH A . 
AB 6 HOH 4   404 211 HOH HOH A . 
AB 6 HOH 5   405 474 HOH HOH A . 
AB 6 HOH 6   406 489 HOH HOH A . 
AB 6 HOH 7   407 490 HOH HOH A . 
AB 6 HOH 8   408 449 HOH HOH A . 
AB 6 HOH 9   409 551 HOH HOH A . 
AB 6 HOH 10  410 223 HOH HOH A . 
AB 6 HOH 11  411 60  HOH HOH A . 
AB 6 HOH 12  412 468 HOH HOH A . 
AB 6 HOH 13  413 338 HOH HOH A . 
AB 6 HOH 14  414 466 HOH HOH A . 
AB 6 HOH 15  415 470 HOH HOH A . 
AB 6 HOH 16  416 122 HOH HOH A . 
AB 6 HOH 17  417 176 HOH HOH A . 
AB 6 HOH 18  418 426 HOH HOH A . 
AB 6 HOH 19  419 46  HOH HOH A . 
AB 6 HOH 20  420 49  HOH HOH A . 
AB 6 HOH 21  421 359 HOH HOH A . 
AB 6 HOH 22  422 18  HOH HOH A . 
AB 6 HOH 23  423 35  HOH HOH A . 
AB 6 HOH 24  424 93  HOH HOH A . 
AB 6 HOH 25  425 325 HOH HOH A . 
AB 6 HOH 26  426 357 HOH HOH A . 
AB 6 HOH 27  427 21  HOH HOH A . 
AB 6 HOH 28  428 563 HOH HOH A . 
AB 6 HOH 29  429 163 HOH HOH A . 
AB 6 HOH 30  430 5   HOH HOH A . 
AB 6 HOH 31  431 47  HOH HOH A . 
AB 6 HOH 32  432 582 HOH HOH A . 
AB 6 HOH 33  433 8   HOH HOH A . 
AB 6 HOH 34  434 6   HOH HOH A . 
AB 6 HOH 35  435 323 HOH HOH A . 
AB 6 HOH 36  436 64  HOH HOH A . 
AB 6 HOH 37  437 43  HOH HOH A . 
AB 6 HOH 38  438 102 HOH HOH A . 
AB 6 HOH 39  439 544 HOH HOH A . 
AB 6 HOH 40  440 125 HOH HOH A . 
AB 6 HOH 41  441 175 HOH HOH A . 
AB 6 HOH 42  442 226 HOH HOH A . 
AB 6 HOH 43  443 169 HOH HOH A . 
AB 6 HOH 44  444 295 HOH HOH A . 
AB 6 HOH 45  445 53  HOH HOH A . 
AB 6 HOH 46  446 73  HOH HOH A . 
AB 6 HOH 47  447 161 HOH HOH A . 
AB 6 HOH 48  448 37  HOH HOH A . 
AB 6 HOH 49  449 178 HOH HOH A . 
AB 6 HOH 50  450 36  HOH HOH A . 
AB 6 HOH 51  451 95  HOH HOH A . 
AB 6 HOH 52  452 3   HOH HOH A . 
AB 6 HOH 53  453 552 HOH HOH A . 
AB 6 HOH 54  454 542 HOH HOH A . 
AB 6 HOH 55  455 180 HOH HOH A . 
AB 6 HOH 56  456 194 HOH HOH A . 
AB 6 HOH 57  457 373 HOH HOH A . 
AB 6 HOH 58  458 379 HOH HOH A . 
AB 6 HOH 59  459 109 HOH HOH A . 
AB 6 HOH 60  460 140 HOH HOH A . 
AB 6 HOH 61  461 168 HOH HOH A . 
AB 6 HOH 62  462 44  HOH HOH A . 
AB 6 HOH 63  463 207 HOH HOH A . 
AB 6 HOH 64  464 148 HOH HOH A . 
AB 6 HOH 65  465 81  HOH HOH A . 
AB 6 HOH 66  466 493 HOH HOH A . 
AB 6 HOH 67  467 142 HOH HOH A . 
AB 6 HOH 68  468 120 HOH HOH A . 
AB 6 HOH 69  469 165 HOH HOH A . 
AB 6 HOH 70  470 12  HOH HOH A . 
AB 6 HOH 71  471 471 HOH HOH A . 
AB 6 HOH 72  472 154 HOH HOH A . 
AB 6 HOH 73  473 234 HOH HOH A . 
AB 6 HOH 74  474 33  HOH HOH A . 
AB 6 HOH 75  475 29  HOH HOH A . 
AB 6 HOH 76  476 524 HOH HOH A . 
AB 6 HOH 77  477 157 HOH HOH A . 
AB 6 HOH 78  478 501 HOH HOH A . 
AB 6 HOH 79  479 250 HOH HOH A . 
AB 6 HOH 80  480 150 HOH HOH A . 
AB 6 HOH 81  481 51  HOH HOH A . 
AB 6 HOH 82  482 14  HOH HOH A . 
AB 6 HOH 83  483 531 HOH HOH A . 
AB 6 HOH 84  484 273 HOH HOH A . 
AB 6 HOH 85  485 561 HOH HOH A . 
AB 6 HOH 86  486 4   HOH HOH A . 
AB 6 HOH 87  487 26  HOH HOH A . 
AB 6 HOH 88  488 494 HOH HOH A . 
AB 6 HOH 89  489 553 HOH HOH A . 
AB 6 HOH 90  490 108 HOH HOH A . 
AB 6 HOH 91  491 113 HOH HOH A . 
AB 6 HOH 92  492 202 HOH HOH A . 
AB 6 HOH 93  493 284 HOH HOH A . 
AB 6 HOH 94  494 399 HOH HOH A . 
AB 6 HOH 95  495 225 HOH HOH A . 
AB 6 HOH 96  496 555 HOH HOH A . 
AB 6 HOH 97  497 123 HOH HOH A . 
AB 6 HOH 98  498 2   HOH HOH A . 
AB 6 HOH 99  499 52  HOH HOH A . 
AB 6 HOH 100 500 227 HOH HOH A . 
AB 6 HOH 101 501 153 HOH HOH A . 
AB 6 HOH 102 502 30  HOH HOH A . 
AB 6 HOH 103 503 260 HOH HOH A . 
AB 6 HOH 104 504 74  HOH HOH A . 
AB 6 HOH 105 505 238 HOH HOH A . 
AB 6 HOH 106 506 461 HOH HOH A . 
AB 6 HOH 107 507 428 HOH HOH A . 
AB 6 HOH 108 508 327 HOH HOH A . 
AB 6 HOH 109 509 158 HOH HOH A . 
AB 6 HOH 110 510 472 HOH HOH A . 
AB 6 HOH 111 511 400 HOH HOH A . 
AB 6 HOH 112 512 559 HOH HOH A . 
AB 6 HOH 113 513 63  HOH HOH A . 
AB 6 HOH 114 514 16  HOH HOH A . 
AB 6 HOH 115 515 241 HOH HOH A . 
AB 6 HOH 116 516 103 HOH HOH A . 
AB 6 HOH 117 517 292 HOH HOH A . 
AB 6 HOH 118 518 429 HOH HOH A . 
AB 6 HOH 119 519 221 HOH HOH A . 
AB 6 HOH 120 520 565 HOH HOH A . 
AB 6 HOH 121 521 328 HOH HOH A . 
AB 6 HOH 122 522 128 HOH HOH A . 
AB 6 HOH 123 523 393 HOH HOH A . 
AB 6 HOH 124 524 100 HOH HOH A . 
AB 6 HOH 125 525 23  HOH HOH A . 
AB 6 HOH 126 526 371 HOH HOH A . 
AB 6 HOH 127 527 86  HOH HOH A . 
AB 6 HOH 128 528 39  HOH HOH A . 
AB 6 HOH 129 529 149 HOH HOH A . 
AB 6 HOH 130 530 31  HOH HOH A . 
AB 6 HOH 131 531 309 HOH HOH A . 
AB 6 HOH 132 532 289 HOH HOH A . 
AB 6 HOH 133 533 437 HOH HOH A . 
AB 6 HOH 134 534 170 HOH HOH A . 
AB 6 HOH 135 535 526 HOH HOH A . 
AB 6 HOH 136 536 275 HOH HOH A . 
AB 6 HOH 137 537 66  HOH HOH A . 
AB 6 HOH 138 538 560 HOH HOH A . 
AB 6 HOH 139 539 92  HOH HOH A . 
AB 6 HOH 140 540 10  HOH HOH A . 
AB 6 HOH 141 541 302 HOH HOH A . 
AB 6 HOH 142 542 254 HOH HOH A . 
AB 6 HOH 143 543 476 HOH HOH A . 
AB 6 HOH 144 544 306 HOH HOH A . 
AB 6 HOH 145 545 177 HOH HOH A . 
AB 6 HOH 146 546 97  HOH HOH A . 
AB 6 HOH 147 547 500 HOH HOH A . 
AB 6 HOH 148 548 155 HOH HOH A . 
AB 6 HOH 149 549 174 HOH HOH A . 
AB 6 HOH 150 550 171 HOH HOH A . 
AB 6 HOH 151 551 294 HOH HOH A . 
AB 6 HOH 152 552 69  HOH HOH A . 
AB 6 HOH 153 553 42  HOH HOH A . 
AB 6 HOH 154 554 28  HOH HOH A . 
AB 6 HOH 155 555 88  HOH HOH A . 
AB 6 HOH 156 556 195 HOH HOH A . 
AB 6 HOH 157 557 481 HOH HOH A . 
AB 6 HOH 158 558 201 HOH HOH A . 
AB 6 HOH 159 559 83  HOH HOH A . 
AB 6 HOH 160 560 585 HOH HOH A . 
AB 6 HOH 161 561 455 HOH HOH A . 
AB 6 HOH 162 562 99  HOH HOH A . 
AB 6 HOH 163 563 349 HOH HOH A . 
AB 6 HOH 164 564 579 HOH HOH A . 
AB 6 HOH 165 565 72  HOH HOH A . 
AB 6 HOH 166 566 326 HOH HOH A . 
AB 6 HOH 167 567 269 HOH HOH A . 
AB 6 HOH 168 568 237 HOH HOH A . 
AB 6 HOH 169 569 193 HOH HOH A . 
AB 6 HOH 170 570 286 HOH HOH A . 
AB 6 HOH 171 571 406 HOH HOH A . 
AB 6 HOH 172 572 564 HOH HOH A . 
AB 6 HOH 173 573 358 HOH HOH A . 
AB 6 HOH 174 574 550 HOH HOH A . 
AB 6 HOH 175 575 265 HOH HOH A . 
AB 6 HOH 176 576 210 HOH HOH A . 
AB 6 HOH 177 577 186 HOH HOH A . 
AB 6 HOH 178 578 80  HOH HOH A . 
AB 6 HOH 179 579 469 HOH HOH A . 
AB 6 HOH 180 580 477 HOH HOH A . 
AB 6 HOH 181 581 535 HOH HOH A . 
AB 6 HOH 182 582 212 HOH HOH A . 
AB 6 HOH 183 583 408 HOH HOH A . 
AB 6 HOH 184 584 539 HOH HOH A . 
AB 6 HOH 185 585 556 HOH HOH A . 
AB 6 HOH 186 586 166 HOH HOH A . 
AB 6 HOH 187 587 566 HOH HOH A . 
AB 6 HOH 188 588 256 HOH HOH A . 
AB 6 HOH 189 589 447 HOH HOH A . 
AB 6 HOH 190 590 473 HOH HOH A . 
AB 6 HOH 191 591 460 HOH HOH A . 
AB 6 HOH 192 592 367 HOH HOH A . 
AB 6 HOH 193 593 416 HOH HOH A . 
AB 6 HOH 194 594 118 HOH HOH A . 
AB 6 HOH 195 595 459 HOH HOH A . 
AB 6 HOH 196 596 525 HOH HOH A . 
AB 6 HOH 197 597 586 HOH HOH A . 
AB 6 HOH 198 598 117 HOH HOH A . 
AB 6 HOH 199 599 496 HOH HOH A . 
AB 6 HOH 200 600 581 HOH HOH A . 
AB 6 HOH 201 601 567 HOH HOH A . 
AB 6 HOH 202 602 478 HOH HOH A . 
AB 6 HOH 203 603 499 HOH HOH A . 
AB 6 HOH 204 604 330 HOH HOH A . 
AB 6 HOH 205 605 482 HOH HOH A . 
AB 6 HOH 206 606 296 HOH HOH A . 
AB 6 HOH 207 607 298 HOH HOH A . 
AB 6 HOH 208 608 421 HOH HOH A . 
AB 6 HOH 209 609 215 HOH HOH A . 
AB 6 HOH 210 610 361 HOH HOH A . 
AB 6 HOH 211 611 497 HOH HOH A . 
AB 6 HOH 212 612 277 HOH HOH A . 
AB 6 HOH 213 613 392 HOH HOH A . 
AB 6 HOH 214 614 578 HOH HOH A . 
AB 6 HOH 215 615 346 HOH HOH A . 
AB 6 HOH 216 616 339 HOH HOH A . 
AB 6 HOH 217 617 129 HOH HOH A . 
AB 6 HOH 218 618 498 HOH HOH A . 
AB 6 HOH 219 619 475 HOH HOH A . 
AB 6 HOH 220 620 485 HOH HOH A . 
AB 6 HOH 221 621 413 HOH HOH A . 
AB 6 HOH 222 622 299 HOH HOH A . 
AB 6 HOH 223 623 249 HOH HOH A . 
AB 6 HOH 224 624 491 HOH HOH A . 
AB 6 HOH 225 625 341 HOH HOH A . 
AB 6 HOH 226 626 111 HOH HOH A . 
AB 6 HOH 227 627 427 HOH HOH A . 
AB 6 HOH 228 628 479 HOH HOH A . 
AB 6 HOH 229 629 365 HOH HOH A . 
AB 6 HOH 230 630 492 HOH HOH A . 
AB 6 HOH 231 631 534 HOH HOH A . 
AB 6 HOH 232 632 557 HOH HOH A . 
AB 6 HOH 233 633 583 HOH HOH A . 
AB 6 HOH 234 634 584 HOH HOH A . 
BB 6 HOH 1   401 517 HOH HOH B . 
BB 6 HOH 2   402 251 HOH HOH B . 
BB 6 HOH 3   403 173 HOH HOH B . 
BB 6 HOH 4   404 247 HOH HOH B . 
BB 6 HOH 5   405 443 HOH HOH B . 
BB 6 HOH 6   406 354 HOH HOH B . 
BB 6 HOH 7   407 529 HOH HOH B . 
BB 6 HOH 8   408 77  HOH HOH B . 
BB 6 HOH 9   409 548 HOH HOH B . 
BB 6 HOH 10  410 61  HOH HOH B . 
BB 6 HOH 11  411 432 HOH HOH B . 
BB 6 HOH 12  412 112 HOH HOH B . 
BB 6 HOH 13  413 236 HOH HOH B . 
BB 6 HOH 14  414 135 HOH HOH B . 
BB 6 HOH 15  415 130 HOH HOH B . 
BB 6 HOH 16  416 126 HOH HOH B . 
BB 6 HOH 17  417 71  HOH HOH B . 
BB 6 HOH 18  418 218 HOH HOH B . 
BB 6 HOH 19  419 54  HOH HOH B . 
BB 6 HOH 20  420 79  HOH HOH B . 
BB 6 HOH 21  421 348 HOH HOH B . 
BB 6 HOH 22  422 139 HOH HOH B . 
BB 6 HOH 23  423 134 HOH HOH B . 
BB 6 HOH 24  424 84  HOH HOH B . 
BB 6 HOH 25  425 513 HOH HOH B . 
BB 6 HOH 26  426 11  HOH HOH B . 
BB 6 HOH 27  427 116 HOH HOH B . 
BB 6 HOH 28  428 572 HOH HOH B . 
BB 6 HOH 29  429 209 HOH HOH B . 
BB 6 HOH 30  430 514 HOH HOH B . 
BB 6 HOH 31  431 511 HOH HOH B . 
BB 6 HOH 32  432 32  HOH HOH B . 
BB 6 HOH 33  433 509 HOH HOH B . 
BB 6 HOH 34  434 57  HOH HOH B . 
BB 6 HOH 35  435 48  HOH HOH B . 
BB 6 HOH 36  436 352 HOH HOH B . 
BB 6 HOH 37  437 384 HOH HOH B . 
BB 6 HOH 38  438 164 HOH HOH B . 
BB 6 HOH 39  439 119 HOH HOH B . 
BB 6 HOH 40  440 179 HOH HOH B . 
BB 6 HOH 41  441 182 HOH HOH B . 
BB 6 HOH 42  442 185 HOH HOH B . 
BB 6 HOH 43  443 141 HOH HOH B . 
BB 6 HOH 44  444 430 HOH HOH B . 
BB 6 HOH 45  445 300 HOH HOH B . 
BB 6 HOH 46  446 1   HOH HOH B . 
BB 6 HOH 47  447 146 HOH HOH B . 
BB 6 HOH 48  448 67  HOH HOH B . 
BB 6 HOH 49  449 547 HOH HOH B . 
BB 6 HOH 50  450 220 HOH HOH B . 
BB 6 HOH 51  451 252 HOH HOH B . 
BB 6 HOH 52  452 87  HOH HOH B . 
BB 6 HOH 53  453 156 HOH HOH B . 
BB 6 HOH 54  454 329 HOH HOH B . 
BB 6 HOH 55  455 105 HOH HOH B . 
BB 6 HOH 56  456 7   HOH HOH B . 
BB 6 HOH 57  457 41  HOH HOH B . 
BB 6 HOH 58  458 248 HOH HOH B . 
BB 6 HOH 59  459 353 HOH HOH B . 
BB 6 HOH 60  460 376 HOH HOH B . 
BB 6 HOH 61  461 304 HOH HOH B . 
BB 6 HOH 62  462 55  HOH HOH B . 
BB 6 HOH 63  463 205 HOH HOH B . 
BB 6 HOH 64  464 214 HOH HOH B . 
BB 6 HOH 65  465 160 HOH HOH B . 
BB 6 HOH 66  466 520 HOH HOH B . 
BB 6 HOH 67  467 506 HOH HOH B . 
BB 6 HOH 68  468 94  HOH HOH B . 
BB 6 HOH 69  469 85  HOH HOH B . 
BB 6 HOH 70  470 40  HOH HOH B . 
BB 6 HOH 71  471 507 HOH HOH B . 
BB 6 HOH 72  472 334 HOH HOH B . 
BB 6 HOH 73  473 452 HOH HOH B . 
BB 6 HOH 74  474 576 HOH HOH B . 
BB 6 HOH 75  475 441 HOH HOH B . 
BB 6 HOH 76  476 240 HOH HOH B . 
BB 6 HOH 77  477 276 HOH HOH B . 
BB 6 HOH 78  478 431 HOH HOH B . 
BB 6 HOH 79  479 435 HOH HOH B . 
BB 6 HOH 80  480 285 HOH HOH B . 
BB 6 HOH 81  481 231 HOH HOH B . 
BB 6 HOH 82  482 151 HOH HOH B . 
BB 6 HOH 83  483 502 HOH HOH B . 
BB 6 HOH 84  484 332 HOH HOH B . 
BB 6 HOH 85  485 78  HOH HOH B . 
BB 6 HOH 86  486 9   HOH HOH B . 
BB 6 HOH 87  487 258 HOH HOH B . 
BB 6 HOH 88  488 270 HOH HOH B . 
BB 6 HOH 89  489 188 HOH HOH B . 
BB 6 HOH 90  490 264 HOH HOH B . 
BB 6 HOH 91  491 137 HOH HOH B . 
BB 6 HOH 92  492 27  HOH HOH B . 
BB 6 HOH 93  493 189 HOH HOH B . 
BB 6 HOH 94  494 454 HOH HOH B . 
BB 6 HOH 95  495 25  HOH HOH B . 
BB 6 HOH 96  496 38  HOH HOH B . 
BB 6 HOH 97  497 288 HOH HOH B . 
BB 6 HOH 98  498 389 HOH HOH B . 
BB 6 HOH 99  499 445 HOH HOH B . 
BB 6 HOH 100 500 453 HOH HOH B . 
BB 6 HOH 101 501 62  HOH HOH B . 
BB 6 HOH 102 502 127 HOH HOH B . 
BB 6 HOH 103 503 197 HOH HOH B . 
BB 6 HOH 104 504 206 HOH HOH B . 
BB 6 HOH 105 505 575 HOH HOH B . 
BB 6 HOH 106 506 184 HOH HOH B . 
BB 6 HOH 107 507 115 HOH HOH B . 
BB 6 HOH 108 508 293 HOH HOH B . 
BB 6 HOH 109 509 518 HOH HOH B . 
BB 6 HOH 110 510 310 HOH HOH B . 
BB 6 HOH 111 511 167 HOH HOH B . 
BB 6 HOH 112 512 58  HOH HOH B . 
BB 6 HOH 113 513 503 HOH HOH B . 
BB 6 HOH 114 514 203 HOH HOH B . 
BB 6 HOH 115 515 261 HOH HOH B . 
BB 6 HOH 116 516 59  HOH HOH B . 
BB 6 HOH 117 517 297 HOH HOH B . 
BB 6 HOH 118 518 15  HOH HOH B . 
BB 6 HOH 119 519 200 HOH HOH B . 
BB 6 HOH 120 520 351 HOH HOH B . 
BB 6 HOH 121 521 456 HOH HOH B . 
BB 6 HOH 122 522 228 HOH HOH B . 
BB 6 HOH 123 523 22  HOH HOH B . 
BB 6 HOH 124 524 458 HOH HOH B . 
BB 6 HOH 125 525 192 HOH HOH B . 
BB 6 HOH 126 526 89  HOH HOH B . 
BB 6 HOH 127 527 121 HOH HOH B . 
BB 6 HOH 128 528 283 HOH HOH B . 
BB 6 HOH 129 529 381 HOH HOH B . 
BB 6 HOH 130 530 50  HOH HOH B . 
BB 6 HOH 131 531 162 HOH HOH B . 
BB 6 HOH 132 532 342 HOH HOH B . 
BB 6 HOH 133 533 268 HOH HOH B . 
BB 6 HOH 134 534 34  HOH HOH B . 
BB 6 HOH 135 535 138 HOH HOH B . 
BB 6 HOH 136 536 145 HOH HOH B . 
BB 6 HOH 137 537 549 HOH HOH B . 
BB 6 HOH 138 538 568 HOH HOH B . 
BB 6 HOH 139 539 311 HOH HOH B . 
BB 6 HOH 140 540 144 HOH HOH B . 
BB 6 HOH 141 541 152 HOH HOH B . 
BB 6 HOH 142 542 462 HOH HOH B . 
BB 6 HOH 143 543 217 HOH HOH B . 
BB 6 HOH 144 544 388 HOH HOH B . 
BB 6 HOH 145 545 267 HOH HOH B . 
BB 6 HOH 146 546 319 HOH HOH B . 
BB 6 HOH 147 547 523 HOH HOH B . 
BB 6 HOH 148 548 510 HOH HOH B . 
BB 6 HOH 149 549 278 HOH HOH B . 
BB 6 HOH 150 550 487 HOH HOH B . 
BB 6 HOH 151 551 571 HOH HOH B . 
BB 6 HOH 152 552 308 HOH HOH B . 
BB 6 HOH 153 553 244 HOH HOH B . 
BB 6 HOH 154 554 65  HOH HOH B . 
BB 6 HOH 155 555 313 HOH HOH B . 
BB 6 HOH 156 556 187 HOH HOH B . 
BB 6 HOH 157 557 409 HOH HOH B . 
BB 6 HOH 158 558 436 HOH HOH B . 
BB 6 HOH 159 559 537 HOH HOH B . 
BB 6 HOH 160 560 224 HOH HOH B . 
BB 6 HOH 161 561 101 HOH HOH B . 
BB 6 HOH 162 562 519 HOH HOH B . 
BB 6 HOH 163 563 132 HOH HOH B . 
BB 6 HOH 164 564 390 HOH HOH B . 
BB 6 HOH 165 565 522 HOH HOH B . 
BB 6 HOH 166 566 402 HOH HOH B . 
BB 6 HOH 167 567 587 HOH HOH B . 
BB 6 HOH 168 568 243 HOH HOH B . 
BB 6 HOH 169 569 451 HOH HOH B . 
BB 6 HOH 170 570 257 HOH HOH B . 
BB 6 HOH 171 571 387 HOH HOH B . 
BB 6 HOH 172 572 196 HOH HOH B . 
BB 6 HOH 173 573 417 HOH HOH B . 
BB 6 HOH 174 574 235 HOH HOH B . 
BB 6 HOH 175 575 570 HOH HOH B . 
BB 6 HOH 176 576 229 HOH HOH B . 
CB 6 HOH 1   201 213 HOH HOH D . 
CB 6 HOH 2   202 271 HOH HOH D . 
CB 6 HOH 3   203 20  HOH HOH D . 
CB 6 HOH 4   204 104 HOH HOH D . 
CB 6 HOH 5   205 467 HOH HOH D . 
CB 6 HOH 6   206 543 HOH HOH D . 
DB 6 HOH 1   201 259 HOH HOH E . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA dimeric 2 
2 software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,YA,AB,CB           
2 1 B,D,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,ZA,BB,DB 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1490  ? 
1 MORE         -4    ? 
1 'SSA (A^2)'  10480 ? 
2 'ABSA (A^2)' 1340  ? 
2 MORE         -4    ? 
2 'SSA (A^2)'  9970  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-10-28 
2 'Structure model' 1 1 2015-11-18 
3 'Structure model' 1 2 2015-12-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 16.1601 31.6899 -14.5184 0.0413 ? 0.0196 ? 0.0091 ? 0.0158 ? 0.0008 ? 0.0052 ? 0.9909 ? -0.1635 ? 
0.0853  ? 0.9579 ? -0.1584 ? 1.8284 ? -0.0543 ? -0.0303 ? -0.0145 ? 0.0863 ? 0.0289 ? 0.0559 ? -0.0702 ? -0.1298 ? 0.0254 ? 
2 'X-RAY DIFFRACTION' ? refined -6.8053 38.9752 14.2489  0.1097 ? 0.0331 ? 0.0464 ? 0.0521 ? 0.0097 ? 0.0367 ? 2.0269 ? -1.0728 ? 
-0.9770 ? 1.5540 ? 0.4565  ? 1.7607 ? -0.1542 ? -0.1214 ? -0.1919 ? 0.1782 ? 0.0834 ? 0.1086 ? 0.2023  ? 0.0694  ? 0.0709 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A -3 ? ? A 223 ? ? 
2 'X-RAY DIFFRACTION' 2 ? ? B -2 ? ? B 223 ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0131 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.9    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 7   ? ? OE1 A GLU 7   ? ? 1.185 1.252 -0.067 0.011 N 
2 1 CB B SER 156 ? ? OG  B SER 156 ? ? 1.323 1.418 -0.095 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A LEU 201 ? B CG A LEU 201 ? B CD2 A LEU 201 ? B 100.67 111.00 -10.33 1.70 N 
2 1 CB B ASP 8   ? ? CG B ASP 8   ? ? OD1 B ASP 8   ? ? 123.83 118.30 5.53   0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 112 ? ? -90.55  -73.97 
2 1 VAL A 137 ? ? -146.64 -16.06 
3 1 SER A 181 ? ? 62.17   69.91  
4 1 ASN B 58  ? B -117.03 54.62  
5 1 VAL B 137 ? ? -144.95 -15.90 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       634 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.28 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A VAL -3  ? CG1 ? A VAL 15  CG1 
2  1 Y 1 A VAL -3  ? CG2 ? A VAL 15  CG2 
3  1 Y 1 A LYS 10  ? CD  ? A LYS 28  CD  
4  1 Y 1 A LYS 10  ? CE  ? A LYS 28  CE  
5  1 Y 1 A LYS 10  ? NZ  ? A LYS 28  NZ  
6  1 Y 1 A LYS 15  ? CE  ? A LYS 33  CE  
7  1 Y 1 A LYS 15  ? NZ  ? A LYS 33  NZ  
8  1 Y 1 A LYS 47  ? CE  ? A LYS 65  CE  
9  1 Y 1 A LYS 47  ? NZ  ? A LYS 65  NZ  
10 1 Y 1 A LYS 59  ? CE  ? A LYS 77  CE  
11 1 Y 1 A LYS 59  ? NZ  ? A LYS 77  NZ  
12 1 Y 1 A ARG 85  ? CD  ? A ARG 103 CD  
13 1 Y 1 A ARG 85  ? NE  ? A ARG 103 NE  
14 1 Y 1 A ARG 85  ? CZ  ? A ARG 103 CZ  
15 1 Y 1 A ARG 85  ? NH1 ? A ARG 103 NH1 
16 1 Y 1 A ARG 85  ? NH2 ? A ARG 103 NH2 
17 1 Y 1 A LYS 101 ? CD  ? A LYS 119 CD  
18 1 Y 1 A LYS 101 ? CE  ? A LYS 119 CE  
19 1 Y 1 A LYS 101 ? NZ  ? A LYS 119 NZ  
20 1 Y 1 A LYS 109 ? CD  ? A LYS 127 CD  
21 1 Y 1 A LYS 109 ? CE  ? A LYS 127 CE  
22 1 Y 1 A LYS 109 ? NZ  ? A LYS 127 NZ  
23 1 Y 1 A ARG 158 ? CZ  ? A ARG 176 CZ  
24 1 Y 1 A ARG 158 ? NH1 ? A ARG 176 NH1 
25 1 Y 1 A ARG 158 ? NH2 ? A ARG 176 NH2 
26 1 Y 1 A GLN 171 ? CD  ? A GLN 189 CD  
27 1 Y 1 A GLN 171 ? OE1 ? A GLN 189 OE1 
28 1 Y 1 A GLN 171 ? NE2 ? A GLN 189 NE2 
29 1 Y 1 B PRO -2  ? N   ? B PRO 16  N   
30 1 Y 1 B PRO -2  ? CB  ? B PRO 16  CB  
31 1 Y 1 B PRO -2  ? CG  ? B PRO 16  CG  
32 1 Y 1 B PRO -2  ? CD  ? B PRO 16  CD  
33 1 Y 1 B ARG -1  ? CG  ? B ARG 17  CG  
34 1 Y 1 B ARG -1  ? CD  ? B ARG 17  CD  
35 1 Y 1 B ARG -1  ? NE  ? B ARG 17  NE  
36 1 Y 1 B ARG -1  ? CZ  ? B ARG 17  CZ  
37 1 Y 1 B ARG -1  ? NH1 ? B ARG 17  NH1 
38 1 Y 1 B ARG -1  ? NH2 ? B ARG 17  NH2 
39 1 Y 1 B GLU 7   ? CG  ? B GLU 25  CG  
40 1 Y 1 B GLU 7   ? CD  ? B GLU 25  CD  
41 1 Y 1 B GLU 7   ? OE1 ? B GLU 25  OE1 
42 1 Y 1 B GLU 7   ? OE2 ? B GLU 25  OE2 
43 1 Y 1 B LYS 10  ? CD  ? B LYS 28  CD  
44 1 Y 1 B LYS 10  ? CE  ? B LYS 28  CE  
45 1 Y 1 B LYS 10  ? NZ  ? B LYS 28  NZ  
46 1 Y 1 B LYS 15  ? NZ  ? B LYS 33  NZ  
47 1 Y 1 B LYS 21  ? NZ  ? B LYS 39  NZ  
48 1 Y 1 B ARG 85  ? CD  ? B ARG 103 CD  
49 1 Y 1 B ARG 85  ? NE  ? B ARG 103 NE  
50 1 Y 1 B ARG 85  ? CZ  ? B ARG 103 CZ  
51 1 Y 1 B ARG 85  ? NH1 ? B ARG 103 NH1 
52 1 Y 1 B ARG 85  ? NH2 ? B ARG 103 NH2 
53 1 Y 1 B LYS 154 ? CE  ? B LYS 172 CE  
54 1 Y 1 B LYS 154 ? NZ  ? B LYS 172 NZ  
55 1 Y 1 B ARG 158 ? NH1 ? B ARG 176 NH1 
56 1 Y 1 B ARG 158 ? NH2 ? B ARG 176 NH2 
57 1 Y 1 B GLN 171 ? CG  ? B GLN 189 CG  
58 1 Y 1 B GLN 171 ? CD  ? B GLN 189 CD  
59 1 Y 1 B GLN 171 ? OE1 ? B GLN 189 OE1 
60 1 Y 1 B GLN 171 ? NE2 ? B GLN 189 NE2 
61 1 Y 1 B ASP 178 ? OD1 ? B ASP 196 OD1 
62 1 Y 1 B ASP 178 ? OD2 ? B ASP 196 OD2 
63 1 Y 1 B GLU 208 ? CD  ? B GLU 226 CD  
64 1 Y 1 B GLU 208 ? OE1 ? B GLU 226 OE1 
65 1 Y 1 B GLU 208 ? OE2 ? B GLU 226 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -17 ? A MET 1  
2  1 Y 1 A GLY -16 ? A GLY 2  
3  1 Y 1 A SER -15 ? A SER 3  
4  1 Y 1 A SER -14 ? A SER 4  
5  1 Y 1 A HIS -13 ? A HIS 5  
6  1 Y 1 A HIS -12 ? A HIS 6  
7  1 Y 1 A HIS -11 ? A HIS 7  
8  1 Y 1 A HIS -10 ? A HIS 8  
9  1 Y 1 A HIS -9  ? A HIS 9  
10 1 Y 1 A HIS -8  ? A HIS 10 
11 1 Y 1 A SER -7  ? A SER 11 
12 1 Y 1 A SER -6  ? A SER 12 
13 1 Y 1 A GLY -5  ? A GLY 13 
14 1 Y 1 A LEU -4  ? A LEU 14 
15 1 Y 1 B MET -17 ? B MET 1  
16 1 Y 1 B GLY -16 ? B GLY 2  
17 1 Y 1 B SER -15 ? B SER 3  
18 1 Y 1 B SER -14 ? B SER 4  
19 1 Y 1 B HIS -13 ? B HIS 5  
20 1 Y 1 B HIS -12 ? B HIS 6  
21 1 Y 1 B HIS -11 ? B HIS 7  
22 1 Y 1 B HIS -10 ? B HIS 8  
23 1 Y 1 B HIS -9  ? B HIS 9  
24 1 Y 1 B HIS -8  ? B HIS 10 
25 1 Y 1 B SER -7  ? B SER 11 
26 1 Y 1 B SER -6  ? B SER 12 
27 1 Y 1 B GLY -5  ? B GLY 13 
28 1 Y 1 B LEU -4  ? B LEU 14 
29 1 Y 1 B VAL -3  ? B VAL 15 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 S-ADENOSYL-L-HOMOCYSTEINE SAH 
4 GLYCEROL                  GOL 
5 'UNKNOWN ATOM OR ION'     UNX 
6 water                     HOH 
#