data_5E67
# 
_entry.id   5E67 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5E67         
WWPDB D_1000214424 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4LOX PDB . 
unspecified 5E5O PDB . 
unspecified 5E5P PDB . 
unspecified 5E5S PDB . 
unspecified 5E63 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5E67 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shen, B.W.'   1 
'Stoddard, B.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            428 
_citation.language                  ? 
_citation.page_first                206 
_citation.page_last                 220 
_citation.title                     
'The Structural Basis of Asymmetry in DNA Binding and Cleavage as Exhibited by the I-SmaMI LAGLIDADG Meganuclease.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2015.12.005 
_citation.pdbx_database_id_PubMed   26705195 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shen, B.W.'     1 ? 
primary 'Lambert, A.'    2 ? 
primary 'Walker, B.C.'   3 ? 
primary 'Stoddard, B.L.' 4 ? 
primary 'Kaiser, B.K.'   5 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5E67 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     60.518 
_cell.length_a_esd                 ? 
_cell.length_b                     67.326 
_cell.length_b_esd                 ? 
_cell.length_c                     98.572 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5E67 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'I-SmaMI LAGLIDADG meganuclease' 34036.438 1   ? 'K103A, L165N, K262A, M268Q' 'UNP residues 114-415' ? 
2 polymer     syn 'DNA bottom strand'              7691.988  1   ? ?                            ?                      ? 
3 polymer     syn 'DNA top strand'                 7664.945  1   ? ?                            ?                      ? 
4 non-polymer syn 'MAGNESIUM ION'                  24.305    2   ? ?                            ?                      ? 
5 non-polymer syn 2-METHOXYETHANOL                 76.094    1   ? ?                            ?                      ? 
6 non-polymer syn '2-(2-METHOXYETHOXY)ETHANOL'     120.147   1   ? ?                            ?                      ? 
7 water       nat water                            18.015    188 ? ?                            ?                      ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;SKGENSKLNPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVAIFSVTVDKKDLFLLESLKTFFGGLGSIKKSGNSTFSYRI
ESSEQLTKIILPFFDKYSLITEALGDYLLFKKVLELMGTKEHLTQRGLEKIVSLKASINKGLSEELQAAFPQCVPTPRPE
INNKNIPDPFWLAGFVSGDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSRGPWLYYTVT
NFSDIQGKIIPFFHQYKIIGSAYGDYQDWCKIALIMQNKNHLTPEGLNEIRALKGGMNKGRL
;
;SKGENSKLNPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVAIFSVTVDKKDLFLLESLKTFFGGLGSIKKSGNSTFSYRI
ESSEQLTKIILPFFDKYSLITEALGDYLLFKKVLELMGTKEHLTQRGLEKIVSLKASINKGLSEELQAAFPQCVPTPRPE
INNKNIPDPFWLAGFVSGDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSRGPWLYYTVT
NFSDIQGKIIPFFHQYKIIGSAYGDYQDWCKIALIMQNKNHLTPEGLNEIRALKGGMNKGRL
;
A ? 
2 polydeoxyribonucleotide no no 
;(DC)(DG)(DT)(DA)(DC)(DA)(DC)(DC)(DT)(DG)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DA)(DG)(DG)
(DA)(DT)(DA)(DC)(DC)
;
CGTACACCTGATAATGGAGGATACC B ? 
3 polydeoxyribonucleotide no no 
;(DG)(DG)(DT)(DA)(DT)(DC)(DC)(DT)(DC)(DC)(DA)(DT)(DT)(DA)(DT)(DC)(DA)(DG)(DG)(DT)
(DG)(DT)(DA)(DC)(DG)
;
GGTATCCTCCATTATCAGGTGTACG C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   GLY n 
1 4   GLU n 
1 5   ASN n 
1 6   SER n 
1 7   LYS n 
1 8   LEU n 
1 9   ASN n 
1 10  PRO n 
1 11  TRP n 
1 12  ALA n 
1 13  VAL n 
1 14  VAL n 
1 15  GLY n 
1 16  PHE n 
1 17  ILE n 
1 18  ASP n 
1 19  ALA n 
1 20  GLU n 
1 21  GLY n 
1 22  SER n 
1 23  PHE n 
1 24  MET n 
1 25  VAL n 
1 26  ARG n 
1 27  VAL n 
1 28  ARG n 
1 29  LYS n 
1 30  ASN n 
1 31  SER n 
1 32  LYS n 
1 33  TYR n 
1 34  LYS n 
1 35  THR n 
1 36  GLY n 
1 37  TRP n 
1 38  LEU n 
1 39  VAL n 
1 40  VAL n 
1 41  ALA n 
1 42  ILE n 
1 43  PHE n 
1 44  SER n 
1 45  VAL n 
1 46  THR n 
1 47  VAL n 
1 48  ASP n 
1 49  LYS n 
1 50  LYS n 
1 51  ASP n 
1 52  LEU n 
1 53  PHE n 
1 54  LEU n 
1 55  LEU n 
1 56  GLU n 
1 57  SER n 
1 58  LEU n 
1 59  LYS n 
1 60  THR n 
1 61  PHE n 
1 62  PHE n 
1 63  GLY n 
1 64  GLY n 
1 65  LEU n 
1 66  GLY n 
1 67  SER n 
1 68  ILE n 
1 69  LYS n 
1 70  LYS n 
1 71  SER n 
1 72  GLY n 
1 73  ASN n 
1 74  SER n 
1 75  THR n 
1 76  PHE n 
1 77  SER n 
1 78  TYR n 
1 79  ARG n 
1 80  ILE n 
1 81  GLU n 
1 82  SER n 
1 83  SER n 
1 84  GLU n 
1 85  GLN n 
1 86  LEU n 
1 87  THR n 
1 88  LYS n 
1 89  ILE n 
1 90  ILE n 
1 91  LEU n 
1 92  PRO n 
1 93  PHE n 
1 94  PHE n 
1 95  ASP n 
1 96  LYS n 
1 97  TYR n 
1 98  SER n 
1 99  LEU n 
1 100 ILE n 
1 101 THR n 
1 102 GLU n 
1 103 ALA n 
1 104 LEU n 
1 105 GLY n 
1 106 ASP n 
1 107 TYR n 
1 108 LEU n 
1 109 LEU n 
1 110 PHE n 
1 111 LYS n 
1 112 LYS n 
1 113 VAL n 
1 114 LEU n 
1 115 GLU n 
1 116 LEU n 
1 117 MET n 
1 118 GLY n 
1 119 THR n 
1 120 LYS n 
1 121 GLU n 
1 122 HIS n 
1 123 LEU n 
1 124 THR n 
1 125 GLN n 
1 126 ARG n 
1 127 GLY n 
1 128 LEU n 
1 129 GLU n 
1 130 LYS n 
1 131 ILE n 
1 132 VAL n 
1 133 SER n 
1 134 LEU n 
1 135 LYS n 
1 136 ALA n 
1 137 SER n 
1 138 ILE n 
1 139 ASN n 
1 140 LYS n 
1 141 GLY n 
1 142 LEU n 
1 143 SER n 
1 144 GLU n 
1 145 GLU n 
1 146 LEU n 
1 147 GLN n 
1 148 ALA n 
1 149 ALA n 
1 150 PHE n 
1 151 PRO n 
1 152 GLN n 
1 153 CYS n 
1 154 VAL n 
1 155 PRO n 
1 156 THR n 
1 157 PRO n 
1 158 ARG n 
1 159 PRO n 
1 160 GLU n 
1 161 ILE n 
1 162 ASN n 
1 163 ASN n 
1 164 LYS n 
1 165 ASN n 
1 166 ILE n 
1 167 PRO n 
1 168 ASP n 
1 169 PRO n 
1 170 PHE n 
1 171 TRP n 
1 172 LEU n 
1 173 ALA n 
1 174 GLY n 
1 175 PHE n 
1 176 VAL n 
1 177 SER n 
1 178 GLY n 
1 179 ASP n 
1 180 GLY n 
1 181 SER n 
1 182 PHE n 
1 183 LYS n 
1 184 SER n 
1 185 ILE n 
1 186 LEU n 
1 187 LYS n 
1 188 LYS n 
1 189 SER n 
1 190 GLU n 
1 191 SER n 
1 192 ILE n 
1 193 LYS n 
1 194 VAL n 
1 195 GLY n 
1 196 PHE n 
1 197 GLN n 
1 198 SER n 
1 199 ILE n 
1 200 LEU n 
1 201 VAL n 
1 202 PHE n 
1 203 GLN n 
1 204 ILE n 
1 205 THR n 
1 206 GLN n 
1 207 HIS n 
1 208 ALA n 
1 209 ARG n 
1 210 ASP n 
1 211 VAL n 
1 212 LYS n 
1 213 LEU n 
1 214 MET n 
1 215 GLU n 
1 216 SER n 
1 217 LEU n 
1 218 ILE n 
1 219 SER n 
1 220 TYR n 
1 221 LEU n 
1 222 GLY n 
1 223 CYS n 
1 224 GLY n 
1 225 PHE n 
1 226 ILE n 
1 227 GLU n 
1 228 LYS n 
1 229 ASP n 
1 230 SER n 
1 231 ARG n 
1 232 GLY n 
1 233 PRO n 
1 234 TRP n 
1 235 LEU n 
1 236 TYR n 
1 237 TYR n 
1 238 THR n 
1 239 VAL n 
1 240 THR n 
1 241 ASN n 
1 242 PHE n 
1 243 SER n 
1 244 ASP n 
1 245 ILE n 
1 246 GLN n 
1 247 GLY n 
1 248 LYS n 
1 249 ILE n 
1 250 ILE n 
1 251 PRO n 
1 252 PHE n 
1 253 PHE n 
1 254 HIS n 
1 255 GLN n 
1 256 TYR n 
1 257 LYS n 
1 258 ILE n 
1 259 ILE n 
1 260 GLY n 
1 261 SER n 
1 262 ALA n 
1 263 TYR n 
1 264 GLY n 
1 265 ASP n 
1 266 TYR n 
1 267 GLN n 
1 268 ASP n 
1 269 TRP n 
1 270 CYS n 
1 271 LYS n 
1 272 ILE n 
1 273 ALA n 
1 274 LEU n 
1 275 ILE n 
1 276 MET n 
1 277 GLN n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 HIS n 
1 282 LEU n 
1 283 THR n 
1 284 PRO n 
1 285 GLU n 
1 286 GLY n 
1 287 LEU n 
1 288 ASN n 
1 289 GLU n 
1 290 ILE n 
1 291 ARG n 
1 292 ALA n 
1 293 LEU n 
1 294 LYS n 
1 295 GLY n 
1 296 GLY n 
1 297 MET n 
1 298 ASN n 
1 299 LYS n 
1 300 GLY n 
1 301 ARG n 
1 302 LEU n 
2 1   DC  n 
2 2   DG  n 
2 3   DT  n 
2 4   DA  n 
2 5   DC  n 
2 6   DA  n 
2 7   DC  n 
2 8   DC  n 
2 9   DT  n 
2 10  DG  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
2 15  DT  n 
2 16  DG  n 
2 17  DG  n 
2 18  DA  n 
2 19  DG  n 
2 20  DG  n 
2 21  DA  n 
2 22  DT  n 
2 23  DA  n 
2 24  DC  n 
2 25  DC  n 
3 1   DG  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
3 5   DT  n 
3 6   DC  n 
3 7   DC  n 
3 8   DT  n 
3 9   DC  n 
3 10  DC  n 
3 11  DA  n 
3 12  DT  n 
3 13  DT  n 
3 14  DA  n 
3 15  DT  n 
3 16  DC  n 
3 17  DA  n 
3 18  DG  n 
3 19  DG  n 
3 20  DT  n 
3 21  DG  n 
3 22  DT  n 
3 23  DA  n 
3 24  DC  n 
3 25  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   302 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SMAC_12671 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC MYA-333 / DSM 997 / K(L3346) / K-hell' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     771870 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIL+' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET24d(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 25 'Synthetic construct' ? 32630 ? 
3 1 sample 1 25 'Synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP F7WD42_SORMK F7WD42 ? 1 
;SKGENSKLNPWAVVGFIDAEGSFMVRVRKNSKYKTGWLVVAIFSVTVDKKDLFLLESLKTFFGGLGSIKKSGNSTFSYRI
ESSEQLTKIILPFFDKYSLITEKLGDYLLFKKVLELMGTKEHLTQRGLEKIVSLKASINKGLSEELQAAFPQCVPTPRPE
INNKLIPDPFWLAGFVSGDGSFKSILKKSESIKVGFQSILVFQITQHARDVKLMESLISYLGCGFIEKDSRGPWLYYTVT
NFSDIQGKIIPFFHQYKIIGSKYGDYMDWCKIALIMQNKNHLTPEGLNEIRALKGGMNKGRL
;
114 
2 PDB 5E67         5E67   ? 2 ? 1   
3 PDB 5E67         5E67   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5E67 A 1 ? 302 ? F7WD42 114 ? 415 ? 1 302 
2 2 5E67 B 1 ? 25  ? 5E67   1   ? 25  ? 1 25  
3 3 5E67 C 1 ? 25  ? 5E67   1   ? 25  ? 1 25  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5E67 ALA A 103 ? UNP F7WD42 LYS 216 'engineered mutation' 103 1 
1 5E67 ASN A 165 ? UNP F7WD42 LEU 278 'engineered mutation' 165 2 
1 5E67 ALA A 262 ? UNP F7WD42 LYS 375 'engineered mutation' 262 3 
1 5E67 GLN A 267 ? UNP F7WD42 MET 380 'engineered mutation' 267 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?          'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?          'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?          'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?          'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?          'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?          'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?          'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?          'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ?          'Mg 2'            24.305  
MXE non-polymer         . 2-METHOXYETHANOL                     ?          'C3 H8 O2'        76.094  
PG0 non-polymer         . '2-(2-METHOXYETHOXY)ETHANOL'         'PEG 6000' 'C5 H12 O3'       120.147 
PHE 'L-peptide linking' y PHENYLALANINE                        ?          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?          'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?          'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5E67 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         39.49 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '28 - 32% PEGMME550, HEPES, Mg++' 
_exptl_crystal_grow.pdbx_pH_range   '7.5 - 8.0' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 70' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-04-15 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5E67 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 25.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19836 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       1 
_reflns.observed_criterion_sigma_I       1 
_reflns.percent_possible_obs             92 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.088 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.2 
_reflns_shell.d_res_low                   2.28 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        59.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.619 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.68 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            -0.66 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -0.02 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               34.571 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.913 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5E67 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.20 
_refine.ls_d_res_low                             25.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18593 
_refine.ls_number_reflns_R_free                  957 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.73 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.18276 
_refine.ls_R_factor_R_free                       0.25448 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.17909 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.376 
_refine.pdbx_overall_ESU_R_Free                  0.256 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             15.168 
_refine.overall_SU_ML                            0.189 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        2339 
_refine_hist.pdbx_number_atoms_nucleic_acid   1019 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             188 
_refine_hist.number_atoms_total               3561 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        25.0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.018  0.017  3563 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  2958 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 2.064  1.692  5011 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.304  3.000  6869 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.991  5.000  295  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 37.322 24.388 98   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.601 15.000 449  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.627 15.000 8    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.117  0.200  505  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.011  0.020  3255 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  792  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.379  2.034  1180 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.380  2.031  1179 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.303  3.048  1475 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.302  3.051  1476 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.506  2.219  2383 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.503  2.219  2383 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.460  3.271  3537 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.670  18.313 4422 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 4.670  18.321 4423 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             45 
_refine_ls_shell.number_reflns_R_work             861 
_refine_ls_shell.percent_reflns_obs               59.64 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.307 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.233 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5E67 
_struct.title                        'K103A/K262A double mutant of I-SmaMI' 
_struct.pdbx_descriptor              'I-SmaMI LAGLIDADG meganuclease/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5E67 
_struct_keywords.text            'LAGLIDADG, I-SmaMI, K103A/K262A, Hydrolase-DNA complex' 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 9   ? GLY A 21  ? ASN A 9   GLY A 21  1 ? 13 
HELX_P HELX_P2  AA2 ASP A 51  ? PHE A 62  ? ASP A 51  PHE A 62  1 ? 12 
HELX_P HELX_P3  AA3 SER A 82  ? ILE A 89  ? SER A 82  ILE A 89  1 ? 8  
HELX_P HELX_P4  AA4 ILE A 89  ? TYR A 97  ? ILE A 89  TYR A 97  1 ? 9  
HELX_P HELX_P5  AA5 GLU A 102 ? THR A 119 ? GLU A 102 THR A 119 1 ? 18 
HELX_P HELX_P6  AA6 LYS A 120 ? LEU A 123 ? LYS A 120 LEU A 123 5 ? 4  
HELX_P HELX_P7  AA7 THR A 124 ? ALA A 136 ? THR A 124 ALA A 136 1 ? 13 
HELX_P HELX_P8  AA8 SER A 143 ? PHE A 150 ? SER A 143 PHE A 150 1 ? 8  
HELX_P HELX_P9  AA9 ASP A 168 ? ASP A 179 ? ASP A 168 ASP A 179 1 ? 12 
HELX_P HELX_P10 AB1 ASP A 210 ? GLY A 222 ? ASP A 210 GLY A 222 1 ? 13 
HELX_P HELX_P11 AB2 ASN A 241 ? LYS A 248 ? ASN A 241 LYS A 248 1 ? 8  
HELX_P HELX_P12 AB3 LYS A 248 ? TYR A 256 ? LYS A 248 TYR A 256 1 ? 9  
HELX_P HELX_P13 AB4 SER A 261 ? ASN A 278 ? SER A 261 ASN A 278 1 ? 18 
HELX_P HELX_P14 AB5 LYS A 279 ? LEU A 282 ? LYS A 279 LEU A 282 5 ? 4  
HELX_P HELX_P15 AB6 THR A 283 ? GLY A 296 ? THR A 283 GLY A 296 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ALA 19  O   ? ? ? 1_555 D MG  .  MG ? ? A ALA 19  A MG  401 1_555 ? ? ? ? ? ? ?            2.154 ? 
metalc2  metalc ? ? A GLU 20  OE2 ? ? ? 1_555 E MG  .  MG ? ? A GLU 20  A MG  402 1_555 ? ? ? ? ? ? ?            2.392 ? 
metalc3  metalc ? ? A GLY 178 O   ? ? ? 1_555 E MG  .  MG ? ? A GLY 178 A MG  402 1_555 ? ? ? ? ? ? ?            2.862 ? 
metalc4  metalc ? ? A ASP 179 OD1 ? ? ? 1_555 D MG  .  MG ? ? A ASP 179 A MG  401 1_555 ? ? ? ? ? ? ?            2.167 ? 
metalc5  metalc ? ? A ASP 179 OD1 ? ? ? 1_555 E MG  .  MG ? ? A ASP 179 A MG  402 1_555 ? ? ? ? ? ? ?            2.557 ? 
metalc6  metalc ? ? C DC  16  OP1 ? ? ? 1_555 E MG  .  MG ? ? C DC  16  A MG  402 1_555 ? ? ? ? ? ? ?            2.831 ? 
metalc7  metalc ? ? C DC  16  OP2 ? ? ? 1_555 D MG  .  MG ? ? C DC  16  A MG  401 1_555 ? ? ? ? ? ? ?            2.605 ? 
metalc8  metalc ? ? D MG  .   MG  ? ? ? 1_555 H HOH .  O  ? ? A MG  401 A HOH 525 1_555 ? ? ? ? ? ? ?            2.082 ? 
metalc9  metalc ? ? E MG  .   MG  ? ? ? 1_555 J HOH .  O  ? ? A MG  402 C HOH 115 1_555 ? ? ? ? ? ? ?            2.421 ? 
metalc10 metalc ? ? E MG  .   MG  ? ? ? 1_555 I HOH .  O  ? ? A MG  402 B HOH 203 1_555 ? ? ? ? ? ? ?            2.838 ? 
hydrog1  hydrog ? ? B DC  1   N3  ? ? ? 1_555 C DG  25 N1 ? ? B DC  1   C DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4  ? ? ? 1_555 C DG  25 O6 ? ? B DC  1   C DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2  ? ? ? 1_555 C DG  25 N2 ? ? B DC  1   C DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1  ? ? ? 1_555 C DC  24 N3 ? ? B DG  2   C DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2  ? ? ? 1_555 C DC  24 O2 ? ? B DG  2   C DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6  ? ? ? 1_555 C DC  24 N4 ? ? B DG  2   C DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DT  3   N3  ? ? ? 1_555 C DA  23 N1 ? ? B DT  3   C DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DT  3   O4  ? ? ? 1_555 C DA  23 N6 ? ? B DT  3   C DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  4   N1  ? ? ? 1_555 C DT  22 N3 ? ? B DA  4   C DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  4   N6  ? ? ? 1_555 C DT  22 O4 ? ? B DA  4   C DT  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  5   N3  ? ? ? 1_555 C DG  21 N1 ? ? B DC  5   C DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  5   N4  ? ? ? 1_555 C DG  21 O6 ? ? B DC  5   C DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  5   O2  ? ? ? 1_555 C DG  21 N2 ? ? B DC  5   C DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  6   N1  ? ? ? 1_555 C DT  20 N3 ? ? B DA  6   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  6   N6  ? ? ? 1_555 C DT  20 O4 ? ? B DA  6   C DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  7   N3  ? ? ? 1_555 C DG  19 N1 ? ? B DC  7   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  7   N4  ? ? ? 1_555 C DG  19 O6 ? ? B DC  7   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  7   O2  ? ? ? 1_555 C DG  19 N2 ? ? B DC  7   C DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  8   N3  ? ? ? 1_555 C DG  18 N1 ? ? B DC  8   C DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  8   N4  ? ? ? 1_555 C DG  18 O6 ? ? B DC  8   C DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  8   O2  ? ? ? 1_555 C DG  18 N2 ? ? B DC  8   C DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  9   N3  ? ? ? 1_555 C DA  17 N1 ? ? B DT  9   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  9   O4  ? ? ? 1_555 C DA  17 N6 ? ? B DT  9   C DA  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC  16 N3 ? ? B DG  10  C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC  16 O2 ? ? B DG  10  C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC  16 N4 ? ? B DG  10  C DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  11  N1  ? ? ? 1_555 C DT  15 N3 ? ? B DA  11  C DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DA  11  N6  ? ? ? 1_555 C DT  15 O4 ? ? B DA  11  C DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DT  12  N3  ? ? ? 1_555 C DA  14 N1 ? ? B DT  12  C DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DT  12  O4  ? ? ? 1_555 C DA  14 N6 ? ? B DT  12  C DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DA  13  N1  ? ? ? 1_555 C DT  13 N3 ? ? B DA  13  C DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DA  13  N6  ? ? ? 1_555 C DT  13 O4 ? ? B DA  13  C DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DA  14  N1  ? ? ? 1_555 C DT  12 N3 ? ? B DA  14  C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DA  14  N6  ? ? ? 1_555 C DT  12 O4 ? ? B DA  14  C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DT  15  N3  ? ? ? 1_555 C DA  11 N1 ? ? B DT  15  C DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DT  15  O4  ? ? ? 1_555 C DA  11 N6 ? ? B DT  15  C DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? B DG  16  N1  ? ? ? 1_555 C DC  10 N3 ? ? B DG  16  C DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? B DG  16  N2  ? ? ? 1_555 C DC  10 O2 ? ? B DG  16  C DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? B DG  16  O6  ? ? ? 1_555 C DC  10 N4 ? ? B DG  16  C DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? B DG  17  N1  ? ? ? 1_555 C DC  9  N3 ? ? B DG  17  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? B DG  17  N2  ? ? ? 1_555 C DC  9  O2 ? ? B DG  17  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? B DG  17  O6  ? ? ? 1_555 C DC  9  N4 ? ? B DG  17  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? B DA  18  N1  ? ? ? 1_555 C DT  8  N3 ? ? B DA  18  C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? B DA  18  N6  ? ? ? 1_555 C DT  8  O4 ? ? B DA  18  C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? B DG  19  N1  ? ? ? 1_555 C DC  7  N3 ? ? B DG  19  C DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? B DG  19  N2  ? ? ? 1_555 C DC  7  O2 ? ? B DG  19  C DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? B DG  19  O6  ? ? ? 1_555 C DC  7  N4 ? ? B DG  19  C DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? B DG  20  N1  ? ? ? 1_555 C DC  6  N3 ? ? B DG  20  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? B DG  20  N2  ? ? ? 1_555 C DC  6  O2 ? ? B DG  20  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? B DG  20  O6  ? ? ? 1_555 C DC  6  N4 ? ? B DG  20  C DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? B DA  21  N1  ? ? ? 1_555 C DT  5  N3 ? ? B DA  21  C DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? B DA  21  N6  ? ? ? 1_555 C DT  5  O4 ? ? B DA  21  C DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? B DT  22  N3  ? ? ? 1_555 C DA  4  N1 ? ? B DT  22  C DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? B DT  22  O4  ? ? ? 1_555 C DA  4  N6 ? ? B DT  22  C DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? B DA  23  N1  ? ? ? 1_555 C DT  3  N3 ? ? B DA  23  C DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? B DA  23  N6  ? ? ? 1_555 C DT  3  O4 ? ? B DA  23  C DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? B DC  24  N3  ? ? ? 1_555 C DG  2  N1 ? ? B DC  24  C DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? B DC  24  N4  ? ? ? 1_555 C DG  2  O6 ? ? B DC  24  C DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? B DC  24  O2  ? ? ? 1_555 C DG  2  N2 ? ? B DC  24  C DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? B DC  25  N3  ? ? ? 1_555 C DG  1  N1 ? ? B DC  25  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? B DC  25  N4  ? ? ? 1_555 C DG  1  O6 ? ? B DC  25  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? B DC  25  O2  ? ? ? 1_555 C DG  1  N2 ? ? B DC  25  C DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 22  ? LYS A 29  ? SER A 22  LYS A 29  
AA1 2 TRP A 37  ? ASP A 48  ? TRP A 37  ASP A 48  
AA1 3 THR A 75  ? ILE A 80  ? THR A 75  ILE A 80  
AA1 4 SER A 67  ? LYS A 70  ? SER A 67  LYS A 70  
AA2 1 GLY A 180 ? LYS A 188 ? GLY A 180 LYS A 188 
AA2 2 PHE A 196 ? HIS A 207 ? PHE A 196 HIS A 207 
AA2 3 TRP A 234 ? VAL A 239 ? TRP A 234 VAL A 239 
AA2 4 PHE A 225 ? LYS A 228 ? PHE A 225 LYS A 228 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 28  ? N ARG A 28  O LEU A 38  ? O LEU A 38  
AA1 2 3 N VAL A 45  ? N VAL A 45  O TYR A 78  ? O TYR A 78  
AA1 3 4 O ARG A 79  ? O ARG A 79  N SER A 67  ? N SER A 67  
AA2 1 2 N LYS A 183 ? N LYS A 183 O VAL A 201 ? O VAL A 201 
AA2 2 3 N GLN A 206 ? N GLN A 206 O LEU A 235 ? O LEU A 235 
AA2 3 4 O TYR A 236 ? O TYR A 236 N GLU A 227 ? N GLU A 227 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  401 ? 6 'binding site for residue MG A 401'  
AC2 Software A MG  402 ? 7 'binding site for residue MG A 402'  
AC3 Software A MXE 403 ? 7 'binding site for residue MXE A 403' 
AC4 Software B PG0 101 ? 6 'binding site for residue PG0 B 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ALA A 19  ? ALA A 19  . ? 1_555 ? 
2  AC1 6 ASP A 179 ? ASP A 179 . ? 1_555 ? 
3  AC1 6 MG  E .   ? MG  A 402 . ? 1_555 ? 
4  AC1 6 HOH H .   ? HOH A 525 . ? 1_555 ? 
5  AC1 6 HOH I .   ? HOH B 203 . ? 1_555 ? 
6  AC1 6 DC  C 16  ? DC  C 16  . ? 1_555 ? 
7  AC2 7 GLU A 20  ? GLU A 20  . ? 1_555 ? 
8  AC2 7 GLY A 178 ? GLY A 178 . ? 1_555 ? 
9  AC2 7 ASP A 179 ? ASP A 179 . ? 1_555 ? 
10 AC2 7 MG  D .   ? MG  A 401 . ? 1_555 ? 
11 AC2 7 HOH I .   ? HOH B 203 . ? 1_555 ? 
12 AC2 7 DC  C 16  ? DC  C 16  . ? 1_555 ? 
13 AC2 7 HOH J .   ? HOH C 115 . ? 1_555 ? 
14 AC3 7 GLU A 20  ? GLU A 20  . ? 1_555 ? 
15 AC3 7 SER A 177 ? SER A 177 . ? 1_555 ? 
16 AC3 7 GLY A 178 ? GLY A 178 . ? 1_555 ? 
17 AC3 7 HOH H .   ? HOH A 518 . ? 1_555 ? 
18 AC3 7 DA  B 14  ? DA  B 14  . ? 1_555 ? 
19 AC3 7 DC  C 16  ? DC  C 16  . ? 1_555 ? 
20 AC3 7 DA  C 17  ? DA  C 17  . ? 1_555 ? 
21 AC4 6 LYS A 228 ? LYS A 228 . ? 3_544 ? 
22 AC4 6 DG  B 2   ? DG  B 2   . ? 1_555 ? 
23 AC4 6 DT  B 3   ? DT  B 3   . ? 1_555 ? 
24 AC4 6 HOH I .   ? HOH B 205 . ? 1_555 ? 
25 AC4 6 DC  C 24  ? DC  C 24  . ? 1_555 ? 
26 AC4 6 DG  C 25  ? DG  C 25  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5E67 
_atom_sites.fract_transf_matrix[1][1]   0.016524 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014853 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010145 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LYS A 1 7   ? 14.287  -11.687 11.091  1.00 56.60  ? 7   LYS A N     1 
ATOM   2    C  CA    . LYS A 1 7   ? 15.653  -11.691 10.495  1.00 54.16  ? 7   LYS A CA    1 
ATOM   3    C  C     . LYS A 1 7   ? 15.576  -11.213 9.048   1.00 50.36  ? 7   LYS A C     1 
ATOM   4    O  O     . LYS A 1 7   ? 15.662  -11.974 8.091   1.00 52.62  ? 7   LYS A O     1 
ATOM   5    C  CB    . LYS A 1 7   ? 16.321  -13.062 10.629  1.00 60.46  ? 7   LYS A CB    1 
ATOM   6    C  CG    . LYS A 1 7   ? 16.976  -13.249 12.002  1.00 66.77  ? 7   LYS A CG    1 
ATOM   7    C  CD    . LYS A 1 7   ? 17.424  -14.707 12.229  1.00 70.71  ? 7   LYS A CD    1 
ATOM   8    C  CE    . LYS A 1 7   ? 18.580  -14.837 13.215  1.00 74.20  ? 7   LYS A CE    1 
ATOM   9    N  NZ    . LYS A 1 7   ? 18.472  -13.974 14.437  1.00 77.51  ? 7   LYS A NZ    1 
ATOM   10   N  N     . LEU A 1 8   ? 15.378  -9.907  8.955   1.00 44.71  ? 8   LEU A N     1 
ATOM   11   C  CA    . LEU A 1 8   ? 15.297  -9.140  7.728   1.00 38.04  ? 8   LEU A CA    1 
ATOM   12   C  C     . LEU A 1 8   ? 16.663  -8.540  7.389   1.00 35.36  ? 8   LEU A C     1 
ATOM   13   O  O     . LEU A 1 8   ? 17.438  -8.213  8.239   1.00 40.70  ? 8   LEU A O     1 
ATOM   14   C  CB    . LEU A 1 8   ? 14.380  -7.965  7.953   1.00 33.67  ? 8   LEU A CB    1 
ATOM   15   C  CG    . LEU A 1 8   ? 12.942  -8.237  8.337   1.00 34.71  ? 8   LEU A CG    1 
ATOM   16   C  CD1   . LEU A 1 8   ? 12.275  -6.989  8.939   1.00 36.02  ? 8   LEU A CD1   1 
ATOM   17   C  CD2   . LEU A 1 8   ? 12.152  -8.668  7.132   1.00 33.15  ? 8   LEU A CD2   1 
ATOM   18   N  N     . ASN A 1 9   ? 16.884  -8.348  6.129   1.00 30.64  ? 9   ASN A N     1 
ATOM   19   C  CA    . ASN A 1 9   ? 18.115  -7.900  5.564   1.00 29.15  ? 9   ASN A CA    1 
ATOM   20   C  C     . ASN A 1 9   ? 17.828  -6.392  5.293   1.00 25.68  ? 9   ASN A C     1 
ATOM   21   O  O     . ASN A 1 9   ? 16.778  -6.081  4.814   1.00 23.80  ? 9   ASN A O     1 
ATOM   22   C  CB    . ASN A 1 9   ? 18.320  -8.694  4.236   1.00 28.53  ? 9   ASN A CB    1 
ATOM   23   C  CG    . ASN A 1 9   ? 19.329  -8.043  3.334   1.00 32.37  ? 9   ASN A CG    1 
ATOM   24   O  OD1   . ASN A 1 9   ? 19.089  -6.994  2.788   1.00 32.21  ? 9   ASN A OD1   1 
ATOM   25   N  ND2   . ASN A 1 9   ? 20.524  -8.645  3.223   1.00 38.05  ? 9   ASN A ND2   1 
ATOM   26   N  N     . PRO A 1 10  ? 18.787  -5.495  5.479   1.00 24.41  ? 10  PRO A N     1 
ATOM   27   C  CA    . PRO A 1 10  ? 18.539  -4.040  5.239   1.00 23.90  ? 10  PRO A CA    1 
ATOM   28   C  C     . PRO A 1 10  ? 17.921  -3.629  3.858   1.00 21.90  ? 10  PRO A C     1 
ATOM   29   O  O     . PRO A 1 10  ? 17.062  -2.762  3.767   1.00 20.62  ? 10  PRO A O     1 
ATOM   30   C  CB    . PRO A 1 10  ? 19.920  -3.402  5.405   1.00 24.92  ? 10  PRO A CB    1 
ATOM   31   C  CG    . PRO A 1 10  ? 20.768  -4.430  6.042   1.00 25.92  ? 10  PRO A CG    1 
ATOM   32   C  CD    . PRO A 1 10  ? 20.194  -5.789  5.798   1.00 25.69  ? 10  PRO A CD    1 
ATOM   33   N  N     . TRP A 1 11  ? 18.355  -4.272  2.810   1.00 20.96  ? 11  TRP A N     1 
ATOM   34   C  CA    . TRP A 1 11  ? 17.983  -3.869  1.492   1.00 20.06  ? 11  TRP A CA    1 
ATOM   35   C  C     . TRP A 1 11  ? 16.593  -4.404  1.210   1.00 18.92  ? 11  TRP A C     1 
ATOM   36   O  O     . TRP A 1 11  ? 15.809  -3.812  0.435   1.00 17.41  ? 11  TRP A O     1 
ATOM   37   C  CB    . TRP A 1 11  ? 18.994  -4.446  0.493   1.00 20.91  ? 11  TRP A CB    1 
ATOM   38   C  CG    . TRP A 1 11  ? 20.233  -3.608  0.348   1.00 21.79  ? 11  TRP A CG    1 
ATOM   39   C  CD1   . TRP A 1 11  ? 21.510  -3.983  0.514   1.00 22.05  ? 11  TRP A CD1   1 
ATOM   40   C  CD2   . TRP A 1 11  ? 20.262  -2.257  -0.053  1.00 21.75  ? 11  TRP A CD2   1 
ATOM   41   N  NE1   . TRP A 1 11  ? 22.321  -2.975  0.269   1.00 22.48  ? 11  TRP A NE1   1 
ATOM   42   C  CE2   . TRP A 1 11  ? 21.588  -1.878  -0.066  1.00 22.95  ? 11  TRP A CE2   1 
ATOM   43   C  CE3   . TRP A 1 11  ? 19.269  -1.311  -0.344  1.00 21.58  ? 11  TRP A CE3   1 
ATOM   44   C  CZ2   . TRP A 1 11  ? 21.987  -0.580  -0.376  1.00 23.81  ? 11  TRP A CZ2   1 
ATOM   45   C  CZ3   . TRP A 1 11  ? 19.652  -0.058  -0.662  1.00 22.16  ? 11  TRP A CZ3   1 
ATOM   46   C  CH2   . TRP A 1 11  ? 20.999  0.303   -0.690  1.00 22.94  ? 11  TRP A CH2   1 
ATOM   47   N  N     . ALA A 1 12  ? 16.285  -5.547  1.799   1.00 18.94  ? 12  ALA A N     1 
ATOM   48   C  CA    . ALA A 1 12  ? 14.884  -6.057  1.746   1.00 19.11  ? 12  ALA A CA    1 
ATOM   49   C  C     . ALA A 1 12  ? 13.914  -5.107  2.422   1.00 18.65  ? 12  ALA A C     1 
ATOM   50   O  O     . ALA A 1 12  ? 12.791  -4.901  1.914   1.00 18.84  ? 12  ALA A O     1 
ATOM   51   C  CB    . ALA A 1 12  ? 14.767  -7.486  2.299   1.00 19.95  ? 12  ALA A CB    1 
ATOM   52   N  N     . VAL A 1 13  ? 14.338  -4.475  3.523   1.00 18.35  ? 13  VAL A N     1 
ATOM   53   C  CA    . VAL A 1 13  ? 13.439  -3.570  4.261   1.00 17.88  ? 13  VAL A CA    1 
ATOM   54   C  C     . VAL A 1 13  ? 13.190  -2.347  3.361   1.00 18.03  ? 13  VAL A C     1 
ATOM   55   O  O     . VAL A 1 13  ? 12.037  -1.936  3.109   1.00 17.98  ? 13  VAL A O     1 
ATOM   56   C  CB    . VAL A 1 13  ? 14.028  -3.208  5.659   1.00 18.61  ? 13  VAL A CB    1 
ATOM   57   C  CG1   . VAL A 1 13  ? 13.336  -2.000  6.265   1.00 18.27  ? 13  VAL A CG1   1 
ATOM   58   C  CG2   . VAL A 1 13  ? 13.934  -4.409  6.655   1.00 19.04  ? 13  VAL A CG2   1 
ATOM   59   N  N     . VAL A 1 14  ? 14.250  -1.847  2.756   1.00 18.72  ? 14  VAL A N     1 
ATOM   60   C  CA    . VAL A 1 14  ? 14.124  -0.696  1.874   1.00 18.88  ? 14  VAL A CA    1 
ATOM   61   C  C     . VAL A 1 14  ? 13.199  -1.033  0.695   1.00 18.42  ? 14  VAL A C     1 
ATOM   62   O  O     . VAL A 1 14  ? 12.314  -0.239  0.312   1.00 18.10  ? 14  VAL A O     1 
ATOM   63   C  CB    . VAL A 1 14  ? 15.529  -0.234  1.301   1.00 20.06  ? 14  VAL A CB    1 
ATOM   64   C  CG1   . VAL A 1 14  ? 15.343  0.952   0.308   1.00 19.86  ? 14  VAL A CG1   1 
ATOM   65   C  CG2   . VAL A 1 14  ? 16.476  0.177   2.428   1.00 20.35  ? 14  VAL A CG2   1 
ATOM   66   N  N     . GLY A 1 15  ? 13.436  -2.189  0.085   1.00 18.54  ? 15  GLY A N     1 
ATOM   67   C  CA    . GLY A 1 15  ? 12.595  -2.637  -0.986  1.00 18.77  ? 15  GLY A CA    1 
ATOM   68   C  C     . GLY A 1 15  ? 11.121  -2.654  -0.545  1.00 19.36  ? 15  GLY A C     1 
ATOM   69   O  O     . GLY A 1 15  ? 10.241  -2.160  -1.237  1.00 18.79  ? 15  GLY A O     1 
ATOM   70   N  N     . PHE A 1 16  ? 10.854  -3.204  0.632   1.00 20.45  ? 16  PHE A N     1 
ATOM   71   C  CA    . PHE A 1 16  ? 9.451   -3.246  1.124   1.00 21.48  ? 16  PHE A CA    1 
ATOM   72   C  C     . PHE A 1 16  ? 8.780   -1.870  1.324   1.00 21.62  ? 16  PHE A C     1 
ATOM   73   O  O     . PHE A 1 16  ? 7.586   -1.610  0.934   1.00 20.09  ? 16  PHE A O     1 
ATOM   74   C  CB    . PHE A 1 16  ? 9.446   -4.068  2.372   1.00 22.81  ? 16  PHE A CB    1 
ATOM   75   C  CG    . PHE A 1 16  ? 8.112   -4.462  2.796   1.00 24.80  ? 16  PHE A CG    1 
ATOM   76   C  CD1   . PHE A 1 16  ? 7.373   -5.359  2.025   1.00 25.24  ? 16  PHE A CD1   1 
ATOM   77   C  CD2   . PHE A 1 16  ? 7.526   -3.860  3.923   1.00 25.37  ? 16  PHE A CD2   1 
ATOM   78   C  CE1   . PHE A 1 16  ? 6.083   -5.699  2.373   1.00 24.75  ? 16  PHE A CE1   1 
ATOM   79   C  CE2   . PHE A 1 16  ? 6.244   -4.223  4.279   1.00 26.59  ? 16  PHE A CE2   1 
ATOM   80   C  CZ    . PHE A 1 16  ? 5.525   -5.140  3.494   1.00 25.78  ? 16  PHE A CZ    1 
ATOM   81   N  N     . ILE A 1 17  ? 9.590   -0.948  1.830   1.00 22.98  ? 17  ILE A N     1 
ATOM   82   C  CA    . ILE A 1 17  ? 9.117   0.433   2.081   1.00 22.80  ? 17  ILE A CA    1 
ATOM   83   C  C     . ILE A 1 17  ? 9.005   1.197   0.788   1.00 22.48  ? 17  ILE A C     1 
ATOM   84   O  O     . ILE A 1 17  ? 8.070   1.965   0.580   1.00 22.98  ? 17  ILE A O     1 
ATOM   85   C  CB    . ILE A 1 17  ? 10.031  1.199   3.082   1.00 24.20  ? 17  ILE A CB    1 
ATOM   86   C  CG1   . ILE A 1 17  ? 10.051  0.479   4.404   1.00 23.75  ? 17  ILE A CG1   1 
ATOM   87   C  CG2   . ILE A 1 17  ? 9.595   2.680   3.186   1.00 24.90  ? 17  ILE A CG2   1 
ATOM   88   C  CD1   . ILE A 1 17  ? 8.631   0.259   4.935   1.00 24.72  ? 17  ILE A CD1   1 
ATOM   89   N  N     . ASP A 1 18  ? 9.888   0.946   -0.148  1.00 22.59  ? 18  ASP A N     1 
ATOM   90   C  CA    . ASP A 1 18  ? 9.601   1.393   -1.521  1.00 21.15  ? 18  ASP A CA    1 
ATOM   91   C  C     . ASP A 1 18  ? 8.198   0.933   -2.056  1.00 22.95  ? 18  ASP A C     1 
ATOM   92   O  O     . ASP A 1 18  ? 7.546   1.703   -2.802  1.00 26.50  ? 18  ASP A O     1 
ATOM   93   C  CB    . ASP A 1 18  ? 10.730  0.986   -2.444  1.00 19.80  ? 18  ASP A CB    1 
ATOM   94   C  CG    . ASP A 1 18  ? 11.696  2.111   -2.730  1.00 20.10  ? 18  ASP A CG    1 
ATOM   95   O  OD1   . ASP A 1 18  ? 11.289  3.262   -2.944  1.00 18.61  ? 18  ASP A OD1   1 
ATOM   96   O  OD2   . ASP A 1 18  ? 12.910  1.843   -2.842  1.00 20.63  ? 18  ASP A OD2   1 
ATOM   97   N  N     . ALA A 1 19  ? 7.724   -0.255  -1.653  1.00 22.21  ? 19  ALA A N     1 
ATOM   98   C  CA    . ALA A 1 19  ? 6.425   -0.755  -2.070  1.00 23.18  ? 19  ALA A CA    1 
ATOM   99   C  C     . ALA A 1 19  ? 5.190   -0.250  -1.246  1.00 25.08  ? 19  ALA A C     1 
ATOM   100  O  O     . ALA A 1 19  ? 4.136   0.120   -1.838  1.00 24.40  ? 19  ALA A O     1 
ATOM   101  C  CB    . ALA A 1 19  ? 6.452   -2.264  -2.156  1.00 22.11  ? 19  ALA A CB    1 
ATOM   102  N  N     . GLU A 1 20  ? 5.356   -0.240  0.064   1.00 26.54  ? 20  GLU A N     1 
ATOM   103  C  CA    . GLU A 1 20  ? 4.266   -0.091  1.052   1.00 29.81  ? 20  GLU A CA    1 
ATOM   104  C  C     . GLU A 1 20  ? 4.526   0.971   2.136   1.00 28.67  ? 20  GLU A C     1 
ATOM   105  O  O     . GLU A 1 20  ? 3.629   1.380   2.879   1.00 28.41  ? 20  GLU A O     1 
ATOM   106  C  CB    . GLU A 1 20  ? 4.212   -1.341  1.878   1.00 33.39  ? 20  GLU A CB    1 
ATOM   107  C  CG    . GLU A 1 20  ? 4.026   -2.624  1.147   1.00 37.87  ? 20  GLU A CG    1 
ATOM   108  C  CD    . GLU A 1 20  ? 2.616   -3.019  1.307   1.00 43.07  ? 20  GLU A CD    1 
ATOM   109  O  OE1   . GLU A 1 20  ? 2.268   -3.185  2.483   1.00 45.51  ? 20  GLU A OE1   1 
ATOM   110  O  OE2   . GLU A 1 20  ? 1.854   -3.026  0.311   1.00 50.69  ? 20  GLU A OE2   1 
ATOM   111  N  N     . GLY A 1 21  ? 5.729   1.426   2.339   1.00 28.17  ? 21  GLY A N     1 
ATOM   112  C  CA    . GLY A 1 21  ? 5.801   2.479   3.480   1.00 31.59  ? 21  GLY A CA    1 
ATOM   113  C  C     . GLY A 1 21  ? 4.946   3.776   3.296   1.00 32.65  ? 21  GLY A C     1 
ATOM   114  O  O     . GLY A 1 21  ? 4.664   4.173   2.149   1.00 31.74  ? 21  GLY A O     1 
ATOM   115  N  N     . SER A 1 22  ? 4.555   4.457   4.376   1.00 32.09  ? 22  SER A N     1 
ATOM   116  C  CA    . SER A 1 22  ? 4.068   5.833   4.284   1.00 31.20  ? 22  SER A CA    1 
ATOM   117  C  C     . SER A 1 22  ? 4.952   6.777   5.197   1.00 30.60  ? 22  SER A C     1 
ATOM   118  O  O     . SER A 1 22  ? 5.106   6.527   6.418   1.00 29.60  ? 22  SER A O     1 
ATOM   119  C  CB    . SER A 1 22  ? 2.604   5.812   4.703   1.00 33.69  ? 22  SER A CB    1 
ATOM   120  O  OG    . SER A 1 22  ? 1.688   6.642   4.009   1.00 34.91  ? 22  SER A OG    1 
ATOM   121  N  N     . PHE A 1 23  ? 5.503   7.858   4.598   1.00 28.04  ? 23  PHE A N     1 
ATOM   122  C  CA    . PHE A 1 23  ? 6.121   9.004   5.302   1.00 26.92  ? 23  PHE A CA    1 
ATOM   123  C  C     . PHE A 1 23  ? 5.138   10.149  5.460   1.00 27.67  ? 23  PHE A C     1 
ATOM   124  O  O     . PHE A 1 23  ? 4.782   10.793  4.462   1.00 31.05  ? 23  PHE A O     1 
ATOM   125  C  CB    . PHE A 1 23  ? 7.392   9.452   4.564   1.00 27.52  ? 23  PHE A CB    1 
ATOM   126  C  CG    . PHE A 1 23  ? 8.459   8.357   4.528   1.00 27.15  ? 23  PHE A CG    1 
ATOM   127  C  CD1   . PHE A 1 23  ? 9.213   8.080   5.646   1.00 26.41  ? 23  PHE A CD1   1 
ATOM   128  C  CD2   . PHE A 1 23  ? 8.602   7.546   3.419   1.00 26.56  ? 23  PHE A CD2   1 
ATOM   129  C  CE1   . PHE A 1 23  ? 10.137  7.057   5.634   1.00 26.85  ? 23  PHE A CE1   1 
ATOM   130  C  CE2   . PHE A 1 23  ? 9.484   6.507   3.407   1.00 25.67  ? 23  PHE A CE2   1 
ATOM   131  C  CZ    . PHE A 1 23  ? 10.287  6.260   4.499   1.00 25.86  ? 23  PHE A CZ    1 
ATOM   132  N  N     . MET A 1 24  ? 4.669   10.411  6.682   1.00 25.92  ? 24  MET A N     1 
ATOM   133  C  CA    . MET A 1 24  ? 3.620   11.413  6.880   1.00 26.69  ? 24  MET A CA    1 
ATOM   134  C  C     . MET A 1 24  ? 4.085   12.592  7.749   1.00 25.86  ? 24  MET A C     1 
ATOM   135  O  O     . MET A 1 24  ? 4.856   12.415  8.673   1.00 25.10  ? 24  MET A O     1 
ATOM   136  C  CB    . MET A 1 24  ? 2.361   10.791  7.512   1.00 27.43  ? 24  MET A CB    1 
ATOM   137  C  CG    . MET A 1 24  ? 1.561   9.814   6.624   1.00 28.48  ? 24  MET A CG    1 
ATOM   138  S  SD    . MET A 1 24  ? 0.154   9.114   7.553   1.00 30.77  ? 24  MET A SD    1 
ATOM   139  C  CE    . MET A 1 24  ? 1.181   7.926   8.419   1.00 29.53  ? 24  MET A CE    1 
ATOM   140  N  N     . VAL A 1 25  ? 3.576   13.781  7.426   1.00 25.47  ? 25  VAL A N     1 
ATOM   141  C  CA    . VAL A 1 25  ? 3.715   14.984  8.244   1.00 26.20  ? 25  VAL A CA    1 
ATOM   142  C  C     . VAL A 1 25  ? 2.316   15.507  8.479   1.00 27.53  ? 25  VAL A C     1 
ATOM   143  O  O     . VAL A 1 25  ? 1.589   15.765  7.521   1.00 31.62  ? 25  VAL A O     1 
ATOM   144  C  CB    . VAL A 1 25  ? 4.558   16.107  7.596   1.00 25.53  ? 25  VAL A CB    1 
ATOM   145  C  CG1   . VAL A 1 25  ? 4.581   17.330  8.458   1.00 25.75  ? 25  VAL A CG1   1 
ATOM   146  C  CG2   . VAL A 1 25  ? 6.001   15.636  7.343   1.00 24.46  ? 25  VAL A CG2   1 
ATOM   147  N  N     . ARG A 1 26  ? 1.931   15.604  9.729   1.00 26.92  ? 26  ARG A N     1 
ATOM   148  C  CA    . ARG A 1 26  ? 0.684   16.185  10.108  1.00 28.43  ? 26  ARG A CA    1 
ATOM   149  C  C     . ARG A 1 26  ? 0.911   17.545  10.818  1.00 28.63  ? 26  ARG A C     1 
ATOM   150  O  O     . ARG A 1 26  ? 1.840   17.708  11.621  1.00 27.05  ? 26  ARG A O     1 
ATOM   151  C  CB    . ARG A 1 26  ? -0.069  15.229  11.017  1.00 29.46  ? 26  ARG A CB    1 
ATOM   152  C  CG    . ARG A 1 26  ? -0.255  13.832  10.498  1.00 29.60  ? 26  ARG A CG    1 
ATOM   153  C  CD    . ARG A 1 26  ? -1.103  13.009  11.480  1.00 31.51  ? 26  ARG A CD    1 
ATOM   154  N  NE    . ARG A 1 26  ? -2.403  13.656  11.712  1.00 33.24  ? 26  ARG A NE    1 
ATOM   155  C  CZ    . ARG A 1 26  ? -3.201  13.454  12.779  1.00 35.56  ? 26  ARG A CZ    1 
ATOM   156  N  NH1   . ARG A 1 26  ? -2.914  12.564  13.708  1.00 34.28  ? 26  ARG A NH1   1 
ATOM   157  N  NH2   . ARG A 1 26  ? -4.331  14.152  12.902  1.00 37.69  ? 26  ARG A NH2   1 
ATOM   158  N  N     . VAL A 1 27  ? 0.103   18.528  10.420  1.00 29.85  ? 27  VAL A N     1 
ATOM   159  C  CA    . VAL A 1 27  ? 0.073   19.872  11.034  1.00 31.65  ? 27  VAL A CA    1 
ATOM   160  C  C     . VAL A 1 27  ? -1.363  20.083  11.598  1.00 33.89  ? 27  VAL A C     1 
ATOM   161  O  O     . VAL A 1 27  ? -2.311  20.272  10.836  1.00 36.24  ? 27  VAL A O     1 
ATOM   162  C  CB    . VAL A 1 27  ? 0.510   20.966  10.032  1.00 31.06  ? 27  VAL A CB    1 
ATOM   163  C  CG1   . VAL A 1 27  ? 0.473   22.363  10.664  1.00 32.27  ? 27  VAL A CG1   1 
ATOM   164  C  CG2   . VAL A 1 27  ? 1.900   20.685  9.541   1.00 30.17  ? 27  VAL A CG2   1 
ATOM   165  N  N     . ARG A 1 28  ? -1.522  20.000  12.912  1.00 34.98  ? 28  ARG A N     1 
ATOM   166  C  CA    . ARG A 1 28  ? -2.865  19.868  13.534  1.00 37.65  ? 28  ARG A CA    1 
ATOM   167  C  C     . ARG A 1 28  ? -3.186  21.140  14.263  1.00 39.40  ? 28  ARG A C     1 
ATOM   168  O  O     . ARG A 1 28  ? -2.311  21.681  14.949  1.00 38.39  ? 28  ARG A O     1 
ATOM   169  C  CB    . ARG A 1 28  ? -2.857  18.716  14.512  1.00 37.75  ? 28  ARG A CB    1 
ATOM   170  C  CG    . ARG A 1 28  ? -2.479  17.350  13.920  1.00 36.35  ? 28  ARG A CG    1 
ATOM   171  C  CD    . ARG A 1 28  ? -2.350  16.280  15.040  1.00 36.29  ? 28  ARG A CD    1 
ATOM   172  N  NE    . ARG A 1 28  ? -3.579  16.176  15.848  1.00 38.08  ? 28  ARG A NE    1 
ATOM   173  C  CZ    . ARG A 1 28  ? -3.844  15.340  16.864  1.00 38.08  ? 28  ARG A CZ    1 
ATOM   174  N  NH1   . ARG A 1 28  ? -2.980  14.416  17.282  1.00 36.32  ? 28  ARG A NH1   1 
ATOM   175  N  NH2   . ARG A 1 28  ? -5.046  15.430  17.462  1.00 39.74  ? 28  ARG A NH2   1 
ATOM   176  N  N     . LYS A 1 29  ? -4.386  21.692  14.096  1.00 42.93  ? 29  LYS A N     1 
ATOM   177  C  CA    . LYS A 1 29  ? -4.663  22.967  14.809  1.00 46.20  ? 29  LYS A CA    1 
ATOM   178  C  C     . LYS A 1 29  ? -4.865  22.682  16.302  1.00 46.58  ? 29  LYS A C     1 
ATOM   179  O  O     . LYS A 1 29  ? -5.614  21.748  16.675  1.00 45.70  ? 29  LYS A O     1 
ATOM   180  C  CB    . LYS A 1 29  ? -5.866  23.797  14.276  1.00 50.27  ? 29  LYS A CB    1 
ATOM   181  C  CG    . LYS A 1 29  ? -5.807  25.255  14.802  1.00 53.51  ? 29  LYS A CG    1 
ATOM   182  C  CD    . LYS A 1 29  ? -7.101  26.029  14.996  1.00 58.31  ? 29  LYS A CD    1 
ATOM   183  C  CE    . LYS A 1 29  ? -7.578  26.674  13.699  1.00 60.83  ? 29  LYS A CE    1 
ATOM   184  N  NZ    . LYS A 1 29  ? -7.966  25.590  12.739  1.00 61.53  ? 29  LYS A NZ    1 
ATOM   185  N  N     . ASN A 1 30  ? -4.212  23.506  17.130  1.00 46.50  ? 30  ASN A N     1 
ATOM   186  C  CA    . ASN A 1 30  ? -4.353  23.446  18.587  1.00 46.78  ? 30  ASN A CA    1 
ATOM   187  C  C     . ASN A 1 30  ? -3.803  24.726  19.268  1.00 45.79  ? 30  ASN A C     1 
ATOM   188  O  O     . ASN A 1 30  ? -2.609  25.022  19.196  1.00 43.88  ? 30  ASN A O     1 
ATOM   189  C  CB    . ASN A 1 30  ? -3.612  22.215  19.092  1.00 46.70  ? 30  ASN A CB    1 
ATOM   190  C  CG    . ASN A 1 30  ? -3.783  21.981  20.564  1.00 48.50  ? 30  ASN A CG    1 
ATOM   191  O  OD1   . ASN A 1 30  ? -4.003  22.894  21.374  1.00 51.09  ? 30  ASN A OD1   1 
ATOM   192  N  ND2   . ASN A 1 30  ? -3.660  20.734  20.935  1.00 50.21  ? 30  ASN A ND2   1 
ATOM   193  N  N     . SER A 1 31  ? -4.672  25.455  19.970  1.00 47.45  ? 31  SER A N     1 
ATOM   194  C  CA    . SER A 1 31  ? -4.310  26.785  20.489  1.00 47.43  ? 31  SER A CA    1 
ATOM   195  C  C     . SER A 1 31  ? -3.451  26.749  21.745  1.00 46.69  ? 31  SER A C     1 
ATOM   196  O  O     . SER A 1 31  ? -3.044  27.801  22.252  1.00 45.86  ? 31  SER A O     1 
ATOM   197  C  CB    . SER A 1 31  ? -5.552  27.611  20.707  1.00 49.11  ? 31  SER A CB    1 
ATOM   198  O  OG    . SER A 1 31  ? -6.500  26.820  21.348  1.00 50.07  ? 31  SER A OG    1 
ATOM   199  N  N     . LYS A 1 32  ? -3.144  25.549  22.225  1.00 46.48  ? 32  LYS A N     1 
ATOM   200  C  CA    . LYS A 1 32  ? -2.183  25.386  23.305  1.00 46.90  ? 32  LYS A CA    1 
ATOM   201  C  C     . LYS A 1 32  ? -0.727  25.552  22.885  1.00 45.07  ? 32  LYS A C     1 
ATOM   202  O  O     . LYS A 1 32  ? 0.137   25.835  23.737  1.00 42.73  ? 32  LYS A O     1 
ATOM   203  C  CB    . LYS A 1 32  ? -2.404  24.042  23.974  1.00 48.56  ? 32  LYS A CB    1 
ATOM   204  C  CG    . LYS A 1 32  ? -3.713  24.044  24.726  1.00 52.15  ? 32  LYS A CG    1 
ATOM   205  C  CD    . LYS A 1 32  ? -4.089  22.668  25.231  1.00 53.87  ? 32  LYS A CD    1 
ATOM   206  C  CE    . LYS A 1 32  ? -5.266  22.078  24.484  1.00 55.16  ? 32  LYS A CE    1 
ATOM   207  N  NZ    . LYS A 1 32  ? -6.275  21.654  25.497  1.00 57.52  ? 32  LYS A NZ    1 
ATOM   208  N  N     . TYR A 1 33  ? -0.465  25.425  21.575  1.00 44.76  ? 33  TYR A N     1 
ATOM   209  C  CA    . TYR A 1 33  ? 0.905   25.618  21.020  1.00 43.38  ? 33  TYR A CA    1 
ATOM   210  C  C     . TYR A 1 33  ? 0.950   27.077  20.691  1.00 43.60  ? 33  TYR A C     1 
ATOM   211  O  O     . TYR A 1 33  ? -0.063  27.631  20.315  1.00 43.71  ? 33  TYR A O     1 
ATOM   212  C  CB    . TYR A 1 33  ? 1.200   24.689  19.798  1.00 42.50  ? 33  TYR A CB    1 
ATOM   213  C  CG    . TYR A 1 33  ? 1.134   23.198  20.210  1.00 41.05  ? 33  TYR A CG    1 
ATOM   214  C  CD1   . TYR A 1 33  ? -0.091  22.590  20.436  1.00 41.83  ? 33  TYR A CD1   1 
ATOM   215  C  CD2   . TYR A 1 33  ? 2.280   22.427  20.445  1.00 39.85  ? 33  TYR A CD2   1 
ATOM   216  C  CE1   . TYR A 1 33  ? -0.198  21.288  20.868  1.00 40.68  ? 33  TYR A CE1   1 
ATOM   217  C  CE2   . TYR A 1 33  ? 2.160   21.082  20.853  1.00 39.40  ? 33  TYR A CE2   1 
ATOM   218  C  CZ    . TYR A 1 33  ? 0.910   20.541  21.088  1.00 39.83  ? 33  TYR A CZ    1 
ATOM   219  O  OH    . TYR A 1 33  ? 0.706   19.202  21.478  1.00 40.67  ? 33  TYR A OH    1 
ATOM   220  N  N     . LYS A 1 34  ? 2.099   27.711  20.911  1.00 43.98  ? 34  LYS A N     1 
ATOM   221  C  CA    . LYS A 1 34  ? 2.296   29.133  20.613  1.00 44.19  ? 34  LYS A CA    1 
ATOM   222  C  C     . LYS A 1 34  ? 1.971   29.566  19.203  1.00 42.65  ? 34  LYS A C     1 
ATOM   223  O  O     . LYS A 1 34  ? 1.487   30.628  19.026  1.00 43.64  ? 34  LYS A O     1 
ATOM   224  C  CB    . LYS A 1 34  ? 3.734   29.539  20.892  1.00 45.64  ? 34  LYS A CB    1 
ATOM   225  C  CG    . LYS A 1 34  ? 3.975   29.836  22.345  1.00 49.04  ? 34  LYS A CG    1 
ATOM   226  C  CD    . LYS A 1 34  ? 5.413   30.265  22.566  1.00 51.30  ? 34  LYS A CD    1 
ATOM   227  C  CE    . LYS A 1 34  ? 5.495   31.051  23.858  1.00 56.26  ? 34  LYS A CE    1 
ATOM   228  N  NZ    . LYS A 1 34  ? 4.871   30.326  25.029  1.00 58.74  ? 34  LYS A NZ    1 
ATOM   229  N  N     . THR A 1 35  ? 2.298   28.774  18.189  1.00 40.73  ? 35  THR A N     1 
ATOM   230  C  CA    . THR A 1 35  ? 1.962   29.078  16.775  1.00 39.62  ? 35  THR A CA    1 
ATOM   231  C  C     . THR A 1 35  ? 0.481   28.736  16.426  1.00 40.05  ? 35  THR A C     1 
ATOM   232  O  O     . THR A 1 35  ? 0.018   29.034  15.300  1.00 40.64  ? 35  THR A O     1 
ATOM   233  C  CB    . THR A 1 35  ? 2.807   28.208  15.798  1.00 38.15  ? 35  THR A CB    1 
ATOM   234  O  OG1   . THR A 1 35  ? 2.542   26.819  16.064  1.00 36.95  ? 35  THR A OG1   1 
ATOM   235  C  CG2   . THR A 1 35  ? 4.340   28.500  15.920  1.00 37.55  ? 35  THR A CG2   1 
ATOM   236  N  N     . GLY A 1 36  ? -0.215  28.017  17.311  1.00 38.41  ? 36  GLY A N     1 
ATOM   237  C  CA    . GLY A 1 36  ? -1.538  27.515  17.002  1.00 38.32  ? 36  GLY A CA    1 
ATOM   238  C  C     . GLY A 1 36  ? -1.590  26.169  16.330  1.00 36.32  ? 36  GLY A C     1 
ATOM   239  O  O     . GLY A 1 36  ? -2.668  25.635  16.039  1.00 35.91  ? 36  GLY A O     1 
ATOM   240  N  N     . TRP A 1 37  ? -0.429  25.591  16.094  1.00 35.09  ? 37  TRP A N     1 
ATOM   241  C  CA    . TRP A 1 37  ? -0.352  24.307  15.428  1.00 34.05  ? 37  TRP A CA    1 
ATOM   242  C  C     . TRP A 1 37  ? 0.671   23.389  16.062  1.00 33.16  ? 37  TRP A C     1 
ATOM   243  O  O     . TRP A 1 37  ? 1.756   23.825  16.417  1.00 34.27  ? 37  TRP A O     1 
ATOM   244  C  CB    . TRP A 1 37  ? -0.020  24.476  13.895  1.00 33.59  ? 37  TRP A CB    1 
ATOM   245  C  CG    . TRP A 1 37  ? -0.978  25.376  13.161  1.00 34.48  ? 37  TRP A CG    1 
ATOM   246  C  CD1   . TRP A 1 37  ? -0.963  26.690  13.186  1.00 35.76  ? 37  TRP A CD1   1 
ATOM   247  C  CD2   . TRP A 1 37  ? -2.087  25.000  12.368  1.00 35.30  ? 37  TRP A CD2   1 
ATOM   248  N  NE1   . TRP A 1 37  ? -2.012  27.207  12.490  1.00 37.36  ? 37  TRP A NE1   1 
ATOM   249  C  CE2   . TRP A 1 37  ? -2.735  26.187  11.975  1.00 37.41  ? 37  TRP A CE2   1 
ATOM   250  C  CE3   . TRP A 1 37  ? -2.628  23.792  11.983  1.00 34.66  ? 37  TRP A CE3   1 
ATOM   251  C  CZ2   . TRP A 1 37  ? -3.892  26.203  11.187  1.00 38.79  ? 37  TRP A CZ2   1 
ATOM   252  C  CZ3   . TRP A 1 37  ? -3.764  23.802  11.188  1.00 36.29  ? 37  TRP A CZ3   1 
ATOM   253  C  CH2   . TRP A 1 37  ? -4.382  24.998  10.796  1.00 38.06  ? 37  TRP A CH2   1 
ATOM   254  N  N     . LEU A 1 38  ? 0.295   22.113  16.069  1.00 32.36  ? 38  LEU A N     1 
ATOM   255  C  CA    . LEU A 1 38  ? 1.090   20.966  16.399  1.00 30.95  ? 38  LEU A CA    1 
ATOM   256  C  C     . LEU A 1 38  ? 1.562   20.237  15.122  1.00 29.52  ? 38  LEU A C     1 
ATOM   257  O  O     . LEU A 1 38  ? 0.764   19.927  14.241  1.00 28.81  ? 38  LEU A O     1 
ATOM   258  C  CB    . LEU A 1 38  ? 0.201   19.995  17.188  1.00 31.31  ? 38  LEU A CB    1 
ATOM   259  C  CG    . LEU A 1 38  ? 0.777   18.600  17.466  1.00 30.03  ? 38  LEU A CG    1 
ATOM   260  C  CD1   . LEU A 1 38  ? 2.161   18.654  18.038  1.00 28.87  ? 38  LEU A CD1   1 
ATOM   261  C  CD2   . LEU A 1 38  ? -0.154  17.812  18.390  1.00 31.32  ? 38  LEU A CD2   1 
ATOM   262  N  N     . VAL A 1 39  ? 2.868   19.988  15.051  1.00 28.96  ? 39  VAL A N     1 
ATOM   263  C  CA    . VAL A 1 39  ? 3.586   19.415  13.873  1.00 28.10  ? 39  VAL A CA    1 
ATOM   264  C  C     . VAL A 1 39  ? 4.043   18.058  14.352  1.00 27.62  ? 39  VAL A C     1 
ATOM   265  O  O     . VAL A 1 39  ? 4.640   18.003  15.396  1.00 26.81  ? 39  VAL A O     1 
ATOM   266  C  CB    . VAL A 1 39  ? 4.796   20.263  13.491  1.00 27.57  ? 39  VAL A CB    1 
ATOM   267  C  CG1   . VAL A 1 39  ? 5.653   19.584  12.440  1.00 27.44  ? 39  VAL A CG1   1 
ATOM   268  C  CG2   . VAL A 1 39  ? 4.326   21.623  13.031  1.00 29.33  ? 39  VAL A CG2   1 
ATOM   269  N  N     . VAL A 1 40  ? 3.742   17.001  13.595  1.00 27.61  ? 40  VAL A N     1 
ATOM   270  C  CA    . VAL A 1 40  ? 4.018   15.630  13.984  1.00 27.68  ? 40  VAL A CA    1 
ATOM   271  C  C     . VAL A 1 40  ? 4.490   14.933  12.681  1.00 27.05  ? 40  VAL A C     1 
ATOM   272  O  O     . VAL A 1 40  ? 3.946   15.149  11.594  1.00 25.36  ? 40  VAL A O     1 
ATOM   273  C  CB    . VAL A 1 40  ? 2.760   14.906  14.507  1.00 29.46  ? 40  VAL A CB    1 
ATOM   274  C  CG1   . VAL A 1 40  ? 3.033   13.439  14.738  1.00 30.78  ? 40  VAL A CG1   1 
ATOM   275  C  CG2   . VAL A 1 40  ? 2.271   15.485  15.811  1.00 31.07  ? 40  VAL A CG2   1 
ATOM   276  N  N     . ALA A 1 41  ? 5.558   14.145  12.822  1.00 26.47  ? 41  ALA A N     1 
ATOM   277  C  CA    . ALA A 1 41  ? 6.048   13.276  11.738  1.00 24.88  ? 41  ALA A CA    1 
ATOM   278  C  C     . ALA A 1 41  ? 5.845   11.815  12.113  1.00 23.53  ? 41  ALA A C     1 
ATOM   279  O  O     . ALA A 1 41  ? 6.093   11.414  13.256  1.00 22.11  ? 41  ALA A O     1 
ATOM   280  C  CB    . ALA A 1 41  ? 7.495   13.598  11.405  1.00 24.21  ? 41  ALA A CB    1 
ATOM   281  N  N     . ILE A 1 42  ? 5.360   11.033  11.140  1.00 23.25  ? 42  ILE A N     1 
ATOM   282  C  CA    . ILE A 1 42  ? 5.075   9.601   11.347  1.00 23.45  ? 42  ILE A CA    1 
ATOM   283  C  C     . ILE A 1 42  ? 5.657   8.717   10.234  1.00 23.32  ? 42  ILE A C     1 
ATOM   284  O  O     . ILE A 1 42  ? 5.473   9.024   9.037   1.00 23.89  ? 42  ILE A O     1 
ATOM   285  C  CB    . ILE A 1 42  ? 3.548   9.414   11.428  1.00 25.11  ? 42  ILE A CB    1 
ATOM   286  C  CG1   . ILE A 1 42  ? 2.948   10.317  12.509  1.00 25.72  ? 42  ILE A CG1   1 
ATOM   287  C  CG2   . ILE A 1 42  ? 3.099   7.964   11.639  1.00 24.46  ? 42  ILE A CG2   1 
ATOM   288  C  CD1   . ILE A 1 42  ? 1.666   10.839  12.032  1.00 27.28  ? 42  ILE A CD1   1 
ATOM   289  N  N     . PHE A 1 43  ? 6.373   7.641   10.602  1.00 22.30  ? 43  PHE A N     1 
ATOM   290  C  CA    . PHE A 1 43  ? 6.722   6.604   9.681   1.00 21.50  ? 43  PHE A CA    1 
ATOM   291  C  C     . PHE A 1 43  ? 5.719   5.493   9.914   1.00 21.38  ? 43  PHE A C     1 
ATOM   292  O  O     . PHE A 1 43  ? 5.499   5.124   11.062  1.00 22.13  ? 43  PHE A O     1 
ATOM   293  C  CB    . PHE A 1 43  ? 8.161   6.160   9.893   1.00 22.03  ? 43  PHE A CB    1 
ATOM   294  C  CG    . PHE A 1 43  ? 8.517   4.897   9.188   1.00 22.64  ? 43  PHE A CG    1 
ATOM   295  C  CD1   . PHE A 1 43  ? 8.728   4.878   7.806   1.00 22.94  ? 43  PHE A CD1   1 
ATOM   296  C  CD2   . PHE A 1 43  ? 8.641   3.705   9.886   1.00 23.78  ? 43  PHE A CD2   1 
ATOM   297  C  CE1   . PHE A 1 43  ? 9.043   3.700   7.157   1.00 22.74  ? 43  PHE A CE1   1 
ATOM   298  C  CE2   . PHE A 1 43  ? 8.991   2.528   9.226   1.00 23.85  ? 43  PHE A CE2   1 
ATOM   299  C  CZ    . PHE A 1 43  ? 9.210   2.542   7.866   1.00 22.86  ? 43  PHE A CZ    1 
ATOM   300  N  N     . SER A 1 44  ? 5.046   4.993   8.854   1.00 20.55  ? 44  SER A N     1 
ATOM   301  C  CA    . SER A 1 44  ? 3.878   4.046   9.041   1.00 20.98  ? 44  SER A CA    1 
ATOM   302  C  C     . SER A 1 44  ? 3.897   2.928   8.028   1.00 20.53  ? 44  SER A C     1 
ATOM   303  O  O     . SER A 1 44  ? 4.067   3.206   6.878   1.00 22.23  ? 44  SER A O     1 
ATOM   304  C  CB    . SER A 1 44  ? 2.540   4.781   8.876   1.00 21.30  ? 44  SER A CB    1 
ATOM   305  O  OG    . SER A 1 44  ? 1.421   3.927   9.190   1.00 23.02  ? 44  SER A OG    1 
ATOM   306  N  N     . VAL A 1 45  ? 3.671   1.706   8.426   1.00 20.21  ? 45  VAL A N     1 
ATOM   307  C  CA    . VAL A 1 45  ? 3.607   0.529   7.540   1.00 19.68  ? 45  VAL A CA    1 
ATOM   308  C  C     . VAL A 1 45  ? 2.298   -0.148  7.952   1.00 20.57  ? 45  VAL A C     1 
ATOM   309  O  O     . VAL A 1 45  ? 2.064   -0.363  9.146   1.00 20.79  ? 45  VAL A O     1 
ATOM   310  C  CB    . VAL A 1 45  ? 4.810   -0.416  7.745   1.00 19.40  ? 45  VAL A CB    1 
ATOM   311  C  CG1   . VAL A 1 45  ? 4.804   -1.554  6.795   1.00 19.69  ? 45  VAL A CG1   1 
ATOM   312  C  CG2   . VAL A 1 45  ? 6.119   0.277   7.479   1.00 19.79  ? 45  VAL A CG2   1 
ATOM   313  N  N     . THR A 1 46  ? 1.398   -0.380  7.013   1.00 20.77  ? 46  THR A N     1 
ATOM   314  C  CA    . THR A 1 46  ? 0.081   -0.913  7.324   1.00 22.41  ? 46  THR A CA    1 
ATOM   315  C  C     . THR A 1 46  ? -0.197  -2.133  6.419   1.00 23.78  ? 46  THR A C     1 
ATOM   316  O  O     . THR A 1 46  ? -0.096  -2.027  5.206   1.00 25.45  ? 46  THR A O     1 
ATOM   317  C  CB    . THR A 1 46  ? -1.034  0.162   7.163   1.00 22.67  ? 46  THR A CB    1 
ATOM   318  O  OG1   . THR A 1 46  ? -0.737  1.284   7.993   1.00 24.19  ? 46  THR A OG1   1 
ATOM   319  C  CG2   . THR A 1 46  ? -2.364  -0.330  7.581   1.00 23.18  ? 46  THR A CG2   1 
ATOM   320  N  N     . VAL A 1 47  ? -0.538  -3.276  7.023   1.00 25.16  ? 47  VAL A N     1 
ATOM   321  C  CA    . VAL A 1 47  ? -0.742  -4.547  6.343   1.00 23.91  ? 47  VAL A CA    1 
ATOM   322  C  C     . VAL A 1 47  ? -1.898  -5.276  6.984   1.00 25.65  ? 47  VAL A C     1 
ATOM   323  O  O     . VAL A 1 47  ? -2.284  -5.030  8.106   1.00 26.69  ? 47  VAL A O     1 
ATOM   324  C  CB    . VAL A 1 47  ? 0.460   -5.458  6.452   1.00 23.49  ? 47  VAL A CB    1 
ATOM   325  C  CG1   . VAL A 1 47  ? 1.684   -4.799  5.878   1.00 23.06  ? 47  VAL A CG1   1 
ATOM   326  C  CG2   . VAL A 1 47  ? 0.710   -5.898  7.893   1.00 24.44  ? 47  VAL A CG2   1 
ATOM   327  N  N     . ASP A 1 48  ? -2.436  -6.215  6.244   1.00 26.88  ? 48  ASP A N     1 
ATOM   328  C  CA    . ASP A 1 48  ? -3.393  -7.193  6.746   1.00 29.67  ? 48  ASP A CA    1 
ATOM   329  C  C     . ASP A 1 48  ? -2.767  -8.022  7.936   1.00 30.20  ? 48  ASP A C     1 
ATOM   330  O  O     . ASP A 1 48  ? -1.564  -8.329  7.972   1.00 28.58  ? 48  ASP A O     1 
ATOM   331  C  CB    . ASP A 1 48  ? -3.804  -8.123  5.542   1.00 29.84  ? 48  ASP A CB    1 
ATOM   332  C  CG    . ASP A 1 48  ? -4.933  -8.986  5.870   1.00 31.86  ? 48  ASP A CG    1 
ATOM   333  O  OD1   . ASP A 1 48  ? -6.110  -8.481  5.984   1.00 33.67  ? 48  ASP A OD1   1 
ATOM   334  O  OD2   . ASP A 1 48  ? -4.634  -10.162 6.061   1.00 31.65  ? 48  ASP A OD2   1 
ATOM   335  N  N     . LYS A 1 49  ? -3.615  -8.432  8.850   1.00 32.58  ? 49  LYS A N     1 
ATOM   336  C  CA    . LYS A 1 49  ? -3.184  -9.134  10.084  1.00 35.12  ? 49  LYS A CA    1 
ATOM   337  C  C     . LYS A 1 49  ? -2.428  -10.405 9.818   1.00 33.96  ? 49  LYS A C     1 
ATOM   338  O  O     . LYS A 1 49  ? -1.707  -10.882 10.683  1.00 31.91  ? 49  LYS A O     1 
ATOM   339  C  CB    . LYS A 1 49  ? -4.418  -9.468  10.968  1.00 39.38  ? 49  LYS A CB    1 
ATOM   340  C  CG    . LYS A 1 49  ? -5.390  -10.453 10.347  1.00 41.98  ? 49  LYS A CG    1 
ATOM   341  C  CD    . LYS A 1 49  ? -6.757  -9.839  10.270  1.00 46.86  ? 49  LYS A CD    1 
ATOM   342  C  CE    . LYS A 1 49  ? -7.456  -9.898  11.608  1.00 51.30  ? 49  LYS A CE    1 
ATOM   343  N  NZ    . LYS A 1 49  ? -8.011  -11.270 11.785  1.00 53.55  ? 49  LYS A NZ    1 
ATOM   344  N  N     . LYS A 1 50  ? -2.676  -10.975 8.636   1.00 33.30  ? 50  LYS A N     1 
ATOM   345  C  CA    . LYS A 1 50  ? -1.945  -12.116 8.112   1.00 34.99  ? 50  LYS A CA    1 
ATOM   346  C  C     . LYS A 1 50  ? -0.404  -11.844 8.145   1.00 32.82  ? 50  LYS A C     1 
ATOM   347  O  O     . LYS A 1 50  ? 0.396   -12.740 8.372   1.00 30.31  ? 50  LYS A O     1 
ATOM   348  C  CB    . LYS A 1 50  ? -2.491  -12.307 6.715   1.00 39.34  ? 50  LYS A CB    1 
ATOM   349  C  CG    . LYS A 1 50  ? -1.650  -12.924 5.640   1.00 43.41  ? 50  LYS A CG    1 
ATOM   350  C  CD    . LYS A 1 50  ? -1.988  -12.325 4.266   1.00 46.72  ? 50  LYS A CD    1 
ATOM   351  C  CE    . LYS A 1 50  ? -3.469  -12.459 3.897   1.00 51.39  ? 50  LYS A CE    1 
ATOM   352  N  NZ    . LYS A 1 50  ? -3.573  -12.500 2.393   1.00 56.06  ? 50  LYS A NZ    1 
ATOM   353  N  N     . ASP A 1 51  ? -0.021  -10.585 7.955   1.00 30.39  ? 51  ASP A N     1 
ATOM   354  C  CA    . ASP A 1 51  ? 1.385   -10.150 8.084   1.00 28.58  ? 51  ASP A CA    1 
ATOM   355  C  C     . ASP A 1 51  ? 1.778   -9.449  9.372   1.00 28.34  ? 51  ASP A C     1 
ATOM   356  O  O     . ASP A 1 51  ? 2.733   -8.710  9.460   1.00 28.40  ? 51  ASP A O     1 
ATOM   357  C  CB    . ASP A 1 51  ? 1.694   -9.258  6.938   1.00 26.63  ? 51  ASP A CB    1 
ATOM   358  C  CG    . ASP A 1 51  ? 1.971   -10.023 5.725   1.00 26.00  ? 51  ASP A CG    1 
ATOM   359  O  OD1   . ASP A 1 51  ? 2.750   -11.006 5.793   1.00 27.39  ? 51  ASP A OD1   1 
ATOM   360  O  OD2   . ASP A 1 51  ? 1.460   -9.624  4.715   1.00 24.64  ? 51  ASP A OD2   1 
ATOM   361  N  N     . LEU A 1 52  ? 1.047   -9.717  10.394  1.00 27.89  ? 52  LEU A N     1 
ATOM   362  C  CA    . LEU A 1 52  ? 1.403   -9.154  11.657  1.00 29.52  ? 52  LEU A CA    1 
ATOM   363  C  C     . LEU A 1 52  ? 2.825   -9.602  12.079  1.00 29.44  ? 52  LEU A C     1 
ATOM   364  O  O     . LEU A 1 52  ? 3.548   -8.814  12.609  1.00 29.05  ? 52  LEU A O     1 
ATOM   365  C  CB    . LEU A 1 52  ? 0.357   -9.549  12.648  1.00 29.49  ? 52  LEU A CB    1 
ATOM   366  C  CG    . LEU A 1 52  ? 0.119   -9.030  13.990  1.00 31.32  ? 52  LEU A CG    1 
ATOM   367  C  CD1   . LEU A 1 52  ? 0.254   -7.538  14.130  1.00 30.66  ? 52  LEU A CD1   1 
ATOM   368  C  CD2   . LEU A 1 52  ? -1.281  -9.492  14.376  1.00 32.33  ? 52  LEU A CD2   1 
ATOM   369  N  N     . PHE A 1 53  ? 3.242   -10.822 11.755  1.00 30.27  ? 53  PHE A N     1 
ATOM   370  C  CA    . PHE A 1 53  ? 4.536   -11.322 12.184  1.00 29.83  ? 53  PHE A CA    1 
ATOM   371  C  C     . PHE A 1 53  ? 5.659   -10.505 11.456  1.00 27.44  ? 53  PHE A C     1 
ATOM   372  O  O     . PHE A 1 53  ? 6.721   -10.305 12.018  1.00 25.87  ? 53  PHE A O     1 
ATOM   373  C  CB    . PHE A 1 53  ? 4.633   -12.857 12.038  1.00 32.01  ? 53  PHE A CB    1 
ATOM   374  C  CG    . PHE A 1 53  ? 4.845   -13.331 10.641  1.00 34.09  ? 53  PHE A CG    1 
ATOM   375  C  CD1   . PHE A 1 53  ? 6.164   -13.433 10.095  1.00 35.44  ? 53  PHE A CD1   1 
ATOM   376  C  CD2   . PHE A 1 53  ? 3.722   -13.646 9.781   1.00 38.52  ? 53  PHE A CD2   1 
ATOM   377  C  CE1   . PHE A 1 53  ? 6.354   -13.822 8.719   1.00 35.43  ? 53  PHE A CE1   1 
ATOM   378  C  CE2   . PHE A 1 53  ? 3.929   -14.104 8.419   1.00 38.28  ? 53  PHE A CE2   1 
ATOM   379  C  CZ    . PHE A 1 53  ? 5.244   -14.175 7.905   1.00 36.88  ? 53  PHE A CZ    1 
ATOM   380  N  N     . LEU A 1 54  ? 5.394   -10.005 10.240  1.00 25.65  ? 54  LEU A N     1 
ATOM   381  C  CA    . LEU A 1 54  ? 6.368   -9.180  9.536   1.00 24.40  ? 54  LEU A CA    1 
ATOM   382  C  C     . LEU A 1 54  ? 6.426   -7.808  10.152  1.00 23.40  ? 54  LEU A C     1 
ATOM   383  O  O     . LEU A 1 54  ? 7.499   -7.233  10.223  1.00 21.56  ? 54  LEU A O     1 
ATOM   384  C  CB    . LEU A 1 54  ? 6.057   -9.094  8.059   1.00 25.07  ? 54  LEU A CB    1 
ATOM   385  C  CG    . LEU A 1 54  ? 6.932   -8.125  7.196   1.00 25.49  ? 54  LEU A CG    1 
ATOM   386  C  CD1   . LEU A 1 54  ? 8.384   -8.650  7.137   1.00 27.18  ? 54  LEU A CD1   1 
ATOM   387  C  CD2   . LEU A 1 54  ? 6.334   -7.834  5.796   1.00 24.76  ? 54  LEU A CD2   1 
ATOM   388  N  N     . LEU A 1 55  ? 5.288   -7.276  10.635  1.00 24.05  ? 55  LEU A N     1 
ATOM   389  C  CA    . LEU A 1 55  ? 5.347   -6.030  11.404  1.00 23.99  ? 55  LEU A CA    1 
ATOM   390  C  C     . LEU A 1 55  ? 6.231   -6.202  12.684  1.00 24.79  ? 55  LEU A C     1 
ATOM   391  O  O     . LEU A 1 55  ? 7.043   -5.329  12.986  1.00 24.75  ? 55  LEU A O     1 
ATOM   392  C  CB    . LEU A 1 55  ? 3.989   -5.510  11.821  1.00 25.05  ? 55  LEU A CB    1 
ATOM   393  C  CG    . LEU A 1 55  ? 2.971   -5.142  10.764  1.00 25.24  ? 55  LEU A CG    1 
ATOM   394  C  CD1   . LEU A 1 55  ? 1.715   -4.562  11.449  1.00 25.94  ? 55  LEU A CD1   1 
ATOM   395  C  CD2   . LEU A 1 55  ? 3.563   -4.166  9.774   1.00 23.80  ? 55  LEU A CD2   1 
ATOM   396  N  N     . GLU A 1 56  ? 6.125   -7.319  13.357  1.00 24.49  ? 56  GLU A N     1 
ATOM   397  C  CA    . GLU A 1 56  ? 6.960   -7.583  14.530  1.00 26.16  ? 56  GLU A CA    1 
ATOM   398  C  C     . GLU A 1 56  ? 8.462   -7.659  14.248  1.00 25.26  ? 56  GLU A C     1 
ATOM   399  O  O     . GLU A 1 56  ? 9.258   -7.051  14.964  1.00 24.43  ? 56  GLU A O     1 
ATOM   400  C  CB    . GLU A 1 56  ? 6.463   -8.800  15.268  1.00 28.13  ? 56  GLU A CB    1 
ATOM   401  C  CG    . GLU A 1 56  ? 5.064   -8.514  15.797  1.00 29.86  ? 56  GLU A CG    1 
ATOM   402  C  CD    . GLU A 1 56  ? 4.408   -9.672  16.493  1.00 33.90  ? 56  GLU A CD    1 
ATOM   403  O  OE1   . GLU A 1 56  ? 4.432   -10.798 15.924  1.00 36.12  ? 56  GLU A OE1   1 
ATOM   404  O  OE2   . GLU A 1 56  ? 3.804   -9.444  17.583  1.00 36.93  ? 56  GLU A OE2   1 
ATOM   405  N  N     . SER A 1 57  ? 8.817   -8.331  13.152  1.00 24.21  ? 57  SER A N     1 
ATOM   406  C  CA    . SER A 1 57  ? 10.195  -8.329  12.631  1.00 24.52  ? 57  SER A CA    1 
ATOM   407  C  C     . SER A 1 57  ? 10.722  -6.940  12.342  1.00 22.29  ? 57  SER A C     1 
ATOM   408  O  O     . SER A 1 57  ? 11.819  -6.654  12.734  1.00 21.55  ? 57  SER A O     1 
ATOM   409  C  CB    . SER A 1 57  ? 10.310  -9.151  11.359  1.00 24.33  ? 57  SER A CB    1 
ATOM   410  O  OG    . SER A 1 57  ? 9.915   -10.445 11.682  1.00 27.65  ? 57  SER A OG    1 
ATOM   411  N  N     . LEU A 1 58  ? 9.909   -6.122  11.688  1.00 21.54  ? 58  LEU A N     1 
ATOM   412  C  CA    . LEU A 1 58  ? 10.235  -4.724  11.448  1.00 22.56  ? 58  LEU A CA    1 
ATOM   413  C  C     . LEU A 1 58  ? 10.497  -3.900  12.655  1.00 22.67  ? 58  LEU A C     1 
ATOM   414  O  O     . LEU A 1 58  ? 11.425  -3.073  12.659  1.00 23.48  ? 58  LEU A O     1 
ATOM   415  C  CB    . LEU A 1 58  ? 9.172   -4.026  10.595  1.00 23.76  ? 58  LEU A CB    1 
ATOM   416  C  CG    . LEU A 1 58  ? 9.144   -4.521  9.135   1.00 25.64  ? 58  LEU A CG    1 
ATOM   417  C  CD1   . LEU A 1 58  ? 7.867   -3.959  8.487   1.00 26.76  ? 58  LEU A CD1   1 
ATOM   418  C  CD2   . LEU A 1 58  ? 10.353  -3.978  8.368   1.00 25.89  ? 58  LEU A CD2   1 
ATOM   419  N  N     . LYS A 1 59  ? 9.692   -4.106  13.678  1.00 22.73  ? 59  LYS A N     1 
ATOM   420  C  CA    . LYS A 1 59  ? 9.905   -3.451  14.934  1.00 23.69  ? 59  LYS A CA    1 
ATOM   421  C  C     . LYS A 1 59  ? 11.237  -3.847  15.537  1.00 23.87  ? 59  LYS A C     1 
ATOM   422  O  O     . LYS A 1 59  ? 11.989  -3.032  16.015  1.00 22.17  ? 59  LYS A O     1 
ATOM   423  C  CB    . LYS A 1 59  ? 8.763   -3.752  15.888  1.00 25.06  ? 59  LYS A CB    1 
ATOM   424  C  CG    . LYS A 1 59  ? 8.873   -2.997  17.174  1.00 27.29  ? 59  LYS A CG    1 
ATOM   425  C  CD    . LYS A 1 59  ? 7.629   -3.147  18.026  1.00 29.37  ? 59  LYS A CD    1 
ATOM   426  C  CE    . LYS A 1 59  ? 7.985   -3.099  19.505  1.00 31.68  ? 59  LYS A CE    1 
ATOM   427  N  NZ    . LYS A 1 59  ? 7.158   -2.075  20.178  1.00 33.95  ? 59  LYS A NZ    1 
ATOM   428  N  N     . THR A 1 60  ? 11.482  -5.140  15.537  1.00 25.60  ? 60  THR A N     1 
ATOM   429  C  CA    . THR A 1 60  ? 12.752  -5.680  16.088  1.00 27.91  ? 60  THR A CA    1 
ATOM   430  C  C     . THR A 1 60  ? 13.955  -5.184  15.282  1.00 26.04  ? 60  THR A C     1 
ATOM   431  O  O     . THR A 1 60  ? 14.943  -4.706  15.832  1.00 23.99  ? 60  THR A O     1 
ATOM   432  C  CB    . THR A 1 60  ? 12.708  -7.217  16.131  1.00 30.08  ? 60  THR A CB    1 
ATOM   433  O  OG1   . THR A 1 60  ? 11.658  -7.599  17.016  1.00 32.38  ? 60  THR A OG1   1 
ATOM   434  C  CG2   . THR A 1 60  ? 14.016  -7.800  16.675  1.00 32.22  ? 60  THR A CG2   1 
ATOM   435  N  N     . PHE A 1 61  ? 13.792  -5.235  13.962  1.00 25.11  ? 61  PHE A N     1 
ATOM   436  C  CA    . PHE A 1 61  ? 14.787  -4.637  13.050  1.00 24.43  ? 61  PHE A CA    1 
ATOM   437  C  C     . PHE A 1 61  ? 15.120  -3.158  13.415  1.00 24.08  ? 61  PHE A C     1 
ATOM   438  O  O     . PHE A 1 61  ? 16.325  -2.786  13.496  1.00 22.64  ? 61  PHE A O     1 
ATOM   439  C  CB    . PHE A 1 61  ? 14.347  -4.801  11.583  1.00 23.28  ? 61  PHE A CB    1 
ATOM   440  C  CG    . PHE A 1 61  ? 15.356  -4.303  10.599  1.00 22.37  ? 61  PHE A CG    1 
ATOM   441  C  CD1   . PHE A 1 61  ? 16.321  -5.140  10.101  1.00 23.60  ? 61  PHE A CD1   1 
ATOM   442  C  CD2   . PHE A 1 61  ? 15.350  -3.007  10.192  1.00 22.01  ? 61  PHE A CD2   1 
ATOM   443  C  CE1   . PHE A 1 61  ? 17.282  -4.685  9.195   1.00 23.74  ? 61  PHE A CE1   1 
ATOM   444  C  CE2   . PHE A 1 61  ? 16.319  -2.515  9.308   1.00 22.27  ? 61  PHE A CE2   1 
ATOM   445  C  CZ    . PHE A 1 61  ? 17.273  -3.361  8.789   1.00 22.81  ? 61  PHE A CZ    1 
ATOM   446  N  N     . PHE A 1 62  ? 14.073  -2.358  13.680  1.00 24.42  ? 62  PHE A N     1 
ATOM   447  C  CA    . PHE A 1 62  ? 14.229  -0.938  14.065  1.00 24.93  ? 62  PHE A CA    1 
ATOM   448  C  C     . PHE A 1 62  ? 14.358  -0.662  15.531  1.00 26.36  ? 62  PHE A C     1 
ATOM   449  O  O     . PHE A 1 62  ? 13.773  0.306   16.061  1.00 26.41  ? 62  PHE A O     1 
ATOM   450  C  CB    . PHE A 1 62  ? 13.135  -0.048  13.487  1.00 24.49  ? 62  PHE A CB    1 
ATOM   451  C  CG    . PHE A 1 62  ? 13.278  0.178   12.040  1.00 24.71  ? 62  PHE A CG    1 
ATOM   452  C  CD1   . PHE A 1 62  ? 14.414  0.824   11.551  1.00 25.83  ? 62  PHE A CD1   1 
ATOM   453  C  CD2   . PHE A 1 62  ? 12.359  -0.341  11.161  1.00 24.48  ? 62  PHE A CD2   1 
ATOM   454  C  CE1   . PHE A 1 62  ? 14.606  0.948   10.205  1.00 25.34  ? 62  PHE A CE1   1 
ATOM   455  C  CE2   . PHE A 1 62  ? 12.527  -0.237  9.814   1.00 24.46  ? 62  PHE A CE2   1 
ATOM   456  C  CZ    . PHE A 1 62  ? 13.619  0.460   9.322   1.00 24.87  ? 62  PHE A CZ    1 
ATOM   457  N  N     . GLY A 1 63  ? 15.174  -1.467  16.163  1.00 27.98  ? 63  GLY A N     1 
ATOM   458  C  CA    . GLY A 1 63  ? 15.589  -1.260  17.532  1.00 30.27  ? 63  GLY A CA    1 
ATOM   459  C  C     . GLY A 1 63  ? 14.515  -1.490  18.583  1.00 32.02  ? 63  GLY A C     1 
ATOM   460  O  O     . GLY A 1 63  ? 14.675  -1.079  19.693  1.00 33.53  ? 63  GLY A O     1 
ATOM   461  N  N     . GLY A 1 64  ? 13.426  -2.176  18.258  1.00 33.20  ? 64  GLY A N     1 
ATOM   462  C  CA    . GLY A 1 64  ? 12.317  -2.341  19.187  1.00 32.22  ? 64  GLY A CA    1 
ATOM   463  C  C     . GLY A 1 64  ? 11.497  -1.099  19.308  1.00 31.18  ? 64  GLY A C     1 
ATOM   464  O  O     . GLY A 1 64  ? 10.627  -1.043  20.160  1.00 31.50  ? 64  GLY A O     1 
ATOM   465  N  N     . LEU A 1 65  ? 11.758  -0.085  18.483  1.00 30.03  ? 65  LEU A N     1 
ATOM   466  C  CA    . LEU A 1 65  ? 11.050  1.184   18.610  1.00 29.46  ? 65  LEU A CA    1 
ATOM   467  C  C     . LEU A 1 65  ? 9.721   1.158   17.916  1.00 27.56  ? 65  LEU A C     1 
ATOM   468  O  O     . LEU A 1 65  ? 9.503   0.429   16.994  1.00 26.80  ? 65  LEU A O     1 
ATOM   469  C  CB    . LEU A 1 65  ? 11.885  2.360   18.083  1.00 30.49  ? 65  LEU A CB    1 
ATOM   470  C  CG    . LEU A 1 65  ? 13.206  2.637   18.900  1.00 33.29  ? 65  LEU A CG    1 
ATOM   471  C  CD1   . LEU A 1 65  ? 14.027  3.741   18.229  1.00 34.18  ? 65  LEU A CD1   1 
ATOM   472  C  CD2   . LEU A 1 65  ? 13.030  2.978   20.384  1.00 34.64  ? 65  LEU A CD2   1 
ATOM   473  N  N     . GLY A 1 66  ? 8.808   1.973   18.409  1.00 27.71  ? 66  GLY A N     1 
ATOM   474  C  CA    . GLY A 1 66  ? 7.555   2.277   17.722  1.00 26.40  ? 66  GLY A CA    1 
ATOM   475  C  C     . GLY A 1 66  ? 6.529   1.321   18.223  1.00 27.41  ? 66  GLY A C     1 
ATOM   476  O  O     . GLY A 1 66  ? 6.807   0.606   19.174  1.00 27.96  ? 66  GLY A O     1 
ATOM   477  N  N     . SER A 1 67  ? 5.361   1.286   17.593  1.00 26.59  ? 67  SER A N     1 
ATOM   478  C  CA    . SER A 1 67  ? 4.365   0.304   18.030  1.00 28.62  ? 67  SER A CA    1 
ATOM   479  C  C     . SER A 1 67  ? 3.387   -0.137  16.962  1.00 27.34  ? 67  SER A C     1 
ATOM   480  O  O     . SER A 1 67  ? 3.200   0.520   15.913  1.00 25.96  ? 67  SER A O     1 
ATOM   481  C  CB    . SER A 1 67  ? 3.575   0.835   19.199  1.00 30.80  ? 67  SER A CB    1 
ATOM   482  O  OG    . SER A 1 67  ? 2.920   2.007   18.846  1.00 30.10  ? 67  SER A OG    1 
ATOM   483  N  N     . ILE A 1 68  ? 2.817   -1.271  17.266  1.00 27.04  ? 68  ILE A N     1 
ATOM   484  C  CA    . ILE A 1 68  ? 1.976   -2.014  16.352  1.00 27.37  ? 68  ILE A CA    1 
ATOM   485  C  C     . ILE A 1 68  ? 0.542   -2.013  16.932  1.00 28.78  ? 68  ILE A C     1 
ATOM   486  O  O     . ILE A 1 68  ? 0.335   -2.429  18.035  1.00 28.93  ? 68  ILE A O     1 
ATOM   487  C  CB    . ILE A 1 68  ? 2.474   -3.468  16.235  1.00 26.47  ? 68  ILE A CB    1 
ATOM   488  C  CG1   . ILE A 1 68  ? 3.928   -3.462  15.764  1.00 24.97  ? 68  ILE A CG1   1 
ATOM   489  C  CG2   . ILE A 1 68  ? 1.598   -4.264  15.273  1.00 26.34  ? 68  ILE A CG2   1 
ATOM   490  C  CD1   . ILE A 1 68  ? 4.493   -4.820  15.576  1.00 24.31  ? 68  ILE A CD1   1 
ATOM   491  N  N     . LYS A 1 69  ? -0.406  -1.540  16.151  1.00 29.89  ? 69  LYS A N     1 
ATOM   492  C  CA    . LYS A 1 69  ? -1.751  -1.260  16.611  1.00 32.85  ? 69  LYS A CA    1 
ATOM   493  C  C     . LYS A 1 69  ? -2.748  -1.677  15.575  1.00 32.81  ? 69  LYS A C     1 
ATOM   494  O  O     . LYS A 1 69  ? -2.492  -1.567  14.376  1.00 29.97  ? 69  LYS A O     1 
ATOM   495  C  CB    . LYS A 1 69  ? -1.935  0.236   16.849  1.00 33.77  ? 69  LYS A CB    1 
ATOM   496  C  CG    . LYS A 1 69  ? -1.361  0.741   18.173  1.00 36.05  ? 69  LYS A CG    1 
ATOM   497  C  CD    . LYS A 1 69  ? -1.972  0.020   19.372  1.00 39.29  ? 69  LYS A CD    1 
ATOM   498  C  CE    . LYS A 1 69  ? -0.976  -0.264  20.472  1.00 41.41  ? 69  LYS A CE    1 
ATOM   499  N  NZ    . LYS A 1 69  ? -0.221  0.999   20.775  1.00 41.87  ? 69  LYS A NZ    1 
ATOM   500  N  N     . LYS A 1 70  ? -3.919  -2.091  16.036  1.00 34.36  ? 70  LYS A N     1 
ATOM   501  C  CA    . LYS A 1 70  ? -5.028  -2.227  15.115  1.00 35.74  ? 70  LYS A CA    1 
ATOM   502  C  C     . LYS A 1 70  ? -5.228  -0.876  14.310  1.00 35.82  ? 70  LYS A C     1 
ATOM   503  O  O     . LYS A 1 70  ? -5.250  0.219   14.887  1.00 34.63  ? 70  LYS A O     1 
ATOM   504  C  CB    . LYS A 1 70  ? -6.276  -2.606  15.820  1.00 36.58  ? 70  LYS A CB    1 
ATOM   505  C  CG    . LYS A 1 70  ? -7.352  -2.982  14.887  1.00 37.73  ? 70  LYS A CG    1 
ATOM   506  C  CD    . LYS A 1 70  ? -8.708  -2.725  15.537  1.00 41.08  ? 70  LYS A CD    1 
ATOM   507  C  CE    . LYS A 1 70  ? -9.769  -3.614  14.890  1.00 43.07  ? 70  LYS A CE    1 
ATOM   508  N  NZ    . LYS A 1 70  ? -11.040 -2.866  14.766  1.00 45.56  ? 70  LYS A NZ    1 
ATOM   509  N  N     . SER A 1 71  ? -5.333  -1.011  12.982  1.00 35.63  ? 71  SER A N     1 
ATOM   510  C  CA    . SER A 1 71  ? -5.670  0.114   12.074  1.00 35.78  ? 71  SER A CA    1 
ATOM   511  C  C     . SER A 1 71  ? -7.145  0.017   11.601  1.00 37.54  ? 71  SER A C     1 
ATOM   512  O  O     . SER A 1 71  ? -7.949  0.783   12.040  1.00 38.42  ? 71  SER A O     1 
ATOM   513  C  CB    . SER A 1 71  ? -4.711  0.183   10.897  1.00 33.70  ? 71  SER A CB    1 
ATOM   514  O  OG    . SER A 1 71  ? -4.855  1.425   10.252  1.00 33.58  ? 71  SER A OG    1 
ATOM   515  N  N     . GLY A 1 72  ? -7.472  -0.926  10.731  1.00 38.97  ? 72  GLY A N     1 
ATOM   516  C  CA    . GLY A 1 72  ? -8.798  -1.085  10.258  1.00 41.78  ? 72  GLY A CA    1 
ATOM   517  C  C     . GLY A 1 72  ? -9.344  -2.378  10.814  1.00 45.06  ? 72  GLY A C     1 
ATOM   518  O  O     . GLY A 1 72  ? -8.789  -3.014  11.703  1.00 46.87  ? 72  GLY A O     1 
ATOM   519  N  N     . ASN A 1 73  ? -10.426 -2.781  10.204  1.00 47.30  ? 73  ASN A N     1 
ATOM   520  C  CA    . ASN A 1 73  ? -11.112 -3.991  10.520  1.00 51.11  ? 73  ASN A CA    1 
ATOM   521  C  C     . ASN A 1 73  ? -10.191 -5.198  10.556  1.00 48.09  ? 73  ASN A C     1 
ATOM   522  O  O     . ASN A 1 73  ? -10.260 -6.040  11.441  1.00 47.67  ? 73  ASN A O     1 
ATOM   523  C  CB    . ASN A 1 73  ? -12.178 -4.240  9.435   1.00 55.94  ? 73  ASN A CB    1 
ATOM   524  C  CG    . ASN A 1 73  ? -13.470 -4.751  10.015  1.00 61.77  ? 73  ASN A CG    1 
ATOM   525  O  OD1   . ASN A 1 73  ? -14.388 -3.958  10.291  1.00 71.97  ? 73  ASN A OD1   1 
ATOM   526  N  ND2   . ASN A 1 73  ? -13.552 -6.059  10.248  1.00 61.30  ? 73  ASN A ND2   1 
ATOM   527  N  N     . SER A 1 74  ? -9.337  -5.287  9.566   1.00 43.60  ? 74  SER A N     1 
ATOM   528  C  CA    . SER A 1 74  ? -8.441  -6.411  9.515   1.00 44.05  ? 74  SER A CA    1 
ATOM   529  C  C     . SER A 1 74  ? -6.972  -6.029  9.182   1.00 37.55  ? 74  SER A C     1 
ATOM   530  O  O     . SER A 1 74  ? -6.215  -6.861  8.751   1.00 35.82  ? 74  SER A O     1 
ATOM   531  C  CB    . SER A 1 74  ? -9.054  -7.355  8.488   1.00 47.47  ? 74  SER A CB    1 
ATOM   532  O  OG    . SER A 1 74  ? -9.530  -6.504  7.451   1.00 51.76  ? 74  SER A OG    1 
ATOM   533  N  N     . THR A 1 75  ? -6.594  -4.772  9.370   1.00 34.33  ? 75  THR A N     1 
ATOM   534  C  CA    . THR A 1 75  ? -5.186  -4.338  9.199   1.00 32.39  ? 75  THR A CA    1 
ATOM   535  C  C     . THR A 1 75  ? -4.619  -3.904  10.541  1.00 30.16  ? 75  THR A C     1 
ATOM   536  O  O     . THR A 1 75  ? -5.385  -3.687  11.549  1.00 33.53  ? 75  THR A O     1 
ATOM   537  C  CB    . THR A 1 75  ? -5.073  -3.211  8.187   1.00 32.11  ? 75  THR A CB    1 
ATOM   538  O  OG1   . THR A 1 75  ? -6.024  -2.187  8.529   1.00 36.80  ? 75  THR A OG1   1 
ATOM   539  C  CG2   . THR A 1 75  ? -5.451  -3.716  6.850   1.00 32.20  ? 75  THR A CG2   1 
ATOM   540  N  N     . PHE A 1 76  ? -3.310  -3.872  10.569  1.00 26.63  ? 76  PHE A N     1 
ATOM   541  C  CA    . PHE A 1 76  ? -2.508  -3.429  11.685  1.00 26.23  ? 76  PHE A CA    1 
ATOM   542  C  C     . PHE A 1 76  ? -1.432  -2.472  11.110  1.00 24.34  ? 76  PHE A C     1 
ATOM   543  O  O     . PHE A 1 76  ? -0.929  -2.687  10.022  1.00 23.28  ? 76  PHE A O     1 
ATOM   544  C  CB    . PHE A 1 76  ? -1.851  -4.655  12.398  1.00 26.84  ? 76  PHE A CB    1 
ATOM   545  C  CG    . PHE A 1 76  ? -2.749  -5.373  13.331  1.00 29.15  ? 76  PHE A CG    1 
ATOM   546  C  CD1   . PHE A 1 76  ? -3.689  -6.261  12.856  1.00 30.69  ? 76  PHE A CD1   1 
ATOM   547  C  CD2   . PHE A 1 76  ? -2.712  -5.116  14.708  1.00 30.81  ? 76  PHE A CD2   1 
ATOM   548  C  CE1   . PHE A 1 76  ? -4.570  -6.905  13.717  1.00 31.86  ? 76  PHE A CE1   1 
ATOM   549  C  CE2   . PHE A 1 76  ? -3.558  -5.787  15.572  1.00 32.71  ? 76  PHE A CE2   1 
ATOM   550  C  CZ    . PHE A 1 76  ? -4.520  -6.653  15.055  1.00 33.20  ? 76  PHE A CZ    1 
ATOM   551  N  N     . SER A 1 77  ? -1.091  -1.406  11.810  1.00 24.67  ? 77  SER A N     1 
ATOM   552  C  CA    . SER A 1 77  ? -0.029  -0.482  11.398  1.00 24.20  ? 77  SER A CA    1 
ATOM   553  C  C     . SER A 1 77  ? 1.142   -0.636  12.346  1.00 23.60  ? 77  SER A C     1 
ATOM   554  O  O     . SER A 1 77  ? 0.942   -0.814  13.527  1.00 25.57  ? 77  SER A O     1 
ATOM   555  C  CB    . SER A 1 77  ? -0.542  0.969   11.434  1.00 24.66  ? 77  SER A CB    1 
ATOM   556  O  OG    . SER A 1 77  ? -1.096  1.291   12.727  1.00 26.56  ? 77  SER A OG    1 
ATOM   557  N  N     . TYR A 1 78  ? 2.354   -0.606  11.832  1.00 22.64  ? 78  TYR A N     1 
ATOM   558  C  CA    . TYR A 1 78  ? 3.548   -0.340  12.643  1.00 22.75  ? 78  TYR A CA    1 
ATOM   559  C  C     . TYR A 1 78  ? 3.914   1.097   12.433  1.00 21.89  ? 78  TYR A C     1 
ATOM   560  O  O     . TYR A 1 78  ? 4.093   1.531   11.302  1.00 20.89  ? 78  TYR A O     1 
ATOM   561  C  CB    . TYR A 1 78  ? 4.709   -1.205  12.190  1.00 22.90  ? 78  TYR A CB    1 
ATOM   562  C  CG    . TYR A 1 78  ? 6.033   -0.836  12.806  1.00 23.72  ? 78  TYR A CG    1 
ATOM   563  C  CD1   . TYR A 1 78  ? 6.261   -0.941  14.208  1.00 24.67  ? 78  TYR A CD1   1 
ATOM   564  C  CD2   . TYR A 1 78  ? 7.085   -0.436  12.021  1.00 23.95  ? 78  TYR A CD2   1 
ATOM   565  C  CE1   . TYR A 1 78  ? 7.490   -0.590  14.772  1.00 24.81  ? 78  TYR A CE1   1 
ATOM   566  C  CE2   . TYR A 1 78  ? 8.332   -0.135  12.601  1.00 24.88  ? 78  TYR A CE2   1 
ATOM   567  C  CZ    . TYR A 1 78  ? 8.517   -0.208  13.971  1.00 24.28  ? 78  TYR A CZ    1 
ATOM   568  O  OH    . TYR A 1 78  ? 9.727   0.126   14.460  1.00 23.87  ? 78  TYR A OH    1 
ATOM   569  N  N     . ARG A 1 79  ? 4.041   1.848   13.511  1.00 22.80  ? 79  ARG A N     1 
ATOM   570  C  CA    . ARG A 1 79  ? 4.369   3.254   13.414  1.00 22.29  ? 79  ARG A CA    1 
ATOM   571  C  C     . ARG A 1 79  ? 5.409   3.735   14.397  1.00 22.22  ? 79  ARG A C     1 
ATOM   572  O  O     . ARG A 1 79  ? 5.510   3.247   15.494  1.00 22.12  ? 79  ARG A O     1 
ATOM   573  C  CB    . ARG A 1 79  ? 3.136   4.038   13.635  1.00 23.67  ? 79  ARG A CB    1 
ATOM   574  C  CG    . ARG A 1 79  ? 2.159   3.841   12.499  1.00 24.58  ? 79  ARG A CG    1 
ATOM   575  C  CD    . ARG A 1 79  ? 0.906   4.694   12.662  1.00 25.51  ? 79  ARG A CD    1 
ATOM   576  N  NE    . ARG A 1 79  ? 0.229   4.826   11.360  1.00 26.72  ? 79  ARG A NE    1 
ATOM   577  C  CZ    . ARG A 1 79  ? -0.907  5.495   11.181  1.00 29.19  ? 79  ARG A CZ    1 
ATOM   578  N  NH1   . ARG A 1 79  ? -1.509  6.075   12.220  1.00 30.40  ? 79  ARG A NH1   1 
ATOM   579  N  NH2   . ARG A 1 79  ? -1.472  5.566   9.990   1.00 30.47  ? 79  ARG A NH2   1 
ATOM   580  N  N     . ILE A 1 80  ? 6.142   4.727   13.952  1.00 21.72  ? 80  ILE A N     1 
ATOM   581  C  CA    . ILE A 1 80  ? 7.034   5.484   14.777  1.00 23.64  ? 80  ILE A CA    1 
ATOM   582  C  C     . ILE A 1 80  ? 6.572   6.947   14.661  1.00 23.78  ? 80  ILE A C     1 
ATOM   583  O  O     . ILE A 1 80  ? 6.570   7.487   13.538  1.00 24.45  ? 80  ILE A O     1 
ATOM   584  C  CB    . ILE A 1 80  ? 8.544   5.291   14.318  1.00 22.33  ? 80  ILE A CB    1 
ATOM   585  C  CG1   . ILE A 1 80  ? 8.952   3.811   14.390  1.00 21.79  ? 80  ILE A CG1   1 
ATOM   586  C  CG2   . ILE A 1 80  ? 9.489   6.090   15.185  1.00 22.98  ? 80  ILE A CG2   1 
ATOM   587  C  CD1   . ILE A 1 80  ? 10.393  3.562   13.966  1.00 21.60  ? 80  ILE A CD1   1 
ATOM   588  N  N     . GLU A 1 81  ? 6.156   7.545   15.777  1.00 25.64  ? 81  GLU A N     1 
ATOM   589  C  CA    . GLU A 1 81  ? 5.630   8.933   15.859  1.00 26.80  ? 81  GLU A CA    1 
ATOM   590  C  C     . GLU A 1 81  ? 6.517   9.846   16.672  1.00 26.49  ? 81  GLU A C     1 
ATOM   591  O  O     . GLU A 1 81  ? 6.268   11.027  16.737  1.00 26.46  ? 81  GLU A O     1 
ATOM   592  C  CB    . GLU A 1 81  ? 4.189   8.993   16.402  1.00 29.12  ? 81  GLU A CB    1 
ATOM   593  C  CG    . GLU A 1 81  ? 3.230   8.016   15.730  1.00 30.88  ? 81  GLU A CG    1 
ATOM   594  C  CD    . GLU A 1 81  ? 1.753   8.274   16.020  1.00 33.05  ? 81  GLU A CD    1 
ATOM   595  O  OE1   . GLU A 1 81  ? 1.241   9.358   15.921  1.00 34.95  ? 81  GLU A OE1   1 
ATOM   596  O  OE2   . GLU A 1 81  ? 1.021   7.362   16.359  1.00 38.50  ? 81  GLU A OE2   1 
ATOM   597  N  N     . SER A 1 82  ? 7.548   9.316   17.309  1.00 27.53  ? 82  SER A N     1 
ATOM   598  C  CA    . SER A 1 82  ? 8.529   10.138  18.039  1.00 28.13  ? 82  SER A CA    1 
ATOM   599  C  C     . SER A 1 82  ? 9.558   10.742  17.084  1.00 28.21  ? 82  SER A C     1 
ATOM   600  O  O     . SER A 1 82  ? 10.349  10.025  16.413  1.00 27.90  ? 82  SER A O     1 
ATOM   601  C  CB    . SER A 1 82  ? 9.285   9.337   19.113  1.00 27.84  ? 82  SER A CB    1 
ATOM   602  O  OG    . SER A 1 82  ? 10.274  10.194  19.675  1.00 28.35  ? 82  SER A OG    1 
ATOM   603  N  N     . SER A 1 83  ? 9.459   12.050  16.981  1.00 28.72  ? 83  SER A N     1 
ATOM   604  C  CA    . SER A 1 83  ? 10.410  12.932  16.318  1.00 30.20  ? 83  SER A CA    1 
ATOM   605  C  C     . SER A 1 83  ? 11.898  12.569  16.622  1.00 30.67  ? 83  SER A C     1 
ATOM   606  O  O     . SER A 1 83  ? 12.772  12.469  15.763  1.00 30.61  ? 83  SER A O     1 
ATOM   607  C  CB    . SER A 1 83  ? 10.081  14.296  16.908  1.00 32.28  ? 83  SER A CB    1 
ATOM   608  O  OG    . SER A 1 83  ? 10.641  15.302  16.208  1.00 36.56  ? 83  SER A OG    1 
ATOM   609  N  N     . GLU A 1 84  ? 12.151  12.360  17.889  1.00 30.40  ? 84  GLU A N     1 
ATOM   610  C  CA    . GLU A 1 84  ? 13.421  11.969  18.345  1.00 32.43  ? 84  GLU A CA    1 
ATOM   611  C  C     . GLU A 1 84  ? 13.854  10.599  17.870  1.00 30.58  ? 84  GLU A C     1 
ATOM   612  O  O     . GLU A 1 84  ? 14.906  10.458  17.383  1.00 30.61  ? 84  GLU A O     1 
ATOM   613  C  CB    . GLU A 1 84  ? 13.340  11.963  19.848  1.00 35.34  ? 84  GLU A CB    1 
ATOM   614  C  CG    . GLU A 1 84  ? 14.602  11.622  20.572  1.00 38.00  ? 84  GLU A CG    1 
ATOM   615  C  CD    . GLU A 1 84  ? 14.476  12.144  21.969  1.00 41.11  ? 84  GLU A CD    1 
ATOM   616  O  OE1   . GLU A 1 84  ? 14.271  13.366  22.129  1.00 44.03  ? 84  GLU A OE1   1 
ATOM   617  O  OE2   . GLU A 1 84  ? 14.478  11.345  22.896  1.00 43.07  ? 84  GLU A OE2   1 
ATOM   618  N  N     . GLN A 1 85  ? 13.015  9.600   18.042  1.00 31.90  ? 85  GLN A N     1 
ATOM   619  C  CA    . GLN A 1 85  ? 13.309  8.252   17.625  1.00 30.83  ? 85  GLN A CA    1 
ATOM   620  C  C     . GLN A 1 85  ? 13.468  8.157   16.088  1.00 28.40  ? 85  GLN A C     1 
ATOM   621  O  O     . GLN A 1 85  ? 14.263  7.377   15.601  1.00 29.04  ? 85  GLN A O     1 
ATOM   622  C  CB    . GLN A 1 85  ? 12.162  7.297   18.064  1.00 33.52  ? 85  GLN A CB    1 
ATOM   623  C  CG    . GLN A 1 85  ? 11.952  7.038   19.577  1.00 36.16  ? 85  GLN A CG    1 
ATOM   624  C  CD    . GLN A 1 85  ? 10.635  6.239   19.940  1.00 37.89  ? 85  GLN A CD    1 
ATOM   625  O  OE1   . GLN A 1 85  ? 10.239  6.209   21.113  1.00 44.69  ? 85  GLN A OE1   1 
ATOM   626  N  NE2   . GLN A 1 85  ? 9.945   5.650   18.968  1.00 36.48  ? 85  GLN A NE2   1 
ATOM   627  N  N     . LEU A 1 86  ? 12.662  8.897   15.347  1.00 25.46  ? 86  LEU A N     1 
ATOM   628  C  CA    . LEU A 1 86  ? 12.755  9.056   13.927  1.00 23.33  ? 86  LEU A CA    1 
ATOM   629  C  C     . LEU A 1 86  ? 14.079  9.609   13.509  1.00 23.80  ? 86  LEU A C     1 
ATOM   630  O  O     . LEU A 1 86  ? 14.677  9.107   12.578  1.00 23.76  ? 86  LEU A O     1 
ATOM   631  C  CB    . LEU A 1 86  ? 11.581  9.939   13.364  1.00 22.46  ? 86  LEU A CB    1 
ATOM   632  C  CG    . LEU A 1 86  ? 10.183  9.270   13.290  1.00 22.54  ? 86  LEU A CG    1 
ATOM   633  C  CD1   . LEU A 1 86  ? 9.066   10.226  12.965  1.00 22.47  ? 86  LEU A CD1   1 
ATOM   634  C  CD2   . LEU A 1 86  ? 10.134  8.117   12.292  1.00 21.32  ? 86  LEU A CD2   1 
ATOM   635  N  N     . THR A 1 87  ? 14.524  10.663  14.160  1.00 25.71  ? 87  THR A N     1 
ATOM   636  C  CA    . THR A 1 87  ? 15.826  11.250  13.865  1.00 27.78  ? 87  THR A CA    1 
ATOM   637  C  C     . THR A 1 87  ? 16.966  10.331  14.244  1.00 30.21  ? 87  THR A C     1 
ATOM   638  O  O     . THR A 1 87  ? 17.949  10.290  13.576  1.00 32.83  ? 87  THR A O     1 
ATOM   639  C  CB    . THR A 1 87  ? 15.997  12.602  14.535  1.00 28.71  ? 87  THR A CB    1 
ATOM   640  O  OG1   . THR A 1 87  ? 15.147  13.534  13.888  1.00 28.27  ? 87  THR A OG1   1 
ATOM   641  C  CG2   . THR A 1 87  ? 17.456  13.146  14.371  1.00 30.31  ? 87  THR A CG2   1 
ATOM   642  N  N     . LYS A 1 88  ? 16.811  9.542   15.276  1.00 33.20  ? 88  LYS A N     1 
ATOM   643  C  CA    . LYS A 1 88  ? 17.877  8.628   15.687  1.00 36.25  ? 88  LYS A CA    1 
ATOM   644  C  C     . LYS A 1 88  ? 17.968  7.294   14.951  1.00 34.15  ? 88  LYS A C     1 
ATOM   645  O  O     . LYS A 1 88  ? 19.049  6.781   14.728  1.00 34.50  ? 88  LYS A O     1 
ATOM   646  C  CB    . LYS A 1 88  ? 17.784  8.371   17.220  1.00 42.11  ? 88  LYS A CB    1 
ATOM   647  C  CG    . LYS A 1 88  ? 18.555  9.410   18.080  1.00 47.15  ? 88  LYS A CG    1 
ATOM   648  C  CD    . LYS A 1 88  ? 18.464  9.188   19.640  1.00 51.52  ? 88  LYS A CD    1 
ATOM   649  C  CE    . LYS A 1 88  ? 18.794  7.743   20.159  1.00 55.51  ? 88  LYS A CE    1 
ATOM   650  N  NZ    . LYS A 1 88  ? 19.377  7.703   21.564  1.00 54.87  ? 88  LYS A NZ    1 
ATOM   651  N  N     . ILE A 1 89  ? 16.847  6.699   14.596  1.00 32.77  ? 89  ILE A N     1 
ATOM   652  C  CA    . ILE A 1 89  ? 16.870  5.414   13.994  1.00 33.69  ? 89  ILE A CA    1 
ATOM   653  C  C     . ILE A 1 89  ? 16.480  5.446   12.498  1.00 30.30  ? 89  ILE A C     1 
ATOM   654  O  O     . ILE A 1 89  ? 17.175  4.870   11.723  1.00 31.22  ? 89  ILE A O     1 
ATOM   655  C  CB    . ILE A 1 89  ? 15.972  4.470   14.857  1.00 37.95  ? 89  ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 89  ? 16.575  4.309   16.308  1.00 43.55  ? 89  ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 89  ? 15.669  3.132   14.179  1.00 38.29  ? 89  ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 89  ? 18.097  4.176   16.543  1.00 44.12  ? 89  ILE A CD1   1 
ATOM   659  N  N     . ILE A 1 90  ? 15.380  6.096   12.107  1.00 26.60  ? 90  ILE A N     1 
ATOM   660  C  CA    . ILE A 1 90  ? 14.888  6.017   10.741  1.00 23.76  ? 90  ILE A CA    1 
ATOM   661  C  C     . ILE A 1 90  ? 15.766  6.784   9.737   1.00 23.08  ? 90  ILE A C     1 
ATOM   662  O  O     . ILE A 1 90  ? 16.169  6.236   8.745   1.00 22.78  ? 90  ILE A O     1 
ATOM   663  C  CB    . ILE A 1 90  ? 13.426  6.472   10.673  1.00 23.47  ? 90  ILE A CB    1 
ATOM   664  C  CG1   . ILE A 1 90  ? 12.539  5.529   11.477  1.00 23.86  ? 90  ILE A CG1   1 
ATOM   665  C  CG2   . ILE A 1 90  ? 12.916  6.543   9.252   1.00 22.53  ? 90  ILE A CG2   1 
ATOM   666  C  CD1   . ILE A 1 90  ? 12.554  4.065   11.052  1.00 23.30  ? 90  ILE A CD1   1 
ATOM   667  N  N     . LEU A 1 91  ? 16.086  8.027   10.020  1.00 22.59  ? 91  LEU A N     1 
ATOM   668  C  CA    . LEU A 1 91  ? 16.947  8.799   9.139   1.00 23.26  ? 91  LEU A CA    1 
ATOM   669  C  C     . LEU A 1 91  ? 18.309  8.193   8.817   1.00 23.59  ? 91  LEU A C     1 
ATOM   670  O  O     . LEU A 1 91  ? 18.700  8.186   7.656   1.00 22.63  ? 91  LEU A O     1 
ATOM   671  C  CB    . LEU A 1 91  ? 17.112  10.240  9.631   1.00 23.80  ? 91  LEU A CB    1 
ATOM   672  C  CG    . LEU A 1 91  ? 15.799  11.088  9.730   1.00 24.10  ? 91  LEU A CG    1 
ATOM   673  C  CD1   . LEU A 1 91  ? 16.137  12.567  9.996   1.00 25.01  ? 91  LEU A CD1   1 
ATOM   674  C  CD2   . LEU A 1 91  ? 14.969  11.023  8.469   1.00 23.66  ? 91  LEU A CD2   1 
ATOM   675  N  N     . PRO A 1 92  ? 19.041  7.677   9.832   1.00 24.53  ? 92  PRO A N     1 
ATOM   676  C  CA    . PRO A 1 92  ? 20.318  7.153   9.465   1.00 24.73  ? 92  PRO A CA    1 
ATOM   677  C  C     . PRO A 1 92  ? 20.201  5.861   8.732   1.00 23.60  ? 92  PRO A C     1 
ATOM   678  O  O     . PRO A 1 92  ? 21.090  5.506   7.945   1.00 23.59  ? 92  PRO A O     1 
ATOM   679  C  CB    . PRO A 1 92  ? 21.057  7.011   10.823  1.00 26.64  ? 92  PRO A CB    1 
ATOM   680  C  CG    . PRO A 1 92  ? 20.379  7.957   11.725  1.00 26.17  ? 92  PRO A CG    1 
ATOM   681  C  CD    . PRO A 1 92  ? 18.922  7.809   11.286  1.00 25.00  ? 92  PRO A CD    1 
ATOM   682  N  N     . PHE A 1 93  ? 19.104  5.147   8.938   1.00 22.46  ? 93  PHE A N     1 
ATOM   683  C  CA    . PHE A 1 93  ? 18.923  3.948   8.163   1.00 21.92  ? 93  PHE A CA    1 
ATOM   684  C  C     . PHE A 1 93  ? 18.757  4.290   6.645   1.00 21.33  ? 93  PHE A C     1 
ATOM   685  O  O     . PHE A 1 93  ? 19.556  3.857   5.824   1.00 21.72  ? 93  PHE A O     1 
ATOM   686  C  CB    . PHE A 1 93  ? 17.765  3.103   8.676   1.00 21.31  ? 93  PHE A CB    1 
ATOM   687  C  CG    . PHE A 1 93  ? 17.534  1.891   7.837   1.00 20.72  ? 93  PHE A CG    1 
ATOM   688  C  CD1   . PHE A 1 93  ? 18.440  0.855   7.841   1.00 21.13  ? 93  PHE A CD1   1 
ATOM   689  C  CD2   . PHE A 1 93  ? 16.469  1.826   6.965   1.00 20.23  ? 93  PHE A CD2   1 
ATOM   690  C  CE1   . PHE A 1 93  ? 18.259  -0.245  6.999   1.00 20.54  ? 93  PHE A CE1   1 
ATOM   691  C  CE2   . PHE A 1 93  ? 16.271  0.727   6.127   1.00 19.32  ? 93  PHE A CE2   1 
ATOM   692  C  CZ    . PHE A 1 93  ? 17.196  -0.294  6.142   1.00 20.17  ? 93  PHE A CZ    1 
ATOM   693  N  N     . PHE A 1 94  ? 17.779  5.107   6.323   1.00 20.91  ? 94  PHE A N     1 
ATOM   694  C  CA    . PHE A 1 94  ? 17.449  5.422   4.925   1.00 21.91  ? 94  PHE A CA    1 
ATOM   695  C  C     . PHE A 1 94  ? 18.417  6.383   4.300   1.00 22.21  ? 94  PHE A C     1 
ATOM   696  O  O     . PHE A 1 94  ? 18.436  6.521   3.076   1.00 22.13  ? 94  PHE A O     1 
ATOM   697  C  CB    . PHE A 1 94  ? 16.032  5.976   4.762   1.00 21.66  ? 94  PHE A CB    1 
ATOM   698  C  CG    . PHE A 1 94  ? 14.973  4.978   4.974   1.00 22.32  ? 94  PHE A CG    1 
ATOM   699  C  CD1   . PHE A 1 94  ? 14.728  3.987   4.005   1.00 23.22  ? 94  PHE A CD1   1 
ATOM   700  C  CD2   . PHE A 1 94  ? 14.184  5.018   6.129   1.00 22.57  ? 94  PHE A CD2   1 
ATOM   701  C  CE1   . PHE A 1 94  ? 13.751  3.027   4.229   1.00 22.81  ? 94  PHE A CE1   1 
ATOM   702  C  CE2   . PHE A 1 94  ? 13.220  4.080   6.356   1.00 22.77  ? 94  PHE A CE2   1 
ATOM   703  C  CZ    . PHE A 1 94  ? 13.000  3.070   5.401   1.00 23.47  ? 94  PHE A CZ    1 
ATOM   704  N  N     . ASP A 1 95  ? 19.178  7.095   5.103   1.00 22.85  ? 95  ASP A N     1 
ATOM   705  C  CA    . ASP A 1 95  ? 20.279  7.889   4.488   1.00 24.93  ? 95  ASP A CA    1 
ATOM   706  C  C     . ASP A 1 95  ? 21.379  6.951   4.038   1.00 25.59  ? 95  ASP A C     1 
ATOM   707  O  O     . ASP A 1 95  ? 22.089  7.277   3.101   1.00 26.34  ? 95  ASP A O     1 
ATOM   708  C  CB    . ASP A 1 95  ? 20.875  8.978   5.379   1.00 26.03  ? 95  ASP A CB    1 
ATOM   709  C  CG    . ASP A 1 95  ? 19.893  10.092  5.707   1.00 27.24  ? 95  ASP A CG    1 
ATOM   710  O  OD1   . ASP A 1 95  ? 18.755  10.190  5.145   1.00 29.93  ? 95  ASP A OD1   1 
ATOM   711  O  OD2   . ASP A 1 95  ? 20.190  10.835  6.631   1.00 27.96  ? 95  ASP A OD2   1 
ATOM   712  N  N     . LYS A 1 96  ? 21.540  5.805   4.687   1.00 25.34  ? 96  LYS A N     1 
ATOM   713  C  CA    . LYS A 1 96  ? 22.558  4.885   4.274   1.00 26.17  ? 96  LYS A CA    1 
ATOM   714  C  C     . LYS A 1 96  ? 22.042  3.883   3.211   1.00 25.61  ? 96  LYS A C     1 
ATOM   715  O  O     . LYS A 1 96  ? 22.795  3.448   2.317   1.00 26.16  ? 96  LYS A O     1 
ATOM   716  C  CB    . LYS A 1 96  ? 23.084  4.175   5.504   1.00 27.68  ? 96  LYS A CB    1 
ATOM   717  C  CG    . LYS A 1 96  ? 24.003  2.994   5.253   1.00 29.36  ? 96  LYS A CG    1 
ATOM   718  C  CD    . LYS A 1 96  ? 25.345  3.515   4.847   1.00 32.68  ? 96  LYS A CD    1 
ATOM   719  C  CE    . LYS A 1 96  ? 26.304  2.383   4.505   1.00 36.18  ? 96  LYS A CE    1 
ATOM   720  N  NZ    . LYS A 1 96  ? 27.654  3.036   4.299   1.00 37.82  ? 96  LYS A NZ    1 
ATOM   721  N  N     . TYR A 1 97  ? 20.773  3.502   3.296   1.00 24.45  ? 97  TYR A N     1 
ATOM   722  C  CA    . TYR A 1 97  ? 20.184  2.509   2.401   1.00 22.96  ? 97  TYR A CA    1 
ATOM   723  C  C     . TYR A 1 97  ? 18.967  3.171   1.779   1.00 23.01  ? 97  TYR A C     1 
ATOM   724  O  O     . TYR A 1 97  ? 17.860  3.097   2.291   1.00 21.68  ? 97  TYR A O     1 
ATOM   725  C  CB    . TYR A 1 97  ? 19.843  1.209   3.163   1.00 22.10  ? 97  TYR A CB    1 
ATOM   726  C  CG    . TYR A 1 97  ? 20.992  0.573   3.954   1.00 22.10  ? 97  TYR A CG    1 
ATOM   727  C  CD1   . TYR A 1 97  ? 21.915  -0.275  3.356   1.00 22.60  ? 97  TYR A CD1   1 
ATOM   728  C  CD2   . TYR A 1 97  ? 21.136  0.816   5.304   1.00 22.64  ? 97  TYR A CD2   1 
ATOM   729  C  CE1   . TYR A 1 97  ? 22.955  -0.824  4.093   1.00 23.21  ? 97  TYR A CE1   1 
ATOM   730  C  CE2   . TYR A 1 97  ? 22.200  0.297   6.044   1.00 23.38  ? 97  TYR A CE2   1 
ATOM   731  C  CZ    . TYR A 1 97  ? 23.101  -0.539  5.436   1.00 23.57  ? 97  TYR A CZ    1 
ATOM   732  O  OH    . TYR A 1 97  ? 24.109  -1.073  6.190   1.00 24.55  ? 97  TYR A OH    1 
ATOM   733  N  N     . SER A 1 98  ? 19.223  3.876   0.670   1.00 24.92  ? 98  SER A N     1 
ATOM   734  C  CA    . SER A 1 98  ? 18.246  4.779   0.031   1.00 24.64  ? 98  SER A CA    1 
ATOM   735  C  C     . SER A 1 98  ? 17.207  4.086   -0.849  1.00 23.03  ? 98  SER A C     1 
ATOM   736  O  O     . SER A 1 98  ? 17.536  3.217   -1.636  1.00 20.71  ? 98  SER A O     1 
ATOM   737  C  CB    . SER A 1 98  ? 18.899  5.901   -0.755  1.00 26.34  ? 98  SER A CB    1 
ATOM   738  O  OG    . SER A 1 98  ? 19.150  6.963   0.182   1.00 30.29  ? 98  SER A OG    1 
ATOM   739  N  N     . LEU A 1 99  ? 15.966  4.544   -0.636  1.00 21.41  ? 99  LEU A N     1 
ATOM   740  C  CA    . LEU A 1 99  ? 14.818  4.288   -1.442  1.00 21.68  ? 99  LEU A CA    1 
ATOM   741  C  C     . LEU A 1 99  ? 15.087  4.663   -2.904  1.00 22.27  ? 99  LEU A C     1 
ATOM   742  O  O     . LEU A 1 99  ? 15.938  5.542   -3.192  1.00 22.76  ? 99  LEU A O     1 
ATOM   743  C  CB    . LEU A 1 99  ? 13.702  5.159   -0.870  1.00 22.94  ? 99  LEU A CB    1 
ATOM   744  C  CG    . LEU A 1 99  ? 13.186  4.719   0.526   1.00 22.93  ? 99  LEU A CG    1 
ATOM   745  C  CD1   . LEU A 1 99  ? 12.369  5.845   1.127   1.00 23.20  ? 99  LEU A CD1   1 
ATOM   746  C  CD2   . LEU A 1 99  ? 12.323  3.445   0.379   1.00 22.55  ? 99  LEU A CD2   1 
ATOM   747  N  N     . ILE A 1 100 ? 14.450  3.965   -3.831  1.00 21.47  ? 100 ILE A N     1 
ATOM   748  C  CA    . ILE A 1 100 ? 14.669  4.266   -5.267  1.00 22.61  ? 100 ILE A CA    1 
ATOM   749  C  C     . ILE A 1 100 ? 13.424  4.639   -6.056  1.00 22.21  ? 100 ILE A C     1 
ATOM   750  O  O     . ILE A 1 100 ? 13.553  5.152   -7.156  1.00 20.81  ? 100 ILE A O     1 
ATOM   751  C  CB    . ILE A 1 100 ? 15.516  3.213   -5.975  1.00 22.98  ? 100 ILE A CB    1 
ATOM   752  C  CG1   . ILE A 1 100 ? 14.780  1.891   -6.028  1.00 23.06  ? 100 ILE A CG1   1 
ATOM   753  C  CG2   . ILE A 1 100 ? 16.916  3.123   -5.283  1.00 23.26  ? 100 ILE A CG2   1 
ATOM   754  C  CD1   . ILE A 1 100 ? 15.279  0.974   -7.126  1.00 23.60  ? 100 ILE A CD1   1 
ATOM   755  N  N     . THR A 1 101 ? 12.226  4.449   -5.464  1.00 21.55  ? 101 THR A N     1 
ATOM   756  C  CA    . THR A 1 101 ? 11.056  4.851   -6.198  1.00 22.86  ? 101 THR A CA    1 
ATOM   757  C  C     . THR A 1 101 ? 10.815  6.370   -5.924  1.00 24.96  ? 101 THR A C     1 
ATOM   758  O  O     . THR A 1 101 ? 11.569  7.029   -5.192  1.00 24.39  ? 101 THR A O     1 
ATOM   759  C  CB    . THR A 1 101 ? 9.828   3.982   -5.869  1.00 21.32  ? 101 THR A CB    1 
ATOM   760  O  OG1   . THR A 1 101 ? 9.326   4.303   -4.575  1.00 21.08  ? 101 THR A OG1   1 
ATOM   761  C  CG2   . THR A 1 101 ? 10.121  2.483   -5.948  1.00 20.99  ? 101 THR A CG2   1 
ATOM   762  N  N     . GLU A 1 102 ? 9.713   6.899   -6.434  1.00 27.70  ? 102 GLU A N     1 
ATOM   763  C  CA    . GLU A 1 102 ? 9.227   8.214   -5.997  1.00 28.85  ? 102 GLU A CA    1 
ATOM   764  C  C     . GLU A 1 102 ? 8.963   8.336   -4.490  1.00 25.34  ? 102 GLU A C     1 
ATOM   765  O  O     . GLU A 1 102 ? 8.883   9.421   -3.969  1.00 24.59  ? 102 GLU A O     1 
ATOM   766  C  CB    . GLU A 1 102 ? 7.919   8.522   -6.670  1.00 32.89  ? 102 GLU A CB    1 
ATOM   767  C  CG    . GLU A 1 102 ? 8.007   8.948   -8.090  1.00 36.99  ? 102 GLU A CG    1 
ATOM   768  C  CD    . GLU A 1 102 ? 8.850   10.150  -8.324  1.00 39.88  ? 102 GLU A CD    1 
ATOM   769  O  OE1   . GLU A 1 102 ? 8.757   11.129  -7.543  1.00 43.46  ? 102 GLU A OE1   1 
ATOM   770  O  OE2   . GLU A 1 102 ? 9.612   10.055  -9.295  1.00 42.39  ? 102 GLU A OE2   1 
ATOM   771  N  N     . ALA A 1 103 ? 8.800   7.246   -3.778  1.00 22.60  ? 103 ALA A N     1 
ATOM   772  C  CA    . ALA A 1 103 ? 8.748   7.333   -2.319  1.00 21.23  ? 103 ALA A CA    1 
ATOM   773  C  C     . ALA A 1 103 ? 9.982   8.084   -1.790  1.00 21.95  ? 103 ALA A C     1 
ATOM   774  O  O     . ALA A 1 103 ? 9.924   8.726   -0.778  1.00 21.67  ? 103 ALA A O     1 
ATOM   775  C  CB    . ALA A 1 103 ? 8.708   5.952   -1.709  1.00 19.72  ? 103 ALA A CB    1 
ATOM   776  N  N     . LEU A 1 104 ? 11.121  8.025   -2.496  1.00 22.80  ? 104 LEU A N     1 
ATOM   777  C  CA    . LEU A 1 104 ? 12.327  8.678   -2.057  1.00 22.22  ? 104 LEU A CA    1 
ATOM   778  C  C     . LEU A 1 104 ? 12.011  10.178  -1.949  1.00 23.25  ? 104 LEU A C     1 
ATOM   779  O  O     . LEU A 1 104 ? 12.539  10.864  -1.061  1.00 23.63  ? 104 LEU A O     1 
ATOM   780  C  CB    . LEU A 1 104 ? 13.506  8.418   -3.031  1.00 22.82  ? 104 LEU A CB    1 
ATOM   781  C  CG    . LEU A 1 104 ? 14.780  9.224   -2.719  1.00 24.38  ? 104 LEU A CG    1 
ATOM   782  C  CD1   . LEU A 1 104 ? 15.381  8.767   -1.372  1.00 23.83  ? 104 LEU A CD1   1 
ATOM   783  C  CD2   . LEU A 1 104 ? 15.785  9.066   -3.847  1.00 25.87  ? 104 LEU A CD2   1 
ATOM   784  N  N     . GLY A 1 105 ? 11.180  10.715  -2.837  1.00 22.66  ? 105 GLY A N     1 
ATOM   785  C  CA    . GLY A 1 105 ? 10.937  12.136  -2.791  1.00 23.24  ? 105 GLY A CA    1 
ATOM   786  C  C     . GLY A 1 105 ? 10.218  12.557  -1.512  1.00 23.49  ? 105 GLY A C     1 
ATOM   787  O  O     . GLY A 1 105 ? 10.467  13.627  -0.943  1.00 23.13  ? 105 GLY A O     1 
ATOM   788  N  N     . ASP A 1 106 ? 9.272   11.741  -1.123  1.00 23.40  ? 106 ASP A N     1 
ATOM   789  C  CA    . ASP A 1 106 ? 8.476   11.944  0.086   1.00 24.14  ? 106 ASP A CA    1 
ATOM   790  C  C     . ASP A 1 106 ? 9.407   11.809  1.286   1.00 22.40  ? 106 ASP A C     1 
ATOM   791  O  O     . ASP A 1 106 ? 9.335   12.623  2.171   1.00 22.40  ? 106 ASP A O     1 
ATOM   792  C  CB    . ASP A 1 106 ? 7.334   10.873  0.180   1.00 24.16  ? 106 ASP A CB    1 
ATOM   793  C  CG    . ASP A 1 106 ? 6.308   11.004  -0.971  1.00 27.07  ? 106 ASP A CG    1 
ATOM   794  O  OD1   . ASP A 1 106 ? 5.708   12.094  -1.125  1.00 27.65  ? 106 ASP A OD1   1 
ATOM   795  O  OD2   . ASP A 1 106 ? 6.130   10.036  -1.763  1.00 30.42  ? 106 ASP A OD2   1 
ATOM   796  N  N     . TYR A 1 107 ? 10.237  10.748  1.322   1.00 21.58  ? 107 TYR A N     1 
ATOM   797  C  CA    . TYR A 1 107 ? 11.269  10.569  2.363   1.00 20.26  ? 107 TYR A CA    1 
ATOM   798  C  C     . TYR A 1 107 ? 12.134  11.819  2.444   1.00 21.37  ? 107 TYR A C     1 
ATOM   799  O  O     . TYR A 1 107 ? 12.296  12.374  3.522   1.00 22.17  ? 107 TYR A O     1 
ATOM   800  C  CB    . TYR A 1 107 ? 12.122  9.381   2.168   1.00 19.63  ? 107 TYR A CB    1 
ATOM   801  C  CG    . TYR A 1 107 ? 13.304  9.400   3.129   1.00 19.94  ? 107 TYR A CG    1 
ATOM   802  C  CD1   . TYR A 1 107 ? 13.142  9.041   4.513   1.00 19.75  ? 107 TYR A CD1   1 
ATOM   803  C  CD2   . TYR A 1 107 ? 14.584  9.764   2.706   1.00 19.38  ? 107 TYR A CD2   1 
ATOM   804  C  CE1   . TYR A 1 107 ? 14.222  9.110   5.420   1.00 19.58  ? 107 TYR A CE1   1 
ATOM   805  C  CE2   . TYR A 1 107 ? 15.643  9.811   3.618   1.00 20.10  ? 107 TYR A CE2   1 
ATOM   806  C  CZ    . TYR A 1 107 ? 15.452  9.475   4.964   1.00 20.25  ? 107 TYR A CZ    1 
ATOM   807  O  OH    . TYR A 1 107 ? 16.515  9.532   5.841   1.00 22.06  ? 107 TYR A OH    1 
ATOM   808  N  N     . LEU A 1 108 ? 12.669  12.326  1.349   1.00 21.78  ? 108 LEU A N     1 
ATOM   809  C  CA    . LEU A 1 108 ? 13.606  13.439  1.522   1.00 22.72  ? 108 LEU A CA    1 
ATOM   810  C  C     . LEU A 1 108 ? 12.948  14.692  2.087   1.00 23.66  ? 108 LEU A C     1 
ATOM   811  O  O     . LEU A 1 108 ? 13.606  15.402  2.856   1.00 24.31  ? 108 LEU A O     1 
ATOM   812  C  CB    . LEU A 1 108 ? 14.324  13.808  0.248   1.00 23.54  ? 108 LEU A CB    1 
ATOM   813  C  CG    . LEU A 1 108 ? 15.307  12.787  -0.296  1.00 23.58  ? 108 LEU A CG    1 
ATOM   814  C  CD1   . LEU A 1 108 ? 15.614  13.110  -1.753  1.00 24.11  ? 108 LEU A CD1   1 
ATOM   815  C  CD2   . LEU A 1 108 ? 16.546  12.801  0.619   1.00 23.79  ? 108 LEU A CD2   1 
ATOM   816  N  N     . LEU A 1 109 ? 11.689  14.974  1.721   1.00 23.56  ? 109 LEU A N     1 
ATOM   817  C  CA    . LEU A 1 109 ? 10.967  16.118  2.241   1.00 24.12  ? 109 LEU A CA    1 
ATOM   818  C  C     . LEU A 1 109 ? 10.588  15.917  3.746   1.00 23.19  ? 109 LEU A C     1 
ATOM   819  O  O     . LEU A 1 109 ? 10.658  16.853  4.519   1.00 22.44  ? 109 LEU A O     1 
ATOM   820  C  CB    . LEU A 1 109 ? 9.715   16.348  1.439   1.00 25.00  ? 109 LEU A CB    1 
ATOM   821  C  CG    . LEU A 1 109 ? 9.981   16.829  0.016   1.00 26.65  ? 109 LEU A CG    1 
ATOM   822  C  CD1   . LEU A 1 109 ? 8.684   16.678  -0.766  1.00 27.31  ? 109 LEU A CD1   1 
ATOM   823  C  CD2   . LEU A 1 109 ? 10.443  18.267  -0.006  1.00 27.63  ? 109 LEU A CD2   1 
ATOM   824  N  N     . PHE A 1 110 ? 10.152  14.698  4.087   1.00 22.41  ? 110 PHE A N     1 
ATOM   825  C  CA    . PHE A 1 110 ? 9.995   14.192  5.496   1.00 22.55  ? 110 PHE A CA    1 
ATOM   826  C  C     . PHE A 1 110 ? 11.229  14.419  6.384   1.00 23.83  ? 110 PHE A C     1 
ATOM   827  O  O     . PHE A 1 110 ? 11.098  14.907  7.545   1.00 23.07  ? 110 PHE A O     1 
ATOM   828  C  CB    . PHE A 1 110 ? 9.635   12.735  5.404   1.00 21.76  ? 110 PHE A CB    1 
ATOM   829  C  CG    . PHE A 1 110 ? 9.549   11.966  6.700   1.00 21.18  ? 110 PHE A CG    1 
ATOM   830  C  CD1   . PHE A 1 110 ? 8.354   11.893  7.412   1.00 21.27  ? 110 PHE A CD1   1 
ATOM   831  C  CD2   . PHE A 1 110 ? 10.583  11.166  7.108   1.00 20.57  ? 110 PHE A CD2   1 
ATOM   832  C  CE1   . PHE A 1 110 ? 8.249   11.129  8.586   1.00 20.83  ? 110 PHE A CE1   1 
ATOM   833  C  CE2   . PHE A 1 110 ? 10.477  10.396  8.289   1.00 21.05  ? 110 PHE A CE2   1 
ATOM   834  C  CZ    . PHE A 1 110 ? 9.302   10.360  9.018   1.00 20.29  ? 110 PHE A CZ    1 
ATOM   835  N  N     . LYS A 1 111 ? 12.421  14.117  5.835   1.00 24.14  ? 111 LYS A N     1 
ATOM   836  C  CA    . LYS A 1 111 ? 13.681  14.368  6.542   1.00 24.29  ? 111 LYS A CA    1 
ATOM   837  C  C     . LYS A 1 111 ? 13.918  15.844  6.888   1.00 25.93  ? 111 LYS A C     1 
ATOM   838  O  O     . LYS A 1 111 ? 14.366  16.177  7.996   1.00 25.22  ? 111 LYS A O     1 
ATOM   839  C  CB    . LYS A 1 111 ? 14.829  13.892  5.676   1.00 24.46  ? 111 LYS A CB    1 
ATOM   840  C  CG    . LYS A 1 111 ? 16.220  14.053  6.299   1.00 25.11  ? 111 LYS A CG    1 
ATOM   841  C  CD    . LYS A 1 111 ? 17.310  13.385  5.513   1.00 25.48  ? 111 LYS A CD    1 
ATOM   842  C  CE    . LYS A 1 111 ? 18.576  14.186  5.599   1.00 27.23  ? 111 LYS A CE    1 
ATOM   843  N  NZ    . LYS A 1 111 ? 19.745  13.324  5.478   1.00 28.24  ? 111 LYS A NZ    1 
ATOM   844  N  N     . LYS A 1 112 ? 13.690  16.720  5.908   1.00 27.46  ? 112 LYS A N     1 
ATOM   845  C  CA    . LYS A 1 112 ? 13.774  18.161  6.121   1.00 29.13  ? 112 LYS A CA    1 
ATOM   846  C  C     . LYS A 1 112 ? 12.855  18.682  7.201   1.00 28.63  ? 112 LYS A C     1 
ATOM   847  O  O     . LYS A 1 112 ? 13.243  19.555  7.974   1.00 29.32  ? 112 LYS A O     1 
ATOM   848  C  CB    . LYS A 1 112 ? 13.464  18.923  4.851   1.00 31.90  ? 112 LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 112 ? 14.516  18.599  3.799   1.00 35.52  ? 112 LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 112 ? 14.472  19.510  2.578   1.00 38.16  ? 112 LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 112 ? 15.682  19.251  1.694   1.00 40.86  ? 112 LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 112 ? 16.153  20.494  1.012   1.00 44.53  ? 112 LYS A NZ    1 
ATOM   853  N  N     . VAL A 1 113 ? 11.638  18.173  7.242   1.00 27.34  ? 113 VAL A N     1 
ATOM   854  C  CA    . VAL A 1 113 ? 10.735  18.514  8.316   1.00 27.80  ? 113 VAL A CA    1 
ATOM   855  C  C     . VAL A 1 113 ? 11.368  18.084  9.650   1.00 27.74  ? 113 VAL A C     1 
ATOM   856  O  O     . VAL A 1 113 ? 11.449  18.862  10.586  1.00 27.28  ? 113 VAL A O     1 
ATOM   857  C  CB    . VAL A 1 113 ? 9.319   17.924  8.063   1.00 27.61  ? 113 VAL A CB    1 
ATOM   858  C  CG1   . VAL A 1 113 ? 8.422   18.066  9.285   1.00 28.26  ? 113 VAL A CG1   1 
ATOM   859  C  CG2   . VAL A 1 113 ? 8.686   18.523  6.798   1.00 27.42  ? 113 VAL A CG2   1 
ATOM   860  N  N     . LEU A 1 114 ? 11.820  16.841  9.719   1.00 28.23  ? 114 LEU A N     1 
ATOM   861  C  CA    . LEU A 1 114 ? 12.466  16.331  10.920  1.00 28.71  ? 114 LEU A CA    1 
ATOM   862  C  C     . LEU A 1 114 ? 13.662  17.197  11.361  1.00 29.68  ? 114 LEU A C     1 
ATOM   863  O  O     . LEU A 1 114 ? 13.807  17.416  12.551  1.00 29.14  ? 114 LEU A O     1 
ATOM   864  C  CB    . LEU A 1 114 ? 12.899  14.864  10.757  1.00 27.65  ? 114 LEU A CB    1 
ATOM   865  C  CG    . LEU A 1 114 ? 11.774  13.822  10.999  1.00 27.64  ? 114 LEU A CG    1 
ATOM   866  C  CD1   . LEU A 1 114 ? 12.290  12.433  10.727  1.00 27.58  ? 114 LEU A CD1   1 
ATOM   867  C  CD2   . LEU A 1 114 ? 11.215  13.857  12.402  1.00 28.26  ? 114 LEU A CD2   1 
ATOM   868  N  N     . GLU A 1 115 ? 14.464  17.703  10.410  1.00 30.15  ? 115 GLU A N     1 
ATOM   869  C  CA    . GLU A 1 115 ? 15.643  18.514  10.741  1.00 30.99  ? 115 GLU A CA    1 
ATOM   870  C  C     . GLU A 1 115 ? 15.221  19.839  11.306  1.00 30.94  ? 115 GLU A C     1 
ATOM   871  O  O     . GLU A 1 115 ? 15.892  20.375  12.200  1.00 29.94  ? 115 GLU A O     1 
ATOM   872  C  CB    . GLU A 1 115 ? 16.569  18.665  9.552   1.00 33.49  ? 115 GLU A CB    1 
ATOM   873  C  CG    . GLU A 1 115 ? 17.130  17.292  9.254   1.00 36.51  ? 115 GLU A CG    1 
ATOM   874  C  CD    . GLU A 1 115 ? 18.203  17.218  8.173   1.00 40.88  ? 115 GLU A CD    1 
ATOM   875  O  OE1   . GLU A 1 115 ? 18.108  17.870  7.099   1.00 43.30  ? 115 GLU A OE1   1 
ATOM   876  O  OE2   . GLU A 1 115 ? 19.131  16.394  8.399   1.00 46.30  ? 115 GLU A OE2   1 
ATOM   877  N  N     . LEU A 1 116 ? 14.086  20.343  10.827  1.00 29.65  ? 116 LEU A N     1 
ATOM   878  C  CA    . LEU A 1 116 ? 13.533  21.576  11.343  1.00 30.45  ? 116 LEU A CA    1 
ATOM   879  C  C     . LEU A 1 116 ? 12.908  21.407  12.735  1.00 31.36  ? 116 LEU A C     1 
ATOM   880  O  O     . LEU A 1 116 ? 12.908  22.311  13.573  1.00 33.14  ? 116 LEU A O     1 
ATOM   881  C  CB    . LEU A 1 116 ? 12.529  22.149  10.382  1.00 29.99  ? 116 LEU A CB    1 
ATOM   882  C  CG    . LEU A 1 116 ? 13.079  22.758  9.111   1.00 30.93  ? 116 LEU A CG    1 
ATOM   883  C  CD1   . LEU A 1 116 ? 11.956  23.010  8.119   1.00 31.54  ? 116 LEU A CD1   1 
ATOM   884  C  CD2   . LEU A 1 116 ? 13.765  24.096  9.367   1.00 32.01  ? 116 LEU A CD2   1 
ATOM   885  N  N     . MET A 1 117 ? 12.358  20.243  12.978  1.00 30.81  ? 117 MET A N     1 
ATOM   886  C  CA    . MET A 1 117 ? 11.852  19.891  14.299  1.00 30.40  ? 117 MET A CA    1 
ATOM   887  C  C     . MET A 1 117 ? 13.026  19.680  15.281  1.00 30.52  ? 117 MET A C     1 
ATOM   888  O  O     . MET A 1 117 ? 12.919  20.010  16.444  1.00 31.30  ? 117 MET A O     1 
ATOM   889  C  CB    . MET A 1 117 ? 11.005  18.610  14.194  1.00 30.20  ? 117 MET A CB    1 
ATOM   890  C  CG    . MET A 1 117 ? 9.718   18.781  13.364  1.00 30.38  ? 117 MET A CG    1 
ATOM   891  S  SD    . MET A 1 117 ? 8.752   17.300  13.126  1.00 30.18  ? 117 MET A SD    1 
ATOM   892  C  CE    . MET A 1 117 ? 7.982   17.255  14.741  1.00 29.53  ? 117 MET A CE    1 
ATOM   893  N  N     . GLY A 1 118 ? 14.137  19.143  14.802  1.00 30.26  ? 118 GLY A N     1 
ATOM   894  C  CA    . GLY A 1 118 ? 15.282  18.909  15.638  1.00 31.55  ? 118 GLY A CA    1 
ATOM   895  C  C     . GLY A 1 118 ? 15.920  20.138  16.288  1.00 33.34  ? 118 GLY A C     1 
ATOM   896  O  O     . GLY A 1 118 ? 16.371  20.023  17.373  1.00 34.29  ? 118 GLY A O     1 
ATOM   897  N  N     . THR A 1 119 ? 15.925  21.290  15.620  1.00 34.34  ? 119 THR A N     1 
ATOM   898  C  CA    . THR A 1 119 ? 16.441  22.535  16.115  1.00 36.09  ? 119 THR A CA    1 
ATOM   899  C  C     . THR A 1 119 ? 15.317  23.375  16.679  1.00 38.60  ? 119 THR A C     1 
ATOM   900  O  O     . THR A 1 119 ? 15.536  24.552  16.992  1.00 39.60  ? 119 THR A O     1 
ATOM   901  C  CB    . THR A 1 119 ? 17.084  23.342  14.973  1.00 36.76  ? 119 THR A CB    1 
ATOM   902  O  OG1   . THR A 1 119 ? 16.068  23.833  14.040  1.00 37.33  ? 119 THR A OG1   1 
ATOM   903  C  CG2   . THR A 1 119 ? 18.079  22.438  14.246  1.00 36.26  ? 119 THR A CG2   1 
ATOM   904  N  N     . LYS A 1 120 ? 14.126  22.788  16.790  1.00 38.41  ? 120 LYS A N     1 
ATOM   905  C  CA    . LYS A 1 120 ? 12.926  23.444  17.336  1.00 40.93  ? 120 LYS A CA    1 
ATOM   906  C  C     . LYS A 1 120 ? 12.331  24.554  16.522  1.00 40.31  ? 120 LYS A C     1 
ATOM   907  O  O     . LYS A 1 120 ? 11.437  25.266  17.024  1.00 39.39  ? 120 LYS A O     1 
ATOM   908  C  CB    . LYS A 1 120 ? 13.106  23.955  18.788  1.00 43.67  ? 120 LYS A CB    1 
ATOM   909  C  CG    . LYS A 1 120 ? 13.375  22.886  19.837  1.00 46.01  ? 120 LYS A CG    1 
ATOM   910  C  CD    . LYS A 1 120 ? 12.673  21.544  19.629  1.00 48.44  ? 120 LYS A CD    1 
ATOM   911  C  CE    . LYS A 1 120 ? 12.932  20.599  20.814  1.00 51.10  ? 120 LYS A CE    1 
ATOM   912  N  NZ    . LYS A 1 120 ? 12.628  21.259  22.146  1.00 54.45  ? 120 LYS A NZ    1 
ATOM   913  N  N     . GLU A 1 121 ? 12.753  24.665  15.271  1.00 39.42  ? 121 GLU A N     1 
ATOM   914  C  CA    . GLU A 1 121 ? 12.204  25.680  14.389  1.00 40.69  ? 121 GLU A CA    1 
ATOM   915  C  C     . GLU A 1 121 ? 10.716  25.557  14.061  1.00 39.01  ? 121 GLU A C     1 
ATOM   916  O  O     . GLU A 1 121 ? 10.101  26.522  13.611  1.00 38.45  ? 121 GLU A O     1 
ATOM   917  C  CB    . GLU A 1 121 ? 12.984  25.716  13.106  1.00 42.65  ? 121 GLU A CB    1 
ATOM   918  C  CG    . GLU A 1 121 ? 14.135  26.703  13.165  1.00 46.03  ? 121 GLU A CG    1 
ATOM   919  C  CD    . GLU A 1 121 ? 14.734  26.823  11.801  1.00 47.89  ? 121 GLU A CD    1 
ATOM   920  O  OE1   . GLU A 1 121 ? 15.757  26.130  11.597  1.00 45.56  ? 121 GLU A OE1   1 
ATOM   921  O  OE2   . GLU A 1 121 ? 14.095  27.534  10.946  1.00 52.63  ? 121 GLU A OE2   1 
ATOM   922  N  N     . HIS A 1 122 ? 10.153  24.382  14.305  1.00 36.70  ? 122 HIS A N     1 
ATOM   923  C  CA    . HIS A 1 122 ? 8.702   24.153  14.159  1.00 37.14  ? 122 HIS A CA    1 
ATOM   924  C  C     . HIS A 1 122 ? 7.786   24.877  15.165  1.00 37.00  ? 122 HIS A C     1 
ATOM   925  O  O     . HIS A 1 122 ? 6.567   25.038  14.935  1.00 37.67  ? 122 HIS A O     1 
ATOM   926  C  CB    . HIS A 1 122 ? 8.397   22.654  14.150  1.00 35.99  ? 122 HIS A CB    1 
ATOM   927  C  CG    . HIS A 1 122 ? 8.501   21.988  15.485  1.00 35.75  ? 122 HIS A CG    1 
ATOM   928  N  ND1   . HIS A 1 122 ? 9.701   21.796  16.138  1.00 36.96  ? 122 HIS A ND1   1 
ATOM   929  C  CD2   . HIS A 1 122 ? 7.554   21.443  16.282  1.00 36.58  ? 122 HIS A CD2   1 
ATOM   930  C  CE1   . HIS A 1 122 ? 9.493   21.138  17.266  1.00 36.51  ? 122 HIS A CE1   1 
ATOM   931  N  NE2   . HIS A 1 122 ? 8.195   20.926  17.385  1.00 36.93  ? 122 HIS A NE2   1 
ATOM   932  N  N     . LEU A 1 123 ? 8.396   25.303  16.275  1.00 36.61  ? 123 LEU A N     1 
ATOM   933  C  CA    . LEU A 1 123 ? 7.734   26.076  17.295  1.00 36.79  ? 123 LEU A CA    1 
ATOM   934  C  C     . LEU A 1 123 ? 7.821   27.566  17.014  1.00 38.32  ? 123 LEU A C     1 
ATOM   935  O  O     . LEU A 1 123 ? 7.429   28.376  17.897  1.00 41.55  ? 123 LEU A O     1 
ATOM   936  C  CB    . LEU A 1 123 ? 8.349   25.764  18.660  1.00 36.28  ? 123 LEU A CB    1 
ATOM   937  C  CG    . LEU A 1 123 ? 8.379   24.299  19.084  1.00 35.15  ? 123 LEU A CG    1 
ATOM   938  C  CD1   . LEU A 1 123 ? 9.126   24.160  20.425  1.00 34.87  ? 123 LEU A CD1   1 
ATOM   939  C  CD2   . LEU A 1 123 ? 6.949   23.800  19.208  1.00 35.47  ? 123 LEU A CD2   1 
ATOM   940  N  N     . THR A 1 124 ? 8.315   27.924  15.805  1.00 37.39  ? 124 THR A N     1 
ATOM   941  C  CA    . THR A 1 124 ? 8.336   29.286  15.306  1.00 37.66  ? 124 THR A CA    1 
ATOM   942  C  C     . THR A 1 124 ? 7.515   29.480  14.066  1.00 37.94  ? 124 THR A C     1 
ATOM   943  O  O     . THR A 1 124 ? 7.283   28.571  13.263  1.00 36.62  ? 124 THR A O     1 
ATOM   944  C  CB    . THR A 1 124 ? 9.757   29.710  14.971  1.00 38.04  ? 124 THR A CB    1 
ATOM   945  O  OG1   . THR A 1 124 ? 10.224  29.006  13.799  1.00 37.08  ? 124 THR A OG1   1 
ATOM   946  C  CG2   . THR A 1 124 ? 10.685  29.437  16.238  1.00 36.75  ? 124 THR A CG2   1 
ATOM   947  N  N     . GLN A 1 125 ? 7.090   30.700  13.887  1.00 39.08  ? 125 GLN A N     1 
ATOM   948  C  CA    . GLN A 1 125 ? 6.255   31.027  12.753  1.00 41.12  ? 125 GLN A CA    1 
ATOM   949  C  C     . GLN A 1 125 ? 6.949   30.675  11.389  1.00 40.72  ? 125 GLN A C     1 
ATOM   950  O  O     . GLN A 1 125 ? 6.391   29.900  10.594  1.00 38.34  ? 125 GLN A O     1 
ATOM   951  C  CB    . GLN A 1 125 ? 5.803   32.498  12.867  1.00 43.12  ? 125 GLN A CB    1 
ATOM   952  C  CG    . GLN A 1 125 ? 4.789   32.939  11.829  1.00 45.53  ? 125 GLN A CG    1 
ATOM   953  C  CD    . GLN A 1 125 ? 3.668   31.941  11.660  1.00 45.78  ? 125 GLN A CD    1 
ATOM   954  O  OE1   . GLN A 1 125 ? 3.143   31.391  12.639  1.00 45.74  ? 125 GLN A OE1   1 
ATOM   955  N  NE2   . GLN A 1 125 ? 3.329   31.657  10.412  1.00 46.22  ? 125 GLN A NE2   1 
ATOM   956  N  N     . ARG A 1 126 ? 8.166   31.184  11.176  1.00 42.20  ? 126 ARG A N     1 
ATOM   957  C  CA    . ARG A 1 126 ? 8.962   30.921  9.940   1.00 44.65  ? 126 ARG A CA    1 
ATOM   958  C  C     . ARG A 1 126 ? 9.226   29.399  9.649   1.00 41.06  ? 126 ARG A C     1 
ATOM   959  O  O     . ARG A 1 126 ? 9.067   28.938  8.506   1.00 40.61  ? 126 ARG A O     1 
ATOM   960  C  CB    . ARG A 1 126 ? 10.275  31.771  9.936   1.00 50.85  ? 126 ARG A CB    1 
ATOM   961  C  CG    . ARG A 1 126 ? 11.471  31.361  9.026   1.00 55.34  ? 126 ARG A CG    1 
ATOM   962  C  CD    . ARG A 1 126 ? 12.821  32.045  9.405   1.00 59.83  ? 126 ARG A CD    1 
ATOM   963  N  NE    . ARG A 1 126 ? 12.752  33.538  9.491   1.00 67.51  ? 126 ARG A NE    1 
ATOM   964  C  CZ    . ARG A 1 126 ? 13.247  34.446  8.601   1.00 74.04  ? 126 ARG A CZ    1 
ATOM   965  N  NH1   . ARG A 1 126 ? 13.913  34.099  7.485   1.00 76.82  ? 126 ARG A NH1   1 
ATOM   966  N  NH2   . ARG A 1 126 ? 13.075  35.755  8.821   1.00 76.29  ? 126 ARG A NH2   1 
ATOM   967  N  N     . GLY A 1 127 ? 9.604   28.627  10.673  1.00 37.34  ? 127 GLY A N     1 
ATOM   968  C  CA    . GLY A 1 127 ? 9.772   27.213  10.507  1.00 34.51  ? 127 GLY A CA    1 
ATOM   969  C  C     . GLY A 1 127 ? 8.449   26.512  10.253  1.00 32.91  ? 127 GLY A C     1 
ATOM   970  O  O     . GLY A 1 127 ? 8.402   25.566  9.485   1.00 31.04  ? 127 GLY A O     1 
ATOM   971  N  N     . LEU A 1 128 ? 7.374   26.947  10.899  1.00 32.81  ? 128 LEU A N     1 
ATOM   972  C  CA    . LEU A 1 128 ? 6.098   26.319  10.649  1.00 33.20  ? 128 LEU A CA    1 
ATOM   973  C  C     . LEU A 1 128 ? 5.739   26.491  9.178   1.00 33.76  ? 128 LEU A C     1 
ATOM   974  O  O     . LEU A 1 128 ? 5.248   25.573  8.542   1.00 31.83  ? 128 LEU A O     1 
ATOM   975  C  CB    . LEU A 1 128 ? 4.973   26.871  11.566  1.00 34.25  ? 128 LEU A CB    1 
ATOM   976  C  CG    . LEU A 1 128 ? 3.521   26.371  11.298  1.00 34.53  ? 128 LEU A CG    1 
ATOM   977  C  CD1   . LEU A 1 128 ? 3.341   24.855  11.414  1.00 33.29  ? 128 LEU A CD1   1 
ATOM   978  C  CD2   . LEU A 1 128 ? 2.546   27.036  12.238  1.00 35.40  ? 128 LEU A CD2   1 
ATOM   979  N  N     . GLU A 1 129 ? 5.964   27.698  8.655   1.00 36.34  ? 129 GLU A N     1 
ATOM   980  C  CA    . GLU A 1 129 ? 5.674   27.939  7.251   1.00 38.17  ? 129 GLU A CA    1 
ATOM   981  C  C     . GLU A 1 129 ? 6.484   26.994  6.344   1.00 36.80  ? 129 GLU A C     1 
ATOM   982  O  O     . GLU A 1 129 ? 5.923   26.401  5.429   1.00 35.29  ? 129 GLU A O     1 
ATOM   983  C  CB    . GLU A 1 129 ? 5.828   29.409  6.907   1.00 40.16  ? 129 GLU A CB    1 
ATOM   984  C  CG    . GLU A 1 129 ? 4.641   30.163  7.491   1.00 42.40  ? 129 GLU A CG    1 
ATOM   985  C  CD    . GLU A 1 129 ? 4.768   31.677  7.374   1.00 44.68  ? 129 GLU A CD    1 
ATOM   986  O  OE1   . GLU A 1 129 ? 4.261   32.417  8.227   1.00 45.94  ? 129 GLU A OE1   1 
ATOM   987  O  OE2   . GLU A 1 129 ? 5.383   32.152  6.415   1.00 46.66  ? 129 GLU A OE2   1 
ATOM   988  N  N     . LYS A 1 130 ? 7.769   26.813  6.665   1.00 36.75  ? 130 LYS A N     1 
ATOM   989  C  CA    . LYS A 1 130 ? 8.650   25.938  5.840   1.00 37.62  ? 130 LYS A CA    1 
ATOM   990  C  C     . LYS A 1 130 ? 8.139   24.529  5.821   1.00 34.54  ? 130 LYS A C     1 
ATOM   991  O  O     . LYS A 1 130 ? 8.112   23.897  4.753   1.00 34.09  ? 130 LYS A O     1 
ATOM   992  C  CB    . LYS A 1 130 ? 10.105  25.914  6.325   1.00 38.81  ? 130 LYS A CB    1 
ATOM   993  C  CG    . LYS A 1 130 ? 10.849  27.223  6.123   1.00 42.55  ? 130 LYS A CG    1 
ATOM   994  C  CD    . LYS A 1 130 ? 12.220  27.162  6.795   1.00 44.70  ? 130 LYS A CD    1 
ATOM   995  C  CE    . LYS A 1 130 ? 12.957  28.512  6.906   1.00 46.90  ? 130 LYS A CE    1 
ATOM   996  N  NZ    . LYS A 1 130 ? 14.361  28.077  7.189   1.00 47.21  ? 130 LYS A NZ    1 
ATOM   997  N  N     . ILE A 1 131 ? 7.710   24.082  7.009   1.00 32.62  ? 131 ILE A N     1 
ATOM   998  C  CA    . ILE A 1 131 ? 7.149   22.760  7.212   1.00 30.86  ? 131 ILE A CA    1 
ATOM   999  C  C     . ILE A 1 131 ? 5.862   22.578  6.393   1.00 30.51  ? 131 ILE A C     1 
ATOM   1000 O  O     . ILE A 1 131 ? 5.671   21.565  5.756   1.00 29.14  ? 131 ILE A O     1 
ATOM   1001 C  CB    . ILE A 1 131 ? 6.944   22.488  8.702   1.00 30.88  ? 131 ILE A CB    1 
ATOM   1002 C  CG1   . ILE A 1 131 ? 8.294   22.182  9.327   1.00 30.43  ? 131 ILE A CG1   1 
ATOM   1003 C  CG2   . ILE A 1 131 ? 6.000   21.304  8.936   1.00 30.50  ? 131 ILE A CG2   1 
ATOM   1004 C  CD1   . ILE A 1 131 ? 8.382   22.458  10.794  1.00 31.21  ? 131 ILE A CD1   1 
ATOM   1005 N  N     . VAL A 1 132 ? 5.007   23.576  6.426   1.00 31.26  ? 132 VAL A N     1 
ATOM   1006 C  CA    . VAL A 1 132 ? 3.839   23.567  5.574   1.00 32.11  ? 132 VAL A CA    1 
ATOM   1007 C  C     . VAL A 1 132 ? 4.308   23.527  4.106   1.00 32.12  ? 132 VAL A C     1 
ATOM   1008 O  O     . VAL A 1 132 ? 3.842   22.659  3.351   1.00 31.84  ? 132 VAL A O     1 
ATOM   1009 C  CB    . VAL A 1 132 ? 2.844   24.695  5.918   1.00 33.79  ? 132 VAL A CB    1 
ATOM   1010 C  CG1   . VAL A 1 132 ? 1.793   24.854  4.824   1.00 35.26  ? 132 VAL A CG1   1 
ATOM   1011 C  CG2   . VAL A 1 132 ? 2.172   24.371  7.248   1.00 33.29  ? 132 VAL A CG2   1 
ATOM   1012 N  N     . SER A 1 133 ? 5.292   24.321  3.704   1.00 32.09  ? 133 SER A N     1 
ATOM   1013 C  CA    . SER A 1 133 ? 5.735   24.143  2.310   1.00 32.43  ? 133 SER A CA    1 
ATOM   1014 C  C     . SER A 1 133 ? 6.231   22.726  1.998   1.00 30.09  ? 133 SER A C     1 
ATOM   1015 O  O     . SER A 1 133 ? 5.954   22.215  0.911   1.00 30.52  ? 133 SER A O     1 
ATOM   1016 C  CB    . SER A 1 133 ? 6.801   25.146  1.878   1.00 33.42  ? 133 SER A CB    1 
ATOM   1017 O  OG    . SER A 1 133 ? 6.230   26.393  1.760   1.00 35.46  ? 133 SER A OG    1 
ATOM   1018 N  N     . LEU A 1 134 ? 6.970   22.113  2.924   1.00 28.63  ? 134 LEU A N     1 
ATOM   1019 C  CA    . LEU A 1 134 ? 7.493   20.724  2.739   1.00 26.53  ? 134 LEU A CA    1 
ATOM   1020 C  C     . LEU A 1 134 ? 6.319   19.792  2.633   1.00 25.63  ? 134 LEU A C     1 
ATOM   1021 O  O     . LEU A 1 134 ? 6.261   18.990  1.686   1.00 24.32  ? 134 LEU A O     1 
ATOM   1022 C  CB    . LEU A 1 134 ? 8.489   20.300  3.828   1.00 25.71  ? 134 LEU A CB    1 
ATOM   1023 C  CG    . LEU A 1 134 ? 9.734   21.226  3.903   1.00 27.03  ? 134 LEU A CG    1 
ATOM   1024 C  CD1   . LEU A 1 134 ? 10.259  21.427  5.305   1.00 26.78  ? 134 LEU A CD1   1 
ATOM   1025 C  CD2   . LEU A 1 134 ? 10.879  20.761  3.024   1.00 27.72  ? 134 LEU A CD2   1 
ATOM   1026 N  N     . LYS A 1 135 ? 5.327   19.938  3.553   1.00 25.31  ? 135 LYS A N     1 
ATOM   1027 C  CA    . LYS A 1 135 ? 4.215   19.001  3.587   1.00 24.58  ? 135 LYS A CA    1 
ATOM   1028 C  C     . LYS A 1 135 ? 3.414   19.073  2.288   1.00 25.32  ? 135 LYS A C     1 
ATOM   1029 O  O     . LYS A 1 135 ? 2.882   18.077  1.802   1.00 23.86  ? 135 LYS A O     1 
ATOM   1030 C  CB    . LYS A 1 135 ? 3.317   19.258  4.785   1.00 24.89  ? 135 LYS A CB    1 
ATOM   1031 C  CG    . LYS A 1 135 ? 2.190   18.238  4.849   1.00 25.04  ? 135 LYS A CG    1 
ATOM   1032 C  CD    . LYS A 1 135 ? 1.313   18.395  6.061   1.00 25.96  ? 135 LYS A CD    1 
ATOM   1033 C  CE    . LYS A 1 135 ? -0.069  17.844  5.866   1.00 26.64  ? 135 LYS A CE    1 
ATOM   1034 N  NZ    . LYS A 1 135 ? -0.023  16.441  5.402   1.00 26.42  ? 135 LYS A NZ    1 
ATOM   1035 N  N     . ALA A 1 136 ? 3.389   20.286  1.726   1.00 27.20  ? 136 ALA A N     1 
ATOM   1036 C  CA    . ALA A 1 136 ? 2.694   20.562  0.480   1.00 29.10  ? 136 ALA A CA    1 
ATOM   1037 C  C     . ALA A 1 136 ? 3.119   19.654  -0.699  1.00 29.34  ? 136 ALA A C     1 
ATOM   1038 O  O     . ALA A 1 136 ? 2.314   19.428  -1.580  1.00 31.01  ? 136 ALA A O     1 
ATOM   1039 C  CB    . ALA A 1 136 ? 2.824   22.038  0.124   1.00 30.57  ? 136 ALA A CB    1 
ATOM   1040 N  N     . SER A 1 137 ? 4.338   19.089  -0.696  1.00 28.60  ? 137 SER A N     1 
ATOM   1041 C  CA    . SER A 1 137 ? 4.830   18.264  -1.818  1.00 28.50  ? 137 SER A CA    1 
ATOM   1042 C  C     . SER A 1 137 ? 4.987   16.827  -1.483  1.00 27.48  ? 137 SER A C     1 
ATOM   1043 O  O     . SER A 1 137 ? 5.569   16.080  -2.237  1.00 27.54  ? 137 SER A O     1 
ATOM   1044 C  CB    . SER A 1 137 ? 6.149   18.828  -2.279  1.00 28.84  ? 137 SER A CB    1 
ATOM   1045 O  OG    . SER A 1 137 ? 5.910   20.157  -2.766  1.00 30.92  ? 137 SER A OG    1 
ATOM   1046 N  N     . ILE A 1 138 ? 4.465   16.438  -0.324  1.00 28.42  ? 138 ILE A N     1 
ATOM   1047 C  CA    . ILE A 1 138 ? 4.530   15.077  0.211   1.00 26.94  ? 138 ILE A CA    1 
ATOM   1048 C  C     . ILE A 1 138 ? 3.171   14.469  -0.088  1.00 27.97  ? 138 ILE A C     1 
ATOM   1049 O  O     . ILE A 1 138 ? 2.115   15.122  0.129   1.00 27.48  ? 138 ILE A O     1 
ATOM   1050 C  CB    . ILE A 1 138 ? 4.738   15.103  1.743   1.00 26.59  ? 138 ILE A CB    1 
ATOM   1051 C  CG1   . ILE A 1 138 ? 6.162   15.551  2.062   1.00 26.99  ? 138 ILE A CG1   1 
ATOM   1052 C  CG2   . ILE A 1 138 ? 4.389   13.760  2.434   1.00 25.93  ? 138 ILE A CG2   1 
ATOM   1053 C  CD1   . ILE A 1 138 ? 6.575   15.453  3.544   1.00 25.91  ? 138 ILE A CD1   1 
ATOM   1054 N  N     . ASN A 1 139 ? 3.201   13.218  -0.551  1.00 28.97  ? 139 ASN A N     1 
ATOM   1055 C  CA    . ASN A 1 139 ? 1.975   12.427  -0.774  1.00 30.83  ? 139 ASN A CA    1 
ATOM   1056 C  C     . ASN A 1 139 ? 0.969   13.292  -1.495  1.00 33.11  ? 139 ASN A C     1 
ATOM   1057 O  O     . ASN A 1 139 ? 1.296   13.785  -2.552  1.00 33.64  ? 139 ASN A O     1 
ATOM   1058 C  CB    . ASN A 1 139 ? 1.449   11.925  0.558   1.00 31.00  ? 139 ASN A CB    1 
ATOM   1059 C  CG    . ASN A 1 139 ? 2.466   11.108  1.271   1.00 31.07  ? 139 ASN A CG    1 
ATOM   1060 O  OD1   . ASN A 1 139 ? 3.284   10.440  0.603   1.00 31.82  ? 139 ASN A OD1   1 
ATOM   1061 N  ND2   . ASN A 1 139 ? 2.453   11.133  2.624   1.00 31.15  ? 139 ASN A ND2   1 
ATOM   1062 N  N     . LYS A 1 140 ? -0.196  13.518  -0.924  1.00 36.04  ? 140 LYS A N     1 
ATOM   1063 C  CA    . LYS A 1 140 ? -1.284  14.151  -1.637  1.00 40.55  ? 140 LYS A CA    1 
ATOM   1064 C  C     . LYS A 1 140 ? -1.337  15.650  -1.395  1.00 40.13  ? 140 LYS A C     1 
ATOM   1065 O  O     . LYS A 1 140 ? -2.136  16.321  -1.970  1.00 40.95  ? 140 LYS A O     1 
ATOM   1066 C  CB    . LYS A 1 140 ? -2.599  13.467  -1.293  1.00 44.80  ? 140 LYS A CB    1 
ATOM   1067 C  CG    . LYS A 1 140 ? -2.945  12.347  -2.275  1.00 50.31  ? 140 LYS A CG    1 
ATOM   1068 C  CD    . LYS A 1 140 ? -4.447  12.026  -2.295  1.00 57.77  ? 140 LYS A CD    1 
ATOM   1069 C  CE    . LYS A 1 140 ? -4.849  11.123  -3.494  1.00 63.15  ? 140 LYS A CE    1 
ATOM   1070 N  NZ    . LYS A 1 140 ? -6.188  11.450  -4.094  1.00 66.88  ? 140 LYS A NZ    1 
ATOM   1071 N  N     . GLY A 1 141 ? -0.465  16.193  -0.565  1.00 38.23  ? 141 GLY A N     1 
ATOM   1072 C  CA    . GLY A 1 141 ? -0.281  17.645  -0.556  1.00 38.39  ? 141 GLY A CA    1 
ATOM   1073 C  C     . GLY A 1 141 ? -1.089  18.199  0.587   1.00 38.20  ? 141 GLY A C     1 
ATOM   1074 O  O     . GLY A 1 141 ? -1.472  17.430  1.432   1.00 39.15  ? 141 GLY A O     1 
ATOM   1075 N  N     . LEU A 1 142 ? -1.330  19.502  0.620   1.00 37.85  ? 142 LEU A N     1 
ATOM   1076 C  CA    . LEU A 1 142 ? -2.107  20.109  1.666   1.00 39.00  ? 142 LEU A CA    1 
ATOM   1077 C  C     . LEU A 1 142 ? -3.616  19.722  1.643   1.00 40.57  ? 142 LEU A C     1 
ATOM   1078 O  O     . LEU A 1 142 ? -4.245  19.613  0.589   1.00 39.90  ? 142 LEU A O     1 
ATOM   1079 C  CB    . LEU A 1 142 ? -1.977  21.653  1.590   1.00 40.66  ? 142 LEU A CB    1 
ATOM   1080 C  CG    . LEU A 1 142 ? -0.580  22.347  1.725   1.00 39.89  ? 142 LEU A CG    1 
ATOM   1081 C  CD1   . LEU A 1 142 ? -0.694  23.855  1.991   1.00 41.04  ? 142 LEU A CD1   1 
ATOM   1082 C  CD2   . LEU A 1 142 ? 0.328   21.670  2.775   1.00 37.61  ? 142 LEU A CD2   1 
ATOM   1083 N  N     . SER A 1 143 ? -4.171  19.541  2.844   1.00 41.51  ? 143 SER A N     1 
ATOM   1084 C  CA    . SER A 1 143 ? -5.647  19.506  3.076   1.00 43.36  ? 143 SER A CA    1 
ATOM   1085 C  C     . SER A 1 143 ? -6.249  20.840  2.711   1.00 45.34  ? 143 SER A C     1 
ATOM   1086 O  O     . SER A 1 143 ? -5.520  21.829  2.517   1.00 44.74  ? 143 SER A O     1 
ATOM   1087 C  CB    . SER A 1 143 ? -6.027  19.172  4.568   1.00 42.93  ? 143 SER A CB    1 
ATOM   1088 O  OG    . SER A 1 143 ? -5.596  20.160  5.552   1.00 43.31  ? 143 SER A OG    1 
ATOM   1089 N  N     . GLU A 1 144 ? -7.584  20.858  2.676   1.00 47.59  ? 144 GLU A N     1 
ATOM   1090 C  CA    . GLU A 1 144 ? -8.355  22.072  2.490   1.00 50.18  ? 144 GLU A CA    1 
ATOM   1091 C  C     . GLU A 1 144 ? -8.081  22.974  3.691   1.00 49.14  ? 144 GLU A C     1 
ATOM   1092 O  O     . GLU A 1 144 ? -7.868  24.183  3.543   1.00 48.57  ? 144 GLU A O     1 
ATOM   1093 C  CB    . GLU A 1 144 ? -9.864  21.752  2.299   1.00 54.41  ? 144 GLU A CB    1 
ATOM   1094 C  CG    . GLU A 1 144 ? -10.234 21.121  0.924   1.00 57.70  ? 144 GLU A CG    1 
ATOM   1095 C  CD    . GLU A 1 144 ? -9.972  19.605  0.766   1.00 58.33  ? 144 GLU A CD    1 
ATOM   1096 O  OE1   . GLU A 1 144 ? -9.323  18.971  1.632   1.00 62.39  ? 144 GLU A OE1   1 
ATOM   1097 O  OE2   . GLU A 1 144 ? -10.383 18.994  -0.255  1.00 61.13  ? 144 GLU A OE2   1 
ATOM   1098 N  N     . GLU A 1 145 ? -8.000  22.391  4.887   1.00 48.48  ? 145 GLU A N     1 
ATOM   1099 C  CA    . GLU A 1 145 ? -7.753  23.209  6.086   1.00 48.82  ? 145 GLU A CA    1 
ATOM   1100 C  C     . GLU A 1 145 ? -6.448  24.009  6.035   1.00 46.96  ? 145 GLU A C     1 
ATOM   1101 O  O     . GLU A 1 145 ? -6.450  25.248  6.244   1.00 48.05  ? 145 GLU A O     1 
ATOM   1102 C  CB    . GLU A 1 145 ? -7.823  22.363  7.367   1.00 49.11  ? 145 GLU A CB    1 
ATOM   1103 C  CG    . GLU A 1 145 ? -7.466  23.148  8.628   1.00 50.18  ? 145 GLU A CG    1 
ATOM   1104 C  CD    . GLU A 1 145 ? -7.694  22.379  9.915   1.00 51.38  ? 145 GLU A CD    1 
ATOM   1105 O  OE1   . GLU A 1 145 ? -7.819  21.134  9.859   1.00 51.16  ? 145 GLU A OE1   1 
ATOM   1106 O  OE2   . GLU A 1 145 ? -7.732  23.036  10.990  1.00 53.54  ? 145 GLU A OE2   1 
ATOM   1107 N  N     . LEU A 1 146 ? -5.355  23.308  5.725   1.00 44.21  ? 146 LEU A N     1 
ATOM   1108 C  CA    . LEU A 1 146 ? -4.003  23.913  5.718   1.00 42.82  ? 146 LEU A CA    1 
ATOM   1109 C  C     . LEU A 1 146 ? -3.840  24.860  4.533   1.00 43.09  ? 146 LEU A C     1 
ATOM   1110 O  O     . LEU A 1 146 ? -3.303  25.960  4.660   1.00 42.54  ? 146 LEU A O     1 
ATOM   1111 C  CB    . LEU A 1 146 ? -2.922  22.806  5.669   1.00 40.96  ? 146 LEU A CB    1 
ATOM   1112 C  CG    . LEU A 1 146 ? -2.904  21.907  6.900   1.00 39.90  ? 146 LEU A CG    1 
ATOM   1113 C  CD1   . LEU A 1 146 ? -2.135  20.621  6.677   1.00 37.91  ? 146 LEU A CD1   1 
ATOM   1114 C  CD2   . LEU A 1 146 ? -2.310  22.756  8.039   1.00 40.50  ? 146 LEU A CD2   1 
ATOM   1115 N  N     . GLN A 1 147 ? -4.322  24.408  3.383   1.00 44.29  ? 147 GLN A N     1 
ATOM   1116 C  CA    . GLN A 1 147 ? -4.407  25.249  2.204   1.00 46.93  ? 147 GLN A CA    1 
ATOM   1117 C  C     . GLN A 1 147 ? -5.062  26.609  2.556   1.00 47.18  ? 147 GLN A C     1 
ATOM   1118 O  O     . GLN A 1 147 ? -4.523  27.643  2.252   1.00 47.65  ? 147 GLN A O     1 
ATOM   1119 C  CB    . GLN A 1 147 ? -5.154  24.480  1.101   1.00 49.82  ? 147 GLN A CB    1 
ATOM   1120 C  CG    . GLN A 1 147 ? -4.978  25.030  -0.301  1.00 54.31  ? 147 GLN A CG    1 
ATOM   1121 C  CD    . GLN A 1 147 ? -3.792  24.388  -1.010  1.00 56.67  ? 147 GLN A CD    1 
ATOM   1122 O  OE1   . GLN A 1 147 ? -2.631  24.660  -0.661  1.00 59.17  ? 147 GLN A OE1   1 
ATOM   1123 N  NE2   . GLN A 1 147 ? -4.069  23.512  -2.009  1.00 59.00  ? 147 GLN A NE2   1 
ATOM   1124 N  N     . ALA A 1 148 ? -6.176  26.620  3.266   1.00 47.03  ? 148 ALA A N     1 
ATOM   1125 C  CA    . ALA A 1 148 ? -6.820  27.889  3.600   1.00 49.03  ? 148 ALA A CA    1 
ATOM   1126 C  C     . ALA A 1 148 ? -6.123  28.675  4.742   1.00 48.42  ? 148 ALA A C     1 
ATOM   1127 O  O     . ALA A 1 148 ? -6.054  29.896  4.731   1.00 48.82  ? 148 ALA A O     1 
ATOM   1128 C  CB    . ALA A 1 148 ? -8.274  27.649  3.927   1.00 50.22  ? 148 ALA A CB    1 
ATOM   1129 N  N     . ALA A 1 149 ? -5.604  27.962  5.731   1.00 47.13  ? 149 ALA A N     1 
ATOM   1130 C  CA    . ALA A 1 149 ? -4.877  28.611  6.834   1.00 46.32  ? 149 ALA A CA    1 
ATOM   1131 C  C     . ALA A 1 149 ? -3.497  29.092  6.387   1.00 45.57  ? 149 ALA A C     1 
ATOM   1132 O  O     . ALA A 1 149 ? -2.945  29.980  7.017   1.00 44.77  ? 149 ALA A O     1 
ATOM   1133 C  CB    . ALA A 1 149 ? -4.705  27.624  7.978   1.00 44.90  ? 149 ALA A CB    1 
ATOM   1134 N  N     . PHE A 1 150 ? -2.933  28.471  5.331   1.00 45.20  ? 150 PHE A N     1 
ATOM   1135 C  CA    . PHE A 1 150 ? -1.583  28.824  4.817   1.00 45.27  ? 150 PHE A CA    1 
ATOM   1136 C  C     . PHE A 1 150 ? -1.523  29.150  3.324   1.00 47.34  ? 150 PHE A C     1 
ATOM   1137 O  O     . PHE A 1 150 ? -0.869  28.453  2.584   1.00 44.75  ? 150 PHE A O     1 
ATOM   1138 C  CB    . PHE A 1 150 ? -0.571  27.714  5.143   1.00 42.66  ? 150 PHE A CB    1 
ATOM   1139 C  CG    . PHE A 1 150 ? -0.324  27.525  6.615   1.00 40.37  ? 150 PHE A CG    1 
ATOM   1140 C  CD1   . PHE A 1 150 ? 0.660   28.235  7.244   1.00 39.74  ? 150 PHE A CD1   1 
ATOM   1141 C  CD2   . PHE A 1 150 ? -1.102  26.617  7.357   1.00 39.48  ? 150 PHE A CD2   1 
ATOM   1142 C  CE1   . PHE A 1 150 ? 0.884   28.040  8.599   1.00 39.10  ? 150 PHE A CE1   1 
ATOM   1143 C  CE2   . PHE A 1 150 ? -0.894  26.390  8.702   1.00 37.94  ? 150 PHE A CE2   1 
ATOM   1144 C  CZ    . PHE A 1 150 ? 0.096   27.105  9.332   1.00 38.54  ? 150 PHE A CZ    1 
ATOM   1145 N  N     . PRO A 1 151 ? -2.164  30.262  2.914   1.00 51.55  ? 151 PRO A N     1 
ATOM   1146 C  CA    . PRO A 1 151 ? -2.337  30.619  1.485   1.00 55.68  ? 151 PRO A CA    1 
ATOM   1147 C  C     . PRO A 1 151 ? -1.066  31.111  0.801   1.00 58.36  ? 151 PRO A C     1 
ATOM   1148 O  O     . PRO A 1 151 ? -0.945  31.046  -0.405  1.00 58.75  ? 151 PRO A O     1 
ATOM   1149 C  CB    . PRO A 1 151 ? -3.373  31.764  1.528   1.00 56.98  ? 151 PRO A CB    1 
ATOM   1150 C  CG    . PRO A 1 151 ? -3.222  32.379  2.870   1.00 55.93  ? 151 PRO A CG    1 
ATOM   1151 C  CD    . PRO A 1 151 ? -2.811  31.256  3.801   1.00 53.29  ? 151 PRO A CD    1 
ATOM   1152 N  N     . GLN A 1 152 ? -0.169  31.655  1.601   1.00 62.40  ? 152 GLN A N     1 
ATOM   1153 C  CA    . GLN A 1 152 ? 1.119   32.154  1.149   1.00 66.67  ? 152 GLN A CA    1 
ATOM   1154 C  C     . GLN A 1 152 ? 2.106   30.988  0.772   1.00 65.60  ? 152 GLN A C     1 
ATOM   1155 O  O     . GLN A 1 152 ? 2.695   31.034  -0.319  1.00 66.99  ? 152 GLN A O     1 
ATOM   1156 C  CB    . GLN A 1 152 ? 1.659   33.203  2.185   1.00 68.25  ? 152 GLN A CB    1 
ATOM   1157 C  CG    . GLN A 1 152 ? 2.220   32.725  3.560   1.00 67.39  ? 152 GLN A CG    1 
ATOM   1158 C  CD    . GLN A 1 152 ? 1.241   31.991  4.518   1.00 67.27  ? 152 GLN A CD    1 
ATOM   1159 O  OE1   . GLN A 1 152 ? 0.266   31.392  4.076   1.00 66.95  ? 152 GLN A OE1   1 
ATOM   1160 N  NE2   . GLN A 1 152 ? 1.531   32.022  5.840   1.00 65.60  ? 152 GLN A NE2   1 
ATOM   1161 N  N     . CYS A 1 153 ? 2.206   29.948  1.628   1.00 63.47  ? 153 CYS A N     1 
ATOM   1162 C  CA    . CYS A 1 153 ? 3.087   28.758  1.429   1.00 59.92  ? 153 CYS A CA    1 
ATOM   1163 C  C     . CYS A 1 153 ? 3.103   28.046  0.070   1.00 56.64  ? 153 CYS A C     1 
ATOM   1164 O  O     . CYS A 1 153 ? 2.486   26.964  -0.101  1.00 60.62  ? 153 CYS A O     1 
ATOM   1165 C  CB    . CYS A 1 153 ? 2.861   27.688  2.512   1.00 59.00  ? 153 CYS A CB    1 
ATOM   1166 S  SG    . CYS A 1 153 ? 3.274   28.329  4.156   1.00 62.33  ? 153 CYS A SG    1 
ATOM   1167 N  N     . VAL A 1 154 ? 3.942   28.600  -0.806  1.00 51.08  ? 154 VAL A N     1 
ATOM   1168 C  CA    . VAL A 1 154 ? 4.444   27.949  -2.023  1.00 48.18  ? 154 VAL A CA    1 
ATOM   1169 C  C     . VAL A 1 154 ? 5.036   26.531  -1.735  1.00 44.44  ? 154 VAL A C     1 
ATOM   1170 O  O     . VAL A 1 154 ? 5.870   26.377  -0.830  1.00 42.22  ? 154 VAL A O     1 
ATOM   1171 C  CB    . VAL A 1 154 ? 5.501   28.865  -2.701  1.00 48.42  ? 154 VAL A CB    1 
ATOM   1172 C  CG1   . VAL A 1 154 ? 6.150   28.191  -3.923  1.00 47.83  ? 154 VAL A CG1   1 
ATOM   1173 C  CG2   . VAL A 1 154 ? 4.824   30.171  -3.086  1.00 50.77  ? 154 VAL A CG2   1 
ATOM   1174 N  N     . PRO A 1 155 ? 4.566   25.487  -2.446  1.00 42.25  ? 155 PRO A N     1 
ATOM   1175 C  CA    . PRO A 1 155 ? 5.088   24.115  -2.167  1.00 40.15  ? 155 PRO A CA    1 
ATOM   1176 C  C     . PRO A 1 155 ? 6.567   24.004  -2.465  1.00 39.22  ? 155 PRO A C     1 
ATOM   1177 O  O     . PRO A 1 155 ? 7.028   24.712  -3.305  1.00 41.09  ? 155 PRO A O     1 
ATOM   1178 C  CB    . PRO A 1 155 ? 4.279   23.225  -3.118  1.00 40.21  ? 155 PRO A CB    1 
ATOM   1179 C  CG    . PRO A 1 155 ? 3.041   24.018  -3.438  1.00 41.63  ? 155 PRO A CG    1 
ATOM   1180 C  CD    . PRO A 1 155 ? 3.459   25.458  -3.417  1.00 43.54  ? 155 PRO A CD    1 
ATOM   1181 N  N     . THR A 1 156 ? 7.332   23.202  -1.757  1.00 38.72  ? 156 THR A N     1 
ATOM   1182 C  CA    . THR A 1 156 ? 8.780   23.176  -2.033  1.00 39.86  ? 156 THR A CA    1 
ATOM   1183 C  C     . THR A 1 156 ? 9.012   22.228  -3.231  1.00 38.61  ? 156 THR A C     1 
ATOM   1184 O  O     . THR A 1 156 ? 8.382   21.193  -3.324  1.00 35.51  ? 156 THR A O     1 
ATOM   1185 C  CB    . THR A 1 156 ? 9.767   22.825  -0.842  1.00 39.32  ? 156 THR A CB    1 
ATOM   1186 O  OG1   . THR A 1 156 ? 9.834   21.434  -0.669  1.00 39.80  ? 156 THR A OG1   1 
ATOM   1187 C  CG2   . THR A 1 156 ? 9.415   23.454  0.460   1.00 39.44  ? 156 THR A CG2   1 
ATOM   1188 N  N     . PRO A 1 157 ? 9.898   22.631  -4.160  1.00 40.40  ? 157 PRO A N     1 
ATOM   1189 C  CA    . PRO A 1 157 ? 10.064  21.824  -5.361  1.00 42.02  ? 157 PRO A CA    1 
ATOM   1190 C  C     . PRO A 1 157 ? 10.357  20.364  -5.049  1.00 41.31  ? 157 PRO A C     1 
ATOM   1191 O  O     . PRO A 1 157 ? 11.130  20.100  -4.178  1.00 42.92  ? 157 PRO A O     1 
ATOM   1192 C  CB    . PRO A 1 157 ? 11.230  22.531  -6.079  1.00 43.25  ? 157 PRO A CB    1 
ATOM   1193 C  CG    . PRO A 1 157 ? 11.076  23.972  -5.725  1.00 43.83  ? 157 PRO A CG    1 
ATOM   1194 C  CD    . PRO A 1 157 ? 10.451  24.001  -4.337  1.00 42.11  ? 157 PRO A CD    1 
ATOM   1195 N  N     . ARG A 1 158 ? 9.677   19.420  -5.664  1.00 41.63  ? 158 ARG A N     1 
ATOM   1196 C  CA    . ARG A 1 158 ? 10.016  18.059  -5.398  1.00 42.24  ? 158 ARG A CA    1 
ATOM   1197 C  C     . ARG A 1 158 ? 11.413  17.693  -5.874  1.00 46.38  ? 158 ARG A C     1 
ATOM   1198 O  O     . ARG A 1 158 ? 11.789  18.023  -6.989  1.00 48.18  ? 158 ARG A O     1 
ATOM   1199 C  CB    . ARG A 1 158 ? 9.033   17.100  -6.025  1.00 41.71  ? 158 ARG A CB    1 
ATOM   1200 C  CG    . ARG A 1 158 ? 8.057   16.631  -4.988  1.00 41.16  ? 158 ARG A CG    1 
ATOM   1201 C  CD    . ARG A 1 158 ? 7.189   15.581  -5.535  1.00 39.95  ? 158 ARG A CD    1 
ATOM   1202 N  NE    . ARG A 1 158 ? 7.711   14.262  -5.278  1.00 38.27  ? 158 ARG A NE    1 
ATOM   1203 C  CZ    . ARG A 1 158 ? 7.423   13.505  -4.219  1.00 35.93  ? 158 ARG A CZ    1 
ATOM   1204 N  NH1   . ARG A 1 158 ? 6.681   13.971  -3.186  1.00 34.98  ? 158 ARG A NH1   1 
ATOM   1205 N  NH2   . ARG A 1 158 ? 7.906   12.267  -4.195  1.00 33.72  ? 158 ARG A NH2   1 
ATOM   1206 N  N     . PRO A 1 159 ? 12.180  16.972  -5.026  1.00 51.25  ? 159 PRO A N     1 
ATOM   1207 C  CA    . PRO A 1 159 ? 13.458  16.328  -5.417  1.00 53.65  ? 159 PRO A CA    1 
ATOM   1208 C  C     . PRO A 1 159 ? 13.530  15.786  -6.843  1.00 55.24  ? 159 PRO A C     1 
ATOM   1209 O  O     . PRO A 1 159 ? 12.784  14.871  -7.164  1.00 56.39  ? 159 PRO A O     1 
ATOM   1210 C  CB    . PRO A 1 159 ? 13.526  15.133  -4.436  1.00 51.64  ? 159 PRO A CB    1 
ATOM   1211 C  CG    . PRO A 1 159 ? 12.901  15.669  -3.180  1.00 50.83  ? 159 PRO A CG    1 
ATOM   1212 C  CD    . PRO A 1 159 ? 11.889  16.730  -3.591  1.00 50.43  ? 159 PRO A CD    1 
ATOM   1213 N  N     . GLU A 1 160 ? 14.406  16.333  -7.679  1.00 60.33  ? 160 GLU A N     1 
ATOM   1214 C  CA    . GLU A 1 160 ? 14.709  15.713  -8.991  1.00 63.47  ? 160 GLU A CA    1 
ATOM   1215 C  C     . GLU A 1 160 ? 15.872  14.712  -8.799  1.00 64.34  ? 160 GLU A C     1 
ATOM   1216 O  O     . GLU A 1 160 ? 17.061  15.095  -8.907  1.00 61.90  ? 160 GLU A O     1 
ATOM   1217 C  CB    . GLU A 1 160 ? 15.031  16.806  -10.063 1.00 65.06  ? 160 GLU A CB    1 
ATOM   1218 C  CG    . GLU A 1 160 ? 15.014  16.343  -11.529 0.50 65.60  ? 160 GLU A CG    1 
ATOM   1219 C  CD    . GLU A 1 160 ? 16.352  16.499  -12.256 0.50 66.63  ? 160 GLU A CD    1 
ATOM   1220 O  OE1   . GLU A 1 160 ? 16.892  17.624  -12.282 0.50 66.21  ? 160 GLU A OE1   1 
ATOM   1221 O  OE2   . GLU A 1 160 ? 16.857  15.504  -12.824 0.50 64.57  ? 160 GLU A OE2   1 
ATOM   1222 N  N     . ILE A 1 161 ? 15.547  13.450  -8.467  1.00 63.60  ? 161 ILE A N     1 
ATOM   1223 C  CA    . ILE A 1 161 ? 16.591  12.386  -8.423  1.00 63.33  ? 161 ILE A CA    1 
ATOM   1224 C  C     . ILE A 1 161 ? 16.422  11.550  -9.696  1.00 66.63  ? 161 ILE A C     1 
ATOM   1225 O  O     . ILE A 1 161 ? 15.349  11.041  -9.960  1.00 65.90  ? 161 ILE A O     1 
ATOM   1226 C  CB    . ILE A 1 161 ? 16.642  11.538  -7.120  0.50 57.66  ? 161 ILE A CB    1 
ATOM   1227 C  CG1   . ILE A 1 161 ? 16.494  12.415  -5.856  0.50 55.61  ? 161 ILE A CG1   1 
ATOM   1228 C  CG2   . ILE A 1 161 ? 17.972  10.779  -7.043  0.50 56.15  ? 161 ILE A CG2   1 
ATOM   1229 C  CD1   . ILE A 1 161 ? 17.695  13.290  -5.515  0.50 55.14  ? 161 ILE A CD1   1 
ATOM   1230 N  N     . ASN A 1 162 ? 17.473  11.493  -10.519 1.00 71.90  ? 162 ASN A N     1 
ATOM   1231 C  CA    . ASN A 1 162 ? 17.376  10.801  -11.819 1.00 76.77  ? 162 ASN A CA    1 
ATOM   1232 C  C     . ASN A 1 162 ? 17.613  9.301   -11.656 1.00 75.34  ? 162 ASN A C     1 
ATOM   1233 O  O     . ASN A 1 162 ? 17.880  8.819   -10.538 1.00 72.20  ? 162 ASN A O     1 
ATOM   1234 C  CB    . ASN A 1 162 ? 18.216  11.449  -12.993 1.00 80.30  ? 162 ASN A CB    1 
ATOM   1235 C  CG    . ASN A 1 162 ? 19.673  11.748  -12.630 1.00 82.08  ? 162 ASN A CG    1 
ATOM   1236 O  OD1   . ASN A 1 162 ? 19.947  12.370  -11.604 1.00 86.71  ? 162 ASN A OD1   1 
ATOM   1237 N  ND2   . ASN A 1 162 ? 20.608  11.337  -13.485 1.00 81.05  ? 162 ASN A ND2   1 
ATOM   1238 N  N     . ASN A 1 163 ? 17.385  8.602   -12.776 1.00 77.65  ? 163 ASN A N     1 
ATOM   1239 C  CA    . ASN A 1 163 ? 17.595  7.145   -12.999 1.00 75.80  ? 163 ASN A CA    1 
ATOM   1240 C  C     . ASN A 1 163 ? 18.367  6.425   -11.900 1.00 65.24  ? 163 ASN A C     1 
ATOM   1241 O  O     . ASN A 1 163 ? 19.604  6.443   -11.943 1.00 66.42  ? 163 ASN A O     1 
ATOM   1242 C  CB    . ASN A 1 163 ? 18.383  6.907   -14.342 1.00 85.08  ? 163 ASN A CB    1 
ATOM   1243 C  CG    . ASN A 1 163 ? 17.562  7.186   -15.614 1.00 88.11  ? 163 ASN A CG    1 
ATOM   1244 O  OD1   . ASN A 1 163 ? 16.366  6.859   -15.702 1.00 88.55  ? 163 ASN A OD1   1 
ATOM   1245 N  ND2   . ASN A 1 163 ? 18.230  7.750   -16.628 1.00 87.59  ? 163 ASN A ND2   1 
ATOM   1246 N  N     A LYS A 1 164 ? 17.640  5.800   -10.966 0.50 58.92  ? 164 LYS A N     1 
ATOM   1247 N  N     B LYS A 1 164 ? 17.674  5.841   -10.917 0.50 58.87  ? 164 LYS A N     1 
ATOM   1248 C  CA    A LYS A 1 164 ? 18.216  5.011   -9.883  0.50 52.90  ? 164 LYS A CA    1 
ATOM   1249 C  CA    B LYS A 1 164 ? 18.344  5.030   -9.899  0.50 53.02  ? 164 LYS A CA    1 
ATOM   1250 C  C     A LYS A 1 164 ? 18.197  3.504   -10.219 0.50 49.82  ? 164 LYS A C     1 
ATOM   1251 C  C     B LYS A 1 164 ? 18.216  3.528   -10.194 0.50 49.92  ? 164 LYS A C     1 
ATOM   1252 O  O     A LYS A 1 164 ? 17.156  2.961   -10.607 0.50 47.66  ? 164 LYS A O     1 
ATOM   1253 O  O     B LYS A 1 164 ? 17.139  3.019   -10.528 0.50 47.90  ? 164 LYS A O     1 
ATOM   1254 C  CB    A LYS A 1 164 ? 17.448  5.299   -8.592  0.50 51.05  ? 164 LYS A CB    1 
ATOM   1255 C  CB    B LYS A 1 164 ? 17.875  5.379   -8.488  0.50 51.50  ? 164 LYS A CB    1 
ATOM   1256 C  CG    A LYS A 1 164 ? 17.772  6.675   -8.013  0.50 50.74  ? 164 LYS A CG    1 
ATOM   1257 C  CG    B LYS A 1 164 ? 18.794  6.394   -7.799  0.50 50.92  ? 164 LYS A CG    1 
ATOM   1258 C  CD    A LYS A 1 164 ? 16.748  7.164   -6.986  0.50 48.02  ? 164 LYS A CD    1 
ATOM   1259 C  CD    B LYS A 1 164 ? 18.075  7.126   -6.683  0.50 49.47  ? 164 LYS A CD    1 
ATOM   1260 C  CE    A LYS A 1 164 ? 15.324  7.295   -7.530  0.50 45.19  ? 164 LYS A CE    1 
ATOM   1261 C  CE    B LYS A 1 164 ? 18.329  6.518   -5.324  0.50 47.72  ? 164 LYS A CE    1 
ATOM   1262 N  NZ    A LYS A 1 164 ? 14.837  8.659   -7.841  0.50 44.41  ? 164 LYS A NZ    1 
ATOM   1263 N  NZ    B LYS A 1 164 ? 19.041  7.519   -4.511  0.50 49.62  ? 164 LYS A NZ    1 
ATOM   1264 N  N     . ASN A 1 165 ? 19.359  2.852   -10.100 1.00 47.44  ? 165 ASN A N     1 
ATOM   1265 C  CA    . ASN A 1 165 ? 19.472  1.436   -10.286 1.00 43.65  ? 165 ASN A CA    1 
ATOM   1266 C  C     . ASN A 1 165 ? 18.962  0.664   -9.075  1.00 37.09  ? 165 ASN A C     1 
ATOM   1267 O  O     . ASN A 1 165 ? 19.043  1.145   -7.966  1.00 32.96  ? 165 ASN A O     1 
ATOM   1268 C  CB    . ASN A 1 165 ? 20.928  1.075   -10.467 1.00 46.51  ? 165 ASN A CB    1 
ATOM   1269 C  CG    . ASN A 1 165 ? 21.443  1.462   -11.825 1.00 52.00  ? 165 ASN A CG    1 
ATOM   1270 O  OD1   . ASN A 1 165 ? 20.767  2.173   -12.586 1.00 51.77  ? 165 ASN A OD1   1 
ATOM   1271 N  ND2   . ASN A 1 165 ? 22.665  1.005   -12.144 1.00 54.39  ? 165 ASN A ND2   1 
ATOM   1272 N  N     . ILE A 1 166 ? 18.558  -0.575  -9.319  1.00 31.81  ? 166 ILE A N     1 
ATOM   1273 C  CA    . ILE A 1 166 ? 18.307  -1.515  -8.248  1.00 29.73  ? 166 ILE A CA    1 
ATOM   1274 C  C     . ILE A 1 166 ? 19.601  -1.736  -7.464  1.00 27.47  ? 166 ILE A C     1 
ATOM   1275 O  O     . ILE A 1 166 ? 20.561  -2.156  -8.010  1.00 28.40  ? 166 ILE A O     1 
ATOM   1276 C  CB    . ILE A 1 166 ? 17.740  -2.812  -8.772  1.00 28.64  ? 166 ILE A CB    1 
ATOM   1277 C  CG1   . ILE A 1 166 ? 16.362  -2.494  -9.342  1.00 28.03  ? 166 ILE A CG1   1 
ATOM   1278 C  CG2   . ILE A 1 166 ? 17.750  -3.876  -7.657  1.00 27.92  ? 166 ILE A CG2   1 
ATOM   1279 C  CD1   . ILE A 1 166 ? 15.665  -3.625  -10.055 1.00 29.15  ? 166 ILE A CD1   1 
ATOM   1280 N  N     . PRO A 1 167 ? 19.616  -1.351  -6.183  1.00 24.73  ? 167 PRO A N     1 
ATOM   1281 C  CA    . PRO A 1 167 ? 20.894  -1.321  -5.455  1.00 24.30  ? 167 PRO A CA    1 
ATOM   1282 C  C     . PRO A 1 167 ? 21.440  -2.662  -5.047  1.00 23.26  ? 167 PRO A C     1 
ATOM   1283 O  O     . PRO A 1 167 ? 22.575  -2.786  -4.702  1.00 25.01  ? 167 PRO A O     1 
ATOM   1284 C  CB    . PRO A 1 167 ? 20.544  -0.489  -4.210  1.00 24.05  ? 167 PRO A CB    1 
ATOM   1285 C  CG    . PRO A 1 167 ? 19.049  -0.571  -4.033  1.00 23.11  ? 167 PRO A CG    1 
ATOM   1286 C  CD    . PRO A 1 167 ? 18.497  -0.766  -5.421  1.00 23.52  ? 167 PRO A CD    1 
ATOM   1287 N  N     . ASP A 1 168 ? 20.626  -3.682  -5.027  1.00 22.74  ? 168 ASP A N     1 
ATOM   1288 C  CA    . ASP A 1 168 ? 20.997  -4.940  -4.409  1.00 22.70  ? 168 ASP A CA    1 
ATOM   1289 C  C     . ASP A 1 168 ? 19.826  -5.827  -4.693  1.00 21.96  ? 168 ASP A C     1 
ATOM   1290 O  O     . ASP A 1 168 ? 18.689  -5.366  -4.620  1.00 22.24  ? 168 ASP A O     1 
ATOM   1291 C  CB    . ASP A 1 168 ? 21.136  -4.827  -2.840  1.00 22.82  ? 168 ASP A CB    1 
ATOM   1292 C  CG    . ASP A 1 168 ? 21.731  -6.088  -2.210  1.00 23.64  ? 168 ASP A CG    1 
ATOM   1293 O  OD1   . ASP A 1 168 ? 21.050  -7.064  -1.841  1.00 23.75  ? 168 ASP A OD1   1 
ATOM   1294 O  OD2   . ASP A 1 168 ? 22.920  -6.126  -2.160  1.00 24.94  ? 168 ASP A OD2   1 
ATOM   1295 N  N     . PRO A 1 169 ? 20.089  -7.107  -4.945  1.00 21.30  ? 169 PRO A N     1 
ATOM   1296 C  CA    . PRO A 1 169 ? 19.042  -7.970  -5.243  1.00 20.03  ? 169 PRO A CA    1 
ATOM   1297 C  C     . PRO A 1 169 ? 18.039  -8.158  -4.160  1.00 18.99  ? 169 PRO A C     1 
ATOM   1298 O  O     . PRO A 1 169 ? 16.894  -8.552  -4.464  1.00 17.11  ? 169 PRO A O     1 
ATOM   1299 C  CB    . PRO A 1 169 ? 19.755  -9.313  -5.507  1.00 20.98  ? 169 PRO A CB    1 
ATOM   1300 C  CG    . PRO A 1 169 ? 21.170  -9.134  -5.050  1.00 22.29  ? 169 PRO A CG    1 
ATOM   1301 C  CD    . PRO A 1 169 ? 21.408  -7.693  -5.227  1.00 22.12  ? 169 PRO A CD    1 
ATOM   1302 N  N     . PHE A 1 170 ? 18.485  -8.038  -2.916  1.00 19.34  ? 170 PHE A N     1 
ATOM   1303 C  CA    . PHE A 1 170 ? 17.575  -8.039  -1.818  1.00 19.23  ? 170 PHE A CA    1 
ATOM   1304 C  C     . PHE A 1 170 ? 16.583  -6.933  -1.866  1.00 18.45  ? 170 PHE A C     1 
ATOM   1305 O  O     . PHE A 1 170 ? 15.524  -7.079  -1.323  1.00 19.12  ? 170 PHE A O     1 
ATOM   1306 C  CB    . PHE A 1 170 ? 18.312  -8.027  -0.476  1.00 20.88  ? 170 PHE A CB    1 
ATOM   1307 C  CG    . PHE A 1 170 ? 18.680  -9.434  0.016   1.00 22.59  ? 170 PHE A CG    1 
ATOM   1308 C  CD1   . PHE A 1 170 ? 17.691  -10.330 0.391   1.00 22.33  ? 170 PHE A CD1   1 
ATOM   1309 C  CD2   . PHE A 1 170 ? 20.004  -9.855  0.066   1.00 24.48  ? 170 PHE A CD2   1 
ATOM   1310 C  CE1   . PHE A 1 170 ? 18.022  -11.636 0.845   1.00 24.40  ? 170 PHE A CE1   1 
ATOM   1311 C  CE2   . PHE A 1 170 ? 20.336  -11.164 0.512   1.00 26.18  ? 170 PHE A CE2   1 
ATOM   1312 C  CZ    . PHE A 1 170 ? 19.340  -12.058 0.923   1.00 24.50  ? 170 PHE A CZ    1 
ATOM   1313 N  N     . TRP A 1 171 ? 16.896  -5.810  -2.487  1.00 18.52  ? 171 TRP A N     1 
ATOM   1314 C  CA    . TRP A 1 171 ? 15.896  -4.758  -2.666  1.00 18.24  ? 171 TRP A CA    1 
ATOM   1315 C  C     . TRP A 1 171 ? 14.731  -5.283  -3.480  1.00 18.62  ? 171 TRP A C     1 
ATOM   1316 O  O     . TRP A 1 171 ? 13.567  -5.104  -3.132  1.00 18.78  ? 171 TRP A O     1 
ATOM   1317 C  CB    . TRP A 1 171 ? 16.527  -3.534  -3.318  1.00 18.43  ? 171 TRP A CB    1 
ATOM   1318 C  CG    . TRP A 1 171 ? 15.578  -2.449  -3.486  1.00 18.05  ? 171 TRP A CG    1 
ATOM   1319 C  CD1   . TRP A 1 171 ? 15.381  -1.367  -2.665  1.00 17.38  ? 171 TRP A CD1   1 
ATOM   1320 C  CD2   . TRP A 1 171 ? 14.651  -2.323  -4.561  1.00 17.79  ? 171 TRP A CD2   1 
ATOM   1321 N  NE1   . TRP A 1 171 ? 14.404  -0.589  -3.179  1.00 16.92  ? 171 TRP A NE1   1 
ATOM   1322 C  CE2   . TRP A 1 171 ? 13.924  -1.168  -4.336  1.00 17.41  ? 171 TRP A CE2   1 
ATOM   1323 C  CE3   . TRP A 1 171 ? 14.387  -3.087  -5.709  1.00 18.83  ? 171 TRP A CE3   1 
ATOM   1324 C  CZ2   . TRP A 1 171 ? 12.895  -0.753  -5.187  1.00 18.04  ? 171 TRP A CZ2   1 
ATOM   1325 C  CZ3   . TRP A 1 171 ? 13.370  -2.683  -6.562  1.00 19.05  ? 171 TRP A CZ3   1 
ATOM   1326 C  CH2   . TRP A 1 171 ? 12.610  -1.509  -6.280  1.00 18.72  ? 171 TRP A CH2   1 
ATOM   1327 N  N     . LEU A 1 172 ? 15.039  -6.020  -4.525  1.00 19.01  ? 172 LEU A N     1 
ATOM   1328 C  CA    . LEU A 1 172 ? 13.974  -6.546  -5.332  1.00 19.63  ? 172 LEU A CA    1 
ATOM   1329 C  C     . LEU A 1 172 ? 13.129  -7.586  -4.573  1.00 18.14  ? 172 LEU A C     1 
ATOM   1330 O  O     . LEU A 1 172 ? 11.916  -7.596  -4.697  1.00 17.16  ? 172 LEU A O     1 
ATOM   1331 C  CB    . LEU A 1 172 ? 14.551  -7.109  -6.657  1.00 21.20  ? 172 LEU A CB    1 
ATOM   1332 C  CG    . LEU A 1 172 ? 13.524  -7.509  -7.718  1.00 22.27  ? 172 LEU A CG    1 
ATOM   1333 C  CD1   . LEU A 1 172 ? 12.571  -6.299  -8.109  1.00 23.04  ? 172 LEU A CD1   1 
ATOM   1334 C  CD2   . LEU A 1 172 ? 14.203  -8.129  -8.924  1.00 22.70  ? 172 LEU A CD2   1 
ATOM   1335 N  N     . ALA A 1 173 ? 13.756  -8.449  -3.769  1.00 17.44  ? 173 ALA A N     1 
ATOM   1336 C  CA    . ALA A 1 173 ? 12.990  -9.310  -2.916  1.00 16.75  ? 173 ALA A CA    1 
ATOM   1337 C  C     . ALA A 1 173 ? 11.989  -8.512  -2.077  1.00 16.05  ? 173 ALA A C     1 
ATOM   1338 O  O     . ALA A 1 173 ? 10.803  -8.853  -1.976  1.00 15.86  ? 173 ALA A O     1 
ATOM   1339 C  CB    . ALA A 1 173 ? 13.902  -10.224 -2.026  1.00 17.29  ? 173 ALA A CB    1 
ATOM   1340 N  N     . GLY A 1 174 ? 12.439  -7.441  -1.461  1.00 15.84  ? 174 GLY A N     1 
ATOM   1341 C  CA    . GLY A 1 174 ? 11.516  -6.683  -0.580  1.00 16.11  ? 174 GLY A CA    1 
ATOM   1342 C  C     . GLY A 1 174 ? 10.431  -5.986  -1.291  1.00 16.66  ? 174 GLY A C     1 
ATOM   1343 O  O     . GLY A 1 174 ? 9.253   -5.878  -0.831  1.00 16.87  ? 174 GLY A O     1 
ATOM   1344 N  N     . PHE A 1 175 ? 10.822  -5.440  -2.407  1.00 17.26  ? 175 PHE A N     1 
ATOM   1345 C  CA    . PHE A 1 175 ? 9.875   -4.737  -3.222  1.00 18.75  ? 175 PHE A CA    1 
ATOM   1346 C  C     . PHE A 1 175 ? 8.781   -5.631  -3.778  1.00 19.04  ? 175 PHE A C     1 
ATOM   1347 O  O     . PHE A 1 175 ? 7.622   -5.272  -3.771  1.00 20.04  ? 175 PHE A O     1 
ATOM   1348 C  CB    . PHE A 1 175 ? 10.631  -4.074  -4.353  1.00 19.33  ? 175 PHE A CB    1 
ATOM   1349 C  CG    . PHE A 1 175 ? 9.810   -3.151  -5.168  1.00 20.33  ? 175 PHE A CG    1 
ATOM   1350 C  CD1   . PHE A 1 175 ? 9.387   -1.973  -4.655  1.00 20.48  ? 175 PHE A CD1   1 
ATOM   1351 C  CD2   . PHE A 1 175 ? 9.530   -3.441  -6.501  1.00 21.45  ? 175 PHE A CD2   1 
ATOM   1352 C  CE1   . PHE A 1 175 ? 8.653   -1.106  -5.465  1.00 22.19  ? 175 PHE A CE1   1 
ATOM   1353 C  CE2   . PHE A 1 175 ? 8.854   -2.558  -7.317  1.00 22.09  ? 175 PHE A CE2   1 
ATOM   1354 C  CZ    . PHE A 1 175 ? 8.431   -1.372  -6.798  1.00 21.74  ? 175 PHE A CZ    1 
ATOM   1355 N  N     . VAL A 1 176 ? 9.163   -6.805  -4.252  1.00 19.64  ? 176 VAL A N     1 
ATOM   1356 C  CA    . VAL A 1 176 ? 8.202   -7.762  -4.777  1.00 18.96  ? 176 VAL A CA    1 
ATOM   1357 C  C     . VAL A 1 176 ? 7.352   -8.261  -3.664  1.00 18.89  ? 176 VAL A C     1 
ATOM   1358 O  O     . VAL A 1 176 ? 6.181   -8.588  -3.875  1.00 19.15  ? 176 VAL A O     1 
ATOM   1359 C  CB    . VAL A 1 176 ? 8.890   -8.916  -5.486  1.00 18.78  ? 176 VAL A CB    1 
ATOM   1360 C  CG1   . VAL A 1 176 ? 7.906   -10.064 -5.797  1.00 18.59  ? 176 VAL A CG1   1 
ATOM   1361 C  CG2   . VAL A 1 176 ? 9.518   -8.408  -6.781  1.00 18.75  ? 176 VAL A CG2   1 
ATOM   1362 N  N     . SER A 1 177 ? 7.907   -8.326  -2.461  1.00 18.73  ? 177 SER A N     1 
ATOM   1363 C  CA    . SER A 1 177 ? 7.076   -8.660  -1.300  1.00 18.34  ? 177 SER A CA    1 
ATOM   1364 C  C     . SER A 1 177 ? 5.903   -7.741  -1.063  1.00 18.80  ? 177 SER A C     1 
ATOM   1365 O  O     . SER A 1 177 ? 4.881   -8.167  -0.482  1.00 18.73  ? 177 SER A O     1 
ATOM   1366 C  CB    . SER A 1 177 ? 7.918   -8.709  -0.015  1.00 18.91  ? 177 SER A CB    1 
ATOM   1367 O  OG    . SER A 1 177 ? 8.982   -9.613  -0.178  1.00 18.24  ? 177 SER A OG    1 
ATOM   1368 N  N     . GLY A 1 178 ? 6.032   -6.488  -1.481  1.00 19.29  ? 178 GLY A N     1 
ATOM   1369 C  CA    . GLY A 1 178 ? 4.965   -5.554  -1.382  1.00 20.92  ? 178 GLY A CA    1 
ATOM   1370 C  C     . GLY A 1 178 ? 4.122   -5.327  -2.618  1.00 21.85  ? 178 GLY A C     1 
ATOM   1371 O  O     . GLY A 1 178 ? 2.911   -5.228  -2.564  1.00 24.65  ? 178 GLY A O     1 
ATOM   1372 N  N     . ASP A 1 179 ? 4.790   -5.170  -3.738  1.00 22.03  ? 179 ASP A N     1 
ATOM   1373 C  CA    . ASP A 1 179 ? 4.121   -4.831  -4.982  1.00 23.76  ? 179 ASP A CA    1 
ATOM   1374 C  C     . ASP A 1 179 ? 4.141   -5.912  -6.084  1.00 22.88  ? 179 ASP A C     1 
ATOM   1375 O  O     . ASP A 1 179 ? 3.697   -5.661  -7.239  1.00 21.72  ? 179 ASP A O     1 
ATOM   1376 C  CB    . ASP A 1 179 ? 4.757   -3.550  -5.532  1.00 24.30  ? 179 ASP A CB    1 
ATOM   1377 C  CG    . ASP A 1 179 ? 4.257   -2.297  -4.794  1.00 24.85  ? 179 ASP A CG    1 
ATOM   1378 O  OD1   . ASP A 1 179 ? 3.340   -2.442  -3.942  1.00 23.65  ? 179 ASP A OD1   1 
ATOM   1379 O  OD2   . ASP A 1 179 ? 4.810   -1.210  -5.115  1.00 25.01  ? 179 ASP A OD2   1 
ATOM   1380 N  N     . GLY A 1 180 ? 4.626   -7.092  -5.731  1.00 22.94  ? 180 GLY A N     1 
ATOM   1381 C  CA    . GLY A 1 180 ? 4.701   -8.225  -6.708  1.00 23.60  ? 180 GLY A CA    1 
ATOM   1382 C  C     . GLY A 1 180 ? 3.473   -9.145  -6.534  1.00 24.17  ? 180 GLY A C     1 
ATOM   1383 O  O     . GLY A 1 180 ? 2.815   -9.103  -5.500  1.00 24.90  ? 180 GLY A O     1 
ATOM   1384 N  N     . SER A 1 181 ? 3.160   -9.945  -7.539  1.00 24.12  ? 181 SER A N     1 
ATOM   1385 C  CA    . SER A 1 181 ? 2.100   -10.928 -7.429  1.00 23.49  ? 181 SER A CA    1 
ATOM   1386 C  C     . SER A 1 181 ? 2.578   -12.190 -8.064  1.00 21.95  ? 181 SER A C     1 
ATOM   1387 O  O     . SER A 1 181 ? 3.104   -12.157 -9.129  1.00 20.41  ? 181 SER A O     1 
ATOM   1388 C  CB    . SER A 1 181 ? 0.861   -10.515 -8.196  1.00 25.30  ? 181 SER A CB    1 
ATOM   1389 O  OG    . SER A 1 181 ? 0.384   -9.310  -7.759  1.00 27.88  ? 181 SER A OG    1 
ATOM   1390 N  N     . PHE A 1 182 ? 2.347   -13.299 -7.400  1.00 21.30  ? 182 PHE A N     1 
ATOM   1391 C  CA    . PHE A 1 182 ? 2.623   -14.591 -7.967  1.00 22.67  ? 182 PHE A CA    1 
ATOM   1392 C  C     . PHE A 1 182 ? 1.280   -15.203 -8.335  1.00 22.12  ? 182 PHE A C     1 
ATOM   1393 O  O     . PHE A 1 182 ? 0.602   -15.647 -7.470  1.00 22.55  ? 182 PHE A O     1 
ATOM   1394 C  CB    . PHE A 1 182 ? 3.397   -15.430 -6.953  1.00 22.68  ? 182 PHE A CB    1 
ATOM   1395 C  CG    . PHE A 1 182 ? 4.734   -14.919 -6.712  1.00 21.65  ? 182 PHE A CG    1 
ATOM   1396 C  CD1   . PHE A 1 182 ? 5.795   -15.275 -7.542  1.00 21.75  ? 182 PHE A CD1   1 
ATOM   1397 C  CD2   . PHE A 1 182 ? 4.987   -14.113 -5.616  1.00 22.38  ? 182 PHE A CD2   1 
ATOM   1398 C  CE1   . PHE A 1 182 ? 7.089   -14.783 -7.280  1.00 21.33  ? 182 PHE A CE1   1 
ATOM   1399 C  CE2   . PHE A 1 182 ? 6.286   -13.649 -5.353  1.00 20.95  ? 182 PHE A CE2   1 
ATOM   1400 C  CZ    . PHE A 1 182 ? 7.323   -13.977 -6.172  1.00 19.83  ? 182 PHE A CZ    1 
ATOM   1401 N  N     . LYS A 1 183 ? 0.880   -15.114 -9.596  1.00 22.53  ? 183 LYS A N     1 
ATOM   1402 C  CA    . LYS A 1 183 ? -0.505  -15.430 -9.979  1.00 23.71  ? 183 LYS A CA    1 
ATOM   1403 C  C     . LYS A 1 183 ? -0.505  -16.805 -10.597 1.00 23.74  ? 183 LYS A C     1 
ATOM   1404 O  O     . LYS A 1 183 ? 0.406   -17.202 -11.358 1.00 21.96  ? 183 LYS A O     1 
ATOM   1405 C  CB    . LYS A 1 183 ? -1.104  -14.427 -10.962 1.00 24.78  ? 183 LYS A CB    1 
ATOM   1406 C  CG    . LYS A 1 183 ? -1.054  -13.011 -10.468 1.00 25.15  ? 183 LYS A CG    1 
ATOM   1407 C  CD    . LYS A 1 183 ? -1.855  -12.041 -11.323 1.00 27.42  ? 183 LYS A CD    1 
ATOM   1408 C  CE    . LYS A 1 183 ? -1.436  -11.899 -12.787 1.00 27.24  ? 183 LYS A CE    1 
ATOM   1409 N  NZ    . LYS A 1 183 ? -2.344  -10.829 -13.304 1.00 29.38  ? 183 LYS A NZ    1 
ATOM   1410 N  N     . SER A 1 184 ? -1.511  -17.548 -10.172 1.00 24.91  ? 184 SER A N     1 
ATOM   1411 C  CA    . SER A 1 184 ? -1.879  -18.792 -10.817 1.00 25.71  ? 184 SER A CA    1 
ATOM   1412 C  C     . SER A 1 184 ? -3.230  -18.577 -11.431 1.00 26.69  ? 184 SER A C     1 
ATOM   1413 O  O     . SER A 1 184 ? -4.181  -18.359 -10.695 1.00 28.27  ? 184 SER A O     1 
ATOM   1414 C  CB    . SER A 1 184 ? -2.004  -19.923 -9.779  1.00 25.59  ? 184 SER A CB    1 
ATOM   1415 O  OG    . SER A 1 184 ? -2.601  -21.076 -10.390 1.00 26.83  ? 184 SER A OG    1 
ATOM   1416 N  N     . ILE A 1 185 ? -3.335  -18.750 -12.743 1.00 26.58  ? 185 ILE A N     1 
ATOM   1417 C  CA    . ILE A 1 185 ? -4.614  -18.624 -13.467 1.00 27.00  ? 185 ILE A CA    1 
ATOM   1418 C  C     . ILE A 1 185 ? -5.004  -19.955 -14.124 1.00 26.71  ? 185 ILE A C     1 
ATOM   1419 O  O     . ILE A 1 185 ? -4.142  -20.687 -14.629 1.00 25.96  ? 185 ILE A O     1 
ATOM   1420 C  CB    . ILE A 1 185 ? -4.465  -17.568 -14.605 1.00 28.29  ? 185 ILE A CB    1 
ATOM   1421 C  CG1   . ILE A 1 185 ? -3.825  -16.265 -14.084 1.00 28.05  ? 185 ILE A CG1   1 
ATOM   1422 C  CG2   . ILE A 1 185 ? -5.821  -17.243 -15.213 1.00 29.38  ? 185 ILE A CG2   1 
ATOM   1423 C  CD1   . ILE A 1 185 ? -4.763  -15.516 -13.155 1.00 28.19  ? 185 ILE A CD1   1 
ATOM   1424 N  N     . LEU A 1 186 ? -6.294  -20.275 -14.017 1.00 27.85  ? 186 LEU A N     1 
ATOM   1425 C  CA    . LEU A 1 186 ? -6.963  -21.385 -14.647 1.00 29.05  ? 186 LEU A CA    1 
ATOM   1426 C  C     . LEU A 1 186 ? -8.073  -20.757 -15.521 1.00 29.70  ? 186 LEU A C     1 
ATOM   1427 O  O     . LEU A 1 186 ? -9.071  -20.263 -15.068 1.00 30.22  ? 186 LEU A O     1 
ATOM   1428 C  CB    . LEU A 1 186 ? -7.561  -22.380 -13.638 1.00 29.66  ? 186 LEU A CB    1 
ATOM   1429 C  CG    . LEU A 1 186 ? -6.500  -23.123 -12.786 1.00 29.32  ? 186 LEU A CG    1 
ATOM   1430 C  CD1   . LEU A 1 186 ? -7.233  -24.101 -11.922 1.00 30.80  ? 186 LEU A CD1   1 
ATOM   1431 C  CD2   . LEU A 1 186 ? -5.478  -23.888 -13.559 1.00 27.92  ? 186 LEU A CD2   1 
ATOM   1432 N  N     . LYS A 1 187 ? -7.861  -20.865 -16.799 1.00 30.66  ? 187 LYS A N     1 
ATOM   1433 C  CA    . LYS A 1 187 ? -8.546  -20.128 -17.822 1.00 31.78  ? 187 LYS A CA    1 
ATOM   1434 C  C     . LYS A 1 187 ? -9.288  -21.111 -18.728 1.00 32.03  ? 187 LYS A C     1 
ATOM   1435 O  O     . LYS A 1 187 ? -8.694  -22.057 -19.230 1.00 30.58  ? 187 LYS A O     1 
ATOM   1436 C  CB    . LYS A 1 187 ? -7.392  -19.437 -18.531 1.00 32.82  ? 187 LYS A CB    1 
ATOM   1437 C  CG    . LYS A 1 187 ? -7.738  -18.699 -19.769 1.00 36.81  ? 187 LYS A CG    1 
ATOM   1438 C  CD    . LYS A 1 187 ? -6.439  -18.097 -20.277 1.00 38.30  ? 187 LYS A CD    1 
ATOM   1439 C  CE    . LYS A 1 187 ? -6.701  -17.120 -21.420 1.00 39.09  ? 187 LYS A CE    1 
ATOM   1440 N  NZ    . LYS A 1 187 ? -7.547  -17.739 -22.490 1.00 41.93  ? 187 LYS A NZ    1 
ATOM   1441 N  N     . LYS A 1 188 ? -10.568 -20.889 -18.965 1.00 34.01  ? 188 LYS A N     1 
ATOM   1442 C  CA    . LYS A 1 188 ? -11.320 -21.769 -19.864 1.00 37.23  ? 188 LYS A CA    1 
ATOM   1443 C  C     . LYS A 1 188 ? -10.711 -21.795 -21.289 1.00 37.15  ? 188 LYS A C     1 
ATOM   1444 O  O     . LYS A 1 188 ? -10.425 -20.753 -21.855 1.00 36.93  ? 188 LYS A O     1 
ATOM   1445 C  CB    . LYS A 1 188 ? -12.786 -21.371 -19.908 1.00 40.39  ? 188 LYS A CB    1 
ATOM   1446 C  CG    . LYS A 1 188 ? -13.708 -22.427 -20.406 1.00 44.70  ? 188 LYS A CG    1 
ATOM   1447 C  CD    . LYS A 1 188 ? -14.217 -23.336 -19.275 1.00 46.56  ? 188 LYS A CD    1 
ATOM   1448 C  CE    . LYS A 1 188 ? -14.899 -24.579 -19.835 1.00 48.01  ? 188 LYS A CE    1 
ATOM   1449 N  NZ    . LYS A 1 188 ? -13.923 -25.660 -20.275 1.00 47.24  ? 188 LYS A NZ    1 
ATOM   1450 N  N     . SER A 1 189 ? -10.507 -23.001 -21.819 1.00 36.36  ? 189 SER A N     1 
ATOM   1451 C  CA    . SER A 1 189 ? -9.874  -23.242 -23.078 1.00 36.74  ? 189 SER A CA    1 
ATOM   1452 C  C     . SER A 1 189 ? -10.695 -24.219 -23.892 1.00 38.94  ? 189 SER A C     1 
ATOM   1453 O  O     . SER A 1 189 ? -11.032 -25.274 -23.390 1.00 39.68  ? 189 SER A O     1 
ATOM   1454 C  CB    . SER A 1 189 ? -8.507  -23.878 -22.880 1.00 34.89  ? 189 SER A CB    1 
ATOM   1455 O  OG    . SER A 1 189 ? -7.918  -24.169 -24.134 1.00 34.93  ? 189 SER A OG    1 
ATOM   1456 N  N     . GLU A 1 190 ? -10.994 -23.864 -25.140 1.00 40.87  ? 190 GLU A N     1 
ATOM   1457 C  CA    . GLU A 1 190 ? -11.793 -24.697 -26.071 1.00 42.96  ? 190 GLU A CA    1 
ATOM   1458 C  C     . GLU A 1 190 ? -10.911 -25.790 -26.679 1.00 40.81  ? 190 GLU A C     1 
ATOM   1459 O  O     . GLU A 1 190 ? -11.391 -26.789 -27.148 1.00 42.22  ? 190 GLU A O     1 
ATOM   1460 C  CB    . GLU A 1 190 ? -12.432 -23.827 -27.194 1.00 46.95  ? 190 GLU A CB    1 
ATOM   1461 C  CG    . GLU A 1 190 ? -13.969 -23.660 -27.126 1.00 51.54  ? 190 GLU A CG    1 
ATOM   1462 C  CD    . GLU A 1 190 ? -14.581 -22.901 -28.329 1.00 56.06  ? 190 GLU A CD    1 
ATOM   1463 O  OE1   . GLU A 1 190 ? -14.669 -23.421 -29.501 1.00 59.08  ? 190 GLU A OE1   1 
ATOM   1464 O  OE2   . GLU A 1 190 ? -15.040 -21.760 -28.078 1.00 58.79  ? 190 GLU A OE2   1 
ATOM   1465 N  N     . SER A 1 191 ? -9.607  -25.588 -26.666 1.00 38.81  ? 191 SER A N     1 
ATOM   1466 C  CA    . SER A 1 191 ? -8.731  -26.501 -27.326 1.00 38.27  ? 191 SER A CA    1 
ATOM   1467 C  C     . SER A 1 191 ? -7.910  -27.403 -26.387 1.00 36.31  ? 191 SER A C     1 
ATOM   1468 O  O     . SER A 1 191 ? -7.412  -28.428 -26.829 1.00 37.17  ? 191 SER A O     1 
ATOM   1469 C  CB    . SER A 1 191 ? -7.824  -25.686 -28.204 1.00 38.21  ? 191 SER A CB    1 
ATOM   1470 O  OG    . SER A 1 191 ? -6.873  -25.096 -27.375 1.00 37.33  ? 191 SER A OG    1 
ATOM   1471 N  N     . ILE A 1 192 ? -7.718  -27.054 -25.128 1.00 34.69  ? 192 ILE A N     1 
ATOM   1472 C  CA    . ILE A 1 192 ? -6.926  -27.950 -24.241 1.00 33.50  ? 192 ILE A CA    1 
ATOM   1473 C  C     . ILE A 1 192 ? -7.765  -29.126 -23.837 1.00 33.33  ? 192 ILE A C     1 
ATOM   1474 O  O     . ILE A 1 192 ? -8.928  -29.010 -23.535 1.00 34.22  ? 192 ILE A O     1 
ATOM   1475 C  CB    . ILE A 1 192 ? -6.343  -27.233 -23.012 1.00 33.40  ? 192 ILE A CB    1 
ATOM   1476 C  CG1   . ILE A 1 192 ? -5.234  -26.296 -23.475 1.00 33.19  ? 192 ILE A CG1   1 
ATOM   1477 C  CG2   . ILE A 1 192 ? -5.798  -28.231 -21.948 1.00 33.42  ? 192 ILE A CG2   1 
ATOM   1478 C  CD1   . ILE A 1 192 ? -4.780  -25.347 -22.411 1.00 32.68  ? 192 ILE A CD1   1 
ATOM   1479 N  N     . LYS A 1 193 ? -7.164  -30.281 -23.841 1.00 33.31  ? 193 LYS A N     1 
ATOM   1480 C  CA    . LYS A 1 193 ? -7.935  -31.509 -23.682 1.00 35.30  ? 193 LYS A CA    1 
ATOM   1481 C  C     . LYS A 1 193 ? -8.632  -31.514 -22.312 1.00 33.71  ? 193 LYS A C     1 
ATOM   1482 O  O     . LYS A 1 193 ? -9.745  -31.816 -22.292 1.00 33.53  ? 193 LYS A O     1 
ATOM   1483 C  CB    . LYS A 1 193 ? -7.025  -32.692 -24.042 1.00 37.10  ? 193 LYS A CB    1 
ATOM   1484 C  CG    . LYS A 1 193 ? -7.470  -34.126 -23.882 1.00 40.37  ? 193 LYS A CG    1 
ATOM   1485 C  CD    . LYS A 1 193 ? -6.394  -34.979 -24.608 1.00 42.30  ? 193 LYS A CD    1 
ATOM   1486 C  CE    . LYS A 1 193 ? -5.934  -36.261 -23.883 1.00 44.69  ? 193 LYS A CE    1 
ATOM   1487 N  NZ    . LYS A 1 193 ? -5.896  -37.482 -24.831 1.00 46.61  ? 193 LYS A NZ    1 
ATOM   1488 N  N     . VAL A 1 194 ? -8.034  -31.029 -21.207 1.00 32.55  ? 194 VAL A N     1 
ATOM   1489 C  CA    . VAL A 1 194 ? -8.778  -30.874 -19.913 1.00 32.08  ? 194 VAL A CA    1 
ATOM   1490 C  C     . VAL A 1 194 ? -9.700  -29.632 -19.786 1.00 33.11  ? 194 VAL A C     1 
ATOM   1491 O  O     . VAL A 1 194 ? -10.292 -29.398 -18.724 1.00 34.73  ? 194 VAL A O     1 
ATOM   1492 C  CB    . VAL A 1 194 ? -7.851  -30.908 -18.645 1.00 31.45  ? 194 VAL A CB    1 
ATOM   1493 C  CG1   . VAL A 1 194 ? -7.251  -32.296 -18.448 1.00 31.82  ? 194 VAL A CG1   1 
ATOM   1494 C  CG2   . VAL A 1 194 ? -6.762  -29.846 -18.642 1.00 29.17  ? 194 VAL A CG2   1 
ATOM   1495 N  N     . GLY A 1 195 ? -9.791  -28.784 -20.802 1.00 32.23  ? 195 GLY A N     1 
ATOM   1496 C  CA    . GLY A 1 195 ? -10.777 -27.709 -20.773 1.00 31.88  ? 195 GLY A CA    1 
ATOM   1497 C  C     . GLY A 1 195 ? -10.222 -26.406 -20.208 1.00 29.87  ? 195 GLY A C     1 
ATOM   1498 O  O     . GLY A 1 195 ? -10.853 -25.374 -20.361 1.00 30.70  ? 195 GLY A O     1 
ATOM   1499 N  N     . PHE A 1 196 ? -9.049  -26.443 -19.580 1.00 27.44  ? 196 PHE A N     1 
ATOM   1500 C  CA    . PHE A 1 196 ? -8.460  -25.310 -18.884 1.00 25.79  ? 196 PHE A CA    1 
ATOM   1501 C  C     . PHE A 1 196 ? -6.996  -25.199 -19.166 1.00 24.28  ? 196 PHE A C     1 
ATOM   1502 O  O     . PHE A 1 196 ? -6.287  -26.188 -19.206 1.00 23.76  ? 196 PHE A O     1 
ATOM   1503 C  CB    . PHE A 1 196 ? -8.623  -25.448 -17.372 1.00 25.60  ? 196 PHE A CB    1 
ATOM   1504 C  CG    . PHE A 1 196 ? -10.030 -25.259 -16.922 1.00 26.88  ? 196 PHE A CG    1 
ATOM   1505 C  CD1   . PHE A 1 196 ? -10.900 -26.331 -16.874 1.00 28.05  ? 196 PHE A CD1   1 
ATOM   1506 C  CD2   . PHE A 1 196 ? -10.514 -23.983 -16.663 1.00 27.24  ? 196 PHE A CD2   1 
ATOM   1507 C  CE1   . PHE A 1 196 ? -12.252 -26.139 -16.491 1.00 29.95  ? 196 PHE A CE1   1 
ATOM   1508 C  CE2   . PHE A 1 196 ? -11.860 -23.780 -16.327 1.00 28.61  ? 196 PHE A CE2   1 
ATOM   1509 C  CZ    . PHE A 1 196 ? -12.714 -24.865 -16.209 1.00 30.00  ? 196 PHE A CZ    1 
ATOM   1510 N  N     . GLN A 1 197 ? -6.579  -23.969 -19.376 1.00 24.11  ? 197 GLN A N     1 
ATOM   1511 C  CA    . GLN A 1 197 ? -5.171  -23.601 -19.385 1.00 23.62  ? 197 GLN A CA    1 
ATOM   1512 C  C     . GLN A 1 197 ? -4.697  -23.135 -17.975 1.00 23.29  ? 197 GLN A C     1 
ATOM   1513 O  O     . GLN A 1 197 ? -5.317  -22.270 -17.358 1.00 24.39  ? 197 GLN A O     1 
ATOM   1514 C  CB    . GLN A 1 197 ? -4.904  -22.497 -20.391 1.00 23.50  ? 197 GLN A CB    1 
ATOM   1515 C  CG    . GLN A 1 197 ? -3.407  -22.306 -20.687 1.00 22.79  ? 197 GLN A CG    1 
ATOM   1516 C  CD    . GLN A 1 197 ? -3.069  -21.042 -21.452 1.00 23.06  ? 197 GLN A CD    1 
ATOM   1517 O  OE1   . GLN A 1 197 ? -3.947  -20.340 -21.947 1.00 23.95  ? 197 GLN A OE1   1 
ATOM   1518 N  NE2   . GLN A 1 197 ? -1.781  -20.745 -21.548 1.00 22.55  ? 197 GLN A NE2   1 
ATOM   1519 N  N     . SER A 1 198 ? -3.564  -23.684 -17.525 1.00 23.03  ? 198 SER A N     1 
ATOM   1520 C  CA    . SER A 1 198 ? -2.862  -23.293 -16.324 1.00 23.10  ? 198 SER A CA    1 
ATOM   1521 C  C     . SER A 1 198 ? -1.743  -22.330 -16.710 1.00 23.55  ? 198 SER A C     1 
ATOM   1522 O  O     . SER A 1 198 ? -0.797  -22.712 -17.426 1.00 22.24  ? 198 SER A O     1 
ATOM   1523 C  CB    . SER A 1 198 ? -2.276  -24.503 -15.599 1.00 22.28  ? 198 SER A CB    1 
ATOM   1524 O  OG    . SER A 1 198 ? -1.535  -24.099 -14.468 1.00 22.31  ? 198 SER A OG    1 
ATOM   1525 N  N     . ILE A 1 199 ? -1.856  -21.103 -16.220 1.00 24.37  ? 199 ILE A N     1 
ATOM   1526 C  CA    . ILE A 1 199 ? -0.868  -20.062 -16.533 1.00 26.74  ? 199 ILE A CA    1 
ATOM   1527 C  C     . ILE A 1 199 ? -0.249  -19.570 -15.236 1.00 25.41  ? 199 ILE A C     1 
ATOM   1528 O  O     . ILE A 1 199 ? -0.964  -19.303 -14.263 1.00 26.02  ? 199 ILE A O     1 
ATOM   1529 C  CB    . ILE A 1 199 ? -1.516  -18.845 -17.243 1.00 30.55  ? 199 ILE A CB    1 
ATOM   1530 C  CG1   . ILE A 1 199 ? -2.439  -19.297 -18.339 1.00 32.22  ? 199 ILE A CG1   1 
ATOM   1531 C  CG2   . ILE A 1 199 ? -0.437  -17.941 -17.823 1.00 33.88  ? 199 ILE A CG2   1 
ATOM   1532 C  CD1   . ILE A 1 199 ? -2.899  -18.250 -19.332 1.00 34.68  ? 199 ILE A CD1   1 
ATOM   1533 N  N     . LEU A 1 200 ? 1.075   -19.489 -15.181 1.00 24.39  ? 200 LEU A N     1 
ATOM   1534 C  CA    . LEU A 1 200 ? 1.740   -18.799 -14.053 1.00 23.48  ? 200 LEU A CA    1 
ATOM   1535 C  C     . LEU A 1 200 ? 2.164   -17.426 -14.571 1.00 24.37  ? 200 LEU A C     1 
ATOM   1536 O  O     . LEU A 1 200 ? 2.719   -17.316 -15.662 1.00 23.74  ? 200 LEU A O     1 
ATOM   1537 C  CB    . LEU A 1 200 ? 2.942   -19.540 -13.569 1.00 22.38  ? 200 LEU A CB    1 
ATOM   1538 C  CG    . LEU A 1 200 ? 2.728   -20.908 -12.956 1.00 23.18  ? 200 LEU A CG    1 
ATOM   1539 C  CD1   . LEU A 1 200 ? 4.056   -21.557 -12.523 1.00 22.93  ? 200 LEU A CD1   1 
ATOM   1540 C  CD2   . LEU A 1 200 ? 1.819   -20.924 -11.758 1.00 23.72  ? 200 LEU A CD2   1 
ATOM   1541 N  N     . VAL A 1 201 ? 1.839   -16.369 -13.831 1.00 24.08  ? 201 VAL A N     1 
ATOM   1542 C  CA    . VAL A 1 201 ? 2.197   -15.066 -14.222 1.00 22.82  ? 201 VAL A CA    1 
ATOM   1543 C  C     . VAL A 1 201 ? 2.910   -14.484 -13.022 1.00 22.26  ? 201 VAL A C     1 
ATOM   1544 O  O     . VAL A 1 201 ? 2.379   -14.511 -11.877 1.00 21.05  ? 201 VAL A O     1 
ATOM   1545 C  CB    . VAL A 1 201 ? 0.976   -14.213 -14.572 1.00 24.93  ? 201 VAL A CB    1 
ATOM   1546 C  CG1   . VAL A 1 201 ? 1.376   -12.832 -15.058 1.00 25.64  ? 201 VAL A CG1   1 
ATOM   1547 C  CG2   . VAL A 1 201 ? 0.108   -14.826 -15.681 1.00 27.19  ? 201 VAL A CG2   1 
ATOM   1548 N  N     . PHE A 1 202 ? 4.093   -13.911 -13.292 1.00 20.88  ? 202 PHE A N     1 
ATOM   1549 C  CA    . PHE A 1 202 ? 4.776   -13.113 -12.283 1.00 19.84  ? 202 PHE A CA    1 
ATOM   1550 C  C     . PHE A 1 202 ? 4.546   -11.690 -12.674 1.00 20.17  ? 202 PHE A C     1 
ATOM   1551 O  O     . PHE A 1 202 ? 4.699   -11.347 -13.870 1.00 19.53  ? 202 PHE A O     1 
ATOM   1552 C  CB    . PHE A 1 202 ? 6.261   -13.349 -12.285 1.00 19.04  ? 202 PHE A CB    1 
ATOM   1553 C  CG    . PHE A 1 202 ? 7.010   -12.470 -11.327 1.00 18.49  ? 202 PHE A CG    1 
ATOM   1554 C  CD1   . PHE A 1 202 ? 6.772   -12.540 -9.973  1.00 19.68  ? 202 PHE A CD1   1 
ATOM   1555 C  CD2   . PHE A 1 202 ? 7.960   -11.603 -11.757 1.00 18.38  ? 202 PHE A CD2   1 
ATOM   1556 C  CE1   . PHE A 1 202 ? 7.498   -11.752 -9.075  1.00 18.71  ? 202 PHE A CE1   1 
ATOM   1557 C  CE2   . PHE A 1 202 ? 8.690   -10.794 -10.868 1.00 18.07  ? 202 PHE A CE2   1 
ATOM   1558 C  CZ    . PHE A 1 202 ? 8.439   -10.871 -9.539  1.00 17.82  ? 202 PHE A CZ    1 
ATOM   1559 N  N     . GLN A 1 203 ? 4.203   -10.884 -11.671 1.00 19.36  ? 203 GLN A N     1 
ATOM   1560 C  CA    . GLN A 1 203 ? 3.837   -9.532  -11.904 1.00 21.14  ? 203 GLN A CA    1 
ATOM   1561 C  C     . GLN A 1 203 ? 4.391   -8.575  -10.846 1.00 20.78  ? 203 GLN A C     1 
ATOM   1562 O  O     . GLN A 1 203 ? 4.541   -8.954  -9.699  1.00 21.07  ? 203 GLN A O     1 
ATOM   1563 C  CB    . GLN A 1 203 ? 2.308   -9.425  -11.961 1.00 22.26  ? 203 GLN A CB    1 
ATOM   1564 C  CG    . GLN A 1 203 ? 1.826   -8.065  -12.369 1.00 24.29  ? 203 GLN A CG    1 
ATOM   1565 C  CD    . GLN A 1 203 ? 0.307   -7.961  -12.515 1.00 28.17  ? 203 GLN A CD    1 
ATOM   1566 O  OE1   . GLN A 1 203 ? -0.372  -8.863  -12.988 1.00 29.42  ? 203 GLN A OE1   1 
ATOM   1567 N  NE2   . GLN A 1 203 ? -0.215  -6.827  -12.142 1.00 31.93  ? 203 GLN A NE2   1 
ATOM   1568 N  N     . ILE A 1 204 ? 4.747   -7.383  -11.276 1.00 21.14  ? 204 ILE A N     1 
ATOM   1569 C  CA    . ILE A 1 204 ? 5.118   -6.271  -10.366 1.00 21.35  ? 204 ILE A CA    1 
ATOM   1570 C  C     . ILE A 1 204 ? 4.314   -5.104  -10.870 1.00 22.16  ? 204 ILE A C     1 
ATOM   1571 O  O     . ILE A 1 204 ? 4.397   -4.789  -12.031 1.00 24.62  ? 204 ILE A O     1 
ATOM   1572 C  CB    . ILE A 1 204 ? 6.623   -5.967  -10.449 1.00 20.32  ? 204 ILE A CB    1 
ATOM   1573 C  CG1   . ILE A 1 204 ? 7.431   -7.116  -9.867  1.00 19.96  ? 204 ILE A CG1   1 
ATOM   1574 C  CG2   . ILE A 1 204 ? 6.980   -4.755  -9.662  1.00 20.99  ? 204 ILE A CG2   1 
ATOM   1575 C  CD1   . ILE A 1 204 ? 8.924   -6.938  -10.034 1.00 19.39  ? 204 ILE A CD1   1 
ATOM   1576 N  N     . THR A 1 205 ? 3.597   -4.435  -9.983  1.00 24.63  ? 205 THR A N     1 
ATOM   1577 C  CA    . THR A 1 205 ? 2.709   -3.302  -10.297 1.00 25.07  ? 205 THR A CA    1 
ATOM   1578 C  C     . THR A 1 205 ? 3.321   -2.012  -9.692  1.00 26.99  ? 205 THR A C     1 
ATOM   1579 O  O     . THR A 1 205 ? 3.739   -2.008  -8.534  1.00 27.16  ? 205 THR A O     1 
ATOM   1580 C  CB    . THR A 1 205 ? 1.316   -3.482  -9.695  1.00 24.92  ? 205 THR A CB    1 
ATOM   1581 O  OG1   . THR A 1 205 ? 0.669   -4.703  -10.158 1.00 24.25  ? 205 THR A OG1   1 
ATOM   1582 C  CG2   . THR A 1 205 ? 0.438   -2.243  -9.996  1.00 25.83  ? 205 THR A CG2   1 
ATOM   1583 N  N     . GLN A 1 206 ? 3.353   -0.944  -10.488 1.00 28.02  ? 206 GLN A N     1 
ATOM   1584 C  CA    . GLN A 1 206 ? 3.764   0.384   -10.079 1.00 29.64  ? 206 GLN A CA    1 
ATOM   1585 C  C     . GLN A 1 206 ? 3.094   1.486   -10.914 1.00 31.47  ? 206 GLN A C     1 
ATOM   1586 O  O     . GLN A 1 206 ? 2.726   1.272   -12.082 1.00 34.23  ? 206 GLN A O     1 
ATOM   1587 C  CB    . GLN A 1 206 ? 5.276   0.621   -10.324 1.00 30.26  ? 206 GLN A CB    1 
ATOM   1588 C  CG    . GLN A 1 206 ? 6.239   0.575   -9.139  1.00 30.63  ? 206 GLN A CG    1 
ATOM   1589 C  CD    . GLN A 1 206 ? 5.755   0.984   -7.739  1.00 28.33  ? 206 GLN A CD    1 
ATOM   1590 O  OE1   . GLN A 1 206 ? 5.220   0.190   -6.957  1.00 29.21  ? 206 GLN A OE1   1 
ATOM   1591 N  NE2   . GLN A 1 206 ? 6.076   2.145   -7.388  1.00 29.11  ? 206 GLN A NE2   1 
ATOM   1592 N  N     . HIS A 1 207 ? 3.107   2.688   -10.351 1.00 30.23  ? 207 HIS A N     1 
ATOM   1593 C  CA    . HIS A 1 207 ? 2.724   3.903   -11.033 1.00 30.05  ? 207 HIS A CA    1 
ATOM   1594 C  C     . HIS A 1 207 ? 3.784   4.183   -12.086 1.00 31.02  ? 207 HIS A C     1 
ATOM   1595 O  O     . HIS A 1 207 ? 5.002   3.894   -11.943 1.00 29.22  ? 207 HIS A O     1 
ATOM   1596 C  CB    . HIS A 1 207 ? 2.525   5.050   -10.020 1.00 29.95  ? 207 HIS A CB    1 
ATOM   1597 C  CG    . HIS A 1 207 ? 1.957   6.298   -10.607 1.00 31.63  ? 207 HIS A CG    1 
ATOM   1598 N  ND1   . HIS A 1 207 ? 0.659   6.725   -10.378 1.00 32.93  ? 207 HIS A ND1   1 
ATOM   1599 C  CD2   . HIS A 1 207 ? 2.509   7.211   -11.438 1.00 31.85  ? 207 HIS A CD2   1 
ATOM   1600 C  CE1   . HIS A 1 207 ? 0.437   7.834   -11.068 1.00 33.77  ? 207 HIS A CE1   1 
ATOM   1601 N  NE2   . HIS A 1 207 ? 1.558   8.164   -11.692 1.00 33.31  ? 207 HIS A NE2   1 
ATOM   1602 N  N     . ALA A 1 208 ? 3.276   4.768   -13.162 1.00 32.78  ? 208 ALA A N     1 
ATOM   1603 C  CA    . ALA A 1 208 ? 3.977   5.033   -14.366 1.00 34.30  ? 208 ALA A CA    1 
ATOM   1604 C  C     . ALA A 1 208 ? 5.172   5.995   -14.300 1.00 34.83  ? 208 ALA A C     1 
ATOM   1605 O  O     . ALA A 1 208 ? 6.071   5.942   -15.137 1.00 34.14  ? 208 ALA A O     1 
ATOM   1606 C  CB    . ALA A 1 208 ? 2.959   5.595   -15.357 1.00 37.05  ? 208 ALA A CB    1 
ATOM   1607 N  N     . ARG A 1 209 ? 5.110   6.944   -13.403 1.00 35.56  ? 209 ARG A N     1 
ATOM   1608 C  CA    . ARG A 1 209 ? 6.242   7.793   -13.086 1.00 39.31  ? 209 ARG A CA    1 
ATOM   1609 C  C     . ARG A 1 209 ? 7.526   7.079   -12.710 1.00 37.06  ? 209 ARG A C     1 
ATOM   1610 O  O     . ARG A 1 209 ? 8.589   7.640   -12.917 1.00 38.34  ? 209 ARG A O     1 
ATOM   1611 C  CB    . ARG A 1 209 ? 5.916   8.759   -11.975 1.00 41.72  ? 209 ARG A CB    1 
ATOM   1612 C  CG    . ARG A 1 209 ? 5.907   8.071   -10.679 1.00 45.39  ? 209 ARG A CG    1 
ATOM   1613 C  CD    . ARG A 1 209 ? 5.031   8.836   -9.726  1.00 51.37  ? 209 ARG A CD    1 
ATOM   1614 N  NE    . ARG A 1 209 ? 4.923   8.069   -8.483  1.00 54.82  ? 209 ARG A NE    1 
ATOM   1615 C  CZ    . ARG A 1 209 ? 3.844   8.027   -7.701  1.00 61.07  ? 209 ARG A CZ    1 
ATOM   1616 N  NH1   . ARG A 1 209 ? 2.710   8.698   -7.998  1.00 61.02  ? 209 ARG A NH1   1 
ATOM   1617 N  NH2   . ARG A 1 209 ? 3.910   7.292   -6.596  1.00 62.82  ? 209 ARG A NH2   1 
ATOM   1618 N  N     . ASP A 1 210 ? 7.432   5.833   -12.258 1.00 34.71  ? 210 ASP A N     1 
ATOM   1619 C  CA    . ASP A 1 210 ? 8.616   5.002   -12.017 1.00 32.83  ? 210 ASP A CA    1 
ATOM   1620 C  C     . ASP A 1 210 ? 8.887   4.092   -13.231 1.00 32.54  ? 210 ASP A C     1 
ATOM   1621 O  O     . ASP A 1 210 ? 9.458   3.025   -13.118 1.00 31.60  ? 210 ASP A O     1 
ATOM   1622 C  CB    . ASP A 1 210 ? 8.433   4.275   -10.649 1.00 31.93  ? 210 ASP A CB    1 
ATOM   1623 C  CG    . ASP A 1 210 ? 8.931   5.137   -9.463  1.00 31.99  ? 210 ASP A CG    1 
ATOM   1624 O  OD1   . ASP A 1 210 ? 9.996   5.764   -9.616  1.00 32.73  ? 210 ASP A OD1   1 
ATOM   1625 O  OD2   . ASP A 1 210 ? 8.288   5.219   -8.402  1.00 31.38  ? 210 ASP A OD2   1 
ATOM   1626 N  N     . VAL A 1 211 ? 8.494   4.562   -14.418 1.00 32.66  ? 211 VAL A N     1 
ATOM   1627 C  CA    . VAL A 1 211 ? 8.685   3.846   -15.641 1.00 32.15  ? 211 VAL A CA    1 
ATOM   1628 C  C     . VAL A 1 211 ? 10.129  3.308   -15.800 1.00 33.24  ? 211 VAL A C     1 
ATOM   1629 O  O     . VAL A 1 211 ? 10.306  2.161   -16.305 1.00 32.90  ? 211 VAL A O     1 
ATOM   1630 C  CB    . VAL A 1 211 ? 8.270   4.728   -16.882 1.00 33.47  ? 211 VAL A CB    1 
ATOM   1631 C  CG1   . VAL A 1 211 ? 9.148   5.993   -17.059 1.00 34.74  ? 211 VAL A CG1   1 
ATOM   1632 C  CG2   . VAL A 1 211 ? 8.282   3.945   -18.183 1.00 33.76  ? 211 VAL A CG2   1 
ATOM   1633 N  N     . LYS A 1 212 ? 11.144  4.124   -15.458 1.00 35.15  ? 212 LYS A N     1 
ATOM   1634 C  CA    . LYS A 1 212 ? 12.559  3.772   -15.742 1.00 37.09  ? 212 LYS A CA    1 
ATOM   1635 C  C     . LYS A 1 212 ? 12.990  2.560   -14.936 1.00 34.49  ? 212 LYS A C     1 
ATOM   1636 O  O     . LYS A 1 212 ? 13.568  1.591   -15.463 1.00 36.48  ? 212 LYS A O     1 
ATOM   1637 C  CB    . LYS A 1 212 ? 13.507  4.932   -15.447 1.00 42.83  ? 212 LYS A CB    1 
ATOM   1638 C  CG    . LYS A 1 212 ? 13.389  6.158   -16.380 1.00 49.81  ? 212 LYS A CG    1 
ATOM   1639 C  CD    . LYS A 1 212 ? 14.007  5.917   -17.762 1.00 55.26  ? 212 LYS A CD    1 
ATOM   1640 C  CE    . LYS A 1 212 ? 13.600  6.992   -18.791 1.00 62.26  ? 212 LYS A CE    1 
ATOM   1641 N  NZ    . LYS A 1 212 ? 12.328  6.616   -19.511 1.00 63.32  ? 212 LYS A NZ    1 
ATOM   1642 N  N     . LEU A 1 213 ? 12.685  2.607   -13.670 1.00 33.20  ? 213 LEU A N     1 
ATOM   1643 C  CA    . LEU A 1 213 ? 12.789  1.457   -12.797 1.00 33.93  ? 213 LEU A CA    1 
ATOM   1644 C  C     . LEU A 1 213 ? 12.089  0.215   -13.353 1.00 32.22  ? 213 LEU A C     1 
ATOM   1645 O  O     . LEU A 1 213 ? 12.695  -0.836  -13.488 1.00 32.58  ? 213 LEU A O     1 
ATOM   1646 C  CB    . LEU A 1 213 ? 12.237  1.797   -11.417 1.00 34.66  ? 213 LEU A CB    1 
ATOM   1647 C  CG    . LEU A 1 213 ? 12.003  0.632   -10.412 1.00 35.85  ? 213 LEU A CG    1 
ATOM   1648 C  CD1   . LEU A 1 213 ? 13.242  -0.238  -10.268 1.00 36.21  ? 213 LEU A CD1   1 
ATOM   1649 C  CD2   . LEU A 1 213 ? 11.629  1.272   -9.097  1.00 36.60  ? 213 LEU A CD2   1 
ATOM   1650 N  N     . MET A 1 214 ? 10.824  0.344   -13.689 1.00 31.73  ? 214 MET A N     1 
ATOM   1651 C  CA    . MET A 1 214 ? 10.096  -0.779  -14.257 1.00 30.98  ? 214 MET A CA    1 
ATOM   1652 C  C     . MET A 1 214 ? 10.755  -1.298  -15.505 1.00 30.99  ? 214 MET A C     1 
ATOM   1653 O  O     . MET A 1 214 ? 10.876  -2.522  -15.705 1.00 27.65  ? 214 MET A O     1 
ATOM   1654 C  CB    . MET A 1 214 ? 8.654   -0.385  -14.547 1.00 32.12  ? 214 MET A CB    1 
ATOM   1655 C  CG    . MET A 1 214 ? 7.904   -0.033  -13.270 1.00 32.53  ? 214 MET A CG    1 
ATOM   1656 S  SD    . MET A 1 214 ? 7.771   -1.408  -12.107 1.00 31.04  ? 214 MET A SD    1 
ATOM   1657 C  CE    . MET A 1 214 ? 6.273   -2.107  -12.745 1.00 32.03  ? 214 MET A CE    1 
ATOM   1658 N  N     . GLU A 1 215 ? 11.226  -0.376  -16.336 1.00 32.36  ? 215 GLU A N     1 
ATOM   1659 C  CA    . GLU A 1 215 ? 11.923  -0.816  -17.535 1.00 34.48  ? 215 GLU A CA    1 
ATOM   1660 C  C     . GLU A 1 215 ? 13.167  -1.629  -17.227 1.00 33.07  ? 215 GLU A C     1 
ATOM   1661 O  O     . GLU A 1 215 ? 13.421  -2.663  -17.871 1.00 34.82  ? 215 GLU A O     1 
ATOM   1662 C  CB    . GLU A 1 215 ? 12.254  0.346   -18.452 1.00 38.79  ? 215 GLU A CB    1 
ATOM   1663 C  CG    . GLU A 1 215 ? 11.187  0.521   -19.484 1.00 43.38  ? 215 GLU A CG    1 
ATOM   1664 C  CD    . GLU A 1 215 ? 11.317  1.767   -20.317 1.00 50.59  ? 215 GLU A CD    1 
ATOM   1665 O  OE1   . GLU A 1 215 ? 12.119  2.720   -19.992 1.00 54.34  ? 215 GLU A OE1   1 
ATOM   1666 O  OE2   . GLU A 1 215 ? 10.562  1.770   -21.342 1.00 59.26  ? 215 GLU A OE2   1 
ATOM   1667 N  N     . SER A 1 216 ? 13.903  -1.188  -16.221 1.00 31.71  ? 216 SER A N     1 
ATOM   1668 C  CA    . SER A 1 216 ? 15.154  -1.830  -15.818 1.00 31.90  ? 216 SER A CA    1 
ATOM   1669 C  C     . SER A 1 216 ? 14.935  -3.238  -15.266 1.00 29.98  ? 216 SER A C     1 
ATOM   1670 O  O     . SER A 1 216 ? 15.848  -4.044  -15.330 1.00 30.14  ? 216 SER A O     1 
ATOM   1671 C  CB    . SER A 1 216 ? 15.922  -0.969  -14.778 1.00 32.12  ? 216 SER A CB    1 
ATOM   1672 O  OG    . SER A 1 216 ? 15.506  -1.351  -13.484 1.00 30.76  ? 216 SER A OG    1 
ATOM   1673 N  N     . LEU A 1 217 ? 13.715  -3.562  -14.821 1.00 27.61  ? 217 LEU A N     1 
ATOM   1674 C  CA    . LEU A 1 217 ? 13.460  -4.932  -14.424 1.00 26.42  ? 217 LEU A CA    1 
ATOM   1675 C  C     . LEU A 1 217 ? 13.673  -5.908  -15.533 1.00 27.36  ? 217 LEU A C     1 
ATOM   1676 O  O     . LEU A 1 217 ? 14.046  -7.060  -15.231 1.00 26.70  ? 217 LEU A O     1 
ATOM   1677 C  CB    . LEU A 1 217 ? 12.060  -5.122  -13.877 1.00 25.12  ? 217 LEU A CB    1 
ATOM   1678 C  CG    . LEU A 1 217 ? 11.727  -4.265  -12.673 1.00 24.44  ? 217 LEU A CG    1 
ATOM   1679 C  CD1   . LEU A 1 217 ? 10.218  -4.183  -12.417 1.00 24.55  ? 217 LEU A CD1   1 
ATOM   1680 C  CD2   . LEU A 1 217 ? 12.363  -4.823  -11.453 1.00 23.17  ? 217 LEU A CD2   1 
ATOM   1681 N  N     . ILE A 1 218 ? 13.426  -5.504  -16.791 1.00 27.93  ? 218 ILE A N     1 
ATOM   1682 C  CA    . ILE A 1 218 ? 13.519  -6.466  -17.893 1.00 29.16  ? 218 ILE A CA    1 
ATOM   1683 C  C     . ILE A 1 218 ? 14.960  -6.972  -18.047 1.00 30.82  ? 218 ILE A C     1 
ATOM   1684 O  O     . ILE A 1 218 ? 15.198  -8.213  -18.134 1.00 29.24  ? 218 ILE A O     1 
ATOM   1685 C  CB    . ILE A 1 218 ? 13.066  -5.887  -19.241 1.00 30.86  ? 218 ILE A CB    1 
ATOM   1686 C  CG1   . ILE A 1 218 ? 11.557  -5.727  -19.239 1.00 31.09  ? 218 ILE A CG1   1 
ATOM   1687 C  CG2   . ILE A 1 218 ? 13.510  -6.749  -20.454 1.00 30.81  ? 218 ILE A CG2   1 
ATOM   1688 C  CD1   . ILE A 1 218 ? 11.146  -4.693  -20.234 1.00 33.19  ? 218 ILE A CD1   1 
ATOM   1689 N  N     . SER A 1 219 ? 15.909  -6.032  -18.100 1.00 32.86  ? 219 SER A N     1 
ATOM   1690 C  CA    . SER A 1 219 ? 17.358  -6.423  -18.154 1.00 34.11  ? 219 SER A CA    1 
ATOM   1691 C  C     . SER A 1 219 ? 17.781  -7.037  -16.778 1.00 32.75  ? 219 SER A C     1 
ATOM   1692 O  O     . SER A 1 219 ? 18.489  -8.050  -16.760 1.00 33.75  ? 219 SER A O     1 
ATOM   1693 C  CB    . SER A 1 219 ? 18.281  -5.292  -18.599 1.00 35.94  ? 219 SER A CB    1 
ATOM   1694 O  OG    . SER A 1 219 ? 18.231  -4.233  -17.661 1.00 38.91  ? 219 SER A OG    1 
ATOM   1695 N  N     . TYR A 1 220 ? 17.290  -6.519  -15.653 1.00 29.07  ? 220 TYR A N     1 
ATOM   1696 C  CA    . TYR A 1 220 ? 17.702  -7.093  -14.397 1.00 27.11  ? 220 TYR A CA    1 
ATOM   1697 C  C     . TYR A 1 220 ? 17.350  -8.570  -14.306 1.00 25.73  ? 220 TYR A C     1 
ATOM   1698 O  O     . TYR A 1 220 ? 18.171  -9.376  -13.959 1.00 23.91  ? 220 TYR A O     1 
ATOM   1699 C  CB    . TYR A 1 220 ? 17.074  -6.359  -13.264 1.00 26.15  ? 220 TYR A CB    1 
ATOM   1700 C  CG    . TYR A 1 220 ? 17.784  -6.561  -11.958 1.00 26.47  ? 220 TYR A CG    1 
ATOM   1701 C  CD1   . TYR A 1 220 ? 18.925  -5.788  -11.643 1.00 27.13  ? 220 TYR A CD1   1 
ATOM   1702 C  CD2   . TYR A 1 220 ? 17.341  -7.540  -11.029 1.00 24.77  ? 220 TYR A CD2   1 
ATOM   1703 C  CE1   . TYR A 1 220 ? 19.560  -5.929  -10.407 1.00 27.66  ? 220 TYR A CE1   1 
ATOM   1704 C  CE2   . TYR A 1 220 ? 18.003  -7.719  -9.841  1.00 25.00  ? 220 TYR A CE2   1 
ATOM   1705 C  CZ    . TYR A 1 220 ? 19.097  -6.913  -9.516  1.00 26.94  ? 220 TYR A CZ    1 
ATOM   1706 O  OH    . TYR A 1 220 ? 19.745  -7.071  -8.297  1.00 29.29  ? 220 TYR A OH    1 
ATOM   1707 N  N     . LEU A 1 221 ? 16.130  -8.921  -14.679 1.00 25.92  ? 221 LEU A N     1 
ATOM   1708 C  CA    . LEU A 1 221 ? 15.650  -10.281 -14.542 1.00 25.97  ? 221 LEU A CA    1 
ATOM   1709 C  C     . LEU A 1 221 ? 15.780  -11.107 -15.859 1.00 27.23  ? 221 LEU A C     1 
ATOM   1710 O  O     . LEU A 1 221 ? 15.509  -12.355 -15.900 1.00 28.65  ? 221 LEU A O     1 
ATOM   1711 C  CB    . LEU A 1 221 ? 14.229  -10.236 -14.045 1.00 24.49  ? 221 LEU A CB    1 
ATOM   1712 C  CG    . LEU A 1 221 ? 14.001  -9.814  -12.607 1.00 24.59  ? 221 LEU A CG    1 
ATOM   1713 C  CD1   . LEU A 1 221 ? 12.502  -9.492  -12.365 1.00 24.11  ? 221 LEU A CD1   1 
ATOM   1714 C  CD2   . LEU A 1 221 ? 14.469  -10.913 -11.672 1.00 24.24  ? 221 LEU A CD2   1 
ATOM   1715 N  N     . GLY A 1 222 ? 16.214  -10.455 -16.903 1.00 27.80  ? 222 GLY A N     1 
ATOM   1716 C  CA    . GLY A 1 222 ? 16.517  -11.153 -18.145 1.00 29.81  ? 222 GLY A CA    1 
ATOM   1717 C  C     . GLY A 1 222 ? 15.237  -11.702 -18.784 1.00 29.73  ? 222 GLY A C     1 
ATOM   1718 O  O     . GLY A 1 222 ? 15.280  -12.753 -19.383 1.00 30.70  ? 222 GLY A O     1 
ATOM   1719 N  N     . CYS A 1 223 ? 14.106  -11.033 -18.558 1.00 28.96  ? 223 CYS A N     1 
ATOM   1720 C  CA    . CYS A 1 223 ? 12.773  -11.443 -19.065 1.00 28.04  ? 223 CYS A CA    1 
ATOM   1721 C  C     . CYS A 1 223 ? 11.720  -10.374 -18.710 1.00 26.86  ? 223 CYS A C     1 
ATOM   1722 O  O     . CYS A 1 223 ? 11.984  -9.404  -17.946 1.00 24.79  ? 223 CYS A O     1 
ATOM   1723 C  CB    . CYS A 1 223 ? 12.341  -12.790 -18.500 1.00 27.05  ? 223 CYS A CB    1 
ATOM   1724 S  SG    . CYS A 1 223 ? 12.247  -12.921 -16.660 1.00 25.48  ? 223 CYS A SG    1 
ATOM   1725 N  N     . GLY A 1 224 ? 10.557  -10.550 -19.322 1.00 26.82  ? 224 GLY A N     1 
ATOM   1726 C  CA    . GLY A 1 224 ? 9.363   -9.783  -19.012 1.00 26.31  ? 224 GLY A CA    1 
ATOM   1727 C  C     . GLY A 1 224 ? 9.126   -8.710  -20.020 1.00 28.70  ? 224 GLY A C     1 
ATOM   1728 O  O     . GLY A 1 224 ? 9.908   -8.480  -20.969 1.00 30.43  ? 224 GLY A O     1 
ATOM   1729 N  N     . PHE A 1 225 ? 8.006   -8.069  -19.834 1.00 29.30  ? 225 PHE A N     1 
ATOM   1730 C  CA    . PHE A 1 225 ? 7.656   -6.955  -20.659 1.00 32.19  ? 225 PHE A CA    1 
ATOM   1731 C  C     . PHE A 1 225 ? 6.742   -6.070  -19.815 1.00 30.22  ? 225 PHE A C     1 
ATOM   1732 O  O     . PHE A 1 225 ? 6.230   -6.498  -18.808 1.00 27.93  ? 225 PHE A O     1 
ATOM   1733 C  CB    . PHE A 1 225 ? 6.998   -7.464  -21.957 1.00 35.29  ? 225 PHE A CB    1 
ATOM   1734 C  CG    . PHE A 1 225 ? 5.888   -8.406  -21.703 1.00 39.30  ? 225 PHE A CG    1 
ATOM   1735 C  CD1   . PHE A 1 225 ? 6.139   -9.764  -21.508 1.00 41.19  ? 225 PHE A CD1   1 
ATOM   1736 C  CD2   . PHE A 1 225 ? 4.544   -7.929  -21.584 1.00 42.89  ? 225 PHE A CD2   1 
ATOM   1737 C  CE1   . PHE A 1 225 ? 5.071   -10.622 -21.184 1.00 42.58  ? 225 PHE A CE1   1 
ATOM   1738 C  CE2   . PHE A 1 225 ? 3.468   -8.785  -21.335 1.00 43.02  ? 225 PHE A CE2   1 
ATOM   1739 C  CZ    . PHE A 1 225 ? 3.727   -10.137 -21.121 1.00 43.34  ? 225 PHE A CZ    1 
ATOM   1740 N  N     . ILE A 1 226 ? 6.597   -4.831  -20.203 1.00 30.91  ? 226 ILE A N     1 
ATOM   1741 C  CA    . ILE A 1 226 ? 5.841   -3.882  -19.450 1.00 32.63  ? 226 ILE A CA    1 
ATOM   1742 C  C     . ILE A 1 226 ? 4.538   -3.762  -20.167 1.00 32.99  ? 226 ILE A C     1 
ATOM   1743 O  O     . ILE A 1 226 ? 4.566   -3.461  -21.334 1.00 32.83  ? 226 ILE A O     1 
ATOM   1744 C  CB    . ILE A 1 226 ? 6.522   -2.479  -19.388 1.00 33.54  ? 226 ILE A CB    1 
ATOM   1745 C  CG1   . ILE A 1 226 ? 7.444   -2.331  -18.178 1.00 35.56  ? 226 ILE A CG1   1 
ATOM   1746 C  CG2   . ILE A 1 226 ? 5.501   -1.443  -19.036 1.00 33.66  ? 226 ILE A CG2   1 
ATOM   1747 C  CD1   . ILE A 1 226 ? 8.572   -3.283  -18.090 1.00 36.86  ? 226 ILE A CD1   1 
ATOM   1748 N  N     . GLU A 1 227 ? 3.422   -3.891  -19.453 1.00 33.10  ? 227 GLU A N     1 
ATOM   1749 C  CA    . GLU A 1 227 ? 2.103   -3.544  -19.986 1.00 36.15  ? 227 GLU A CA    1 
ATOM   1750 C  C     . GLU A 1 227 ? 1.707   -2.361  -19.270 1.00 35.33  ? 227 GLU A C     1 
ATOM   1751 O  O     . GLU A 1 227 ? 1.925   -2.243  -18.064 1.00 35.20  ? 227 GLU A O     1 
ATOM   1752 C  CB    . GLU A 1 227 ? 0.978   -4.582  -19.669 1.00 38.52  ? 227 GLU A CB    1 
ATOM   1753 C  CG    . GLU A 1 227 ? 1.159   -5.936  -20.293 1.00 40.81  ? 227 GLU A CG    1 
ATOM   1754 C  CD    . GLU A 1 227 ? 0.200   -7.054  -19.798 1.00 43.46  ? 227 GLU A CD    1 
ATOM   1755 O  OE1   . GLU A 1 227 ? -0.371  -7.060  -18.656 1.00 46.92  ? 227 GLU A OE1   1 
ATOM   1756 O  OE2   . GLU A 1 227 ? 0.053   -7.992  -20.591 1.00 43.59  ? 227 GLU A OE2   1 
ATOM   1757 N  N     . LYS A 1 228 ? 1.015   -1.512  -19.985 1.00 37.74  ? 228 LYS A N     1 
ATOM   1758 C  CA    . LYS A 1 228 ? 0.418   -0.325  -19.441 1.00 38.60  ? 228 LYS A CA    1 
ATOM   1759 C  C     . LYS A 1 228 ? -1.076  -0.550  -19.461 1.00 37.46  ? 228 LYS A C     1 
ATOM   1760 O  O     . LYS A 1 228 ? -1.639  -0.983  -20.465 1.00 38.28  ? 228 LYS A O     1 
ATOM   1761 C  CB    . LYS A 1 228 ? 0.733   0.894   -20.290 1.00 42.63  ? 228 LYS A CB    1 
ATOM   1762 C  CG    . LYS A 1 228 ? 0.348   2.158   -19.525 1.00 45.20  ? 228 LYS A CG    1 
ATOM   1763 C  CD    . LYS A 1 228 ? 0.136   3.332   -20.407 1.00 48.33  ? 228 LYS A CD    1 
ATOM   1764 C  CE    . LYS A 1 228 ? -0.585  4.446   -19.676 1.00 51.11  ? 228 LYS A CE    1 
ATOM   1765 N  NZ    . LYS A 1 228 ? -1.989  4.679   -20.150 1.00 54.58  ? 228 LYS A NZ    1 
ATOM   1766 N  N     . ASP A 1 229 ? -1.699  -0.274  -18.332 1.00 34.80  ? 229 ASP A N     1 
ATOM   1767 C  CA    . ASP A 1 229 ? -3.137  -0.274  -18.186 1.00 33.97  ? 229 ASP A CA    1 
ATOM   1768 C  C     . ASP A 1 229 ? -3.708  0.853   -19.113 1.00 36.00  ? 229 ASP A C     1 
ATOM   1769 O  O     . ASP A 1 229 ? -3.311  2.011   -19.011 1.00 35.32  ? 229 ASP A O     1 
ATOM   1770 C  CB    . ASP A 1 229 ? -3.450  -0.054  -16.706 1.00 31.82  ? 229 ASP A CB    1 
ATOM   1771 C  CG    . ASP A 1 229 ? -4.842  -0.344  -16.352 1.00 31.47  ? 229 ASP A CG    1 
ATOM   1772 O  OD1   . ASP A 1 229 ? -5.700  0.114   -17.162 1.00 32.51  ? 229 ASP A OD1   1 
ATOM   1773 O  OD2   . ASP A 1 229 ? -5.051  -0.972  -15.246 1.00 29.19  ? 229 ASP A OD2   1 
ATOM   1774 N  N     . SER A 1 230 ? -4.626  0.501   -20.018 1.00 38.26  ? 230 SER A N     1 
ATOM   1775 C  CA    . SER A 1 230 ? -5.214  1.509   -20.930 1.00 42.30  ? 230 SER A CA    1 
ATOM   1776 C  C     . SER A 1 230 ? -5.982  2.618   -20.226 1.00 43.54  ? 230 SER A C     1 
ATOM   1777 O  O     . SER A 1 230 ? -6.257  3.641   -20.862 1.00 47.56  ? 230 SER A O     1 
ATOM   1778 C  CB    . SER A 1 230 ? -6.138  0.856   -21.931 1.00 44.04  ? 230 SER A CB    1 
ATOM   1779 O  OG    . SER A 1 230 ? -7.078  0.127   -21.196 1.00 45.42  ? 230 SER A OG    1 
ATOM   1780 N  N     . ARG A 1 231 ? -6.314  2.404   -18.939 1.00 43.13  ? 231 ARG A N     1 
ATOM   1781 C  CA    . ARG A 1 231 ? -7.187  3.288   -18.152 1.00 44.63  ? 231 ARG A CA    1 
ATOM   1782 C  C     . ARG A 1 231 ? -6.425  4.417   -17.436 1.00 45.83  ? 231 ARG A C     1 
ATOM   1783 O  O     . ARG A 1 231 ? -7.008  5.462   -17.191 1.00 49.75  ? 231 ARG A O     1 
ATOM   1784 C  CB    . ARG A 1 231 ? -7.975  2.486   -17.095 1.00 42.88  ? 231 ARG A CB    1 
ATOM   1785 C  CG    . ARG A 1 231 ? -8.947  1.471   -17.693 1.00 43.81  ? 231 ARG A CG    1 
ATOM   1786 C  CD    . ARG A 1 231 ? -9.569  0.597   -16.629 1.00 42.52  ? 231 ARG A CD    1 
ATOM   1787 N  NE    . ARG A 1 231 ? -8.541  -0.027  -15.800 1.00 40.73  ? 231 ARG A NE    1 
ATOM   1788 C  CZ    . ARG A 1 231 ? -8.751  -0.743  -14.699 1.00 39.29  ? 231 ARG A CZ    1 
ATOM   1789 N  NH1   . ARG A 1 231 ? -9.982  -0.982  -14.247 1.00 40.08  ? 231 ARG A NH1   1 
ATOM   1790 N  NH2   . ARG A 1 231 ? -7.702  -1.230  -14.051 1.00 37.49  ? 231 ARG A NH2   1 
ATOM   1791 N  N     . GLY A 1 232 ? -5.140  4.234   -17.122 1.00 43.49  ? 232 GLY A N     1 
ATOM   1792 C  CA    . GLY A 1 232 ? -4.419  5.218   -16.329 1.00 42.18  ? 232 GLY A CA    1 
ATOM   1793 C  C     . GLY A 1 232 ? -2.931  4.976   -16.232 1.00 39.46  ? 232 GLY A C     1 
ATOM   1794 O  O     . GLY A 1 232 ? -2.364  4.233   -17.035 1.00 38.87  ? 232 GLY A O     1 
ATOM   1795 N  N     . PRO A 1 233 ? -2.280  5.669   -15.286 1.00 39.32  ? 233 PRO A N     1 
ATOM   1796 C  CA    . PRO A 1 233 ? -0.825  5.650   -15.145 1.00 37.73  ? 233 PRO A CA    1 
ATOM   1797 C  C     . PRO A 1 233 ? -0.262  4.424   -14.378 1.00 35.33  ? 233 PRO A C     1 
ATOM   1798 O  O     . PRO A 1 233 ? 0.369   4.602   -13.325 1.00 34.71  ? 233 PRO A O     1 
ATOM   1799 C  CB    . PRO A 1 233 ? -0.575  6.954   -14.375 1.00 38.07  ? 233 PRO A CB    1 
ATOM   1800 C  CG    . PRO A 1 233 ? -1.770  7.079   -13.487 1.00 38.26  ? 233 PRO A CG    1 
ATOM   1801 C  CD    . PRO A 1 233 ? -2.899  6.632   -14.342 1.00 39.50  ? 233 PRO A CD    1 
ATOM   1802 N  N     . TRP A 1 234 ? -0.498  3.212   -14.888 1.00 33.79  ? 234 TRP A N     1 
ATOM   1803 C  CA    . TRP A 1 234 ? -0.197  1.964   -14.154 1.00 32.19  ? 234 TRP A CA    1 
ATOM   1804 C  C     . TRP A 1 234 ? 0.463   0.971   -15.079 1.00 31.34  ? 234 TRP A C     1 
ATOM   1805 O  O     . TRP A 1 234 ? -0.068  0.623   -16.160 1.00 32.15  ? 234 TRP A O     1 
ATOM   1806 C  CB    . TRP A 1 234 ? -1.437  1.323   -13.522 1.00 32.55  ? 234 TRP A CB    1 
ATOM   1807 C  CG    . TRP A 1 234 ? -2.141  2.277   -12.662 1.00 35.15  ? 234 TRP A CG    1 
ATOM   1808 C  CD1   . TRP A 1 234 ? -1.645  2.872   -11.539 1.00 35.48  ? 234 TRP A CD1   1 
ATOM   1809 C  CD2   . TRP A 1 234 ? -3.455  2.817   -12.859 1.00 37.59  ? 234 TRP A CD2   1 
ATOM   1810 N  NE1   . TRP A 1 234 ? -2.571  3.740   -11.028 1.00 36.69  ? 234 TRP A NE1   1 
ATOM   1811 C  CE2   . TRP A 1 234 ? -3.688  3.736   -11.811 1.00 38.00  ? 234 TRP A CE2   1 
ATOM   1812 C  CE3   . TRP A 1 234 ? -4.452  2.615   -13.815 1.00 41.17  ? 234 TRP A CE3   1 
ATOM   1813 C  CZ2   . TRP A 1 234 ? -4.889  4.476   -11.677 1.00 40.10  ? 234 TRP A CZ2   1 
ATOM   1814 C  CZ3   . TRP A 1 234 ? -5.684  3.375   -13.692 1.00 44.09  ? 234 TRP A CZ3   1 
ATOM   1815 C  CH2   . TRP A 1 234 ? -5.858  4.297   -12.607 1.00 42.06  ? 234 TRP A CH2   1 
ATOM   1816 N  N     . LEU A 1 235 ? 1.634   0.541   -14.648 1.00 28.47  ? 235 LEU A N     1 
ATOM   1817 C  CA    . LEU A 1 235 ? 2.422   -0.412  -15.360 1.00 28.20  ? 235 LEU A CA    1 
ATOM   1818 C  C     . LEU A 1 235 ? 2.463   -1.702  -14.626 1.00 25.78  ? 235 LEU A C     1 
ATOM   1819 O  O     . LEU A 1 235 ? 2.435   -1.747  -13.394 1.00 24.51  ? 235 LEU A O     1 
ATOM   1820 C  CB    . LEU A 1 235 ? 3.841   0.098   -15.526 1.00 28.75  ? 235 LEU A CB    1 
ATOM   1821 C  CG    . LEU A 1 235 ? 3.945   1.536   -16.013 1.00 30.04  ? 235 LEU A CG    1 
ATOM   1822 C  CD1   . LEU A 1 235 ? 5.411   1.946   -16.021 1.00 30.46  ? 235 LEU A CD1   1 
ATOM   1823 C  CD2   . LEU A 1 235 ? 3.325   1.673   -17.379 1.00 31.61  ? 235 LEU A CD2   1 
ATOM   1824 N  N     . TYR A 1 236 ? 2.504   -2.759  -15.422 1.00 25.92  ? 236 TYR A N     1 
ATOM   1825 C  CA    . TYR A 1 236 ? 2.547   -4.101  -14.924 1.00 24.96  ? 236 TYR A CA    1 
ATOM   1826 C  C     . TYR A 1 236 ? 3.706   -4.726  -15.676 1.00 25.16  ? 236 TYR A C     1 
ATOM   1827 O  O     . TYR A 1 236 ? 3.584   -5.106  -16.891 1.00 25.88  ? 236 TYR A O     1 
ATOM   1828 C  CB    . TYR A 1 236 ? 1.251   -4.856  -15.216 1.00 24.88  ? 236 TYR A CB    1 
ATOM   1829 C  CG    . TYR A 1 236 ? 0.050   -4.090  -14.855 1.00 25.60  ? 236 TYR A CG    1 
ATOM   1830 C  CD1   . TYR A 1 236 ? -0.070  -3.593  -13.591 1.00 25.84  ? 236 TYR A CD1   1 
ATOM   1831 C  CD2   . TYR A 1 236 ? -0.986  -3.872  -15.758 1.00 27.71  ? 236 TYR A CD2   1 
ATOM   1832 C  CE1   . TYR A 1 236 ? -1.171  -2.875  -13.191 1.00 27.15  ? 236 TYR A CE1   1 
ATOM   1833 C  CE2   . TYR A 1 236 ? -2.135  -3.149  -15.398 1.00 28.49  ? 236 TYR A CE2   1 
ATOM   1834 C  CZ    . TYR A 1 236 ? -2.212  -2.641  -14.085 1.00 29.07  ? 236 TYR A CZ    1 
ATOM   1835 O  OH    . TYR A 1 236 ? -3.280  -1.904  -13.582 1.00 29.59  ? 236 TYR A OH    1 
ATOM   1836 N  N     . TYR A 1 237 ? 4.814   -4.866  -14.953 1.00 22.72  ? 237 TYR A N     1 
ATOM   1837 C  CA    . TYR A 1 237 ? 5.881   -5.708  -15.409 1.00 21.44  ? 237 TYR A CA    1 
ATOM   1838 C  C     . TYR A 1 237 ? 5.363   -7.144  -15.217 1.00 21.03  ? 237 TYR A C     1 
ATOM   1839 O  O     . TYR A 1 237 ? 4.882   -7.519  -14.156 1.00 18.71  ? 237 TYR A O     1 
ATOM   1840 C  CB    . TYR A 1 237 ? 7.214   -5.429  -14.609 1.00 20.66  ? 237 TYR A CB    1 
ATOM   1841 C  CG    . TYR A 1 237 ? 8.217   -6.523  -14.806 1.00 20.51  ? 237 TYR A CG    1 
ATOM   1842 C  CD1   . TYR A 1 237 ? 9.054   -6.505  -15.832 1.00 20.71  ? 237 TYR A CD1   1 
ATOM   1843 C  CD2   . TYR A 1 237 ? 8.273   -7.603  -13.953 1.00 20.21  ? 237 TYR A CD2   1 
ATOM   1844 C  CE1   . TYR A 1 237 ? 9.966   -7.530  -16.049 1.00 21.36  ? 237 TYR A CE1   1 
ATOM   1845 C  CE2   . TYR A 1 237 ? 9.225   -8.631  -14.123 1.00 19.90  ? 237 TYR A CE2   1 
ATOM   1846 C  CZ    . TYR A 1 237 ? 10.054  -8.591  -15.225 1.00 20.52  ? 237 TYR A CZ    1 
ATOM   1847 O  OH    . TYR A 1 237 ? 10.969  -9.576  -15.477 1.00 19.94  ? 237 TYR A OH    1 
ATOM   1848 N  N     . THR A 1 238 ? 5.555   -7.946  -16.257 1.00 22.36  ? 238 THR A N     1 
ATOM   1849 C  CA    . THR A 1 238 ? 4.829   -9.159  -16.415 1.00 23.20  ? 238 THR A CA    1 
ATOM   1850 C  C     . THR A 1 238 ? 5.728   -10.196 -17.041 1.00 22.54  ? 238 THR A C     1 
ATOM   1851 O  O     . THR A 1 238 ? 6.347   -9.888  -18.054 1.00 23.01  ? 238 THR A O     1 
ATOM   1852 C  CB    . THR A 1 238 ? 3.662   -8.937  -17.384 1.00 25.26  ? 238 THR A CB    1 
ATOM   1853 O  OG1   . THR A 1 238 ? 2.779   -7.931  -16.876 1.00 29.02  ? 238 THR A OG1   1 
ATOM   1854 C  CG2   . THR A 1 238 ? 2.895   -10.254 -17.626 1.00 26.19  ? 238 THR A CG2   1 
ATOM   1855 N  N     . VAL A 1 239 ? 5.746   -11.407 -16.455 1.00 21.44  ? 239 VAL A N     1 
ATOM   1856 C  CA    . VAL A 1 239 ? 6.355   -12.543 -17.073 1.00 21.95  ? 239 VAL A CA    1 
ATOM   1857 C  C     . VAL A 1 239 ? 5.305   -13.646 -17.237 1.00 23.22  ? 239 VAL A C     1 
ATOM   1858 O  O     . VAL A 1 239 ? 4.787   -14.153 -16.290 1.00 21.21  ? 239 VAL A O     1 
ATOM   1859 C  CB    . VAL A 1 239 ? 7.532   -13.062 -16.252 1.00 21.51  ? 239 VAL A CB    1 
ATOM   1860 C  CG1   . VAL A 1 239 ? 8.213   -14.233 -16.933 1.00 21.90  ? 239 VAL A CG1   1 
ATOM   1861 C  CG2   . VAL A 1 239 ? 8.528   -11.953 -16.058 1.00 21.90  ? 239 VAL A CG2   1 
ATOM   1862 N  N     . THR A 1 240 ? 5.081   -14.044 -18.492 1.00 25.94  ? 240 THR A N     1 
ATOM   1863 C  CA    . THR A 1 240 ? 4.152   -15.133 -18.855 1.00 27.97  ? 240 THR A CA    1 
ATOM   1864 C  C     . THR A 1 240 ? 4.807   -16.360 -19.540 1.00 29.03  ? 240 THR A C     1 
ATOM   1865 O  O     . THR A 1 240 ? 4.155   -17.405 -19.717 1.00 31.57  ? 240 THR A O     1 
ATOM   1866 C  CB    . THR A 1 240 ? 3.092   -14.572 -19.863 1.00 29.73  ? 240 THR A CB    1 
ATOM   1867 O  OG1   . THR A 1 240 ? 3.693   -13.671 -20.831 1.00 28.22  ? 240 THR A OG1   1 
ATOM   1868 C  CG2   . THR A 1 240 ? 2.053   -13.809 -19.117 1.00 29.34  ? 240 THR A CG2   1 
ATOM   1869 N  N     . ASN A 1 241 ? 6.072   -16.227 -19.941 1.00 26.84  ? 241 ASN A N     1 
ATOM   1870 C  CA    . ASN A 1 241 ? 6.774   -17.270 -20.595 1.00 26.05  ? 241 ASN A CA    1 
ATOM   1871 C  C     . ASN A 1 241 ? 7.220   -18.285 -19.580 1.00 24.58  ? 241 ASN A C     1 
ATOM   1872 O  O     . ASN A 1 241 ? 7.949   -17.954 -18.678 1.00 24.90  ? 241 ASN A O     1 
ATOM   1873 C  CB    . ASN A 1 241 ? 7.951   -16.615 -21.308 1.00 27.93  ? 241 ASN A CB    1 
ATOM   1874 C  CG    . ASN A 1 241 ? 8.727   -17.574 -22.111 1.00 28.46  ? 241 ASN A CG    1 
ATOM   1875 O  OD1   . ASN A 1 241 ? 9.276   -18.499 -21.555 1.00 29.56  ? 241 ASN A OD1   1 
ATOM   1876 N  ND2   . ASN A 1 241 ? 8.765   -17.396 -23.406 1.00 29.62  ? 241 ASN A ND2   1 
ATOM   1877 N  N     . PHE A 1 242 ? 6.763   -19.518 -19.669 1.00 24.19  ? 242 PHE A N     1 
ATOM   1878 C  CA    . PHE A 1 242 ? 6.972   -20.471 -18.525 1.00 23.91  ? 242 PHE A CA    1 
ATOM   1879 C  C     . PHE A 1 242 ? 8.431   -20.857 -18.340 1.00 24.02  ? 242 PHE A C     1 
ATOM   1880 O  O     . PHE A 1 242 ? 8.853   -21.079 -17.239 1.00 23.28  ? 242 PHE A O     1 
ATOM   1881 C  CB    . PHE A 1 242 ? 6.121   -21.735 -18.682 1.00 23.82  ? 242 PHE A CB    1 
ATOM   1882 C  CG    . PHE A 1 242 ? 6.417   -22.818 -17.676 1.00 23.65  ? 242 PHE A CG    1 
ATOM   1883 C  CD1   . PHE A 1 242 ? 5.877   -22.772 -16.370 1.00 22.40  ? 242 PHE A CD1   1 
ATOM   1884 C  CD2   . PHE A 1 242 ? 7.190   -23.931 -18.042 1.00 23.64  ? 242 PHE A CD2   1 
ATOM   1885 C  CE1   . PHE A 1 242 ? 6.113   -23.758 -15.459 1.00 22.16  ? 242 PHE A CE1   1 
ATOM   1886 C  CE2   . PHE A 1 242 ? 7.455   -24.914 -17.095 1.00 23.79  ? 242 PHE A CE2   1 
ATOM   1887 C  CZ    . PHE A 1 242 ? 6.903   -24.837 -15.824 1.00 23.07  ? 242 PHE A CZ    1 
ATOM   1888 N  N     . SER A 1 243 ? 9.206   -20.912 -19.416 1.00 25.51  ? 243 SER A N     1 
ATOM   1889 C  CA    . SER A 1 243 ? 10.600  -21.256 -19.261 1.00 26.54  ? 243 SER A CA    1 
ATOM   1890 C  C     . SER A 1 243 ? 11.422  -20.125 -18.582 1.00 26.59  ? 243 SER A C     1 
ATOM   1891 O  O     . SER A 1 243 ? 12.382  -20.418 -17.844 1.00 30.08  ? 243 SER A O     1 
ATOM   1892 C  CB    . SER A 1 243 ? 11.197  -21.689 -20.566 1.00 26.90  ? 243 SER A CB    1 
ATOM   1893 O  OG    . SER A 1 243 ? 11.473  -20.524 -21.238 1.00 28.54  ? 243 SER A OG    1 
ATOM   1894 N  N     . ASP A 1 244 ? 11.030  -18.877 -18.754 1.00 25.27  ? 244 ASP A N     1 
ATOM   1895 C  CA    . ASP A 1 244 ? 11.499  -17.757 -17.880 1.00 25.59  ? 244 ASP A CA    1 
ATOM   1896 C  C     . ASP A 1 244 ? 11.068  -17.836 -16.417 1.00 23.57  ? 244 ASP A C     1 
ATOM   1897 O  O     . ASP A 1 244 ? 11.832  -17.566 -15.539 1.00 22.14  ? 244 ASP A O     1 
ATOM   1898 C  CB    . ASP A 1 244 ? 11.023  -16.404 -18.431 1.00 26.45  ? 244 ASP A CB    1 
ATOM   1899 C  CG    . ASP A 1 244 ? 11.691  -16.053 -19.703 1.00 29.06  ? 244 ASP A CG    1 
ATOM   1900 O  OD1   . ASP A 1 244 ? 12.783  -16.588 -19.947 1.00 30.81  ? 244 ASP A OD1   1 
ATOM   1901 O  OD2   . ASP A 1 244 ? 11.158  -15.225 -20.464 1.00 31.23  ? 244 ASP A OD2   1 
ATOM   1902 N  N     . ILE A 1 245 ? 9.828   -18.206 -16.186 1.00 23.39  ? 245 ILE A N     1 
ATOM   1903 C  CA    . ILE A 1 245 ? 9.382   -18.447 -14.839 1.00 23.85  ? 245 ILE A CA    1 
ATOM   1904 C  C     . ILE A 1 245 ? 10.333  -19.458 -14.156 1.00 26.02  ? 245 ILE A C     1 
ATOM   1905 O  O     . ILE A 1 245 ? 10.868  -19.194 -13.051 1.00 26.69  ? 245 ILE A O     1 
ATOM   1906 C  CB    . ILE A 1 245 ? 7.926   -18.990 -14.785 1.00 23.03  ? 245 ILE A CB    1 
ATOM   1907 C  CG1   . ILE A 1 245 ? 6.913   -17.971 -15.328 1.00 23.55  ? 245 ILE A CG1   1 
ATOM   1908 C  CG2   . ILE A 1 245 ? 7.550   -19.352 -13.372 1.00 22.71  ? 245 ILE A CG2   1 
ATOM   1909 C  CD1   . ILE A 1 245 ? 6.812   -16.663 -14.534 1.00 22.39  ? 245 ILE A CD1   1 
ATOM   1910 N  N     . GLN A 1 246 ? 10.484  -20.608 -14.800 1.00 27.60  ? 246 GLN A N     1 
ATOM   1911 C  CA    . GLN A 1 246 ? 11.333  -21.661 -14.326 1.00 30.49  ? 246 GLN A CA    1 
ATOM   1912 C  C     . GLN A 1 246 ? 12.779  -21.322 -14.308 1.00 28.41  ? 246 GLN A C     1 
ATOM   1913 O  O     . GLN A 1 246 ? 13.417  -21.689 -13.392 1.00 29.79  ? 246 GLN A O     1 
ATOM   1914 C  CB    . GLN A 1 246 ? 11.269  -22.864 -15.236 1.00 33.21  ? 246 GLN A CB    1 
ATOM   1915 C  CG    . GLN A 1 246 ? 10.071  -23.701 -15.086 1.00 35.52  ? 246 GLN A CG    1 
ATOM   1916 C  CD    . GLN A 1 246 ? 10.463  -25.137 -15.088 1.00 40.68  ? 246 GLN A CD    1 
ATOM   1917 O  OE1   . GLN A 1 246 ? 10.790  -25.733 -16.171 1.00 41.85  ? 246 GLN A OE1   1 
ATOM   1918 N  NE2   . GLN A 1 246 ? 10.458  -25.736 -13.855 1.00 41.29  ? 246 GLN A NE2   1 
ATOM   1919 N  N     . GLY A 1 247 ? 13.282  -20.673 -15.344 1.00 27.61  ? 247 GLY A N     1 
ATOM   1920 C  CA    . GLY A 1 247 ? 14.705  -20.486 -15.507 1.00 27.01  ? 247 GLY A CA    1 
ATOM   1921 C  C     . GLY A 1 247 ? 15.204  -19.292 -14.748 1.00 27.05  ? 247 GLY A C     1 
ATOM   1922 O  O     . GLY A 1 247 ? 16.337  -19.290 -14.338 1.00 28.23  ? 247 GLY A O     1 
ATOM   1923 N  N     . LYS A 1 248 ? 14.394  -18.236 -14.629 1.00 25.50  ? 248 LYS A N     1 
ATOM   1924 C  CA    . LYS A 1 248 ? 14.841  -16.955 -14.073 1.00 24.52  ? 248 LYS A CA    1 
ATOM   1925 C  C     . LYS A 1 248 ? 14.130  -16.430 -12.849 1.00 23.20  ? 248 LYS A C     1 
ATOM   1926 O  O     . LYS A 1 248 ? 14.804  -16.031 -11.864 1.00 21.07  ? 248 LYS A O     1 
ATOM   1927 C  CB    . LYS A 1 248 ? 14.712  -15.935 -15.135 1.00 27.73  ? 248 LYS A CB    1 
ATOM   1928 C  CG    . LYS A 1 248 ? 15.507  -16.399 -16.325 1.00 29.90  ? 248 LYS A CG    1 
ATOM   1929 C  CD    . LYS A 1 248 ? 15.282  -15.482 -17.475 1.00 33.83  ? 248 LYS A CD    1 
ATOM   1930 C  CE    . LYS A 1 248 ? 15.691  -16.320 -18.711 1.00 37.65  ? 248 LYS A CE    1 
ATOM   1931 N  NZ    . LYS A 1 248 ? 16.003  -15.491 -19.881 1.00 40.38  ? 248 LYS A NZ    1 
ATOM   1932 N  N     . ILE A 1 249 ? 12.788  -16.473 -12.851 1.00 21.71  ? 249 ILE A N     1 
ATOM   1933 C  CA    . ILE A 1 249 ? 12.045  -15.875 -11.704 1.00 21.70  ? 249 ILE A CA    1 
ATOM   1934 C  C     . ILE A 1 249 ? 12.158  -16.809 -10.470 1.00 21.70  ? 249 ILE A C     1 
ATOM   1935 O  O     . ILE A 1 249 ? 12.607  -16.435 -9.413  1.00 24.19  ? 249 ILE A O     1 
ATOM   1936 C  CB    . ILE A 1 249 ? 10.570  -15.566 -12.067 1.00 20.63  ? 249 ILE A CB    1 
ATOM   1937 C  CG1   . ILE A 1 249 ? 10.472  -14.725 -13.336 1.00 20.63  ? 249 ILE A CG1   1 
ATOM   1938 C  CG2   . ILE A 1 249 ? 9.793   -14.924 -10.915 1.00 20.27  ? 249 ILE A CG2   1 
ATOM   1939 C  CD1   . ILE A 1 249 ? 11.178  -13.407 -13.235 1.00 21.07  ? 249 ILE A CD1   1 
ATOM   1940 N  N     . ILE A 1 250 ? 11.785  -18.037 -10.603 1.00 21.73  ? 250 ILE A N     1 
ATOM   1941 C  CA    . ILE A 1 250 ? 11.830  -18.937 -9.445  1.00 22.11  ? 250 ILE A CA    1 
ATOM   1942 C  C     . ILE A 1 250 ? 13.235  -19.009 -8.772  1.00 22.41  ? 250 ILE A C     1 
ATOM   1943 O  O     . ILE A 1 250 ? 13.345  -18.843 -7.548  1.00 22.96  ? 250 ILE A O     1 
ATOM   1944 C  CB    . ILE A 1 250 ? 11.180  -20.341 -9.804  1.00 21.74  ? 250 ILE A CB    1 
ATOM   1945 C  CG1   . ILE A 1 250 ? 9.667   -20.157 -9.857  1.00 20.53  ? 250 ILE A CG1   1 
ATOM   1946 C  CG2   . ILE A 1 250 ? 11.582  -21.457 -8.819  1.00 22.16  ? 250 ILE A CG2   1 
ATOM   1947 C  CD1   . ILE A 1 250 ? 8.915   -21.276 -10.506 1.00 20.31  ? 250 ILE A CD1   1 
ATOM   1948 N  N     . PRO A 1 251 ? 14.281  -19.227 -9.575  1.00 23.25  ? 251 PRO A N     1 
ATOM   1949 C  CA    . PRO A 1 251 ? 15.585  -19.225 -8.955  1.00 22.90  ? 251 PRO A CA    1 
ATOM   1950 C  C     . PRO A 1 251 ? 15.983  -17.915 -8.349  1.00 22.81  ? 251 PRO A C     1 
ATOM   1951 O  O     . PRO A 1 251 ? 16.580  -17.961 -7.275  1.00 23.22  ? 251 PRO A O     1 
ATOM   1952 C  CB    . PRO A 1 251 ? 16.530  -19.607 -10.088 1.00 23.29  ? 251 PRO A CB    1 
ATOM   1953 C  CG    . PRO A 1 251 ? 15.689  -20.431 -10.977 1.00 23.20  ? 251 PRO A CG    1 
ATOM   1954 C  CD    . PRO A 1 251 ? 14.339  -19.740 -10.968 1.00 22.35  ? 251 PRO A CD    1 
ATOM   1955 N  N     . PHE A 1 252 ? 15.688  -16.772 -8.963  1.00 21.77  ? 252 PHE A N     1 
ATOM   1956 C  CA    . PHE A 1 252 ? 16.004  -15.495 -8.281  1.00 22.01  ? 252 PHE A CA    1 
ATOM   1957 C  C     . PHE A 1 252 ? 15.424  -15.436 -6.870  1.00 21.10  ? 252 PHE A C     1 
ATOM   1958 O  O     . PHE A 1 252 ? 16.128  -15.199 -5.926  1.00 19.99  ? 252 PHE A O     1 
ATOM   1959 C  CB    . PHE A 1 252 ? 15.448  -14.271 -8.996  1.00 22.03  ? 252 PHE A CB    1 
ATOM   1960 C  CG    . PHE A 1 252 ? 15.951  -12.972 -8.415  1.00 22.26  ? 252 PHE A CG    1 
ATOM   1961 C  CD1   . PHE A 1 252 ? 17.194  -12.464 -8.817  1.00 22.67  ? 252 PHE A CD1   1 
ATOM   1962 C  CD2   . PHE A 1 252 ? 15.182  -12.261 -7.513  1.00 21.87  ? 252 PHE A CD2   1 
ATOM   1963 C  CE1   . PHE A 1 252 ? 17.671  -11.277 -8.282  1.00 23.83  ? 252 PHE A CE1   1 
ATOM   1964 C  CE2   . PHE A 1 252 ? 15.661  -11.072 -6.965  1.00 22.70  ? 252 PHE A CE2   1 
ATOM   1965 C  CZ    . PHE A 1 252 ? 16.898  -10.557 -7.353  1.00 22.56  ? 252 PHE A CZ    1 
ATOM   1966 N  N     . PHE A 1 253 ? 14.113  -15.626 -6.786  1.00 20.96  ? 253 PHE A N     1 
ATOM   1967 C  CA    . PHE A 1 253 ? 13.428  -15.569 -5.496  1.00 21.27  ? 253 PHE A CA    1 
ATOM   1968 C  C     . PHE A 1 253 ? 13.662  -16.769 -4.541  1.00 22.49  ? 253 PHE A C     1 
ATOM   1969 O  O     . PHE A 1 253 ? 13.371  -16.690 -3.367  1.00 21.25  ? 253 PHE A O     1 
ATOM   1970 C  CB    . PHE A 1 253 ? 11.952  -15.193 -5.643  1.00 19.96  ? 253 PHE A CB    1 
ATOM   1971 C  CG    . PHE A 1 253 ? 11.757  -13.884 -6.331  1.00 19.89  ? 253 PHE A CG    1 
ATOM   1972 C  CD1   . PHE A 1 253 ? 11.988  -12.702 -5.661  1.00 19.86  ? 253 PHE A CD1   1 
ATOM   1973 C  CD2   . PHE A 1 253 ? 11.408  -13.835 -7.676  1.00 21.05  ? 253 PHE A CD2   1 
ATOM   1974 C  CE1   . PHE A 1 253 ? 11.865  -11.493 -6.245  1.00 20.00  ? 253 PHE A CE1   1 
ATOM   1975 C  CE2   . PHE A 1 253 ? 11.259  -12.628 -8.318  1.00 21.32  ? 253 PHE A CE2   1 
ATOM   1976 C  CZ    . PHE A 1 253 ? 11.514  -11.437 -7.598  1.00 21.89  ? 253 PHE A CZ    1 
ATOM   1977 N  N     . HIS A 1 254 ? 14.168  -17.864 -5.061  1.00 25.04  ? 254 HIS A N     1 
ATOM   1978 C  CA    . HIS A 1 254 ? 14.637  -18.937 -4.224  1.00 29.68  ? 254 HIS A CA    1 
ATOM   1979 C  C     . HIS A 1 254 ? 15.817  -18.455 -3.388  1.00 29.66  ? 254 HIS A C     1 
ATOM   1980 O  O     . HIS A 1 254 ? 15.860  -18.696 -2.218  1.00 30.05  ? 254 HIS A O     1 
ATOM   1981 C  CB    . HIS A 1 254 ? 15.010  -20.214 -5.031  1.00 31.68  ? 254 HIS A CB    1 
ATOM   1982 C  CG    . HIS A 1 254 ? 15.549  -21.320 -4.172  1.00 36.63  ? 254 HIS A CG    1 
ATOM   1983 N  ND1   . HIS A 1 254 ? 14.768  -22.002 -3.243  1.00 39.02  ? 254 HIS A ND1   1 
ATOM   1984 C  CD2   . HIS A 1 254 ? 16.816  -21.825 -4.048  1.00 39.48  ? 254 HIS A CD2   1 
ATOM   1985 C  CE1   . HIS A 1 254 ? 15.533  -22.872 -2.593  1.00 40.74  ? 254 HIS A CE1   1 
ATOM   1986 N  NE2   . HIS A 1 254 ? 16.774  -22.792 -3.068  1.00 40.72  ? 254 HIS A NE2   1 
ATOM   1987 N  N     . GLN A 1 255 ? 16.763  -17.789 -4.024  1.00 30.30  ? 255 GLN A N     1 
ATOM   1988 C  CA    . GLN A 1 255 ? 17.914  -17.187 -3.346  1.00 32.05  ? 255 GLN A CA    1 
ATOM   1989 C  C     . GLN A 1 255 ? 17.669  -15.865 -2.629  1.00 29.40  ? 255 GLN A C     1 
ATOM   1990 O  O     . GLN A 1 255 ? 18.272  -15.614 -1.624  1.00 34.66  ? 255 GLN A O     1 
ATOM   1991 C  CB    . GLN A 1 255 ? 18.927  -16.924 -4.373  1.00 35.45  ? 255 GLN A CB    1 
ATOM   1992 C  CG    . GLN A 1 255 ? 20.236  -16.789 -3.791  1.00 41.63  ? 255 GLN A CG    1 
ATOM   1993 C  CD    . GLN A 1 255 ? 21.243  -17.155 -4.832  1.00 47.91  ? 255 GLN A CD    1 
ATOM   1994 O  OE1   . GLN A 1 255 ? 21.238  -16.584 -5.925  1.00 49.59  ? 255 GLN A OE1   1 
ATOM   1995 N  NE2   . GLN A 1 255 ? 22.114  -18.107 -4.517  1.00 51.03  ? 255 GLN A NE2   1 
ATOM   1996 N  N     . TYR A 1 256 ? 16.843  -14.988 -3.174  1.00 26.01  ? 256 TYR A N     1 
ATOM   1997 C  CA    . TYR A 1 256 ? 16.469  -13.691 -2.519  1.00 22.89  ? 256 TYR A CA    1 
ATOM   1998 C  C     . TYR A 1 256 ? 14.987  -13.797 -2.158  1.00 21.79  ? 256 TYR A C     1 
ATOM   1999 O  O     . TYR A 1 256 ? 14.127  -13.494 -2.956  1.00 20.38  ? 256 TYR A O     1 
ATOM   2000 C  CB    . TYR A 1 256 ? 16.832  -12.505 -3.423  1.00 21.15  ? 256 TYR A CB    1 
ATOM   2001 C  CG    . TYR A 1 256 ? 18.310  -12.496 -3.792  1.00 21.16  ? 256 TYR A CG    1 
ATOM   2002 C  CD1   . TYR A 1 256 ? 19.271  -11.971 -2.902  1.00 22.80  ? 256 TYR A CD1   1 
ATOM   2003 C  CD2   . TYR A 1 256 ? 18.760  -13.097 -4.944  1.00 21.14  ? 256 TYR A CD2   1 
ATOM   2004 C  CE1   . TYR A 1 256 ? 20.618  -11.976 -3.211  1.00 23.82  ? 256 TYR A CE1   1 
ATOM   2005 C  CE2   . TYR A 1 256 ? 20.093  -13.131 -5.277  1.00 22.40  ? 256 TYR A CE2   1 
ATOM   2006 C  CZ    . TYR A 1 256 ? 21.017  -12.576 -4.417  1.00 24.30  ? 256 TYR A CZ    1 
ATOM   2007 O  OH    . TYR A 1 256 ? 22.363  -12.633 -4.705  1.00 27.55  ? 256 TYR A OH    1 
ATOM   2008 N  N     . LYS A 1 257 ? 14.719  -14.212 -0.923  1.00 22.39  ? 257 LYS A N     1 
ATOM   2009 C  CA    . LYS A 1 257 ? 13.406  -14.662 -0.500  1.00 23.03  ? 257 LYS A CA    1 
ATOM   2010 C  C     . LYS A 1 257 ? 12.483  -13.522 -0.188  1.00 22.53  ? 257 LYS A C     1 
ATOM   2011 O  O     . LYS A 1 257 ? 12.890  -12.569 0.391   1.00 21.69  ? 257 LYS A O     1 
ATOM   2012 C  CB    . LYS A 1 257 ? 13.486  -15.521 0.737   1.00 25.02  ? 257 LYS A CB    1 
ATOM   2013 C  CG    . LYS A 1 257 ? 14.077  -16.903 0.487   1.00 27.97  ? 257 LYS A CG    1 
ATOM   2014 C  CD    . LYS A 1 257 ? 14.392  -17.567 1.828   1.00 30.68  ? 257 LYS A CD    1 
ATOM   2015 C  CE    . LYS A 1 257 ? 14.732  -19.011 1.744   1.00 32.91  ? 257 LYS A CE    1 
ATOM   2016 N  NZ    . LYS A 1 257 ? 14.981  -19.537 0.350   1.00 35.16  ? 257 LYS A NZ    1 
ATOM   2017 N  N     . ILE A 1 258 ? 11.240  -13.708 -0.584  1.00 21.86  ? 258 ILE A N     1 
ATOM   2018 C  CA    . ILE A 1 258 ? 10.142  -12.850 -0.338  1.00 22.46  ? 258 ILE A CA    1 
ATOM   2019 C  C     . ILE A 1 258 ? 9.910   -12.925 1.172   1.00 22.66  ? 258 ILE A C     1 
ATOM   2020 O  O     . ILE A 1 258 ? 10.126  -13.960 1.784   1.00 21.62  ? 258 ILE A O     1 
ATOM   2021 C  CB    . ILE A 1 258 ? 8.914   -13.395 -1.174  1.00 24.35  ? 258 ILE A CB    1 
ATOM   2022 C  CG1   . ILE A 1 258 ? 9.147   -13.234 -2.692  1.00 25.16  ? 258 ILE A CG1   1 
ATOM   2023 C  CG2   . ILE A 1 258 ? 7.579   -12.804 -0.833  1.00 25.14  ? 258 ILE A CG2   1 
ATOM   2024 C  CD1   . ILE A 1 258 ? 9.520   -11.847 -3.166  1.00 24.74  ? 258 ILE A CD1   1 
ATOM   2025 N  N     . ILE A 1 259 ? 9.461   -11.806 1.738   1.00 21.25  ? 259 ILE A N     1 
ATOM   2026 C  CA    . ILE A 1 259 ? 9.126   -11.677 3.159   1.00 21.87  ? 259 ILE A CA    1 
ATOM   2027 C  C     . ILE A 1 259 ? 7.624   -11.470 3.327   1.00 21.55  ? 259 ILE A C     1 
ATOM   2028 O  O     . ILE A 1 259 ? 6.883   -11.101 2.416   1.00 21.19  ? 259 ILE A O     1 
ATOM   2029 C  CB    . ILE A 1 259 ? 9.982   -10.537 3.832   1.00 21.52  ? 259 ILE A CB    1 
ATOM   2030 C  CG1   . ILE A 1 259 ? 9.564   -9.148  3.280   1.00 20.82  ? 259 ILE A CG1   1 
ATOM   2031 C  CG2   . ILE A 1 259 ? 11.470  -10.852 3.627   1.00 20.64  ? 259 ILE A CG2   1 
ATOM   2032 C  CD1   . ILE A 1 259 ? 10.337  -7.969  3.791   1.00 20.87  ? 259 ILE A CD1   1 
ATOM   2033 N  N     . GLY A 1 260 ? 7.150   -11.758 4.522   1.00 23.68  ? 260 GLY A N     1 
ATOM   2034 C  CA    . GLY A 1 260 ? 5.685   -11.799 4.776   1.00 24.09  ? 260 GLY A CA    1 
ATOM   2035 C  C     . GLY A 1 260 ? 5.006   -13.081 4.327   1.00 25.05  ? 260 GLY A C     1 
ATOM   2036 O  O     . GLY A 1 260 ? 5.658   -14.005 3.807   1.00 26.28  ? 260 GLY A O     1 
ATOM   2037 N  N     . SER A 1 261 ? 3.692   -13.151 4.507   1.00 25.24  ? 261 SER A N     1 
ATOM   2038 C  CA    . SER A 1 261 ? 2.963   -14.356 4.147   1.00 27.67  ? 261 SER A CA    1 
ATOM   2039 C  C     . SER A 1 261 ? 3.013   -14.657 2.633   1.00 24.85  ? 261 SER A C     1 
ATOM   2040 O  O     . SER A 1 261 ? 2.828   -15.795 2.216   1.00 25.08  ? 261 SER A O     1 
ATOM   2041 C  CB    . SER A 1 261 ? 1.511   -14.282 4.629   1.00 30.51  ? 261 SER A CB    1 
ATOM   2042 O  OG    . SER A 1 261 ? 0.932   -13.195 3.946   1.00 35.23  ? 261 SER A OG    1 
ATOM   2043 N  N     . ALA A 1 262 ? 3.341   -13.661 1.832   1.00 22.83  ? 262 ALA A N     1 
ATOM   2044 C  CA    . ALA A 1 262 ? 3.537   -13.857 0.434   1.00 22.43  ? 262 ALA A CA    1 
ATOM   2045 C  C     . ALA A 1 262 ? 4.640   -14.922 0.154   1.00 22.00  ? 262 ALA A C     1 
ATOM   2046 O  O     . ALA A 1 262 ? 4.639   -15.511 -0.928  1.00 21.05  ? 262 ALA A O     1 
ATOM   2047 C  CB    . ALA A 1 262 ? 3.885   -12.533 -0.237  1.00 22.31  ? 262 ALA A CB    1 
ATOM   2048 N  N     . TYR A 1 263 ? 5.575   -15.146 1.090   1.00 21.17  ? 263 TYR A N     1 
ATOM   2049 C  CA    . TYR A 1 263 ? 6.515   -16.211 0.929   1.00 21.80  ? 263 TYR A CA    1 
ATOM   2050 C  C     . TYR A 1 263 ? 5.852   -17.625 0.789   1.00 22.49  ? 263 TYR A C     1 
ATOM   2051 O  O     . TYR A 1 263 ? 6.249   -18.389 -0.078  1.00 22.34  ? 263 TYR A O     1 
ATOM   2052 C  CB    . TYR A 1 263 ? 7.564   -16.174 2.023   1.00 23.30  ? 263 TYR A CB    1 
ATOM   2053 C  CG    . TYR A 1 263 ? 8.560   -17.329 1.907   1.00 25.14  ? 263 TYR A CG    1 
ATOM   2054 C  CD1   . TYR A 1 263 ? 9.424   -17.397 0.820   1.00 25.13  ? 263 TYR A CD1   1 
ATOM   2055 C  CD2   . TYR A 1 263 ? 8.551   -18.407 2.817   1.00 27.08  ? 263 TYR A CD2   1 
ATOM   2056 C  CE1   . TYR A 1 263 ? 10.318  -18.434 0.674   1.00 26.92  ? 263 TYR A CE1   1 
ATOM   2057 C  CE2   . TYR A 1 263 ? 9.459   -19.477 2.688   1.00 29.32  ? 263 TYR A CE2   1 
ATOM   2058 C  CZ    . TYR A 1 263 ? 10.331  -19.485 1.600   1.00 30.22  ? 263 TYR A CZ    1 
ATOM   2059 O  OH    . TYR A 1 263 ? 11.240  -20.505 1.402   1.00 34.00  ? 263 TYR A OH    1 
ATOM   2060 N  N     . GLY A 1 264 ? 4.816   -17.942 1.579   1.00 23.74  ? 264 GLY A N     1 
ATOM   2061 C  CA    . GLY A 1 264 ? 3.992   -19.166 1.428   1.00 23.73  ? 264 GLY A CA    1 
ATOM   2062 C  C     . GLY A 1 264 ? 3.338   -19.243 0.057   1.00 23.91  ? 264 GLY A C     1 
ATOM   2063 O  O     . GLY A 1 264 ? 3.238   -20.318 -0.555  1.00 24.42  ? 264 GLY A O     1 
ATOM   2064 N  N     . ASP A 1 265 ? 2.919   -18.112 -0.459  1.00 24.19  ? 265 ASP A N     1 
ATOM   2065 C  CA    . ASP A 1 265 ? 2.310   -18.076 -1.766  1.00 26.23  ? 265 ASP A CA    1 
ATOM   2066 C  C     . ASP A 1 265 ? 3.294   -18.421 -2.899  1.00 25.54  ? 265 ASP A C     1 
ATOM   2067 O  O     . ASP A 1 265 ? 2.985   -19.206 -3.806  1.00 27.83  ? 265 ASP A O     1 
ATOM   2068 C  CB    . ASP A 1 265 ? 1.727   -16.682 -2.040  1.00 28.36  ? 265 ASP A CB    1 
ATOM   2069 C  CG    . ASP A 1 265 ? 0.476   -16.365 -1.178  1.00 30.55  ? 265 ASP A CG    1 
ATOM   2070 O  OD1   . ASP A 1 265 ? -0.161  -17.250 -0.606  1.00 31.90  ? 265 ASP A OD1   1 
ATOM   2071 O  OD2   . ASP A 1 265 ? 0.132   -15.213 -1.101  1.00 31.27  ? 265 ASP A OD2   1 
ATOM   2072 N  N     . TYR A 1 266 ? 4.453   -17.791 -2.862  1.00 23.66  ? 266 TYR A N     1 
ATOM   2073 C  CA    . TYR A 1 266 ? 5.561   -18.132 -3.741  1.00 22.33  ? 266 TYR A CA    1 
ATOM   2074 C  C     . TYR A 1 266 ? 5.876   -19.615 -3.678  1.00 21.96  ? 266 TYR A C     1 
ATOM   2075 O  O     . TYR A 1 266 ? 6.082   -20.192 -4.723  1.00 19.91  ? 266 TYR A O     1 
ATOM   2076 C  CB    . TYR A 1 266 ? 6.824   -17.341 -3.382  1.00 21.47  ? 266 TYR A CB    1 
ATOM   2077 C  CG    . TYR A 1 266 ? 8.116   -17.850 -3.992  1.00 21.39  ? 266 TYR A CG    1 
ATOM   2078 C  CD1   . TYR A 1 266 ? 8.469   -17.546 -5.306  1.00 22.22  ? 266 TYR A CD1   1 
ATOM   2079 C  CD2   . TYR A 1 266 ? 8.972   -18.627 -3.270  1.00 22.16  ? 266 TYR A CD2   1 
ATOM   2080 C  CE1   . TYR A 1 266 ? 9.668   -18.026 -5.877  1.00 22.68  ? 266 TYR A CE1   1 
ATOM   2081 C  CE2   . TYR A 1 266 ? 10.162  -19.111 -3.813  1.00 23.21  ? 266 TYR A CE2   1 
ATOM   2082 C  CZ    . TYR A 1 266 ? 10.516  -18.817 -5.107  1.00 23.14  ? 266 TYR A CZ    1 
ATOM   2083 O  OH    . TYR A 1 266 ? 11.688  -19.332 -5.600  1.00 25.06  ? 266 TYR A OH    1 
ATOM   2084 N  N     . GLN A 1 267 ? 5.944   -20.220 -2.490  1.00 23.08  ? 267 GLN A N     1 
ATOM   2085 C  CA    . GLN A 1 267 ? 6.189   -21.644 -2.437  1.00 25.48  ? 267 GLN A CA    1 
ATOM   2086 C  C     . GLN A 1 267 ? 5.098   -22.485 -3.158  1.00 24.22  ? 267 GLN A C     1 
ATOM   2087 O  O     . GLN A 1 267 ? 5.375   -23.446 -3.884  1.00 23.30  ? 267 GLN A O     1 
ATOM   2088 C  CB    . GLN A 1 267 ? 6.330   -22.143 -1.005  1.00 29.06  ? 267 GLN A CB    1 
ATOM   2089 C  CG    . GLN A 1 267 ? 7.603   -21.647 -0.330  1.00 31.82  ? 267 GLN A CG    1 
ATOM   2090 C  CD    . GLN A 1 267 ? 7.622   -22.086 1.113   1.00 36.31  ? 267 GLN A CD    1 
ATOM   2091 O  OE1   . GLN A 1 267 ? 6.642   -21.932 1.859   1.00 38.82  ? 267 GLN A OE1   1 
ATOM   2092 N  NE2   . GLN A 1 267 ? 8.719   -22.676 1.512   1.00 39.95  ? 267 GLN A NE2   1 
ATOM   2093 N  N     . ASP A 1 268 ? 3.871   -22.134 -2.884  1.00 23.90  ? 268 ASP A N     1 
ATOM   2094 C  CA    . ASP A 1 268 ? 2.733   -22.747 -3.583  1.00 24.32  ? 268 ASP A CA    1 
ATOM   2095 C  C     . ASP A 1 268 ? 2.807   -22.635 -5.099  1.00 23.14  ? 268 ASP A C     1 
ATOM   2096 O  O     . ASP A 1 268 ? 2.567   -23.591 -5.866  1.00 23.89  ? 268 ASP A O     1 
ATOM   2097 C  CB    . ASP A 1 268 ? 1.477   -22.177 -2.964  1.00 24.19  ? 268 ASP A CB    1 
ATOM   2098 C  CG    . ASP A 1 268 ? 1.250   -22.763 -1.560  1.00 25.95  ? 268 ASP A CG    1 
ATOM   2099 O  OD1   . ASP A 1 268 ? 1.885   -23.774 -1.274  1.00 28.38  ? 268 ASP A OD1   1 
ATOM   2100 O  OD2   . ASP A 1 268 ? 0.440   -22.325 -0.772  1.00 24.92  ? 268 ASP A OD2   1 
ATOM   2101 N  N     . TRP A 1 269 ? 3.227   -21.471 -5.532  1.00 22.54  ? 269 TRP A N     1 
ATOM   2102 C  CA    . TRP A 1 269 ? 3.309   -21.167 -6.964  1.00 21.27  ? 269 TRP A CA    1 
ATOM   2103 C  C     . TRP A 1 269 ? 4.392   -22.054 -7.588  1.00 22.54  ? 269 TRP A C     1 
ATOM   2104 O  O     . TRP A 1 269 ? 4.250   -22.597 -8.731  1.00 21.52  ? 269 TRP A O     1 
ATOM   2105 C  CB    . TRP A 1 269 ? 3.591   -19.734 -7.026  1.00 20.15  ? 269 TRP A CB    1 
ATOM   2106 C  CG    . TRP A 1 269 ? 3.572   -18.985 -8.329  1.00 19.82  ? 269 TRP A CG    1 
ATOM   2107 C  CD1   . TRP A 1 269 ? 2.477   -18.556 -9.036  1.00 19.96  ? 269 TRP A CD1   1 
ATOM   2108 C  CD2   . TRP A 1 269 ? 4.701   -18.474 -8.993  1.00 18.99  ? 269 TRP A CD2   1 
ATOM   2109 N  NE1   . TRP A 1 269 ? 2.875   -17.807 -10.127 1.00 19.37  ? 269 TRP A NE1   1 
ATOM   2110 C  CE2   . TRP A 1 269 ? 4.252   -17.739 -10.099 1.00 18.85  ? 269 TRP A CE2   1 
ATOM   2111 C  CE3   . TRP A 1 269 ? 6.068   -18.556 -8.753  1.00 19.53  ? 269 TRP A CE3   1 
ATOM   2112 C  CZ2   . TRP A 1 269 ? 5.138   -17.112 -10.981 1.00 19.36  ? 269 TRP A CZ2   1 
ATOM   2113 C  CZ3   . TRP A 1 269 ? 6.958   -17.929 -9.621  1.00 19.38  ? 269 TRP A CZ3   1 
ATOM   2114 C  CH2   . TRP A 1 269 ? 6.482   -17.201 -10.722 1.00 19.44  ? 269 TRP A CH2   1 
ATOM   2115 N  N     . CYS A 1 270 ? 5.479   -22.218 -6.818  1.00 23.28  ? 270 CYS A N     1 
ATOM   2116 C  CA    . CYS A 1 270 ? 6.565   -23.111 -7.172  1.00 23.23  ? 270 CYS A CA    1 
ATOM   2117 C  C     . CYS A 1 270 ? 6.139   -24.542 -7.313  1.00 23.36  ? 270 CYS A C     1 
ATOM   2118 O  O     . CYS A 1 270 ? 6.600   -25.217 -8.204  1.00 21.75  ? 270 CYS A O     1 
ATOM   2119 C  CB    . CYS A 1 270 ? 7.689   -23.013 -6.118  1.00 24.40  ? 270 CYS A CB    1 
ATOM   2120 S  SG    . CYS A 1 270 ? 8.555   -21.448 -6.299  1.00 26.87  ? 270 CYS A SG    1 
ATOM   2121 N  N     . LYS A 1 271 ? 5.241   -24.967 -6.441  1.00 24.04  ? 271 LYS A N     1 
ATOM   2122 C  CA    . LYS A 1 271 ? 4.674   -26.265 -6.549  1.00 26.92  ? 271 LYS A CA    1 
ATOM   2123 C  C     . LYS A 1 271 ? 3.812   -26.450 -7.812  1.00 25.15  ? 271 LYS A C     1 
ATOM   2124 O  O     . LYS A 1 271 ? 3.855   -27.491 -8.414  1.00 25.83  ? 271 LYS A O     1 
ATOM   2125 C  CB    . LYS A 1 271 ? 3.846   -26.660 -5.299  1.00 30.30  ? 271 LYS A CB    1 
ATOM   2126 C  CG    . LYS A 1 271 ? 4.704   -27.180 -4.155  1.00 33.78  ? 271 LYS A CG    1 
ATOM   2127 C  CD    . LYS A 1 271 ? 3.853   -27.580 -2.973  1.00 38.11  ? 271 LYS A CD    1 
ATOM   2128 C  CE    . LYS A 1 271 ? 3.818   -26.488 -1.947  1.00 40.90  ? 271 LYS A CE    1 
ATOM   2129 N  NZ    . LYS A 1 271 ? 4.975   -26.741 -1.032  1.00 44.83  ? 271 LYS A NZ    1 
ATOM   2130 N  N     . ILE A 1 272 ? 3.019   -25.464 -8.174  1.00 23.17  ? 272 ILE A N     1 
ATOM   2131 C  CA    . ILE A 1 272 ? 2.299   -25.480 -9.479  1.00 21.85  ? 272 ILE A CA    1 
ATOM   2132 C  C     . ILE A 1 272 ? 3.281   -25.636 -10.659 1.00 22.04  ? 272 ILE A C     1 
ATOM   2133 O  O     . ILE A 1 272 ? 3.095   -26.424 -11.511 1.00 20.91  ? 272 ILE A O     1 
ATOM   2134 C  CB    . ILE A 1 272 ? 1.459   -24.207 -9.633  1.00 20.93  ? 272 ILE A CB    1 
ATOM   2135 C  CG1   . ILE A 1 272 ? 0.345   -24.202 -8.567  1.00 21.35  ? 272 ILE A CG1   1 
ATOM   2136 C  CG2   . ILE A 1 272 ? 0.821   -24.131 -11.036 1.00 21.07  ? 272 ILE A CG2   1 
ATOM   2137 C  CD1   . ILE A 1 272 ? -0.473  -22.954 -8.456  1.00 20.93  ? 272 ILE A CD1   1 
ATOM   2138 N  N     . ALA A 1 273 ? 4.367   -24.889 -10.642 1.00 23.12  ? 273 ALA A N     1 
ATOM   2139 C  CA    . ALA A 1 273 ? 5.372   -24.968 -11.703 1.00 23.54  ? 273 ALA A CA    1 
ATOM   2140 C  C     . ALA A 1 273 ? 5.936   -26.315 -11.842 1.00 23.89  ? 273 ALA A C     1 
ATOM   2141 O  O     . ALA A 1 273 ? 6.275   -26.708 -12.955 1.00 22.67  ? 273 ALA A O     1 
ATOM   2142 C  CB    . ALA A 1 273 ? 6.519   -24.003 -11.441 1.00 23.59  ? 273 ALA A CB    1 
ATOM   2143 N  N     . LEU A 1 274 ? 6.081   -27.022 -10.732 1.00 26.46  ? 274 LEU A N     1 
ATOM   2144 C  CA    . LEU A 1 274 ? 6.616   -28.379 -10.765 1.00 27.64  ? 274 LEU A CA    1 
ATOM   2145 C  C     . LEU A 1 274 ? 5.682   -29.300 -11.467 1.00 25.83  ? 274 LEU A C     1 
ATOM   2146 O  O     . LEU A 1 274 ? 6.107   -30.078 -12.301 1.00 23.49  ? 274 LEU A O     1 
ATOM   2147 C  CB    . LEU A 1 274 ? 6.827   -28.892 -9.384  1.00 32.57  ? 274 LEU A CB    1 
ATOM   2148 C  CG    . LEU A 1 274 ? 8.240   -29.344 -9.107  1.00 39.22  ? 274 LEU A CG    1 
ATOM   2149 C  CD1   . LEU A 1 274 ? 9.215   -28.217 -9.441  1.00 41.77  ? 274 LEU A CD1   1 
ATOM   2150 C  CD2   . LEU A 1 274 ? 8.359   -29.704 -7.608  1.00 40.76  ? 274 LEU A CD2   1 
ATOM   2151 N  N     . ILE A 1 275 ? 4.397   -29.218 -11.105 1.00 24.90  ? 275 ILE A N     1 
ATOM   2152 C  CA    . ILE A 1 275 ? 3.364   -30.009 -11.772 1.00 24.70  ? 275 ILE A CA    1 
ATOM   2153 C  C     . ILE A 1 275 ? 3.385   -29.623 -13.259 1.00 24.64  ? 275 ILE A C     1 
ATOM   2154 O  O     . ILE A 1 275 ? 3.205   -30.479 -14.107 1.00 25.74  ? 275 ILE A O     1 
ATOM   2155 C  CB    . ILE A 1 275 ? 1.995   -29.728 -11.145 1.00 24.49  ? 275 ILE A CB    1 
ATOM   2156 C  CG1   . ILE A 1 275 ? 1.909   -30.306 -9.736  1.00 25.76  ? 275 ILE A CG1   1 
ATOM   2157 C  CG2   . ILE A 1 275 ? 0.887   -30.299 -11.975 1.00 25.31  ? 275 ILE A CG2   1 
ATOM   2158 C  CD1   . ILE A 1 275 ? 1.092   -29.489 -8.759  1.00 25.08  ? 275 ILE A CD1   1 
ATOM   2159 N  N     . MET A 1 276 ? 3.597   -28.349 -13.567 1.00 23.34  ? 276 MET A N     1 
ATOM   2160 C  CA    . MET A 1 276 ? 3.664   -27.912 -14.981 1.00 24.17  ? 276 MET A CA    1 
ATOM   2161 C  C     . MET A 1 276 ? 4.909   -28.345 -15.735 1.00 24.42  ? 276 MET A C     1 
ATOM   2162 O  O     . MET A 1 276 ? 4.791   -28.770 -16.870 1.00 24.39  ? 276 MET A O     1 
ATOM   2163 C  CB    . MET A 1 276 ? 3.449   -26.407 -15.176 1.00 22.77  ? 276 MET A CB    1 
ATOM   2164 C  CG    . MET A 1 276 ? 1.997   -25.985 -14.918 1.00 22.59  ? 276 MET A CG    1 
ATOM   2165 S  SD    . MET A 1 276 ? 1.787   -24.191 -14.949 1.00 22.61  ? 276 MET A SD    1 
ATOM   2166 C  CE    . MET A 1 276 ? 1.974   -23.916 -16.704 1.00 23.07  ? 276 MET A CE    1 
ATOM   2167 N  N     . GLN A 1 277 ? 6.058   -28.294 -15.108 1.00 25.53  ? 277 GLN A N     1 
ATOM   2168 C  CA    . GLN A 1 277 ? 7.287   -28.846 -15.669 1.00 28.88  ? 277 GLN A CA    1 
ATOM   2169 C  C     . GLN A 1 277 ? 7.150   -30.326 -16.035 1.00 30.31  ? 277 GLN A C     1 
ATOM   2170 O  O     . GLN A 1 277 ? 7.634   -30.747 -17.075 1.00 34.05  ? 277 GLN A O     1 
ATOM   2171 C  CB    . GLN A 1 277 ? 8.402   -28.722 -14.671 1.00 31.19  ? 277 GLN A CB    1 
ATOM   2172 C  CG    . GLN A 1 277 ? 9.761   -29.315 -15.058 1.00 33.64  ? 277 GLN A CG    1 
ATOM   2173 C  CD    . GLN A 1 277 ? 10.678  -29.123 -13.853 1.00 37.91  ? 277 GLN A CD    1 
ATOM   2174 O  OE1   . GLN A 1 277 ? 10.930  -28.007 -13.426 1.00 38.27  ? 277 GLN A OE1   1 
ATOM   2175 N  NE2   . GLN A 1 277 ? 11.074  -30.207 -13.226 1.00 42.58  ? 277 GLN A NE2   1 
ATOM   2176 N  N     . ASN A 1 278 ? 6.484   -31.082 -15.185 1.00 31.02  ? 278 ASN A N     1 
ATOM   2177 C  CA    . ASN A 1 278 ? 6.110   -32.469 -15.460 1.00 34.43  ? 278 ASN A CA    1 
ATOM   2178 C  C     . ASN A 1 278 ? 4.993   -32.685 -16.486 1.00 32.66  ? 278 ASN A C     1 
ATOM   2179 O  O     . ASN A 1 278 ? 4.698   -33.803 -16.793 1.00 29.87  ? 278 ASN A O     1 
ATOM   2180 C  CB    . ASN A 1 278 ? 5.765   -33.205 -14.136 1.00 36.41  ? 278 ASN A CB    1 
ATOM   2181 C  CG    . ASN A 1 278 ? 6.961   -33.241 -13.171 1.00 40.22  ? 278 ASN A CG    1 
ATOM   2182 O  OD1   . ASN A 1 278 ? 8.085   -33.654 -13.541 1.00 41.54  ? 278 ASN A OD1   1 
ATOM   2183 N  ND2   . ASN A 1 278 ? 6.732   -32.814 -11.935 1.00 42.21  ? 278 ASN A ND2   1 
ATOM   2184 N  N     . LYS A 1 279 ? 4.382   -31.608 -17.001 1.00 31.82  ? 279 LYS A N     1 
ATOM   2185 C  CA    . LYS A 1 279 ? 3.260   -31.721 -17.943 1.00 31.85  ? 279 LYS A CA    1 
ATOM   2186 C  C     . LYS A 1 279 ? 2.004   -32.292 -17.313 1.00 30.57  ? 279 LYS A C     1 
ATOM   2187 O  O     . LYS A 1 279 ? 1.057   -32.618 -18.052 1.00 28.75  ? 279 LYS A O     1 
ATOM   2188 C  CB    . LYS A 1 279 ? 3.565   -32.570 -19.170 1.00 33.75  ? 279 LYS A CB    1 
ATOM   2189 C  CG    . LYS A 1 279 ? 4.857   -32.231 -19.883 1.00 37.46  ? 279 LYS A CG    1 
ATOM   2190 C  CD    . LYS A 1 279 ? 4.814   -30.950 -20.654 1.00 39.67  ? 279 LYS A CD    1 
ATOM   2191 C  CE    . LYS A 1 279 ? 6.049   -30.127 -20.352 1.00 42.26  ? 279 LYS A CE    1 
ATOM   2192 N  NZ    . LYS A 1 279 ? 5.983   -28.948 -21.277 1.00 43.17  ? 279 LYS A NZ    1 
ATOM   2193 N  N     . ASN A 1 280 ? 1.959   -32.363 -15.976 1.00 28.86  ? 280 ASN A N     1 
ATOM   2194 C  CA    . ASN A 1 280 ? 0.807   -32.989 -15.353 1.00 29.25  ? 280 ASN A CA    1 
ATOM   2195 C  C     . ASN A 1 280 ? -0.377  -32.054 -15.286 1.00 27.70  ? 280 ASN A C     1 
ATOM   2196 O  O     . ASN A 1 280 ? -1.489  -32.496 -15.159 1.00 28.31  ? 280 ASN A O     1 
ATOM   2197 C  CB    . ASN A 1 280 ? 1.146   -33.569 -14.004 1.00 30.11  ? 280 ASN A CB    1 
ATOM   2198 C  CG    . ASN A 1 280 ? 1.896   -34.893 -14.100 1.00 31.99  ? 280 ASN A CG    1 
ATOM   2199 O  OD1   . ASN A 1 280 ? 2.972   -35.069 -13.490 1.00 33.88  ? 280 ASN A OD1   1 
ATOM   2200 N  ND2   . ASN A 1 280 ? 1.309   -35.848 -14.799 1.00 33.03  ? 280 ASN A ND2   1 
ATOM   2201 N  N     . HIS A 1 281 ? -0.159  -30.759 -15.440 1.00 25.86  ? 281 HIS A N     1 
ATOM   2202 C  CA    . HIS A 1 281 ? -1.308  -29.816 -15.664 1.00 25.48  ? 281 HIS A CA    1 
ATOM   2203 C  C     . HIS A 1 281 ? -2.275  -30.120 -16.788 1.00 26.24  ? 281 HIS A C     1 
ATOM   2204 O  O     . HIS A 1 281 ? -3.403  -29.561 -16.834 1.00 26.28  ? 281 HIS A O     1 
ATOM   2205 C  CB    . HIS A 1 281 ? -0.826  -28.385 -15.846 1.00 24.28  ? 281 HIS A CB    1 
ATOM   2206 C  CG    . HIS A 1 281 ? 0.064   -28.172 -17.021 1.00 23.67  ? 281 HIS A CG    1 
ATOM   2207 N  ND1   . HIS A 1 281 ? 1.210   -28.885 -17.242 1.00 23.28  ? 281 HIS A ND1   1 
ATOM   2208 C  CD2   . HIS A 1 281 ? -0.015  -27.264 -18.023 1.00 23.56  ? 281 HIS A CD2   1 
ATOM   2209 C  CE1   . HIS A 1 281 ? 1.775   -28.463 -18.359 1.00 23.64  ? 281 HIS A CE1   1 
ATOM   2210 N  NE2   . HIS A 1 281 ? 1.034   -27.496 -18.865 1.00 23.17  ? 281 HIS A NE2   1 
ATOM   2211 N  N     . LEU A 1 282 ? -1.852  -31.004 -17.699 1.00 26.55  ? 282 LEU A N     1 
ATOM   2212 C  CA    . LEU A 1 282 ? -2.674  -31.375 -18.832 1.00 26.76  ? 282 LEU A CA    1 
ATOM   2213 C  C     . LEU A 1 282 ? -3.474  -32.638 -18.600 1.00 27.78  ? 282 LEU A C     1 
ATOM   2214 O  O     . LEU A 1 282 ? -4.008  -33.168 -19.552 1.00 27.91  ? 282 LEU A O     1 
ATOM   2215 C  CB    . LEU A 1 282 ? -1.800  -31.489 -20.122 1.00 26.48  ? 282 LEU A CB    1 
ATOM   2216 C  CG    . LEU A 1 282 ? -0.985  -30.255 -20.490 1.00 25.82  ? 282 LEU A CG    1 
ATOM   2217 C  CD1   . LEU A 1 282 ? 0.042   -30.585 -21.544 1.00 25.96  ? 282 LEU A CD1   1 
ATOM   2218 C  CD2   . LEU A 1 282 ? -1.853  -29.131 -20.988 1.00 26.22  ? 282 LEU A CD2   1 
ATOM   2219 N  N     . THR A 1 283 ? -3.501  -33.129 -17.345 1.00 28.23  ? 283 THR A N     1 
ATOM   2220 C  CA    . THR A 1 283 ? -4.286  -34.290 -16.917 1.00 28.62  ? 283 THR A CA    1 
ATOM   2221 C  C     . THR A 1 283 ? -5.325  -33.770 -15.915 1.00 28.35  ? 283 THR A C     1 
ATOM   2222 O  O     . THR A 1 283 ? -5.026  -32.799 -15.198 1.00 27.31  ? 283 THR A O     1 
ATOM   2223 C  CB    . THR A 1 283 ? -3.362  -35.363 -16.210 1.00 28.85  ? 283 THR A CB    1 
ATOM   2224 O  OG1   . THR A 1 283 ? -2.898  -34.884 -14.929 1.00 27.83  ? 283 THR A OG1   1 
ATOM   2225 C  CG2   . THR A 1 283 ? -2.141  -35.717 -17.077 1.00 27.49  ? 283 THR A CG2   1 
ATOM   2226 N  N     . PRO A 1 284 ? -6.503  -34.441 -15.815 1.00 29.06  ? 284 PRO A N     1 
ATOM   2227 C  CA    . PRO A 1 284 ? -7.481  -34.024 -14.764 1.00 29.62  ? 284 PRO A CA    1 
ATOM   2228 C  C     . PRO A 1 284 ? -6.902  -33.993 -13.317 1.00 29.13  ? 284 PRO A C     1 
ATOM   2229 O  O     . PRO A 1 284 ? -7.167  -33.069 -12.563 1.00 28.54  ? 284 PRO A O     1 
ATOM   2230 C  CB    . PRO A 1 284 ? -8.648  -35.043 -14.912 1.00 31.23  ? 284 PRO A CB    1 
ATOM   2231 C  CG    . PRO A 1 284 ? -8.451  -35.734 -16.259 1.00 31.38  ? 284 PRO A CG    1 
ATOM   2232 C  CD    . PRO A 1 284 ? -6.931  -35.700 -16.492 1.00 30.13  ? 284 PRO A CD    1 
ATOM   2233 N  N     . GLU A 1 285 ? -6.070  -34.964 -12.966 1.00 29.21  ? 285 GLU A N     1 
ATOM   2234 C  CA    . GLU A 1 285 ? -5.564  -35.065 -11.609 1.00 29.75  ? 285 GLU A CA    1 
ATOM   2235 C  C     . GLU A 1 285 ? -4.629  -33.887 -11.317 1.00 27.52  ? 285 GLU A C     1 
ATOM   2236 O  O     . GLU A 1 285 ? -4.750  -33.209 -10.284 1.00 26.53  ? 285 GLU A O     1 
ATOM   2237 C  CB    . GLU A 1 285 ? -4.854  -36.406 -11.417 1.00 31.44  ? 285 GLU A CB    1 
ATOM   2238 C  CG    . GLU A 1 285 ? -5.768  -37.658 -11.677 1.00 34.92  ? 285 GLU A CG    1 
ATOM   2239 C  CD    . GLU A 1 285 ? -5.838  -38.194 -13.177 1.00 36.29  ? 285 GLU A CD    1 
ATOM   2240 O  OE1   . GLU A 1 285 ? -5.200  -37.585 -14.152 1.00 34.63  ? 285 GLU A OE1   1 
ATOM   2241 O  OE2   . GLU A 1 285 ? -6.589  -39.218 -13.336 1.00 37.74  ? 285 GLU A OE2   1 
ATOM   2242 N  N     . GLY A 1 286 ? -3.751  -33.625 -12.281 1.00 26.32  ? 286 GLY A N     1 
ATOM   2243 C  CA    . GLY A 1 286 ? -2.764  -32.537 -12.175 1.00 25.00  ? 286 GLY A CA    1 
ATOM   2244 C  C     . GLY A 1 286 ? -3.520  -31.224 -12.106 1.00 24.11  ? 286 GLY A C     1 
ATOM   2245 O  O     . GLY A 1 286 ? -3.250  -30.454 -11.262 1.00 24.44  ? 286 GLY A O     1 
ATOM   2246 N  N     . LEU A 1 287 ? -4.493  -30.986 -13.001 1.00 24.40  ? 287 LEU A N     1 
ATOM   2247 C  CA    . LEU A 1 287 ? -5.348  -29.781 -12.940 1.00 23.48  ? 287 LEU A CA    1 
ATOM   2248 C  C     . LEU A 1 287 ? -5.934  -29.661 -11.518 1.00 23.92  ? 287 LEU A C     1 
ATOM   2249 O  O     . LEU A 1 287 ? -5.908  -28.625 -10.956 1.00 23.48  ? 287 LEU A O     1 
ATOM   2250 C  CB    . LEU A 1 287 ? -6.480  -29.865 -13.942 1.00 24.25  ? 287 LEU A CB    1 
ATOM   2251 C  CG    . LEU A 1 287 ? -7.350  -28.617 -14.063 1.00 24.64  ? 287 LEU A CG    1 
ATOM   2252 C  CD1   . LEU A 1 287 ? -6.525  -27.407 -14.464 1.00 23.23  ? 287 LEU A CD1   1 
ATOM   2253 C  CD2   . LEU A 1 287 ? -8.378  -28.921 -15.102 1.00 25.67  ? 287 LEU A CD2   1 
ATOM   2254 N  N     . ASN A 1 288 ? -6.445  -30.742 -10.951 1.00 24.68  ? 288 ASN A N     1 
ATOM   2255 C  CA    . ASN A 1 288 ? -7.037  -30.681 -9.619  1.00 25.68  ? 288 ASN A CA    1 
ATOM   2256 C  C     . ASN A 1 288 ? -6.044  -30.357 -8.532  1.00 25.95  ? 288 ASN A C     1 
ATOM   2257 O  O     . ASN A 1 288 ? -6.359  -29.612 -7.676  1.00 25.07  ? 288 ASN A O     1 
ATOM   2258 C  CB    . ASN A 1 288 ? -7.928  -31.921 -9.312  1.00 26.35  ? 288 ASN A CB    1 
ATOM   2259 C  CG    . ASN A 1 288 ? -9.295  -31.766 -9.977  1.00 27.09  ? 288 ASN A CG    1 
ATOM   2260 O  OD1   . ASN A 1 288 ? -9.849  -30.648 -9.997  1.00 27.18  ? 288 ASN A OD1   1 
ATOM   2261 N  ND2   . ASN A 1 288 ? -9.810  -32.801 -10.550 1.00 27.57  ? 288 ASN A ND2   1 
ATOM   2262 N  N     . GLU A 1 289 ? -4.817  -30.874 -8.604  1.00 27.35  ? 289 GLU A N     1 
ATOM   2263 C  CA    . GLU A 1 289 ? -3.780  -30.459 -7.656  1.00 28.03  ? 289 GLU A CA    1 
ATOM   2264 C  C     . GLU A 1 289 ? -3.504  -28.971 -7.665  1.00 25.52  ? 289 GLU A C     1 
ATOM   2265 O  O     . GLU A 1 289 ? -3.327  -28.334 -6.617  1.00 25.03  ? 289 GLU A O     1 
ATOM   2266 C  CB    . GLU A 1 289 ? -2.482  -31.182 -7.958  1.00 30.85  ? 289 GLU A CB    1 
ATOM   2267 C  CG    . GLU A 1 289 ? -2.411  -32.594 -7.418  1.00 36.24  ? 289 GLU A CG    1 
ATOM   2268 C  CD    . GLU A 1 289 ? -1.009  -33.213 -7.663  1.00 40.65  ? 289 GLU A CD    1 
ATOM   2269 O  OE1   . GLU A 1 289 ? -1.027  -34.271 -8.339  1.00 46.74  ? 289 GLU A OE1   1 
ATOM   2270 O  OE2   . GLU A 1 289 ? 0.071   -32.656 -7.226  1.00 39.76  ? 289 GLU A OE2   1 
ATOM   2271 N  N     . ILE A 1 290 ? -3.403  -28.454 -8.879  1.00 23.86  ? 290 ILE A N     1 
ATOM   2272 C  CA    . ILE A 1 290 ? -3.203  -27.057 -9.104  1.00 22.61  ? 290 ILE A CA    1 
ATOM   2273 C  C     . ILE A 1 290 ? -4.407  -26.277 -8.570  1.00 23.45  ? 290 ILE A C     1 
ATOM   2274 O  O     . ILE A 1 290 ? -4.221  -25.269 -7.858  1.00 22.49  ? 290 ILE A O     1 
ATOM   2275 C  CB    . ILE A 1 290 ? -2.988  -26.727 -10.582 1.00 22.08  ? 290 ILE A CB    1 
ATOM   2276 C  CG1   . ILE A 1 290 ? -1.671  -27.342 -11.064 1.00 21.39  ? 290 ILE A CG1   1 
ATOM   2277 C  CG2   . ILE A 1 290 ? -3.023  -25.197 -10.797 1.00 21.48  ? 290 ILE A CG2   1 
ATOM   2278 C  CD1   . ILE A 1 290 ? -1.502  -27.226 -12.576 1.00 21.19  ? 290 ILE A CD1   1 
ATOM   2279 N  N     . ARG A 1 291 ? -5.611  -26.744 -8.862  1.00 24.48  ? 291 ARG A N     1 
ATOM   2280 C  CA    . ARG A 1 291 ? -6.736  -26.120 -8.224  1.00 26.51  ? 291 ARG A CA    1 
ATOM   2281 C  C     . ARG A 1 291 ? -6.633  -26.103 -6.701  1.00 27.13  ? 291 ARG A C     1 
ATOM   2282 O  O     . ARG A 1 291 ? -6.962  -25.093 -6.117  1.00 26.83  ? 291 ARG A O     1 
ATOM   2283 C  CB    . ARG A 1 291 ? -8.028  -26.793 -8.551  1.00 28.65  ? 291 ARG A CB    1 
ATOM   2284 C  CG    . ARG A 1 291 ? -8.390  -26.729 -9.981  1.00 30.01  ? 291 ARG A CG    1 
ATOM   2285 C  CD    . ARG A 1 291 ? -9.889  -26.698 -10.199 1.00 32.97  ? 291 ARG A CD    1 
ATOM   2286 N  NE    . ARG A 1 291 ? -10.307 -27.731 -11.090 1.00 35.29  ? 291 ARG A NE    1 
ATOM   2287 C  CZ    . ARG A 1 291 ? -10.829 -27.584 -12.299 1.00 37.54  ? 291 ARG A CZ    1 
ATOM   2288 N  NH1   . ARG A 1 291 ? -10.948 -26.382 -12.860 1.00 38.91  ? 291 ARG A NH1   1 
ATOM   2289 N  NH2   . ARG A 1 291 ? -11.243 -28.676 -12.954 1.00 38.92  ? 291 ARG A NH2   1 
ATOM   2290 N  N     . ALA A 1 292 ? -6.201  -27.190 -6.057  1.00 27.83  ? 292 ALA A N     1 
ATOM   2291 C  CA    . ALA A 1 292 ? -6.120  -27.166 -4.585  1.00 29.53  ? 292 ALA A CA    1 
ATOM   2292 C  C     . ALA A 1 292 ? -5.026  -26.206 -4.090  1.00 30.67  ? 292 ALA A C     1 
ATOM   2293 O  O     . ALA A 1 292 ? -5.257  -25.415 -3.137  1.00 33.81  ? 292 ALA A O     1 
ATOM   2294 C  CB    . ALA A 1 292 ? -5.949  -28.543 -4.043  1.00 29.67  ? 292 ALA A CB    1 
ATOM   2295 N  N     . LEU A 1 293 ? -3.870  -26.179 -4.752  1.00 30.44  ? 293 LEU A N     1 
ATOM   2296 C  CA    . LEU A 1 293 ? -2.760  -25.337 -4.263  1.00 30.34  ? 293 LEU A CA    1 
ATOM   2297 C  C     . LEU A 1 293 ? -3.173  -23.893 -4.259  1.00 30.94  ? 293 LEU A C     1 
ATOM   2298 O  O     . LEU A 1 293 ? -2.929  -23.129 -3.276  1.00 32.60  ? 293 LEU A O     1 
ATOM   2299 C  CB    . LEU A 1 293 ? -1.519  -25.472 -5.179  1.00 29.19  ? 293 LEU A CB    1 
ATOM   2300 C  CG    . LEU A 1 293 ? -0.714  -26.746 -4.942  1.00 29.00  ? 293 LEU A CG    1 
ATOM   2301 C  CD1   . LEU A 1 293 ? 0.080   -27.157 -6.210  1.00 28.33  ? 293 LEU A CD1   1 
ATOM   2302 C  CD2   . LEU A 1 293 ? 0.153   -26.571 -3.697  1.00 28.24  ? 293 LEU A CD2   1 
ATOM   2303 N  N     . LYS A 1 294 ? -3.772  -23.558 -5.392  1.00 31.53  ? 294 LYS A N     1 
ATOM   2304 C  CA    . LYS A 1 294 ? -4.299  -22.257 -5.724  1.00 32.51  ? 294 LYS A CA    1 
ATOM   2305 C  C     . LYS A 1 294 ? -5.359  -21.841 -4.767  1.00 34.52  ? 294 LYS A C     1 
ATOM   2306 O  O     . LYS A 1 294 ? -5.324  -20.743 -4.242  1.00 35.78  ? 294 LYS A O     1 
ATOM   2307 C  CB    . LYS A 1 294 ? -4.939  -22.357 -7.064  1.00 33.34  ? 294 LYS A CB    1 
ATOM   2308 C  CG    . LYS A 1 294 ? -4.921  -21.104 -7.817  1.00 34.56  ? 294 LYS A CG    1 
ATOM   2309 C  CD    . LYS A 1 294 ? -5.400  -21.384 -9.221  1.00 34.80  ? 294 LYS A CD    1 
ATOM   2310 C  CE    . LYS A 1 294 ? -6.836  -21.056 -9.400  1.00 37.20  ? 294 LYS A CE    1 
ATOM   2311 N  NZ    . LYS A 1 294 ? -6.962  -19.618 -9.657  1.00 38.10  ? 294 LYS A NZ    1 
ATOM   2312 N  N     . GLY A 1 295 ? -6.298  -22.714 -4.496  1.00 35.41  ? 295 GLY A N     1 
ATOM   2313 C  CA    . GLY A 1 295 ? -7.294  -22.366 -3.550  1.00 39.38  ? 295 GLY A CA    1 
ATOM   2314 C  C     . GLY A 1 295 ? -6.672  -21.947 -2.244  1.00 40.34  ? 295 GLY A C     1 
ATOM   2315 O  O     . GLY A 1 295 ? -7.135  -20.984 -1.631  1.00 43.45  ? 295 GLY A O     1 
ATOM   2316 N  N     . GLY A 1 296 ? -5.618  -22.660 -1.841  1.00 40.66  ? 296 GLY A N     1 
ATOM   2317 C  CA    . GLY A 1 296 ? -4.905  -22.399 -0.618  1.00 40.20  ? 296 GLY A CA    1 
ATOM   2318 C  C     . GLY A 1 296 ? -4.108  -21.099 -0.554  1.00 39.74  ? 296 GLY A C     1 
ATOM   2319 O  O     . GLY A 1 296 ? -3.584  -20.751 0.514   1.00 37.22  ? 296 GLY A O     1 
ATOM   2320 N  N     . MET A 1 297 ? -3.991  -20.373 -1.658  1.00 40.13  ? 297 MET A N     1 
ATOM   2321 C  CA    . MET A 1 297 ? -3.040  -19.291 -1.714  1.00 42.70  ? 297 MET A CA    1 
ATOM   2322 C  C     . MET A 1 297 ? -3.748  -18.078 -1.095  1.00 46.26  ? 297 MET A C     1 
ATOM   2323 O  O     . MET A 1 297 ? -4.947  -18.136 -0.941  1.00 47.22  ? 297 MET A O     1 
ATOM   2324 C  CB    . MET A 1 297 ? -2.523  -19.070 -3.149  1.00 43.57  ? 297 MET A CB    1 
ATOM   2325 C  CG    . MET A 1 297 ? -1.375  -19.996 -3.514  1.00 43.24  ? 297 MET A CG    1 
ATOM   2326 S  SD    . MET A 1 297 ? -1.085  -20.090 -5.313  1.00 43.52  ? 297 MET A SD    1 
ATOM   2327 C  CE    . MET A 1 297 ? -0.227  -18.553 -5.606  1.00 38.51  ? 297 MET A CE    1 
ATOM   2328 N  N     . ASN A 1 298 ? -3.006  -17.068 -0.627  1.00 47.52  ? 298 ASN A N     1 
ATOM   2329 C  CA    . ASN A 1 298 ? -3.596  -15.875 -0.045  1.00 51.79  ? 298 ASN A CA    1 
ATOM   2330 C  C     . ASN A 1 298 ? -4.509  -16.169 1.140   1.00 52.97  ? 298 ASN A C     1 
ATOM   2331 O  O     . ASN A 1 298 ? -5.516  -15.498 1.261   1.00 57.51  ? 298 ASN A O     1 
ATOM   2332 C  CB    . ASN A 1 298 ? -4.466  -15.116 -1.079  1.00 58.29  ? 298 ASN A CB    1 
ATOM   2333 C  CG    . ASN A 1 298 ? -3.702  -14.693 -2.339  1.00 67.61  ? 298 ASN A CG    1 
ATOM   2334 O  OD1   . ASN A 1 298 ? -3.138  -15.516 -3.077  1.00 70.61  ? 298 ASN A OD1   1 
ATOM   2335 N  ND2   . ASN A 1 298 ? -3.720  -13.380 -2.612  1.00 72.81  ? 298 ASN A ND2   1 
ATOM   2336 N  N     . LYS A 1 299 ? -4.232  -17.176 1.972   1.00 50.33  ? 299 LYS A N     1 
ATOM   2337 C  CA    . LYS A 1 299 ? -5.071  -17.473 3.162   1.00 51.36  ? 299 LYS A CA    1 
ATOM   2338 C  C     . LYS A 1 299 ? -4.358  -17.303 4.530   1.00 55.60  ? 299 LYS A C     1 
ATOM   2339 O  O     . LYS A 1 299 ? -4.891  -17.755 5.546   1.00 57.65  ? 299 LYS A O     1 
ATOM   2340 C  CB    . LYS A 1 299 ? -5.604  -18.935 3.088   1.00 50.40  ? 299 LYS A CB    1 
ATOM   2341 C  CG    . LYS A 1 299 ? -6.523  -19.306 1.917   1.00 46.92  ? 299 LYS A CG    1 
ATOM   2342 C  CD    . LYS A 1 299 ? -7.784  -18.486 1.929   1.00 45.54  ? 299 LYS A CD    1 
ATOM   2343 C  CE    . LYS A 1 299 ? -8.643  -18.780 0.730   1.00 44.67  ? 299 LYS A CE    1 
ATOM   2344 N  NZ    . LYS A 1 299 ? -7.954  -18.441 -0.524  1.00 42.61  ? 299 LYS A NZ    1 
ATOM   2345 N  N     . GLY A 1 300 ? -3.178  -16.665 4.566   1.00 56.93  ? 300 GLY A N     1 
ATOM   2346 C  CA    . GLY A 1 300 ? -2.206  -16.913 5.650   1.00 57.57  ? 300 GLY A CA    1 
ATOM   2347 C  C     . GLY A 1 300 ? -1.738  -18.369 5.582   1.00 58.70  ? 300 GLY A C     1 
ATOM   2348 O  O     . GLY A 1 300 ? -1.100  -18.877 6.507   1.00 58.45  ? 300 GLY A O     1 
ATOM   2349 O  "O5'" . DC  B 2 1   ? -6.229  -32.675 -28.171 1.00 35.57  ? 1   DC  B "O5'" 1 
ATOM   2350 C  "C5'" . DC  B 2 1   ? -5.928  -31.434 -28.790 1.00 32.58  ? 1   DC  B "C5'" 1 
ATOM   2351 C  "C4'" . DC  B 2 1   ? -4.519  -31.028 -28.454 1.00 30.65  ? 1   DC  B "C4'" 1 
ATOM   2352 O  "O4'" . DC  B 2 1   ? -4.184  -30.041 -29.454 1.00 29.75  ? 1   DC  B "O4'" 1 
ATOM   2353 C  "C3'" . DC  B 2 1   ? -4.325  -30.361 -27.073 1.00 29.83  ? 1   DC  B "C3'" 1 
ATOM   2354 O  "O3'" . DC  B 2 1   ? -3.177  -30.866 -26.350 1.00 28.69  ? 1   DC  B "O3'" 1 
ATOM   2355 C  "C2'" . DC  B 2 1   ? -4.170  -28.884 -27.400 1.00 28.65  ? 1   DC  B "C2'" 1 
ATOM   2356 C  "C1'" . DC  B 2 1   ? -3.623  -28.890 -28.828 1.00 28.32  ? 1   DC  B "C1'" 1 
ATOM   2357 N  N1    . DC  B 2 1   ? -3.961  -27.738 -29.672 1.00 26.86  ? 1   DC  B N1    1 
ATOM   2358 C  C2    . DC  B 2 1   ? -2.930  -26.950 -30.157 1.00 25.49  ? 1   DC  B C2    1 
ATOM   2359 O  O2    . DC  B 2 1   ? -1.779  -27.174 -29.771 1.00 25.19  ? 1   DC  B O2    1 
ATOM   2360 N  N3    . DC  B 2 1   ? -3.215  -25.930 -30.994 1.00 25.77  ? 1   DC  B N3    1 
ATOM   2361 C  C4    . DC  B 2 1   ? -4.475  -25.718 -31.388 1.00 26.51  ? 1   DC  B C4    1 
ATOM   2362 N  N4    . DC  B 2 1   ? -4.710  -24.701 -32.222 1.00 26.54  ? 1   DC  B N4    1 
ATOM   2363 C  C5    . DC  B 2 1   ? -5.551  -26.531 -30.931 1.00 27.42  ? 1   DC  B C5    1 
ATOM   2364 C  C6    . DC  B 2 1   ? -5.243  -27.552 -30.119 1.00 27.90  ? 1   DC  B C6    1 
ATOM   2365 P  P     . DG  B 2 2   ? -3.029  -30.710 -24.708 1.00 28.05  ? 2   DG  B P     1 
ATOM   2366 O  OP1   . DG  B 2 2   ? -2.065  -31.743 -24.259 1.00 28.58  ? 2   DG  B OP1   1 
ATOM   2367 O  OP2   . DG  B 2 2   ? -4.363  -30.610 -24.080 1.00 28.03  ? 2   DG  B OP2   1 
ATOM   2368 O  "O5'" . DG  B 2 2   ? -2.275  -29.319 -24.610 1.00 26.14  ? 2   DG  B "O5'" 1 
ATOM   2369 C  "C5'" . DG  B 2 2   ? -0.895  -29.250 -24.924 1.00 25.34  ? 2   DG  B "C5'" 1 
ATOM   2370 C  "C4'" . DG  B 2 2   ? -0.525  -27.813 -25.182 1.00 24.37  ? 2   DG  B "C4'" 1 
ATOM   2371 O  "O4'" . DG  B 2 2   ? -1.322  -27.310 -26.249 1.00 23.88  ? 2   DG  B "O4'" 1 
ATOM   2372 C  "C3'" . DG  B 2 2   ? -0.739  -26.821 -24.026 1.00 24.30  ? 2   DG  B "C3'" 1 
ATOM   2373 O  "O3'" . DG  B 2 2   ? 0.466   -26.820 -23.267 1.00 24.58  ? 2   DG  B "O3'" 1 
ATOM   2374 C  "C2'" . DG  B 2 2   ? -1.072  -25.516 -24.731 1.00 23.79  ? 2   DG  B "C2'" 1 
ATOM   2375 C  "C1'" . DG  B 2 2   ? -1.119  -25.908 -26.218 1.00 24.16  ? 2   DG  B "C1'" 1 
ATOM   2376 N  N9    . DG  B 2 2   ? -2.172  -25.264 -27.001 1.00 23.79  ? 2   DG  B N9    1 
ATOM   2377 C  C8    . DG  B 2 2   ? -3.526  -25.467 -26.935 1.00 24.54  ? 2   DG  B C8    1 
ATOM   2378 N  N7    . DG  B 2 2   ? -4.194  -24.732 -27.782 1.00 25.31  ? 2   DG  B N7    1 
ATOM   2379 C  C5    . DG  B 2 2   ? -3.223  -23.960 -28.405 1.00 24.83  ? 2   DG  B C5    1 
ATOM   2380 C  C6    . DG  B 2 2   ? -3.337  -22.977 -29.424 1.00 25.30  ? 2   DG  B C6    1 
ATOM   2381 O  O6    . DG  B 2 2   ? -4.357  -22.533 -29.951 1.00 26.40  ? 2   DG  B O6    1 
ATOM   2382 N  N1    . DG  B 2 2   ? -2.089  -22.476 -29.798 1.00 24.91  ? 2   DG  B N1    1 
ATOM   2383 C  C2    . DG  B 2 2   ? -0.892  -22.858 -29.245 1.00 24.86  ? 2   DG  B C2    1 
ATOM   2384 N  N2    . DG  B 2 2   ? 0.200   -22.233 -29.699 1.00 25.62  ? 2   DG  B N2    1 
ATOM   2385 N  N3    . DG  B 2 2   ? -0.777  -23.754 -28.281 1.00 24.20  ? 2   DG  B N3    1 
ATOM   2386 C  C4    . DG  B 2 2   ? -1.970  -24.277 -27.929 1.00 24.03  ? 2   DG  B C4    1 
ATOM   2387 P  P     . DT  B 2 3   ? 0.779   -25.706 -22.140 1.00 25.57  ? 3   DT  B P     1 
ATOM   2388 O  OP1   . DT  B 2 3   ? 1.831   -26.321 -21.248 1.00 26.32  ? 3   DT  B OP1   1 
ATOM   2389 O  OP2   . DT  B 2 3   ? -0.498  -25.173 -21.598 1.00 25.45  ? 3   DT  B OP2   1 
ATOM   2390 O  "O5'" . DT  B 2 3   ? 1.335   -24.471 -22.963 1.00 25.83  ? 3   DT  B "O5'" 1 
ATOM   2391 C  "C5'" . DT  B 2 3   ? 2.401   -24.660 -23.874 1.00 26.31  ? 3   DT  B "C5'" 1 
ATOM   2392 C  "C4'" . DT  B 2 3   ? 2.818   -23.321 -24.414 1.00 27.22  ? 3   DT  B "C4'" 1 
ATOM   2393 O  "O4'" . DT  B 2 3   ? 1.795   -22.875 -25.312 1.00 27.18  ? 3   DT  B "O4'" 1 
ATOM   2394 C  "C3'" . DT  B 2 3   ? 3.014   -22.188 -23.400 1.00 28.24  ? 3   DT  B "C3'" 1 
ATOM   2395 O  "O3'" . DT  B 2 3   ? 4.203   -21.495 -23.801 1.00 31.51  ? 3   DT  B "O3'" 1 
ATOM   2396 C  "C2'" . DT  B 2 3   ? 1.773   -21.335 -23.573 1.00 27.16  ? 3   DT  B "C2'" 1 
ATOM   2397 C  "C1'" . DT  B 2 3   ? 1.498   -21.525 -25.057 1.00 27.12  ? 3   DT  B "C1'" 1 
ATOM   2398 N  N1    . DT  B 2 3   ? 0.120   -21.294 -25.504 1.00 25.76  ? 3   DT  B N1    1 
ATOM   2399 C  C2    . DT  B 2 3   ? -0.115  -20.433 -26.554 1.00 26.18  ? 3   DT  B C2    1 
ATOM   2400 O  O2    . DT  B 2 3   ? 0.775   -19.821 -27.141 1.00 26.56  ? 3   DT  B O2    1 
ATOM   2401 N  N3    . DT  B 2 3   ? -1.441  -20.305 -26.892 1.00 26.12  ? 3   DT  B N3    1 
ATOM   2402 C  C4    . DT  B 2 3   ? -2.516  -20.951 -26.320 1.00 26.15  ? 3   DT  B C4    1 
ATOM   2403 O  O4    . DT  B 2 3   ? -3.652  -20.704 -26.708 1.00 27.68  ? 3   DT  B O4    1 
ATOM   2404 C  C5    . DT  B 2 3   ? -2.197  -21.807 -25.208 1.00 25.93  ? 3   DT  B C5    1 
ATOM   2405 C  C7    . DT  B 2 3   ? -3.301  -22.535 -24.518 1.00 27.03  ? 3   DT  B C7    1 
ATOM   2406 C  C6    . DT  B 2 3   ? -0.913  -21.949 -24.871 1.00 25.52  ? 3   DT  B C6    1 
ATOM   2407 P  P     . DA  B 2 4   ? 4.998   -20.499 -22.800 1.00 33.55  ? 4   DA  B P     1 
ATOM   2408 O  OP1   . DA  B 2 4   ? 6.429   -20.805 -22.909 1.00 33.98  ? 4   DA  B OP1   1 
ATOM   2409 O  OP2   . DA  B 2 4   ? 4.302   -20.462 -21.466 1.00 33.94  ? 4   DA  B OP2   1 
ATOM   2410 O  "O5'" . DA  B 2 4   ? 4.596   -19.076 -23.407 1.00 33.19  ? 4   DA  B "O5'" 1 
ATOM   2411 C  "C5'" . DA  B 2 4   ? 5.031   -18.706 -24.717 1.00 31.58  ? 4   DA  B "C5'" 1 
ATOM   2412 C  "C4'" . DA  B 2 4   ? 4.331   -17.432 -25.113 1.00 30.86  ? 4   DA  B "C4'" 1 
ATOM   2413 O  "O4'" . DA  B 2 4   ? 2.913   -17.662 -25.381 1.00 30.89  ? 4   DA  B "O4'" 1 
ATOM   2414 C  "C3'" . DA  B 2 4   ? 4.389   -16.335 -24.056 1.00 29.35  ? 4   DA  B "C3'" 1 
ATOM   2415 O  "O3'" . DA  B 2 4   ? 4.671   -15.074 -24.647 1.00 28.86  ? 4   DA  B "O3'" 1 
ATOM   2416 C  "C2'" . DA  B 2 4   ? 2.984   -16.298 -23.485 1.00 28.69  ? 4   DA  B "C2'" 1 
ATOM   2417 C  "C1'" . DA  B 2 4   ? 2.136   -16.681 -24.688 1.00 28.38  ? 4   DA  B "C1'" 1 
ATOM   2418 N  N9    . DA  B 2 4   ? 0.832   -17.262 -24.358 1.00 25.96  ? 4   DA  B N9    1 
ATOM   2419 C  C8    . DA  B 2 4   ? 0.528   -18.080 -23.297 1.00 25.01  ? 4   DA  B C8    1 
ATOM   2420 N  N7    . DA  B 2 4   ? -0.736  -18.420 -23.240 1.00 25.48  ? 4   DA  B N7    1 
ATOM   2421 C  C5    . DA  B 2 4   ? -1.302  -17.799 -24.347 1.00 24.98  ? 4   DA  B C5    1 
ATOM   2422 C  C6    . DA  B 2 4   ? -2.609  -17.764 -24.846 1.00 25.30  ? 4   DA  B C6    1 
ATOM   2423 N  N6    . DA  B 2 4   ? -3.631  -18.427 -24.300 1.00 25.72  ? 4   DA  B N6    1 
ATOM   2424 N  N1    . DA  B 2 4   ? -2.843  -17.011 -25.941 1.00 25.51  ? 4   DA  B N1    1 
ATOM   2425 C  C2    . DA  B 2 4   ? -1.805  -16.421 -26.547 1.00 25.46  ? 4   DA  B C2    1 
ATOM   2426 N  N3    . DA  B 2 4   ? -0.538  -16.374 -26.174 1.00 25.26  ? 4   DA  B N3    1 
ATOM   2427 C  C4    . DA  B 2 4   ? -0.347  -17.090 -25.050 1.00 25.47  ? 4   DA  B C4    1 
ATOM   2428 P  P     . DC  B 2 5   ? 5.866   -14.238 -24.123 1.00 29.94  ? 5   DC  B P     1 
ATOM   2429 O  OP1   . DC  B 2 5   ? 7.082   -14.802 -24.646 1.00 30.07  ? 5   DC  B OP1   1 
ATOM   2430 O  OP2   . DC  B 2 5   ? 5.747   -14.094 -22.628 1.00 29.63  ? 5   DC  B OP2   1 
ATOM   2431 O  "O5'" . DC  B 2 5   ? 5.425   -12.731 -24.391 1.00 32.39  ? 5   DC  B "O5'" 1 
ATOM   2432 C  "C5'" . DC  B 2 5   ? 5.016   -12.267 -25.637 1.00 34.53  ? 5   DC  B "C5'" 1 
ATOM   2433 C  "C4'" . DC  B 2 5   ? 3.542   -11.926 -25.650 1.00 35.31  ? 5   DC  B "C4'" 1 
ATOM   2434 O  "O4'" . DC  B 2 5   ? 2.673   -12.911 -25.069 1.00 34.40  ? 5   DC  B "O4'" 1 
ATOM   2435 C  "C3'" . DC  B 2 5   ? 3.081   -10.579 -25.084 1.00 36.51  ? 5   DC  B "C3'" 1 
ATOM   2436 O  "O3'" . DC  B 2 5   ? 2.850   -9.779  -26.257 1.00 40.22  ? 5   DC  B "O3'" 1 
ATOM   2437 C  "C2'" . DC  B 2 5   ? 1.741   -10.902 -24.444 1.00 35.15  ? 5   DC  B "C2'" 1 
ATOM   2438 C  "C1'" . DC  B 2 5   ? 1.424   -12.260 -25.057 1.00 34.23  ? 5   DC  B "C1'" 1 
ATOM   2439 N  N1    . DC  B 2 5   ? 0.475   -13.090 -24.294 1.00 33.09  ? 5   DC  B N1    1 
ATOM   2440 C  C2    . DC  B 2 5   ? -0.807  -13.339 -24.817 1.00 32.60  ? 5   DC  B C2    1 
ATOM   2441 O  O2    . DC  B 2 5   ? -1.093  -12.891 -25.931 1.00 32.66  ? 5   DC  B O2    1 
ATOM   2442 N  N3    . DC  B 2 5   ? -1.690  -14.060 -24.087 1.00 31.16  ? 5   DC  B N3    1 
ATOM   2443 C  C4    . DC  B 2 5   ? -1.340  -14.508 -22.880 1.00 31.11  ? 5   DC  B C4    1 
ATOM   2444 N  N4    . DC  B 2 5   ? -2.219  -15.226 -22.199 1.00 31.26  ? 5   DC  B N4    1 
ATOM   2445 C  C5    . DC  B 2 5   ? -0.048  -14.267 -22.330 1.00 32.17  ? 5   DC  B C5    1 
ATOM   2446 C  C6    . DC  B 2 5   ? 0.801   -13.523 -23.043 1.00 31.71  ? 5   DC  B C6    1 
ATOM   2447 P  P     . DA  B 2 6   ? 2.589   -8.203  -26.190 1.00 42.71  ? 6   DA  B P     1 
ATOM   2448 O  OP1   . DA  B 2 6   ? 3.240   -7.607  -27.360 1.00 45.44  ? 6   DA  B OP1   1 
ATOM   2449 O  OP2   . DA  B 2 6   ? 2.914   -7.718  -24.801 1.00 41.34  ? 6   DA  B OP2   1 
ATOM   2450 O  "O5'" . DA  B 2 6   ? 1.019   -8.138  -26.444 1.00 41.71  ? 6   DA  B "O5'" 1 
ATOM   2451 C  "C5'" . DA  B 2 6   ? 0.422   -8.853  -27.515 1.00 42.36  ? 6   DA  B "C5'" 1 
ATOM   2452 C  "C4'" . DA  B 2 6   ? -1.037  -8.489  -27.648 1.00 42.23  ? 6   DA  B "C4'" 1 
ATOM   2453 O  "O4'" . DA  B 2 6   ? -1.846  -9.366  -26.828 1.00 39.71  ? 6   DA  B "O4'" 1 
ATOM   2454 C  "C3'" . DA  B 2 6   ? -1.414  -7.073  -27.217 1.00 43.17  ? 6   DA  B "C3'" 1 
ATOM   2455 O  "O3'" . DA  B 2 6   ? -2.539  -6.721  -28.044 1.00 46.51  ? 6   DA  B "O3'" 1 
ATOM   2456 C  "C2'" . DA  B 2 6   ? -1.818  -7.252  -25.760 1.00 39.67  ? 6   DA  B "C2'" 1 
ATOM   2457 C  "C1'" . DA  B 2 6   ? -2.499  -8.615  -25.805 1.00 38.21  ? 6   DA  B "C1'" 1 
ATOM   2458 N  N9    . DA  B 2 6   ? -2.412  -9.390  -24.580 1.00 34.72  ? 6   DA  B N9    1 
ATOM   2459 C  C8    . DA  B 2 6   ? -1.305  -9.562  -23.784 1.00 32.53  ? 6   DA  B C8    1 
ATOM   2460 N  N7    . DA  B 2 6   ? -1.508  -10.352 -22.758 1.00 31.26  ? 6   DA  B N7    1 
ATOM   2461 C  C5    . DA  B 2 6   ? -2.836  -10.735 -22.891 1.00 30.60  ? 6   DA  B C5    1 
ATOM   2462 C  C6    . DA  B 2 6   ? -3.670  -11.538 -22.095 1.00 29.43  ? 6   DA  B C6    1 
ATOM   2463 N  N6    . DA  B 2 6   ? -3.259  -12.148 -20.985 1.00 27.09  ? 6   DA  B N6    1 
ATOM   2464 N  N1    . DA  B 2 6   ? -4.948  -11.724 -22.509 1.00 30.21  ? 6   DA  B N1    1 
ATOM   2465 C  C2    . DA  B 2 6   ? -5.359  -11.092 -23.627 1.00 31.44  ? 6   DA  B C2    1 
ATOM   2466 N  N3    . DA  B 2 6   ? -4.671  -10.295 -24.445 1.00 31.95  ? 6   DA  B N3    1 
ATOM   2467 C  C4    . DA  B 2 6   ? -3.404  -10.155 -24.015 1.00 32.36  ? 6   DA  B C4    1 
ATOM   2468 P  P     . DC  B 2 7   ? -3.151  -5.255  -28.013 1.00 50.36  ? 7   DC  B P     1 
ATOM   2469 O  OP1   . DC  B 2 7   ? -3.683  -5.032  -29.372 1.00 53.17  ? 7   DC  B OP1   1 
ATOM   2470 O  OP2   . DC  B 2 7   ? -2.141  -4.317  -27.416 1.00 50.50  ? 7   DC  B OP2   1 
ATOM   2471 O  "O5'" . DC  B 2 7   ? -4.270  -5.298  -26.870 1.00 46.71  ? 7   DC  B "O5'" 1 
ATOM   2472 C  "C5'" . DC  B 2 7   ? -5.479  -6.034  -27.116 1.00 44.95  ? 7   DC  B "C5'" 1 
ATOM   2473 C  "C4'" . DC  B 2 7   ? -6.208  -6.339  -25.830 1.00 42.70  ? 7   DC  B "C4'" 1 
ATOM   2474 O  "O4'" . DC  B 2 7   ? -5.447  -7.154  -24.878 1.00 40.34  ? 7   DC  B "O4'" 1 
ATOM   2475 C  "C3'" . DC  B 2 7   ? -6.682  -5.114  -25.055 1.00 42.20  ? 7   DC  B "C3'" 1 
ATOM   2476 O  "O3'" . DC  B 2 7   ? -8.099  -5.208  -25.097 1.00 42.07  ? 7   DC  B "O3'" 1 
ATOM   2477 C  "C2'" . DC  B 2 7   ? -6.191  -5.369  -23.635 1.00 40.78  ? 7   DC  B "C2'" 1 
ATOM   2478 C  "C1'" . DC  B 2 7   ? -6.038  -6.876  -23.630 1.00 38.58  ? 7   DC  B "C1'" 1 
ATOM   2479 N  N1    . DC  B 2 7   ? -5.194  -7.432  -22.572 1.00 36.04  ? 7   DC  B N1    1 
ATOM   2480 C  C2    . DC  B 2 7   ? -5.755  -8.326  -21.658 1.00 33.64  ? 7   DC  B C2    1 
ATOM   2481 O  O2    . DC  B 2 7   ? -6.938  -8.634  -21.775 1.00 33.75  ? 7   DC  B O2    1 
ATOM   2482 N  N3    . DC  B 2 7   ? -5.008  -8.775  -20.627 1.00 31.90  ? 7   DC  B N3    1 
ATOM   2483 C  C4    . DC  B 2 7   ? -3.728  -8.425  -20.532 1.00 31.88  ? 7   DC  B C4    1 
ATOM   2484 N  N4    . DC  B 2 7   ? -3.011  -8.948  -19.533 1.00 30.97  ? 7   DC  B N4    1 
ATOM   2485 C  C5    . DC  B 2 7   ? -3.123  -7.525  -21.455 1.00 33.01  ? 7   DC  B C5    1 
ATOM   2486 C  C6    . DC  B 2 7   ? -3.898  -7.024  -22.427 1.00 35.50  ? 7   DC  B C6    1 
ATOM   2487 P  P     . DC  B 2 8   ? -9.037  -4.061  -24.477 1.00 42.71  ? 8   DC  B P     1 
ATOM   2488 O  OP1   . DC  B 2 8   ? -10.165 -3.881  -25.442 1.00 44.64  ? 8   DC  B OP1   1 
ATOM   2489 O  OP2   . DC  B 2 8   ? -8.193  -2.932  -23.988 1.00 42.70  ? 8   DC  B OP2   1 
ATOM   2490 O  "O5'" . DC  B 2 8   ? -9.608  -4.660  -23.112 1.00 41.05  ? 8   DC  B "O5'" 1 
ATOM   2491 C  "C5'" . DC  B 2 8   ? -10.441 -5.840  -23.156 1.00 40.32  ? 8   DC  B "C5'" 1 
ATOM   2492 C  "C4'" . DC  B 2 8   ? -10.958 -6.179  -21.783 1.00 38.73  ? 8   DC  B "C4'" 1 
ATOM   2493 O  "O4'" . DC  B 2 8   ? -9.877  -6.747  -21.022 1.00 36.00  ? 8   DC  B "O4'" 1 
ATOM   2494 C  "C3'" . DC  B 2 8   ? -11.471 -4.987  -20.979 1.00 40.24  ? 8   DC  B "C3'" 1 
ATOM   2495 O  "O3'" . DC  B 2 8   ? -12.727 -5.378  -20.437 1.00 43.08  ? 8   DC  B "O3'" 1 
ATOM   2496 C  "C2'" . DC  B 2 8   ? -10.431 -4.807  -19.879 1.00 37.96  ? 8   DC  B "C2'" 1 
ATOM   2497 C  "C1'" . DC  B 2 8   ? -9.904  -6.222  -19.715 1.00 35.39  ? 8   DC  B "C1'" 1 
ATOM   2498 N  N1    . DC  B 2 8   ? -8.555  -6.392  -19.142 1.00 32.93  ? 8   DC  B N1    1 
ATOM   2499 C  C2    . DC  B 2 8   ? -8.425  -7.066  -17.923 1.00 30.96  ? 8   DC  B C2    1 
ATOM   2500 O  O2    . DC  B 2 8   ? -9.450  -7.472  -17.352 1.00 31.57  ? 8   DC  B O2    1 
ATOM   2501 N  N3    . DC  B 2 8   ? -7.192  -7.252  -17.395 1.00 29.28  ? 8   DC  B N3    1 
ATOM   2502 C  C4    . DC  B 2 8   ? -6.116  -6.793  -18.034 1.00 28.63  ? 8   DC  B C4    1 
ATOM   2503 N  N4    . DC  B 2 8   ? -4.917  -6.993  -17.467 1.00 27.38  ? 8   DC  B N4    1 
ATOM   2504 C  C5    . DC  B 2 8   ? -6.218  -6.103  -19.277 1.00 30.22  ? 8   DC  B C5    1 
ATOM   2505 C  C6    . DC  B 2 8   ? -7.444  -5.940  -19.799 1.00 31.91  ? 8   DC  B C6    1 
ATOM   2506 P  P     . DT  B 2 9   ? -13.748 -4.309  -19.876 1.00 47.37  ? 9   DT  B P     1 
ATOM   2507 O  OP1   . DT  B 2 9   ? -15.117 -4.736  -20.265 1.00 50.69  ? 9   DT  B OP1   1 
ATOM   2508 O  OP2   . DT  B 2 9   ? -13.297 -2.959  -20.261 1.00 48.94  ? 9   DT  B OP2   1 
ATOM   2509 O  "O5'" . DT  B 2 9   ? -13.573 -4.446  -18.316 1.00 46.30  ? 9   DT  B "O5'" 1 
ATOM   2510 C  "C5'" . DT  B 2 9   ? -13.616 -5.754  -17.747 1.00 46.75  ? 9   DT  B "C5'" 1 
ATOM   2511 C  "C4'" . DT  B 2 9   ? -13.485 -5.663  -16.248 1.00 45.94  ? 9   DT  B "C4'" 1 
ATOM   2512 O  "O4'" . DT  B 2 9   ? -12.109 -5.872  -15.864 1.00 43.83  ? 9   DT  B "O4'" 1 
ATOM   2513 C  "C3'" . DT  B 2 9   ? -13.908 -4.337  -15.615 1.00 47.89  ? 9   DT  B "C3'" 1 
ATOM   2514 O  "O3'" . DT  B 2 9   ? -14.483 -4.712  -14.375 1.00 49.43  ? 9   DT  B "O3'" 1 
ATOM   2515 C  "C2'" . DT  B 2 9   ? -12.592 -3.633  -15.323 1.00 45.71  ? 9   DT  B "C2'" 1 
ATOM   2516 C  "C1'" . DT  B 2 9   ? -11.697 -4.830  -14.982 1.00 43.77  ? 9   DT  B "C1'" 1 
ATOM   2517 N  N1    . DT  B 2 9   ? -10.246 -4.653  -15.158 1.00 40.91  ? 9   DT  B N1    1 
ATOM   2518 C  C2    . DT  B 2 9   ? -9.400  -5.249  -14.248 1.00 39.80  ? 9   DT  B C2    1 
ATOM   2519 O  O2    . DT  B 2 9   ? -9.801  -5.882  -13.287 1.00 41.93  ? 9   DT  B O2    1 
ATOM   2520 N  N3    . DT  B 2 9   ? -8.061  -5.050  -14.492 1.00 37.14  ? 9   DT  B N3    1 
ATOM   2521 C  C4    . DT  B 2 9   ? -7.505  -4.368  -15.558 1.00 36.45  ? 9   DT  B C4    1 
ATOM   2522 O  O4    . DT  B 2 9   ? -6.291  -4.309  -15.675 1.00 34.33  ? 9   DT  B O4    1 
ATOM   2523 C  C5    . DT  B 2 9   ? -8.454  -3.792  -16.487 1.00 38.44  ? 9   DT  B C5    1 
ATOM   2524 C  C7    . DT  B 2 9   ? -7.946  -3.006  -17.656 1.00 39.34  ? 9   DT  B C7    1 
ATOM   2525 C  C6    . DT  B 2 9   ? -9.757  -3.960  -16.242 1.00 40.10  ? 9   DT  B C6    1 
ATOM   2526 P  P     . DG  B 2 10  ? -15.840 -4.106  -13.878 1.00 52.70  ? 10  DG  B P     1 
ATOM   2527 O  OP1   . DG  B 2 10  ? -16.932 -4.852  -14.586 1.00 51.64  ? 10  DG  B OP1   1 
ATOM   2528 O  OP2   . DG  B 2 10  ? -15.729 -2.627  -13.916 1.00 51.58  ? 10  DG  B OP2   1 
ATOM   2529 O  "O5'" . DG  B 2 10  ? -15.766 -4.473  -12.327 1.00 50.40  ? 10  DG  B "O5'" 1 
ATOM   2530 C  "C5'" . DG  B 2 10  ? -15.492 -5.836  -11.902 1.00 49.31  ? 10  DG  B "C5'" 1 
ATOM   2531 C  "C4'" . DG  B 2 10  ? -14.929 -5.826  -10.506 1.00 48.02  ? 10  DG  B "C4'" 1 
ATOM   2532 O  "O4'" . DG  B 2 10  ? -13.499 -5.606  -10.593 1.00 44.97  ? 10  DG  B "O4'" 1 
ATOM   2533 C  "C3'" . DG  B 2 10  ? -15.468 -4.692  -9.626  1.00 48.98  ? 10  DG  B "C3'" 1 
ATOM   2534 O  "O3'" . DG  B 2 10  ? -15.357 -5.051  -8.255  1.00 49.72  ? 10  DG  B "O3'" 1 
ATOM   2535 C  "C2'" . DG  B 2 10  ? -14.462 -3.581  -9.842  1.00 47.21  ? 10  DG  B "C2'" 1 
ATOM   2536 C  "C1'" . DG  B 2 10  ? -13.189 -4.412  -9.894  1.00 44.83  ? 10  DG  B "C1'" 1 
ATOM   2537 N  N9    . DG  B 2 10  ? -12.062 -3.800  -10.558 1.00 43.17  ? 10  DG  B N9    1 
ATOM   2538 C  C8    . DG  B 2 10  ? -12.044 -2.921  -11.618 1.00 43.63  ? 10  DG  B C8    1 
ATOM   2539 N  N7    . DG  B 2 10  ? -10.840 -2.547  -11.949 1.00 41.84  ? 10  DG  B N7    1 
ATOM   2540 C  C5    . DG  B 2 10  ? -10.018 -3.215  -11.050 1.00 40.17  ? 10  DG  B C5    1 
ATOM   2541 C  C6    . DG  B 2 10  ? -8.603  -3.212  -10.915 1.00 37.29  ? 10  DG  B C6    1 
ATOM   2542 O  O6    . DG  B 2 10  ? -7.772  -2.583  -11.570 1.00 35.81  ? 10  DG  B O6    1 
ATOM   2543 N  N1    . DG  B 2 10  ? -8.185  -4.066  -9.896  1.00 35.70  ? 10  DG  B N1    1 
ATOM   2544 C  C2    . DG  B 2 10  ? -9.026  -4.763  -9.056  1.00 36.72  ? 10  DG  B C2    1 
ATOM   2545 N  N2    . DG  B 2 10  ? -8.446  -5.480  -8.090  1.00 35.09  ? 10  DG  B N2    1 
ATOM   2546 N  N3    . DG  B 2 10  ? -10.345 -4.760  -9.164  1.00 39.34  ? 10  DG  B N3    1 
ATOM   2547 C  C4    . DG  B 2 10  ? -10.765 -3.988  -10.185 1.00 40.64  ? 10  DG  B C4    1 
ATOM   2548 P  P     . DA  B 2 11  ? -16.641 -5.476  -7.445  1.00 52.45  ? 11  DA  B P     1 
ATOM   2549 O  OP1   . DA  B 2 11  ? -17.266 -6.596  -8.194  1.00 53.65  ? 11  DA  B OP1   1 
ATOM   2550 O  OP2   . DA  B 2 11  ? -17.375 -4.222  -7.148  1.00 52.24  ? 11  DA  B OP2   1 
ATOM   2551 O  "O5'" . DA  B 2 11  ? -16.000 -6.110  -6.128  1.00 53.04  ? 11  DA  B "O5'" 1 
ATOM   2552 C  "C5'" . DA  B 2 11  ? -15.141 -7.242  -6.276  1.00 52.67  ? 11  DA  B "C5'" 1 
ATOM   2553 C  "C4'" . DA  B 2 11  ? -14.181 -7.308  -5.118  1.00 53.59  ? 11  DA  B "C4'" 1 
ATOM   2554 O  "O4'" . DA  B 2 11  ? -13.053 -6.424  -5.311  1.00 53.67  ? 11  DA  B "O4'" 1 
ATOM   2555 C  "C3'" . DA  B 2 11  ? -14.752 -6.936  -3.752  1.00 55.47  ? 11  DA  B "C3'" 1 
ATOM   2556 O  "O3'" . DA  B 2 11  ? -14.018 -7.842  -2.934  1.00 55.20  ? 11  DA  B "O3'" 1 
ATOM   2557 C  "C2'" . DA  B 2 11  ? -14.408 -5.461  -3.604  1.00 53.93  ? 11  DA  B "C2'" 1 
ATOM   2558 C  "C1'" . DA  B 2 11  ? -13.111 -5.315  -4.397  1.00 52.10  ? 11  DA  B "C1'" 1 
ATOM   2559 N  N9    . DA  B 2 11  ? -12.953 -4.109  -5.206  1.00 51.54  ? 11  DA  B N9    1 
ATOM   2560 C  C8    . DA  B 2 11  ? -13.906 -3.309  -5.792  1.00 52.21  ? 11  DA  B C8    1 
ATOM   2561 N  N7    . DA  B 2 11  ? -13.406 -2.381  -6.572  1.00 51.04  ? 11  DA  B N7    1 
ATOM   2562 C  C5    . DA  B 2 11  ? -12.038 -2.616  -6.535  1.00 48.30  ? 11  DA  B C5    1 
ATOM   2563 C  C6    . DA  B 2 11  ? -10.950 -1.975  -7.153  1.00 47.18  ? 11  DA  B C6    1 
ATOM   2564 N  N6    . DA  B 2 11  ? -11.078 -0.925  -7.966  1.00 48.69  ? 11  DA  B N6    1 
ATOM   2565 N  N1    . DA  B 2 11  ? -9.710  -2.440  -6.888  1.00 44.00  ? 11  DA  B N1    1 
ATOM   2566 C  C2    . DA  B 2 11  ? -9.583  -3.482  -6.053  1.00 44.11  ? 11  DA  B C2    1 
ATOM   2567 N  N3    . DA  B 2 11  ? -10.531 -4.186  -5.434  1.00 44.75  ? 11  DA  B N3    1 
ATOM   2568 C  C4    . DA  B 2 11  ? -11.750 -3.700  -5.726  1.00 47.62  ? 11  DA  B C4    1 
ATOM   2569 P  P     . DT  B 2 12  ? -14.008 -7.729  -1.359  1.00 57.46  ? 12  DT  B P     1 
ATOM   2570 O  OP1   . DT  B 2 12  ? -13.784 -9.110  -0.824  1.00 58.29  ? 12  DT  B OP1   1 
ATOM   2571 O  OP2   . DT  B 2 12  ? -15.115 -6.864  -0.918  1.00 55.05  ? 12  DT  B OP2   1 
ATOM   2572 O  "O5'" . DT  B 2 12  ? -12.678 -6.920  -1.083  1.00 53.97  ? 12  DT  B "O5'" 1 
ATOM   2573 C  "C5'" . DT  B 2 12  ? -11.405 -7.449  -1.451  1.00 50.61  ? 12  DT  B "C5'" 1 
ATOM   2574 C  "C4'" . DT  B 2 12  ? -10.363 -6.451  -1.010  1.00 48.72  ? 12  DT  B "C4'" 1 
ATOM   2575 O  "O4'" . DT  B 2 12  ? -10.426 -5.297  -1.886  1.00 46.90  ? 12  DT  B "O4'" 1 
ATOM   2576 C  "C3'" . DT  B 2 12  ? -10.570 -5.909  0.420   1.00 48.14  ? 12  DT  B "C3'" 1 
ATOM   2577 O  "O3'" . DT  B 2 12  ? -9.306  -5.820  1.087   1.00 45.37  ? 12  DT  B "O3'" 1 
ATOM   2578 C  "C2'" . DT  B 2 12  ? -11.213 -4.554  0.211   1.00 47.71  ? 12  DT  B "C2'" 1 
ATOM   2579 C  "C1'" . DT  B 2 12  ? -10.481 -4.142  -1.061  1.00 47.34  ? 12  DT  B "C1'" 1 
ATOM   2580 N  N1    . DT  B 2 12  ? -11.057 -3.039  -1.846  1.00 47.67  ? 12  DT  B N1    1 
ATOM   2581 C  C2    . DT  B 2 12  ? -10.168 -2.235  -2.529  1.00 46.29  ? 12  DT  B C2    1 
ATOM   2582 O  O2    . DT  B 2 12  ? -8.958  -2.410  -2.515  1.00 43.45  ? 12  DT  B O2    1 
ATOM   2583 N  N3    . DT  B 2 12  ? -10.750 -1.205  -3.222  1.00 46.54  ? 12  DT  B N3    1 
ATOM   2584 C  C4    . DT  B 2 12  ? -12.094 -0.897  -3.286  1.00 48.28  ? 12  DT  B C4    1 
ATOM   2585 O  O4    . DT  B 2 12  ? -12.460 0.080   -3.930  1.00 50.96  ? 12  DT  B O4    1 
ATOM   2586 C  C5    . DT  B 2 12  ? -12.974 -1.802  -2.567  1.00 49.12  ? 12  DT  B C5    1 
ATOM   2587 C  C7    . DT  B 2 12  ? -14.452 -1.570  -2.604  1.00 50.78  ? 12  DT  B C7    1 
ATOM   2588 C  C6    . DT  B 2 12  ? -12.416 -2.805  -1.883  1.00 47.89  ? 12  DT  B C6    1 
ATOM   2589 P  P     . DA  B 2 13  ? -8.826  -7.073  1.966   1.00 45.72  ? 13  DA  B P     1 
ATOM   2590 O  OP1   . DA  B 2 13  ? -9.141  -8.337  1.234   1.00 44.97  ? 13  DA  B OP1   1 
ATOM   2591 O  OP2   . DA  B 2 13  ? -9.367  -6.872  3.310   1.00 44.74  ? 13  DA  B OP2   1 
ATOM   2592 O  "O5'" . DA  B 2 13  ? -7.230  -6.939  1.959   1.00 44.36  ? 13  DA  B "O5'" 1 
ATOM   2593 C  "C5'" . DA  B 2 13  ? -6.392  -7.314  0.863   1.00 41.27  ? 13  DA  B "C5'" 1 
ATOM   2594 C  "C4'" . DA  B 2 13  ? -5.263  -6.317  0.739   1.00 41.25  ? 13  DA  B "C4'" 1 
ATOM   2595 O  "O4'" . DA  B 2 13  ? -5.802  -4.983  0.546   1.00 38.95  ? 13  DA  B "O4'" 1 
ATOM   2596 C  "C3'" . DA  B 2 13  ? -4.341  -6.170  1.947   1.00 42.29  ? 13  DA  B "C3'" 1 
ATOM   2597 O  "O3'" . DA  B 2 13  ? -3.257  -5.351  1.506   1.00 42.87  ? 13  DA  B "O3'" 1 
ATOM   2598 C  "C2'" . DA  B 2 13  ? -5.098  -5.172  2.800   1.00 41.64  ? 13  DA  B "C2'" 1 
ATOM   2599 C  "C1'" . DA  B 2 13  ? -5.569  -4.200  1.693   1.00 39.68  ? 13  DA  B "C1'" 1 
ATOM   2600 N  N9    . DA  B 2 13  ? -6.806  -3.491  1.955   1.00 41.07  ? 13  DA  B N9    1 
ATOM   2601 C  C8    . DA  B 2 13  ? -7.799  -3.771  2.865   1.00 41.69  ? 13  DA  B C8    1 
ATOM   2602 N  N7    . DA  B 2 13  ? -8.834  -2.974  2.776   1.00 42.32  ? 13  DA  B N7    1 
ATOM   2603 C  C5    . DA  B 2 13  ? -8.522  -2.141  1.708   1.00 41.75  ? 13  DA  B C5    1 
ATOM   2604 C  C6    . DA  B 2 13  ? -9.216  -1.084  1.101   1.00 41.09  ? 13  DA  B C6    1 
ATOM   2605 N  N6    . DA  B 2 13  ? -10.416 -0.667  1.503   1.00 41.80  ? 13  DA  B N6    1 
ATOM   2606 N  N1    . DA  B 2 13  ? -8.617  -0.450  0.068   1.00 40.23  ? 13  DA  B N1    1 
ATOM   2607 C  C2    . DA  B 2 13  ? -7.416  -0.877  -0.340  1.00 39.85  ? 13  DA  B C2    1 
ATOM   2608 N  N3    . DA  B 2 13  ? -6.656  -1.846  0.160   1.00 39.51  ? 13  DA  B N3    1 
ATOM   2609 C  C4    . DA  B 2 13  ? -7.276  -2.449  1.193   1.00 40.97  ? 13  DA  B C4    1 
ATOM   2610 P  P     . DA  B 2 14  ? -1.825  -5.511  2.073   1.00 43.44  ? 14  DA  B P     1 
ATOM   2611 O  OP1   . DA  B 2 14  ? -1.034  -6.212  1.014   1.00 47.62  ? 14  DA  B OP1   1 
ATOM   2612 O  OP2   . DA  B 2 14  ? -1.881  -6.124  3.410   1.00 44.89  ? 14  DA  B OP2   1 
ATOM   2613 O  "O5'" . DA  B 2 14  ? -1.268  -4.024  2.105   1.00 42.12  ? 14  DA  B "O5'" 1 
ATOM   2614 C  "C5'" . DA  B 2 14  ? -2.056  -2.904  2.490   1.00 43.56  ? 14  DA  B "C5'" 1 
ATOM   2615 C  "C4'" . DA  B 2 14  ? -1.942  -1.827  1.433   1.00 42.31  ? 14  DA  B "C4'" 1 
ATOM   2616 O  "O4'" . DA  B 2 14  ? -3.262  -1.307  1.147   1.00 40.05  ? 14  DA  B "O4'" 1 
ATOM   2617 C  "C3'" . DA  B 2 14  ? -1.107  -0.607  1.822   1.00 40.32  ? 14  DA  B "C3'" 1 
ATOM   2618 O  "O3'" . DA  B 2 14  ? -0.586  0.058   0.653   1.00 39.61  ? 14  DA  B "O3'" 1 
ATOM   2619 C  "C2'" . DA  B 2 14  ? -2.134  0.254   2.526   1.00 39.87  ? 14  DA  B "C2'" 1 
ATOM   2620 C  "C1'" . DA  B 2 14  ? -3.407  -0.019  1.709   1.00 38.89  ? 14  DA  B "C1'" 1 
ATOM   2621 N  N9    . DA  B 2 14  ? -4.643  -0.030  2.482   1.00 37.14  ? 14  DA  B N9    1 
ATOM   2622 C  C8    . DA  B 2 14  ? -4.967  -0.826  3.554   1.00 36.03  ? 14  DA  B C8    1 
ATOM   2623 N  N7    . DA  B 2 14  ? -6.160  -0.595  4.040   1.00 35.74  ? 14  DA  B N7    1 
ATOM   2624 C  C5    . DA  B 2 14  ? -6.678  0.380   3.198   1.00 36.45  ? 14  DA  B C5    1 
ATOM   2625 C  C6    . DA  B 2 14  ? -7.918  1.053   3.171   1.00 36.72  ? 14  DA  B C6    1 
ATOM   2626 N  N6    . DA  B 2 14  ? -8.900  0.827   4.044   1.00 37.32  ? 14  DA  B N6    1 
ATOM   2627 N  N1    . DA  B 2 14  ? -8.109  1.983   2.206   1.00 36.98  ? 14  DA  B N1    1 
ATOM   2628 C  C2    . DA  B 2 14  ? -7.120  2.203   1.326   1.00 36.74  ? 14  DA  B C2    1 
ATOM   2629 N  N3    . DA  B 2 14  ? -5.901  1.659   1.272   1.00 35.61  ? 14  DA  B N3    1 
ATOM   2630 C  C4    . DA  B 2 14  ? -5.746  0.747   2.243   1.00 35.15  ? 14  DA  B C4    1 
ATOM   2631 P  P     . DT  B 2 15  ? 0.326   1.375   0.834   1.00 38.80  ? 15  DT  B P     1 
ATOM   2632 O  OP1   . DT  B 2 15  ? 1.346   1.392   -0.268  1.00 38.45  ? 15  DT  B OP1   1 
ATOM   2633 O  OP2   . DT  B 2 15  ? 0.838   1.402   2.224   1.00 38.45  ? 15  DT  B OP2   1 
ATOM   2634 O  "O5'" . DT  B 2 15  ? -0.776  2.540   0.716   1.00 39.70  ? 15  DT  B "O5'" 1 
ATOM   2635 C  "C5'" . DT  B 2 15  ? -1.422  2.837   -0.583  1.00 37.58  ? 15  DT  B "C5'" 1 
ATOM   2636 C  "C4'" . DT  B 2 15  ? -2.159  4.165   -0.579  1.00 37.02  ? 15  DT  B "C4'" 1 
ATOM   2637 O  "O4'" . DT  B 2 15  ? -3.334  4.102   0.268   1.00 35.98  ? 15  DT  B "O4'" 1 
ATOM   2638 C  "C3'" . DT  B 2 15  ? -1.344  5.345   -0.052  1.00 37.88  ? 15  DT  B "C3'" 1 
ATOM   2639 O  "O3'" . DT  B 2 15  ? -1.641  6.541   -0.755  1.00 37.93  ? 15  DT  B "O3'" 1 
ATOM   2640 C  "C2'" . DT  B 2 15  ? -1.824  5.493   1.385   1.00 37.63  ? 15  DT  B "C2'" 1 
ATOM   2641 C  "C1'" . DT  B 2 15  ? -3.301  5.154   1.234   1.00 37.47  ? 15  DT  B "C1'" 1 
ATOM   2642 N  N1    . DT  B 2 15  ? -4.001  4.655   2.443   1.00 37.30  ? 15  DT  B N1    1 
ATOM   2643 C  C2    . DT  B 2 15  ? -5.314  5.012   2.682   1.00 37.66  ? 15  DT  B C2    1 
ATOM   2644 O  O2    . DT  B 2 15  ? -5.927  5.803   1.990   1.00 39.54  ? 15  DT  B O2    1 
ATOM   2645 N  N3    . DT  B 2 15  ? -5.887  4.397   3.770   1.00 37.18  ? 15  DT  B N3    1 
ATOM   2646 C  C4    . DT  B 2 15  ? -5.290  3.484   4.617   1.00 36.37  ? 15  DT  B C4    1 
ATOM   2647 O  O4    . DT  B 2 15  ? -5.933  2.983   5.521   1.00 36.20  ? 15  DT  B O4    1 
ATOM   2648 C  C5    . DT  B 2 15  ? -3.914  3.168   4.315   1.00 36.45  ? 15  DT  B C5    1 
ATOM   2649 C  C7    . DT  B 2 15  ? -3.185  2.193   5.185   1.00 36.71  ? 15  DT  B C7    1 
ATOM   2650 C  C6    . DT  B 2 15  ? -3.356  3.741   3.244   1.00 36.35  ? 15  DT  B C6    1 
ATOM   2651 P  P     . DG  B 2 16  ? -0.643  7.785   -0.675  1.00 38.63  ? 16  DG  B P     1 
ATOM   2652 O  OP1   . DG  B 2 16  ? -1.070  8.813   -1.723  1.00 41.34  ? 16  DG  B OP1   1 
ATOM   2653 O  OP2   . DG  B 2 16  ? 0.761   7.252   -0.729  1.00 41.33  ? 16  DG  B OP2   1 
ATOM   2654 O  "O5'" . DG  B 2 16  ? -1.033  8.518   0.683   1.00 37.47  ? 16  DG  B "O5'" 1 
ATOM   2655 C  "C5'" . DG  B 2 16  ? -2.303  9.198   0.736   1.00 36.76  ? 16  DG  B "C5'" 1 
ATOM   2656 C  "C4'" . DG  B 2 16  ? -2.715  9.420   2.167   1.00 36.11  ? 16  DG  B "C4'" 1 
ATOM   2657 O  "O4'" . DG  B 2 16  ? -2.993  8.149   2.841   1.00 34.70  ? 16  DG  B "O4'" 1 
ATOM   2658 C  "C3'" . DG  B 2 16  ? -1.662  10.155  3.021   1.00 35.78  ? 16  DG  B "C3'" 1 
ATOM   2659 O  "O3'" . DG  B 2 16  ? -2.173  11.412  3.513   1.00 36.19  ? 16  DG  B "O3'" 1 
ATOM   2660 C  "C2'" . DG  B 2 16  ? -1.383  9.159   4.133   1.00 34.73  ? 16  DG  B "C2'" 1 
ATOM   2661 C  "C1'" . DG  B 2 16  ? -2.723  8.444   4.179   1.00 34.24  ? 16  DG  B "C1'" 1 
ATOM   2662 N  N9    . DG  B 2 16  ? -2.852  7.250   5.018   1.00 33.09  ? 16  DG  B N9    1 
ATOM   2663 C  C8    . DG  B 2 16  ? -1.834  6.488   5.544   1.00 32.07  ? 16  DG  B C8    1 
ATOM   2664 N  N7    . DG  B 2 16  ? -2.247  5.629   6.437   1.00 31.96  ? 16  DG  B N7    1 
ATOM   2665 C  C5    . DG  B 2 16  ? -3.613  5.866   6.536   1.00 32.07  ? 16  DG  B C5    1 
ATOM   2666 C  C6    . DG  B 2 16  ? -4.593  5.266   7.366   1.00 32.23  ? 16  DG  B C6    1 
ATOM   2667 O  O6    . DG  B 2 16  ? -4.462  4.340   8.160   1.00 32.37  ? 16  DG  B O6    1 
ATOM   2668 N  N1    . DG  B 2 16  ? -5.858  5.788   7.126   1.00 32.92  ? 16  DG  B N1    1 
ATOM   2669 C  C2    . DG  B 2 16  ? -6.134  6.814   6.260   1.00 33.40  ? 16  DG  B C2    1 
ATOM   2670 N  N2    . DG  B 2 16  ? -7.409  7.240   6.235   1.00 34.86  ? 16  DG  B N2    1 
ATOM   2671 N  N3    . DG  B 2 16  ? -5.224  7.407   5.506   1.00 32.56  ? 16  DG  B N3    1 
ATOM   2672 C  C4    . DG  B 2 16  ? -3.997  6.879   5.685   1.00 32.43  ? 16  DG  B C4    1 
ATOM   2673 P  P     . DG  B 2 17  ? -1.237  12.373  4.350   1.00 36.46  ? 17  DG  B P     1 
ATOM   2674 O  OP1   . DG  B 2 17  ? -1.845  13.687  4.424   1.00 38.54  ? 17  DG  B OP1   1 
ATOM   2675 O  OP2   . DG  B 2 17  ? 0.134   12.265  3.835   1.00 35.92  ? 17  DG  B OP2   1 
ATOM   2676 O  "O5'" . DG  B 2 17  ? -1.383  11.786  5.828   1.00 37.91  ? 17  DG  B "O5'" 1 
ATOM   2677 C  "C5'" . DG  B 2 17  ? -2.247  12.361  6.846   1.00 38.24  ? 17  DG  B "C5'" 1 
ATOM   2678 C  "C4'" . DG  B 2 17  ? -3.714  12.291  6.477   1.00 37.60  ? 17  DG  B "C4'" 1 
ATOM   2679 O  "O4'" . DG  B 2 17  ? -4.099  10.934  6.152   1.00 35.72  ? 17  DG  B "O4'" 1 
ATOM   2680 C  "C3'" . DG  B 2 17  ? -4.631  12.719  7.614   1.00 37.53  ? 17  DG  B "C3'" 1 
ATOM   2681 O  "O3'" . DG  B 2 17  ? -5.123  14.010  7.345   1.00 39.71  ? 17  DG  B "O3'" 1 
ATOM   2682 C  "C2'" . DG  B 2 17  ? -5.806  11.768  7.530   1.00 36.81  ? 17  DG  B "C2'" 1 
ATOM   2683 C  "C1'" . DG  B 2 17  ? -5.180  10.516  6.983   1.00 34.91  ? 17  DG  B "C1'" 1 
ATOM   2684 N  N9    . DG  B 2 17  ? -4.650  9.591   7.985   1.00 33.08  ? 17  DG  B N9    1 
ATOM   2685 C  C8    . DG  B 2 17  ? -3.356  9.135   8.070   1.00 32.55  ? 17  DG  B C8    1 
ATOM   2686 N  N7    . DG  B 2 17  ? -3.192  8.223   8.987   1.00 31.83  ? 17  DG  B N7    1 
ATOM   2687 C  C5    . DG  B 2 17  ? -4.447  8.091   9.567   1.00 31.72  ? 17  DG  B C5    1 
ATOM   2688 C  C6    . DG  B 2 17  ? -4.883  7.276   10.648  1.00 31.36  ? 17  DG  B C6    1 
ATOM   2689 O  O6    . DG  B 2 17  ? -4.237  6.468   11.314  1.00 30.83  ? 17  DG  B O6    1 
ATOM   2690 N  N1    . DG  B 2 17  ? -6.224  7.483   10.936  1.00 32.25  ? 17  DG  B N1    1 
ATOM   2691 C  C2    . DG  B 2 17  ? -7.059  8.318   10.239  1.00 32.48  ? 17  DG  B C2    1 
ATOM   2692 N  N2    . DG  B 2 17  ? -8.336  8.322   10.635  1.00 33.14  ? 17  DG  B N2    1 
ATOM   2693 N  N3    . DG  B 2 17  ? -6.674  9.071   9.218   1.00 32.48  ? 17  DG  B N3    1 
ATOM   2694 C  C4    . DG  B 2 17  ? -5.364  8.908   8.938   1.00 32.28  ? 17  DG  B C4    1 
ATOM   2695 P  P     . DA  B 2 18  ? -5.047  15.122  8.485   1.00 41.76  ? 18  DA  B P     1 
ATOM   2696 O  OP1   . DA  B 2 18  ? -5.577  16.374  7.865   1.00 43.38  ? 18  DA  B OP1   1 
ATOM   2697 O  OP2   . DA  B 2 18  ? -3.665  15.097  9.083   1.00 40.92  ? 18  DA  B OP2   1 
ATOM   2698 O  "O5'" . DA  B 2 18  ? -6.098  14.586  9.556   1.00 40.72  ? 18  DA  B "O5'" 1 
ATOM   2699 C  "C5'" . DA  B 2 18  ? -7.483  14.554  9.134   1.00 41.73  ? 18  DA  B "C5'" 1 
ATOM   2700 C  "C4'" . DA  B 2 18  ? -8.362  13.875  10.155  1.00 41.55  ? 18  DA  B "C4'" 1 
ATOM   2701 O  "O4'" . DA  B 2 18  ? -8.022  12.483  10.219  1.00 41.34  ? 18  DA  B "O4'" 1 
ATOM   2702 C  "C3'" . DA  B 2 18  ? -8.191  14.369  11.577  1.00 42.03  ? 18  DA  B "C3'" 1 
ATOM   2703 O  "O3'" . DA  B 2 18  ? -9.103  15.440  11.722  1.00 43.65  ? 18  DA  B "O3'" 1 
ATOM   2704 C  "C2'" . DA  B 2 18  ? -8.632  13.172  12.391  1.00 41.59  ? 18  DA  B "C2'" 1 
ATOM   2705 C  "C1'" . DA  B 2 18  ? -8.190  12.004  11.541  1.00 40.06  ? 18  DA  B "C1'" 1 
ATOM   2706 N  N9    . DA  B 2 18  ? -6.942  11.370  11.939  1.00 37.96  ? 18  DA  B N9    1 
ATOM   2707 C  C8    . DA  B 2 18  ? -5.696  11.481  11.371  1.00 37.44  ? 18  DA  B C8    1 
ATOM   2708 N  N7    . DA  B 2 18  ? -4.788  10.721  11.937  1.00 36.33  ? 18  DA  B N7    1 
ATOM   2709 C  C5    . DA  B 2 18  ? -5.487  10.058  12.933  1.00 36.17  ? 18  DA  B C5    1 
ATOM   2710 C  C6    . DA  B 2 18  ? -5.094  9.118   13.888  1.00 36.03  ? 18  DA  B C6    1 
ATOM   2711 N  N6    . DA  B 2 18  ? -3.848  8.653   13.996  1.00 35.84  ? 18  DA  B N6    1 
ATOM   2712 N  N1    . DA  B 2 18  ? -6.036  8.658   14.739  1.00 36.51  ? 18  DA  B N1    1 
ATOM   2713 C  C2    . DA  B 2 18  ? -7.286  9.132   14.634  1.00 37.01  ? 18  DA  B C2    1 
ATOM   2714 N  N3    . DA  B 2 18  ? -7.781  10.000  13.764  1.00 36.87  ? 18  DA  B N3    1 
ATOM   2715 C  C4    . DA  B 2 18  ? -6.813  10.454  12.950  1.00 37.39  ? 18  DA  B C4    1 
ATOM   2716 P  P     . DG  B 2 19  ? -9.066  16.349  12.947  1.00 43.78  ? 19  DG  B P     1 
ATOM   2717 O  OP1   . DG  B 2 19  ? -10.213 17.283  12.799  1.00 46.63  ? 19  DG  B OP1   1 
ATOM   2718 O  OP2   . DG  B 2 19  ? -7.676  16.792  13.128  1.00 43.96  ? 19  DG  B OP2   1 
ATOM   2719 O  "O5'" . DG  B 2 19  ? -9.439  15.387  14.149  1.00 44.87  ? 19  DG  B "O5'" 1 
ATOM   2720 C  "C5'" . DG  B 2 19  ? -10.800 15.010  14.439  1.00 46.30  ? 19  DG  B "C5'" 1 
ATOM   2721 C  "C4'" . DG  B 2 19  ? -10.789 14.334  15.785  1.00 46.51  ? 19  DG  B "C4'" 1 
ATOM   2722 O  "O4'" . DG  B 2 19  ? -9.759  13.308  15.776  1.00 45.45  ? 19  DG  B "O4'" 1 
ATOM   2723 C  "C3'" . DG  B 2 19  ? -10.412 15.290  16.918  1.00 48.12  ? 19  DG  B "C3'" 1 
ATOM   2724 O  "O3'" . DG  B 2 19  ? -11.133 14.865  18.077  1.00 51.89  ? 19  DG  B "O3'" 1 
ATOM   2725 C  "C2'" . DG  B 2 19  ? -8.919  15.064  17.079  1.00 46.66  ? 19  DG  B "C2'" 1 
ATOM   2726 C  "C1'" . DG  B 2 19  ? -8.825  13.578  16.816  1.00 45.24  ? 19  DG  B "C1'" 1 
ATOM   2727 N  N9    . DG  B 2 19  ? -7.506  13.080  16.422  1.00 42.79  ? 19  DG  B N9    1 
ATOM   2728 C  C8    . DG  B 2 19  ? -6.633  13.628  15.512  1.00 42.68  ? 19  DG  B C8    1 
ATOM   2729 N  N7    . DG  B 2 19  ? -5.531  12.938  15.379  1.00 41.00  ? 19  DG  B N7    1 
ATOM   2730 C  C5    . DG  B 2 19  ? -5.656  11.914  16.308  1.00 40.66  ? 19  DG  B C5    1 
ATOM   2731 C  C6    . DG  B 2 19  ? -4.748  10.890  16.676  1.00 39.48  ? 19  DG  B C6    1 
ATOM   2732 O  O6    . DG  B 2 19  ? -3.644  10.637  16.200  1.00 39.23  ? 19  DG  B O6    1 
ATOM   2733 N  N1    . DG  B 2 19  ? -5.276  10.066  17.658  1.00 39.95  ? 19  DG  B N1    1 
ATOM   2734 C  C2    . DG  B 2 19  ? -6.514  10.204  18.220  1.00 40.80  ? 19  DG  B C2    1 
ATOM   2735 N  N2    . DG  B 2 19  ? -6.845  9.292   19.137  1.00 41.11  ? 19  DG  B N2    1 
ATOM   2736 N  N3    . DG  B 2 19  ? -7.362  11.172  17.913  1.00 41.75  ? 19  DG  B N3    1 
ATOM   2737 C  C4    . DG  B 2 19  ? -6.871  11.986  16.956  1.00 41.50  ? 19  DG  B C4    1 
ATOM   2738 P  P     . DG  B 2 20  ? -11.148 15.700  19.438  1.00 55.50  ? 20  DG  B P     1 
ATOM   2739 O  OP1   . DG  B 2 20  ? -12.478 16.337  19.564  1.00 59.12  ? 20  DG  B OP1   1 
ATOM   2740 O  OP2   . DG  B 2 20  ? -9.888  16.473  19.647  1.00 53.74  ? 20  DG  B OP2   1 
ATOM   2741 O  "O5'" . DG  B 2 20  ? -10.987 14.576  20.544  1.00 53.98  ? 20  DG  B "O5'" 1 
ATOM   2742 C  "C5'" . DG  B 2 20  ? -11.682 13.333  20.489  1.00 52.45  ? 20  DG  B "C5'" 1 
ATOM   2743 C  "C4'" . DG  B 2 20  ? -11.124 12.482  21.603  1.00 51.74  ? 20  DG  B "C4'" 1 
ATOM   2744 O  "O4'" . DG  B 2 20  ? -9.801  12.066  21.201  1.00 49.74  ? 20  DG  B "O4'" 1 
ATOM   2745 C  "C3'" . DG  B 2 20  ? -10.929 13.227  22.928  1.00 51.73  ? 20  DG  B "C3'" 1 
ATOM   2746 O  "O3'" . DG  B 2 20  ? -11.139 12.269  23.974  1.00 52.47  ? 20  DG  B "O3'" 1 
ATOM   2747 C  "C2'" . DG  B 2 20  ? -9.514  13.767  22.790  1.00 50.48  ? 20  DG  B "C2'" 1 
ATOM   2748 C  "C1'" . DG  B 2 20  ? -8.842  12.609  22.099  1.00 49.02  ? 20  DG  B "C1'" 1 
ATOM   2749 N  N9    . DG  B 2 20  ? -7.633  12.903  21.340  1.00 47.05  ? 20  DG  B N9    1 
ATOM   2750 C  C8    . DG  B 2 20  ? -7.429  13.931  20.456  1.00 46.31  ? 20  DG  B C8    1 
ATOM   2751 N  N7    . DG  B 2 20  ? -6.255  13.888  19.885  1.00 45.12  ? 20  DG  B N7    1 
ATOM   2752 C  C5    . DG  B 2 20  ? -5.646  12.769  20.435  1.00 44.49  ? 20  DG  B C5    1 
ATOM   2753 C  C6    . DG  B 2 20  ? -4.341  12.243  20.242  1.00 43.04  ? 20  DG  B C6    1 
ATOM   2754 O  O6    . DG  B 2 20  ? -3.442  12.661  19.509  1.00 42.78  ? 20  DG  B O6    1 
ATOM   2755 N  N1    . DG  B 2 20  ? -4.134  11.100  21.002  1.00 43.57  ? 20  DG  B N1    1 
ATOM   2756 C  C2    . DG  B 2 20  ? -5.051  10.547  21.861  1.00 44.43  ? 20  DG  B C2    1 
ATOM   2757 N  N2    . DG  B 2 20  ? -4.660  9.456   22.517  1.00 44.60  ? 20  DG  B N2    1 
ATOM   2758 N  N3    . DG  B 2 20  ? -6.260  11.040  22.068  1.00 45.17  ? 20  DG  B N3    1 
ATOM   2759 C  C4    . DG  B 2 20  ? -6.488  12.144  21.326  1.00 45.38  ? 20  DG  B C4    1 
ATOM   2760 P  P     . DA  B 2 21  ? -10.603 12.527  25.447  1.00 54.24  ? 21  DA  B P     1 
ATOM   2761 O  OP1   . DA  B 2 21  ? -11.519 11.851  26.387  1.00 56.49  ? 21  DA  B OP1   1 
ATOM   2762 O  OP2   . DA  B 2 21  ? -10.247 13.977  25.598  1.00 52.23  ? 21  DA  B OP2   1 
ATOM   2763 O  "O5'" . DA  B 2 21  ? -9.236  11.718  25.496  1.00 54.18  ? 21  DA  B "O5'" 1 
ATOM   2764 C  "C5'" . DA  B 2 21  ? -9.161  10.293  25.300  1.00 54.45  ? 21  DA  B "C5'" 1 
ATOM   2765 C  "C4'" . DA  B 2 21  ? -7.915  9.755   25.969  1.00 54.40  ? 21  DA  B "C4'" 1 
ATOM   2766 O  "O4'" . DA  B 2 21  ? -6.729  10.116  25.222  1.00 52.30  ? 21  DA  B "O4'" 1 
ATOM   2767 C  "C3'" . DA  B 2 21  ? -7.677  10.265  27.391  1.00 55.76  ? 21  DA  B "C3'" 1 
ATOM   2768 O  "O3'" . DA  B 2 21  ? -7.173  9.116   28.070  1.00 57.91  ? 21  DA  B "O3'" 1 
ATOM   2769 C  "C2'" . DA  B 2 21  ? -6.717  11.431  27.204  1.00 54.38  ? 21  DA  B "C2'" 1 
ATOM   2770 C  "C1'" . DA  B 2 21  ? -5.891  10.970  26.006  1.00 52.37  ? 21  DA  B "C1'" 1 
ATOM   2771 N  N9    . DA  B 2 21  ? -5.371  12.013  25.121  1.00 50.41  ? 21  DA  B N9    1 
ATOM   2772 C  C8    . DA  B 2 21  ? -6.029  13.089  24.582  1.00 49.30  ? 21  DA  B C8    1 
ATOM   2773 N  N7    . DA  B 2 21  ? -5.292  13.800  23.762  1.00 48.17  ? 21  DA  B N7    1 
ATOM   2774 C  C5    . DA  B 2 21  ? -4.068  13.146  23.758  1.00 46.80  ? 21  DA  B C5    1 
ATOM   2775 C  C6    . DA  B 2 21  ? -2.865  13.401  23.089  1.00 45.18  ? 21  DA  B C6    1 
ATOM   2776 N  N6    . DA  B 2 21  ? -2.682  14.434  22.274  1.00 44.39  ? 21  DA  B N6    1 
ATOM   2777 N  N1    . DA  B 2 21  ? -1.830  12.566  23.312  1.00 45.51  ? 21  DA  B N1    1 
ATOM   2778 C  C2    . DA  B 2 21  ? -2.017  11.519  24.118  1.00 47.21  ? 21  DA  B C2    1 
ATOM   2779 N  N3    . DA  B 2 21  ? -3.107  11.159  24.788  1.00 48.08  ? 21  DA  B N3    1 
ATOM   2780 C  C4    . DA  B 2 21  ? -4.107  12.034  24.573  1.00 48.72  ? 21  DA  B C4    1 
ATOM   2781 P  P     . DT  B 2 22  ? -6.661  9.183   29.576  1.00 59.27  ? 22  DT  B P     1 
ATOM   2782 O  OP1   . DT  B 2 22  ? -6.830  7.830   30.139  1.00 60.06  ? 22  DT  B OP1   1 
ATOM   2783 O  OP2   . DT  B 2 22  ? -7.138  10.437  30.223  1.00 56.70  ? 22  DT  B OP2   1 
ATOM   2784 O  "O5'" . DT  B 2 22  ? -5.096  9.301   29.378  1.00 58.48  ? 22  DT  B "O5'" 1 
ATOM   2785 C  "C5'" . DT  B 2 22  ? -4.342  8.261   28.738  1.00 57.65  ? 22  DT  B "C5'" 1 
ATOM   2786 C  "C4'" . DT  B 2 22  ? -2.916  8.748   28.727  1.00 57.27  ? 22  DT  B "C4'" 1 
ATOM   2787 O  "O4'" . DT  B 2 22  ? -2.818  9.869   27.817  1.00 54.75  ? 22  DT  B "O4'" 1 
ATOM   2788 C  "C3'" . DT  B 2 22  ? -2.445  9.265   30.099  1.00 58.14  ? 22  DT  B "C3'" 1 
ATOM   2789 O  "O3'" . DT  B 2 22  ? -1.391  8.384   30.504  1.00 61.81  ? 22  DT  B "O3'" 1 
ATOM   2790 C  "C2'" . DT  B 2 22  ? -2.147  10.737  29.872  1.00 56.08  ? 22  DT  B "C2'" 1 
ATOM   2791 C  "C1'" . DT  B 2 22  ? -1.896  10.774  28.383  1.00 54.07  ? 22  DT  B "C1'" 1 
ATOM   2792 N  N1    . DT  B 2 22  ? -2.046  12.088  27.714  1.00 51.57  ? 22  DT  B N1    1 
ATOM   2793 C  C2    . DT  B 2 22  ? -0.977  12.527  26.964  1.00 49.20  ? 22  DT  B C2    1 
ATOM   2794 O  O2    . DT  B 2 22  ? 0.035   11.874  26.797  1.00 48.90  ? 22  DT  B O2    1 
ATOM   2795 N  N3    . DT  B 2 22  ? -1.135  13.772  26.418  1.00 48.44  ? 22  DT  B N3    1 
ATOM   2796 C  C4    . DT  B 2 22  ? -2.236  14.588  26.514  1.00 47.85  ? 22  DT  B C4    1 
ATOM   2797 O  O4    . DT  B 2 22  ? -2.246  15.657  25.924  1.00 47.39  ? 22  DT  B O4    1 
ATOM   2798 C  C5    . DT  B 2 22  ? -3.322  14.072  27.317  1.00 49.23  ? 22  DT  B C5    1 
ATOM   2799 C  C7    . DT  B 2 22  ? -4.556  14.903  27.491  1.00 49.63  ? 22  DT  B C7    1 
ATOM   2800 C  C6    . DT  B 2 22  ? -3.169  12.867  27.882  1.00 49.99  ? 22  DT  B C6    1 
ATOM   2801 P  P     . DA  B 2 23  ? -0.370  8.725   31.705  1.00 62.85  ? 23  DA  B P     1 
ATOM   2802 O  OP1   . DA  B 2 23  ? 0.208   7.439   32.134  1.00 62.40  ? 23  DA  B OP1   1 
ATOM   2803 O  OP2   . DA  B 2 23  ? -1.064  9.608   32.688  1.00 63.38  ? 23  DA  B OP2   1 
ATOM   2804 O  "O5'" . DA  B 2 23  ? 0.754   9.576   30.943  1.00 63.25  ? 23  DA  B "O5'" 1 
ATOM   2805 C  "C5'" . DA  B 2 23  ? 1.336   9.111   29.675  1.00 62.66  ? 23  DA  B "C5'" 1 
ATOM   2806 C  "C4'" . DA  B 2 23  ? 2.704   9.710   29.418  1.00 64.26  ? 23  DA  B "C4'" 1 
ATOM   2807 O  "O4'" . DA  B 2 23  ? 2.613   10.966  28.689  1.00 61.35  ? 23  DA  B "O4'" 1 
ATOM   2808 C  "C3'" . DA  B 2 23  ? 3.502   10.040  30.677  1.00 68.10  ? 23  DA  B "C3'" 1 
ATOM   2809 O  "O3'" . DA  B 2 23  ? 4.874   9.867   30.317  1.00 73.88  ? 23  DA  B "O3'" 1 
ATOM   2810 C  "C2'" . DA  B 2 23  ? 3.086   11.473  30.970  1.00 65.38  ? 23  DA  B "C2'" 1 
ATOM   2811 C  "C1'" . DA  B 2 23  ? 2.977   12.046  29.554  1.00 62.24  ? 23  DA  B "C1'" 1 
ATOM   2812 N  N9    . DA  B 2 23  ? 1.996   13.126  29.387  1.00 58.80  ? 23  DA  B N9    1 
ATOM   2813 C  C8    . DA  B 2 23  ? 0.761   13.273  29.970  1.00 56.13  ? 23  DA  B C8    1 
ATOM   2814 N  N7    . DA  B 2 23  ? 0.136   14.366  29.609  1.00 54.42  ? 23  DA  B N7    1 
ATOM   2815 C  C5    . DA  B 2 23  ? 1.027   14.997  28.755  1.00 53.23  ? 23  DA  B C5    1 
ATOM   2816 C  C6    . DA  B 2 23  ? 0.951   16.195  28.023  1.00 51.22  ? 23  DA  B C6    1 
ATOM   2817 N  N6    . DA  B 2 23  ? -0.089  17.021  28.069  1.00 50.36  ? 23  DA  B N6    1 
ATOM   2818 N  N1    . DA  B 2 23  ? 2.013   16.536  27.262  1.00 50.66  ? 23  DA  B N1    1 
ATOM   2819 C  C2    . DA  B 2 23  ? 3.063   15.706  27.219  1.00 52.13  ? 23  DA  B C2    1 
ATOM   2820 N  N3    . DA  B 2 23  ? 3.238   14.536  27.831  1.00 53.64  ? 23  DA  B N3    1 
ATOM   2821 C  C4    . DA  B 2 23  ? 2.175   14.241  28.603  1.00 55.55  ? 23  DA  B C4    1 
ATOM   2822 P  P     . DC  B 2 24  ? 6.077   10.139  31.395  1.00 83.72  ? 24  DC  B P     1 
ATOM   2823 O  OP1   . DC  B 2 24  ? 6.901   8.903   31.415  1.00 84.08  ? 24  DC  B OP1   1 
ATOM   2824 O  OP2   . DC  B 2 24  ? 5.527   10.719  32.731  1.00 76.92  ? 24  DC  B OP2   1 
ATOM   2825 O  "O5'" . DC  B 2 24  ? 6.982   11.195  30.595  1.00 84.13  ? 24  DC  B "O5'" 1 
ATOM   2826 C  "C5'" . DC  B 2 24  ? 6.914   11.484  29.147  1.00 80.59  ? 24  DC  B "C5'" 1 
ATOM   2827 C  "C4'" . DC  B 2 24  ? 7.459   12.871  28.848  1.00 81.11  ? 24  DC  B "C4'" 1 
ATOM   2828 O  "O4'" . DC  B 2 24  ? 6.387   13.861  28.826  1.00 79.56  ? 24  DC  B "O4'" 1 
ATOM   2829 C  "C3'" . DC  B 2 24  ? 8.488   13.419  29.859  1.00 85.02  ? 24  DC  B "C3'" 1 
ATOM   2830 O  "O3'" . DC  B 2 24  ? 9.530   14.161  29.178  1.00 86.06  ? 24  DC  B "O3'" 1 
ATOM   2831 C  "C2'" . DC  B 2 24  ? 7.632   14.279  30.788  1.00 82.38  ? 24  DC  B "C2'" 1 
ATOM   2832 C  "C1'" . DC  B 2 24  ? 6.702   14.912  29.760  1.00 79.32  ? 24  DC  B "C1'" 1 
ATOM   2833 N  N1    . DC  B 2 24  ? 5.433   15.540  30.216  1.00 76.60  ? 24  DC  B N1    1 
ATOM   2834 C  C2    . DC  B 2 24  ? 5.034   16.744  29.610  1.00 72.58  ? 24  DC  B C2    1 
ATOM   2835 O  O2    . DC  B 2 24  ? 5.758   17.245  28.734  1.00 71.44  ? 24  DC  B O2    1 
ATOM   2836 N  N3    . DC  B 2 24  ? 3.874   17.328  29.996  1.00 68.09  ? 24  DC  B N3    1 
ATOM   2837 C  C4    . DC  B 2 24  ? 3.102   16.737  30.910  1.00 67.55  ? 24  DC  B C4    1 
ATOM   2838 N  N4    . DC  B 2 24  ? 1.960   17.338  31.238  1.00 64.93  ? 24  DC  B N4    1 
ATOM   2839 C  C5    . DC  B 2 24  ? 3.490   15.525  31.557  1.00 70.46  ? 24  DC  B C5    1 
ATOM   2840 C  C6    . DC  B 2 24  ? 4.652   14.965  31.183  1.00 74.46  ? 24  DC  B C6    1 
ATOM   2841 P  P     . DC  B 2 25  ? 10.988  14.448  29.881  1.00 91.41  ? 25  DC  B P     1 
ATOM   2842 O  OP1   . DC  B 2 25  ? 11.990  13.641  29.140  1.00 88.18  ? 25  DC  B OP1   1 
ATOM   2843 O  OP2   . DC  B 2 25  ? 10.861  14.315  31.398  1.00 88.66  ? 25  DC  B OP2   1 
ATOM   2844 O  "O5'" . DC  B 2 25  ? 11.322  15.969  29.487  1.00 92.34  ? 25  DC  B "O5'" 1 
ATOM   2845 C  "C5'" . DC  B 2 25  ? 10.297  16.959  29.183  1.00 92.40  ? 25  DC  B "C5'" 1 
ATOM   2846 C  "C4'" . DC  B 2 25  ? 10.579  18.321  29.786  1.00 95.62  ? 25  DC  B "C4'" 1 
ATOM   2847 O  "O4'" . DC  B 2 25  ? 9.303   18.958  30.043  1.00 95.22  ? 25  DC  B "O4'" 1 
ATOM   2848 C  "C3'" . DC  B 2 25  ? 11.371  18.343  31.105  1.00 100.61 ? 25  DC  B "C3'" 1 
ATOM   2849 O  "O3'" . DC  B 2 25  ? 12.647  18.987  30.957  1.00 102.59 ? 25  DC  B "O3'" 1 
ATOM   2850 C  "C2'" . DC  B 2 25  ? 10.508  19.115  32.097  1.00 100.69 ? 25  DC  B "C2'" 1 
ATOM   2851 C  "C1'" . DC  B 2 25  ? 9.241   19.535  31.345  1.00 98.19  ? 25  DC  B "C1'" 1 
ATOM   2852 N  N1    . DC  B 2 25  ? 7.922   19.185  31.948  1.00 96.26  ? 25  DC  B N1    1 
ATOM   2853 C  C2    . DC  B 2 25  ? 6.823   20.008  31.673  1.00 91.07  ? 25  DC  B C2    1 
ATOM   2854 O  O2    . DC  B 2 25  ? 6.981   20.996  30.949  1.00 87.11  ? 25  DC  B O2    1 
ATOM   2855 N  N3    . DC  B 2 25  ? 5.620   19.713  32.216  1.00 90.98  ? 25  DC  B N3    1 
ATOM   2856 C  C4    . DC  B 2 25  ? 5.483   18.631  32.985  1.00 92.56  ? 25  DC  B C4    1 
ATOM   2857 N  N4    . DC  B 2 25  ? 4.275   18.369  33.483  1.00 89.97  ? 25  DC  B N4    1 
ATOM   2858 C  C5    . DC  B 2 25  ? 6.583   17.772  33.281  1.00 95.59  ? 25  DC  B C5    1 
ATOM   2859 C  C6    . DC  B 2 25  ? 7.772   18.081  32.745  1.00 97.59  ? 25  DC  B C6    1 
ATOM   2860 O  "O5'" . DG  C 3 1   ? -2.600  25.985  30.766  1.00 47.69  ? 1   DG  C "O5'" 1 
ATOM   2861 C  "C5'" . DG  C 3 1   ? -2.267  27.320  30.379  1.00 48.72  ? 1   DG  C "C5'" 1 
ATOM   2862 C  "C4'" . DG  C 3 1   ? -0.782  27.560  30.568  1.00 48.14  ? 1   DG  C "C4'" 1 
ATOM   2863 O  "O4'" . DG  C 3 1   ? -0.174  26.580  31.447  1.00 46.00  ? 1   DG  C "O4'" 1 
ATOM   2864 C  "C3'" . DG  C 3 1   ? 0.061   27.526  29.291  1.00 47.61  ? 1   DG  C "C3'" 1 
ATOM   2865 O  "O3'" . DG  C 3 1   ? 1.152   28.462  29.391  1.00 47.01  ? 1   DG  C "O3'" 1 
ATOM   2866 C  "C2'" . DG  C 3 1   ? 0.616   26.118  29.278  1.00 45.99  ? 1   DG  C "C2'" 1 
ATOM   2867 C  "C1'" . DG  C 3 1   ? 0.874   25.901  30.745  1.00 44.65  ? 1   DG  C "C1'" 1 
ATOM   2868 N  N9    . DG  C 3 1   ? 0.852   24.508  31.160  1.00 42.73  ? 1   DG  C N9    1 
ATOM   2869 C  C8    . DG  C 3 1   ? -0.201  23.797  31.689  1.00 43.37  ? 1   DG  C C8    1 
ATOM   2870 N  N7    . DG  C 3 1   ? 0.132   22.590  32.059  1.00 42.14  ? 1   DG  C N7    1 
ATOM   2871 C  C5    . DG  C 3 1   ? 1.492   22.519  31.797  1.00 39.87  ? 1   DG  C C5    1 
ATOM   2872 C  C6    . DG  C 3 1   ? 2.412   21.482  32.040  1.00 38.72  ? 1   DG  C C6    1 
ATOM   2873 O  O6    . DG  C 3 1   ? 2.200   20.364  32.488  1.00 38.64  ? 1   DG  C O6    1 
ATOM   2874 N  N1    . DG  C 3 1   ? 3.693   21.832  31.639  1.00 39.88  ? 1   DG  C N1    1 
ATOM   2875 C  C2    . DG  C 3 1   ? 4.046   23.042  31.094  1.00 39.67  ? 1   DG  C C2    1 
ATOM   2876 N  N2    . DG  C 3 1   ? 5.338   23.195  30.771  1.00 39.95  ? 1   DG  C N2    1 
ATOM   2877 N  N3    . DG  C 3 1   ? 3.203   24.041  30.915  1.00 39.32  ? 1   DG  C N3    1 
ATOM   2878 C  C4    . DG  C 3 1   ? 1.948   23.699  31.248  1.00 40.26  ? 1   DG  C C4    1 
ATOM   2879 P  P     . DG  C 3 2   ? 1.664   29.224  28.070  1.00 46.83  ? 2   DG  C P     1 
ATOM   2880 O  OP1   . DG  C 3 2   ? 2.446   30.438  28.453  1.00 45.30  ? 2   DG  C OP1   1 
ATOM   2881 O  OP2   . DG  C 3 2   ? 0.530   29.271  27.062  1.00 47.42  ? 2   DG  C OP2   1 
ATOM   2882 O  "O5'" . DG  C 3 2   ? 2.680   28.170  27.450  1.00 45.10  ? 2   DG  C "O5'" 1 
ATOM   2883 C  "C5'" . DG  C 3 2   ? 2.499   27.672  26.153  1.00 43.00  ? 2   DG  C "C5'" 1 
ATOM   2884 C  "C4'" . DG  C 3 2   ? 3.624   26.710  25.903  1.00 41.47  ? 2   DG  C "C4'" 1 
ATOM   2885 O  "O4'" . DG  C 3 2   ? 3.569   25.617  26.863  1.00 39.63  ? 2   DG  C "O4'" 1 
ATOM   2886 C  "C3'" . DG  C 3 2   ? 3.526   26.089  24.515  1.00 40.53  ? 2   DG  C "C3'" 1 
ATOM   2887 O  "O3'" . DG  C 3 2   ? 4.852   26.218  24.010  1.00 40.87  ? 2   DG  C "O3'" 1 
ATOM   2888 C  "C2'" . DG  C 3 2   ? 2.942   24.717  24.786  1.00 38.85  ? 2   DG  C "C2'" 1 
ATOM   2889 C  "C1'" . DG  C 3 2   ? 3.451   24.382  26.172  1.00 37.86  ? 2   DG  C "C1'" 1 
ATOM   2890 N  N9    . DG  C 3 2   ? 2.594   23.491  26.956  1.00 36.67  ? 2   DG  C N9    1 
ATOM   2891 C  C8    . DG  C 3 2   ? 1.245   23.590  27.185  1.00 36.27  ? 2   DG  C C8    1 
ATOM   2892 N  N7    . DG  C 3 2   ? 0.770   22.590  27.878  1.00 35.71  ? 2   DG  C N7    1 
ATOM   2893 C  C5    . DG  C 3 2   ? 1.876   21.801  28.146  1.00 34.31  ? 2   DG  C C5    1 
ATOM   2894 C  C6    . DG  C 3 2   ? 1.982   20.563  28.847  1.00 34.45  ? 2   DG  C C6    1 
ATOM   2895 O  O6    . DG  C 3 2   ? 1.101   19.932  29.451  1.00 33.83  ? 2   DG  C O6    1 
ATOM   2896 N  N1    . DG  C 3 2   ? 3.291   20.092  28.851  1.00 34.42  ? 2   DG  C N1    1 
ATOM   2897 C  C2    . DG  C 3 2   ? 4.354   20.709  28.231  1.00 34.90  ? 2   DG  C C2    1 
ATOM   2898 N  N2    . DG  C 3 2   ? 5.537   20.091  28.319  1.00 35.77  ? 2   DG  C N2    1 
ATOM   2899 N  N3    . DG  C 3 2   ? 4.261   21.841  27.557  1.00 35.55  ? 2   DG  C N3    1 
ATOM   2900 C  C4    . DG  C 3 2   ? 3.004   22.330  27.562  1.00 35.26  ? 2   DG  C C4    1 
ATOM   2901 P  P     . DT  C 3 3   ? 5.211   25.815  22.535  1.00 41.33  ? 3   DT  C P     1 
ATOM   2902 O  OP1   . DT  C 3 3   ? 6.358   26.652  22.129  1.00 42.03  ? 3   DT  C OP1   1 
ATOM   2903 O  OP2   . DT  C 3 3   ? 3.970   25.841  21.716  1.00 42.65  ? 3   DT  C OP2   1 
ATOM   2904 O  "O5'" . DT  C 3 3   ? 5.539   24.272  22.718  1.00 38.89  ? 3   DT  C "O5'" 1 
ATOM   2905 C  "C5'" . DT  C 3 3   ? 6.707   23.899  23.435  1.00 37.84  ? 3   DT  C "C5'" 1 
ATOM   2906 C  "C4'" . DT  C 3 3   ? 6.662   22.408  23.637  1.00 36.62  ? 3   DT  C "C4'" 1 
ATOM   2907 O  "O4'" . DT  C 3 3   ? 5.501   22.056  24.412  1.00 35.19  ? 3   DT  C "O4'" 1 
ATOM   2908 C  "C3'" . DT  C 3 3   ? 6.560   21.595  22.336  1.00 36.63  ? 3   DT  C "C3'" 1 
ATOM   2909 O  "O3'" . DT  C 3 3   ? 7.760   20.821  22.238  1.00 36.88  ? 3   DT  C "O3'" 1 
ATOM   2910 C  "C2'" . DT  C 3 3   ? 5.347   20.703  22.547  1.00 35.79  ? 3   DT  C "C2'" 1 
ATOM   2911 C  "C1'" . DT  C 3 3   ? 5.206   20.731  24.060  1.00 35.36  ? 3   DT  C "C1'" 1 
ATOM   2912 N  N1    . DT  C 3 3   ? 3.874   20.379  24.595  1.00 34.53  ? 3   DT  C N1    1 
ATOM   2913 C  C2    . DT  C 3 3   ? 3.783   19.203  25.304  1.00 34.48  ? 3   DT  C C2    1 
ATOM   2914 O  O2    . DT  C 3 3   ? 4.746   18.478  25.525  1.00 34.17  ? 3   DT  C O2    1 
ATOM   2915 N  N3    . DT  C 3 3   ? 2.516   18.895  25.737  1.00 33.95  ? 3   DT  C N3    1 
ATOM   2916 C  C4    . DT  C 3 3   ? 1.359   19.612  25.509  1.00 34.26  ? 3   DT  C C4    1 
ATOM   2917 O  O4    . DT  C 3 3   ? 0.305   19.233  25.995  1.00 34.98  ? 3   DT  C O4    1 
ATOM   2918 C  C5    . DT  C 3 3   ? 1.522   20.814  24.732  1.00 35.07  ? 3   DT  C C5    1 
ATOM   2919 C  C7    . DT  C 3 3   ? 0.317   21.646  24.422  1.00 35.71  ? 3   DT  C C7    1 
ATOM   2920 C  C6    . DT  C 3 3   ? 2.755   21.129  24.309  1.00 35.07  ? 3   DT  C C6    1 
ATOM   2921 P  P     . DA  C 3 4   ? 8.128   19.946  20.946  1.00 35.88  ? 4   DA  C P     1 
ATOM   2922 O  OP1   . DA  C 3 4   ? 9.595   20.059  20.775  1.00 37.12  ? 4   DA  C OP1   1 
ATOM   2923 O  OP2   . DA  C 3 4   ? 7.226   20.342  19.840  1.00 36.11  ? 4   DA  C OP2   1 
ATOM   2924 O  "O5'" . DA  C 3 4   ? 7.646   18.498  21.393  1.00 33.85  ? 4   DA  C "O5'" 1 
ATOM   2925 C  "C5'" . DA  C 3 4   ? 8.343   17.811  22.435  1.00 32.64  ? 4   DA  C "C5'" 1 
ATOM   2926 C  "C4'" . DA  C 3 4   ? 7.801   16.410  22.578  1.00 31.73  ? 4   DA  C "C4'" 1 
ATOM   2927 O  "O4'" . DA  C 3 4   ? 6.504   16.448  23.222  1.00 31.01  ? 4   DA  C "O4'" 1 
ATOM   2928 C  "C3'" . DA  C 3 4   ? 7.637   15.629  21.259  1.00 31.06  ? 4   DA  C "C3'" 1 
ATOM   2929 O  "O3'" . DA  C 3 4   ? 8.445   14.458  21.344  1.00 30.18  ? 4   DA  C "O3'" 1 
ATOM   2930 C  "C2'" . DA  C 3 4   ? 6.147   15.337  21.185  1.00 31.37  ? 4   DA  C "C2'" 1 
ATOM   2931 C  "C1'" . DA  C 3 4   ? 5.660   15.473  22.639  1.00 31.66  ? 4   DA  C "C1'" 1 
ATOM   2932 N  N9    . DA  C 3 4   ? 4.283   15.944  22.781  1.00 32.02  ? 4   DA  C N9    1 
ATOM   2933 C  C8    . DA  C 3 4   ? 3.774   17.087  22.217  1.00 32.70  ? 4   DA  C C8    1 
ATOM   2934 N  N7    . DA  C 3 4   ? 2.528   17.328  22.542  1.00 32.84  ? 4   DA  C N7    1 
ATOM   2935 C  C5    . DA  C 3 4   ? 2.193   16.279  23.386  1.00 32.62  ? 4   DA  C C5    1 
ATOM   2936 C  C6    . DA  C 3 4   ? 0.993   15.942  24.043  1.00 33.07  ? 4   DA  C C6    1 
ATOM   2937 N  N6    . DA  C 3 4   ? -0.113  16.684  23.980  1.00 33.82  ? 4   DA  C N6    1 
ATOM   2938 N  N1    . DA  C 3 4   ? 0.981   14.823  24.798  1.00 32.80  ? 4   DA  C N1    1 
ATOM   2939 C  C2    . DA  C 3 4   ? 2.106   14.088  24.870  1.00 33.31  ? 4   DA  C C2    1 
ATOM   2940 N  N3    . DA  C 3 4   ? 3.290   14.291  24.278  1.00 33.19  ? 4   DA  C N3    1 
ATOM   2941 C  C4    . DA  C 3 4   ? 3.261   15.410  23.533  1.00 32.54  ? 4   DA  C C4    1 
ATOM   2942 P  P     . DT  C 3 5   ? 8.433   13.322  20.206  1.00 30.22  ? 5   DT  C P     1 
ATOM   2943 O  OP1   . DT  C 3 5   ? 9.787   12.631  20.203  1.00 30.85  ? 5   DT  C OP1   1 
ATOM   2944 O  OP2   . DT  C 3 5   ? 7.937   13.914  18.941  1.00 30.34  ? 5   DT  C OP2   1 
ATOM   2945 O  "O5'" . DT  C 3 5   ? 7.306   12.332  20.749  1.00 30.12  ? 5   DT  C "O5'" 1 
ATOM   2946 C  "C5'" . DT  C 3 5   ? 7.391   11.817  22.100  1.00 30.57  ? 5   DT  C "C5'" 1 
ATOM   2947 C  "C4'" . DT  C 3 5   ? 6.174   11.003  22.469  1.00 30.73  ? 5   DT  C "C4'" 1 
ATOM   2948 O  "O4'" . DT  C 3 5   ? 5.002   11.845  22.582  1.00 30.59  ? 5   DT  C "O4'" 1 
ATOM   2949 C  "C3'" . DT  C 3 5   ? 5.803   9.885   21.497  1.00 31.54  ? 5   DT  C "C3'" 1 
ATOM   2950 O  "O3'" . DT  C 3 5   ? 5.840   8.645   22.216  1.00 32.75  ? 5   DT  C "O3'" 1 
ATOM   2951 C  "C2'" . DT  C 3 5   ? 4.392   10.234  21.043  1.00 30.93  ? 5   DT  C "C2'" 1 
ATOM   2952 C  "C1'" . DT  C 3 5   ? 3.890   11.079  22.175  1.00 30.86  ? 5   DT  C "C1'" 1 
ATOM   2953 N  N1    . DT  C 3 5   ? 2.842   12.015  21.794  1.00 31.26  ? 5   DT  C N1    1 
ATOM   2954 C  C2    . DT  C 3 5   ? 1.610   11.889  22.384  1.00 31.88  ? 5   DT  C C2    1 
ATOM   2955 O  O2    . DT  C 3 5   ? 1.328   10.980  23.142  1.00 32.10  ? 5   DT  C O2    1 
ATOM   2956 N  N3    . DT  C 3 5   ? 0.691   12.827  21.993  1.00 32.58  ? 5   DT  C N3    1 
ATOM   2957 C  C4    . DT  C 3 5   ? 0.894   13.875  21.121  1.00 33.16  ? 5   DT  C C4    1 
ATOM   2958 O  O4    . DT  C 3 5   ? -0.026  14.656  20.886  1.00 34.34  ? 5   DT  C O4    1 
ATOM   2959 C  C5    . DT  C 3 5   ? 2.217   13.940  20.529  1.00 32.23  ? 5   DT  C C5    1 
ATOM   2960 C  C7    . DT  C 3 5   ? 2.539   15.044  19.571  1.00 32.61  ? 5   DT  C C7    1 
ATOM   2961 C  C6    . DT  C 3 5   ? 3.116   13.033  20.913  1.00 31.21  ? 5   DT  C C6    1 
ATOM   2962 P  P     . DC  C 3 6   ? 5.509   7.263   21.479  1.00 33.27  ? 6   DC  C P     1 
ATOM   2963 O  OP1   . DC  C 3 6   ? 6.538   6.294   21.902  1.00 35.65  ? 6   DC  C OP1   1 
ATOM   2964 O  OP2   . DC  C 3 6   ? 5.374   7.513   20.045  1.00 33.20  ? 6   DC  C OP2   1 
ATOM   2965 O  "O5'" . DC  C 3 6   ? 4.086   6.862   22.091  1.00 33.57  ? 6   DC  C "O5'" 1 
ATOM   2966 C  "C5'" . DC  C 3 6   ? 3.734   7.210   23.458  1.00 34.34  ? 6   DC  C "C5'" 1 
ATOM   2967 C  "C4'" . DC  C 3 6   ? 2.323   6.815   23.831  1.00 35.10  ? 6   DC  C "C4'" 1 
ATOM   2968 O  "O4'" . DC  C 3 6   ? 1.421   7.888   23.453  1.00 34.57  ? 6   DC  C "O4'" 1 
ATOM   2969 C  "C3'" . DC  C 3 6   ? 1.768   5.532   23.197  1.00 36.17  ? 6   DC  C "C3'" 1 
ATOM   2970 O  "O3'" . DC  C 3 6   ? 1.089   4.697   24.157  1.00 37.65  ? 6   DC  C "O3'" 1 
ATOM   2971 C  "C2'" . DC  C 3 6   ? 0.830   6.052   22.117  1.00 35.40  ? 6   DC  C "C2'" 1 
ATOM   2972 C  "C1'" . DC  C 3 6   ? 0.384   7.406   22.639  1.00 34.97  ? 6   DC  C "C1'" 1 
ATOM   2973 N  N1    . DC  C 3 6   ? 0.118   8.437   21.616  1.00 34.29  ? 6   DC  C N1    1 
ATOM   2974 C  C2    . DC  C 3 6   ? -1.139  9.041   21.599  1.00 33.77  ? 6   DC  C C2    1 
ATOM   2975 O  O2    . DC  C 3 6   ? -1.997  8.652   22.400  1.00 34.43  ? 6   DC  C O2    1 
ATOM   2976 N  N3    . DC  C 3 6   ? -1.397  10.008  20.692  1.00 33.18  ? 6   DC  C N3    1 
ATOM   2977 C  C4    . DC  C 3 6   ? -0.438  10.416  19.863  1.00 33.30  ? 6   DC  C C4    1 
ATOM   2978 N  N4    . DC  C 3 6   ? -0.735  11.383  18.997  1.00 33.33  ? 6   DC  C N4    1 
ATOM   2979 C  C5    . DC  C 3 6   ? 0.860   9.817   19.856  1.00 32.82  ? 6   DC  C C5    1 
ATOM   2980 C  C6    . DC  C 3 6   ? 1.091   8.842   20.744  1.00 33.04  ? 6   DC  C C6    1 
ATOM   2981 P  P     . DC  C 3 7   ? 0.551   3.215   23.738  1.00 38.28  ? 7   DC  C P     1 
ATOM   2982 O  OP1   . DC  C 3 7   ? 0.442   2.469   24.996  1.00 39.76  ? 7   DC  C OP1   1 
ATOM   2983 O  OP2   . DC  C 3 7   ? 1.353   2.742   22.613  1.00 37.30  ? 7   DC  C OP2   1 
ATOM   2984 O  "O5'" . DC  C 3 7   ? -0.903  3.455   23.137  1.00 36.19  ? 7   DC  C "O5'" 1 
ATOM   2985 C  "C5'" . DC  C 3 7   ? -1.865  4.122   23.941  1.00 36.14  ? 7   DC  C "C5'" 1 
ATOM   2986 C  "C4'" . DC  C 3 7   ? -3.140  4.391   23.183  1.00 36.15  ? 7   DC  C "C4'" 1 
ATOM   2987 O  "O4'" . DC  C 3 7   ? -3.007  5.561   22.343  1.00 35.36  ? 7   DC  C "O4'" 1 
ATOM   2988 C  "C3'" . DC  C 3 7   ? -3.629  3.255   22.282  1.00 36.78  ? 7   DC  C "C3'" 1 
ATOM   2989 O  "O3'" . DC  C 3 7   ? -4.894  2.888   22.825  1.00 38.44  ? 7   DC  C "O3'" 1 
ATOM   2990 C  "C2'" . DC  C 3 7   ? -3.708  3.866   20.886  1.00 36.04  ? 7   DC  C "C2'" 1 
ATOM   2991 C  "C1'" . DC  C 3 7   ? -3.775  5.360   21.163  1.00 35.75  ? 7   DC  C "C1'" 1 
ATOM   2992 N  N1    . DC  C 3 7   ? -3.215  6.228   20.115  1.00 33.94  ? 7   DC  C N1    1 
ATOM   2993 C  C2    . DC  C 3 7   ? -4.021  7.225   19.572  1.00 33.64  ? 7   DC  C C2    1 
ATOM   2994 O  O2    . DC  C 3 7   ? -5.188  7.316   19.957  1.00 33.25  ? 7   DC  C O2    1 
ATOM   2995 N  N3    . DC  C 3 7   ? -3.501  8.068   18.636  1.00 32.87  ? 7   DC  C N3    1 
ATOM   2996 C  C4    . DC  C 3 7   ? -2.225  7.934   18.255  1.00 32.39  ? 7   DC  C C4    1 
ATOM   2997 N  N4    . DC  C 3 7   ? -1.749  8.782   17.345  1.00 31.63  ? 7   DC  C N4    1 
ATOM   2998 C  C5    . DC  C 3 7   ? -1.375  6.933   18.809  1.00 32.04  ? 7   DC  C C5    1 
ATOM   2999 C  C6    . DC  C 3 7   ? -1.898  6.131   19.753  1.00 32.92  ? 7   DC  C C6    1 
ATOM   3000 P  P     . DT  C 3 8   ? -5.608  1.562   22.412  1.00 39.28  ? 8   DT  C P     1 
ATOM   3001 O  OP1   . DT  C 3 8   ? -6.180  0.994   23.633  1.00 41.15  ? 8   DT  C OP1   1 
ATOM   3002 O  OP2   . DT  C 3 8   ? -4.704  0.755   21.531  1.00 38.10  ? 8   DT  C OP2   1 
ATOM   3003 O  "O5'" . DT  C 3 8   ? -6.838  2.080   21.544  1.00 40.38  ? 8   DT  C "O5'" 1 
ATOM   3004 C  "C5'" . DT  C 3 8   ? -7.679  3.158   22.015  1.00 41.10  ? 8   DT  C "C5'" 1 
ATOM   3005 C  "C4'" . DT  C 3 8   ? -8.422  3.767   20.846  1.00 41.26  ? 8   DT  C "C4'" 1 
ATOM   3006 O  "O4'" . DT  C 3 8   ? -7.559  4.628   20.075  1.00 39.18  ? 8   DT  C "O4'" 1 
ATOM   3007 C  "C3'" . DT  C 3 8   ? -9.008  2.764   19.847  1.00 41.80  ? 8   DT  C "C3'" 1 
ATOM   3008 O  "O3'" . DT  C 3 8   ? -10.420 2.844   19.967  1.00 44.43  ? 8   DT  C "O3'" 1 
ATOM   3009 C  "C2'" . DT  C 3 8   ? -8.540  3.247   18.481  1.00 39.97  ? 8   DT  C "C2'" 1 
ATOM   3010 C  "C1'" . DT  C 3 8   ? -8.013  4.636   18.741  1.00 39.06  ? 8   DT  C "C1'" 1 
ATOM   3011 N  N1    . DT  C 3 8   ? -6.888  5.040   17.907  1.00 37.57  ? 8   DT  C N1    1 
ATOM   3012 C  C2    . DT  C 3 8   ? -6.997  6.190   17.161  1.00 37.97  ? 8   DT  C C2    1 
ATOM   3013 O  O2    . DT  C 3 8   ? -8.020  6.841   17.090  1.00 39.09  ? 8   DT  C O2    1 
ATOM   3014 N  N3    . DT  C 3 8   ? -5.867  6.527   16.457  1.00 36.68  ? 8   DT  C N3    1 
ATOM   3015 C  C4    . DT  C 3 8   ? -4.676  5.830   16.410  1.00 35.29  ? 8   DT  C C4    1 
ATOM   3016 O  O4    . DT  C 3 8   ? -3.752  6.246   15.721  1.00 34.33  ? 8   DT  C O4    1 
ATOM   3017 C  C5    . DT  C 3 8   ? -4.619  4.651   17.247  1.00 35.79  ? 8   DT  C C5    1 
ATOM   3018 C  C7    . DT  C 3 8   ? -3.369  3.834   17.263  1.00 34.95  ? 8   DT  C C7    1 
ATOM   3019 C  C6    . DT  C 3 8   ? -5.715  4.319   17.943  1.00 36.98  ? 8   DT  C C6    1 
ATOM   3020 P  P     . DC  C 3 9   ? -11.361 1.909   19.096  1.00 47.18  ? 9   DC  C P     1 
ATOM   3021 O  OP1   . DC  C 3 9   ? -12.627 1.710   19.875  1.00 48.10  ? 9   DC  C OP1   1 
ATOM   3022 O  OP2   . DC  C 3 9   ? -10.563 0.726   18.641  1.00 44.83  ? 9   DC  C OP2   1 
ATOM   3023 O  "O5'" . DC  C 3 9   ? -11.588 2.815   17.803  1.00 46.58  ? 9   DC  C "O5'" 1 
ATOM   3024 C  "C5'" . DC  C 3 9   ? -12.102 4.156   17.925  1.00 47.22  ? 9   DC  C "C5'" 1 
ATOM   3025 C  "C4'" . DC  C 3 9   ? -11.989 4.851   16.589  1.00 46.77  ? 9   DC  C "C4'" 1 
ATOM   3026 O  "O4'" . DC  C 3 9   ? -10.592 4.985   16.294  1.00 44.48  ? 9   DC  C "O4'" 1 
ATOM   3027 C  "C3'" . DC  C 3 9   ? -12.594 4.109   15.375  1.00 47.63  ? 9   DC  C "C3'" 1 
ATOM   3028 O  "O3'" . DC  C 3 9   ? -13.746 4.733   14.790  1.00 49.59  ? 9   DC  C "O3'" 1 
ATOM   3029 C  "C2'" . DC  C 3 9   ? -11.482 4.106   14.335  1.00 45.30  ? 9   DC  C "C2'" 1 
ATOM   3030 C  "C1'" . DC  C 3 9   ? -10.515 5.117   14.880  1.00 43.79  ? 9   DC  C "C1'" 1 
ATOM   3031 N  N1    . DC  C 3 9   ? -9.117  4.919   14.470  1.00 41.13  ? 9   DC  C N1    1 
ATOM   3032 C  C2    . DC  C 3 9   ? -8.533  5.858   13.611  1.00 40.04  ? 9   DC  C C2    1 
ATOM   3033 O  O2    . DC  C 3 9   ? -9.213  6.816   13.220  1.00 39.24  ? 9   DC  C O2    1 
ATOM   3034 N  N3    . DC  C 3 9   ? -7.235  5.708   13.251  1.00 39.15  ? 9   DC  C N3    1 
ATOM   3035 C  C4    . DC  C 3 9   ? -6.540  4.656   13.692  1.00 39.00  ? 9   DC  C C4    1 
ATOM   3036 N  N4    . DC  C 3 9   ? -5.278  4.526   13.283  1.00 38.44  ? 9   DC  C N4    1 
ATOM   3037 C  C5    . DC  C 3 9   ? -7.113  3.685   14.569  1.00 39.28  ? 9   DC  C C5    1 
ATOM   3038 C  C6    . DC  C 3 9   ? -8.389  3.860   14.935  1.00 40.31  ? 9   DC  C C6    1 
ATOM   3039 P  P     . DC  C 3 10  ? -14.551 4.014   13.602  1.00 53.08  ? 10  DC  C P     1 
ATOM   3040 O  OP1   . DC  C 3 10  ? -15.986 4.366   13.761  1.00 54.53  ? 10  DC  C OP1   1 
ATOM   3041 O  OP2   . DC  C 3 10  ? -14.162 2.593   13.524  1.00 51.72  ? 10  DC  C OP2   1 
ATOM   3042 O  "O5'" . DC  C 3 10  ? -13.891 4.615   12.285  1.00 50.60  ? 10  DC  C "O5'" 1 
ATOM   3043 C  "C5'" . DC  C 3 10  ? -13.730 6.027   12.134  1.00 51.67  ? 10  DC  C "C5'" 1 
ATOM   3044 C  "C4'" . DC  C 3 10  ? -13.490 6.364   10.681  1.00 52.34  ? 10  DC  C "C4'" 1 
ATOM   3045 O  "O4'" . DC  C 3 10  ? -12.064 6.436   10.472  1.00 51.69  ? 10  DC  C "O4'" 1 
ATOM   3046 C  "C3'" . DC  C 3 10  ? -13.994 5.330   9.669   1.00 54.25  ? 10  DC  C "C3'" 1 
ATOM   3047 O  "O3'" . DC  C 3 10  ? -14.395 5.919   8.434   1.00 56.32  ? 10  DC  C "O3'" 1 
ATOM   3048 C  "C2'" . DC  C 3 10  ? -12.762 4.496   9.382   1.00 51.78  ? 10  DC  C "C2'" 1 
ATOM   3049 C  "C1'" . DC  C 3 10  ? -11.706 5.574   9.411   1.00 49.60  ? 10  DC  C "C1'" 1 
ATOM   3050 N  N1    . DC  C 3 10  ? -10.362 5.094   9.666   1.00 47.33  ? 10  DC  C N1    1 
ATOM   3051 C  C2    . DC  C 3 10  ? -9.342  5.525   8.819   1.00 45.69  ? 10  DC  C C2    1 
ATOM   3052 O  O2    . DC  C 3 10  ? -9.625  6.301   7.899   1.00 46.93  ? 10  DC  C O2    1 
ATOM   3053 N  N3    . DC  C 3 10  ? -8.079  5.078   9.014   1.00 42.73  ? 10  DC  C N3    1 
ATOM   3054 C  C4    . DC  C 3 10  ? -7.819  4.242   10.023  1.00 43.30  ? 10  DC  C C4    1 
ATOM   3055 N  N4    . DC  C 3 10  ? -6.556  3.839   10.193  1.00 41.64  ? 10  DC  C N4    1 
ATOM   3056 C  C5    . DC  C 3 10  ? -8.842  3.798   10.920  1.00 45.13  ? 10  DC  C C5    1 
ATOM   3057 C  C6    . DC  C 3 10  ? -10.086 4.254   10.712  1.00 47.20  ? 10  DC  C C6    1 
ATOM   3058 P  P     . DA  C 3 11  ? -15.899 6.461   8.284   1.00 61.22  ? 11  DA  C P     1 
ATOM   3059 O  OP1   . DA  C 3 11  ? -16.157 7.364   9.429   1.00 63.28  ? 11  DA  C OP1   1 
ATOM   3060 O  OP2   . DA  C 3 11  ? -16.774 5.295   8.104   1.00 61.81  ? 11  DA  C OP2   1 
ATOM   3061 O  "O5'" . DA  C 3 11  ? -15.785 7.438   7.029   1.00 59.25  ? 11  DA  C "O5'" 1 
ATOM   3062 C  "C5'" . DA  C 3 11  ? -14.866 8.563   7.037   1.00 56.38  ? 11  DA  C "C5'" 1 
ATOM   3063 C  "C4'" . DA  C 3 11  ? -14.431 8.905   5.630   1.00 54.96  ? 11  DA  C "C4'" 1 
ATOM   3064 O  "O4'" . DA  C 3 11  ? -13.106 8.392   5.339   1.00 52.27  ? 11  DA  C "O4'" 1 
ATOM   3065 C  "C3'" . DA  C 3 11  ? -15.330 8.361   4.521   1.00 55.92  ? 11  DA  C "C3'" 1 
ATOM   3066 O  "O3'" . DA  C 3 11  ? -15.361 9.365   3.506   1.00 57.05  ? 11  DA  C "O3'" 1 
ATOM   3067 C  "C2'" . DA  C 3 11  ? -14.666 7.041   4.147   1.00 54.00  ? 11  DA  C "C2'" 1 
ATOM   3068 C  "C1'" . DA  C 3 11  ? -13.177 7.342   4.360   1.00 51.72  ? 11  DA  C "C1'" 1 
ATOM   3069 N  N9    . DA  C 3 11  ? -12.368 6.229   4.845   1.00 48.53  ? 11  DA  C N9    1 
ATOM   3070 C  C8    . DA  C 3 11  ? -12.714 5.269   5.765   1.00 48.81  ? 11  DA  C C8    1 
ATOM   3071 N  N7    . DA  C 3 11  ? -11.742 4.438   6.052   1.00 47.66  ? 11  DA  C N7    1 
ATOM   3072 C  C5    . DA  C 3 11  ? -10.680 4.886   5.277   1.00 45.79  ? 11  DA  C C5    1 
ATOM   3073 C  C6    . DA  C 3 11  ? -9.348  4.444   5.145   1.00 43.29  ? 11  DA  C C6    1 
ATOM   3074 N  N6    . DA  C 3 11  ? -8.859  3.380   5.777   1.00 40.99  ? 11  DA  C N6    1 
ATOM   3075 N  N1    . DA  C 3 11  ? -8.537  5.125   4.300   1.00 43.29  ? 11  DA  C N1    1 
ATOM   3076 C  C2    . DA  C 3 11  ? -9.038  6.186   3.652   1.00 44.08  ? 11  DA  C C2    1 
ATOM   3077 N  N3    . DA  C 3 11  ? -10.266 6.706   3.705   1.00 46.07  ? 11  DA  C N3    1 
ATOM   3078 C  C4    . DA  C 3 11  ? -11.047 6.002   4.544   1.00 47.08  ? 11  DA  C C4    1 
ATOM   3079 P  P     . DT  C 3 12  ? -16.019 9.087   2.082   1.00 60.00  ? 12  DT  C P     1 
ATOM   3080 O  OP1   . DT  C 3 12  ? -16.545 10.373  1.610   1.00 62.48  ? 12  DT  C OP1   1 
ATOM   3081 O  OP2   . DT  C 3 12  ? -16.932 7.905   2.179   1.00 59.02  ? 12  DT  C OP2   1 
ATOM   3082 O  "O5'" . DT  C 3 12  ? -14.759 8.702   1.185   1.00 58.35  ? 12  DT  C "O5'" 1 
ATOM   3083 C  "C5'" . DT  C 3 12  ? -13.586 9.536   1.177   1.00 57.55  ? 12  DT  C "C5'" 1 
ATOM   3084 C  "C4'" . DT  C 3 12  ? -12.487 8.835   0.415   1.00 56.39  ? 12  DT  C "C4'" 1 
ATOM   3085 O  "O4'" . DT  C 3 12  ? -12.024 7.676   1.146   1.00 55.06  ? 12  DT  C "O4'" 1 
ATOM   3086 C  "C3'" . DT  C 3 12  ? -12.893 8.332   -0.977  1.00 56.88  ? 12  DT  C "C3'" 1 
ATOM   3087 O  "O3'" . DT  C 3 12  ? -12.004 8.993   -1.883  1.00 57.57  ? 12  DT  C "O3'" 1 
ATOM   3088 C  "C2'" . DT  C 3 12  ? -12.775 6.814   -0.882  1.00 55.70  ? 12  DT  C "C2'" 1 
ATOM   3089 C  "C1'" . DT  C 3 12  ? -11.725 6.659   0.198   1.00 54.67  ? 12  DT  C "C1'" 1 
ATOM   3090 N  N1    . DT  C 3 12  ? -11.663 5.364   0.917   1.00 53.13  ? 12  DT  C N1    1 
ATOM   3091 C  C2    . DT  C 3 12  ? -10.458 4.691   0.963   1.00 50.52  ? 12  DT  C C2    1 
ATOM   3092 O  O2    . DT  C 3 12  ? -9.456  5.065   0.368   1.00 50.03  ? 12  DT  C O2    1 
ATOM   3093 N  N3    . DT  C 3 12  ? -10.481 3.530   1.699   1.00 48.95  ? 12  DT  C N3    1 
ATOM   3094 C  C4    . DT  C 3 12  ? -11.552 3.000   2.395   1.00 49.94  ? 12  DT  C C4    1 
ATOM   3095 O  O4    . DT  C 3 12  ? -11.415 1.956   3.020   1.00 48.00  ? 12  DT  C O4    1 
ATOM   3096 C  C5    . DT  C 3 12  ? -12.777 3.766   2.320   1.00 53.54  ? 12  DT  C C5    1 
ATOM   3097 C  C7    . DT  C 3 12  ? -13.986 3.277   3.056   1.00 54.68  ? 12  DT  C C7    1 
ATOM   3098 C  C6    . DT  C 3 12  ? -12.769 4.898   1.600   1.00 54.79  ? 12  DT  C C6    1 
ATOM   3099 P  P     . DT  C 3 13  ? -12.014 8.687   -3.457  1.00 59.61  ? 13  DT  C P     1 
ATOM   3100 O  OP1   . DT  C 3 13  ? -11.551 9.898   -4.168  1.00 60.64  ? 13  DT  C OP1   1 
ATOM   3101 O  OP2   . DT  C 3 13  ? -13.305 8.029   -3.802  1.00 60.76  ? 13  DT  C OP2   1 
ATOM   3102 O  "O5'" . DT  C 3 13  ? -10.819 7.659   -3.619  1.00 58.35  ? 13  DT  C "O5'" 1 
ATOM   3103 C  "C5'" . DT  C 3 13  ? -9.505  7.868   -3.022  1.00 57.42  ? 13  DT  C "C5'" 1 
ATOM   3104 C  "C4'" . DT  C 3 13  ? -8.601  6.752   -3.500  1.00 56.17  ? 13  DT  C "C4'" 1 
ATOM   3105 O  "O4'" . DT  C 3 13  ? -8.773  5.626   -2.598  1.00 54.17  ? 13  DT  C "O4'" 1 
ATOM   3106 C  "C3'" . DT  C 3 13  ? -8.987  6.250   -4.910  1.00 57.44  ? 13  DT  C "C3'" 1 
ATOM   3107 O  "O3'" . DT  C 3 13  ? -8.026  6.001   -5.948  1.00 56.72  ? 13  DT  C "O3'" 1 
ATOM   3108 C  "C2'" . DT  C 3 13  ? -9.686  4.930   -4.648  1.00 56.25  ? 13  DT  C "C2'" 1 
ATOM   3109 C  "C1'" . DT  C 3 13  ? -9.037  4.451   -3.357  1.00 54.22  ? 13  DT  C "C1'" 1 
ATOM   3110 N  N1    . DT  C 3 13  ? -9.862  3.533   -2.526  1.00 52.69  ? 13  DT  C N1    1 
ATOM   3111 C  C2    . DT  C 3 13  ? -9.233  2.513   -1.833  1.00 51.30  ? 13  DT  C C2    1 
ATOM   3112 O  O2    . DT  C 3 13  ? -8.020  2.346   -1.833  1.00 49.68  ? 13  DT  C O2    1 
ATOM   3113 N  N3    . DT  C 3 13  ? -10.078 1.708   -1.110  1.00 51.05  ? 13  DT  C N3    1 
ATOM   3114 C  C4    . DT  C 3 13  ? -11.453 1.823   -1.004  1.00 53.65  ? 13  DT  C C4    1 
ATOM   3115 O  O4    . DT  C 3 13  ? -12.080 1.027   -0.314  1.00 53.64  ? 13  DT  C O4    1 
ATOM   3116 C  C5    . DT  C 3 13  ? -12.046 2.898   -1.772  1.00 54.74  ? 13  DT  C C5    1 
ATOM   3117 C  C7    . DT  C 3 13  ? -13.528 3.086   -1.734  1.00 56.22  ? 13  DT  C C7    1 
ATOM   3118 C  C6    . DT  C 3 13  ? -11.231 3.688   -2.482  1.00 54.00  ? 13  DT  C C6    1 
ATOM   3119 P  P     . DA  C 3 14  ? -6.714  6.897   -6.154  1.00 58.29  ? 14  DA  C P     1 
ATOM   3120 O  OP1   . DA  C 3 14  ? -6.861  8.223   -5.441  1.00 57.26  ? 14  DA  C OP1   1 
ATOM   3121 O  OP2   . DA  C 3 14  ? -6.364  6.829   -7.593  1.00 58.80  ? 14  DA  C OP2   1 
ATOM   3122 O  "O5'" . DA  C 3 14  ? -5.650  6.043   -5.336  1.00 56.76  ? 14  DA  C "O5'" 1 
ATOM   3123 C  "C5'" . DA  C 3 14  ? -4.245  6.145   -5.524  1.00 52.99  ? 14  DA  C "C5'" 1 
ATOM   3124 C  "C4'" . DA  C 3 14  ? -3.649  4.758   -5.570  1.00 50.90  ? 14  DA  C "C4'" 1 
ATOM   3125 O  "O4'" . DA  C 3 14  ? -4.627  3.702   -5.335  1.00 48.31  ? 14  DA  C "O4'" 1 
ATOM   3126 C  "C3'" . DA  C 3 14  ? -3.094  4.459   -6.942  1.00 50.42  ? 14  DA  C "C3'" 1 
ATOM   3127 O  "O3'" . DA  C 3 14  ? -2.071  3.483   -6.838  1.00 48.93  ? 14  DA  C "O3'" 1 
ATOM   3128 C  "C2'" . DA  C 3 14  ? -4.294  3.864   -7.642  1.00 50.33  ? 14  DA  C "C2'" 1 
ATOM   3129 C  "C1'" . DA  C 3 14  ? -4.823  2.963   -6.534  1.00 49.04  ? 14  DA  C "C1'" 1 
ATOM   3130 N  N9    . DA  C 3 14  ? -6.241  2.648   -6.631  1.00 48.69  ? 14  DA  C N9    1 
ATOM   3131 C  C8    . DA  C 3 14  ? -7.192  3.239   -7.433  1.00 49.14  ? 14  DA  C C8    1 
ATOM   3132 N  N7    . DA  C 3 14  ? -8.406  2.797   -7.224  1.00 49.17  ? 14  DA  C N7    1 
ATOM   3133 C  C5    . DA  C 3 14  ? -8.248  1.857   -6.214  1.00 48.48  ? 14  DA  C C5    1 
ATOM   3134 C  C6    . DA  C 3 14  ? -9.167  1.064   -5.520  1.00 48.44  ? 14  DA  C C6    1 
ATOM   3135 N  N6    . DA  C 3 14  ? -10.477 1.063   -5.783  1.00 49.17  ? 14  DA  C N6    1 
ATOM   3136 N  N1    . DA  C 3 14  ? -8.691  0.250   -4.547  1.00 47.69  ? 14  DA  C N1    1 
ATOM   3137 C  C2    . DA  C 3 14  ? -7.373  0.253   -4.294  1.00 46.36  ? 14  DA  C C2    1 
ATOM   3138 N  N3    . DA  C 3 14  ? -6.412  0.979   -4.862  1.00 46.61  ? 14  DA  C N3    1 
ATOM   3139 C  C4    . DA  C 3 14  ? -6.922  1.767   -5.828  1.00 47.96  ? 14  DA  C C4    1 
ATOM   3140 P  P     . DT  C 3 15  ? -0.850  3.559   -7.861  1.00 51.81  ? 15  DT  C P     1 
ATOM   3141 O  OP1   . DT  C 3 15  ? 0.422   3.591   -7.054  1.00 52.69  ? 15  DT  C OP1   1 
ATOM   3142 O  OP2   . DT  C 3 15  ? -1.124  4.615   -8.903  1.00 49.95  ? 15  DT  C OP2   1 
ATOM   3143 O  "O5'" . DT  C 3 15  ? -0.709  2.088   -8.490  1.00 51.67  ? 15  DT  C "O5'" 1 
ATOM   3144 C  "C5'" . DT  C 3 15  ? -1.727  1.095   -8.501  1.00 48.60  ? 15  DT  C "C5'" 1 
ATOM   3145 C  "C4'" . DT  C 3 15  ? -1.887  0.429   -7.158  1.00 46.12  ? 15  DT  C "C4'" 1 
ATOM   3146 O  "O4'" . DT  C 3 15  ? -3.294  0.405   -6.878  1.00 46.71  ? 15  DT  C "O4'" 1 
ATOM   3147 C  "C3'" . DT  C 3 15  ? -1.494  -1.037  -7.120  1.00 44.49  ? 15  DT  C "C3'" 1 
ATOM   3148 O  "O3'" . DT  C 3 15  ? -1.442  -1.412  -5.754  1.00 41.31  ? 15  DT  C "O3'" 1 
ATOM   3149 C  "C2'" . DT  C 3 15  ? -2.694  -1.705  -7.763  1.00 43.87  ? 15  DT  C "C2'" 1 
ATOM   3150 C  "C1'" . DT  C 3 15  ? -3.803  -0.910  -7.116  1.00 45.75  ? 15  DT  C "C1'" 1 
ATOM   3151 N  N1    . DT  C 3 15  ? -5.052  -0.772  -7.883  1.00 46.02  ? 15  DT  C N1    1 
ATOM   3152 C  C2    . DT  C 3 15  ? -6.172  -1.337  -7.322  1.00 44.65  ? 15  DT  C C2    1 
ATOM   3153 O  O2    . DT  C 3 15  ? -6.138  -1.988  -6.293  1.00 43.51  ? 15  DT  C O2    1 
ATOM   3154 N  N3    . DT  C 3 15  ? -7.327  -1.156  -8.040  1.00 45.29  ? 15  DT  C N3    1 
ATOM   3155 C  C4    . DT  C 3 15  ? -7.472  -0.452  -9.223  1.00 47.06  ? 15  DT  C C4    1 
ATOM   3156 O  O4    . DT  C 3 15  ? -8.586  -0.337  -9.734  1.00 48.30  ? 15  DT  C O4    1 
ATOM   3157 C  C5    . DT  C 3 15  ? -6.255  0.141   -9.744  1.00 46.80  ? 15  DT  C C5    1 
ATOM   3158 C  C7    . DT  C 3 15  ? -6.318  0.936   -11.011 1.00 48.00  ? 15  DT  C C7    1 
ATOM   3159 C  C6    . DT  C 3 15  ? -5.120  -0.052  -9.060  1.00 45.95  ? 15  DT  C C6    1 
ATOM   3160 P  P     . DC  C 3 16  ? -0.117  -2.092  -5.155  1.00 40.03  ? 16  DC  C P     1 
ATOM   3161 O  OP1   . DC  C 3 16  ? -0.491  -2.827  -3.912  1.00 39.29  ? 16  DC  C OP1   1 
ATOM   3162 O  OP2   . DC  C 3 16  ? 0.933   -1.043  -5.119  1.00 40.40  ? 16  DC  C OP2   1 
ATOM   3163 O  "O5'" . DC  C 3 16  ? 0.195   -3.328  -6.122  1.00 38.83  ? 16  DC  C "O5'" 1 
ATOM   3164 C  "C5'" . DC  C 3 16  ? 0.229   -4.699  -5.653  1.00 38.01  ? 16  DC  C "C5'" 1 
ATOM   3165 C  "C4'" . DC  C 3 16  ? -1.149  -5.336  -5.596  1.00 38.58  ? 16  DC  C "C4'" 1 
ATOM   3166 O  "O4'" . DC  C 3 16  ? -2.159  -4.718  -6.443  1.00 38.26  ? 16  DC  C "O4'" 1 
ATOM   3167 C  "C3'" . DC  C 3 16  ? -1.186  -6.820  -5.973  1.00 38.46  ? 16  DC  C "C3'" 1 
ATOM   3168 O  "O3'" . DC  C 3 16  ? -1.883  -7.429  -4.901  1.00 39.19  ? 16  DC  C "O3'" 1 
ATOM   3169 C  "C2'" . DC  C 3 16  ? -1.941  -6.866  -7.300  1.00 37.52  ? 16  DC  C "C2'" 1 
ATOM   3170 C  "C1'" . DC  C 3 16  ? -2.917  -5.732  -7.124  1.00 37.51  ? 16  DC  C "C1'" 1 
ATOM   3171 N  N1    . DC  C 3 16  ? -3.433  -5.133  -8.365  1.00 37.25  ? 16  DC  C N1    1 
ATOM   3172 C  C2    . DC  C 3 16  ? -4.808  -4.885  -8.512  1.00 38.28  ? 16  DC  C C2    1 
ATOM   3173 O  O2    . DC  C 3 16  ? -5.588  -5.301  -7.652  1.00 39.77  ? 16  DC  C O2    1 
ATOM   3174 N  N3    . DC  C 3 16  ? -5.254  -4.281  -9.640  1.00 37.98  ? 16  DC  C N3    1 
ATOM   3175 C  C4    . DC  C 3 16  ? -4.377  -3.821  -10.539 1.00 38.02  ? 16  DC  C C4    1 
ATOM   3176 N  N4    . DC  C 3 16  ? -4.852  -3.188  -11.620 1.00 38.34  ? 16  DC  C N4    1 
ATOM   3177 C  C5    . DC  C 3 16  ? -2.975  -4.049  -10.406 1.00 37.52  ? 16  DC  C C5    1 
ATOM   3178 C  C6    . DC  C 3 16  ? -2.552  -4.705  -9.318  1.00 37.15  ? 16  DC  C C6    1 
ATOM   3179 P  P     . DA  C 3 17  ? -2.092  -9.003  -4.850  1.00 42.71  ? 17  DA  C P     1 
ATOM   3180 O  OP1   . DA  C 3 17  ? -2.515  -9.307  -3.444  1.00 43.85  ? 17  DA  C OP1   1 
ATOM   3181 O  OP2   . DA  C 3 17  ? -0.928  -9.712  -5.503  1.00 41.15  ? 17  DA  C OP2   1 
ATOM   3182 O  "O5'" . DA  C 3 17  ? -3.312  -9.234  -5.824  1.00 41.90  ? 17  DA  C "O5'" 1 
ATOM   3183 C  "C5'" . DA  C 3 17  ? -4.610  -8.763  -5.474  1.00 45.45  ? 17  DA  C "C5'" 1 
ATOM   3184 C  "C4'" . DA  C 3 17  ? -5.554  -9.251  -6.538  1.00 47.98  ? 17  DA  C "C4'" 1 
ATOM   3185 O  "O4'" . DA  C 3 17  ? -5.414  -8.423  -7.716  1.00 47.42  ? 17  DA  C "O4'" 1 
ATOM   3186 C  "C3'" . DA  C 3 17  ? -5.222  -10.679 -6.988  1.00 48.87  ? 17  DA  C "C3'" 1 
ATOM   3187 O  "O3'" . DA  C 3 17  ? -6.417  -11.332 -7.350  1.00 53.41  ? 17  DA  C "O3'" 1 
ATOM   3188 C  "C2'" . DA  C 3 17  ? -4.465  -10.492 -8.286  1.00 48.23  ? 17  DA  C "C2'" 1 
ATOM   3189 C  "C1'" . DA  C 3 17  ? -5.256  -9.322  -8.825  1.00 46.78  ? 17  DA  C "C1'" 1 
ATOM   3190 N  N9    . DA  C 3 17  ? -4.636  -8.587  -9.916  1.00 43.02  ? 17  DA  C N9    1 
ATOM   3191 C  C8    . DA  C 3 17  ? -3.326  -8.373  -10.289 1.00 41.14  ? 17  DA  C C8    1 
ATOM   3192 N  N7    . DA  C 3 17  ? -3.200  -7.595  -11.334 1.00 39.86  ? 17  DA  C N7    1 
ATOM   3193 C  C5    . DA  C 3 17  ? -4.510  -7.244  -11.641 1.00 40.97  ? 17  DA  C C5    1 
ATOM   3194 C  C6    . DA  C 3 17  ? -5.059  -6.454  -12.653 1.00 41.10  ? 17  DA  C C6    1 
ATOM   3195 N  N6    . DA  C 3 17  ? -4.325  -5.823  -13.572 1.00 41.04  ? 17  DA  C N6    1 
ATOM   3196 N  N1    . DA  C 3 17  ? -6.406  -6.304  -12.675 1.00 42.50  ? 17  DA  C N1    1 
ATOM   3197 C  C2    . DA  C 3 17  ? -7.138  -6.938  -11.746 1.00 43.29  ? 17  DA  C C2    1 
ATOM   3198 N  N3    . DA  C 3 17  ? -6.736  -7.732  -10.766 1.00 42.03  ? 17  DA  C N3    1 
ATOM   3199 C  C4    . DA  C 3 17  ? -5.399  -7.844  -10.771 1.00 41.16  ? 17  DA  C C4    1 
ATOM   3200 P  P     . DG  C 3 18  ? -6.779  -12.648 -6.623  1.00 55.87  ? 18  DG  C P     1 
ATOM   3201 O  OP1   . DG  C 3 18  ? -7.379  -12.220 -5.336  1.00 54.85  ? 18  DG  C OP1   1 
ATOM   3202 O  OP2   . DG  C 3 18  ? -5.543  -13.521 -6.665  1.00 50.97  ? 18  DG  C OP2   1 
ATOM   3203 O  "O5'" . DG  C 3 18  ? -7.925  -13.249 -7.550  1.00 53.25  ? 18  DG  C "O5'" 1 
ATOM   3204 C  "C5'" . DG  C 3 18  ? -9.081  -12.460 -7.898  1.00 51.04  ? 18  DG  C "C5'" 1 
ATOM   3205 C  "C4'" . DG  C 3 18  ? -9.259  -12.468 -9.399  1.00 49.43  ? 18  DG  C "C4'" 1 
ATOM   3206 O  "O4'" . DG  C 3 18  ? -8.326  -11.534 -10.013 1.00 47.00  ? 18  DG  C "O4'" 1 
ATOM   3207 C  "C3'" . DG  C 3 18  ? -8.995  -13.827 -10.077 1.00 47.97  ? 18  DG  C "C3'" 1 
ATOM   3208 O  "O3'" . DG  C 3 18  ? -10.152 -14.383 -10.696 1.00 49.57  ? 18  DG  C "O3'" 1 
ATOM   3209 C  "C2'" . DG  C 3 18  ? -7.901  -13.514 -11.084 1.00 45.87  ? 18  DG  C "C2'" 1 
ATOM   3210 C  "C1'" . DG  C 3 18  ? -8.149  -12.050 -11.305 1.00 44.52  ? 18  DG  C "C1'" 1 
ATOM   3211 N  N9    . DG  C 3 18  ? -7.074  -11.338 -11.974 1.00 42.19  ? 18  DG  C N9    1 
ATOM   3212 C  C8    . DG  C 3 18  ? -5.721  -11.540 -11.861 1.00 40.17  ? 18  DG  C C8    1 
ATOM   3213 N  N7    . DG  C 3 18  ? -5.026  -10.802 -12.684 1.00 40.20  ? 18  DG  C N7    1 
ATOM   3214 C  C5    . DG  C 3 18  ? -5.982  -10.128 -13.436 1.00 39.75  ? 18  DG  C C5    1 
ATOM   3215 C  C6    . DG  C 3 18  ? -5.833  -9.213  -14.512 1.00 39.84  ? 18  DG  C C6    1 
ATOM   3216 O  O6    . DG  C 3 18  ? -4.786  -8.784  -15.025 1.00 40.02  ? 18  DG  C O6    1 
ATOM   3217 N  N1    . DG  C 3 18  ? -7.069  -8.775  -14.987 1.00 40.18  ? 18  DG  C N1    1 
ATOM   3218 C  C2    . DG  C 3 18  ? -8.289  -9.147  -14.474 1.00 41.11  ? 18  DG  C C2    1 
ATOM   3219 N  N2    . DG  C 3 18  ? -9.370  -8.607  -15.047 1.00 41.09  ? 18  DG  C N2    1 
ATOM   3220 N  N3    . DG  C 3 18  ? -8.438  -9.989  -13.467 1.00 41.74  ? 18  DG  C N3    1 
ATOM   3221 C  C4    . DG  C 3 18  ? -7.250  -10.438 -13.001 1.00 41.41  ? 18  DG  C C4    1 
ATOM   3222 P  P     . DG  C 3 19  ? -10.080 -15.836 -11.403 1.00 50.75  ? 19  DG  C P     1 
ATOM   3223 O  OP1   . DG  C 3 19  ? -11.435 -16.226 -11.831 1.00 52.56  ? 19  DG  C OP1   1 
ATOM   3224 O  OP2   . DG  C 3 19  ? -9.312  -16.725 -10.517 1.00 53.76  ? 19  DG  C OP2   1 
ATOM   3225 O  "O5'" . DG  C 3 19  ? -9.146  -15.601 -12.668 1.00 50.71  ? 19  DG  C "O5'" 1 
ATOM   3226 C  "C5'" . DG  C 3 19  ? -9.574  -15.733 -14.044 1.00 48.74  ? 19  DG  C "C5'" 1 
ATOM   3227 C  "C4'" . DG  C 3 19  ? -10.278 -14.472 -14.499 1.00 47.56  ? 19  DG  C "C4'" 1 
ATOM   3228 O  "O4'" . DG  C 3 19  ? -9.498  -13.287 -14.235 1.00 46.09  ? 19  DG  C "O4'" 1 
ATOM   3229 C  "C3'" . DG  C 3 19  ? -10.564 -14.450 -15.989 1.00 46.70  ? 19  DG  C "C3'" 1 
ATOM   3230 O  "O3'" . DG  C 3 19  ? -11.940 -14.680 -16.121 1.00 47.83  ? 19  DG  C "O3'" 1 
ATOM   3231 C  "C2'" . DG  C 3 19  ? -10.395 -13.005 -16.404 1.00 45.79  ? 19  DG  C "C2'" 1 
ATOM   3232 C  "C1'" . DG  C 3 19  ? -9.435  -12.449 -15.386 1.00 43.44  ? 19  DG  C "C1'" 1 
ATOM   3233 N  N9    . DG  C 3 19  ? -8.036  -12.323 -15.800 1.00 39.26  ? 19  DG  C N9    1 
ATOM   3234 C  C8    . DG  C 3 19  ? -6.909  -12.759 -15.138 1.00 37.70  ? 19  DG  C C8    1 
ATOM   3235 N  N7    . DG  C 3 19  ? -5.799  -12.383 -15.713 1.00 35.39  ? 19  DG  C N7    1 
ATOM   3236 C  C5    . DG  C 3 19  ? -6.217  -11.668 -16.826 1.00 35.10  ? 19  DG  C C5    1 
ATOM   3237 C  C6    . DG  C 3 19  ? -5.464  -11.006 -17.821 1.00 33.74  ? 19  DG  C C6    1 
ATOM   3238 O  O6    . DG  C 3 19  ? -4.240  -10.936 -17.928 1.00 31.71  ? 19  DG  C O6    1 
ATOM   3239 N  N1    . DG  C 3 19  ? -6.286  -10.418 -18.783 1.00 34.07  ? 19  DG  C N1    1 
ATOM   3240 C  C2    . DG  C 3 19  ? -7.665  -10.435 -18.764 1.00 34.89  ? 19  DG  C C2    1 
ATOM   3241 N  N2    . DG  C 3 19  ? -8.288  -9.800  -19.768 1.00 34.69  ? 19  DG  C N2    1 
ATOM   3242 N  N3    . DG  C 3 19  ? -8.378  -11.032 -17.824 1.00 36.00  ? 19  DG  C N3    1 
ATOM   3243 C  C4    . DG  C 3 19  ? -7.596  -11.627 -16.896 1.00 36.70  ? 19  DG  C C4    1 
ATOM   3244 P  P     . DT  C 3 20  ? -12.444 -15.699 -17.192 1.00 49.33  ? 20  DT  C P     1 
ATOM   3245 O  OP1   . DT  C 3 20  ? -13.919 -15.816 -16.966 1.00 50.91  ? 20  DT  C OP1   1 
ATOM   3246 O  OP2   . DT  C 3 20  ? -11.517 -16.890 -17.219 1.00 46.87  ? 20  DT  C OP2   1 
ATOM   3247 O  "O5'" . DT  C 3 20  ? -12.251 -14.936 -18.575 1.00 45.60  ? 20  DT  C "O5'" 1 
ATOM   3248 C  "C5'" . DT  C 3 20  ? -13.002 -13.774 -18.825 1.00 43.83  ? 20  DT  C "C5'" 1 
ATOM   3249 C  "C4'" . DT  C 3 20  ? -12.617 -13.271 -20.190 1.00 42.85  ? 20  DT  C "C4'" 1 
ATOM   3250 O  "O4'" . DT  C 3 20  ? -11.241 -12.843 -20.192 1.00 40.84  ? 20  DT  C "O4'" 1 
ATOM   3251 C  "C3'" . DT  C 3 20  ? -12.724 -14.286 -21.321 1.00 42.34  ? 20  DT  C "C3'" 1 
ATOM   3252 O  "O3'" . DT  C 3 20  ? -13.210 -13.519 -22.432 1.00 42.92  ? 20  DT  C "O3'" 1 
ATOM   3253 C  "C2'" . DT  C 3 20  ? -11.287 -14.749 -21.499 1.00 40.10  ? 20  DT  C "C2'" 1 
ATOM   3254 C  "C1'" . DT  C 3 20  ? -10.559 -13.449 -21.267 1.00 39.05  ? 20  DT  C "C1'" 1 
ATOM   3255 N  N1    . DT  C 3 20  ? -9.156  -13.561 -20.877 1.00 36.95  ? 20  DT  C N1    1 
ATOM   3256 C  C2    . DT  C 3 20  ? -8.202  -12.955 -21.659 1.00 36.28  ? 20  DT  C C2    1 
ATOM   3257 O  O2    . DT  C 3 20  ? -8.460  -12.370 -22.696 1.00 38.19  ? 20  DT  C O2    1 
ATOM   3258 N  N3    . DT  C 3 20  ? -6.921  -13.096 -21.207 1.00 34.57  ? 20  DT  C N3    1 
ATOM   3259 C  C4    . DT  C 3 20  ? -6.509  -13.724 -20.056 1.00 34.27  ? 20  DT  C C4    1 
ATOM   3260 O  O4    . DT  C 3 20  ? -5.317  -13.744 -19.771 1.00 33.52  ? 20  DT  C O4    1 
ATOM   3261 C  C5    . DT  C 3 20  ? -7.566  -14.328 -19.268 1.00 34.96  ? 20  DT  C C5    1 
ATOM   3262 C  C7    . DT  C 3 20  ? -7.215  -15.065 -18.011 1.00 34.64  ? 20  DT  C C7    1 
ATOM   3263 C  C6    . DT  C 3 20  ? -8.822  -14.199 -19.705 1.00 35.80  ? 20  DT  C C6    1 
ATOM   3264 P  P     . DG  C 3 21  ? -13.604 -14.204 -23.805 1.00 43.06  ? 21  DG  C P     1 
ATOM   3265 O  OP1   . DG  C 3 21  ? -14.796 -13.466 -24.264 1.00 45.86  ? 21  DG  C OP1   1 
ATOM   3266 O  OP2   . DG  C 3 21  ? -13.683 -15.667 -23.588 1.00 42.72  ? 21  DG  C OP2   1 
ATOM   3267 O  "O5'" . DG  C 3 21  ? -12.425 -13.803 -24.796 1.00 41.89  ? 21  DG  C "O5'" 1 
ATOM   3268 C  "C5'" . DG  C 3 21  ? -12.163 -12.373 -24.975 1.00 42.62  ? 21  DG  C "C5'" 1 
ATOM   3269 C  "C4'" . DG  C 3 21  ? -11.242 -12.068 -26.136 1.00 41.96  ? 21  DG  C "C4'" 1 
ATOM   3270 O  "O4'" . DG  C 3 21  ? -9.861  -12.296 -25.756 1.00 40.14  ? 21  DG  C "O4'" 1 
ATOM   3271 C  "C3'" . DG  C 3 21  ? -11.463 -12.912 -27.378 1.00 42.25  ? 21  DG  C "C3'" 1 
ATOM   3272 O  "O3'" . DG  C 3 21  ? -11.161 -12.035 -28.460 1.00 44.42  ? 21  DG  C "O3'" 1 
ATOM   3273 C  "C2'" . DG  C 3 21  ? -10.466 -14.050 -27.200 1.00 40.48  ? 21  DG  C "C2'" 1 
ATOM   3274 C  "C1'" . DG  C 3 21  ? -9.284  -13.344 -26.529 1.00 39.00  ? 21  DG  C "C1'" 1 
ATOM   3275 N  N9    . DG  C 3 21  ? -8.425  -14.112 -25.629 1.00 36.83  ? 21  DG  C N9    1 
ATOM   3276 C  C8    . DG  C 3 21  ? -8.816  -14.976 -24.634 1.00 36.21  ? 21  DG  C C8    1 
ATOM   3277 N  N7    . DG  C 3 21  ? -7.814  -15.438 -23.934 1.00 34.83  ? 21  DG  C N7    1 
ATOM   3278 C  C5    . DG  C 3 21  ? -6.703  -14.795 -24.460 1.00 34.21  ? 21  DG  C C5    1 
ATOM   3279 C  C6    . DG  C 3 21  ? -5.327  -14.900 -24.114 1.00 33.24  ? 21  DG  C C6    1 
ATOM   3280 O  O6    . DG  C 3 21  ? -4.803  -15.583 -23.220 1.00 31.92  ? 21  DG  C O6    1 
ATOM   3281 N  N1    . DG  C 3 21  ? -4.538  -14.085 -24.915 1.00 32.88  ? 21  DG  C N1    1 
ATOM   3282 C  C2    . DG  C 3 21  ? -5.004  -13.298 -25.941 1.00 33.94  ? 21  DG  C C2    1 
ATOM   3283 N  N2    . DG  C 3 21  ? -4.087  -12.583 -26.605 1.00 34.28  ? 21  DG  C N2    1 
ATOM   3284 N  N3    . DG  C 3 21  ? -6.276  -13.196 -26.277 1.00 34.85  ? 21  DG  C N3    1 
ATOM   3285 C  C4    . DG  C 3 21  ? -7.064  -13.966 -25.501 1.00 35.29  ? 21  DG  C C4    1 
ATOM   3286 P  P     . DT  C 3 22  ? -11.214 -12.603 -29.957 1.00 45.82  ? 22  DT  C P     1 
ATOM   3287 O  OP1   . DT  C 3 22  ? -11.516 -11.474 -30.839 1.00 48.38  ? 22  DT  C OP1   1 
ATOM   3288 O  OP2   . DT  C 3 22  ? -12.031 -13.840 -29.972 1.00 46.01  ? 22  DT  C OP2   1 
ATOM   3289 O  "O5'" . DT  C 3 22  ? -9.724  -13.070 -30.263 1.00 45.28  ? 22  DT  C "O5'" 1 
ATOM   3290 C  "C5'" . DT  C 3 22  ? -8.636  -12.135 -30.208 1.00 45.13  ? 22  DT  C "C5'" 1 
ATOM   3291 C  "C4'" . DT  C 3 22  ? -7.362  -12.816 -30.648 1.00 44.56  ? 22  DT  C "C4'" 1 
ATOM   3292 O  "O4'" . DT  C 3 22  ? -6.817  -13.568 -29.546 1.00 42.60  ? 22  DT  C "O4'" 1 
ATOM   3293 C  "C3'" . DT  C 3 22  ? -7.513  -13.816 -31.796 1.00 45.03  ? 22  DT  C "C3'" 1 
ATOM   3294 O  "O3'" . DT  C 3 22  ? -6.324  -13.811 -32.567 1.00 47.64  ? 22  DT  C "O3'" 1 
ATOM   3295 C  "C2'" . DT  C 3 22  ? -7.541  -15.161 -31.104 1.00 43.14  ? 22  DT  C "C2'" 1 
ATOM   3296 C  "C1'" . DT  C 3 22  ? -6.527  -14.881 -30.011 1.00 41.79  ? 22  DT  C "C1'" 1 
ATOM   3297 N  N1    . DT  C 3 22  ? -6.498  -15.793 -28.840 1.00 39.64  ? 22  DT  C N1    1 
ATOM   3298 C  C2    . DT  C 3 22  ? -5.283  -15.966 -28.205 1.00 37.19  ? 22  DT  C C2    1 
ATOM   3299 O  O2    . DT  C 3 22  ? -4.255  -15.442 -28.584 1.00 35.79  ? 22  DT  C O2    1 
ATOM   3300 N  N3    . DT  C 3 22  ? -5.310  -16.828 -27.145 1.00 36.22  ? 22  DT  C N3    1 
ATOM   3301 C  C4    . DT  C 3 22  ? -6.409  -17.477 -26.625 1.00 36.89  ? 22  DT  C C4    1 
ATOM   3302 O  O4    . DT  C 3 22  ? -6.278  -18.191 -25.639 1.00 36.91  ? 22  DT  C O4    1 
ATOM   3303 C  C5    . DT  C 3 22  ? -7.663  -17.226 -27.317 1.00 38.22  ? 22  DT  C C5    1 
ATOM   3304 C  C7    . DT  C 3 22  ? -8.911  -17.891 -26.832 1.00 38.47  ? 22  DT  C C7    1 
ATOM   3305 C  C6    . DT  C 3 22  ? -7.641  -16.417 -28.383 1.00 39.28  ? 22  DT  C C6    1 
ATOM   3306 P  P     . DA  C 3 23  ? -6.411  -13.521 -34.126 1.00 50.50  ? 23  DA  C P     1 
ATOM   3307 O  OP1   . DA  C 3 23  ? -6.955  -12.136 -34.263 1.00 50.73  ? 23  DA  C OP1   1 
ATOM   3308 O  OP2   . DA  C 3 23  ? -7.002  -14.698 -34.770 1.00 47.80  ? 23  DA  C OP2   1 
ATOM   3309 O  "O5'" . DA  C 3 23  ? -4.895  -13.491 -34.596 1.00 49.93  ? 23  DA  C "O5'" 1 
ATOM   3310 C  "C5'" . DA  C 3 23  ? -3.907  -12.600 -34.021 1.00 48.64  ? 23  DA  C "C5'" 1 
ATOM   3311 C  "C4'" . DA  C 3 23  ? -2.607  -13.368 -33.984 1.00 47.80  ? 23  DA  C "C4'" 1 
ATOM   3312 O  "O4'" . DA  C 3 23  ? -2.672  -14.155 -32.776 1.00 44.62  ? 23  DA  C "O4'" 1 
ATOM   3313 C  "C3'" . DA  C 3 23  ? -2.493  -14.376 -35.141 1.00 48.07  ? 23  DA  C "C3'" 1 
ATOM   3314 O  "O3'" . DA  C 3 23  ? -1.651  -14.092 -36.274 1.00 52.59  ? 23  DA  C "O3'" 1 
ATOM   3315 C  "C2'" . DA  C 3 23  ? -2.304  -15.731 -34.485 1.00 45.31  ? 23  DA  C "C2'" 1 
ATOM   3316 C  "C1'" . DA  C 3 23  ? -2.175  -15.446 -33.006 1.00 43.23  ? 23  DA  C "C1'" 1 
ATOM   3317 N  N9    . DA  C 3 23  ? -2.974  -16.360 -32.222 1.00 40.17  ? 23  DA  C N9    1 
ATOM   3318 C  C8    . DA  C 3 23  ? -4.300  -16.664 -32.394 1.00 39.90  ? 23  DA  C C8    1 
ATOM   3319 N  N7    . DA  C 3 23  ? -4.761  -17.521 -31.517 1.00 38.33  ? 23  DA  C N7    1 
ATOM   3320 C  C5    . DA  C 3 23  ? -3.648  -17.853 -30.759 1.00 36.48  ? 23  DA  C C5    1 
ATOM   3321 C  C6    . DA  C 3 23  ? -3.465  -18.738 -29.692 1.00 34.49  ? 23  DA  C C6    1 
ATOM   3322 N  N6    . DA  C 3 23  ? -4.444  -19.455 -29.163 1.00 34.16  ? 23  DA  C N6    1 
ATOM   3323 N  N1    . DA  C 3 23  ? -2.239  -18.807 -29.133 1.00 33.69  ? 23  DA  C N1    1 
ATOM   3324 C  C2    . DA  C 3 23  ? -1.261  -18.048 -29.638 1.00 34.62  ? 23  DA  C C2    1 
ATOM   3325 N  N3    . DA  C 3 23  ? -1.304  -17.187 -30.653 1.00 36.27  ? 23  DA  C N3    1 
ATOM   3326 C  C4    . DA  C 3 23  ? -2.542  -17.134 -31.175 1.00 37.94  ? 23  DA  C C4    1 
ATOM   3327 P  P     . DC  C 3 24  ? -0.050  -14.034 -36.220 1.00 54.17  ? 24  DC  C P     1 
ATOM   3328 O  OP1   . DC  C 3 24  ? 0.354   -12.825 -35.493 1.00 54.44  ? 24  DC  C OP1   1 
ATOM   3329 O  OP2   . DC  C 3 24  ? 0.445   -14.319 -37.578 1.00 57.46  ? 24  DC  C OP2   1 
ATOM   3330 O  "O5'" . DC  C 3 24  ? 0.387   -15.362 -35.495 1.00 51.78  ? 24  DC  C "O5'" 1 
ATOM   3331 C  "C5'" . DC  C 3 24  ? 1.530   -15.336 -34.633 1.00 49.09  ? 24  DC  C "C5'" 1 
ATOM   3332 C  "C4'" . DC  C 3 24  ? 1.814   -16.759 -34.232 1.00 46.44  ? 24  DC  C "C4'" 1 
ATOM   3333 O  "O4'" . DC  C 3 24  ? 0.612   -17.327 -33.687 1.00 43.01  ? 24  DC  C "O4'" 1 
ATOM   3334 C  "C3'" . DC  C 3 24  ? 2.177   -17.670 -35.400 1.00 46.45  ? 24  DC  C "C3'" 1 
ATOM   3335 O  "O3'" . DC  C 3 24  ? 3.605   -17.727 -35.461 1.00 48.77  ? 24  DC  C "O3'" 1 
ATOM   3336 C  "C2'" . DC  C 3 24  ? 1.443   -18.974 -35.091 1.00 44.04  ? 24  DC  C "C2'" 1 
ATOM   3337 C  "C1'" . DC  C 3 24  ? 0.790   -18.705 -33.742 1.00 41.50  ? 24  DC  C "C1'" 1 
ATOM   3338 N  N1    . DC  C 3 24  ? -0.514  -19.302 -33.487 1.00 38.94  ? 24  DC  C N1    1 
ATOM   3339 C  C2    . DC  C 3 24  ? -0.664  -20.076 -32.338 1.00 37.03  ? 24  DC  C C2    1 
ATOM   3340 O  O2    . DC  C 3 24  ? 0.328   -20.303 -31.643 1.00 36.20  ? 24  DC  C O2    1 
ATOM   3341 N  N3    . DC  C 3 24  ? -1.864  -20.636 -32.069 1.00 36.53  ? 24  DC  C N3    1 
ATOM   3342 C  C4    . DC  C 3 24  ? -2.905  -20.396 -32.868 1.00 36.30  ? 24  DC  C C4    1 
ATOM   3343 N  N4    . DC  C 3 24  ? -4.073  -20.920 -32.530 1.00 35.74  ? 24  DC  C N4    1 
ATOM   3344 C  C5    . DC  C 3 24  ? -2.795  -19.565 -34.022 1.00 36.89  ? 24  DC  C C5    1 
ATOM   3345 C  C6    . DC  C 3 24  ? -1.591  -19.039 -34.288 1.00 37.86  ? 24  DC  C C6    1 
ATOM   3346 P  P     . DG  C 3 25  ? 4.315   -18.748 -36.463 1.00 50.78  ? 25  DG  C P     1 
ATOM   3347 O  OP1   . DG  C 3 25  ? 5.673   -18.196 -36.749 1.00 52.01  ? 25  DG  C OP1   1 
ATOM   3348 O  OP2   . DG  C 3 25  ? 3.356   -19.062 -37.562 1.00 48.32  ? 25  DG  C OP2   1 
ATOM   3349 O  "O5'" . DG  C 3 25  ? 4.531   -20.050 -35.566 1.00 46.49  ? 25  DG  C "O5'" 1 
ATOM   3350 C  "C5'" . DG  C 3 25  ? 5.342   -20.055 -34.383 1.00 43.94  ? 25  DG  C "C5'" 1 
ATOM   3351 C  "C4'" . DG  C 3 25  ? 5.327   -21.461 -33.835 1.00 42.66  ? 25  DG  C "C4'" 1 
ATOM   3352 O  "O4'" . DG  C 3 25  ? 3.979   -21.799 -33.417 1.00 40.62  ? 25  DG  C "O4'" 1 
ATOM   3353 C  "C3'" . DG  C 3 25  ? 5.712   -22.527 -34.859 1.00 43.25  ? 25  DG  C "C3'" 1 
ATOM   3354 O  "O3'" . DG  C 3 25  ? 6.522   -23.452 -34.172 1.00 44.49  ? 25  DG  C "O3'" 1 
ATOM   3355 C  "C2'" . DG  C 3 25  ? 4.394   -23.178 -35.250 1.00 41.50  ? 25  DG  C "C2'" 1 
ATOM   3356 C  "C1'" . DG  C 3 25  ? 3.585   -23.037 -33.979 1.00 40.09  ? 25  DG  C "C1'" 1 
ATOM   3357 N  N9    . DG  C 3 25  ? 2.131   -23.013 -34.137 1.00 38.68  ? 25  DG  C N9    1 
ATOM   3358 C  C8    . DG  C 3 25  ? 1.396   -22.341 -35.087 1.00 38.05  ? 25  DG  C C8    1 
ATOM   3359 N  N7    . DG  C 3 25  ? 0.108   -22.507 -34.951 1.00 36.93  ? 25  DG  C N7    1 
ATOM   3360 C  C5    . DG  C 3 25  ? -0.019  -23.318 -33.831 1.00 36.90  ? 25  DG  C C5    1 
ATOM   3361 C  C6    . DG  C 3 25  ? -1.181  -23.852 -33.201 1.00 36.25  ? 25  DG  C C6    1 
ATOM   3362 O  O6    . DG  C 3 25  ? -2.363  -23.682 -33.500 1.00 36.68  ? 25  DG  C O6    1 
ATOM   3363 N  N1    . DG  C 3 25  ? -0.853  -24.670 -32.124 1.00 35.89  ? 25  DG  C N1    1 
ATOM   3364 C  C2    . DG  C 3 25  ? 0.422   -24.906 -31.677 1.00 36.38  ? 25  DG  C C2    1 
ATOM   3365 N  N2    . DG  C 3 25  ? 0.534   -25.707 -30.616 1.00 36.63  ? 25  DG  C N2    1 
ATOM   3366 N  N3    . DG  C 3 25  ? 1.512   -24.404 -32.241 1.00 37.24  ? 25  DG  C N3    1 
ATOM   3367 C  C4    . DG  C 3 25  ? 1.220   -23.641 -33.317 1.00 37.40  ? 25  DG  C C4    1 
HETATM 3368 MG MG    . MG  D 4 .   ? 2.579   -0.571  -3.156  1.00 41.90  ? 401 MG  A MG    1 
HETATM 3369 MG MG    . MG  E 4 .   ? 1.640   -2.715  -2.051  1.00 48.06  ? 402 MG  A MG    1 
HETATM 3370 O  O1    . MXE F 5 .   ? 1.979   -6.256  1.567   1.00 47.03  ? 403 MXE A O1    1 
HETATM 3371 C  C1    . MXE F 5 .   ? 1.673   -6.520  0.183   1.00 51.75  ? 403 MXE A C1    1 
HETATM 3372 C  C2    . MXE F 5 .   ? 1.655   -7.988  -0.286  1.00 52.88  ? 403 MXE A C2    1 
HETATM 3373 O  O2    . MXE F 5 .   ? 0.374   -8.418  -0.821  1.00 55.57  ? 403 MXE A O2    1 
HETATM 3374 C  C3    . MXE F 5 .   ? -0.102  -7.708  -1.978  1.00 50.61  ? 403 MXE A C3    1 
HETATM 3375 C  C5    A PG0 G 6 .   ? 4.480   -26.805 -27.918 0.50 21.90  ? 101 PG0 B C5    1 
HETATM 3376 C  C5    B PG0 G 6 .   ? 2.864   -26.928 -26.953 0.50 30.04  ? 101 PG0 B C5    1 
HETATM 3377 O  O2    A PG0 G 6 .   ? 3.172   -26.597 -28.433 0.50 22.25  ? 101 PG0 B O2    1 
HETATM 3378 O  O2    B PG0 G 6 .   ? 3.273   -26.272 -28.131 0.50 30.31  ? 101 PG0 B O2    1 
HETATM 3379 C  C4    A PG0 G 6 .   ? 2.693   -25.433 -27.797 0.50 26.60  ? 101 PG0 B C4    1 
HETATM 3380 C  C4    B PG0 G 6 .   ? 2.856   -24.932 -27.932 0.50 36.98  ? 101 PG0 B C4    1 
HETATM 3381 C  C3    A PG0 G 6 .   ? 3.595   -24.247 -28.171 0.50 30.18  ? 101 PG0 B C3    1 
HETATM 3382 C  C3    B PG0 G 6 .   ? 3.820   -23.907 -28.533 0.50 40.97  ? 101 PG0 B C3    1 
HETATM 3383 O  O1    A PG0 G 6 .   ? 2.897   -23.204 -28.881 0.50 34.60  ? 101 PG0 B O1    1 
HETATM 3384 O  O1    B PG0 G 6 .   ? 3.092   -22.745 -28.959 0.50 46.63  ? 101 PG0 B O1    1 
HETATM 3385 C  C2    A PG0 G 6 .   ? 3.625   -21.962 -28.984 0.50 37.12  ? 101 PG0 B C2    1 
HETATM 3386 C  C2    B PG0 G 6 .   ? 3.754   -21.502 -28.683 0.50 49.15  ? 101 PG0 B C2    1 
HETATM 3387 C  C1    A PG0 G 6 .   ? 3.539   -21.415 -30.419 0.50 36.98  ? 101 PG0 B C1    1 
HETATM 3388 C  C1    B PG0 G 6 .   ? 3.755   -20.639 -29.948 0.50 50.48  ? 101 PG0 B C1    1 
HETATM 3389 O  OTT   A PG0 G 6 .   ? 3.149   -20.029 -30.481 0.50 36.75  ? 101 PG0 B OTT   1 
HETATM 3390 O  OTT   B PG0 G 6 .   ? 3.977   -19.274 -29.566 0.50 48.37  ? 101 PG0 B OTT   1 
HETATM 3391 O  O     . HOH H 7 .   ? 1.909   7.390   1.742   1.00 27.23  ? 501 HOH A O     1 
HETATM 3392 O  O     . HOH H 7 .   ? 6.883   4.615   -4.550  1.00 28.43  ? 502 HOH A O     1 
HETATM 3393 O  O     . HOH H 7 .   ? 14.194  15.716  14.527  1.00 36.26  ? 503 HOH A O     1 
HETATM 3394 O  O     . HOH H 7 .   ? 4.117   -18.863 -17.702 1.00 26.86  ? 504 HOH A O     1 
HETATM 3395 O  O     . HOH H 7 .   ? -0.661  -8.590  3.901   1.00 38.70  ? 505 HOH A O     1 
HETATM 3396 O  O     . HOH H 7 .   ? -2.058  -21.811 -12.722 1.00 26.42  ? 506 HOH A O     1 
HETATM 3397 O  O     . HOH H 7 .   ? 13.606  -18.662 -21.142 1.00 33.21  ? 507 HOH A O     1 
HETATM 3398 O  O     . HOH H 7 .   ? 5.679   17.264  17.596  1.00 26.66  ? 508 HOH A O     1 
HETATM 3399 O  O     . HOH H 7 .   ? 0.029   3.445   6.854   1.00 31.43  ? 509 HOH A O     1 
HETATM 3400 O  O     . HOH H 7 .   ? -6.227  0.864   17.172  1.00 22.88  ? 510 HOH A O     1 
HETATM 3401 O  O     . HOH H 7 .   ? 0.179   -19.489 0.607   1.00 40.40  ? 511 HOH A O     1 
HETATM 3402 O  O     . HOH H 7 .   ? -1.541  -36.668 -13.662 1.00 43.48  ? 512 HOH A O     1 
HETATM 3403 O  O     . HOH H 7 .   ? 5.879   3.686   -0.073  1.00 29.82  ? 513 HOH A O     1 
HETATM 3404 O  O     . HOH H 7 .   ? 9.866   -13.027 -20.857 1.00 19.33  ? 514 HOH A O     1 
HETATM 3405 O  O     . HOH H 7 .   ? 1.484   11.702  17.001  1.00 24.74  ? 515 HOH A O     1 
HETATM 3406 O  O     . HOH H 7 .   ? -0.464  20.672  -1.545  1.00 33.04  ? 516 HOH A O     1 
HETATM 3407 O  O     . HOH H 7 .   ? 13.930  -12.001 6.135   1.00 45.55  ? 517 HOH A O     1 
HETATM 3408 O  O     . HOH H 7 .   ? 0.507   -10.643 0.556   1.00 35.20  ? 518 HOH A O     1 
HETATM 3409 O  O     . HOH H 7 .   ? -2.220  -19.060 1.991   1.00 33.35  ? 519 HOH A O     1 
HETATM 3410 O  O     . HOH H 7 .   ? 4.683   -9.647  1.686   1.00 27.34  ? 520 HOH A O     1 
HETATM 3411 O  O     . HOH H 7 .   ? -2.538  -29.910 -4.661  1.00 23.01  ? 521 HOH A O     1 
HETATM 3412 O  O     . HOH H 7 .   ? 10.982  -10.050 16.307  1.00 42.98  ? 522 HOH A O     1 
HETATM 3413 O  O     . HOH H 7 .   ? 1.375   -6.770  -8.675  1.00 18.74  ? 523 HOH A O     1 
HETATM 3414 O  O     . HOH H 7 .   ? -2.703  2.711   9.403   1.00 33.22  ? 524 HOH A O     1 
HETATM 3415 O  O     . HOH H 7 .   ? 3.308   0.879   -4.460  1.00 38.63  ? 525 HOH A O     1 
HETATM 3416 O  O     . HOH H 7 .   ? 10.549  -24.970 -11.308 1.00 34.76  ? 526 HOH A O     1 
HETATM 3417 O  O     . HOH H 7 .   ? 17.931  18.995  13.227  1.00 37.08  ? 527 HOH A O     1 
HETATM 3418 O  O     . HOH H 7 .   ? 10.997  -15.228 3.970   1.00 42.67  ? 528 HOH A O     1 
HETATM 3419 O  O     . HOH H 7 .   ? 17.471  -15.855 -11.903 1.00 36.86  ? 529 HOH A O     1 
HETATM 3420 O  O     . HOH H 7 .   ? 11.909  -9.759  -22.199 1.00 31.38  ? 530 HOH A O     1 
HETATM 3421 O  O     . HOH H 7 .   ? 24.507  0.845   8.012   1.00 21.30  ? 531 HOH A O     1 
HETATM 3422 O  O     . HOH H 7 .   ? 24.473  1.871   0.953   1.00 28.28  ? 532 HOH A O     1 
HETATM 3423 O  O     . HOH H 7 .   ? 26.181  -1.101  4.481   1.00 35.78  ? 533 HOH A O     1 
HETATM 3424 O  O     . HOH H 7 .   ? 15.309  13.306  -13.010 1.00 54.53  ? 534 HOH A O     1 
HETATM 3425 O  O     . HOH H 7 .   ? 9.445   -11.320 14.189  1.00 39.32  ? 535 HOH A O     1 
HETATM 3426 O  O     . HOH H 7 .   ? -3.784  -27.330 -18.307 1.00 24.38  ? 536 HOH A O     1 
HETATM 3427 O  O     . HOH H 7 .   ? -7.807  -37.879 -26.699 1.00 24.98  ? 537 HOH A O     1 
HETATM 3428 O  O     . HOH H 7 .   ? -7.411  -6.222  5.248   1.00 37.42  ? 538 HOH A O     1 
HETATM 3429 O  O     . HOH H 7 .   ? 4.057   12.252  17.731  1.00 22.73  ? 539 HOH A O     1 
HETATM 3430 O  O     . HOH H 7 .   ? -7.396  28.587  23.208  1.00 45.87  ? 540 HOH A O     1 
HETATM 3431 O  O     . HOH H 7 .   ? -12.105 -29.425 -15.425 1.00 39.76  ? 541 HOH A O     1 
HETATM 3432 O  O     . HOH H 7 .   ? 14.946  -11.897 2.050   1.00 30.58  ? 542 HOH A O     1 
HETATM 3433 O  O     . HOH H 7 .   ? 6.693   13.573  15.236  1.00 20.82  ? 543 HOH A O     1 
HETATM 3434 O  O     . HOH H 7 .   ? 16.319  15.693  2.855   1.00 25.05  ? 544 HOH A O     1 
HETATM 3435 O  O     . HOH H 7 .   ? 5.120   -27.136 -19.037 1.00 24.67  ? 545 HOH A O     1 
HETATM 3436 O  O     . HOH H 7 .   ? -7.528  11.301  -6.478  1.00 43.05  ? 546 HOH A O     1 
HETATM 3437 O  O     . HOH H 7 .   ? 13.886  -22.685 -18.162 1.00 38.44  ? 547 HOH A O     1 
HETATM 3438 O  O     . HOH H 7 .   ? 9.175   -24.916 -9.099  1.00 26.01  ? 548 HOH A O     1 
HETATM 3439 O  O     . HOH H 7 .   ? 20.191  11.383  12.433  1.00 41.80  ? 549 HOH A O     1 
HETATM 3440 O  O     . HOH H 7 .   ? -2.701  -5.614  -18.558 1.00 32.42  ? 550 HOH A O     1 
HETATM 3441 O  O     . HOH H 7 .   ? 2.906   9.166   -1.803  1.00 37.71  ? 551 HOH A O     1 
HETATM 3442 O  O     . HOH H 7 .   ? 16.329  15.304  12.147  1.00 35.75  ? 552 HOH A O     1 
HETATM 3443 O  O     . HOH H 7 .   ? -10.639 -18.220 -20.776 1.00 41.77  ? 553 HOH A O     1 
HETATM 3444 O  O     . HOH H 7 .   ? -3.530  2.267   13.630  1.00 38.48  ? 554 HOH A O     1 
HETATM 3445 O  O     . HOH H 7 .   ? 1.259   15.710  3.053   1.00 31.85  ? 555 HOH A O     1 
HETATM 3446 O  O     . HOH H 7 .   ? 0.754   1.623   14.853  1.00 24.50  ? 556 HOH A O     1 
HETATM 3447 O  O     . HOH H 7 .   ? -2.377  -25.393 -19.370 1.00 18.80  ? 557 HOH A O     1 
HETATM 3448 O  O     . HOH H 7 .   ? 4.291   2.784   -2.623  1.00 41.55  ? 558 HOH A O     1 
HETATM 3449 O  O     . HOH H 7 .   ? 21.464  -4.982  -7.621  1.00 38.91  ? 559 HOH A O     1 
HETATM 3450 O  O     . HOH H 7 .   ? 4.687   8.444   1.966   1.00 21.60  ? 560 HOH A O     1 
HETATM 3451 O  O     . HOH H 7 .   ? 4.235   -29.802 -6.889  1.00 32.11  ? 561 HOH A O     1 
HETATM 3452 O  O     . HOH H 7 .   ? 10.864  6.684   -14.230 1.00 28.63  ? 562 HOH A O     1 
HETATM 3453 O  O     . HOH H 7 .   ? -7.406  -25.821 -1.375  1.00 29.74  ? 563 HOH A O     1 
HETATM 3454 O  O     . HOH H 7 .   ? 20.570  2.807   -6.292  1.00 33.82  ? 564 HOH A O     1 
HETATM 3455 O  O     . HOH H 7 .   ? 3.832   -2.387  19.642  1.00 41.80  ? 565 HOH A O     1 
HETATM 3456 O  O     . HOH H 7 .   ? 8.083   -28.519 -23.104 1.00 39.58  ? 566 HOH A O     1 
HETATM 3457 O  O     . HOH H 7 .   ? 13.886  -8.550  12.436  1.00 28.54  ? 567 HOH A O     1 
HETATM 3458 O  O     . HOH H 7 .   ? -0.559  -21.186 4.970   1.00 53.07  ? 568 HOH A O     1 
HETATM 3459 O  O     . HOH H 7 .   ? -12.630 -5.661  12.934  1.00 43.18  ? 569 HOH A O     1 
HETATM 3460 O  O     . HOH H 7 .   ? 15.763  -5.149  18.502  1.00 38.28  ? 570 HOH A O     1 
HETATM 3461 O  O     . HOH H 7 .   ? -6.598  -20.363 -22.966 1.00 27.90  ? 571 HOH A O     1 
HETATM 3462 O  O     . HOH H 7 .   ? -5.169  -31.446 -21.476 1.00 19.56  ? 572 HOH A O     1 
HETATM 3463 O  O     . HOH H 7 .   ? 8.981   -19.851 -24.806 1.00 31.89  ? 573 HOH A O     1 
HETATM 3464 O  O     . HOH H 7 .   ? 25.107  -2.784  0.801   1.00 42.62  ? 574 HOH A O     1 
HETATM 3465 O  O     . HOH H 7 .   ? 4.973   7.452   -2.056  1.00 36.03  ? 575 HOH A O     1 
HETATM 3466 O  O     . HOH H 7 .   ? 19.497  3.313   12.271  1.00 35.24  ? 576 HOH A O     1 
HETATM 3467 O  O     . HOH H 7 .   ? 17.939  17.199  4.333   1.00 39.65  ? 577 HOH A O     1 
HETATM 3468 O  O     . HOH H 7 .   ? 8.510   -6.986  17.718  1.00 27.36  ? 578 HOH A O     1 
HETATM 3469 O  O     . HOH H 7 .   ? -3.081  -16.595 -7.979  1.00 29.87  ? 579 HOH A O     1 
HETATM 3470 O  O     . HOH H 7 .   ? 8.486   3.744   20.635  1.00 41.54  ? 580 HOH A O     1 
HETATM 3471 O  O     . HOH H 7 .   ? 20.749  10.522  9.422   1.00 35.82  ? 581 HOH A O     1 
HETATM 3472 O  O     . HOH H 7 .   ? 8.745   -32.831 -18.704 1.00 44.53  ? 582 HOH A O     1 
HETATM 3473 O  O     . HOH H 7 .   ? 24.041  -10.854 -3.189  1.00 35.12  ? 583 HOH A O     1 
HETATM 3474 O  O     . HOH H 7 .   ? 20.041  -4.607  -15.454 1.00 34.87  ? 584 HOH A O     1 
HETATM 3475 O  O     . HOH H 7 .   ? 0.090   25.743  -1.137  1.00 41.42  ? 585 HOH A O     1 
HETATM 3476 O  O     . HOH H 7 .   ? 10.796  -16.142 -2.178  1.00 23.80  ? 586 HOH A O     1 
HETATM 3477 O  O     . HOH H 7 .   ? 21.359  -2.680  -10.746 1.00 36.78  ? 587 HOH A O     1 
HETATM 3478 O  O     . HOH H 7 .   ? -12.139 -32.943 -12.275 1.00 25.41  ? 588 HOH A O     1 
HETATM 3479 O  O     . HOH H 7 .   ? 21.666  4.004   -0.893  1.00 34.33  ? 589 HOH A O     1 
HETATM 3480 O  O     . HOH H 7 .   ? 2.603   6.738   18.712  1.00 40.06  ? 590 HOH A O     1 
HETATM 3481 O  O     . HOH H 7 .   ? 19.057  10.966  2.356   1.00 32.09  ? 591 HOH A O     1 
HETATM 3482 O  O     . HOH H 7 .   ? 18.553  -3.159  -14.717 1.00 42.36  ? 592 HOH A O     1 
HETATM 3483 O  O     . HOH H 7 .   ? -6.647  -21.730 -25.124 1.00 43.71  ? 593 HOH A O     1 
HETATM 3484 O  O     . HOH H 7 .   ? 18.443  -20.151 -6.740  1.00 35.27  ? 594 HOH A O     1 
HETATM 3485 O  O     . HOH H 7 .   ? -9.420  -21.903 -26.640 1.00 42.00  ? 595 HOH A O     1 
HETATM 3486 O  O     . HOH H 7 .   ? 4.144   11.382  -3.509  1.00 33.93  ? 596 HOH A O     1 
HETATM 3487 O  O     . HOH H 7 .   ? 7.869   -24.790 -3.088  1.00 39.10  ? 597 HOH A O     1 
HETATM 3488 O  O     . HOH H 7 .   ? 17.241  -15.151 1.100   1.00 45.58  ? 598 HOH A O     1 
HETATM 3489 O  O     . HOH H 7 .   ? 15.807  1.161   -17.353 1.00 48.80  ? 599 HOH A O     1 
HETATM 3490 O  O     . HOH H 7 .   ? 9.033   -13.007 6.437   1.00 33.46  ? 600 HOH A O     1 
HETATM 3491 O  O     . HOH H 7 .   ? 11.951  5.084   -12.220 1.00 26.97  ? 601 HOH A O     1 
HETATM 3492 O  O     . HOH H 7 .   ? 10.579  13.154  -6.150  1.00 35.53  ? 602 HOH A O     1 
HETATM 3493 O  O     . HOH H 7 .   ? -2.249  3.470   -22.860 1.00 38.17  ? 603 HOH A O     1 
HETATM 3494 O  O     . HOH H 7 .   ? 15.435  21.291  6.924   1.00 37.73  ? 604 HOH A O     1 
HETATM 3495 O  O     . HOH H 7 .   ? 22.410  6.820   0.160   1.00 48.57  ? 605 HOH A O     1 
HETATM 3496 O  O     . HOH H 7 .   ? 12.202  -12.397 9.022   1.00 40.96  ? 606 HOH A O     1 
HETATM 3497 O  O     . HOH H 7 .   ? 23.188  -9.122  -1.265  1.00 32.91  ? 607 HOH A O     1 
HETATM 3498 O  O     . HOH H 7 .   ? -6.533  20.142  12.409  1.00 28.15  ? 608 HOH A O     1 
HETATM 3499 O  O     . HOH H 7 .   ? 3.387   -9.829  -2.618  1.00 38.16  ? 609 HOH A O     1 
HETATM 3500 O  O     . HOH H 7 .   ? 12.755  29.995  12.434  1.00 49.23  ? 610 HOH A O     1 
HETATM 3501 O  O     . HOH H 7 .   ? 12.911  -23.724 -11.125 1.00 41.29  ? 611 HOH A O     1 
HETATM 3502 O  O     . HOH H 7 .   ? -5.634  -2.419  -20.067 1.00 30.43  ? 612 HOH A O     1 
HETATM 3503 O  O     . HOH H 7 .   ? -7.466  24.740  18.862  1.00 37.16  ? 613 HOH A O     1 
HETATM 3504 O  O     . HOH H 7 .   ? 9.465   32.974  13.355  1.00 30.68  ? 614 HOH A O     1 
HETATM 3505 O  O     . HOH H 7 .   ? -9.192  19.730  5.977   1.00 33.33  ? 615 HOH A O     1 
HETATM 3506 O  O     . HOH H 7 .   ? 9.584   -13.329 10.525  1.00 55.66  ? 616 HOH A O     1 
HETATM 3507 O  O     . HOH H 7 .   ? 4.392   21.113  17.545  1.00 30.00  ? 617 HOH A O     1 
HETATM 3508 O  O     . HOH H 7 .   ? 18.835  -1.975  -12.107 1.00 44.94  ? 618 HOH A O     1 
HETATM 3509 O  O     . HOH H 7 .   ? 11.967  -22.421 -5.069  1.00 37.83  ? 619 HOH A O     1 
HETATM 3510 O  O     . HOH H 7 .   ? 15.179  -10.371 4.422   1.00 25.03  ? 620 HOH A O     1 
HETATM 3511 O  O     . HOH H 7 .   ? 3.523   -33.582 -10.758 1.00 24.91  ? 621 HOH A O     1 
HETATM 3512 O  O     . HOH H 7 .   ? 5.128   19.525  -5.771  1.00 44.04  ? 622 HOH A O     1 
HETATM 3513 O  O     . HOH H 7 .   ? 13.395  -10.771 14.027  1.00 37.71  ? 623 HOH A O     1 
HETATM 3514 O  O     . HOH H 7 .   ? 15.693  7.047   1.353   1.00 25.27  ? 624 HOH A O     1 
HETATM 3515 O  O     . HOH H 7 .   ? 22.593  2.789   8.944   1.00 26.30  ? 625 HOH A O     1 
HETATM 3516 O  O     . HOH H 7 .   ? -8.262  -10.444 14.977  1.00 54.98  ? 626 HOH A O     1 
HETATM 3517 O  O     . HOH H 7 .   ? 10.689  -5.551  19.446  1.00 34.04  ? 627 HOH A O     1 
HETATM 3518 O  O     . HOH H 7 .   ? 22.502  14.445  7.045   1.00 41.67  ? 628 HOH A O     1 
HETATM 3519 O  O     . HOH H 7 .   ? -11.127 -32.092 -16.612 1.00 37.64  ? 629 HOH A O     1 
HETATM 3520 O  O     . HOH H 7 .   ? 0.357   3.842   16.598  1.00 39.48  ? 630 HOH A O     1 
HETATM 3521 O  O     . HOH H 7 .   ? 18.964  4.038   -16.859 1.00 44.01  ? 631 HOH A O     1 
HETATM 3522 O  O     . HOH H 7 .   ? 4.785   -31.887 -8.266  1.00 41.23  ? 632 HOH A O     1 
HETATM 3523 O  O     . HOH H 7 .   ? 10.158  -23.195 -3.190  1.00 39.47  ? 633 HOH A O     1 
HETATM 3524 O  O     . HOH I 7 .   ? 8.245   -21.917 -22.401 1.00 25.98  ? 201 HOH B O     1 
HETATM 3525 O  O     . HOH I 7 .   ? 2.388   -19.324 -20.586 1.00 35.49  ? 202 HOH B O     1 
HETATM 3526 O  O     . HOH I 7 .   ? 1.288   0.084   -2.365  1.00 35.18  ? 203 HOH B O     1 
HETATM 3527 O  O     . HOH I 7 .   ? -7.952  -2.677  -21.477 1.00 29.58  ? 204 HOH B O     1 
HETATM 3528 O  O     . HOH I 7 .   ? 3.898   -17.129 -30.939 1.00 32.00  ? 205 HOH B O     1 
HETATM 3529 O  O     . HOH I 7 .   ? 1.606   -0.107  4.194   1.00 29.98  ? 206 HOH B O     1 
HETATM 3530 O  O     . HOH I 7 .   ? 7.096   -13.360 -20.447 1.00 21.55  ? 207 HOH B O     1 
HETATM 3531 O  O     . HOH I 7 .   ? 3.197   -28.339 -22.392 1.00 27.21  ? 208 HOH B O     1 
HETATM 3532 O  O     . HOH I 7 .   ? -2.717  15.731  5.958   1.00 33.10  ? 209 HOH B O     1 
HETATM 3533 O  O     . HOH I 7 .   ? 1.942   13.881  5.024   1.00 32.69  ? 210 HOH B O     1 
HETATM 3534 O  O     . HOH I 7 .   ? 0.069   -22.937 -20.176 1.00 17.05  ? 211 HOH B O     1 
HETATM 3535 O  O     . HOH I 7 .   ? -13.278 -1.988  -22.791 1.00 42.87  ? 212 HOH B O     1 
HETATM 3536 O  O     . HOH I 7 .   ? -2.261  17.414  8.980   1.00 28.99  ? 213 HOH B O     1 
HETATM 3537 O  O     . HOH I 7 .   ? -4.432  -2.424  -1.279  1.00 32.56  ? 214 HOH B O     1 
HETATM 3538 O  O     . HOH I 7 .   ? 2.843   3.725   -0.454  1.00 32.15  ? 215 HOH B O     1 
HETATM 3539 O  O     . HOH I 7 .   ? 3.676   -24.606 -20.039 1.00 22.42  ? 216 HOH B O     1 
HETATM 3540 O  O     . HOH I 7 .   ? -4.612  -3.548  -17.800 1.00 34.17  ? 217 HOH B O     1 
HETATM 3541 O  O     . HOH I 7 .   ? 9.633   -13.632 -24.250 1.00 37.90  ? 218 HOH B O     1 
HETATM 3542 O  O     . HOH I 7 .   ? -2.151  9.730   11.557  1.00 36.85  ? 219 HOH B O     1 
HETATM 3543 O  O     . HOH I 7 .   ? -17.036 -3.712  -18.358 1.00 41.85  ? 220 HOH B O     1 
HETATM 3544 O  O     . HOH I 7 .   ? 7.680   -16.389 -27.033 1.00 38.84  ? 221 HOH B O     1 
HETATM 3545 O  O     . HOH I 7 .   ? -10.961 -6.422  -26.699 1.00 52.01  ? 222 HOH B O     1 
HETATM 3546 O  O     . HOH I 7 .   ? -10.874 -1.717  -19.122 1.00 47.66  ? 223 HOH B O     1 
HETATM 3547 O  O     . HOH I 7 .   ? -1.392  -15.021 -19.210 1.00 22.82  ? 224 HOH B O     1 
HETATM 3548 O  O     . HOH I 7 .   ? 2.609   -22.399 -19.610 1.00 17.72  ? 225 HOH B O     1 
HETATM 3549 O  O     . HOH I 7 .   ? -8.211  10.012  4.770   1.00 34.94  ? 226 HOH B O     1 
HETATM 3550 O  O     . HOH I 7 .   ? -8.782  12.353  33.391  1.00 47.26  ? 227 HOH B O     1 
HETATM 3551 O  O     . HOH J 7 .   ? 1.970   -0.380  -7.142  1.00 39.45  ? 101 HOH C O     1 
HETATM 3552 O  O     . HOH J 7 .   ? 6.851   17.135  25.987  1.00 28.91  ? 102 HOH C O     1 
HETATM 3553 O  O     . HOH J 7 .   ? -5.604  -0.404  19.408  1.00 33.38  ? 103 HOH C O     1 
HETATM 3554 O  O     . HOH J 7 .   ? -10.723 -10.666 -33.172 1.00 51.95  ? 104 HOH C O     1 
HETATM 3555 O  O     . HOH J 7 .   ? -3.323  -13.367 -29.937 1.00 36.93  ? 105 HOH C O     1 
HETATM 3556 O  O     . HOH J 7 .   ? 5.697   14.796  17.832  1.00 28.95  ? 106 HOH C O     1 
HETATM 3557 O  O     . HOH J 7 .   ? -1.204  5.695   15.184  1.00 37.87  ? 107 HOH C O     1 
HETATM 3558 O  O     . HOH J 7 .   ? 6.928   6.273   18.196  1.00 30.32  ? 108 HOH C O     1 
HETATM 3559 O  O     . HOH J 7 .   ? -2.366  -7.314  -14.775 1.00 29.45  ? 109 HOH C O     1 
HETATM 3560 O  O     . HOH J 7 .   ? -3.112  -12.924 -15.677 1.00 32.33  ? 110 HOH C O     1 
HETATM 3561 O  O     . HOH J 7 .   ? 2.962   2.678   -7.588  1.00 33.51  ? 111 HOH C O     1 
HETATM 3562 O  O     . HOH J 7 .   ? -11.937 1.416   12.312  1.00 40.76  ? 112 HOH C O     1 
HETATM 3563 O  O     . HOH J 7 .   ? -14.649 -13.228 -16.096 1.00 46.40  ? 113 HOH C O     1 
HETATM 3564 O  O     . HOH J 7 .   ? 4.392   26.344  18.945  1.00 41.99  ? 114 HOH C O     1 
HETATM 3565 O  O     . HOH J 7 .   ? 0.014   -4.453  -1.605  1.00 43.58  ? 115 HOH C O     1 
HETATM 3566 O  O     . HOH J 7 .   ? -17.741 4.362   11.475  1.00 49.02  ? 116 HOH C O     1 
HETATM 3567 O  O     . HOH J 7 .   ? -3.628  -14.817 -17.665 1.00 24.25  ? 117 HOH C O     1 
HETATM 3568 O  O     . HOH J 7 .   ? -2.466  8.066   25.235  1.00 33.29  ? 118 HOH C O     1 
HETATM 3569 O  O     . HOH J 7 .   ? -4.014  -22.900 -35.814 1.00 38.26  ? 119 HOH C O     1 
HETATM 3570 O  O     . HOH J 7 .   ? -8.860  0.564   16.221  1.00 39.61  ? 120 HOH C O     1 
HETATM 3571 O  O     . HOH J 7 .   ? 5.459   12.868  25.786  1.00 28.87  ? 121 HOH C O     1 
HETATM 3572 O  O     . HOH J 7 .   ? 6.559   23.690  26.736  1.00 39.41  ? 122 HOH C O     1 
HETATM 3573 O  O     . HOH J 7 .   ? -12.411 -8.863  -14.862 1.00 47.16  ? 123 HOH C O     1 
HETATM 3574 O  O     . HOH J 7 .   ? -5.020  5.228   -2.455  1.00 46.18  ? 124 HOH C O     1 
HETATM 3575 O  O     . HOH J 7 .   ? -1.653  -10.050 -16.531 1.00 33.67  ? 125 HOH C O     1 
HETATM 3576 O  O     . HOH J 7 .   ? -13.472 -18.180 -21.673 1.00 43.87  ? 126 HOH C O     1 
HETATM 3577 O  O     . HOH J 7 .   ? -5.393  -4.495  -4.241  1.00 46.30  ? 127 HOH C O     1 
HETATM 3578 O  O     . HOH J 7 .   ? 5.364   22.455  34.517  1.00 37.97  ? 128 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 7   ? 0.8202 0.6832 0.6470 0.0581  -0.0831 0.0009  7   LYS A N     
2    C CA    . LYS A 7   ? 0.7728 0.6562 0.6286 0.0685  -0.0969 -0.0103 7   LYS A CA    
3    C C     . LYS A 7   ? 0.6998 0.6196 0.5939 0.0633  -0.0848 -0.0123 7   LYS A C     
4    O O     . LYS A 7   ? 0.7217 0.6492 0.6283 0.0640  -0.0849 -0.0136 7   LYS A O     
5    C CB    . LYS A 7   ? 0.8648 0.7261 0.7062 0.0791  -0.1150 -0.0140 7   LYS A CB    
6    C CG    . LYS A 7   ? 0.9656 0.7953 0.7760 0.0889  -0.1342 -0.0173 7   LYS A CG    
7    C CD    . LYS A 7   ? 1.0342 0.8319 0.8206 0.0996  -0.1531 -0.0189 7   LYS A CD    
8    C CE    . LYS A 7   ? 1.0896 0.8673 0.8620 0.1151  -0.1796 -0.0285 7   LYS A CE    
9    N NZ    . LYS A 7   ? 1.1454 0.9067 0.8926 0.1130  -0.1808 -0.0262 7   LYS A NZ    
10   N N     . LEU A 8   ? 0.6171 0.5556 0.5258 0.0576  -0.0746 -0.0124 8   LEU A N     
11   C CA    . LEU A 8   ? 0.5128 0.4807 0.4516 0.0516  -0.0630 -0.0139 8   LEU A CA    
12   C C     . LEU A 8   ? 0.4631 0.4521 0.4283 0.0559  -0.0694 -0.0269 8   LEU A C     
13   O O     . LEU A 8   ? 0.5325 0.5181 0.4957 0.0616  -0.0795 -0.0337 8   LEU A O     
14   C CB    . LEU A 8   ? 0.4569 0.4288 0.3935 0.0439  -0.0500 -0.0079 8   LEU A CB    
15   C CG    . LEU A 8   ? 0.4819 0.4387 0.3983 0.0377  -0.0402 0.0020  8   LEU A CG    
16   C CD1   . LEU A 8   ? 0.4988 0.4574 0.4124 0.0330  -0.0308 0.0044  8   LEU A CD1   
17   C CD2   . LEU A 8   ? 0.4545 0.4220 0.3829 0.0326  -0.0316 0.0062  8   LEU A CD2   
18   N N     . ASN A 9   ? 0.3882 0.3986 0.3774 0.0516  -0.0621 -0.0305 9   ASN A N     
19   C CA    . ASN A 9   ? 0.3530 0.3850 0.3693 0.0525  -0.0642 -0.0442 9   ASN A CA    
20   C C     . ASN A 9   ? 0.3031 0.3462 0.3262 0.0433  -0.0511 -0.0422 9   ASN A C     
21   O O     . ASN A 9   ? 0.2824 0.3230 0.2986 0.0369  -0.0405 -0.0321 9   ASN A O     
22   C CB    . ASN A 9   ? 0.3360 0.3796 0.3681 0.0509  -0.0609 -0.0478 9   ASN A CB    
23   C CG    . ASN A 9   ? 0.3671 0.4351 0.4275 0.0462  -0.0552 -0.0611 9   ASN A CG    
24   O OD1   . ASN A 9   ? 0.3611 0.4369 0.4255 0.0369  -0.0429 -0.0590 9   ASN A OD1   
25   N ND2   . ASN A 9   ? 0.4289 0.5080 0.5089 0.0528  -0.0646 -0.0765 9   ASN A ND2   
26   N N     . PRO A 10  ? 0.2780 0.3335 0.3160 0.0426  -0.0522 -0.0530 10  PRO A N     
27   C CA    . PRO A 10  ? 0.2683 0.3301 0.3094 0.0336  -0.0401 -0.0511 10  PRO A CA    
28   C C     . PRO A 10  ? 0.2402 0.3072 0.2846 0.0238  -0.0258 -0.0454 10  PRO A C     
29   O O     . PRO A 10  ? 0.2291 0.2902 0.2640 0.0189  -0.0179 -0.0368 10  PRO A O     
30   C CB    . PRO A 10  ? 0.2693 0.3464 0.3309 0.0334  -0.0436 -0.0674 10  PRO A CB    
31   C CG    . PRO A 10  ? 0.2801 0.3573 0.3473 0.0447  -0.0604 -0.0772 10  PRO A CG    
32   C CD    . PRO A 10  ? 0.2848 0.3505 0.3405 0.0499  -0.0648 -0.0695 10  PRO A CD    
33   N N     . TRP A 11  ? 0.2211 0.2974 0.2777 0.0218  -0.0238 -0.0506 11  TRP A N     
34   C CA    . TRP A 11  ? 0.2084 0.2875 0.2660 0.0124  -0.0118 -0.0474 11  TRP A CA    
35   C C     . TRP A 11  ? 0.2031 0.2705 0.2452 0.0132  -0.0104 -0.0330 11  TRP A C     
36   O O     . TRP A 11  ? 0.1877 0.2509 0.2229 0.0071  -0.0025 -0.0259 11  TRP A O     
37   C CB    . TRP A 11  ? 0.2086 0.3014 0.2842 0.0093  -0.0095 -0.0598 11  TRP A CB    
38   C CG    . TRP A 11  ? 0.2092 0.3160 0.3025 0.0030  -0.0046 -0.0754 11  TRP A CG    
39   C CD1   . TRP A 11  ? 0.1992 0.3225 0.3158 0.0059  -0.0097 -0.0930 11  TRP A CD1   
40   C CD2   . TRP A 11  ? 0.2108 0.3155 0.2999 -0.0080 0.0070  -0.0755 11  TRP A CD2   
41   N NE1   . TRP A 11  ? 0.1971 0.3308 0.3261 -0.0035 -0.0008 -0.1047 11  TRP A NE1   
42   C CE2   . TRP A 11  ? 0.2136 0.3343 0.3239 -0.0128 0.0098  -0.0937 11  TRP A CE2   
43   C CE3   . TRP A 11  ? 0.2205 0.3099 0.2895 -0.0138 0.0142  -0.0627 11  TRP A CE3   
44   C CZ2   . TRP A 11  ? 0.2248 0.3453 0.3346 -0.0251 0.0216  -0.0990 11  TRP A CZ2   
45   C CZ3   . TRP A 11  ? 0.2295 0.3163 0.2961 -0.0242 0.0239  -0.0670 11  TRP A CZ3   
46   C CH2   . TRP A 11  ? 0.2282 0.3295 0.3137 -0.0308 0.0285  -0.0846 11  TRP A CH2   
47   N N     . ALA A 12  ? 0.2074 0.2685 0.2434 0.0205  -0.0185 -0.0297 12  ALA A N     
48   C CA    . ALA A 12  ? 0.2180 0.2681 0.2397 0.0205  -0.0165 -0.0171 12  ALA A CA    
49   C C     . ALA A 12  ? 0.2181 0.2610 0.2292 0.0191  -0.0126 -0.0095 12  ALA A C     
50   O O     . ALA A 12  ? 0.2228 0.2631 0.2297 0.0159  -0.0071 -0.0021 12  ALA A O     
51   C CB    . ALA A 12  ? 0.2345 0.2753 0.2481 0.0270  -0.0249 -0.0155 12  ALA A CB    
52   N N     . VAL A 13  ? 0.2162 0.2565 0.2244 0.0217  -0.0157 -0.0126 13  VAL A N     
53   C CA    . VAL A 13  ? 0.2159 0.2491 0.2143 0.0206  -0.0115 -0.0067 13  VAL A CA    
54   C C     . VAL A 13  ? 0.2143 0.2523 0.2183 0.0150  -0.0039 -0.0057 13  VAL A C     
55   O O     . VAL A 13  ? 0.2163 0.2506 0.2162 0.0136  0.0004  0.0008  13  VAL A O     
56   C CB    . VAL A 13  ? 0.2293 0.2567 0.2209 0.0246  -0.0173 -0.0108 13  VAL A CB    
57   C CG1   . VAL A 13  ? 0.2286 0.2515 0.2138 0.0225  -0.0115 -0.0074 13  VAL A CG1   
58   C CG2   . VAL A 13  ? 0.2449 0.2580 0.2206 0.0301  -0.0253 -0.0090 13  VAL A CG2   
59   N N     . VAL A 14  ? 0.2175 0.2628 0.2308 0.0114  -0.0025 -0.0130 14  VAL A N     
60   C CA    . VAL A 14  ? 0.2203 0.2641 0.2330 0.0049  0.0045  -0.0123 14  VAL A CA    
61   C C     . VAL A 14  ? 0.2169 0.2572 0.2255 0.0028  0.0072  -0.0054 14  VAL A C     
62   O O     . VAL A 14  ? 0.2178 0.2503 0.2193 0.0015  0.0097  0.0001  14  VAL A O     
63   C CB    . VAL A 14  ? 0.2295 0.2808 0.2519 -0.0014 0.0080  -0.0233 14  VAL A CB    
64   C CG1   . VAL A 14  ? 0.2325 0.2751 0.2467 -0.0100 0.0164  -0.0214 14  VAL A CG1   
65   C CG2   . VAL A 14  ? 0.2291 0.2857 0.2583 0.0006  0.0042  -0.0321 14  VAL A CG2   
66   N N     . GLY A 15  ? 0.2154 0.2605 0.2284 0.0029  0.0056  -0.0068 15  GLY A N     
67   C CA    . GLY A 15  ? 0.2208 0.2626 0.2298 0.0012  0.0069  -0.0010 15  GLY A CA    
68   C C     . GLY A 15  ? 0.2314 0.2685 0.2355 0.0052  0.0053  0.0071  15  GLY A C     
69   O O     . GLY A 15  ? 0.2271 0.2593 0.2273 0.0042  0.0061  0.0114  15  GLY A O     
70   N N     . PHE A 16  ? 0.2452 0.2827 0.2491 0.0095  0.0029  0.0080  16  PHE A N     
71   C CA    . PHE A 16  ? 0.2600 0.2947 0.2613 0.0115  0.0039  0.0133  16  PHE A CA    
72   C C     . PHE A 16  ? 0.2629 0.2948 0.2636 0.0121  0.0062  0.0145  16  PHE A C     
73   O O     . PHE A 16  ? 0.2427 0.2745 0.2460 0.0132  0.0066  0.0171  16  PHE A O     
74   C CB    . PHE A 16  ? 0.2798 0.3110 0.2757 0.0139  0.0025  0.0132  16  PHE A CB    
75   C CG    . PHE A 16  ? 0.3065 0.3355 0.3001 0.0135  0.0058  0.0166  16  PHE A CG    
76   C CD1   . PHE A 16  ? 0.3100 0.3416 0.3071 0.0117  0.0063  0.0187  16  PHE A CD1   
77   C CD2   . PHE A 16  ? 0.3164 0.3417 0.3057 0.0138  0.0095  0.0164  16  PHE A CD2   
78   C CE1   . PHE A 16  ? 0.3034 0.3353 0.3017 0.0099  0.0107  0.0198  16  PHE A CE1   
79   C CE2   . PHE A 16  ? 0.3318 0.3569 0.3215 0.0118  0.0148  0.0173  16  PHE A CE2   
80   C CZ    . PHE A 16  ? 0.3182 0.3475 0.3136 0.0096  0.0155  0.0185  16  PHE A CZ    
81   N N     . ILE A 17  ? 0.2816 0.3114 0.2801 0.0117  0.0069  0.0114  17  ILE A N     
82   C CA    . ILE A 17  ? 0.2816 0.3065 0.2782 0.0125  0.0087  0.0118  17  ILE A CA    
83   C C     . ILE A 17  ? 0.2807 0.2993 0.2741 0.0103  0.0083  0.0132  17  ILE A C     
84   O O     . ILE A 17  ? 0.2893 0.3024 0.2814 0.0130  0.0071  0.0152  17  ILE A O     
85   C CB    . ILE A 17  ? 0.3009 0.3238 0.2947 0.0122  0.0095  0.0076  17  ILE A CB    
86   C CG1   . ILE A 17  ? 0.2960 0.3195 0.2869 0.0149  0.0083  0.0067  17  ILE A CG1   
87   C CG2   . ILE A 17  ? 0.3132 0.3289 0.3039 0.0127  0.0114  0.0079  17  ILE A CG2   
88   C CD1   . ILE A 17  ? 0.3091 0.3311 0.2988 0.0167  0.0114  0.0100  17  ILE A CD1   
89   N N     . ASP A 18  ? 0.2831 0.3010 0.2742 0.0055  0.0090  0.0116  18  ASP A N     
90   C CA    . ASP A 18  ? 0.2711 0.2787 0.2536 0.0026  0.0084  0.0141  18  ASP A CA    
91   C C     . ASP A 18  ? 0.2934 0.3008 0.2778 0.0072  0.0035  0.0187  18  ASP A C     
92   O O     . ASP A 18  ? 0.3450 0.3404 0.3213 0.0086  -0.0002 0.0209  18  ASP A O     
93   C CB    . ASP A 18  ? 0.2550 0.2626 0.2344 -0.0046 0.0117  0.0105  18  ASP A CB    
94   C CG    . ASP A 18  ? 0.2650 0.2630 0.2356 -0.0120 0.0170  0.0062  18  ASP A CG    
95   O OD1   . ASP A 18  ? 0.2556 0.2378 0.2134 -0.0126 0.0168  0.0089  18  ASP A OD1   
96   O OD2   . ASP A 18  ? 0.2677 0.2727 0.2435 -0.0180 0.0218  -0.0010 18  ASP A OD2   
97   N N     . ALA A 19  ? 0.2770 0.2957 0.2710 0.0095  0.0029  0.0192  19  ALA A N     
98   C CA    . ALA A 19  ? 0.2864 0.3081 0.2860 0.0128  -0.0007 0.0213  19  ALA A CA    
99   C C     . ALA A 19  ? 0.3061 0.3318 0.3148 0.0183  -0.0014 0.0202  19  ALA A C     
100  O O     . ALA A 19  ? 0.2966 0.3208 0.3094 0.0223  -0.0067 0.0200  19  ALA A O     
101  C CB    . ALA A 19  ? 0.2685 0.2985 0.2730 0.0112  -0.0001 0.0215  19  ALA A CB    
102  N N     . GLU A 20  ? 0.3224 0.3523 0.3338 0.0185  0.0032  0.0185  20  GLU A N     
103  C CA    . GLU A 20  ? 0.3587 0.3946 0.3794 0.0214  0.0061  0.0158  20  GLU A CA    
104  C C     . GLU A 20  ? 0.3466 0.3786 0.3641 0.0228  0.0093  0.0137  20  GLU A C     
105  O O     . GLU A 20  ? 0.3396 0.3752 0.3645 0.0253  0.0122  0.0101  20  GLU A O     
106  C CB    . GLU A 20  ? 0.4020 0.4431 0.4232 0.0182  0.0111  0.0154  20  GLU A CB    
107  C CG    . GLU A 20  ? 0.4569 0.5016 0.4802 0.0157  0.0097  0.0169  20  GLU A CG    
108  C CD    . GLU A 20  ? 0.5159 0.5690 0.5514 0.0154  0.0125  0.0136  20  GLU A CD    
109  O OE1   . GLU A 20  ? 0.5469 0.6004 0.5817 0.0132  0.0196  0.0111  20  GLU A OE1   
110  O OE2   . GLU A 20  ? 0.6073 0.6657 0.6528 0.0173  0.0078  0.0125  20  GLU A OE2   
111  N N     . GLY A 21  ? 0.3456 0.3711 0.3535 0.0209  0.0096  0.0143  21  GLY A N     
112  C CA    . GLY A 21  ? 0.3909 0.4128 0.3965 0.0225  0.0127  0.0115  21  GLY A CA    
113  C C     . GLY A 21  ? 0.4045 0.4219 0.4141 0.0273  0.0107  0.0097  21  GLY A C     
114  O O     . GLY A 21  ? 0.3951 0.4068 0.4039 0.0294  0.0050  0.0113  21  GLY A O     
115  N N     . SER A 22  ? 0.3967 0.4141 0.4085 0.0295  0.0145  0.0060  22  SER A N     
116  C CA    . SER A 22  ? 0.3872 0.3974 0.4006 0.0346  0.0118  0.0035  22  SER A CA    
117  C C     . SER A 22  ? 0.3859 0.3875 0.3890 0.0328  0.0151  0.0022  22  SER A C     
118  O O     . SER A 22  ? 0.3724 0.3779 0.3742 0.0309  0.0208  -0.0001 22  SER A O     
119  C CB    . SER A 22  ? 0.4097 0.4301 0.4399 0.0394  0.0136  -0.0022 22  SER A CB    
120  O OG    . SER A 22  ? 0.4232 0.4408 0.4623 0.0473  0.0062  -0.0053 22  SER A OG    
121  N N     . PHE A 23  ? 0.3613 0.3491 0.3548 0.0328  0.0115  0.0033  23  PHE A N     
122  C CA    . PHE A 23  ? 0.3532 0.3311 0.3383 0.0317  0.0138  0.0009  23  PHE A CA    
123  C C     . PHE A 23  ? 0.3642 0.3345 0.3525 0.0390  0.0115  -0.0023 23  PHE A C     
124  O O     . PHE A 23  ? 0.4129 0.3703 0.3966 0.0428  0.0047  -0.0008 23  PHE A O     
125  C CB    . PHE A 23  ? 0.3693 0.3353 0.3409 0.0252  0.0130  0.0028  23  PHE A CB    
126  C CG    . PHE A 23  ? 0.3609 0.3371 0.3334 0.0189  0.0151  0.0032  23  PHE A CG    
127  C CD1   . PHE A 23  ? 0.3489 0.3321 0.3225 0.0168  0.0178  -0.0001 23  PHE A CD1   
128  C CD2   . PHE A 23  ? 0.3527 0.3312 0.3252 0.0164  0.0133  0.0061  23  PHE A CD2   
129  C CE1   . PHE A 23  ? 0.3506 0.3427 0.3266 0.0132  0.0173  -0.0012 23  PHE A CE1   
130  C CE2   . PHE A 23  ? 0.3370 0.3256 0.3128 0.0122  0.0145  0.0051  23  PHE A CE2   
131  C CZ    . PHE A 23  ? 0.3362 0.3317 0.3144 0.0110  0.0159  0.0011  23  PHE A CZ    
132  N N     . MET A 24  ? 0.3380 0.3140 0.3328 0.0413  0.0165  -0.0073 24  MET A N     
133  C CA    . MET A 24  ? 0.3465 0.3185 0.3490 0.0494  0.0146  -0.0127 24  MET A CA    
134  C C     . MET A 24  ? 0.3427 0.3034 0.3362 0.0491  0.0177  -0.0159 24  MET A C     
135  O O     . MET A 24  ? 0.3345 0.2974 0.3215 0.0433  0.0236  -0.0164 24  MET A O     
136  C CB    . MET A 24  ? 0.3434 0.3332 0.3656 0.0529  0.0193  -0.0191 24  MET A CB    
137  C CG    . MET A 24  ? 0.3481 0.3498 0.3840 0.0549  0.0153  -0.0185 24  MET A CG    
138  S SD    . MET A 24  ? 0.3618 0.3856 0.4216 0.0555  0.0248  -0.0289 24  MET A SD    
139  C CE    . MET A 24  ? 0.3517 0.3760 0.3943 0.0438  0.0344  -0.0230 24  MET A CE    
140  N N     . VAL A 25  ? 0.3427 0.2897 0.3352 0.0560  0.0122  -0.0185 25  VAL A N     
141  C CA    . VAL A 25  ? 0.3577 0.2935 0.3443 0.0576  0.0147  -0.0231 25  VAL A CA    
142  C C     . VAL A 25  ? 0.3675 0.3072 0.3712 0.0686  0.0123  -0.0313 25  VAL A C     
143  O O     . VAL A 25  ? 0.4194 0.3533 0.4285 0.0769  0.0023  -0.0318 25  VAL A O     
144  C CB    . VAL A 25  ? 0.3648 0.2746 0.3305 0.0553  0.0099  -0.0195 25  VAL A CB    
145  C CG1   . VAL A 25  ? 0.3732 0.2713 0.3339 0.0575  0.0122  -0.0249 25  VAL A CG1   
146  C CG2   . VAL A 25  ? 0.3560 0.2647 0.3087 0.0435  0.0135  -0.0144 25  VAL A CG2   
147  N N     . ARG A 26  ? 0.3535 0.3032 0.3660 0.0687  0.0210  -0.0387 26  ARG A N     
148  C CA    . ARG A 26  ? 0.3644 0.3198 0.3957 0.0783  0.0210  -0.0494 26  ARG A CA    
149  C C     . ARG A 26  ? 0.3754 0.3148 0.3976 0.0809  0.0223  -0.0540 26  ARG A C     
150  O O     . ARG A 26  ? 0.3623 0.2962 0.3692 0.0729  0.0292  -0.0519 26  ARG A O     
151  C CB    . ARG A 26  ? 0.3637 0.3429 0.4126 0.0751  0.0327  -0.0566 26  ARG A CB    
152  C CG    . ARG A 26  ? 0.3580 0.3522 0.4142 0.0708  0.0334  -0.0526 26  ARG A CG    
153  C CD    . ARG A 26  ? 0.3706 0.3844 0.4420 0.0663  0.0469  -0.0615 26  ARG A CD    
154  N NE    . ARG A 26  ? 0.3804 0.4048 0.4776 0.0748  0.0485  -0.0760 26  ARG A NE    
155  C CZ    . ARG A 26  ? 0.4006 0.4389 0.5114 0.0711  0.0629  -0.0883 26  ARG A CZ    
156  N NH1   . ARG A 26  ? 0.3881 0.4286 0.4856 0.0587  0.0768  -0.0867 26  ARG A NH1   
157  N NH2   . ARG A 26  ? 0.4150 0.4640 0.5528 0.0800  0.0632  -0.1034 26  ARG A NH2   
158  N N     . VAL A 27  ? 0.3912 0.3211 0.4218 0.0928  0.0136  -0.0602 27  VAL A N     
159  C CA    . VAL A 27  ? 0.4210 0.3351 0.4462 0.0977  0.0136  -0.0666 27  VAL A CA    
160  C C     . VAL A 27  ? 0.4337 0.3648 0.4891 0.1082  0.0160  -0.0821 27  VAL A C     
161  O O     . VAL A 27  ? 0.4571 0.3900 0.5298 0.1204  0.0047  -0.0877 27  VAL A O     
162  C CB    . VAL A 27  ? 0.4315 0.3129 0.4355 0.1025  0.0003  -0.0607 27  VAL A CB    
163  C CG1   . VAL A 27  ? 0.4555 0.3181 0.4526 0.1077  0.0000  -0.0674 27  VAL A CG1   
164  C CG2   . VAL A 27  ? 0.4330 0.3020 0.4112 0.0898  0.0016  -0.0484 27  VAL A CG2   
165  N N     . ARG A 28  ? 0.4410 0.3848 0.5030 0.1032  0.0305  -0.0901 28  ARG A N     
166  C CA    . ARG A 28  ? 0.4567 0.4234 0.5502 0.1088  0.0379  -0.1066 28  ARG A CA    
167  C C     . ARG A 28  ? 0.4809 0.4381 0.5777 0.1159  0.0397  -0.1178 28  ARG A C     
168  O O     . ARG A 28  ? 0.4810 0.4226 0.5548 0.1094  0.0449  -0.1137 28  ARG A O     
169  C CB    . ARG A 28  ? 0.4512 0.4370 0.5460 0.0957  0.0557  -0.1081 28  ARG A CB    
170  C CG    . ARG A 28  ? 0.4323 0.4266 0.5219 0.0876  0.0552  -0.0971 28  ARG A CG    
171  C CD    . ARG A 28  ? 0.4305 0.4356 0.5126 0.0738  0.0726  -0.0979 28  ARG A CD    
172  N NE    . ARG A 28  ? 0.4394 0.4624 0.5449 0.0733  0.0863  -0.1148 28  ARG A NE    
173  C CZ    . ARG A 28  ? 0.4380 0.4694 0.5395 0.0614  0.1039  -0.1199 28  ARG A CZ    
174  N NH1   . ARG A 28  ? 0.4279 0.4505 0.5014 0.0496  0.1089  -0.1088 28  ARG A NH1   
175  N NH2   . ARG A 28  ? 0.4451 0.4931 0.5715 0.0614  0.1168  -0.1380 28  ARG A NH2   
176  N N     . LYS A 29  ? 0.5134 0.4788 0.6389 0.1298  0.0340  -0.1327 29  LYS A N     
177  C CA    . LYS A 29  ? 0.5573 0.5122 0.6858 0.1373  0.0354  -0.1443 29  LYS A CA    
178  C C     . LYS A 29  ? 0.5546 0.5261 0.6889 0.1269  0.0577  -0.1548 29  LYS A C     
179  O O     . LYS A 29  ? 0.5274 0.5255 0.6835 0.1218  0.0699  -0.1638 29  LYS A O     
180  C CB    . LYS A 29  ? 0.5986 0.5547 0.7565 0.1574  0.0212  -0.1597 29  LYS A CB    
181  C CG    . LYS A 29  ? 0.6497 0.5837 0.7997 0.1656  0.0185  -0.1668 29  LYS A CG    
182  C CD    . LYS A 29  ? 0.6951 0.6391 0.8810 0.1831  0.0135  -0.1895 29  LYS A CD    
183  C CE    . LYS A 29  ? 0.7316 0.6569 0.9226 0.2030  -0.0136 -0.1901 29  LYS A CE    
184  N NZ    . LYS A 29  ? 0.7297 0.6727 0.9353 0.2038  -0.0213 -0.1863 29  LYS A NZ    
185  N N     . ASN A 30  ? 0.5666 0.5203 0.6796 0.1232  0.0632  -0.1541 30  ASN A N     
186  C CA    . ASN A 30  ? 0.5675 0.5300 0.6797 0.1138  0.0833  -0.1644 30  ASN A CA    
187  C C     . ASN A 30  ? 0.5693 0.5083 0.6622 0.1153  0.0837  -0.1663 30  ASN A C     
188  O O     . ASN A 30  ? 0.5625 0.4799 0.6247 0.1096  0.0787  -0.1526 30  ASN A O     
189  C CB    . ASN A 30  ? 0.5722 0.5393 0.6628 0.0965  0.0950  -0.1534 30  ASN A CB    
190  C CG    . ASN A 30  ? 0.5956 0.5679 0.6792 0.0852  0.1157  -0.1630 30  ASN A CG    
191  O OD1   . ASN A 30  ? 0.6304 0.5965 0.7141 0.0874  0.1223  -0.1742 30  ASN A OD1   
192  N ND2   . ASN A 30  ? 0.6175 0.5985 0.6916 0.0725  0.1263  -0.1586 30  ASN A ND2   
193  N N     . SER A 31  ? 0.5819 0.5268 0.6942 0.1220  0.0908  -0.1848 31  SER A N     
194  C CA    . SER A 31  ? 0.5941 0.5159 0.6919 0.1263  0.0891  -0.1885 31  SER A CA    
195  C C     . SER A 31  ? 0.5977 0.5105 0.6659 0.1110  0.1040  -0.1852 31  SER A C     
196  O O     . SER A 31  ? 0.5986 0.4919 0.6519 0.1124  0.1036  -0.1878 31  SER A O     
197  C CB    . SER A 31  ? 0.6014 0.5321 0.7324 0.1408  0.0894  -0.2105 31  SER A CB    
198  O OG    . SER A 31  ? 0.5944 0.5558 0.7522 0.1356  0.1068  -0.2257 31  SER A OG    
199  N N     . LYS A 32  ? 0.5950 0.5190 0.6520 0.0966  0.1156  -0.1794 32  LYS A N     
200  C CA    . LYS A 32  ? 0.6156 0.5272 0.6391 0.0824  0.1255  -0.1738 32  LYS A CA    
201  C C     . LYS A 32  ? 0.6090 0.5001 0.6031 0.0783  0.1131  -0.1561 32  LYS A C     
202  O O     . LYS A 32  ? 0.5930 0.4697 0.5607 0.0700  0.1170  -0.1537 32  LYS A O     
203  C CB    . LYS A 32  ? 0.6333 0.5595 0.6520 0.0693  0.1409  -0.1745 32  LYS A CB    
204  C CG    . LYS A 32  ? 0.6654 0.6085 0.7075 0.0690  0.1586  -0.1952 32  LYS A CG    
205  C CD    . LYS A 32  ? 0.6841 0.6403 0.7223 0.0553  0.1748  -0.1968 32  LYS A CD    
206  C CE    . LYS A 32  ? 0.6781 0.6617 0.7561 0.0604  0.1765  -0.2060 32  LYS A CE    
207  N NZ    . LYS A 32  ? 0.6996 0.6974 0.7882 0.0501  0.2013  -0.2250 32  LYS A NZ    
208  N N     . TYR A 33  ? 0.6041 0.4935 0.6031 0.0838  0.0984  -0.1453 33  TYR A N     
209  C CA    . TYR A 33  ? 0.6008 0.4720 0.5752 0.0792  0.0874  -0.1303 33  TYR A CA    
210  C C     . TYR A 33  ? 0.6117 0.4613 0.5834 0.0880  0.0788  -0.1335 33  TYR A C     
211  O O     . TYR A 33  ? 0.6060 0.4566 0.5980 0.1007  0.0746  -0.1424 33  TYR A O     
212  C CB    . TYR A 33  ? 0.5864 0.4646 0.5638 0.0784  0.0781  -0.1176 33  TYR A CB    
213  C CG    . TYR A 33  ? 0.5613 0.4588 0.5395 0.0694  0.0871  -0.1150 33  TYR A CG    
214  C CD1   . TYR A 33  ? 0.5571 0.4744 0.5576 0.0716  0.0960  -0.1246 33  TYR A CD1   
215  C CD2   . TYR A 33  ? 0.5541 0.4490 0.5107 0.0585  0.0871  -0.1048 33  TYR A CD2   
216  C CE1   . TYR A 33  ? 0.5392 0.4695 0.5367 0.0622  0.1056  -0.1229 33  TYR A CE1   
217  C CE2   . TYR A 33  ? 0.5451 0.4528 0.4991 0.0512  0.0944  -0.1028 33  TYR A CE2   
218  C CZ    . TYR A 33  ? 0.5391 0.4627 0.5115 0.0524  0.1044  -0.1115 33  TYR A CZ    
219  O OH    . TYR A 33  ? 0.5481 0.4812 0.5157 0.0439  0.1130  -0.1100 33  TYR A OH    
220  N N     . LYS A 34  ? 0.6315 0.4610 0.5784 0.0814  0.0763  -0.1279 34  LYS A N     
221  C CA    . LYS A 34  ? 0.6458 0.4493 0.5839 0.0875  0.0686  -0.1299 34  LYS A CA    
222  C C     . LYS A 34  ? 0.6291 0.4192 0.5721 0.0979  0.0542  -0.1253 34  LYS A C     
223  O O     . LYS A 34  ? 0.6469 0.4194 0.5916 0.1083  0.0482  -0.1316 34  LYS A O     
224  C CB    . LYS A 34  ? 0.6790 0.4651 0.5897 0.0757  0.0681  -0.1233 34  LYS A CB    
225  C CG    . LYS A 34  ? 0.7257 0.5110 0.6263 0.0697  0.0785  -0.1315 34  LYS A CG    
226  C CD    . LYS A 34  ? 0.7676 0.5371 0.6441 0.0586  0.0762  -0.1266 34  LYS A CD    
227  C CE    . LYS A 34  ? 0.8373 0.5972 0.7029 0.0561  0.0835  -0.1368 34  LYS A CE    
228  N NZ    . LYS A 34  ? 0.8620 0.6385 0.7311 0.0545  0.0951  -0.1441 34  LYS A NZ    
229  N N     . THR A 35  ? 0.6037 0.3984 0.5454 0.0951  0.0479  -0.1141 35  THR A N     
230  C CA    . THR A 35  ? 0.5945 0.3739 0.5368 0.1046  0.0334  -0.1090 35  THR A CA    
231  C C     . THR A 35  ? 0.5837 0.3808 0.5568 0.1194  0.0287  -0.1175 35  THR A C     
232  O O     . THR A 35  ? 0.5951 0.3786 0.5702 0.1303  0.0143  -0.1154 35  THR A O     
233  C CB    . THR A 35  ? 0.5792 0.3599 0.5102 0.0953  0.0295  -0.0948 35  THR A CB    
234  O OG1   . THR A 35  ? 0.5478 0.3603 0.4956 0.0916  0.0362  -0.0940 35  THR A OG1   
235  C CG2   . THR A 35  ? 0.5858 0.3509 0.4900 0.0802  0.0328  -0.0877 35  THR A CG2   
236  N N     . GLY A 36  ? 0.5456 0.3725 0.5413 0.1187  0.0406  -0.1268 36  GLY A N     
237  C CA    . GLY A 36  ? 0.5260 0.3754 0.5543 0.1297  0.0385  -0.1363 36  GLY A CA    
238  C C     . GLY A 36  ? 0.4913 0.3605 0.5279 0.1251  0.0377  -0.1283 36  GLY A C     
239  O O     . GLY A 36  ? 0.4696 0.3599 0.5347 0.1328  0.0363  -0.1363 36  GLY A O     
240  N N     . TRP A 37  ? 0.4852 0.3490 0.4988 0.1126  0.0387  -0.1137 37  TRP A N     
241  C CA    . TRP A 37  ? 0.4651 0.3451 0.4835 0.1077  0.0376  -0.1053 37  TRP A CA    
242  C C     . TRP A 37  ? 0.4564 0.3444 0.4590 0.0920  0.0481  -0.0973 37  TRP A C     
243  O O     . TRP A 37  ? 0.4829 0.3558 0.4632 0.0844  0.0494  -0.0923 37  TRP A O     
244  C CB    . TRP A 37  ? 0.4695 0.3304 0.4763 0.1120  0.0213  -0.0942 37  TRP A CB    
245  C CG    . TRP A 37  ? 0.4821 0.3288 0.4991 0.1290  0.0068  -0.1010 37  TRP A CG    
246  C CD1   . TRP A 37  ? 0.5112 0.3310 0.5165 0.1363  0.0001  -0.1046 37  TRP A CD1   
247  C CD2   . TRP A 37  ? 0.4806 0.3392 0.5215 0.1413  -0.0035 -0.1062 37  TRP A CD2   
248  N NE1   . TRP A 37  ? 0.5293 0.3413 0.5490 0.1537  -0.0148 -0.1121 37  TRP A NE1   
249  C CE2   . TRP A 37  ? 0.5136 0.3506 0.5569 0.1575  -0.0179 -0.1138 37  TRP A CE2   
250  C CE3   . TRP A 37  ? 0.4567 0.3418 0.5182 0.1406  -0.0027 -0.1063 37  TRP A CE3   
251  C CZ2   . TRP A 37  ? 0.5220 0.3634 0.5883 0.1742  -0.0332 -0.1220 37  TRP A CZ2   
252  C CZ3   . TRP A 37  ? 0.4677 0.3587 0.5525 0.1557  -0.0165 -0.1143 37  TRP A CZ3   
253  C CH2   . TRP A 37  ? 0.4961 0.3659 0.5839 0.1728  -0.0324 -0.1223 37  TRP A CH2   
254  N N     . LEU A 38  ? 0.4347 0.3452 0.4497 0.0881  0.0534  -0.0965 38  LEU A N     
255  C CA    . LEU A 38  ? 0.4183 0.3370 0.4207 0.0757  0.0597  -0.0883 38  LEU A CA    
256  C C     . LEU A 38  ? 0.4008 0.3202 0.4005 0.0743  0.0503  -0.0765 38  LEU A C     
257  O O     . LEU A 38  ? 0.3836 0.3109 0.3999 0.0813  0.0441  -0.0771 38  LEU A O     
258  C CB    . LEU A 38  ? 0.4106 0.3510 0.4277 0.0724  0.0725  -0.0962 38  LEU A CB    
259  C CG    . LEU A 38  ? 0.3959 0.3440 0.4008 0.0610  0.0780  -0.0883 38  LEU A CG    
260  C CD1   . LEU A 38  ? 0.3952 0.3293 0.3723 0.0527  0.0775  -0.0811 38  LEU A CD1   
261  C CD2   . LEU A 38  ? 0.4043 0.3674 0.4181 0.0560  0.0931  -0.0977 38  LEU A CD2   
262  N N     . VAL A 39  ? 0.4031 0.3145 0.3826 0.0652  0.0490  -0.0672 39  VAL A N     
263  C CA    . VAL A 39  ? 0.3951 0.3042 0.3681 0.0618  0.0413  -0.0565 39  VAL A CA    
264  C C     . VAL A 39  ? 0.3848 0.3089 0.3555 0.0534  0.0471  -0.0529 39  VAL A C     
265  O O     . VAL A 39  ? 0.3787 0.3015 0.3381 0.0475  0.0526  -0.0546 39  VAL A O     
266  C CB    . VAL A 39  ? 0.4020 0.2902 0.3551 0.0569  0.0368  -0.0517 39  VAL A CB    
267  C CG1   . VAL A 39  ? 0.4028 0.2907 0.3490 0.0506  0.0323  -0.0427 39  VAL A CG1   
268  C CG2   . VAL A 39  ? 0.4322 0.2996 0.3825 0.0652  0.0305  -0.0547 39  VAL A CG2   
269  N N     . VAL A 40  ? 0.3778 0.3138 0.3574 0.0535  0.0447  -0.0484 40  VAL A N     
270  C CA    . VAL A 40  ? 0.3753 0.3237 0.3527 0.0467  0.0494  -0.0452 40  VAL A CA    
271  C C     . VAL A 40  ? 0.3663 0.3169 0.3443 0.0454  0.0418  -0.0367 40  VAL A C     
272  O O     . VAL A 40  ? 0.3426 0.2919 0.3291 0.0510  0.0355  -0.0352 40  VAL A O     
273  C CB    . VAL A 40  ? 0.3881 0.3513 0.3799 0.0479  0.0576  -0.0515 40  VAL A CB    
274  C CG1   . VAL A 40  ? 0.4043 0.3752 0.3897 0.0407  0.0613  -0.0469 40  VAL A CG1   
275  C CG2   . VAL A 40  ? 0.4095 0.3709 0.3999 0.0475  0.0675  -0.0611 40  VAL A CG2   
276  N N     . ALA A 41  ? 0.3619 0.3143 0.3294 0.0383  0.0416  -0.0320 41  ALA A N     
277  C CA    . ALA A 41  ? 0.3399 0.2969 0.3085 0.0359  0.0364  -0.0253 41  ALA A CA    
278  C C     . ALA A 41  ? 0.3180 0.2871 0.2887 0.0332  0.0397  -0.0237 41  ALA A C     
279  O O     . ALA A 41  ? 0.3034 0.2718 0.2647 0.0299  0.0440  -0.0258 41  ALA A O     
280  C CB    . ALA A 41  ? 0.3377 0.2868 0.2952 0.0303  0.0329  -0.0229 41  ALA A CB    
281  N N     . ILE A 42  ? 0.3086 0.2856 0.2889 0.0346  0.0371  -0.0202 42  ILE A N     
282  C CA    . ILE A 42  ? 0.3074 0.2941 0.2894 0.0317  0.0401  -0.0185 42  ILE A CA    
283  C C     . ILE A 42  ? 0.3042 0.2946 0.2870 0.0299  0.0342  -0.0123 42  ILE A C     
284  O O     . ILE A 42  ? 0.3095 0.2994 0.2986 0.0325  0.0292  -0.0100 42  ILE A O     
285  C CB    . ILE A 42  ? 0.3201 0.3164 0.3176 0.0348  0.0456  -0.0235 42  ILE A CB    
286  C CG1   . ILE A 42  ? 0.3283 0.3219 0.3270 0.0364  0.0527  -0.0316 42  ILE A CG1   
287  C CG2   . ILE A 42  ? 0.3088 0.3133 0.3073 0.0302  0.0507  -0.0228 42  ILE A CG2   
288  C CD1   . ILE A 42  ? 0.3381 0.3400 0.3584 0.0434  0.0525  -0.0382 42  ILE A CD1   
289  N N     . PHE A 43  ? 0.2937 0.2854 0.2681 0.0258  0.0339  -0.0100 43  PHE A N     
290  C CA    . PHE A 43  ? 0.2810 0.2779 0.2580 0.0244  0.0298  -0.0056 43  PHE A CA    
291  C C     . PHE A 43  ? 0.2763 0.2791 0.2568 0.0236  0.0343  -0.0053 43  PHE A C     
292  O O     . PHE A 43  ? 0.2902 0.2890 0.2613 0.0211  0.0397  -0.0075 43  PHE A O     
293  C CB    . PHE A 43  ? 0.2916 0.2860 0.2594 0.0215  0.0254  -0.0050 43  PHE A CB    
294  C CG    . PHE A 43  ? 0.2968 0.2965 0.2666 0.0203  0.0218  -0.0019 43  PHE A CG    
295  C CD1   . PHE A 43  ? 0.2966 0.3005 0.2743 0.0197  0.0191  0.0003  43  PHE A CD1   
296  C CD2   . PHE A 43  ? 0.3148 0.3124 0.2760 0.0195  0.0210  -0.0012 43  PHE A CD2   
297  C CE1   . PHE A 43  ? 0.2917 0.3006 0.2716 0.0185  0.0163  0.0024  43  PHE A CE1   
298  C CE2   . PHE A 43  ? 0.3139 0.3151 0.2769 0.0191  0.0170  0.0012  43  PHE A CE2   
299  C CZ    . PHE A 43  ? 0.2953 0.3038 0.2693 0.0187  0.0150  0.0026  43  PHE A CZ    
300  N N     . SER A 44  ? 0.2592 0.2698 0.2516 0.0248  0.0327  -0.0034 44  SER A N     
301  C CA    . SER A 44  ? 0.2598 0.2778 0.2593 0.0231  0.0385  -0.0052 44  SER A CA    
302  C C     . SER A 44  ? 0.2511 0.2743 0.2547 0.0219  0.0347  -0.0010 44  SER A C     
303  O O     . SER A 44  ? 0.2699 0.2950 0.2796 0.0245  0.0283  0.0013  44  SER A O     
304  C CB    . SER A 44  ? 0.2551 0.2812 0.2727 0.0271  0.0414  -0.0113 44  SER A CB    
305  O OG    . SER A 44  ? 0.2708 0.3060 0.2978 0.0238  0.0493  -0.0159 44  SER A OG    
306  N N     . VAL A 45  ? 0.2488 0.2720 0.2471 0.0175  0.0388  -0.0004 45  VAL A N     
307  C CA    . VAL A 45  ? 0.2395 0.2670 0.2412 0.0158  0.0359  0.0029  45  VAL A CA    
308  C C     . VAL A 45  ? 0.2468 0.2797 0.2550 0.0115  0.0449  -0.0013 45  VAL A C     
309  O O     . VAL A 45  ? 0.2558 0.2814 0.2524 0.0068  0.0534  -0.0040 45  VAL A O     
310  C CB    . VAL A 45  ? 0.2445 0.2628 0.2296 0.0137  0.0318  0.0072  45  VAL A CB    
311  C CG1   . VAL A 45  ? 0.2458 0.2678 0.2344 0.0125  0.0287  0.0102  45  VAL A CG1   
312  C CG2   . VAL A 45  ? 0.2514 0.2672 0.2334 0.0165  0.0248  0.0082  45  VAL A CG2   
313  N N     . THR A 46  ? 0.2392 0.2842 0.2658 0.0126  0.0438  -0.0034 46  THR A N     
314  C CA    . THR A 46  ? 0.2529 0.3070 0.2916 0.0080  0.0531  -0.0103 46  THR A CA    
315  C C     . THR A 46  ? 0.2668 0.3260 0.3107 0.0050  0.0509  -0.0083 46  THR A C     
316  O O     . THR A 46  ? 0.2829 0.3477 0.3362 0.0100  0.0413  -0.0057 46  THR A O     
317  C CB    . THR A 46  ? 0.2431 0.3113 0.3068 0.0132  0.0539  -0.0195 46  THR A CB    
318  O OG1   . THR A 46  ? 0.2665 0.3284 0.3241 0.0159  0.0561  -0.0214 46  THR A OG1   
319  C CG2   . THR A 46  ? 0.2398 0.3205 0.3201 0.0076  0.0652  -0.0299 46  THR A CG2   
320  N N     . VAL A 47  ? 0.2888 0.3434 0.3237 -0.0036 0.0600  -0.0095 47  VAL A N     
321  C CA    . VAL A 47  ? 0.2723 0.3282 0.3080 -0.0079 0.0592  -0.0075 47  VAL A CA    
322  C C     . VAL A 47  ? 0.2919 0.3508 0.3315 -0.0181 0.0734  -0.0154 47  VAL A C     
323  O O     . VAL A 47  ? 0.3089 0.3630 0.3420 -0.0236 0.0848  -0.0207 47  VAL A O     
324  C CB    . VAL A 47  ? 0.2815 0.3195 0.2915 -0.0094 0.0548  0.0011  47  VAL A CB    
325  C CG1   . VAL A 47  ? 0.2775 0.3137 0.2846 -0.0013 0.0431  0.0067  47  VAL A CG1   
326  C CG2   . VAL A 47  ? 0.3092 0.3271 0.2920 -0.0159 0.0630  0.0015  47  VAL A CG2   
327  N N     . ASP A 48  ? 0.3020 0.3680 0.3513 -0.0219 0.0734  -0.0168 48  ASP A N     
328  C CA    . ASP A 48  ? 0.3373 0.4032 0.3867 -0.0344 0.0876  -0.0238 48  ASP A CA    
329  C C     . ASP A 48  ? 0.3671 0.4032 0.3768 -0.0435 0.0959  -0.0183 48  ASP A C     
330  O O     . ASP A 48  ? 0.3608 0.3787 0.3464 -0.0393 0.0866  -0.0082 48  ASP A O     
331  C CB    . ASP A 48  ? 0.3313 0.4074 0.3951 -0.0357 0.0825  -0.0242 48  ASP A CB    
332  C CG    . ASP A 48  ? 0.3525 0.4337 0.4240 -0.0486 0.0970  -0.0339 48  ASP A CG    
333  O OD1   . ASP A 48  ? 0.3586 0.4612 0.4594 -0.0508 0.1047  -0.0476 48  ASP A OD1   
334  O OD2   . ASP A 48  ? 0.3639 0.4266 0.4118 -0.0569 0.1011  -0.0289 48  ASP A OD2   
335  N N     . LYS A 49  ? 0.4014 0.4318 0.4044 -0.0562 0.1129  -0.0260 49  LYS A N     
336  C CA    . LYS A 49  ? 0.4591 0.4560 0.4192 -0.0660 0.1217  -0.0219 49  LYS A CA    
337  C C     . LYS A 49  ? 0.4612 0.4350 0.3942 -0.0674 0.1144  -0.0121 49  LYS A C     
338  O O     . LYS A 49  ? 0.4587 0.4008 0.3528 -0.0700 0.1138  -0.0059 49  LYS A O     
339  C CB    . LYS A 49  ? 0.5145 0.5090 0.4725 -0.0829 0.1445  -0.0339 49  LYS A CB    
340  C CG    . LYS A 49  ? 0.5380 0.5438 0.5130 -0.0931 0.1527  -0.0409 49  LYS A CG    
341  C CD    . LYS A 49  ? 0.5749 0.6136 0.5919 -0.0974 0.1649  -0.0583 49  LYS A CD    
342  C CE    . LYS A 49  ? 0.6404 0.6668 0.6416 -0.1144 0.1890  -0.0689 49  LYS A CE    
343  N NZ    . LYS A 49  ? 0.6800 0.6907 0.6639 -0.1331 0.2041  -0.0725 49  LYS A NZ    
344  N N     . LYS A 50  ? 0.4410 0.4299 0.3944 -0.0658 0.1087  -0.0119 50  LYS A N     
345  C CA    . LYS A 50  ? 0.4740 0.4463 0.4091 -0.0646 0.0994  -0.0034 50  LYS A CA    
346  C C     . LYS A 50  ? 0.4570 0.4156 0.3742 -0.0520 0.0831  0.0064  50  LYS A C     
347  O O     . LYS A 50  ? 0.4432 0.3765 0.3319 -0.0515 0.0768  0.0126  50  LYS A O     
348  C CB    . LYS A 50  ? 0.5090 0.5078 0.4777 -0.0620 0.0945  -0.0065 50  LYS A CB    
349  C CG    . LYS A 50  ? 0.5618 0.5585 0.5289 -0.0545 0.0799  0.0012  50  LYS A CG    
350  C CD    . LYS A 50  ? 0.5818 0.6085 0.5848 -0.0467 0.0713  -0.0015 50  LYS A CD    
351  C CE    . LYS A 50  ? 0.6246 0.6724 0.6555 -0.0540 0.0799  -0.0125 50  LYS A CE    
352  N NZ    . LYS A 50  ? 0.6705 0.7358 0.7236 -0.0472 0.0677  -0.0124 50  LYS A NZ    
353  N N     . ASP A 51  ? 0.4150 0.3901 0.3495 -0.0422 0.0763  0.0063  51  ASP A N     
354  C CA    . ASP A 51  ? 0.3994 0.3652 0.3211 -0.0318 0.0631  0.0127  51  ASP A CA    
355  C C     . ASP A 51  ? 0.4081 0.3590 0.3097 -0.0314 0.0654  0.0125  51  ASP A C     
356  O O     . ASP A 51  ? 0.4089 0.3604 0.3098 -0.0228 0.0559  0.0148  51  ASP A O     
357  C CB    . ASP A 51  ? 0.3571 0.3472 0.3073 -0.0222 0.0537  0.0130  51  ASP A CB    
358  C CG    . ASP A 51  ? 0.3446 0.3402 0.3029 -0.0198 0.0460  0.0158  51  ASP A CG    
359  O OD1   . ASP A 51  ? 0.3743 0.3529 0.3135 -0.0193 0.0406  0.0198  51  ASP A OD1   
360  O OD2   . ASP A 51  ? 0.3128 0.3281 0.2952 -0.0177 0.0443  0.0136  51  ASP A OD2   
361  N N     . LEU A 52  ? 0.4133 0.3493 0.2969 -0.0418 0.0787  0.0091  52  LEU A N     
362  C CA    . LEU A 52  ? 0.4481 0.3658 0.3076 -0.0424 0.0812  0.0089  52  LEU A CA    
363  C C     . LEU A 52  ? 0.4663 0.3574 0.2947 -0.0352 0.0660  0.0160  52  LEU A C     
364  O O     . LEU A 52  ? 0.4646 0.3522 0.2868 -0.0290 0.0596  0.0164  52  LEU A O     
365  C CB    . LEU A 52  ? 0.4594 0.3613 0.2997 -0.0573 0.1000  0.0036  52  LEU A CB    
366  C CG    . LEU A 52  ? 0.4959 0.3806 0.3131 -0.0640 0.1111  -0.0001 52  LEU A CG    
367  C CD1   . LEU A 52  ? 0.4741 0.3785 0.3123 -0.0560 0.1090  -0.0035 52  LEU A CD1   
368  C CD2   . LEU A 52  ? 0.5091 0.3930 0.3261 -0.0810 0.1336  -0.0090 52  LEU A CD2   
369  N N     . PHE A 53  ? 0.4873 0.3623 0.3002 -0.0349 0.0589  0.0204  53  PHE A N     
370  C CA    . PHE A 53  ? 0.4997 0.3490 0.2846 -0.0270 0.0430  0.0249  53  PHE A CA    
371  C C     . PHE A 53  ? 0.4526 0.3255 0.2644 -0.0133 0.0282  0.0248  53  PHE A C     
372  O O     . PHE A 53  ? 0.4416 0.3021 0.2392 -0.0057 0.0162  0.0250  53  PHE A O     
373  C CB    . PHE A 53  ? 0.5437 0.3677 0.3048 -0.0298 0.0391  0.0286  53  PHE A CB    
374  C CG    . PHE A 53  ? 0.5535 0.3990 0.3425 -0.0246 0.0322  0.0294  53  PHE A CG    
375  C CD1   . PHE A 53  ? 0.5667 0.4164 0.3634 -0.0115 0.0142  0.0304  53  PHE A CD1   
376  C CD2   . PHE A 53  ? 0.5958 0.4604 0.4073 -0.0329 0.0438  0.0274  53  PHE A CD2   
377  C CE1   . PHE A 53  ? 0.5504 0.4215 0.3740 -0.0076 0.0095  0.0302  53  PHE A CE1   
378  C CE2   . PHE A 53  ? 0.5785 0.4617 0.4142 -0.0281 0.0369  0.0282  53  PHE A CE2   
379  C CZ    . PHE A 53  ? 0.5585 0.4439 0.3986 -0.0159 0.0205  0.0299  53  PHE A CZ    
380  N N     . LEU A 54  ? 0.4067 0.3120 0.2557 -0.0111 0.0295  0.0234  54  LEU A N     
381  C CA    . LEU A 54  ? 0.3767 0.3019 0.2483 -0.0013 0.0189  0.0225  54  LEU A CA    
382  C C     . LEU A 54  ? 0.3603 0.2922 0.2365 0.0001  0.0216  0.0199  54  LEU A C     
383  O O     . LEU A 54  ? 0.3352 0.2696 0.2140 0.0071  0.0119  0.0187  54  LEU A O     
384  C CB    . LEU A 54  ? 0.3664 0.3173 0.2687 -0.0005 0.0196  0.0222  54  LEU A CB    
385  C CG    . LEU A 54  ? 0.3577 0.3284 0.2824 0.0066  0.0121  0.0207  54  LEU A CG    
386  C CD1   . LEU A 54  ? 0.3834 0.3472 0.3019 0.0134  -0.0006 0.0197  54  LEU A CD1   
387  C CD2   . LEU A 54  ? 0.3329 0.3250 0.2829 0.0057  0.0148  0.0207  54  LEU A CD2   
388  N N     . LEU A 55  ? 0.3670 0.3018 0.2449 -0.0066 0.0349  0.0178  55  LEU A N     
389  C CA    . LEU A 55  ? 0.3658 0.3023 0.2433 -0.0053 0.0376  0.0149  55  LEU A CA    
390  C C     . LEU A 55  ? 0.3965 0.3052 0.2400 -0.0036 0.0309  0.0158  55  LEU A C     
391  O O     . LEU A 55  ? 0.3945 0.3057 0.2399 0.0022  0.0238  0.0141  55  LEU A O     
392  C CB    . LEU A 55  ? 0.3749 0.3177 0.2592 -0.0127 0.0533  0.0105  55  LEU A CB    
393  C CG    . LEU A 55  ? 0.3571 0.3266 0.2752 -0.0133 0.0589  0.0073  55  LEU A CG    
394  C CD1   . LEU A 55  ? 0.3618 0.3368 0.2868 -0.0198 0.0740  0.0000  55  LEU A CD1   
395  C CD2   . LEU A 55  ? 0.3253 0.3127 0.2661 -0.0043 0.0491  0.0083  55  LEU A CD2   
396  N N     . GLU A 56  ? 0.4124 0.2935 0.2245 -0.0082 0.0316  0.0180  56  GLU A N     
397  C CA    . GLU A 56  ? 0.4563 0.3060 0.2316 -0.0056 0.0223  0.0190  56  GLU A CA    
398  C C     . GLU A 56  ? 0.4432 0.2940 0.2224 0.0067  0.0020  0.0186  56  GLU A C     
399  O O     . GLU A 56  ? 0.4381 0.2818 0.2080 0.0120  -0.0066 0.0161  56  GLU A O     
400  C CB    . GLU A 56  ? 0.5062 0.3206 0.2418 -0.0140 0.0275  0.0217  56  GLU A CB    
401  C CG    . GLU A 56  ? 0.5299 0.3434 0.2611 -0.0277 0.0495  0.0188  56  GLU A CG    
402  C CD    . GLU A 56  ? 0.6061 0.3843 0.2975 -0.0401 0.0596  0.0203  56  GLU A CD    
403  O OE1   . GLU A 56  ? 0.6385 0.4086 0.3251 -0.0409 0.0557  0.0237  56  GLU A OE1   
404  O OE2   . GLU A 56  ? 0.6600 0.4182 0.3249 -0.0505 0.0732  0.0176  56  GLU A OE2   
405  N N     . SER A 57  ? 0.4198 0.2829 0.2170 0.0108  -0.0045 0.0195  57  SER A N     
406  C CA    . SER A 57  ? 0.4154 0.2887 0.2275 0.0218  -0.0212 0.0163  57  SER A CA    
407  C C     . SER A 57  ? 0.3696 0.2684 0.2087 0.0252  -0.0219 0.0119  57  SER A C     
408  O O     . SER A 57  ? 0.3615 0.2581 0.1992 0.0322  -0.0341 0.0072  57  SER A O     
409  C CB    . SER A 57  ? 0.4020 0.2888 0.2334 0.0236  -0.0239 0.0170  57  SER A CB    
410  O OG    . SER A 57  ? 0.4621 0.3223 0.2662 0.0205  -0.0243 0.0208  57  SER A OG    
411  N N     . LEU A 58  ? 0.3455 0.2658 0.2070 0.0203  -0.0095 0.0126  58  LEU A N     
412  C CA    . LEU A 58  ? 0.3452 0.2846 0.2274 0.0219  -0.0083 0.0091  58  LEU A CA    
413  C C     . LEU A 58  ? 0.3550 0.2836 0.2224 0.0227  -0.0093 0.0065  58  LEU A C     
414  O O     . LEU A 58  ? 0.3588 0.2964 0.2370 0.0267  -0.0158 0.0018  58  LEU A O     
415  C CB    . LEU A 58  ? 0.3468 0.3053 0.2507 0.0174  0.0037  0.0107  58  LEU A CB    
416  C CG    . LEU A 58  ? 0.3588 0.3326 0.2825 0.0177  0.0027  0.0121  58  LEU A CG    
417  C CD1   . LEU A 58  ? 0.3636 0.3503 0.3028 0.0137  0.0130  0.0135  58  LEU A CD1   
418  C CD2   . LEU A 58  ? 0.3521 0.3391 0.2924 0.0217  -0.0045 0.0083  58  LEU A CD2   
419  N N     . LYS A 59  ? 0.3709 0.2796 0.2131 0.0176  -0.0020 0.0087  59  LYS A N     
420  C CA    . LYS A 59  ? 0.3949 0.2883 0.2168 0.0176  -0.0029 0.0063  59  LYS A CA    
421  C C     . LYS A 59  ? 0.4083 0.2856 0.2131 0.0254  -0.0210 0.0035  59  LYS A C     
422  O O     . LYS A 59  ? 0.3857 0.2647 0.1918 0.0292  -0.0278 -0.0011 59  LYS A O     
423  C CB    . LYS A 59  ? 0.4284 0.3005 0.2229 0.0089  0.0099  0.0083  59  LYS A CB    
424  C CG    . LYS A 59  ? 0.4697 0.3253 0.2418 0.0077  0.0112  0.0055  59  LYS A CG    
425  C CD    . LYS A 59  ? 0.5097 0.3478 0.2584 -0.0031 0.0284  0.0057  59  LYS A CD    
426  C CE    . LYS A 59  ? 0.5646 0.3685 0.2704 -0.0048 0.0252  0.0046  59  LYS A CE    
427  N NZ    . LYS A 59  ? 0.5926 0.3992 0.2980 -0.0117 0.0412  0.0002  59  LYS A NZ    
428  N N     . THR A 60  ? 0.4415 0.3017 0.2294 0.0278  -0.0293 0.0057  60  THR A N     
429  C CA    . THR A 60  ? 0.4821 0.3247 0.2535 0.0374  -0.0500 0.0019  60  THR A CA    
430  C C     . THR A 60  ? 0.4368 0.3082 0.2443 0.0452  -0.0607 -0.0057 60  THR A C     
431  O O     . THR A 60  ? 0.4110 0.2817 0.2188 0.0515  -0.0730 -0.0127 60  THR A O     
432  C CB    . THR A 60  ? 0.5265 0.3433 0.2729 0.0390  -0.0571 0.0058  60  THR A CB    
433  O OG1   . THR A 60  ? 0.5785 0.3649 0.2869 0.0295  -0.0458 0.0115  60  THR A OG1   
434  C CG2   . THR A 60  ? 0.5655 0.3629 0.2956 0.0512  -0.0815 0.0005  60  THR A CG2   
435  N N     . PHE A 61  ? 0.4062 0.3032 0.2444 0.0434  -0.0541 -0.0051 61  PHE A N     
436  C CA    . PHE A 61  ? 0.3762 0.3021 0.2497 0.0471  -0.0587 -0.0128 61  PHE A CA    
437  C C     . PHE A 61  ? 0.3646 0.3017 0.2484 0.0456  -0.0559 -0.0177 61  PHE A C     
438  O O     . PHE A 61  ? 0.3387 0.2854 0.2360 0.0506  -0.0667 -0.0274 61  PHE A O     
439  C CB    . PHE A 61  ? 0.3462 0.2935 0.2448 0.0429  -0.0490 -0.0100 61  PHE A CB    
440  C CG    . PHE A 61  ? 0.3157 0.2884 0.2458 0.0444  -0.0516 -0.0183 61  PHE A CG    
441  C CD1   . PHE A 61  ? 0.3253 0.3042 0.2672 0.0502  -0.0622 -0.0252 61  PHE A CD1   
442  C CD2   . PHE A 61  ? 0.3004 0.2890 0.2467 0.0395  -0.0429 -0.0201 61  PHE A CD2   
443  C CE1   . PHE A 61  ? 0.3090 0.3121 0.2807 0.0497  -0.0623 -0.0350 61  PHE A CE1   
444  C CE2   . PHE A 61  ? 0.2883 0.2974 0.2603 0.0386  -0.0433 -0.0287 61  PHE A CE2   
445  C CZ    . PHE A 61  ? 0.2878 0.3053 0.2733 0.0428  -0.0519 -0.0366 61  PHE A CZ    
446  N N     . PHE A 62  ? 0.3714 0.3069 0.2494 0.0388  -0.0419 -0.0124 62  PHE A N     
447  C CA    . PHE A 62  ? 0.3733 0.3159 0.2578 0.0369  -0.0380 -0.0162 62  PHE A CA    
448  C C     . PHE A 62  ? 0.4076 0.3288 0.2650 0.0385  -0.0431 -0.0180 62  PHE A C     
449  O O     . PHE A 62  ? 0.4109 0.3296 0.2627 0.0342  -0.0337 -0.0171 62  PHE A O     
450  C CB    . PHE A 62  ? 0.3599 0.3139 0.2565 0.0305  -0.0219 -0.0118 62  PHE A CB    
451  C CG    . PHE A 62  ? 0.3468 0.3218 0.2702 0.0290  -0.0185 -0.0121 62  PHE A CG    
452  C CD1   . PHE A 62  ? 0.3504 0.3391 0.2918 0.0296  -0.0229 -0.0196 62  PHE A CD1   
453  C CD2   . PHE A 62  ? 0.3402 0.3200 0.2696 0.0264  -0.0115 -0.0062 62  PHE A CD2   
454  C CE1   . PHE A 62  ? 0.3325 0.3365 0.2938 0.0267  -0.0191 -0.0203 62  PHE A CE1   
455  C CE2   . PHE A 62  ? 0.3283 0.3235 0.2776 0.0249  -0.0096 -0.0064 62  PHE A CE2   
456  C CZ    . PHE A 62  ? 0.3251 0.3311 0.2887 0.0245  -0.0124 -0.0130 62  PHE A CZ    
457  N N     . GLY A 63  ? 0.4389 0.3442 0.2798 0.0451  -0.0590 -0.0214 63  GLY A N     
458  C CA    . GLY A 63  ? 0.4845 0.3674 0.2980 0.0484  -0.0688 -0.0248 63  GLY A CA    
459  C C     . GLY A 63  ? 0.5300 0.3825 0.3040 0.0428  -0.0603 -0.0176 63  GLY A C     
460  O O     . GLY A 63  ? 0.5634 0.3972 0.3133 0.0432  -0.0644 -0.0198 63  GLY A O     
461  N N     . GLY A 64  ? 0.5494 0.3960 0.3157 0.0368  -0.0480 -0.0099 64  GLY A N     
462  C CA    . GLY A 64  ? 0.5571 0.3777 0.2892 0.0287  -0.0356 -0.0050 64  GLY A CA    
463  C C     . GLY A 64  ? 0.5354 0.3695 0.2795 0.0220  -0.0187 -0.0059 64  GLY A C     
464  O O     . GLY A 64  ? 0.5542 0.3695 0.2730 0.0146  -0.0069 -0.0044 64  GLY A O     
465  N N     . LEU A 65  ? 0.4985 0.3630 0.2794 0.0240  -0.0168 -0.0091 65  LEU A N     
466  C CA    . LEU A 65  ? 0.4840 0.3592 0.2760 0.0194  -0.0031 -0.0107 65  LEU A CA    
467  C C     . LEU A 65  ? 0.4503 0.3385 0.2582 0.0137  0.0130  -0.0075 65  LEU A C     
468  O O     . LEU A 65  ? 0.4331 0.3308 0.2541 0.0138  0.0133  -0.0042 65  LEU A O     
469  C CB    . LEU A 65  ? 0.4806 0.3774 0.3004 0.0233  -0.0081 -0.0158 65  LEU A CB    
470  C CG    . LEU A 65  ? 0.5230 0.4104 0.3313 0.0285  -0.0239 -0.0223 65  LEU A CG    
471  C CD1   . LEU A 65  ? 0.5163 0.4272 0.3552 0.0300  -0.0266 -0.0285 65  LEU A CD1   
472  C CD2   . LEU A 65  ? 0.5598 0.4217 0.3344 0.0266  -0.0234 -0.0240 65  LEU A CD2   
473  N N     . GLY A 66  ? 0.4525 0.3407 0.2595 0.0090  0.0264  -0.0097 66  GLY A N     
474  C CA    . GLY A 66  ? 0.4223 0.3281 0.2525 0.0054  0.0405  -0.0098 66  GLY A CA    
475  C C     . GLY A 66  ? 0.4458 0.3379 0.2576 -0.0023 0.0520  -0.0089 66  GLY A C     
476  O O     . GLY A 66  ? 0.4733 0.3387 0.2501 -0.0054 0.0498  -0.0076 66  GLY A O     
477  N N     . SER A 67  ? 0.4227 0.3312 0.2563 -0.0059 0.0638  -0.0104 67  SER A N     
478  C CA    . SER A 67  ? 0.4575 0.3542 0.2754 -0.0155 0.0767  -0.0112 67  SER A CA    
479  C C     . SER A 67  ? 0.4248 0.3428 0.2712 -0.0175 0.0835  -0.0119 67  SER A C     
480  O O     . SER A 67  ? 0.3877 0.3305 0.2679 -0.0115 0.0804  -0.0129 67  SER A O     
481  C CB    . SER A 67  ? 0.4938 0.3797 0.2967 -0.0232 0.0923  -0.0180 67  SER A CB    
482  O OG    . SER A 67  ? 0.4662 0.3760 0.3014 -0.0204 0.0988  -0.0244 67  SER A OG    
483  N N     . ILE A 68  ? 0.4314 0.3358 0.2601 -0.0264 0.0919  -0.0115 68  ILE A N     
484  C CA    . ILE A 68  ? 0.4235 0.3432 0.2731 -0.0299 0.0975  -0.0121 68  ILE A CA    
485  C C     . ILE A 68  ? 0.4392 0.3618 0.2924 -0.0416 0.1188  -0.0218 68  ILE A C     
486  O O     . ILE A 68  ? 0.4604 0.3581 0.2807 -0.0517 0.1295  -0.0238 68  ILE A O     
487  C CB    . ILE A 68  ? 0.4270 0.3267 0.2520 -0.0324 0.0909  -0.0051 68  ILE A CB    
488  C CG1   . ILE A 68  ? 0.4090 0.3071 0.2324 -0.0210 0.0705  0.0015  68  ILE A CG1   
489  C CG2   . ILE A 68  ? 0.4129 0.3283 0.2593 -0.0368 0.0969  -0.0061 68  ILE A CG2   
490  C CD1   . ILE A 68  ? 0.4133 0.2936 0.2167 -0.0208 0.0616  0.0072  68  ILE A CD1   
491  N N     . LYS A 69  ? 0.4301 0.3825 0.3231 -0.0399 0.1241  -0.0288 69  LYS A N     
492  C CA    . LYS A 69  ? 0.4588 0.4223 0.3669 -0.0485 0.1434  -0.0417 69  LYS A CA    
493  C C     . LYS A 69  ? 0.4376 0.4273 0.3817 -0.0496 0.1467  -0.0474 69  LYS A C     
494  O O     . LYS A 69  ? 0.3884 0.3945 0.3555 -0.0394 0.1325  -0.0428 69  LYS A O     
495  C CB    . LYS A 69  ? 0.4592 0.4367 0.3871 -0.0415 0.1442  -0.0488 69  LYS A CB    
496  C CG    . LYS A 69  ? 0.5077 0.4604 0.4014 -0.0445 0.1479  -0.0484 69  LYS A CG    
497  C CD    . LYS A 69  ? 0.5668 0.4970 0.4289 -0.0611 0.1678  -0.0542 69  LYS A CD    
498  C CE    . LYS A 69  ? 0.6243 0.5155 0.4336 -0.0645 0.1637  -0.0465 69  LYS A CE    
499  N NZ    . LYS A 69  ? 0.6293 0.5216 0.4398 -0.0541 0.1536  -0.0456 69  LYS A NZ    
500  N N     . LYS A 70  ? 0.4539 0.4479 0.4037 -0.0623 0.1661  -0.0590 70  LYS A N     
501  C CA    . LYS A 70  ? 0.4467 0.4717 0.4394 -0.0623 0.1697  -0.0690 70  LYS A CA    
502  C C     . LYS A 70  ? 0.4246 0.4779 0.4585 -0.0462 0.1576  -0.0737 70  LYS A C     
503  O O     . LYS A 70  ? 0.4077 0.4625 0.4453 -0.0420 0.1599  -0.0789 70  LYS A O     
504  C CB    . LYS A 70  ? 0.4537 0.4835 0.4525 -0.0784 0.1939  -0.0847 70  LYS A CB    
505  C CG    . LYS A 70  ? 0.4441 0.5043 0.4852 -0.0797 0.1967  -0.0954 70  LYS A CG    
506  C CD    . LYS A 70  ? 0.4721 0.5504 0.5381 -0.0911 0.2198  -0.1175 70  LYS A CD    
507  C CE    . LYS A 70  ? 0.4800 0.5802 0.5760 -0.1000 0.2282  -0.1291 70  LYS A CE    
508  N NZ    . LYS A 70  ? 0.4810 0.6192 0.6307 -0.0979 0.2364  -0.1523 70  LYS A NZ    
509  N N     . SER A 71  ? 0.4075 0.4788 0.4675 -0.0375 0.1441  -0.0712 71  SER A N     
510  C CA    . SER A 71  ? 0.3895 0.4838 0.4860 -0.0228 0.1315  -0.0761 71  SER A CA    
511  C C     . SER A 71  ? 0.3879 0.5114 0.5271 -0.0239 0.1376  -0.0932 71  SER A C     
512  O O     . SER A 71  ? 0.3865 0.5244 0.5487 -0.0225 0.1453  -0.1078 71  SER A O     
513  C CB    . SER A 71  ? 0.3655 0.4563 0.4585 -0.0116 0.1105  -0.0621 71  SER A CB    
514  O OG    . SER A 71  ? 0.3526 0.4549 0.4681 0.0017  0.0987  -0.0651 71  SER A OG    
515  N N     . GLY A 72  ? 0.3991 0.5317 0.5496 -0.0262 0.1339  -0.0925 72  GLY A N     
516  C CA    . GLY A 72  ? 0.4118 0.5726 0.6032 -0.0273 0.1381  -0.1093 72  GLY A CA    
517  C C     . GLY A 72  ? 0.4567 0.6151 0.6400 -0.0465 0.1581  -0.1154 72  GLY A C     
518  O O     . GLY A 72  ? 0.5013 0.6338 0.6454 -0.0585 0.1695  -0.1077 72  GLY A O     
519  N N     . ASN A 73  ? 0.4645 0.6485 0.6842 -0.0488 0.1603  -0.1294 73  ASN A N     
520  C CA    . ASN A 73  ? 0.5120 0.6982 0.7314 -0.0673 0.1790  -0.1379 73  ASN A CA    
521  C C     . ASN A 73  ? 0.4992 0.6545 0.6732 -0.0764 0.1792  -0.1196 73  ASN A C     
522  O O     . ASN A 73  ? 0.5098 0.6456 0.6556 -0.0940 0.1980  -0.1204 73  ASN A O     
523  C CB    . ASN A 73  ? 0.5460 0.7656 0.8137 -0.0636 0.1725  -0.1523 73  ASN A CB    
524  C CG    . ASN A 73  ? 0.6044 0.8440 0.8985 -0.0809 0.1967  -0.1758 73  ASN A CG    
525  O OD1   . ASN A 73  ? 0.7119 0.9778 1.0448 -0.0781 0.2029  -0.1966 73  ASN A OD1   
526  N ND2   . ASN A 73  ? 0.6099 0.8363 0.8828 -0.0997 0.2117  -0.1741 73  ASN A ND2   
527  N N     . SER A 74  ? 0.4472 0.5963 0.6131 -0.0643 0.1581  -0.1040 74  SER A N     
528  C CA    . SER A 74  ? 0.4749 0.5967 0.6019 -0.0705 0.1560  -0.0881 74  SER A CA    
529  C C     . SER A 74  ? 0.4074 0.5105 0.5086 -0.0573 0.1370  -0.0689 74  SER A C     
530  O O     . SER A 74  ? 0.3978 0.4855 0.4776 -0.0575 0.1293  -0.0569 74  SER A O     
531  C CB    . SER A 74  ? 0.5062 0.6431 0.6543 -0.0739 0.1531  -0.0922 74  SER A CB    
532  O OG    . SER A 74  ? 0.5373 0.7029 0.7265 -0.0589 0.1376  -0.0989 74  SER A OG    
533  N N     . THR A 75  ? 0.3646 0.4699 0.4696 -0.0463 0.1300  -0.0677 75  THR A N     
534  C CA    . THR A 75  ? 0.3540 0.4419 0.4348 -0.0361 0.1149  -0.0521 75  THR A CA    
535  C C     . THR A 75  ? 0.3422 0.4095 0.3940 -0.0397 0.1228  -0.0497 75  THR A C     
536  O O     . THR A 75  ? 0.3842 0.4525 0.4373 -0.0484 0.1397  -0.0608 75  THR A O     
537  C CB    . THR A 75  ? 0.3373 0.4405 0.4421 -0.0204 0.0981  -0.0513 75  THR A CB    
538  O OG1   . THR A 75  ? 0.3819 0.5024 0.5138 -0.0171 0.1033  -0.0652 75  THR A OG1   
539  C CG2   . THR A 75  ? 0.3271 0.4442 0.4520 -0.0168 0.0880  -0.0515 75  THR A CG2   
540  N N     . PHE A 76  ? 0.3126 0.3611 0.3381 -0.0342 0.1117  -0.0366 76  PHE A N     
541  C CA    . PHE A 76  ? 0.3243 0.3517 0.3204 -0.0347 0.1135  -0.0324 76  PHE A CA    
542  C C     . PHE A 76  ? 0.2989 0.3280 0.2979 -0.0211 0.0965  -0.0248 76  PHE A C     
543  O O     . PHE A 76  ? 0.2813 0.3155 0.2874 -0.0150 0.0842  -0.0185 76  PHE A O     
544  C CB    . PHE A 76  ? 0.3561 0.3530 0.3107 -0.0435 0.1163  -0.0248 76  PHE A CB    
545  C CG    . PHE A 76  ? 0.3945 0.3794 0.3337 -0.0592 0.1359  -0.0321 76  PHE A CG    
546  C CD1   . PHE A 76  ? 0.4059 0.4007 0.3593 -0.0680 0.1447  -0.0378 76  PHE A CD1   
547  C CD2   . PHE A 76  ? 0.4325 0.3957 0.3425 -0.0666 0.1471  -0.0347 76  PHE A CD2   
548  C CE1   . PHE A 76  ? 0.4292 0.4128 0.3686 -0.0851 0.1656  -0.0465 76  PHE A CE1   
549  C CE2   . PHE A 76  ? 0.4673 0.4162 0.3591 -0.0835 0.1676  -0.0423 76  PHE A CE2   
550  C CZ    . PHE A 76  ? 0.4641 0.4246 0.3726 -0.0932 0.1777  -0.0488 76  PHE A CZ    
551  N N     . SER A 77  ? 0.3065 0.3310 0.2998 -0.0175 0.0967  -0.0261 77  SER A N     
552  C CA    . SER A 77  ? 0.3011 0.3243 0.2938 -0.0072 0.0829  -0.0199 77  SER A CA    
553  C C     . SER A 77  ? 0.3123 0.3126 0.2719 -0.0087 0.0803  -0.0139 77  SER A C     
554  O O     . SER A 77  ? 0.3489 0.3346 0.2880 -0.0156 0.0901  -0.0168 77  SER A O     
555  C CB    . SER A 77  ? 0.2961 0.3313 0.3093 -0.0009 0.0836  -0.0271 77  SER A CB    
556  O OG    . SER A 77  ? 0.3244 0.3545 0.3302 -0.0070 0.0976  -0.0352 77  SER A OG    
557  N N     . TYR A 78  ? 0.3035 0.2996 0.2571 -0.0027 0.0671  -0.0068 78  TYR A N     
558  C CA    . TYR A 78  ? 0.3182 0.2977 0.2485 -0.0008 0.0611  -0.0038 78  TYR A CA    
559  C C     . TYR A 78  ? 0.3002 0.2879 0.2434 0.0054  0.0567  -0.0056 78  TYR A C     
560  O O     . TYR A 78  ? 0.2776 0.2772 0.2388 0.0103  0.0501  -0.0040 78  TYR A O     
561  C CB    . TYR A 78  ? 0.3259 0.2982 0.2458 0.0017  0.0493  0.0024  78  TYR A CB    
562  C CG    . TYR A 78  ? 0.3455 0.3061 0.2495 0.0057  0.0399  0.0033  78  TYR A CG    
563  C CD1   . TYR A 78  ? 0.3744 0.3134 0.2495 0.0031  0.0414  0.0022  78  TYR A CD1   
564  C CD2   . TYR A 78  ? 0.3414 0.3110 0.2573 0.0114  0.0294  0.0042  78  TYR A CD2   
565  C CE1   . TYR A 78  ? 0.3838 0.3130 0.2459 0.0077  0.0306  0.0016  78  TYR A CE1   
566  C CE2   . TYR A 78  ? 0.3597 0.3211 0.2645 0.0148  0.0204  0.0027  78  TYR A CE2   
567  C CZ    . TYR A 78  ? 0.3670 0.3091 0.2462 0.0136  0.0201  0.0013  78  TYR A CZ    
568  O OH    . TYR A 78  ? 0.3663 0.3025 0.2379 0.0179  0.0095  -0.0013 78  TYR A OH    
569  N N     . ARG A 79  ? 0.3188 0.2974 0.2500 0.0047  0.0605  -0.0089 79  ARG A N     
570  C CA    . ARG A 79  ? 0.3075 0.2910 0.2485 0.0100  0.0571  -0.0111 79  ARG A CA    
571  C C     . ARG A 79  ? 0.3180 0.2872 0.2388 0.0104  0.0531  -0.0114 79  ARG A C     
572  O O     . ARG A 79  ? 0.3300 0.2834 0.2271 0.0064  0.0561  -0.0119 79  ARG A O     
573  C CB    . ARG A 79  ? 0.3171 0.3089 0.2731 0.0099  0.0669  -0.0182 79  ARG A CB    
574  C CG    . ARG A 79  ? 0.3142 0.3232 0.2962 0.0121  0.0672  -0.0198 79  ARG A CG    
575  C CD    . ARG A 79  ? 0.3156 0.3356 0.3181 0.0142  0.0749  -0.0295 79  ARG A CD    
576  N NE    . ARG A 79  ? 0.3171 0.3524 0.3457 0.0202  0.0686  -0.0308 79  ARG A NE    
577  C CZ    . ARG A 79  ? 0.3361 0.3840 0.3888 0.0248  0.0709  -0.0403 79  ARG A CZ    
578  N NH1   . ARG A 79  ? 0.3499 0.3989 0.4060 0.0233  0.0814  -0.0499 79  ARG A NH1   
579  N NH2   . ARG A 79  ? 0.3417 0.4006 0.4152 0.0312  0.0624  -0.0415 79  ARG A NH2   
580  N N     . ILE A 80  ? 0.3074 0.2810 0.2368 0.0148  0.0462  -0.0114 80  ILE A N     
581  C CA    . ILE A 80  ? 0.3392 0.3032 0.2558 0.0156  0.0427  -0.0138 80  ILE A CA    
582  C C     . ILE A 80  ? 0.3349 0.3038 0.2645 0.0180  0.0466  -0.0178 80  ILE A C     
583  O O     . ILE A 80  ? 0.3352 0.3125 0.2812 0.0211  0.0431  -0.0165 80  ILE A O     
584  C CB    . ILE A 80  ? 0.3228 0.2872 0.2384 0.0177  0.0303  -0.0119 80  ILE A CB    
585  C CG1   . ILE A 80  ? 0.3217 0.2804 0.2257 0.0172  0.0247  -0.0088 80  ILE A CG1   
586  C CG2   . ILE A 80  ? 0.3372 0.2935 0.2421 0.0183  0.0258  -0.0161 80  ILE A CG2   
587  C CD1   . ILE A 80  ? 0.3170 0.2790 0.2245 0.0201  0.0126  -0.0098 80  ILE A CD1   
588  N N     . GLU A 81  ? 0.3643 0.3255 0.2844 0.0166  0.0537  -0.0227 81  GLU A N     
589  C CA    . GLU A 81  ? 0.3747 0.3381 0.3054 0.0194  0.0579  -0.0280 81  GLU A CA    
590  C C     . GLU A 81  ? 0.3789 0.3314 0.2961 0.0193  0.0552  -0.0307 81  GLU A C     
591  O O     . GLU A 81  ? 0.3766 0.3283 0.3002 0.0217  0.0573  -0.0347 81  GLU A O     
592  C CB    . GLU A 81  ? 0.4006 0.3677 0.3379 0.0180  0.0705  -0.0345 81  GLU A CB    
593  C CG    . GLU A 81  ? 0.4141 0.3931 0.3658 0.0169  0.0744  -0.0340 81  GLU A CG    
594  C CD    . GLU A 81  ? 0.4328 0.4215 0.4013 0.0163  0.0865  -0.0437 81  GLU A CD    
595  O OE1   . GLU A 81  ? 0.4499 0.4440 0.4340 0.0218  0.0872  -0.0499 81  GLU A OE1   
596  O OE2   . GLU A 81  ? 0.5012 0.4927 0.4687 0.0101  0.0962  -0.0467 81  GLU A OE2   
597  N N     . SER A 82  ? 0.4014 0.3445 0.2997 0.0170  0.0493  -0.0293 82  SER A N     
598  C CA    . SER A 82  ? 0.4160 0.3499 0.3027 0.0169  0.0445  -0.0328 82  SER A CA    
599  C C     . SER A 82  ? 0.4103 0.3512 0.3102 0.0185  0.0361  -0.0323 82  SER A C     
600  O O     . SER A 82  ? 0.4029 0.3498 0.3074 0.0185  0.0286  -0.0296 82  SER A O     
601  C CB    . SER A 82  ? 0.4257 0.3453 0.2864 0.0149  0.0387  -0.0330 82  SER A CB    
602  O OG    . SER A 82  ? 0.4364 0.3501 0.2904 0.0155  0.0322  -0.0376 82  SER A OG    
603  N N     . SER A 83  ? 0.4152 0.3546 0.3212 0.0193  0.0386  -0.0355 83  SER A N     
604  C CA    . SER A 83  ? 0.4314 0.3716 0.3443 0.0183  0.0336  -0.0369 83  SER A CA    
605  C C     . SER A 83  ? 0.4389 0.3800 0.3465 0.0157  0.0249  -0.0399 83  SER A C     
606  O O     . SER A 83  ? 0.4323 0.3808 0.3499 0.0137  0.0202  -0.0404 83  SER A O     
607  C CB    . SER A 83  ? 0.4620 0.3931 0.3713 0.0189  0.0383  -0.0417 83  SER A CB    
608  O OG    . SER A 83  ? 0.5154 0.4436 0.4299 0.0175  0.0363  -0.0429 83  SER A OG    
609  N N     . GLU A 84  ? 0.4435 0.3764 0.3350 0.0158  0.0225  -0.0432 84  GLU A N     
610  C CA    . GLU A 84  ? 0.4711 0.4037 0.3571 0.0154  0.0120  -0.0476 84  GLU A CA    
611  C C     . GLU A 84  ? 0.4442 0.3837 0.3337 0.0172  0.0046  -0.0449 84  GLU A C     
612  O O     . GLU A 84  ? 0.4378 0.3864 0.3387 0.0168  -0.0026 -0.0489 84  GLU A O     
613  C CB    . GLU A 84  ? 0.5211 0.4382 0.3832 0.0160  0.0106  -0.0507 84  GLU A CB    
614  C CG    . GLU A 84  ? 0.5596 0.4722 0.4118 0.0173  -0.0030 -0.0567 84  GLU A CG    
615  C CD    . GLU A 84  ? 0.6130 0.5078 0.4410 0.0167  -0.0025 -0.0606 84  GLU A CD    
616  O OE1   . GLU A 84  ? 0.6493 0.5429 0.4806 0.0144  0.0042  -0.0639 84  GLU A OE1   
617  O OE2   . GLU A 84  ? 0.6514 0.5305 0.4545 0.0183  -0.0081 -0.0600 84  GLU A OE2   
618  N N     . GLN A 85  ? 0.4658 0.4005 0.3457 0.0186  0.0072  -0.0391 85  GLN A N     
619  C CA    . GLN A 85  ? 0.4508 0.3890 0.3315 0.0206  0.0005  -0.0360 85  GLN A CA    
620  C C     . GLN A 85  ? 0.4063 0.3615 0.3112 0.0198  0.0016  -0.0339 85  GLN A C     
621  O O     . GLN A 85  ? 0.4096 0.3719 0.3218 0.0211  -0.0060 -0.0353 85  GLN A O     
622  C CB    . GLN A 85  ? 0.4940 0.4214 0.3581 0.0202  0.0067  -0.0300 85  GLN A CB    
623  C CG    . GLN A 85  ? 0.5456 0.4504 0.3776 0.0193  0.0066  -0.0313 85  GLN A CG    
624  C CD    . GLN A 85  ? 0.5766 0.4704 0.3927 0.0154  0.0181  -0.0266 85  GLN A CD    
625  O OE1   . GLN A 85  ? 0.6783 0.5523 0.4672 0.0121  0.0229  -0.0280 85  GLN A OE1   
626  N NE2   . GLN A 85  ? 0.5494 0.4551 0.3814 0.0146  0.0235  -0.0222 85  GLN A NE2   
627  N N     . LEU A 86  ? 0.3641 0.3237 0.2795 0.0181  0.0107  -0.0309 86  LEU A N     
628  C CA    . LEU A 86  ? 0.3279 0.2979 0.2605 0.0165  0.0123  -0.0289 86  LEU A CA    
629  C C     . LEU A 86  ? 0.3290 0.3047 0.2705 0.0132  0.0081  -0.0355 86  LEU A C     
630  O O     . LEU A 86  ? 0.3216 0.3066 0.2742 0.0114  0.0059  -0.0363 86  LEU A O     
631  C CB    . LEU A 86  ? 0.3159 0.2839 0.2534 0.0167  0.0206  -0.0254 86  LEU A CB    
632  C CG    . LEU A 86  ? 0.3162 0.2854 0.2545 0.0193  0.0256  -0.0205 86  LEU A CG    
633  C CD1   . LEU A 86  ? 0.3136 0.2812 0.2587 0.0216  0.0314  -0.0204 86  LEU A CD1   
634  C CD2   . LEU A 86  ? 0.2955 0.2730 0.2413 0.0194  0.0231  -0.0159 86  LEU A CD2   
635  N N     . THR A 87  ? 0.3561 0.3266 0.2939 0.0113  0.0084  -0.0412 87  THR A N     
636  C CA    . THR A 87  ? 0.3771 0.3536 0.3245 0.0064  0.0056  -0.0498 87  THR A CA    
637  C C     . THR A 87  ? 0.4030 0.3887 0.3559 0.0083  -0.0050 -0.0570 87  THR A C     
638  O O     . THR A 87  ? 0.4273 0.4246 0.3954 0.0045  -0.0067 -0.0641 87  THR A O     
639  C CB    . THR A 87  ? 0.3937 0.3617 0.3353 0.0036  0.0083  -0.0548 87  THR A CB    
640  O OG1   . THR A 87  ? 0.3916 0.3511 0.3314 0.0019  0.0168  -0.0498 87  THR A OG1   
641  C CG2   . THR A 87  ? 0.4077 0.3833 0.3605 -0.0028 0.0057  -0.0664 87  THR A CG2   
642  N N     . LYS A 88  ? 0.4475 0.4266 0.3871 0.0142  -0.0123 -0.0559 88  LYS A N     
643  C CA    . LYS A 88  ? 0.4836 0.4677 0.4260 0.0184  -0.0258 -0.0632 88  LYS A CA    
644  C C     . LYS A 88  ? 0.4519 0.4436 0.4019 0.0215  -0.0301 -0.0606 88  LYS A C     
645  O O     . LYS A 88  ? 0.4478 0.4508 0.4120 0.0234  -0.0393 -0.0695 88  LYS A O     
646  C CB    . LYS A 88  ? 0.5716 0.5387 0.4896 0.0237  -0.0343 -0.0638 88  LYS A CB    
647  C CG    . LYS A 88  ? 0.6369 0.6015 0.5530 0.0223  -0.0390 -0.0739 88  LYS A CG    
648  C CD    . LYS A 88  ? 0.7093 0.6526 0.5956 0.0273  -0.0481 -0.0745 88  LYS A CD    
649  C CE    . LYS A 88  ? 0.7686 0.7013 0.6393 0.0351  -0.0637 -0.0742 88  LYS A CE    
650  N NZ    . LYS A 88  ? 0.7748 0.6887 0.6212 0.0402  -0.0790 -0.0808 88  LYS A NZ    
651  N N     . ILE A 89  ? 0.4389 0.4251 0.3811 0.0223  -0.0239 -0.0497 89  ILE A N     
652  C CA    . ILE A 89  ? 0.4475 0.4383 0.3940 0.0252  -0.0280 -0.0469 89  ILE A CA    
653  C C     . ILE A 89  ? 0.3956 0.3977 0.3579 0.0207  -0.0186 -0.0425 89  ILE A C     
654  O O     . ILE A 89  ? 0.3988 0.4121 0.3752 0.0204  -0.0218 -0.0466 89  ILE A O     
655  C CB    . ILE A 89  ? 0.5158 0.4886 0.4374 0.0293  -0.0300 -0.0390 89  ILE A CB    
656  C CG1   . ILE A 89  ? 0.5989 0.5558 0.4997 0.0341  -0.0423 -0.0442 89  ILE A CG1   
657  C CG2   . ILE A 89  ? 0.5192 0.4933 0.4420 0.0313  -0.0315 -0.0337 89  ILE A CG2   
658  C CD1   . ILE A 89  ? 0.6003 0.5643 0.5116 0.0390  -0.0586 -0.0567 89  ILE A CD1   
659  N N     . ILE A 90  ? 0.3512 0.3491 0.3103 0.0177  -0.0079 -0.0350 90  ILE A N     
660  C CA    . ILE A 90  ? 0.3100 0.3140 0.2787 0.0147  -0.0014 -0.0300 90  ILE A CA    
661  C C     . ILE A 90  ? 0.2944 0.3061 0.2762 0.0082  0.0018  -0.0360 90  ILE A C     
662  O O     . ILE A 90  ? 0.2847 0.3045 0.2761 0.0058  0.0022  -0.0373 90  ILE A O     
663  C CB    . ILE A 90  ? 0.3111 0.3076 0.2731 0.0150  0.0063  -0.0220 90  ILE A CB    
664  C CG1   . ILE A 90  ? 0.3218 0.3122 0.2724 0.0187  0.0060  -0.0173 90  ILE A CG1   
665  C CG2   . ILE A 90  ? 0.2953 0.2953 0.2653 0.0128  0.0107  -0.0174 90  ILE A CG2   
666  C CD1   . ILE A 90  ? 0.3133 0.3070 0.2648 0.0202  0.0021  -0.0144 90  ILE A CD1   
667  N N     . LEU A 91  ? 0.2899 0.2976 0.2705 0.0044  0.0049  -0.0404 91  LEU A N     
668  C CA    . LEU A 91  ? 0.2942 0.3058 0.2837 -0.0040 0.0099  -0.0470 91  LEU A CA    
669  C C     . LEU A 91  ? 0.2876 0.3149 0.2938 -0.0071 0.0062  -0.0584 91  LEU A C     
670  O O     . LEU A 91  ? 0.2713 0.3034 0.2850 -0.0141 0.0121  -0.0611 91  LEU A O     
671  C CB    . LEU A 91  ? 0.3060 0.3086 0.2897 -0.0082 0.0137  -0.0508 91  LEU A CB    
672  C CG    . LEU A 91  ? 0.3198 0.3063 0.2896 -0.0058 0.0184  -0.0417 91  LEU A CG    
673  C CD1   . LEU A 91  ? 0.3367 0.3127 0.3009 -0.0112 0.0227  -0.0466 91  LEU A CD1   
674  C CD2   . LEU A 91  ? 0.3170 0.2978 0.2841 -0.0064 0.0225  -0.0335 91  LEU A CD2   
675  N N     . PRO A 92  ? 0.2953 0.3298 0.3069 -0.0016 -0.0040 -0.0663 92  PRO A N     
676  C CA    . PRO A 92  ? 0.2854 0.3369 0.3172 -0.0036 -0.0081 -0.0795 92  PRO A CA    
677  C C     . PRO A 92  ? 0.2670 0.3250 0.3046 -0.0001 -0.0105 -0.0765 92  PRO A C     
678  O O     . PRO A 92  ? 0.2559 0.3284 0.3119 -0.0043 -0.0091 -0.0866 92  PRO A O     
679  C CB    . PRO A 92  ? 0.3078 0.3622 0.3419 0.0033  -0.0215 -0.0891 92  PRO A CB    
680  C CG    . PRO A 92  ? 0.3132 0.3522 0.3288 0.0036  -0.0193 -0.0829 92  PRO A CG    
681  C CD    . PRO A 92  ? 0.3075 0.3342 0.3078 0.0046  -0.0116 -0.0667 92  PRO A CD    
682  N N     . PHE A 93  ? 0.2609 0.3086 0.2838 0.0064  -0.0128 -0.0637 93  PHE A N     
683  C CA    . PHE A 93  ? 0.2511 0.3034 0.2783 0.0088  -0.0141 -0.0602 93  PHE A CA    
684  C C     . PHE A 93  ? 0.2410 0.2962 0.2732 -0.0004 -0.0022 -0.0580 93  PHE A C     
685  O O     . PHE A 93  ? 0.2371 0.3042 0.2840 -0.0042 -0.0006 -0.0663 93  PHE A O     
686  C CB    . PHE A 93  ? 0.2532 0.2932 0.2631 0.0159  -0.0177 -0.0479 93  PHE A CB    
687  C CG    . PHE A 93  ? 0.2433 0.2869 0.2570 0.0176  -0.0185 -0.0442 93  PHE A CG    
688  C CD1   . PHE A 93  ? 0.2424 0.2939 0.2663 0.0224  -0.0280 -0.0524 93  PHE A CD1   
689  C CD2   . PHE A 93  ? 0.2399 0.2798 0.2487 0.0145  -0.0105 -0.0342 93  PHE A CD2   
690  C CE1   . PHE A 93  ? 0.2326 0.2872 0.2604 0.0235  -0.0282 -0.0497 93  PHE A CE1   
691  C CE2   . PHE A 93  ? 0.2260 0.2694 0.2384 0.0153  -0.0109 -0.0313 93  PHE A CE2   
692  C CZ    . PHE A 93  ? 0.2312 0.2819 0.2530 0.0194  -0.0191 -0.0390 93  PHE A CZ    
693  N N     . PHE A 94  ? 0.2441 0.2870 0.2633 -0.0037 0.0054  -0.0483 94  PHE A N     
694  C CA    . PHE A 94  ? 0.2592 0.2977 0.2755 -0.0112 0.0144  -0.0442 94  PHE A CA    
695  C C     . PHE A 94  ? 0.2611 0.3005 0.2820 -0.0226 0.0226  -0.0538 94  PHE A C     
696  O O     . PHE A 94  ? 0.2630 0.2976 0.2800 -0.0306 0.0303  -0.0530 94  PHE A O     
697  C CB    . PHE A 94  ? 0.2664 0.2894 0.2669 -0.0092 0.0173  -0.0317 94  PHE A CB    
698  C CG    . PHE A 94  ? 0.2759 0.2987 0.2733 -0.0014 0.0130  -0.0230 94  PHE A CG    
699  C CD1   . PHE A 94  ? 0.2852 0.3118 0.2853 -0.0015 0.0129  -0.0197 94  PHE A CD1   
700  C CD2   . PHE A 94  ? 0.2828 0.3009 0.2736 0.0048  0.0103  -0.0188 94  PHE A CD2   
701  C CE1   . PHE A 94  ? 0.2808 0.3072 0.2785 0.0045  0.0096  -0.0126 94  PHE A CE1   
702  C CE2   . PHE A 94  ? 0.2866 0.3041 0.2742 0.0098  0.0083  -0.0124 94  PHE A CE2   
703  C CZ    . PHE A 94  ? 0.2927 0.3146 0.2842 0.0096  0.0078  -0.0092 94  PHE A CZ    
704  N N     . ASP A 95  ? 0.2661 0.3092 0.2927 -0.0247 0.0218  -0.0630 95  ASP A N     
705  C CA    . ASP A 95  ? 0.2887 0.3354 0.3230 -0.0379 0.0311  -0.0755 95  ASP A CA    
706  C C     . ASP A 95  ? 0.2826 0.3503 0.3394 -0.0403 0.0306  -0.0889 95  ASP A C     
707  O O     . ASP A 95  ? 0.2891 0.3599 0.3516 -0.0529 0.0414  -0.0981 95  ASP A O     
708  C CB    . ASP A 95  ? 0.3021 0.3482 0.3385 -0.0413 0.0316  -0.0840 95  ASP A CB    
709  C CG    . ASP A 95  ? 0.3320 0.3562 0.3467 -0.0407 0.0341  -0.0730 95  ASP A CG    
710  O OD1   . ASP A 95  ? 0.3768 0.3853 0.3750 -0.0383 0.0361  -0.0598 95  ASP A OD1   
711  O OD2   . ASP A 95  ? 0.3416 0.3644 0.3563 -0.0406 0.0324  -0.0780 95  ASP A OD2   
712  N N     . LYS A 96  ? 0.2712 0.3516 0.3398 -0.0288 0.0184  -0.0912 96  LYS A N     
713  C CA    . LYS A 96  ? 0.2673 0.3676 0.3592 -0.0291 0.0162  -0.1051 96  LYS A CA    
714  C C     . LYS A 96  ? 0.2618 0.3608 0.3501 -0.0284 0.0188  -0.0976 96  LYS A C     
715  O O     . LYS A 96  ? 0.2596 0.3710 0.3632 -0.0349 0.0245  -0.1086 96  LYS A O     
716  C CB    . LYS A 96  ? 0.2787 0.3898 0.3831 -0.0162 -0.0004 -0.1127 96  LYS A CB    
717  C CG    . LYS A 96  ? 0.2854 0.4160 0.4141 -0.0112 -0.0080 -0.1265 96  LYS A CG    
718  C CD    . LYS A 96  ? 0.3114 0.4626 0.4677 -0.0217 -0.0010 -0.1486 96  LYS A CD    
719  C CE    . LYS A 96  ? 0.3385 0.5121 0.5240 -0.0168 -0.0077 -0.1656 96  LYS A CE    
720  N NZ    . LYS A 96  ? 0.3413 0.5380 0.5577 -0.0277 -0.0004 -0.1906 96  LYS A NZ    
721  N N     . TYR A 97  ? 0.2581 0.3429 0.3277 -0.0213 0.0152  -0.0804 97  TYR A N     
722  C CA    . TYR A 97  ? 0.2412 0.3241 0.3068 -0.0196 0.0160  -0.0728 97  TYR A CA    
723  C C     . TYR A 97  ? 0.2557 0.3195 0.2990 -0.0235 0.0229  -0.0580 97  TYR A C     
724  O O     . TYR A 97  ? 0.2461 0.3003 0.2773 -0.0163 0.0182  -0.0461 97  TYR A O     
725  C CB    . TYR A 97  ? 0.2293 0.3143 0.2958 -0.0062 0.0027  -0.0685 97  TYR A CB    
726  C CG    . TYR A 97  ? 0.2183 0.3176 0.3035 0.0009  -0.0087 -0.0830 97  TYR A CG    
727  C CD1   . TYR A 97  ? 0.2126 0.3276 0.3183 0.0013  -0.0106 -0.0958 97  TYR A CD1   
728  C CD2   . TYR A 97  ? 0.2277 0.3234 0.3091 0.0081  -0.0187 -0.0845 97  TYR A CD2   
729  C CE1   . TYR A 97  ? 0.2098 0.3375 0.3342 0.0098  -0.0237 -0.1106 97  TYR A CE1   
730  C CE2   . TYR A 97  ? 0.2283 0.3346 0.3252 0.0160  -0.0320 -0.0986 97  TYR A CE2   
731  C CZ    . TYR A 97  ? 0.2177 0.3404 0.3371 0.0176  -0.0354 -0.1119 97  TYR A CZ    
732  O OH    . TYR A 97  ? 0.2215 0.3539 0.3570 0.0275  -0.0513 -0.1268 97  TYR A OH    
733  N N     . SER A 98  ? 0.2840 0.3412 0.3214 -0.0358 0.0342  -0.0605 98  SER A N     
734  C CA    . SER A 98  ? 0.2958 0.3306 0.3097 -0.0401 0.0396  -0.0488 98  SER A CA    
735  C C     . SER A 98  ? 0.2820 0.3084 0.2847 -0.0370 0.0380  -0.0375 98  SER A C     
736  O O     . SER A 98  ? 0.2485 0.2817 0.2567 -0.0397 0.0399  -0.0408 98  SER A O     
737  C CB    . SER A 98  ? 0.3243 0.3477 0.3287 -0.0551 0.0518  -0.0552 98  SER A CB    
738  O OG    . SER A 98  ? 0.3755 0.3958 0.3795 -0.0559 0.0519  -0.0585 98  SER A OG    
739  N N     . LEU A 99  ? 0.2707 0.2831 0.2594 -0.0311 0.0340  -0.0257 99  LEU A N     
740  C CA    . LEU A 99  ? 0.2822 0.2831 0.2584 -0.0283 0.0317  -0.0153 99  LEU A CA    
741  C C     . LEU A 99  ? 0.3002 0.2855 0.2602 -0.0393 0.0389  -0.0159 99  LEU A C     
742  O O     . LEU A 99  ? 0.3116 0.2885 0.2644 -0.0502 0.0473  -0.0226 99  LEU A O     
743  C CB    . LEU A 99  ? 0.3054 0.2941 0.2721 -0.0217 0.0275  -0.0074 99  LEU A CB    
744  C CG    . LEU A 99  ? 0.2976 0.2981 0.2755 -0.0116 0.0218  -0.0057 99  LEU A CG    
745  C CD1   . LEU A 99  ? 0.3073 0.2965 0.2777 -0.0075 0.0205  -0.0019 99  LEU A CD1   
746  C CD2   . LEU A 99  ? 0.2887 0.2964 0.2717 -0.0054 0.0172  -0.0003 99  LEU A CD2   
747  N N     . ILE A 100 ? 0.2940 0.2745 0.2471 -0.0381 0.0366  -0.0102 100 ILE A N     
748  C CA    . ILE A 100 ? 0.3218 0.2830 0.2540 -0.0491 0.0431  -0.0104 100 ILE A CA    
749  C C     . ILE A 100 ? 0.3326 0.2697 0.2414 -0.0455 0.0366  0.0004  100 ILE A C     
750  O O     . ILE A 100 ? 0.3313 0.2444 0.2150 -0.0547 0.0408  0.0013  100 ILE A O     
751  C CB    . ILE A 100 ? 0.3191 0.2932 0.2606 -0.0558 0.0491  -0.0182 100 ILE A CB    
752  C CG1   . ILE A 100 ? 0.3129 0.2987 0.2644 -0.0461 0.0409  -0.0128 100 ILE A CG1   
753  C CG2   . ILE A 100 ? 0.3078 0.3035 0.2725 -0.0604 0.0554  -0.0325 100 ILE A CG2   
754  C CD1   . ILE A 100 ? 0.3187 0.3076 0.2701 -0.0530 0.0462  -0.0177 100 ILE A CD1   
755  N N     . THR A 101 ? 0.3201 0.2621 0.2363 -0.0326 0.0262  0.0075  101 THR A N     
756  C CA    . THR A 101 ? 0.3499 0.2708 0.2477 -0.0278 0.0181  0.0154  101 THR A CA    
757  C C     . THR A 101 ? 0.3894 0.2881 0.2709 -0.0269 0.0164  0.0173  101 THR A C     
758  O O     . THR A 101 ? 0.3801 0.2812 0.2651 -0.0312 0.0227  0.0126  101 THR A O     
759  C CB    . THR A 101 ? 0.3201 0.2558 0.2341 -0.0156 0.0085  0.0198  101 THR A CB    
760  O OG1   . THR A 101 ? 0.3082 0.2552 0.2374 -0.0074 0.0058  0.0198  101 THR A OG1   
761  C CG2   . THR A 101 ? 0.3036 0.2603 0.2335 -0.0164 0.0104  0.0177  101 THR A CG2   
762  N N     . GLU A 102 ? 0.4361 0.3142 0.3020 -0.0199 0.0063  0.0233  102 GLU A N     
763  C CA    . GLU A 102 ? 0.4602 0.3200 0.3158 -0.0146 0.0014  0.0250  102 GLU A CA    
764  C C     . GLU A 102 ? 0.3996 0.2821 0.2810 -0.0064 0.0012  0.0225  102 GLU A C     
765  O O     . GLU A 102 ? 0.3961 0.2667 0.2714 -0.0043 0.0005  0.0219  102 GLU A O     
766  C CB    . GLU A 102 ? 0.5222 0.3626 0.3649 -0.0042 -0.0130 0.0301  102 GLU A CB    
767  C CG    . GLU A 102 ? 0.5992 0.4022 0.4039 -0.0106 -0.0162 0.0337  102 GLU A CG    
768  C CD    . GLU A 102 ? 0.6567 0.4278 0.4307 -0.0218 -0.0088 0.0331  102 GLU A CD    
769  O OE1   . GLU A 102 ? 0.7038 0.4688 0.4786 -0.0178 -0.0098 0.0323  102 GLU A OE1   
770  O OE2   . GLU A 102 ? 0.7029 0.4555 0.4520 -0.0355 -0.0007 0.0328  102 GLU A OE2   
771  N N     . ALA A 103 ? 0.3465 0.2584 0.2538 -0.0021 0.0019  0.0210  103 ALA A N     
772  C CA    . ALA A 103 ? 0.3168 0.2466 0.2432 0.0027  0.0039  0.0181  103 ALA A CA    
773  C C     . ALA A 103 ? 0.3288 0.2549 0.2503 -0.0055 0.0121  0.0135  103 ALA A C     
774  O O     . ALA A 103 ? 0.3228 0.2511 0.2493 -0.0022 0.0126  0.0115  103 ALA A O     
775  C CB    . ALA A 103 ? 0.2817 0.2381 0.2293 0.0050  0.0052  0.0169  103 ALA A CB    
776  N N     . LEU A 104 ? 0.3445 0.2653 0.2566 -0.0170 0.0191  0.0104  104 LEU A N     
777  C CA    . LEU A 104 ? 0.3377 0.2579 0.2487 -0.0261 0.0275  0.0036  104 LEU A CA    
778  C C     . LEU A 104 ? 0.3654 0.2601 0.2578 -0.0259 0.0264  0.0054  104 LEU A C     
779  O O     . LEU A 104 ? 0.3681 0.2650 0.2645 -0.0280 0.0302  0.0008  104 LEU A O     
780  C CB    . LEU A 104 ? 0.3486 0.2660 0.2525 -0.0401 0.0367  -0.0019 104 LEU A CB    
781  C CG    . LEU A 104 ? 0.3691 0.2848 0.2721 -0.0519 0.0467  -0.0114 104 LEU A CG    
782  C CD1   . LEU A 104 ? 0.3432 0.2880 0.2742 -0.0474 0.0459  -0.0185 104 LEU A CD1   
783  C CD2   . LEU A 104 ? 0.3930 0.3027 0.2869 -0.0674 0.0577  -0.0180 104 LEU A CD2   
784  N N     . GLY A 105 ? 0.3738 0.2424 0.2447 -0.0231 0.0203  0.0115  105 GLY A N     
785  C CA    . GLY A 105 ? 0.3974 0.2376 0.2478 -0.0226 0.0182  0.0129  105 GLY A CA    
786  C C     . GLY A 105 ? 0.3914 0.2425 0.2583 -0.0106 0.0132  0.0123  105 GLY A C     
787  O O     . GLY A 105 ? 0.3933 0.2325 0.2531 -0.0121 0.0155  0.0099  105 GLY A O     
788  N N     . ASP A 106 ? 0.3767 0.2483 0.2638 0.0003  0.0069  0.0140  106 ASP A N     
789  C CA    . ASP A 106 ? 0.3758 0.2606 0.2805 0.0110  0.0037  0.0123  106 ASP A CA    
790  C C     . ASP A 106 ? 0.3437 0.2465 0.2607 0.0061  0.0119  0.0072  106 ASP A C     
791  O O     . ASP A 106 ? 0.3445 0.2441 0.2622 0.0087  0.0128  0.0045  106 ASP A O     
792  C CB    . ASP A 106 ? 0.3626 0.2679 0.2873 0.0207  -0.0019 0.0136  106 ASP A CB    
793  C CG    . ASP A 106 ? 0.4079 0.2971 0.3235 0.0276  -0.0128 0.0171  106 ASP A CG    
794  O OD1   . ASP A 106 ? 0.4258 0.2941 0.3307 0.0342  -0.0201 0.0169  106 ASP A OD1   
795  O OD2   . ASP A 106 ? 0.4476 0.3430 0.3652 0.0267  -0.0153 0.0195  106 ASP A OD2   
796  N N     . TYR A 107 ? 0.3239 0.2452 0.2507 0.0002  0.0165  0.0053  107 TYR A N     
797  C CA    . TYR A 107 ? 0.2987 0.2353 0.2358 -0.0041 0.0217  -0.0007 107 TYR A CA    
798  C C     . TYR A 107 ? 0.3218 0.2431 0.2469 -0.0121 0.0267  -0.0052 107 TYR A C     
799  O O     . TYR A 107 ? 0.3297 0.2537 0.2586 -0.0105 0.0276  -0.0088 107 TYR A O     
800  C CB    . TYR A 107 ? 0.2815 0.2354 0.2288 -0.0088 0.0240  -0.0035 107 TYR A CB    
801  C CG    . TYR A 107 ? 0.2784 0.2443 0.2347 -0.0129 0.0270  -0.0117 107 TYR A CG    
802  C CD1   . TYR A 107 ? 0.2690 0.2467 0.2345 -0.0060 0.0238  -0.0132 107 TYR A CD1   
803  C CD2   . TYR A 107 ? 0.2720 0.2369 0.2272 -0.0238 0.0329  -0.0193 107 TYR A CD2   
804  C CE1   . TYR A 107 ? 0.2619 0.2481 0.2337 -0.0086 0.0240  -0.0213 107 TYR A CE1   
805  C CE2   . TYR A 107 ? 0.2730 0.2508 0.2398 -0.0264 0.0339  -0.0287 107 TYR A CE2   
806  C CZ    . TYR A 107 ? 0.2689 0.2568 0.2435 -0.0179 0.0281  -0.0293 107 TYR A CZ    
807  O OH    . TYR A 107 ? 0.2851 0.2836 0.2692 -0.0197 0.0267  -0.0392 107 TYR A OH    
808  N N     . LEU A 108 ? 0.3387 0.2416 0.2471 -0.0218 0.0307  -0.0054 108 LEU A N     
809  C CA    . LEU A 108 ? 0.3583 0.2482 0.2564 -0.0318 0.0375  -0.0113 108 LEU A CA    
810  C C     . LEU A 108 ? 0.3803 0.2511 0.2673 -0.0262 0.0344  -0.0094 108 LEU A C     
811  O O     . LEU A 108 ? 0.3883 0.2588 0.2764 -0.0308 0.0387  -0.0154 108 LEU A O     
812  C CB    . LEU A 108 ? 0.3822 0.2517 0.2602 -0.0459 0.0448  -0.0129 108 LEU A CB    
813  C CG    . LEU A 108 ? 0.3728 0.2607 0.2624 -0.0551 0.0513  -0.0190 108 LEU A CG    
814  C CD1   . LEU A 108 ? 0.3970 0.2587 0.2604 -0.0681 0.0584  -0.0182 108 LEU A CD1   
815  C CD2   . LEU A 108 ? 0.3615 0.2711 0.2712 -0.0613 0.0570  -0.0312 108 LEU A CD2   
816  N N     . LEU A 109 ? 0.3871 0.2427 0.2651 -0.0161 0.0265  -0.0025 109 LEU A N     
817  C CA    . LEU A 109 ? 0.4026 0.2410 0.2728 -0.0086 0.0222  -0.0018 109 LEU A CA    
818  C C     . LEU A 109 ? 0.3755 0.2375 0.2679 0.0000  0.0216  -0.0052 109 LEU A C     
819  O O     . LEU A 109 ? 0.3697 0.2239 0.2588 0.0006  0.0230  -0.0086 109 LEU A O     
820  C CB    . LEU A 109 ? 0.4238 0.2431 0.2829 0.0015  0.0119  0.0042  109 LEU A CB    
821  C CG    . LEU A 109 ? 0.4668 0.2517 0.2941 -0.0063 0.0110  0.0081  109 LEU A CG    
822  C CD1   . LEU A 109 ? 0.4810 0.2538 0.3027 0.0063  -0.0023 0.0136  109 LEU A CD1   
823  C CD2   . LEU A 109 ? 0.4993 0.2503 0.3002 -0.0131 0.0141  0.0066  109 LEU A CD2   
824  N N     . PHE A 110 ? 0.3509 0.2381 0.2623 0.0056  0.0198  -0.0042 110 PHE A N     
825  C CA    . PHE A 110 ? 0.3395 0.2489 0.2682 0.0104  0.0212  -0.0076 110 PHE A CA    
826  C C     . PHE A 110 ? 0.3534 0.2687 0.2830 0.0030  0.0262  -0.0138 110 PHE A C     
827  O O     . PHE A 110 ? 0.3427 0.2593 0.2743 0.0061  0.0270  -0.0173 110 PHE A O     
828  C CB    . PHE A 110 ? 0.3184 0.2479 0.2604 0.0133  0.0197  -0.0051 110 PHE A CB    
829  C CG    . PHE A 110 ? 0.3010 0.2489 0.2547 0.0162  0.0214  -0.0077 110 PHE A CG    
830  C CD1   . PHE A 110 ? 0.2981 0.2509 0.2589 0.0238  0.0213  -0.0081 110 PHE A CD1   
831  C CD2   . PHE A 110 ? 0.2882 0.2479 0.2454 0.0114  0.0226  -0.0101 110 PHE A CD2   
832  C CE1   . PHE A 110 ? 0.2869 0.2519 0.2527 0.0246  0.0243  -0.0101 110 PHE A CE1   
833  C CE2   . PHE A 110 ? 0.2892 0.2598 0.2508 0.0143  0.0226  -0.0117 110 PHE A CE2   
834  C CZ    . PHE A 110 ? 0.2786 0.2501 0.2421 0.0200  0.0242  -0.0111 110 PHE A CZ    
835  N N     . LYS A 111 ? 0.3566 0.2752 0.2853 -0.0069 0.0294  -0.0165 111 LYS A N     
836  C CA    . LYS A 111 ? 0.3550 0.2804 0.2875 -0.0143 0.0330  -0.0248 111 LYS A CA    
837  C C     . LYS A 111 ? 0.3858 0.2927 0.3064 -0.0183 0.0361  -0.0285 111 LYS A C     
838  O O     . LYS A 111 ? 0.3735 0.2862 0.2985 -0.0186 0.0365  -0.0344 111 LYS A O     
839  C CB    . LYS A 111 ? 0.3538 0.2857 0.2897 -0.0248 0.0369  -0.0293 111 LYS A CB    
840  C CG    . LYS A 111 ? 0.3550 0.2985 0.3005 -0.0327 0.0398  -0.0409 111 LYS A CG    
841  C CD    . LYS A 111 ? 0.3522 0.3082 0.3078 -0.0418 0.0437  -0.0480 111 LYS A CD    
842  C CE    . LYS A 111 ? 0.3730 0.3295 0.3320 -0.0544 0.0505  -0.0606 111 LYS A CE    
843  N NZ    . LYS A 111 ? 0.3705 0.3511 0.3511 -0.0593 0.0512  -0.0724 111 LYS A NZ    
844  N N     . LYS A 112 ? 0.4193 0.3015 0.3225 -0.0222 0.0379  -0.0252 112 LYS A N     
845  C CA    . LYS A 112 ? 0.4534 0.3121 0.3412 -0.0255 0.0403  -0.0276 112 LYS A CA    
846  C C     . LYS A 112 ? 0.4468 0.3038 0.3370 -0.0142 0.0363  -0.0270 112 LYS A C     
847  O O     . LYS A 112 ? 0.4590 0.3094 0.3454 -0.0170 0.0388  -0.0323 112 LYS A O     
848  C CB    . LYS A 112 ? 0.5076 0.3338 0.3707 -0.0293 0.0405  -0.0225 112 LYS A CB    
849  C CG    . LYS A 112 ? 0.5564 0.3802 0.4128 -0.0443 0.0479  -0.0250 112 LYS A CG    
850  C CD    . LYS A 112 ? 0.6142 0.3981 0.4376 -0.0525 0.0505  -0.0213 112 LYS A CD    
851  C CE    . LYS A 112 ? 0.6508 0.4336 0.4680 -0.0709 0.0618  -0.0269 112 LYS A CE    
852  N NZ    . LYS A 112 ? 0.7219 0.4646 0.5054 -0.0856 0.0698  -0.0285 112 LYS A NZ    
853  N N     . VAL A 113 ? 0.4263 0.2892 0.3234 -0.0023 0.0309  -0.0219 113 VAL A N     
854  C CA    . VAL A 113 ? 0.4290 0.2947 0.3323 0.0077  0.0289  -0.0235 113 VAL A CA    
855  C C     . VAL A 113 ? 0.4185 0.3034 0.3317 0.0055  0.0320  -0.0290 113 VAL A C     
856  O O     . VAL A 113 ? 0.4156 0.2952 0.3255 0.0060  0.0337  -0.0337 113 VAL A O     
857  C CB    . VAL A 113 ? 0.4211 0.2936 0.3342 0.0195  0.0238  -0.0193 113 VAL A CB    
858  C CG1   . VAL A 113 ? 0.4229 0.3043 0.3466 0.0282  0.0246  -0.0234 113 VAL A CG1   
859  C CG2   . VAL A 113 ? 0.4306 0.2797 0.3312 0.0234  0.0175  -0.0149 113 VAL A CG2   
860  N N     . LEU A 114 ? 0.4149 0.3197 0.3381 0.0036  0.0316  -0.0288 114 LEU A N     
861  C CA    . LEU A 114 ? 0.4142 0.3335 0.3431 0.0025  0.0317  -0.0339 114 LEU A CA    
862  C C     . LEU A 114 ? 0.4296 0.3437 0.3541 -0.0056 0.0336  -0.0417 114 LEU A C     
863  O O     . LEU A 114 ? 0.4226 0.3386 0.3459 -0.0040 0.0330  -0.0463 114 LEU A O     
864  C CB    . LEU A 114 ? 0.3916 0.3290 0.3298 0.0018  0.0291  -0.0328 114 LEU A CB    
865  C CG    . LEU A 114 ? 0.3871 0.3330 0.3298 0.0096  0.0277  -0.0275 114 LEU A CG    
866  C CD1   . LEU A 114 ? 0.3797 0.3393 0.3288 0.0084  0.0247  -0.0264 114 LEU A CD1   
867  C CD2   . LEU A 114 ? 0.3963 0.3420 0.3354 0.0140  0.0291  -0.0298 114 LEU A CD2   
868  N N     . GLU A 115 ? 0.4395 0.3456 0.3602 -0.0150 0.0366  -0.0438 115 GLU A N     
869  C CA    . GLU A 115 ? 0.4519 0.3546 0.3708 -0.0248 0.0397  -0.0531 115 GLU A CA    
870  C C     . GLU A 115 ? 0.4619 0.3451 0.3685 -0.0235 0.0415  -0.0541 115 GLU A C     
871  O O     . GLU A 115 ? 0.4488 0.3330 0.3557 -0.0272 0.0422  -0.0620 115 GLU A O     
872  C CB    . GLU A 115 ? 0.4854 0.3842 0.4029 -0.0374 0.0451  -0.0563 115 GLU A CB    
873  C CG    . GLU A 115 ? 0.5102 0.4327 0.4440 -0.0379 0.0428  -0.0583 115 GLU A CG    
874  C CD    . GLU A 115 ? 0.5634 0.4888 0.5011 -0.0513 0.0494  -0.0649 115 GLU A CD    
875  O OE1   . GLU A 115 ? 0.6063 0.5108 0.5282 -0.0594 0.0561  -0.0618 115 GLU A OE1   
876  O OE2   . GLU A 115 ? 0.6179 0.5666 0.5745 -0.0532 0.0473  -0.0736 115 GLU A OE2   
877  N N     . LEU A 116 ? 0.4547 0.3205 0.3515 -0.0170 0.0411  -0.0471 116 LEU A N     
878  C CA    . LEU A 116 ? 0.4749 0.3211 0.3608 -0.0134 0.0417  -0.0482 116 LEU A CA    
879  C C     . LEU A 116 ? 0.4806 0.3376 0.3733 -0.0044 0.0401  -0.0505 116 LEU A C     
880  O O     . LEU A 116 ? 0.5083 0.3557 0.3949 -0.0040 0.0416  -0.0554 116 LEU A O     
881  C CB    . LEU A 116 ? 0.4805 0.3040 0.3548 -0.0077 0.0394  -0.0416 116 LEU A CB    
882  C CG    . LEU A 116 ? 0.5066 0.3058 0.3627 -0.0179 0.0417  -0.0397 116 LEU A CG    
883  C CD1   . LEU A 116 ? 0.5256 0.3031 0.3695 -0.0092 0.0356  -0.0320 116 LEU A CD1   
884  C CD2   . LEU A 116 ? 0.5331 0.3095 0.3734 -0.0271 0.0465  -0.0455 116 LEU A CD2   
885  N N     . MET A 117 ? 0.4642 0.3390 0.3672 0.0019  0.0380  -0.0473 117 MET A N     
886  C CA    . MET A 117 ? 0.4550 0.3390 0.3610 0.0078  0.0383  -0.0498 117 MET A CA    
887  C C     . MET A 117 ? 0.4544 0.3462 0.3589 0.0020  0.0371  -0.0564 117 MET A C     
888  O O     . MET A 117 ? 0.4672 0.3561 0.3659 0.0038  0.0379  -0.0608 117 MET A O     
889  C CB    . MET A 117 ? 0.4445 0.3432 0.3595 0.0139  0.0373  -0.0447 117 MET A CB    
890  C CG    . MET A 117 ? 0.4469 0.3406 0.3667 0.0214  0.0369  -0.0404 117 MET A CG    
891  S SD    . MET A 117 ? 0.4341 0.3459 0.3666 0.0267  0.0366  -0.0359 117 MET A SD    
892  C CE    . MET A 117 ? 0.4243 0.3406 0.3568 0.0301  0.0428  -0.0420 117 MET A CE    
893  N N     . GLY A 118 ? 0.4461 0.3475 0.3560 -0.0045 0.0346  -0.0582 118 GLY A N     
894  C CA    . GLY A 118 ? 0.4588 0.3692 0.3706 -0.0086 0.0308  -0.0662 118 GLY A CA    
895  C C     . GLY A 118 ? 0.4869 0.3871 0.3925 -0.0139 0.0322  -0.0747 118 GLY A C     
896  O O     . GLY A 118 ? 0.4986 0.4025 0.4017 -0.0133 0.0280  -0.0806 118 GLY A O     
897  N N     . THR A 119 ? 0.5064 0.3913 0.4070 -0.0192 0.0375  -0.0750 119 THR A N     
898  C CA    . THR A 119 ? 0.5353 0.4074 0.4285 -0.0252 0.0400  -0.0826 119 THR A CA    
899  C C     . THR A 119 ? 0.5766 0.4317 0.4584 -0.0179 0.0424  -0.0799 119 THR A C     
900  O O     . THR A 119 ? 0.5973 0.4368 0.4704 -0.0219 0.0452  -0.0850 119 THR A O     
901  C CB    . THR A 119 ? 0.5489 0.4087 0.4390 -0.0367 0.0457  -0.0847 119 THR A CB    
902  O OG1   . THR A 119 ? 0.5667 0.4060 0.4454 -0.0331 0.0484  -0.0755 119 THR A OG1   
903  C CG2   . THR A 119 ? 0.5316 0.4101 0.4358 -0.0440 0.0452  -0.0881 119 THR A CG2   
904  N N     . LYS A 120 ? 0.5726 0.4310 0.4558 -0.0078 0.0419  -0.0733 120 LYS A N     
905  C CA    . LYS A 120 ? 0.6103 0.4569 0.4878 0.0003  0.0447  -0.0727 120 LYS A CA    
906  C C     . LYS A 120 ? 0.6114 0.4369 0.4831 0.0024  0.0463  -0.0705 120 LYS A C     
907  O O     . LYS A 120 ? 0.6044 0.4193 0.4729 0.0096  0.0479  -0.0726 120 LYS A O     
908  C CB    . LYS A 120 ? 0.6489 0.4917 0.5184 0.0000  0.0458  -0.0804 120 LYS A CB    
909  C CG    . LYS A 120 ? 0.6743 0.5311 0.5426 0.0007  0.0429  -0.0823 120 LYS A CG    
910  C CD    . LYS A 120 ? 0.6988 0.5685 0.5730 0.0059  0.0424  -0.0756 120 LYS A CD    
911  C CE    . LYS A 120 ? 0.7338 0.6089 0.5988 0.0062  0.0392  -0.0778 120 LYS A CE    
912  N NZ    . LYS A 120 ? 0.7852 0.6482 0.6353 0.0068  0.0428  -0.0839 120 LYS A NZ    
913  N N     . GLU A 121 ? 0.6035 0.4213 0.4727 -0.0029 0.0456  -0.0667 121 GLU A N     
914  C CA    . GLU A 121 ? 0.6321 0.4237 0.4900 -0.0006 0.0451  -0.0636 121 GLU A CA    
915  C C     . GLU A 121 ? 0.6101 0.3991 0.4730 0.0132  0.0414  -0.0590 121 GLU A C     
916  O O     . GLU A 121 ? 0.6141 0.3793 0.4675 0.0187  0.0386  -0.0584 121 GLU A O     
917  C CB    . GLU A 121 ? 0.6631 0.4445 0.5128 -0.0110 0.0460  -0.0605 121 GLU A CB    
918  C CG    . GLU A 121 ? 0.7152 0.4809 0.5526 -0.0247 0.0509  -0.0671 121 GLU A CG    
919  C CD    . GLU A 121 ? 0.7478 0.4982 0.5734 -0.0360 0.0540  -0.0643 121 GLU A CD    
920  O OE1   . GLU A 121 ? 0.7087 0.4780 0.5444 -0.0463 0.0574  -0.0681 121 GLU A OE1   
921  O OE2   . GLU A 121 ? 0.8247 0.5440 0.6308 -0.0332 0.0521  -0.0586 121 GLU A OE2   
922  N N     . HIS A 122 ? 0.5678 0.3805 0.4457 0.0189  0.0408  -0.0569 122 HIS A N     
923  C CA    . HIS A 122 ? 0.5686 0.3852 0.4571 0.0317  0.0383  -0.0555 122 HIS A CA    
924  C C     . HIS A 122 ? 0.5667 0.3798 0.4591 0.0403  0.0407  -0.0629 122 HIS A C     
925  O O     . HIS A 122 ? 0.5721 0.3844 0.4746 0.0516  0.0379  -0.0647 122 HIS A O     
926  C CB    . HIS A 122 ? 0.5406 0.3832 0.4435 0.0331  0.0388  -0.0522 122 HIS A CB    
927  C CG    . HIS A 122 ? 0.5306 0.3900 0.4375 0.0313  0.0439  -0.0563 122 HIS A CG    
928  N ND1   . HIS A 122 ? 0.5472 0.4101 0.4467 0.0227  0.0449  -0.0583 122 HIS A ND1   
929  C CD2   . HIS A 122 ? 0.5342 0.4059 0.4496 0.0365  0.0481  -0.0594 122 HIS A CD2   
930  C CE1   . HIS A 122 ? 0.5379 0.4115 0.4376 0.0234  0.0480  -0.0611 122 HIS A CE1   
931  N NE2   . HIS A 122 ? 0.5389 0.4172 0.4471 0.0307  0.0514  -0.0617 122 HIS A NE2   
932  N N     . LEU A 123 ? 0.5645 0.3762 0.4500 0.0349  0.0454  -0.0685 123 LEU A N     
933  C CA    . LEU A 123 ? 0.5685 0.3746 0.4545 0.0407  0.0492  -0.0766 123 LEU A CA    
934  C C     . LEU A 123 ? 0.6017 0.3791 0.4751 0.0422  0.0464  -0.0792 123 LEU A C     
935  O O     . LEU A 123 ? 0.6456 0.4153 0.5174 0.0462  0.0496  -0.0870 123 LEU A O     
936  C CB    . LEU A 123 ? 0.5605 0.3763 0.4414 0.0339  0.0549  -0.0813 123 LEU A CB    
937  C CG    . LEU A 123 ? 0.5370 0.3749 0.4234 0.0315  0.0570  -0.0789 123 LEU A CG    
938  C CD1   . LEU A 123 ? 0.5371 0.3764 0.4113 0.0250  0.0598  -0.0837 123 LEU A CD1   
939  C CD2   . LEU A 123 ? 0.5327 0.3818 0.4331 0.0399  0.0611  -0.0808 123 LEU A CD2   
940  N N     . THR A 124 ? 0.5997 0.3591 0.4619 0.0385  0.0413  -0.0731 124 THR A N     
941  C CA    . THR A 124 ? 0.6200 0.3456 0.4651 0.0397  0.0376  -0.0740 124 THR A CA    
942  C C     . THR A 124 ? 0.6304 0.3387 0.4725 0.0494  0.0285  -0.0690 124 THR A C     
943  O O     . THR A 124 ? 0.6073 0.3272 0.4567 0.0510  0.0250  -0.0630 124 THR A O     
944  C CB    . THR A 124 ? 0.6360 0.3465 0.4625 0.0239  0.0404  -0.0724 124 THR A CB    
945  O OG1   . THR A 124 ? 0.6240 0.3367 0.4478 0.0174  0.0386  -0.0648 124 THR A OG1   
946  C CG2   . THR A 124 ? 0.6116 0.3416 0.4428 0.0146  0.0471  -0.0786 124 THR A CG2   
947  N N     . GLN A 125 ? 0.6592 0.3369 0.4885 0.0564  0.0233  -0.0718 125 GLN A N     
948  C CA    . GLN A 125 ? 0.6947 0.3500 0.5177 0.0679  0.0115  -0.0683 125 GLN A CA    
949  C C     . GLN A 125 ? 0.7013 0.3411 0.5046 0.0581  0.0084  -0.0578 125 GLN A C     
950  O O     . GLN A 125 ? 0.6655 0.3143 0.4769 0.0643  0.0020  -0.0531 125 GLN A O     
951  C CB    . GLN A 125 ? 0.7369 0.3562 0.5451 0.0770  0.0054  -0.0738 125 GLN A CB    
952  C CG    . GLN A 125 ? 0.7784 0.3714 0.5801 0.0931  -0.0103 -0.0723 125 GLN A CG    
953  C CD    . GLN A 125 ? 0.7603 0.3853 0.5937 0.1064  -0.0158 -0.0744 125 GLN A CD    
954  O OE1   . GLN A 125 ? 0.7379 0.3987 0.6010 0.1103  -0.0086 -0.0822 125 GLN A OE1   
955  N NE2   . GLN A 125 ? 0.7730 0.3847 0.5984 0.1117  -0.0277 -0.0678 125 GLN A NE2   
956  N N     . ARG A 126 ? 0.7349 0.3541 0.5142 0.0418  0.0144  -0.0557 126 ARG A N     
957  C CA    . ARG A 126 ? 0.7783 0.3815 0.5367 0.0289  0.0151  -0.0478 126 ARG A CA    
958  C C     . ARG A 126 ? 0.7138 0.3542 0.4920 0.0243  0.0183  -0.0437 126 ARG A C     
959  O O     . ARG A 126 ? 0.7135 0.3457 0.4835 0.0245  0.0133  -0.0370 126 ARG A O     
960  C CB    . ARG A 126 ? 0.8735 0.4518 0.6064 0.0097  0.0242  -0.0497 126 ARG A CB    
961  C CG    . ARG A 126 ? 0.9367 0.5107 0.6553 -0.0100 0.0321  -0.0461 126 ARG A CG    
962  C CD    . ARG A 126 ? 1.0006 0.5653 0.7071 -0.0301 0.0442  -0.0528 126 ARG A CD    
963  N NE    . ARG A 126 ? 1.1224 0.6422 0.8002 -0.0313 0.0434  -0.0551 126 ARG A NE    
964  C CZ    . ARG A 126 ? 1.2341 0.7060 0.8730 -0.0444 0.0466  -0.0531 126 ARG A CZ    
965  N NH1   . ARG A 126 ? 1.2790 0.7392 0.9006 -0.0597 0.0525  -0.0493 126 ARG A NH1   
966  N NH2   . ARG A 126 ? 1.2842 0.7159 0.8983 -0.0431 0.0445  -0.0554 126 ARG A NH2   
967  N N     . GLY A 127 ? 0.6464 0.3244 0.4480 0.0209  0.0256  -0.0478 127 GLY A N     
968  C CA    . GLY A 127 ? 0.5935 0.3043 0.4132 0.0185  0.0274  -0.0446 127 GLY A CA    
969  C C     . GLY A 127 ? 0.5630 0.2877 0.3996 0.0339  0.0199  -0.0420 127 GLY A C     
970  O O     . GLY A 127 ? 0.5339 0.2698 0.3754 0.0331  0.0178  -0.0366 127 GLY A O     
971  N N     . LEU A 128 ? 0.5578 0.2835 0.4051 0.0475  0.0163  -0.0470 128 LEU A N     
972  C CA    . LEU A 128 ? 0.5512 0.2920 0.4181 0.0615  0.0097  -0.0472 128 LEU A CA    
973  C C     . LEU A 128 ? 0.5716 0.2874 0.4237 0.0663  -0.0015 -0.0408 128 LEU A C     
974  O O     . LEU A 128 ? 0.5387 0.2688 0.4018 0.0704  -0.0060 -0.0373 128 LEU A O     
975  C CB    . LEU A 128 ? 0.5574 0.3032 0.4406 0.0752  0.0086  -0.0568 128 LEU A CB    
976  C CG    . LEU A 128 ? 0.5473 0.3093 0.4552 0.0907  0.0015  -0.0606 128 LEU A CG    
977  C CD1   . LEU A 128 ? 0.5128 0.3106 0.4414 0.0874  0.0069  -0.0588 128 LEU A CD1   
978  C CD2   . LEU A 128 ? 0.5512 0.3178 0.4759 0.1023  0.0024  -0.0728 128 LEU A CD2   
979  N N     . GLU A 129 ? 0.6271 0.3022 0.4512 0.0656  -0.0066 -0.0395 129 GLU A N     
980  C CA    . GLU A 129 ? 0.6685 0.3116 0.4702 0.0695  -0.0184 -0.0330 129 GLU A CA    
981  C C     . GLU A 129 ? 0.6522 0.3009 0.4449 0.0559  -0.0141 -0.0250 129 GLU A C     
982  O O     . GLU A 129 ? 0.6329 0.2814 0.4263 0.0619  -0.0227 -0.0206 129 GLU A O     
983  C CB    . GLU A 129 ? 0.7218 0.3146 0.4891 0.0698  -0.0240 -0.0329 129 GLU A CB    
984  C CG    . GLU A 129 ? 0.7474 0.3352 0.5281 0.0895  -0.0338 -0.0412 129 GLU A CG    
985  C CD    . GLU A 129 ? 0.8040 0.3417 0.5518 0.0912  -0.0394 -0.0424 129 GLU A CD    
986  O OE1   . GLU A 129 ? 0.8169 0.3533 0.5751 0.1012  -0.0409 -0.0509 129 GLU A OE1   
987  O OE2   . GLU A 129 ? 0.8558 0.3523 0.5648 0.0817  -0.0418 -0.0351 129 GLU A OE2   
988  N N     . LYS A 130 ? 0.6503 0.3075 0.4384 0.0383  -0.0010 -0.0249 130 LYS A N     
989  C CA    . LYS A 130 ? 0.6610 0.3253 0.4429 0.0243  0.0045  -0.0196 130 LYS A CA    
990  C C     . LYS A 130 ? 0.6004 0.3020 0.4099 0.0305  0.0028  -0.0178 130 LYS A C     
991  O O     . LYS A 130 ? 0.5980 0.2963 0.4008 0.0286  -0.0006 -0.0122 130 LYS A O     
992  C CB    . LYS A 130 ? 0.6732 0.3475 0.4538 0.0058  0.0184  -0.0232 130 LYS A CB    
993  C CG    . LYS A 130 ? 0.7439 0.3793 0.4935 -0.0058 0.0230  -0.0251 130 LYS A CG    
994  C CD    . LYS A 130 ? 0.7625 0.4160 0.5198 -0.0227 0.0362  -0.0320 130 LYS A CD    
995  C CE    . LYS A 130 ? 0.8100 0.4299 0.5419 -0.0350 0.0426  -0.0366 130 LYS A CE    
996  N NZ    . LYS A 130 ? 0.8017 0.4460 0.5459 -0.0529 0.0549  -0.0439 130 LYS A NZ    
997  N N     . ILE A 131 ? 0.5558 0.2898 0.3937 0.0374  0.0055  -0.0230 131 ILE A N     
998  C CA    . ILE A 131 ? 0.5128 0.2821 0.3773 0.0428  0.0053  -0.0226 131 ILE A CA    
999  C C     . ILE A 131 ? 0.5082 0.2728 0.3780 0.0568  -0.0066 -0.0206 131 ILE A C     
1000 O O     . ILE A 131 ? 0.4837 0.2621 0.3611 0.0569  -0.0089 -0.0168 131 ILE A O     
1001 C CB    . ILE A 131 ? 0.4969 0.2934 0.3830 0.0457  0.0117  -0.0292 131 ILE A CB    
1002 C CG1   . ILE A 131 ? 0.4880 0.2959 0.3719 0.0319  0.0209  -0.0303 131 ILE A CG1   
1003 C CG2   . ILE A 131 ? 0.4737 0.3002 0.3849 0.0535  0.0110  -0.0299 131 ILE A CG2   
1004 C CD1   . ILE A 131 ? 0.4920 0.3104 0.3831 0.0323  0.0264  -0.0371 131 ILE A CD1   
1005 N N     . VAL A 132 ? 0.5255 0.2702 0.3918 0.0689  -0.0151 -0.0243 132 VAL A N     
1006 C CA    . VAL A 132 ? 0.5381 0.2740 0.4079 0.0833  -0.0296 -0.0241 132 VAL A CA    
1007 C C     . VAL A 132 ? 0.5581 0.2647 0.3976 0.0771  -0.0359 -0.0150 132 VAL A C     
1008 O O     . VAL A 132 ? 0.5487 0.2654 0.3956 0.0808  -0.0421 -0.0120 132 VAL A O     
1009 C CB    . VAL A 132 ? 0.5635 0.2832 0.4371 0.0993  -0.0392 -0.0319 132 VAL A CB    
1010 C CG1   . VAL A 132 ? 0.5891 0.2906 0.4598 0.1146  -0.0581 -0.0319 132 VAL A CG1   
1011 C CG2   . VAL A 132 ? 0.5330 0.2894 0.4422 0.1052  -0.0316 -0.0421 132 VAL A CG2   
1012 N N     . SER A 133 ? 0.5802 0.2530 0.3860 0.0654  -0.0324 -0.0110 133 SER A N     
1013 C CA    . SER A 133 ? 0.6034 0.2494 0.3793 0.0572  -0.0359 -0.0030 133 SER A CA    
1014 C C     . SER A 133 ? 0.5586 0.2360 0.3487 0.0477  -0.0281 0.0002  133 SER A C     
1015 O O     . SER A 133 ? 0.5702 0.2387 0.3503 0.0490  -0.0353 0.0052  133 SER A O     
1016 C CB    . SER A 133 ? 0.6436 0.2474 0.3787 0.0421  -0.0299 -0.0001 133 SER A CB    
1017 O OG    . SER A 133 ? 0.6901 0.2541 0.4031 0.0521  -0.0411 -0.0010 133 SER A OG    
1018 N N     . LEU A 134 ? 0.5219 0.2329 0.3329 0.0387  -0.0148 -0.0027 134 LEU A N     
1019 C CA    . LEU A 134 ? 0.4800 0.2217 0.3062 0.0306  -0.0079 -0.0007 134 LEU A CA    
1020 C C     . LEU A 134 ? 0.4530 0.2177 0.3028 0.0437  -0.0161 -0.0002 134 LEU A C     
1021 O O     . LEU A 134 ? 0.4368 0.2035 0.2838 0.0419  -0.0192 0.0041  134 LEU A O     
1022 C CB    . LEU A 134 ? 0.4545 0.2247 0.2974 0.0207  0.0049  -0.0051 134 LEU A CB    
1023 C CG    . LEU A 134 ? 0.4849 0.2347 0.3072 0.0061  0.0136  -0.0077 134 LEU A CG    
1024 C CD1   . LEU A 134 ? 0.4704 0.2392 0.3078 0.0036  0.0207  -0.0145 134 LEU A CD1   
1025 C CD2   . LEU A 134 ? 0.4984 0.2456 0.3092 -0.0101 0.0214  -0.0067 134 LEU A CD2   
1026 N N     . LYS A 135 ? 0.4360 0.2166 0.3088 0.0565  -0.0194 -0.0059 135 LYS A N     
1027 C CA    . LYS A 135 ? 0.4089 0.2160 0.3088 0.0670  -0.0245 -0.0080 135 LYS A CA    
1028 C C     . LYS A 135 ? 0.4282 0.2156 0.3181 0.0761  -0.0396 -0.0051 135 LYS A C     
1029 O O     . LYS A 135 ? 0.3993 0.2040 0.3032 0.0793  -0.0436 -0.0042 135 LYS A O     
1030 C CB    . LYS A 135 ? 0.3984 0.2238 0.3234 0.0772  -0.0232 -0.0168 135 LYS A CB    
1031 C CG    . LYS A 135 ? 0.3806 0.2354 0.3353 0.0854  -0.0257 -0.0209 135 LYS A CG    
1032 C CD    . LYS A 135 ? 0.3768 0.2519 0.3573 0.0929  -0.0211 -0.0315 135 LYS A CD    
1033 C CE    . LYS A 135 ? 0.3691 0.2646 0.3782 0.1039  -0.0272 -0.0388 135 LYS A CE    
1034 N NZ    . LYS A 135 ? 0.3575 0.2722 0.3741 0.0978  -0.0247 -0.0342 135 LYS A NZ    
1035 N N     . ALA A 136 ? 0.4745 0.2221 0.3367 0.0797  -0.0486 -0.0037 136 ALA A N     
1036 C CA    . ALA A 136 ? 0.5143 0.2329 0.3583 0.0891  -0.0658 -0.0009 136 ALA A CA    
1037 C C     . ALA A 136 ? 0.5239 0.2382 0.3526 0.0803  -0.0663 0.0067  136 ALA A C     
1038 O O     . ALA A 136 ? 0.5490 0.2541 0.3748 0.0899  -0.0808 0.0077  136 ALA A O     
1039 C CB    . ALA A 136 ? 0.5613 0.2305 0.3694 0.0917  -0.0740 0.0004  136 ALA A CB    
1040 N N     . SER A 137 ? 0.5138 0.2370 0.3357 0.0628  -0.0512 0.0107  137 SER A N     
1041 C CA    . SER A 137 ? 0.5194 0.2376 0.3259 0.0531  -0.0499 0.0168  137 SER A CA    
1042 C C     . SER A 137 ? 0.4821 0.2432 0.3185 0.0491  -0.0414 0.0161  137 SER A C     
1043 O O     . SER A 137 ? 0.4856 0.2476 0.3131 0.0395  -0.0373 0.0199  137 SER A O     
1044 C CB    . SER A 137 ? 0.5451 0.2339 0.3166 0.0354  -0.0395 0.0203  137 SER A CB    
1045 O OG    . SER A 137 ? 0.5995 0.2397 0.3355 0.0392  -0.0491 0.0221  137 SER A OG    
1046 N N     . ILE A 138 ? 0.4713 0.2664 0.3419 0.0560  -0.0384 0.0106  138 ILE A N     
1047 C CA    . ILE A 138 ? 0.4303 0.2645 0.3286 0.0529  -0.0303 0.0094  138 ILE A CA    
1048 C C     . ILE A 138 ? 0.4317 0.2803 0.3504 0.0654  -0.0409 0.0070  138 ILE A C     
1049 O O     . ILE A 138 ? 0.4234 0.2685 0.3520 0.0785  -0.0502 0.0017  138 ILE A O     
1050 C CB    . ILE A 138 ? 0.4116 0.2688 0.3296 0.0520  -0.0202 0.0041  138 ILE A CB    
1051 C CG1   . ILE A 138 ? 0.4250 0.2732 0.3271 0.0390  -0.0101 0.0049  138 ILE A CG1   
1052 C CG2   . ILE A 138 ? 0.3820 0.2754 0.3278 0.0525  -0.0147 0.0019  138 ILE A CG2   
1053 C CD1   . ILE A 138 ? 0.3990 0.2685 0.3168 0.0366  -0.0008 0.0000  138 ILE A CD1   
1054 N N     . ASN A 139 ? 0.4358 0.3019 0.3630 0.0615  -0.0392 0.0095  139 ASN A N     
1055 C CA    . ASN A 139 ? 0.4451 0.3305 0.3957 0.0710  -0.0470 0.0061  139 ASN A CA    
1056 C C     . ASN A 139 ? 0.4835 0.3468 0.4277 0.0844  -0.0643 0.0037  139 ASN A C     
1057 O O     . ASN A 139 ? 0.5113 0.3420 0.4247 0.0830  -0.0724 0.0092  139 ASN A O     
1058 C CB    . ASN A 139 ? 0.4258 0.3440 0.4081 0.0733  -0.0385 -0.0007 139 ASN A CB    
1059 C CG    . ASN A 139 ? 0.4209 0.3549 0.4044 0.0615  -0.0244 0.0019  139 ASN A CG    
1060 O OD1   . ASN A 139 ? 0.4352 0.3667 0.4070 0.0532  -0.0222 0.0075  139 ASN A OD1   
1061 N ND2   . ASN A 139 ? 0.4127 0.3617 0.4090 0.0607  -0.0152 -0.0027 139 ASN A ND2   
1062 N N     . LYS A 140 ? 0.5065 0.3850 0.4776 0.0969  -0.0700 -0.0053 140 LYS A N     
1063 C CA    . LYS A 140 ? 0.5686 0.4313 0.5405 0.1123  -0.0895 -0.0101 140 LYS A CA    
1064 C C     . LYS A 140 ? 0.5778 0.4121 0.5346 0.1201  -0.0964 -0.0125 140 LYS A C     
1065 O O     . LYS A 140 ? 0.5960 0.4109 0.5488 0.1340  -0.1145 -0.0165 140 LYS A O     
1066 C CB    . LYS A 140 ? 0.5967 0.4944 0.6108 0.1219  -0.0931 -0.0215 140 LYS A CB    
1067 C CG    . LYS A 140 ? 0.6619 0.5689 0.6806 0.1211  -0.0997 -0.0195 140 LYS A CG    
1068 C CD    . LYS A 140 ? 0.7352 0.6672 0.7925 0.1344  -0.1104 -0.0331 140 LYS A CD    
1069 C CE    . LYS A 140 ? 0.8029 0.7364 0.8599 0.1357  -0.1222 -0.0315 140 LYS A CE    
1070 N NZ    . LYS A 140 ? 0.8435 0.7776 0.9201 0.1537  -0.1448 -0.0434 140 LYS A NZ    
1071 N N     . GLY A 141 ? 0.5586 0.3882 0.5056 0.1117  -0.0833 -0.0104 141 GLY A N     
1072 C CA    . GLY A 141 ? 0.5807 0.3745 0.5032 0.1162  -0.0896 -0.0102 141 GLY A CA    
1073 C C     . GLY A 141 ? 0.5627 0.3740 0.5145 0.1272  -0.0889 -0.0218 141 GLY A C     
1074 O O     . GLY A 141 ? 0.5512 0.4003 0.5359 0.1261  -0.0787 -0.0281 141 GLY A O     
1075 N N     . LEU A 142 ? 0.5725 0.3548 0.5108 0.1368  -0.0987 -0.0250 142 LEU A N     
1076 C CA    . LEU A 142 ? 0.5728 0.3701 0.5389 0.1478  -0.0982 -0.0374 142 LEU A CA    
1077 C C     . LEU A 142 ? 0.5699 0.3946 0.5770 0.1642  -0.1095 -0.0511 142 LEU A C     
1078 O O     . LEU A 142 ? 0.5657 0.3793 0.5707 0.1745  -0.1279 -0.0518 142 LEU A O     
1079 C CB    . LEU A 142 ? 0.6174 0.3717 0.5556 0.1550  -0.1080 -0.0376 142 LEU A CB    
1080 C CG    . LEU A 142 ? 0.6309 0.3549 0.5299 0.1396  -0.0970 -0.0278 142 LEU A CG    
1081 C CD1   . LEU A 142 ? 0.6629 0.3519 0.5442 0.1482  -0.1046 -0.0317 142 LEU A CD1   
1082 C CD2   . LEU A 142 ? 0.5873 0.3430 0.4987 0.1230  -0.0739 -0.0262 142 LEU A CD2   
1083 N N     . SER A 143 ? 0.5578 0.4175 0.6016 0.1658  -0.0976 -0.0630 143 SER A N     
1084 C CA    . SER A 143 ? 0.5579 0.4441 0.6454 0.1817  -0.1058 -0.0811 143 SER A CA    
1085 C C     . SER A 143 ? 0.5947 0.4512 0.6767 0.2008  -0.1268 -0.0885 143 SER A C     
1086 O O     . SER A 143 ? 0.6132 0.4294 0.6572 0.2000  -0.1312 -0.0798 143 SER A O     
1087 C CB    . SER A 143 ? 0.5274 0.4530 0.6505 0.1767  -0.0848 -0.0935 143 SER A CB    
1088 O OG    . SER A 143 ? 0.5394 0.4532 0.6527 0.1751  -0.0758 -0.0954 143 SER A OG    
1089 N N     . GLU A 144 ? 0.6031 0.4805 0.7246 0.2177  -0.1390 -0.1060 144 GLU A N     
1090 C CA    . GLU A 144 ? 0.6413 0.4973 0.7679 0.2392  -0.1601 -0.1178 144 GLU A CA    
1091 C C     . GLU A 144 ? 0.6288 0.4822 0.7560 0.2374  -0.1465 -0.1229 144 GLU A C     
1092 O O     . GLU A 144 ? 0.6436 0.4575 0.7442 0.2460  -0.1583 -0.1209 144 GLU A O     
1093 C CB    . GLU A 144 ? 0.6668 0.5553 0.8451 0.2570  -0.1743 -0.1392 144 GLU A CB    
1094 C CG    . GLU A 144 ? 0.7125 0.5939 0.8857 0.2636  -0.1956 -0.1355 144 GLU A CG    
1095 C CD    . GLU A 144 ? 0.7075 0.6195 0.8891 0.2462  -0.1802 -0.1281 144 GLU A CD    
1096 O OE1   . GLU A 144 ? 0.7513 0.6847 0.9345 0.2273  -0.1533 -0.1222 144 GLU A OE1   
1097 O OE2   . GLU A 144 ? 0.7418 0.6546 0.9259 0.2512  -0.1957 -0.1276 144 GLU A OE2   
1098 N N     . GLU A 145 ? 0.5998 0.4906 0.7515 0.2247  -0.1212 -0.1281 145 GLU A N     
1099 C CA    . GLU A 145 ? 0.6045 0.4937 0.7565 0.2223  -0.1074 -0.1337 145 GLU A CA    
1100 C C     . GLU A 145 ? 0.6122 0.4585 0.7133 0.2133  -0.1056 -0.1167 145 GLU A C     
1101 O O     . GLU A 145 ? 0.6395 0.4582 0.7280 0.2225  -0.1129 -0.1206 145 GLU A O     
1102 C CB    . GLU A 145 ? 0.5846 0.5168 0.7645 0.2081  -0.0800 -0.1409 145 GLU A CB    
1103 C CG    . GLU A 145 ? 0.6010 0.5294 0.7760 0.2035  -0.0647 -0.1454 145 GLU A CG    
1104 C CD    . GLU A 145 ? 0.5950 0.5617 0.7952 0.1908  -0.0389 -0.1548 145 GLU A CD    
1105 O OE1   . GLU A 145 ? 0.5797 0.5718 0.7921 0.1811  -0.0299 -0.1530 145 GLU A OE1   
1106 O OE2   . GLU A 145 ? 0.6205 0.5886 0.8250 0.1900  -0.0274 -0.1639 145 GLU A OE2   
1107 N N     . LEU A 146 ? 0.5887 0.4292 0.6618 0.1957  -0.0962 -0.0994 146 LEU A N     
1108 C CA    . LEU A 146 ? 0.5977 0.4034 0.6258 0.1832  -0.0906 -0.0846 146 LEU A CA    
1109 C C     . LEU A 146 ? 0.6307 0.3852 0.6211 0.1918  -0.1119 -0.0772 146 LEU A C     
1110 O O     . LEU A 146 ? 0.6449 0.3646 0.6065 0.1912  -0.1135 -0.0741 146 LEU A O     
1111 C CB    . LEU A 146 ? 0.5747 0.3926 0.5889 0.1628  -0.0753 -0.0708 146 LEU A CB    
1112 C CG    . LEU A 146 ? 0.5386 0.3978 0.5792 0.1525  -0.0542 -0.0759 146 LEU A CG    
1113 C CD1   . LEU A 146 ? 0.5109 0.3849 0.5444 0.1371  -0.0444 -0.0648 146 LEU A CD1   
1114 C CD2   . LEU A 146 ? 0.5527 0.4033 0.5828 0.1471  -0.0425 -0.0781 146 LEU A CD2   
1115 N N     . GLN A 147 ? 0.6486 0.3970 0.6372 0.1993  -0.1284 -0.0748 147 GLN A N     
1116 C CA    . GLN A 147 ? 0.7110 0.4085 0.6636 0.2102  -0.1520 -0.0697 147 GLN A CA    
1117 C C     . GLN A 147 ? 0.7211 0.3953 0.6759 0.2286  -0.1657 -0.0814 147 GLN A C     
1118 O O     . GLN A 147 ? 0.7571 0.3830 0.6702 0.2284  -0.1724 -0.0745 147 GLN A O     
1119 C CB    . GLN A 147 ? 0.7425 0.4459 0.7045 0.2194  -0.1695 -0.0704 147 GLN A CB    
1120 C CG    . GLN A 147 ? 0.8347 0.4813 0.7474 0.2249  -0.1919 -0.0603 147 GLN A CG    
1121 C CD    . GLN A 147 ? 0.8823 0.5137 0.7569 0.2034  -0.1808 -0.0425 147 GLN A CD    
1122 O OE1   . GLN A 147 ? 0.9270 0.5453 0.7757 0.1859  -0.1635 -0.0336 147 GLN A OE1   
1123 N NE2   . GLN A 147 ? 0.9112 0.5462 0.7841 0.2043  -0.1906 -0.0387 147 GLN A NE2   
1124 N N     . ALA A 148 ? 0.6916 0.4003 0.6949 0.2431  -0.1677 -0.0999 148 ALA A N     
1125 C CA    . ALA A 148 ? 0.7219 0.4103 0.7306 0.2619  -0.1812 -0.1129 148 ALA A CA    
1126 C C     . ALA A 148 ? 0.7200 0.4014 0.7181 0.2524  -0.1629 -0.1127 148 ALA A C     
1127 O O     . ALA A 148 ? 0.7464 0.3877 0.7206 0.2610  -0.1733 -0.1139 148 ALA A O     
1128 C CB    . ALA A 148 ? 0.7037 0.4330 0.7713 0.2808  -0.1895 -0.1356 148 ALA A CB    
1129 N N     . ALA A 149 ? 0.6859 0.4045 0.7002 0.2347  -0.1364 -0.1114 149 ALA A N     
1130 C CA    . ALA A 149 ? 0.6810 0.3945 0.6843 0.2243  -0.1188 -0.1110 149 ALA A CA    
1131 C C     . ALA A 149 ? 0.7043 0.3740 0.6529 0.2089  -0.1160 -0.0928 149 ALA A C     
1132 O O     . ALA A 149 ? 0.7065 0.3567 0.6376 0.2043  -0.1090 -0.0927 149 ALA A O     
1133 C CB    . ALA A 149 ? 0.6370 0.3997 0.6690 0.2096  -0.0931 -0.1145 149 ALA A CB    
1134 N N     . PHE A 150 ? 0.7123 0.3689 0.6358 0.1998  -0.1197 -0.0787 150 PHE A N     
1135 C CA    . PHE A 150 ? 0.7433 0.3606 0.6161 0.1824  -0.1146 -0.0628 150 PHE A CA    
1136 C C     . PHE A 150 ? 0.7997 0.3678 0.6310 0.1863  -0.1341 -0.0531 150 PHE A C     
1137 O O     . PHE A 150 ? 0.7746 0.3389 0.5867 0.1730  -0.1300 -0.0419 150 PHE A O     
1138 C CB    . PHE A 150 ? 0.6988 0.3470 0.5749 0.1604  -0.0931 -0.0544 150 PHE A CB    
1139 C CG    . PHE A 150 ? 0.6497 0.3331 0.5509 0.1529  -0.0735 -0.0611 150 PHE A CG    
1140 C CD1   . PHE A 150 ? 0.6543 0.3213 0.5342 0.1412  -0.0624 -0.0586 150 PHE A CD1   
1141 C CD2   . PHE A 150 ? 0.6080 0.3394 0.5526 0.1570  -0.0661 -0.0705 150 PHE A CD2   
1142 C CE1   . PHE A 150 ? 0.6294 0.3266 0.5295 0.1346  -0.0458 -0.0648 150 PHE A CE1   
1143 C CE2   . PHE A 150 ? 0.5732 0.3328 0.5356 0.1493  -0.0481 -0.0763 150 PHE A CE2   
1144 C CZ    . PHE A 150 ? 0.5941 0.3362 0.5337 0.1388  -0.0388 -0.0733 150 PHE A CZ    
1145 N N     . PRO A 151 ? 0.8726 0.3992 0.6867 0.2041  -0.1552 -0.0577 151 PRO A N     
1146 C CA    . PRO A 151 ? 0.9563 0.4305 0.7287 0.2118  -0.1783 -0.0502 151 PRO A CA    
1147 C C     . PRO A 151 ? 1.0287 0.4500 0.7387 0.1920  -0.1722 -0.0347 151 PRO A C     
1148 O O     . PRO A 151 ? 1.0588 0.4426 0.7308 0.1903  -0.1841 -0.0256 151 PRO A O     
1149 C CB    . PRO A 151 ? 0.9813 0.4274 0.7561 0.2377  -0.2018 -0.0622 151 PRO A CB    
1150 C CG    . PRO A 151 ? 0.9558 0.4186 0.7504 0.2358  -0.1865 -0.0709 151 PRO A CG    
1151 C CD    . PRO A 151 ? 0.8891 0.4140 0.7215 0.2193  -0.1596 -0.0715 151 PRO A CD    
1152 N N     . GLN A 152 ? 1.0847 0.5019 0.7843 0.1774  -0.1538 -0.0335 152 GLN A N     
1153 C CA    . GLN A 152 ? 1.1711 0.5444 0.8176 0.1555  -0.1431 -0.0219 152 GLN A CA    
1154 C C     . GLN A 152 ? 1.1499 0.5480 0.7944 0.1325  -0.1249 -0.0127 152 GLN A C     
1155 O O     . GLN A 152 ? 1.1959 0.5539 0.7953 0.1207  -0.1263 -0.0029 152 GLN A O     
1156 C CB    . GLN A 152 ? 1.1970 0.5588 0.8372 0.1493  -0.1311 -0.0264 152 GLN A CB    
1157 C CG    . GLN A 152 ? 1.1546 0.5717 0.8339 0.1372  -0.1069 -0.0317 152 GLN A CG    
1158 C CD    . GLN A 152 ? 1.1127 0.5905 0.8526 0.1515  -0.1058 -0.0431 152 GLN A CD    
1159 O OE1   . GLN A 152 ? 1.0955 0.5903 0.8578 0.1662  -0.1188 -0.0463 152 GLN A OE1   
1160 N NE2   . GLN A 152 ? 1.0727 0.5822 0.8373 0.1457  -0.0892 -0.0499 152 GLN A NE2   
1161 N N     . CYS A 153 ? 1.0863 0.5470 0.7780 0.1275  -0.1094 -0.0167 153 CYS A N     
1162 C CA    . CYS A 153 ? 1.0293 0.5202 0.7271 0.1083  -0.0930 -0.0102 153 CYS A CA    
1163 C C     . CYS A 153 ? 0.9995 0.4760 0.6764 0.1048  -0.1005 -0.0017 153 CYS A C     
1164 O O     . CYS A 153 ? 1.0278 0.5402 0.7352 0.1120  -0.1047 -0.0029 153 CYS A O     
1165 C CB    . CYS A 153 ? 0.9777 0.5345 0.7295 0.1093  -0.0812 -0.0166 153 CYS A CB    
1166 S SG    . CYS A 153 ? 1.0079 0.5829 0.7775 0.1051  -0.0659 -0.0248 153 CYS A SG    
1167 N N     . VAL A 154 ? 0.9631 0.3896 0.5881 0.0903  -0.0983 0.0061  154 VAL A N     
1168 C CA    . VAL A 154 ? 0.9411 0.3514 0.5378 0.0775  -0.0967 0.0148  154 VAL A CA    
1169 C C     . VAL A 154 ? 0.8629 0.3303 0.4951 0.0649  -0.0793 0.0150  154 VAL A C     
1170 O O     . VAL A 154 ? 0.8189 0.3152 0.4699 0.0524  -0.0610 0.0118  154 VAL A O     
1171 C CB    . VAL A 154 ? 0.9842 0.3348 0.5207 0.0577  -0.0889 0.0209  154 VAL A CB    
1172 C CG1   . VAL A 154 ? 0.9923 0.3265 0.4982 0.0408  -0.0828 0.0285  154 VAL A CG1   
1173 C CG2   . VAL A 154 ? 1.0477 0.3366 0.5447 0.0720  -0.1092 0.0216  154 VAL A CG2   
1174 N N     . PRO A 155 ? 0.8260 0.3102 0.4689 0.0696  -0.0863 0.0179  155 PRO A N     
1175 C CA    . PRO A 155 ? 0.7711 0.3074 0.4470 0.0590  -0.0711 0.0178  155 PRO A CA    
1176 C C     . PRO A 155 ? 0.7698 0.2976 0.4227 0.0339  -0.0519 0.0211  155 PRO A C     
1177 O O     . PRO A 155 ? 0.8250 0.3041 0.4319 0.0240  -0.0519 0.0253  155 PRO A O     
1178 C CB    . PRO A 155 ? 0.7686 0.3102 0.4488 0.0685  -0.0849 0.0208  155 PRO A CB    
1179 C CG    . PRO A 155 ? 0.7996 0.3114 0.4706 0.0904  -0.1090 0.0185  155 PRO A CG    
1180 C CD    . PRO A 155 ? 0.8543 0.3150 0.4850 0.0869  -0.1100 0.0198  155 PRO A CD    
1181 N N     . THR A 156 ? 0.7388 0.3105 0.4216 0.0231  -0.0355 0.0180  156 THR A N     
1182 C CA    . THR A 156 ? 0.7617 0.3265 0.4261 -0.0005 -0.0174 0.0180  156 THR A CA    
1183 C C     . THR A 156 ? 0.7506 0.3134 0.4028 -0.0086 -0.0161 0.0227  156 THR A C     
1184 O O     . THR A 156 ? 0.6931 0.2854 0.3706 0.0011  -0.0226 0.0239  156 THR A O     
1185 C CB    . THR A 156 ? 0.7301 0.3371 0.4266 -0.0109 -0.0004 0.0111  156 THR A CB    
1186 O OG1   . THR A 156 ? 0.7103 0.3622 0.4397 -0.0103 0.0029  0.0103  156 THR A OG1   
1187 C CG2   . THR A 156 ? 0.7210 0.3402 0.4371 -0.0012 -0.0020 0.0060  156 THR A CG2   
1188 N N     . PRO A 157 ? 0.7995 0.3247 0.4106 -0.0273 -0.0071 0.0247  157 PRO A N     
1189 C CA    . PRO A 157 ? 0.8281 0.3457 0.4225 -0.0351 -0.0060 0.0288  157 PRO A CA    
1190 C C     . PRO A 157 ? 0.7858 0.3600 0.4238 -0.0365 0.0015  0.0257  157 PRO A C     
1191 O O     . PRO A 157 ? 0.7857 0.3935 0.4514 -0.0436 0.0141  0.0194  157 PRO A O     
1192 C CB    . PRO A 157 ? 0.8729 0.3484 0.4220 -0.0597 0.0095  0.0279  157 PRO A CB    
1193 C CG    . PRO A 157 ? 0.9024 0.3377 0.4249 -0.0574 0.0052  0.0281  157 PRO A CG    
1194 C CD    . PRO A 157 ? 0.8520 0.3271 0.4205 -0.0390 -0.0018 0.0244  157 PRO A CD    
1195 N N     . ARG A 158 ? 0.7836 0.3689 0.4291 -0.0279 -0.0078 0.0297  158 ARG A N     
1196 C CA    . ARG A 158 ? 0.7627 0.3968 0.4453 -0.0304 -0.0002 0.0268  158 ARG A CA    
1197 C C     . ARG A 158 ? 0.8173 0.4538 0.4912 -0.0528 0.0185  0.0226  158 ARG A C     
1198 O O     . ARG A 158 ? 0.8661 0.4645 0.5001 -0.0655 0.0227  0.0248  158 ARG A O     
1199 C CB    . ARG A 158 ? 0.7498 0.3938 0.4410 -0.0182 -0.0132 0.0313  158 ARG A CB    
1200 C CG    . ARG A 158 ? 0.7158 0.3984 0.4497 -0.0001 -0.0219 0.0294  158 ARG A CG    
1201 C CD    . ARG A 158 ? 0.6908 0.3889 0.4382 0.0095  -0.0322 0.0318  158 ARG A CD    
1202 N NE    . ARG A 158 ? 0.6468 0.3850 0.4222 0.0032  -0.0219 0.0298  158 ARG A NE    
1203 C CZ    . ARG A 158 ? 0.5904 0.3698 0.4047 0.0101  -0.0200 0.0265  158 ARG A CZ    
1204 N NH1   . ARG A 158 ? 0.5684 0.3587 0.4016 0.0219  -0.0248 0.0237  158 ARG A NH1   
1205 N NH2   . ARG A 158 ? 0.5469 0.3548 0.3794 0.0044  -0.0126 0.0254  158 ARG A NH2   
1206 N N     . PRO A 159 ? 0.8514 0.5329 0.5629 -0.0575 0.0295  0.0156  159 PRO A N     
1207 C CA    . PRO A 159 ? 0.8752 0.5715 0.5915 -0.0759 0.0460  0.0087  159 PRO A CA    
1208 C C     . PRO A 159 ? 0.9103 0.5873 0.6013 -0.0845 0.0481  0.0118  159 PRO A C     
1209 O O     . PRO A 159 ? 0.9167 0.6070 0.6185 -0.0736 0.0383  0.0166  159 PRO A O     
1210 C CB    . PRO A 159 ? 0.8155 0.5660 0.5805 -0.0673 0.0454  0.0047  159 PRO A CB    
1211 C CG    . PRO A 159 ? 0.7965 0.5568 0.5780 -0.0536 0.0377  0.0054  159 PRO A CG    
1212 C CD    . PRO A 159 ? 0.8148 0.5348 0.5663 -0.0453 0.0265  0.0125  159 PRO A CD    
1213 N N     . GLU A 160 ? 0.9966 0.6419 0.6536 -0.1047 0.0616  0.0084  160 GLU A N     
1214 C CA    . GLU A 160 ? 1.0488 0.6793 0.6832 -0.1168 0.0680  0.0088  160 GLU A CA    
1215 C C     . GLU A 160 ? 1.0332 0.7078 0.7033 -0.1284 0.0840  -0.0031 160 GLU A C     
1216 O O     . GLU A 160 ? 1.0049 0.6766 0.6703 -0.1484 0.1024  -0.0139 160 GLU A O     
1217 C CB    . GLU A 160 ? 1.1100 0.6782 0.6836 -0.1345 0.0756  0.0106  160 GLU A CB    
1218 C CG    . GLU A 160 ? 1.1390 0.6776 0.6756 -0.1445 0.0782  0.0140  160 GLU A CG    
1219 C CD    . GLU A 160 ? 1.1654 0.6876 0.6786 -0.1740 0.1037  0.0037  160 GLU A CD    
1220 O OE1   . GLU A 160 ? 1.1817 0.6696 0.6644 -0.1891 0.1146  0.0005  160 GLU A OE1   
1221 O OE2   . GLU A 160 ? 1.1287 0.6713 0.6534 -0.1829 0.1138  -0.0020 160 GLU A OE2   
1222 N N     . ILE A 161 ? 0.9978 0.7136 0.7052 -0.1158 0.0771  -0.0027 161 ILE A N     
1223 C CA    . ILE A 161 ? 0.9708 0.7252 0.7100 -0.1247 0.0894  -0.0142 161 ILE A CA    
1224 C C     . ILE A 161 ? 1.0216 0.7659 0.7440 -0.1291 0.0904  -0.0113 161 ILE A C     
1225 O O     . ILE A 161 ? 1.0142 0.7559 0.7338 -0.1149 0.0758  -0.0014 161 ILE A O     
1226 C CB    . ILE A 161 ? 0.8650 0.6703 0.6553 -0.1109 0.0836  -0.0182 161 ILE A CB    
1227 C CG1   . ILE A 161 ? 0.8343 0.6436 0.6350 -0.1034 0.0789  -0.0182 161 ILE A CG1   
1228 C CG2   . ILE A 161 ? 0.8254 0.6635 0.6444 -0.1222 0.0969  -0.0333 161 ILE A CG2   
1229 C CD1   . ILE A 161 ? 0.8293 0.6361 0.6297 -0.1194 0.0932  -0.0300 161 ILE A CD1   
1230 N N     . ASN A 162 ? 1.0956 0.8315 0.8047 -0.1500 0.1084  -0.0210 162 ASN A N     
1231 C CA    . ASN A 162 ? 1.1699 0.8903 0.8565 -0.1570 0.1114  -0.0191 162 ASN A CA    
1232 C C     . ASN A 162 ? 1.1220 0.8891 0.8512 -0.1506 0.1110  -0.0249 162 ASN A C     
1233 O O     . ASN A 162 ? 1.0538 0.8623 0.8270 -0.1410 0.1080  -0.0304 162 ASN A O     
1234 C CB    . ASN A 162 ? 1.2433 0.9227 0.8848 -0.1838 0.1314  -0.0256 162 ASN A CB    
1235 C CG    . ASN A 162 ? 1.2527 0.9515 0.9143 -0.2032 0.1537  -0.0440 162 ASN A CG    
1236 O OD1   . ASN A 162 ? 1.3003 1.0127 0.9815 -0.2005 0.1535  -0.0479 162 ASN A OD1   
1237 N ND2   . ASN A 162 ? 1.2410 0.9406 0.8977 -0.2235 0.1732  -0.0566 162 ASN A ND2   
1238 N N     . ASN A 163 ? 1.1616 0.9164 0.8723 -0.1543 0.1116  -0.0223 163 ASN A N     
1239 C CA    . ASN A 163 ? 1.1170 0.9057 0.8570 -0.1511 0.1125  -0.0275 163 ASN A CA    
1240 C C     . ASN A 163 ? 0.9482 0.7883 0.7424 -0.1459 0.1153  -0.0394 163 ASN A C     
1241 O O     . ASN A 163 ? 0.9539 0.8079 0.7619 -0.1607 0.1319  -0.0552 163 ASN A O     
1242 C CB    . ASN A 163 ? 1.2493 1.0196 0.9638 -0.1728 0.1307  -0.0363 163 ASN A CB    
1243 C CG    . ASN A 163 ? 1.3231 1.0426 0.9819 -0.1763 0.1252  -0.0242 163 ASN A CG    
1244 O OD1   . ASN A 163 ? 1.3326 1.0459 0.9858 -0.1592 0.1057  -0.0113 163 ASN A OD1   
1245 N ND2   . ASN A 163 ? 1.3427 1.0255 0.9599 -0.1994 0.1429  -0.0299 163 ASN A ND2   
1246 N N     A LYS A 164 ? 0.8500 0.7158 0.6726 -0.1257 0.0993  -0.0327 164 LYS A N     
1247 N N     B LYS A 164 ? 0.8490 0.7153 0.6724 -0.1259 0.0996  -0.0330 164 LYS A N     
1248 C CA    A LYS A 164 ? 0.7438 0.6533 0.6128 -0.1177 0.0977  -0.0417 164 LYS A CA    
1249 C CA    B LYS A 164 ? 0.7448 0.6551 0.6146 -0.1192 0.0992  -0.0432 164 LYS A CA    
1250 C C     A LYS A 164 ? 0.6907 0.6227 0.5793 -0.1120 0.0945  -0.0439 164 LYS A C     
1251 C C     B LYS A 164 ? 0.6918 0.6241 0.5808 -0.1121 0.0947  -0.0441 164 LYS A C     
1252 O O     A LYS A 164 ? 0.6695 0.5935 0.5478 -0.1029 0.0841  -0.0325 164 LYS A O     
1253 O O     B LYS A 164 ? 0.6722 0.5964 0.5511 -0.1023 0.0836  -0.0322 164 LYS A O     
1254 C CB    A LYS A 164 ? 0.7127 0.6314 0.5953 -0.1008 0.0834  -0.0333 164 LYS A CB    
1255 C CB    B LYS A 164 ? 0.7150 0.6385 0.6029 -0.1044 0.0874  -0.0381 164 LYS A CB    
1256 C CG    A LYS A 164 ? 0.7162 0.6218 0.5899 -0.1063 0.0878  -0.0354 164 LYS A CG    
1257 C CG    B LYS A 164 ? 0.7046 0.6308 0.5991 -0.1129 0.0961  -0.0481 164 LYS A CG    
1258 C CD    A LYS A 164 ? 0.6817 0.5853 0.5575 -0.0906 0.0740  -0.0248 164 LYS A CD    
1259 C CD    B LYS A 164 ? 0.6871 0.6100 0.5825 -0.1007 0.0851  -0.0396 164 LYS A CD    
1260 C CE    A LYS A 164 ? 0.6619 0.5412 0.5138 -0.0812 0.0622  -0.0103 164 LYS A CE    
1261 C CE    B LYS A 164 ? 0.6411 0.5986 0.5731 -0.0887 0.0778  -0.0445 164 LYS A CE    
1262 N NZ    A LYS A 164 ? 0.6760 0.5172 0.4939 -0.0836 0.0603  -0.0039 164 LYS A NZ    
1263 N NZ    B LYS A 164 ? 0.6625 0.6220 0.6005 -0.0939 0.0825  -0.0526 164 LYS A NZ    
1264 N N     . ASN A 165 ? 0.6418 0.6014 0.5591 -0.1175 0.1034  -0.0599 165 ASN A N     
1265 C CA    . ASN A 165 ? 0.5791 0.5612 0.5180 -0.1113 0.1001  -0.0640 165 ASN A CA    
1266 C C     . ASN A 165 ? 0.4794 0.4847 0.4449 -0.0917 0.0839  -0.0586 165 ASN A C     
1267 O O     . ASN A 165 ? 0.4203 0.4340 0.3978 -0.0855 0.0790  -0.0589 165 ASN A O     
1268 C CB    . ASN A 165 ? 0.5995 0.6042 0.5633 -0.1225 0.1138  -0.0853 165 ASN A CB    
1269 C CG    . ASN A 165 ? 0.6847 0.6683 0.6228 -0.1436 0.1324  -0.0925 165 ASN A CG    
1270 O OD1   . ASN A 165 ? 0.7078 0.6547 0.6043 -0.1506 0.1344  -0.0808 165 ASN A OD1   
1271 N ND2   . ASN A 165 ? 0.6998 0.7050 0.6616 -0.1543 0.1462  -0.1132 165 ASN A ND2   
1272 N N     . ILE A 166 ? 0.4068 0.4214 0.3803 -0.0837 0.0772  -0.0555 166 ILE A N     
1273 C CA    . ILE A 166 ? 0.3653 0.4009 0.3632 -0.0679 0.0644  -0.0536 166 ILE A CA    
1274 C C     . ILE A 166 ? 0.3180 0.3790 0.3468 -0.0671 0.0661  -0.0703 166 ILE A C     
1275 O O     . ILE A 166 ? 0.3213 0.3941 0.3636 -0.0742 0.0742  -0.0846 166 ILE A O     
1276 C CB    . ILE A 166 ? 0.3504 0.3886 0.3492 -0.0619 0.0587  -0.0489 166 ILE A CB    
1277 C CG1   . ILE A 166 ? 0.3594 0.3745 0.3309 -0.0604 0.0538  -0.0330 166 ILE A CG1   
1278 C CG2   . ILE A 166 ? 0.3265 0.3848 0.3496 -0.0476 0.0473  -0.0500 166 ILE A CG2   
1279 C CD1   . ILE A 166 ? 0.3755 0.3890 0.3429 -0.0567 0.0489  -0.0276 166 ILE A CD1   
1280 N N     . PRO A 167 ? 0.2773 0.3455 0.3165 -0.0588 0.0584  -0.0694 167 PRO A N     
1281 C CA    . PRO A 167 ? 0.2556 0.3455 0.3223 -0.0587 0.0590  -0.0866 167 PRO A CA    
1282 C C     . PRO A 167 ? 0.2267 0.3375 0.3192 -0.0481 0.0498  -0.0960 167 PRO A C     
1283 O O     . PRO A 167 ? 0.2342 0.3641 0.3519 -0.0481 0.0499  -0.1133 167 PRO A O     
1284 C CB    . PRO A 167 ? 0.2546 0.3406 0.3182 -0.0521 0.0517  -0.0802 167 PRO A CB    
1285 C CG    . PRO A 167 ? 0.2551 0.3245 0.2982 -0.0438 0.0439  -0.0606 167 PRO A CG    
1286 C CD    . PRO A 167 ? 0.2709 0.3264 0.2960 -0.0507 0.0501  -0.0543 167 PRO A CD    
1287 N N     . ASP A 168 ? 0.2235 0.3301 0.3103 -0.0382 0.0407  -0.0853 168 ASP A N     
1288 C CA    . ASP A 168 ? 0.2121 0.3323 0.3180 -0.0256 0.0287  -0.0915 168 ASP A CA    
1289 C C     . ASP A 168 ? 0.2121 0.3201 0.3020 -0.0199 0.0233  -0.0763 168 ASP A C     
1290 O O     . ASP A 168 ? 0.2273 0.3203 0.2972 -0.0199 0.0229  -0.0610 168 ASP A O     
1291 C CB    . ASP A 168 ? 0.2101 0.3339 0.3230 -0.0139 0.0155  -0.0916 168 ASP A CB    
1292 C CG    . ASP A 168 ? 0.2112 0.3454 0.3416 -0.0007 0.0014  -0.1007 168 ASP A CG    
1293 O OD1   . ASP A 168 ? 0.2191 0.3437 0.3395 0.0089  -0.0085 -0.0909 168 ASP A OD1   
1294 O OD2   . ASP A 168 ? 0.2137 0.3654 0.3684 -0.0006 0.0007  -0.1191 168 ASP A OD2   
1295 N N     . PRO A 169 ? 0.1980 0.3128 0.2984 -0.0142 0.0184  -0.0816 169 PRO A N     
1296 C CA    . PRO A 169 ? 0.1904 0.2940 0.2767 -0.0102 0.0143  -0.0688 169 PRO A CA    
1297 C C     . PRO A 169 ? 0.1847 0.2776 0.2589 -0.0008 0.0041  -0.0551 169 PRO A C     
1298 O O     . PRO A 169 ? 0.1695 0.2515 0.2290 -0.0005 0.0034  -0.0427 169 PRO A O     
1299 C CB    . PRO A 169 ? 0.1933 0.3072 0.2964 -0.0046 0.0095  -0.0803 169 PRO A CB    
1300 C CG    . PRO A 169 ? 0.1953 0.3273 0.3242 -0.0025 0.0078  -0.0997 169 PRO A CG    
1301 C CD    . PRO A 169 ? 0.1935 0.3269 0.3199 -0.0142 0.0194  -0.1018 169 PRO A CD    
1302 N N     . PHE A 170 ? 0.1860 0.2820 0.2667 0.0067  -0.0042 -0.0589 170 PHE A N     
1303 C CA    . PHE A 170 ? 0.1935 0.2772 0.2597 0.0133  -0.0114 -0.0469 170 PHE A CA    
1304 C C     . PHE A 170 ? 0.1910 0.2666 0.2432 0.0076  -0.0047 -0.0357 170 PHE A C     
1305 O O     . PHE A 170 ? 0.2070 0.2726 0.2468 0.0108  -0.0074 -0.0249 170 PHE A O     
1306 C CB    . PHE A 170 ? 0.2119 0.2974 0.2840 0.0219  -0.0220 -0.0538 170 PHE A CB    
1307 C CG    . PHE A 170 ? 0.2342 0.3158 0.3082 0.0329  -0.0351 -0.0580 170 PHE A CG    
1308 C CD1   . PHE A 170 ? 0.2432 0.3073 0.2979 0.0370  -0.0399 -0.0460 170 PHE A CD1   
1309 C CD2   . PHE A 170 ? 0.2470 0.3411 0.3420 0.0387  -0.0426 -0.0749 170 PHE A CD2   
1310 C CE1   . PHE A 170 ? 0.2738 0.3284 0.3249 0.0469  -0.0525 -0.0493 170 PHE A CE1   
1311 C CE2   . PHE A 170 ? 0.2710 0.3578 0.3657 0.0505  -0.0572 -0.0791 170 PHE A CE2   
1312 C CZ    . PHE A 170 ? 0.2654 0.3298 0.3353 0.0546  -0.0624 -0.0653 170 PHE A CZ    
1313 N N     . TRP A 171 ? 0.1905 0.2688 0.2440 -0.0010 0.0042  -0.0389 171 TRP A N     
1314 C CA    . TRP A 171 ? 0.1957 0.2630 0.2341 -0.0054 0.0091  -0.0283 171 TRP A CA    
1315 C C     . TRP A 171 ? 0.2068 0.2660 0.2343 -0.0061 0.0095  -0.0182 171 TRP A C     
1316 O O     . TRP A 171 ? 0.2143 0.2662 0.2330 -0.0032 0.0073  -0.0085 171 TRP A O     
1317 C CB    . TRP A 171 ? 0.1987 0.2655 0.2360 -0.0155 0.0185  -0.0341 171 TRP A CB    
1318 C CG    . TRP A 171 ? 0.2042 0.2567 0.2248 -0.0184 0.0213  -0.0241 171 TRP A CG    
1319 C CD1   . TRP A 171 ? 0.1988 0.2463 0.2151 -0.0173 0.0209  -0.0217 171 TRP A CD1   
1320 C CD2   . TRP A 171 ? 0.2104 0.2500 0.2155 -0.0219 0.0234  -0.0158 171 TRP A CD2   
1321 N NE1   . TRP A 171 ? 0.2032 0.2360 0.2036 -0.0193 0.0225  -0.0128 171 TRP A NE1   
1322 C CE2   . TRP A 171 ? 0.2136 0.2410 0.2067 -0.0217 0.0231  -0.0090 171 TRP A CE2   
1323 C CE3   . TRP A 171 ? 0.2263 0.2629 0.2263 -0.0248 0.0246  -0.0142 171 TRP A CE3   
1324 C CZ2   . TRP A 171 ? 0.2323 0.2441 0.2089 -0.0227 0.0220  -0.0008 171 TRP A CZ2   
1325 C CZ3   . TRP A 171 ? 0.2402 0.2610 0.2224 -0.0268 0.0239  -0.0055 171 TRP A CZ3   
1326 C CH2   . TRP A 171 ? 0.2440 0.2524 0.2150 -0.0250 0.0217  0.0009  171 TRP A CH2   
1327 N N     . LEU A 172 ? 0.2102 0.2720 0.2401 -0.0096 0.0121  -0.0220 172 LEU A N     
1328 C CA    . LEU A 172 ? 0.2238 0.2781 0.2437 -0.0103 0.0116  -0.0136 172 LEU A CA    
1329 C C     . LEU A 172 ? 0.2051 0.2586 0.2253 -0.0025 0.0043  -0.0072 172 LEU A C     
1330 O O     . LEU A 172 ? 0.1970 0.2447 0.2099 -0.0020 0.0032  0.0010  172 LEU A O     
1331 C CB    . LEU A 172 ? 0.2430 0.2989 0.2637 -0.0168 0.0168  -0.0199 172 LEU A CB    
1332 C CG    . LEU A 172 ? 0.2640 0.3103 0.2718 -0.0192 0.0165  -0.0121 172 LEU A CG    
1333 C CD1   . LEU A 172 ? 0.2841 0.3163 0.2750 -0.0221 0.0169  -0.0035 172 LEU A CD1   
1334 C CD2   . LEU A 172 ? 0.2691 0.3165 0.2767 -0.0258 0.0221  -0.0196 172 LEU A CD2   
1335 N N     . ALA A 173 ? 0.1924 0.2502 0.2201 0.0033  -0.0008 -0.0121 173 ALA A N     
1336 C CA    . ALA A 173 ? 0.1875 0.2390 0.2096 0.0090  -0.0065 -0.0060 173 ALA A CA    
1337 C C     . ALA A 173 ? 0.1830 0.2291 0.1975 0.0096  -0.0057 0.0015  173 ALA A C     
1338 O O     . ALA A 173 ? 0.1841 0.2254 0.1929 0.0094  -0.0052 0.0083  173 ALA A O     
1339 C CB    . ALA A 173 ? 0.1933 0.2442 0.2192 0.0163  -0.0145 -0.0125 173 ALA A CB    
1340 N N     . GLY A 174 ? 0.1795 0.2271 0.1952 0.0099  -0.0048 -0.0007 174 GLY A N     
1341 C CA    . GLY A 174 ? 0.1867 0.2292 0.1959 0.0109  -0.0036 0.0051  174 GLY A CA    
1342 C C     . GLY A 174 ? 0.1947 0.2361 0.2020 0.0077  0.0000  0.0105  174 GLY A C     
1343 O O     . GLY A 174 ? 0.1990 0.2380 0.2040 0.0088  0.0008  0.0152  174 GLY A O     
1344 N N     . PHE A 175 ? 0.2020 0.2441 0.2098 0.0036  0.0024  0.0087  175 PHE A N     
1345 C CA    . PHE A 175 ? 0.2243 0.2612 0.2269 0.0016  0.0034  0.0133  175 PHE A CA    
1346 C C     . PHE A 175 ? 0.2277 0.2649 0.2308 0.0023  0.0010  0.0173  175 PHE A C     
1347 O O     . PHE A 175 ? 0.2405 0.2765 0.2441 0.0042  -0.0005 0.0206  175 PHE A O     
1348 C CB    . PHE A 175 ? 0.2351 0.2672 0.2319 -0.0044 0.0067  0.0103  175 PHE A CB    
1349 C CG    . PHE A 175 ? 0.2553 0.2758 0.2410 -0.0059 0.0057  0.0149  175 PHE A CG    
1350 C CD1   . PHE A 175 ? 0.2604 0.2749 0.2426 -0.0036 0.0049  0.0169  175 PHE A CD1   
1351 C CD2   . PHE A 175 ? 0.2751 0.2880 0.2516 -0.0093 0.0047  0.0165  175 PHE A CD2   
1352 C CE1   . PHE A 175 ? 0.2910 0.2912 0.2609 -0.0036 0.0017  0.0205  175 PHE A CE1   
1353 C CE2   . PHE A 175 ? 0.2933 0.2907 0.2552 -0.0100 0.0015  0.0203  175 PHE A CE2   
1354 C CZ    . PHE A 175 ? 0.2924 0.2828 0.2509 -0.0067 -0.0005 0.0222  175 PHE A CZ    
1355 N N     . VAL A 176 ? 0.2340 0.2736 0.2386 0.0011  0.0005  0.0156  176 VAL A N     
1356 C CA    . VAL A 176 ? 0.2250 0.2650 0.2303 0.0010  -0.0015 0.0185  176 VAL A CA    
1357 C C     . VAL A 176 ? 0.2226 0.2641 0.2310 0.0036  -0.0016 0.0206  176 VAL A C     
1358 O O     . VAL A 176 ? 0.2243 0.2675 0.2358 0.0031  -0.0021 0.0224  176 VAL A O     
1359 C CB    . VAL A 176 ? 0.2224 0.2632 0.2279 -0.0008 -0.0016 0.0155  176 VAL A CB    
1360 C CG1   . VAL A 176 ? 0.2197 0.2605 0.2260 -0.0010 -0.0036 0.0181  176 VAL A CG1   
1361 C CG2   . VAL A 176 ? 0.2248 0.2625 0.2249 -0.0058 0.0007  0.0128  176 VAL A CG2   
1362 N N     . SER A 177 ? 0.2215 0.2616 0.2284 0.0057  -0.0009 0.0193  177 SER A N     
1363 C CA    . SER A 177 ? 0.2182 0.2556 0.2228 0.0064  0.0007  0.0211  177 SER A CA    
1364 C C     . SER A 177 ? 0.2212 0.2621 0.2308 0.0063  0.0034  0.0222  177 SER A C     
1365 O O     . SER A 177 ? 0.2195 0.2610 0.2308 0.0046  0.0068  0.0222  177 SER A O     
1366 C CB    . SER A 177 ? 0.2301 0.2611 0.2273 0.0091  -0.0002 0.0196  177 SER A CB    
1367 O OG    . SER A 177 ? 0.2233 0.2514 0.2182 0.0110  -0.0046 0.0168  177 SER A OG    
1368 N N     . GLY A 178 ? 0.2262 0.2686 0.2381 0.0077  0.0023  0.0219  178 GLY A N     
1369 C CA    . GLY A 178 ? 0.2439 0.2891 0.2619 0.0094  0.0028  0.0217  178 GLY A CA    
1370 C C     . GLY A 178 ? 0.2532 0.3004 0.2764 0.0103  -0.0017 0.0220  178 GLY A C     
1371 O O     . GLY A 178 ? 0.2834 0.3364 0.3167 0.0119  -0.0025 0.0199  178 GLY A O     
1372 N N     . ASP A 179 ? 0.2599 0.3013 0.2756 0.0091  -0.0050 0.0233  179 ASP A N     
1373 C CA    . ASP A 179 ? 0.2837 0.3211 0.2978 0.0103  -0.0113 0.0239  179 ASP A CA    
1374 C C     . ASP A 179 ? 0.2737 0.3106 0.2849 0.0072  -0.0136 0.0245  179 ASP A C     
1375 O O     . ASP A 179 ? 0.2632 0.2933 0.2685 0.0078  -0.0200 0.0251  179 ASP A O     
1376 C CB    . ASP A 179 ? 0.2993 0.3236 0.3002 0.0102  -0.0132 0.0251  179 ASP A CB    
1377 C CG    . ASP A 179 ? 0.3059 0.3284 0.3099 0.0151  -0.0143 0.0243  179 ASP A CG    
1378 O OD1   . ASP A 179 ? 0.2823 0.3154 0.3006 0.0184  -0.0135 0.0220  179 ASP A OD1   
1379 O OD2   . ASP A 179 ? 0.3166 0.3257 0.3077 0.0144  -0.0152 0.0253  179 ASP A OD2   
1380 N N     . GLY A 180 ? 0.2723 0.3137 0.2854 0.0044  -0.0095 0.0241  180 GLY A N     
1381 C CA    . GLY A 180 ? 0.2816 0.3225 0.2923 0.0013  -0.0110 0.0240  180 GLY A CA    
1382 C C     . GLY A 180 ? 0.2828 0.3313 0.3041 0.0011  -0.0119 0.0230  180 GLY A C     
1383 O O     . GLY A 180 ? 0.2873 0.3416 0.3171 0.0019  -0.0088 0.0217  180 GLY A O     
1384 N N     . SER A 181 ? 0.2826 0.3307 0.3031 -0.0010 -0.0151 0.0225  181 SER A N     
1385 C CA    . SER A 181 ? 0.2687 0.3241 0.2996 -0.0028 -0.0150 0.0203  181 SER A CA    
1386 C C     . SER A 181 ? 0.2525 0.3042 0.2773 -0.0066 -0.0145 0.0206  181 SER A C     
1387 O O     . SER A 181 ? 0.2377 0.2836 0.2539 -0.0072 -0.0176 0.0212  181 SER A O     
1388 C CB    . SER A 181 ? 0.2870 0.3473 0.3269 -0.0005 -0.0226 0.0176  181 SER A CB    
1389 O OG    . SER A 181 ? 0.3167 0.3796 0.3630 0.0042  -0.0248 0.0162  181 SER A OG    
1390 N N     . PHE A 182 ? 0.2429 0.2958 0.2705 -0.0096 -0.0101 0.0197  182 PHE A N     
1391 C CA    . PHE A 182 ? 0.2634 0.3119 0.2860 -0.0129 -0.0101 0.0194  182 PHE A CA    
1392 C C     . PHE A 182 ? 0.2509 0.3058 0.2834 -0.0165 -0.0113 0.0164  182 PHE A C     
1393 O O     . PHE A 182 ? 0.2536 0.3111 0.2917 -0.0198 -0.0061 0.0145  182 PHE A O     
1394 C CB    . PHE A 182 ? 0.2686 0.3093 0.2837 -0.0134 -0.0057 0.0202  182 PHE A CB    
1395 C CG    . PHE A 182 ? 0.2587 0.2958 0.2680 -0.0094 -0.0061 0.0207  182 PHE A CG    
1396 C CD1   . PHE A 182 ? 0.2622 0.2966 0.2675 -0.0088 -0.0079 0.0188  182 PHE A CD1   
1397 C CD2   . PHE A 182 ? 0.2682 0.3051 0.2769 -0.0068 -0.0043 0.0216  182 PHE A CD2   
1398 C CE1   . PHE A 182 ? 0.2574 0.2915 0.2614 -0.0057 -0.0076 0.0166  182 PHE A CE1   
1399 C CE2   . PHE A 182 ? 0.2518 0.2868 0.2572 -0.0033 -0.0051 0.0205  182 PHE A CE2   
1400 C CZ    . PHE A 182 ? 0.2381 0.2727 0.2426 -0.0029 -0.0067 0.0174  182 PHE A CZ    
1401 N N     . LYS A 183 ? 0.2550 0.3118 0.2890 -0.0162 -0.0181 0.0150  183 LYS A N     
1402 C CA    . LYS A 183 ? 0.2622 0.3283 0.3100 -0.0183 -0.0215 0.0102  183 LYS A CA    
1403 C C     . LYS A 183 ? 0.2653 0.3275 0.3089 -0.0235 -0.0211 0.0091  183 LYS A C     
1404 O O     . LYS A 183 ? 0.2503 0.3033 0.2807 -0.0236 -0.0227 0.0114  183 LYS A O     
1405 C CB    . LYS A 183 ? 0.2737 0.3426 0.3252 -0.0134 -0.0325 0.0084  183 LYS A CB    
1406 C CG    . LYS A 183 ? 0.2777 0.3471 0.3307 -0.0076 -0.0341 0.0096  183 LYS A CG    
1407 C CD    . LYS A 183 ? 0.3051 0.3747 0.3618 -0.0014 -0.0469 0.0068  183 LYS A CD    
1408 C CE    . LYS A 183 ? 0.3150 0.3687 0.3511 -0.0006 -0.0562 0.0097  183 LYS A CE    
1409 N NZ    . LYS A 183 ? 0.3419 0.3933 0.3811 0.0071  -0.0703 0.0065  183 LYS A NZ    
1410 N N     . SER A 184 ? 0.2738 0.3430 0.3293 -0.0288 -0.0173 0.0045  184 SER A N     
1411 C CA    . SER A 184 ? 0.2846 0.3522 0.3400 -0.0345 -0.0178 0.0016  184 SER A CA    
1412 C C     . SER A 184 ? 0.2859 0.3679 0.3602 -0.0351 -0.0244 -0.0057 184 SER A C     
1413 O O     . SER A 184 ? 0.2958 0.3903 0.3880 -0.0372 -0.0204 -0.0116 184 SER A O     
1414 C CB    . SER A 184 ? 0.2860 0.3476 0.3384 -0.0421 -0.0071 0.0009  184 SER A CB    
1415 O OG    . SER A 184 ? 0.3011 0.3623 0.3560 -0.0489 -0.0071 -0.0033 184 SER A OG    
1416 N N     . ILE A 185 ? 0.2863 0.3664 0.3572 -0.0338 -0.0341 -0.0069 185 ILE A N     
1417 C CA    . ILE A 185 ? 0.2814 0.3742 0.3700 -0.0331 -0.0440 -0.0153 185 ILE A CA    
1418 C C     . ILE A 185 ? 0.2776 0.3700 0.3672 -0.0403 -0.0442 -0.0195 185 ILE A C     
1419 O O     . ILE A 185 ? 0.2790 0.3574 0.3497 -0.0426 -0.0426 -0.0146 185 ILE A O     
1420 C CB    . ILE A 185 ? 0.3033 0.3894 0.3819 -0.0245 -0.0588 -0.0132 185 ILE A CB    
1421 C CG1   . ILE A 185 ? 0.3045 0.3854 0.3756 -0.0180 -0.0581 -0.0076 185 ILE A CG1   
1422 C CG2   . ILE A 185 ? 0.3064 0.4052 0.4047 -0.0207 -0.0724 -0.0229 185 ILE A CG2   
1423 C CD1   . ILE A 185 ? 0.2929 0.3900 0.3879 -0.0146 -0.0577 -0.0135 185 ILE A CD1   
1424 N N     . LEU A 186 ? 0.2784 0.3874 0.3921 -0.0445 -0.0449 -0.0299 186 LEU A N     
1425 C CA    . LEU A 186 ? 0.2899 0.4029 0.4109 -0.0517 -0.0465 -0.0369 186 LEU A CA    
1426 C C     . LEU A 186 ? 0.2863 0.4144 0.4276 -0.0457 -0.0631 -0.0468 186 LEU A C     
1427 O O     . LEU A 186 ? 0.2773 0.4247 0.4458 -0.0444 -0.0645 -0.0567 186 LEU A O     
1428 C CB    . LEU A 186 ? 0.2914 0.4107 0.4247 -0.0638 -0.0313 -0.0430 186 LEU A CB    
1429 C CG    . LEU A 186 ? 0.3020 0.4009 0.4110 -0.0690 -0.0177 -0.0335 186 LEU A CG    
1430 C CD1   . LEU A 186 ? 0.3178 0.4181 0.4343 -0.0823 -0.0037 -0.0402 186 LEU A CD1   
1431 C CD2   . LEU A 186 ? 0.2985 0.3786 0.3835 -0.0682 -0.0206 -0.0265 186 LEU A CD2   
1432 N N     . LYS A 187 ? 0.3069 0.4245 0.4333 -0.0424 -0.0757 -0.0450 187 LYS A N     
1433 C CA    . LYS A 187 ? 0.3181 0.4392 0.4502 -0.0337 -0.0957 -0.0507 187 LYS A CA    
1434 C C     . LYS A 187 ? 0.3169 0.4430 0.4569 -0.0387 -0.1034 -0.0597 187 LYS A C     
1435 O O     . LYS A 187 ? 0.3097 0.4220 0.4302 -0.0449 -0.0991 -0.0551 187 LYS A O     
1436 C CB    . LYS A 187 ? 0.3512 0.4475 0.4482 -0.0274 -0.1016 -0.0387 187 LYS A CB    
1437 C CG    . LYS A 187 ? 0.4090 0.4950 0.4945 -0.0188 -0.1227 -0.0405 187 LYS A CG    
1438 C CD    . LYS A 187 ? 0.4498 0.5085 0.4969 -0.0166 -0.1220 -0.0282 187 LYS A CD    
1439 C CE    . LYS A 187 ? 0.4727 0.5130 0.4994 -0.0078 -0.1429 -0.0282 187 LYS A CE    
1440 N NZ    . LYS A 187 ? 0.5084 0.5482 0.5365 -0.0077 -0.1584 -0.0362 187 LYS A NZ    
1441 N N     . LYS A 188 ? 0.3256 0.4714 0.4949 -0.0355 -0.1156 -0.0736 188 LYS A N     
1442 C CA    . LYS A 188 ? 0.3614 0.5132 0.5400 -0.0398 -0.1249 -0.0838 188 LYS A CA    
1443 C C     . LYS A 188 ? 0.3808 0.5068 0.5239 -0.0354 -0.1395 -0.0764 188 LYS A C     
1444 O O     . LYS A 188 ? 0.3891 0.5004 0.5134 -0.0249 -0.1533 -0.0711 188 LYS A O     
1445 C CB    . LYS A 188 ? 0.3787 0.5579 0.5979 -0.0351 -0.1383 -0.1022 188 LYS A CB    
1446 C CG    . LYS A 188 ? 0.4212 0.6153 0.6618 -0.0431 -0.1419 -0.1164 188 LYS A CG    
1447 C CD    . LYS A 188 ? 0.4287 0.6433 0.6971 -0.0587 -0.1188 -0.1254 188 LYS A CD    
1448 C CE    . LYS A 188 ? 0.4398 0.6629 0.7212 -0.0699 -0.1190 -0.1371 188 LYS A CE    
1449 N NZ    . LYS A 188 ? 0.4516 0.6477 0.6956 -0.0780 -0.1109 -0.1241 188 LYS A NZ    
1450 N N     . SER A 189 ? 0.3769 0.4955 0.5090 -0.0445 -0.1350 -0.0762 189 SER A N     
1451 C CA    . SER A 189 ? 0.4014 0.4954 0.4991 -0.0436 -0.1440 -0.0699 189 SER A CA    
1452 C C     . SER A 189 ? 0.4239 0.5241 0.5314 -0.0489 -0.1529 -0.0810 189 SER A C     
1453 O O     . SER A 189 ? 0.4229 0.5360 0.5487 -0.0594 -0.1403 -0.0868 189 SER A O     
1454 C CB    . SER A 189 ? 0.3932 0.4688 0.4635 -0.0503 -0.1262 -0.0577 189 SER A CB    
1455 O OG    . SER A 189 ? 0.4119 0.4648 0.4502 -0.0508 -0.1331 -0.0537 189 SER A OG    
1456 N N     . GLU A 190 ? 0.4574 0.5456 0.5497 -0.0420 -0.1746 -0.0838 190 GLU A N     
1457 C CA    . GLU A 190 ? 0.4803 0.5724 0.5794 -0.0456 -0.1872 -0.0952 190 GLU A CA    
1458 C C     . GLU A 190 ? 0.4703 0.5413 0.5386 -0.0551 -0.1771 -0.0880 190 GLU A C     
1459 O O     . GLU A 190 ? 0.4845 0.5599 0.5597 -0.0621 -0.1791 -0.0961 190 GLU A O     
1460 C CB    . GLU A 190 ? 0.5371 0.6197 0.6270 -0.0329 -0.2173 -0.1009 190 GLU A CB    
1461 C CG    . GLU A 190 ? 0.5699 0.6829 0.7055 -0.0274 -0.2347 -0.1205 190 GLU A CG    
1462 C CD    . GLU A 190 ? 0.6360 0.7351 0.7587 -0.0133 -0.2685 -0.1268 190 GLU A CD    
1463 O OE1   . GLU A 190 ? 0.6876 0.7694 0.7874 -0.0145 -0.2825 -0.1290 190 GLU A OE1   
1464 O OE2   . GLU A 190 ? 0.6643 0.7691 0.8001 -0.0003 -0.2825 -0.1307 190 GLU A OE2   
1465 N N     . SER A 191 ? 0.4632 0.5122 0.4990 -0.0553 -0.1661 -0.0741 191 SER A N     
1466 C CA    . SER A 191 ? 0.4729 0.5015 0.4797 -0.0627 -0.1580 -0.0688 191 SER A CA    
1467 C C     . SER A 191 ? 0.4464 0.4769 0.4563 -0.0711 -0.1339 -0.0635 191 SER A C     
1468 O O     . SER A 191 ? 0.4660 0.4850 0.4612 -0.0779 -0.1271 -0.0628 191 SER A O     
1469 C CB    . SER A 191 ? 0.4956 0.4952 0.4608 -0.0576 -0.1642 -0.0597 191 SER A CB    
1470 O OG    . SER A 191 ? 0.4870 0.4842 0.4471 -0.0560 -0.1499 -0.0502 191 SER A OG    
1471 N N     . ILE A 192 ? 0.4167 0.4586 0.4425 -0.0702 -0.1219 -0.0597 192 ILE A N     
1472 C CA    . ILE A 192 ? 0.4032 0.4421 0.4276 -0.0771 -0.1016 -0.0548 192 ILE A CA    
1473 C C     . ILE A 192 ? 0.3899 0.4407 0.4357 -0.0869 -0.0955 -0.0635 192 ILE A C     
1474 O O     . ILE A 192 ? 0.3851 0.4560 0.4589 -0.0886 -0.0999 -0.0730 192 ILE A O     
1475 C CB    . ILE A 192 ? 0.3991 0.4418 0.4280 -0.0733 -0.0907 -0.0474 192 ILE A CB    
1476 C CG1   . ILE A 192 ? 0.4107 0.4371 0.4132 -0.0664 -0.0928 -0.0386 192 ILE A CG1   
1477 C CG2   . ILE A 192 ? 0.3998 0.4397 0.4304 -0.0801 -0.0726 -0.0445 192 ILE A CG2   
1478 C CD1   . ILE A 192 ? 0.4009 0.4321 0.4087 -0.0613 -0.0861 -0.0325 192 ILE A CD1   
1479 N N     . LYS A 193 ? 0.3981 0.4361 0.4311 -0.0939 -0.0850 -0.0615 193 LYS A N     
1480 C CA    . LYS A 193 ? 0.4169 0.4603 0.4639 -0.1048 -0.0799 -0.0701 193 LYS A CA    
1481 C C     . LYS A 193 ? 0.3830 0.4424 0.4555 -0.1103 -0.0689 -0.0739 193 LYS A C     
1482 O O     . LYS A 193 ? 0.3679 0.4429 0.4631 -0.1169 -0.0707 -0.0850 193 LYS A O     
1483 C CB    . LYS A 193 ? 0.4550 0.4764 0.4781 -0.1096 -0.0721 -0.0664 193 LYS A CB    
1484 C CG    . LYS A 193 ? 0.4965 0.5136 0.5238 -0.1215 -0.0643 -0.0727 193 LYS A CG    
1485 C CD    . LYS A 193 ? 0.5381 0.5315 0.5376 -0.1214 -0.0620 -0.0688 193 LYS A CD    
1486 C CE    . LYS A 193 ? 0.5771 0.5533 0.5676 -0.1282 -0.0483 -0.0672 193 LYS A CE    
1487 N NZ    . LYS A 193 ? 0.6104 0.5723 0.5883 -0.1344 -0.0497 -0.0725 193 LYS A NZ    
1488 N N     . VAL A 194 ? 0.3700 0.4270 0.4398 -0.1073 -0.0587 -0.0660 194 VAL A N     
1489 C CA    . VAL A 194 ? 0.3514 0.4233 0.4439 -0.1129 -0.0483 -0.0705 194 VAL A CA    
1490 C C     . VAL A 194 ? 0.3468 0.4440 0.4670 -0.1069 -0.0571 -0.0774 194 VAL A C     
1491 O O     . VAL A 194 ? 0.3562 0.4670 0.4963 -0.1113 -0.0477 -0.0822 194 VAL A O     
1492 C CB    . VAL A 194 ? 0.3533 0.4107 0.4309 -0.1128 -0.0336 -0.0602 194 VAL A CB    
1493 C CG1   . VAL A 194 ? 0.3731 0.4065 0.4294 -0.1204 -0.0238 -0.0569 194 VAL A CG1   
1494 C CG2   . VAL A 194 ? 0.3310 0.3826 0.3945 -0.1001 -0.0379 -0.0496 194 VAL A CG2   
1495 N N     . GLY A 195 ? 0.3345 0.4357 0.4541 -0.0965 -0.0749 -0.0781 195 GLY A N     
1496 C CA    . GLY A 195 ? 0.3133 0.4373 0.4604 -0.0899 -0.0863 -0.0869 195 GLY A CA    
1497 C C     . GLY A 195 ? 0.2901 0.4128 0.4321 -0.0793 -0.0868 -0.0782 195 GLY A C     
1498 O O     . GLY A 195 ? 0.2906 0.4267 0.4491 -0.0706 -0.0995 -0.0838 195 GLY A O     
1499 N N     . PHE A 196 ? 0.2722 0.3783 0.3918 -0.0794 -0.0743 -0.0656 196 PHE A N     
1500 C CA    . PHE A 196 ? 0.2534 0.3580 0.3683 -0.0713 -0.0718 -0.0576 196 PHE A CA    
1501 C C     . PHE A 196 ? 0.2527 0.3346 0.3352 -0.0671 -0.0696 -0.0446 196 PHE A C     
1502 O O     . PHE A 196 ? 0.2560 0.3241 0.3226 -0.0724 -0.0615 -0.0407 196 PHE A O     
1503 C CB    . PHE A 196 ? 0.2440 0.3563 0.3721 -0.0776 -0.0548 -0.0584 196 PHE A CB    
1504 C CG    . PHE A 196 ? 0.2398 0.3779 0.4036 -0.0815 -0.0545 -0.0727 196 PHE A CG    
1505 C CD1   . PHE A 196 ? 0.2461 0.3933 0.4262 -0.0940 -0.0481 -0.0840 196 PHE A CD1   
1506 C CD2   . PHE A 196 ? 0.2328 0.3866 0.4154 -0.0725 -0.0618 -0.0768 196 PHE A CD2   
1507 C CE1   . PHE A 196 ? 0.2481 0.4232 0.4665 -0.0987 -0.0469 -0.1007 196 PHE A CE1   
1508 C CE2   . PHE A 196 ? 0.2283 0.4095 0.4491 -0.0752 -0.0626 -0.0933 196 PHE A CE2   
1509 C CZ    . PHE A 196 ? 0.2357 0.4286 0.4755 -0.0889 -0.0542 -0.1057 196 PHE A CZ    
1510 N N     . GLN A 197 ? 0.2547 0.3329 0.3285 -0.0575 -0.0771 -0.0394 197 GLN A N     
1511 C CA    . GLN A 197 ? 0.2628 0.3235 0.3109 -0.0539 -0.0722 -0.0286 197 GLN A CA    
1512 C C     . GLN A 197 ? 0.2558 0.3200 0.3090 -0.0525 -0.0605 -0.0236 197 GLN A C     
1513 O O     . GLN A 197 ? 0.2600 0.3369 0.3297 -0.0489 -0.0622 -0.0260 197 GLN A O     
1514 C CB    . GLN A 197 ? 0.2705 0.3208 0.3014 -0.0462 -0.0853 -0.0255 197 GLN A CB    
1515 C CG    . GLN A 197 ? 0.2773 0.3084 0.2799 -0.0456 -0.0790 -0.0170 197 GLN A CG    
1516 C CD    . GLN A 197 ? 0.2921 0.3096 0.2743 -0.0397 -0.0884 -0.0133 197 GLN A CD    
1517 O OE1   . GLN A 197 ? 0.3025 0.3205 0.2869 -0.0347 -0.1030 -0.0164 197 GLN A OE1   
1518 N NE2   . GLN A 197 ? 0.2971 0.3009 0.2587 -0.0405 -0.0802 -0.0075 197 GLN A NE2   
1519 N N     . SER A 198 ? 0.2615 0.3135 0.2998 -0.0545 -0.0499 -0.0174 198 SER A N     
1520 C CA    . SER A 198 ? 0.2635 0.3138 0.3001 -0.0523 -0.0406 -0.0121 198 SER A CA    
1521 C C     . SER A 198 ? 0.2775 0.3191 0.2981 -0.0456 -0.0432 -0.0061 198 SER A C     
1522 O O     . SER A 198 ? 0.2703 0.3000 0.2744 -0.0461 -0.0425 -0.0043 198 SER A O     
1523 C CB    . SER A 198 ? 0.2593 0.2991 0.2881 -0.0574 -0.0299 -0.0103 198 SER A CB    
1524 O OG    . SER A 198 ? 0.2624 0.2981 0.2870 -0.0541 -0.0233 -0.0053 198 SER A OG    
1525 N N     . ILE A 199 ? 0.2841 0.3316 0.3103 -0.0404 -0.0450 -0.0042 199 ILE A N     
1526 C CA    . ILE A 199 ? 0.3220 0.3606 0.3331 -0.0354 -0.0465 0.0006  199 ILE A CA    
1527 C C     . ILE A 199 ? 0.3033 0.3444 0.3178 -0.0330 -0.0383 0.0042  199 ILE A C     
1528 O O     . ILE A 199 ? 0.3026 0.3538 0.3319 -0.0324 -0.0361 0.0030  199 ILE A O     
1529 C CB    . ILE A 199 ? 0.3708 0.4093 0.3804 -0.0304 -0.0587 0.0000  199 ILE A CB    
1530 C CG1   . ILE A 199 ? 0.3917 0.4302 0.4021 -0.0317 -0.0696 -0.0051 199 ILE A CG1   
1531 C CG2   . ILE A 199 ? 0.4258 0.4489 0.4125 -0.0283 -0.0591 0.0047  199 ILE A CG2   
1532 C CD1   . ILE A 199 ? 0.4294 0.4592 0.4290 -0.0260 -0.0850 -0.0058 199 ILE A CD1   
1533 N N     . LEU A 200 ? 0.2975 0.3299 0.2994 -0.0319 -0.0333 0.0073  200 LEU A N     
1534 C CA    . LEU A 200 ? 0.2847 0.3187 0.2885 -0.0285 -0.0279 0.0103  200 LEU A CA    
1535 C C     . LEU A 200 ? 0.3003 0.3303 0.2953 -0.0254 -0.0312 0.0123  200 LEU A C     
1536 O O     . LEU A 200 ? 0.3002 0.3208 0.2807 -0.0271 -0.0328 0.0119  200 LEU A O     
1537 C CB    . LEU A 200 ? 0.2747 0.3027 0.2729 -0.0285 -0.0214 0.0105  200 LEU A CB    
1538 C CG    . LEU A 200 ? 0.2851 0.3099 0.2854 -0.0313 -0.0182 0.0094  200 LEU A CG    
1539 C CD1   . LEU A 200 ? 0.2873 0.3034 0.2806 -0.0286 -0.0151 0.0088  200 LEU A CD1   
1540 C CD2   . LEU A 200 ? 0.2878 0.3167 0.2964 -0.0329 -0.0150 0.0102  200 LEU A CD2   
1541 N N     . VAL A 201 ? 0.2927 0.3277 0.2944 -0.0216 -0.0320 0.0139  201 VAL A N     
1542 C CA    . VAL A 201 ? 0.2823 0.3107 0.2739 -0.0190 -0.0350 0.0159  201 VAL A CA    
1543 C C     . VAL A 201 ? 0.2728 0.3045 0.2684 -0.0168 -0.0283 0.0177  201 VAL A C     
1544 O O     . VAL A 201 ? 0.2502 0.2907 0.2589 -0.0150 -0.0260 0.0177  201 VAL A O     
1545 C CB    . VAL A 201 ? 0.3073 0.3370 0.3030 -0.0150 -0.0454 0.0152  201 VAL A CB    
1546 C CG1   . VAL A 201 ? 0.3264 0.3424 0.3053 -0.0124 -0.0496 0.0180  201 VAL A CG1   
1547 C CG2   . VAL A 201 ? 0.3368 0.3648 0.3312 -0.0163 -0.0546 0.0121  201 VAL A CG2   
1548 N N     . PHE A 202 ? 0.2619 0.2858 0.2454 -0.0177 -0.0246 0.0183  202 PHE A N     
1549 C CA    . PHE A 202 ? 0.2469 0.2732 0.2334 -0.0154 -0.0199 0.0193  202 PHE A CA    
1550 C C     . PHE A 202 ? 0.2567 0.2753 0.2341 -0.0140 -0.0239 0.0212  202 PHE A C     
1551 O O     . PHE A 202 ? 0.2587 0.2642 0.2191 -0.0169 -0.0267 0.0214  202 PHE A O     
1552 C CB    . PHE A 202 ? 0.2389 0.2633 0.2211 -0.0177 -0.0132 0.0163  202 PHE A CB    
1553 C CG    . PHE A 202 ? 0.2301 0.2571 0.2154 -0.0156 -0.0094 0.0161  202 PHE A CG    
1554 C CD1   . PHE A 202 ? 0.2395 0.2730 0.2350 -0.0114 -0.0091 0.0174  202 PHE A CD1   
1555 C CD2   . PHE A 202 ? 0.2332 0.2549 0.2101 -0.0187 -0.0053 0.0137  202 PHE A CD2   
1556 C CE1   . PHE A 202 ? 0.2260 0.2613 0.2236 -0.0094 -0.0064 0.0166  202 PHE A CE1   
1557 C CE2   . PHE A 202 ? 0.2268 0.2518 0.2079 -0.0173 -0.0018 0.0123  202 PHE A CE2   
1558 C CZ    . PHE A 202 ? 0.2177 0.2497 0.2094 -0.0120 -0.0032 0.0140  202 PHE A CZ    
1559 N N     . GLN A 203 ? 0.2419 0.2657 0.2278 -0.0098 -0.0241 0.0226  203 GLN A N     
1560 C CA    . GLN A 203 ? 0.2697 0.2853 0.2482 -0.0070 -0.0292 0.0243  203 GLN A CA    
1561 C C     . GLN A 203 ? 0.2637 0.2809 0.2449 -0.0051 -0.0244 0.0250  203 GLN A C     
1562 O O     . GLN A 203 ? 0.2596 0.2875 0.2531 -0.0039 -0.0195 0.0243  203 GLN A O     
1563 C CB    . GLN A 203 ? 0.2784 0.2994 0.2679 -0.0019 -0.0387 0.0233  203 GLN A CB    
1564 C CG    . GLN A 203 ? 0.3110 0.3203 0.2915 0.0029  -0.0477 0.0242  203 GLN A CG    
1565 C CD    . GLN A 203 ? 0.3529 0.3693 0.3480 0.0095  -0.0594 0.0205  203 GLN A CD    
1566 O OE1   . GLN A 203 ? 0.3637 0.3871 0.3670 0.0087  -0.0636 0.0175  203 GLN A OE1   
1567 N NE2   . GLN A 203 ? 0.3996 0.4143 0.3990 0.0163  -0.0652 0.0195  203 GLN A NE2   
1568 N N     . ILE A 204 ? 0.2778 0.2813 0.2440 -0.0055 -0.0256 0.0263  204 ILE A N     
1569 C CA    . ILE A 204 ? 0.2803 0.2830 0.2476 -0.0035 -0.0225 0.0269  204 ILE A CA    
1570 C C     . ILE A 204 ? 0.2988 0.2875 0.2555 0.0006  -0.0316 0.0287  204 ILE A C     
1571 O O     . ILE A 204 ? 0.3431 0.3133 0.2788 -0.0020 -0.0358 0.0301  204 ILE A O     
1572 C CB    . ILE A 204 ? 0.2726 0.2695 0.2297 -0.0099 -0.0137 0.0250  204 ILE A CB    
1573 C CG1   . ILE A 204 ? 0.2590 0.2701 0.2290 -0.0115 -0.0074 0.0215  204 ILE A CG1   
1574 C CG2   . ILE A 204 ? 0.2825 0.2764 0.2385 -0.0087 -0.0111 0.0252  204 ILE A CG2   
1575 C CD1   . ILE A 204 ? 0.2538 0.2633 0.2194 -0.0175 0.0006  0.0164  204 ILE A CD1   
1576 N N     . THR A 205 ? 0.3239 0.3190 0.2930 0.0070  -0.0346 0.0284  205 THR A N     
1577 C CA    . THR A 205 ? 0.3353 0.3184 0.2986 0.0138  -0.0454 0.0287  205 THR A CA    
1578 C C     . THR A 205 ? 0.3659 0.3390 0.3205 0.0141  -0.0416 0.0299  205 THR A C     
1579 O O     . THR A 205 ? 0.3595 0.3455 0.3268 0.0135  -0.0333 0.0287  205 THR A O     
1580 C CB    . THR A 205 ? 0.3190 0.3197 0.3079 0.0216  -0.0514 0.0246  205 THR A CB    
1581 O OG1   . THR A 205 ? 0.3031 0.3151 0.3031 0.0205  -0.0543 0.0222  205 THR A OG1   
1582 C CG2   . THR A 205 ? 0.3357 0.3243 0.3212 0.0307  -0.0645 0.0230  205 THR A CG2   
1583 N N     . GLN A 206 ? 0.3955 0.3430 0.3260 0.0148  -0.0482 0.0320  206 GLN A N     
1584 C CA    . GLN A 206 ? 0.4248 0.3577 0.3435 0.0153  -0.0465 0.0330  206 GLN A CA    
1585 C C     . GLN A 206 ? 0.4653 0.3691 0.3611 0.0213  -0.0606 0.0348  206 GLN A C     
1586 O O     . GLN A 206 ? 0.5117 0.3989 0.3898 0.0216  -0.0700 0.0362  206 GLN A O     
1587 C CB    . GLN A 206 ? 0.4433 0.3641 0.3423 0.0035  -0.0344 0.0339  206 GLN A CB    
1588 C CG    . GLN A 206 ? 0.4370 0.3752 0.3513 -0.0002 -0.0221 0.0313  206 GLN A CG    
1589 C CD    . GLN A 206 ? 0.3961 0.3493 0.3309 0.0072  -0.0224 0.0300  206 GLN A CD    
1590 O OE1   . GLN A 206 ? 0.3927 0.3672 0.3498 0.0114  -0.0220 0.0285  206 GLN A OE1   
1591 N NE2   . GLN A 206 ? 0.4131 0.3543 0.3387 0.0069  -0.0209 0.0300  206 GLN A NE2   
1592 N N     . HIS A 207 ? 0.4548 0.3480 0.3458 0.0250  -0.0616 0.0349  207 HIS A N     
1593 C CA    . HIS A 207 ? 0.4730 0.3321 0.3364 0.0300  -0.0741 0.0368  207 HIS A CA    
1594 C C     . HIS A 207 ? 0.5098 0.3363 0.3324 0.0174  -0.0684 0.0410  207 HIS A C     
1595 O O     . HIS A 207 ? 0.4862 0.3181 0.3058 0.0048  -0.0521 0.0407  207 HIS A O     
1596 C CB    . HIS A 207 ? 0.4695 0.3277 0.3407 0.0367  -0.0748 0.0351  207 HIS A CB    
1597 C CG    . HIS A 207 ? 0.5111 0.3338 0.3566 0.0450  -0.0904 0.0362  207 HIS A CG    
1598 N ND1   . HIS A 207 ? 0.5205 0.3472 0.3833 0.0609  -0.1065 0.0315  207 HIS A ND1   
1599 C CD2   . HIS A 207 ? 0.5428 0.3226 0.3446 0.0396  -0.0930 0.0408  207 HIS A CD2   
1600 C CE1   . HIS A 207 ? 0.5552 0.3420 0.3856 0.0666  -0.1205 0.0336  207 HIS A CE1   
1601 N NE2   . HIS A 207 ? 0.5731 0.3289 0.3636 0.0532  -0.1120 0.0400  207 HIS A NE2   
1602 N N     . ALA A 208 ? 0.5546 0.3457 0.3451 0.0211  -0.0828 0.0437  208 ALA A N     
1603 C CA    . ALA A 208 ? 0.6018 0.3544 0.3467 0.0097  -0.0805 0.0475  208 ALA A CA    
1604 C C     . ALA A 208 ? 0.6262 0.3541 0.3430 -0.0033 -0.0663 0.0488  208 ALA A C     
1605 O O     . ALA A 208 ? 0.6352 0.3409 0.3210 -0.0182 -0.0559 0.0497  208 ALA A O     
1606 C CB    . ALA A 208 ? 0.6586 0.3748 0.3741 0.0200  -0.1034 0.0499  208 ALA A CB    
1607 N N     . ARG A 209 ? 0.6328 0.3607 0.3574 0.0018  -0.0666 0.0481  209 ARG A N     
1608 C CA    . ARG A 209 ? 0.6910 0.4040 0.3984 -0.0105 -0.0516 0.0477  209 ARG A CA    
1609 C C     . ARG A 209 ? 0.6477 0.3879 0.3724 -0.0249 -0.0302 0.0433  209 ARG A C     
1610 O O     . ARG A 209 ? 0.6773 0.3993 0.3800 -0.0394 -0.0167 0.0415  209 ARG A O     
1611 C CB    . ARG A 209 ? 0.7151 0.4327 0.4373 -0.0012 -0.0550 0.0466  209 ARG A CB    
1612 C CG    . ARG A 209 ? 0.7290 0.4956 0.4998 0.0032  -0.0479 0.0424  209 ARG A CG    
1613 C CD    . ARG A 209 ? 0.7969 0.5695 0.5855 0.0175  -0.0574 0.0408  209 ARG A CD    
1614 N NE    . ARG A 209 ? 0.8108 0.6286 0.6433 0.0212  -0.0504 0.0368  209 ARG A NE    
1615 C CZ    . ARG A 209 ? 0.8736 0.7120 0.7348 0.0344  -0.0581 0.0336  209 ARG A CZ    
1616 N NH1   . ARG A 209 ? 0.8791 0.7023 0.7368 0.0475  -0.0748 0.0325  209 ARG A NH1   
1617 N NH2   . ARG A 209 ? 0.8730 0.7471 0.7665 0.0343  -0.0490 0.0303  209 ARG A NH2   
1618 N N     . ASP A 210 ? 0.5923 0.3727 0.3538 -0.0215 -0.0276 0.0407  210 ASP A N     
1619 C CA    . ASP A 210 ? 0.5546 0.3600 0.3329 -0.0331 -0.0104 0.0355  210 ASP A CA    
1620 C C     . ASP A 210 ? 0.5583 0.3567 0.3215 -0.0416 -0.0073 0.0351  210 ASP A C     
1621 O O     . ASP A 210 ? 0.5305 0.3552 0.3149 -0.0458 0.0012  0.0307  210 ASP A O     
1622 C CB    . ASP A 210 ? 0.5135 0.3623 0.3373 -0.0243 -0.0095 0.0327  210 ASP A CB    
1623 C CG    . ASP A 210 ? 0.5084 0.3642 0.3429 -0.0243 -0.0033 0.0301  210 ASP A CG    
1624 O OD1   . ASP A 210 ? 0.5274 0.3699 0.3462 -0.0363 0.0075  0.0268  210 ASP A OD1   
1625 O OD2   . ASP A 210 ? 0.4873 0.3604 0.3443 -0.0138 -0.0084 0.0302  210 ASP A OD2   
1626 N N     . VAL A 211 ? 0.5864 0.3453 0.3093 -0.0439 -0.0150 0.0394  211 VAL A N     
1627 C CA    . VAL A 211 ? 0.5915 0.3369 0.2929 -0.0524 -0.0128 0.0394  211 VAL A CA    
1628 C C     . VAL A 211 ? 0.5997 0.3578 0.3054 -0.0696 0.0089  0.0316  211 VAL A C     
1629 O O     . VAL A 211 ? 0.5876 0.3601 0.3021 -0.0729 0.0126  0.0288  211 VAL A O     
1630 C CB    . VAL A 211 ? 0.6454 0.3352 0.2910 -0.0553 -0.0228 0.0449  211 VAL A CB    
1631 C CG1   . VAL A 211 ? 0.6862 0.3392 0.2943 -0.0694 -0.0111 0.0444  211 VAL A CG1   
1632 C CG2   . VAL A 211 ? 0.6630 0.3363 0.2834 -0.0626 -0.0231 0.0453  211 VAL A CG2   
1633 N N     . LYS A 212 ? 0.6283 0.3798 0.3274 -0.0810 0.0232  0.0269  212 LYS A N     
1634 C CA    . LYS A 212 ? 0.6492 0.4093 0.3504 -0.0989 0.0445  0.0167  212 LYS A CA    
1635 C C     . LYS A 212 ? 0.5833 0.3930 0.3341 -0.0940 0.0488  0.0098  212 LYS A C     
1636 O O     . LYS A 212 ? 0.6017 0.4241 0.3601 -0.1010 0.0572  0.0033  212 LYS A O     
1637 C CB    . LYS A 212 ? 0.7311 0.4767 0.4193 -0.1119 0.0583  0.0114  212 LYS A CB    
1638 C CG    . LYS A 212 ? 0.8581 0.5463 0.4881 -0.1222 0.0587  0.0164  212 LYS A CG    
1639 C CD    . LYS A 212 ? 0.9492 0.6089 0.5413 -0.1415 0.0722  0.0123  212 LYS A CD    
1640 C CE    . LYS A 212 ? 1.0821 0.6762 0.6073 -0.1489 0.0672  0.0203  212 LYS A CE    
1641 N NZ    . LYS A 212 ? 1.1092 0.6829 0.6136 -0.1347 0.0447  0.0308  212 LYS A NZ    
1642 N N     . LEU A 213 ? 0.5480 0.3830 0.3301 -0.0817 0.0423  0.0111  213 LEU A N     
1643 C CA    . LEU A 213 ? 0.5296 0.4057 0.3538 -0.0733 0.0411  0.0074  213 LEU A CA    
1644 C C     . LEU A 213 ? 0.5034 0.3875 0.3331 -0.0671 0.0333  0.0106  213 LEU A C     
1645 O O     . LEU A 213 ? 0.4961 0.3993 0.3422 -0.0704 0.0396  0.0042  213 LEU A O     
1646 C CB    . LEU A 213 ? 0.5257 0.4183 0.3728 -0.0601 0.0327  0.0108  213 LEU A CB    
1647 C CG    . LEU A 213 ? 0.5167 0.4446 0.4006 -0.0491 0.0280  0.0098  213 LEU A CG    
1648 C CD1   . LEU A 213 ? 0.5074 0.4573 0.4111 -0.0552 0.0379  -0.0005 213 LEU A CD1   
1649 C CD2   . LEU A 213 ? 0.5187 0.4552 0.4165 -0.0402 0.0233  0.0120  213 LEU A CD2   
1650 N N     . MET A 214 ? 0.5063 0.3758 0.3231 -0.0581 0.0192  0.0194  214 MET A N     
1651 C CA    . MET A 214 ? 0.4933 0.3693 0.3146 -0.0529 0.0112  0.0220  214 MET A CA    
1652 C C     . MET A 214 ? 0.5046 0.3674 0.3053 -0.0655 0.0199  0.0179  214 MET A C     
1653 O O     . MET A 214 ? 0.4510 0.3320 0.2675 -0.0653 0.0217  0.0146  214 MET A O     
1654 C CB    . MET A 214 ? 0.5173 0.3768 0.3262 -0.0421 -0.0061 0.0299  214 MET A CB    
1655 C CG    . MET A 214 ? 0.5080 0.3853 0.3426 -0.0293 -0.0137 0.0319  214 MET A CG    
1656 S SD    . MET A 214 ? 0.4600 0.3804 0.3389 -0.0225 -0.0117 0.0290  214 MET A SD    
1657 C CE    . MET A 214 ? 0.4717 0.3921 0.3530 -0.0139 -0.0266 0.0324  214 MET A CE    
1658 N N     . GLU A 215 ? 0.5452 0.3749 0.3091 -0.0776 0.0266  0.0174  215 GLU A N     
1659 C CA    . GLU A 215 ? 0.5845 0.3995 0.3259 -0.0921 0.0379  0.0122  215 GLU A CA    
1660 C C     . GLU A 215 ? 0.5465 0.3924 0.3174 -0.0997 0.0540  0.0000  215 GLU A C     
1661 O O     . GLU A 215 ? 0.5650 0.4185 0.3395 -0.1036 0.0583  -0.0047 215 GLU A O     
1662 C CB    . GLU A 215 ? 0.6707 0.4402 0.3626 -0.1060 0.0444  0.0132  215 GLU A CB    
1663 C CG    . GLU A 215 ? 0.7542 0.4868 0.4069 -0.1021 0.0289  0.0223  215 GLU A CG    
1664 C CD    . GLU A 215 ? 0.8823 0.5613 0.4786 -0.1133 0.0310  0.0256  215 GLU A CD    
1665 O OE1   . GLU A 215 ? 0.9367 0.6048 0.5232 -0.1239 0.0440  0.0221  215 GLU A OE1   
1666 O OE2   . GLU A 215 ? 1.0158 0.6607 0.5748 -0.1115 0.0182  0.0319  215 GLU A OE2   
1667 N N     . SER A 216 ? 0.5157 0.3799 0.3092 -0.1003 0.0611  -0.0057 216 SER A N     
1668 C CA    . SER A 216 ? 0.4976 0.3920 0.3222 -0.1060 0.0744  -0.0195 216 SER A CA    
1669 C C     . SER A 216 ? 0.4508 0.3777 0.3106 -0.0935 0.0668  -0.0206 216 SER A C     
1670 O O     . SER A 216 ? 0.4395 0.3860 0.3194 -0.0976 0.0753  -0.0321 216 SER A O     
1671 C CB    . SER A 216 ? 0.4910 0.3972 0.3322 -0.1079 0.0808  -0.0257 216 SER A CB    
1672 O OG    . SER A 216 ? 0.4542 0.3869 0.3276 -0.0918 0.0693  -0.0222 216 SER A OG    
1673 N N     . LEU A 217 ? 0.4177 0.3479 0.2832 -0.0792 0.0511  -0.0096 217 LEU A N     
1674 C CA    . LEU A 217 ? 0.3858 0.3403 0.2778 -0.0697 0.0450  -0.0102 217 LEU A CA    
1675 C C     . LEU A 217 ? 0.4009 0.3527 0.2859 -0.0759 0.0493  -0.0146 217 LEU A C     
1676 O O     . LEU A 217 ? 0.3770 0.3508 0.2866 -0.0718 0.0497  -0.0206 217 LEU A O     
1677 C CB    . LEU A 217 ? 0.3667 0.3235 0.2640 -0.0563 0.0298  0.0008  217 LEU A CB    
1678 C CG    . LEU A 217 ? 0.3532 0.3149 0.2601 -0.0489 0.0251  0.0048  217 LEU A CG    
1679 C CD1   . LEU A 217 ? 0.3561 0.3143 0.2624 -0.0382 0.0116  0.0143  217 LEU A CD1   
1680 C CD2   . LEU A 217 ? 0.3188 0.3062 0.2550 -0.0439 0.0270  -0.0006 217 LEU A CD2   
1681 N N     . ILE A 218 ? 0.4292 0.3524 0.2793 -0.0851 0.0516  -0.0118 218 ILE A N     
1682 C CA    . ILE A 218 ? 0.4497 0.3680 0.2901 -0.0909 0.0551  -0.0155 218 ILE A CA    
1683 C C     . ILE A 218 ? 0.4599 0.3945 0.3166 -0.1008 0.0717  -0.0314 218 ILE A C     
1684 O O     . ILE A 218 ? 0.4272 0.3798 0.3037 -0.0977 0.0720  -0.0375 218 ILE A O     
1685 C CB    . ILE A 218 ? 0.4994 0.3792 0.2938 -0.1001 0.0547  -0.0103 218 ILE A CB    
1686 C CG1   . ILE A 218 ? 0.5098 0.3776 0.2938 -0.0878 0.0350  0.0026  218 ILE A CG1   
1687 C CG2   . ILE A 218 ? 0.5059 0.3783 0.2863 -0.1108 0.0637  -0.0175 218 ILE A CG2   
1688 C CD1   . ILE A 218 ? 0.5664 0.3917 0.3030 -0.0942 0.0312  0.0085  218 ILE A CD1   
1689 N N     . SER A 219 ? 0.4902 0.4185 0.3397 -0.1129 0.0854  -0.0394 219 SER A N     
1690 C CA    . SER A 219 ? 0.4919 0.4405 0.3637 -0.1225 0.1021  -0.0582 219 SER A CA    
1691 C C     . SER A 219 ? 0.4467 0.4324 0.3652 -0.1088 0.0957  -0.0641 219 SER A C     
1692 O O     . SER A 219 ? 0.4434 0.4509 0.3877 -0.1071 0.0991  -0.0764 219 SER A O     
1693 C CB    . SER A 219 ? 0.5265 0.4594 0.3794 -0.1411 0.1202  -0.0675 219 SER A CB    
1694 O OG    . SER A 219 ? 0.5631 0.4957 0.4196 -0.1375 0.1166  -0.0631 219 SER A OG    
1695 N N     . TYR A 220 ? 0.3954 0.3861 0.3228 -0.0979 0.0850  -0.0554 220 TYR A N     
1696 C CA    . TYR A 220 ? 0.3485 0.3683 0.3131 -0.0859 0.0785  -0.0608 220 TYR A CA    
1697 C C     . TYR A 220 ? 0.3218 0.3541 0.3018 -0.0751 0.0693  -0.0597 220 TYR A C     
1698 O O     . TYR A 220 ? 0.2832 0.3358 0.2894 -0.0712 0.0699  -0.0717 220 TYR A O     
1699 C CB    . TYR A 220 ? 0.3360 0.3552 0.3024 -0.0765 0.0685  -0.0503 220 TYR A CB    
1700 C CG    . TYR A 220 ? 0.3212 0.3649 0.3194 -0.0680 0.0648  -0.0582 220 TYR A CG    
1701 C CD1   . TYR A 220 ? 0.3226 0.3753 0.3327 -0.0753 0.0741  -0.0712 220 TYR A CD1   
1702 C CD2   . TYR A 220 ? 0.2900 0.3461 0.3050 -0.0531 0.0516  -0.0537 220 TYR A CD2   
1703 C CE1   . TYR A 220 ? 0.3128 0.3869 0.3513 -0.0663 0.0682  -0.0790 220 TYR A CE1   
1704 C CE2   . TYR A 220 ? 0.2792 0.3527 0.3181 -0.0450 0.0465  -0.0609 220 TYR A CE2   
1705 C CZ    . TYR A 220 ? 0.2963 0.3794 0.3476 -0.0506 0.0535  -0.0734 220 TYR A CZ    
1706 O OH    . TYR A 220 ? 0.3128 0.4124 0.3874 -0.0413 0.0459  -0.0811 220 TYR A OH    
1707 N N     . LEU A 221 ? 0.3343 0.3531 0.2972 -0.0706 0.0604  -0.0462 221 LEU A N     
1708 C CA    . LEU A 221 ? 0.3281 0.3558 0.3028 -0.0611 0.0515  -0.0438 221 LEU A CA    
1709 C C     . LEU A 221 ? 0.3495 0.3709 0.3141 -0.0684 0.0573  -0.0489 221 LEU A C     
1710 O O     . LEU A 221 ? 0.3622 0.3901 0.3362 -0.0619 0.0514  -0.0489 221 LEU A O     
1711 C CB    . LEU A 221 ? 0.3143 0.3349 0.2814 -0.0520 0.0387  -0.0282 221 LEU A CB    
1712 C CG    . LEU A 221 ? 0.3081 0.3375 0.2885 -0.0428 0.0320  -0.0237 221 LEU A CG    
1713 C CD1   . LEU A 221 ? 0.3088 0.3286 0.2784 -0.0372 0.0226  -0.0100 221 LEU A CD1   
1714 C CD2   . LEU A 221 ? 0.2903 0.3365 0.2942 -0.0338 0.0273  -0.0292 221 LEU A CD2   
1715 N N     . GLY A 222 ? 0.3684 0.3753 0.3123 -0.0823 0.0693  -0.0537 222 GLY A N     
1716 C CA    . GLY A 222 ? 0.3997 0.4000 0.3328 -0.0913 0.0776  -0.0611 222 GLY A CA    
1717 C C     . GLY A 222 ? 0.4109 0.3952 0.3235 -0.0877 0.0670  -0.0484 222 GLY A C     
1718 O O     . GLY A 222 ? 0.4216 0.4084 0.3364 -0.0882 0.0678  -0.0528 222 GLY A O     
1719 N N     . CYS A 223 ? 0.4107 0.3816 0.3079 -0.0827 0.0561  -0.0341 223 CYS A N     
1720 C CA    . CYS A 223 ? 0.4087 0.3666 0.2901 -0.0779 0.0437  -0.0229 223 CYS A CA    
1721 C C     . CYS A 223 ? 0.4024 0.3475 0.2707 -0.0726 0.0329  -0.0107 223 CYS A C     
1722 O O     . CYS A 223 ? 0.3739 0.3212 0.2468 -0.0715 0.0346  -0.0098 223 CYS A O     
1723 C CB    . CYS A 223 ? 0.3817 0.3583 0.2877 -0.0673 0.0354  -0.0221 223 CYS A CB    
1724 S SG    . CYS A 223 ? 0.3433 0.3429 0.2818 -0.0538 0.0283  -0.0193 223 CYS A SG    
1725 N N     . GLY A 224 ? 0.4116 0.3431 0.2640 -0.0695 0.0215  -0.0029 224 GLY A N     
1726 C CA    . GLY A 224 ? 0.4102 0.3331 0.2561 -0.0615 0.0081  0.0068  224 GLY A CA    
1727 C C     . GLY A 224 ? 0.4648 0.3540 0.2714 -0.0677 0.0055  0.0106  224 GLY A C     
1728 O O     . GLY A 224 ? 0.5023 0.3718 0.2822 -0.0803 0.0160  0.0062  224 GLY A O     
1729 N N     . PHE A 225 ? 0.4769 0.3577 0.2784 -0.0591 -0.0089 0.0181  225 PHE A N     
1730 C CA    . PHE A 225 ? 0.5384 0.3835 0.3010 -0.0619 -0.0155 0.0227  225 PHE A CA    
1731 C C     . PHE A 225 ? 0.5091 0.3568 0.2822 -0.0498 -0.0283 0.0282  225 PHE A C     
1732 O O     . PHE A 225 ? 0.4592 0.3350 0.2669 -0.0405 -0.0322 0.0284  225 PHE A O     
1733 C CB    . PHE A 225 ? 0.5934 0.4174 0.3297 -0.0634 -0.0252 0.0241  225 PHE A CB    
1734 C CG    . PHE A 225 ? 0.6281 0.4737 0.3911 -0.0524 -0.0384 0.0253  225 PHE A CG    
1735 C CD1   . PHE A 225 ? 0.6352 0.5061 0.4237 -0.0535 -0.0318 0.0208  225 PHE A CD1   
1736 C CD2   . PHE A 225 ? 0.6741 0.5157 0.4396 -0.0404 -0.0580 0.0296  225 PHE A CD2   
1737 C CE1   . PHE A 225 ? 0.6380 0.5283 0.4515 -0.0446 -0.0428 0.0214  225 PHE A CE1   
1738 C CE2   . PHE A 225 ? 0.6593 0.5227 0.4523 -0.0316 -0.0690 0.0285  225 PHE A CE2   
1739 C CZ    . PHE A 225 ? 0.6476 0.5350 0.4638 -0.0345 -0.0607 0.0248  225 PHE A CZ    
1740 N N     . ILE A 226 ? 0.5387 0.3552 0.2804 -0.0508 -0.0336 0.0320  226 ILE A N     
1741 C CA    . ILE A 226 ? 0.5580 0.3742 0.3077 -0.0396 -0.0448 0.0360  226 ILE A CA    
1742 C C     . ILE A 226 ? 0.5734 0.3717 0.3084 -0.0302 -0.0662 0.0392  226 ILE A C     
1743 O O     . ILE A 226 ? 0.5971 0.3595 0.2908 -0.0356 -0.0710 0.0411  226 ILE A O     
1744 C CB    . ILE A 226 ? 0.5873 0.3770 0.3101 -0.0459 -0.0384 0.0375  226 ILE A CB    
1745 C CG1   . ILE A 226 ? 0.5946 0.4106 0.3459 -0.0487 -0.0232 0.0338  226 ILE A CG1   
1746 C CG2   . ILE A 226 ? 0.5942 0.3713 0.3134 -0.0332 -0.0553 0.0420  226 ILE A CG2   
1747 C CD1   . ILE A 226 ? 0.5982 0.4360 0.3661 -0.0582 -0.0063 0.0269  226 ILE A CD1   
1748 N N     . GLU A 227 ? 0.5566 0.3774 0.3234 -0.0165 -0.0790 0.0389  227 GLU A N     
1749 C CA    . GLU A 227 ? 0.6030 0.4091 0.3615 -0.0048 -0.1020 0.0398  227 GLU A CA    
1750 C C     . GLU A 227 ? 0.5923 0.3942 0.3556 0.0042  -0.1090 0.0409  227 GLU A C     
1751 O O     . GLU A 227 ? 0.5721 0.3999 0.3653 0.0058  -0.0994 0.0396  227 GLU A O     
1752 C CB    . GLU A 227 ? 0.6086 0.4481 0.4067 0.0042  -0.1115 0.0353  227 GLU A CB    
1753 C CG    . GLU A 227 ? 0.6339 0.4825 0.4340 -0.0028 -0.1065 0.0334  227 GLU A CG    
1754 C CD    . GLU A 227 ? 0.6416 0.5259 0.4835 0.0032  -0.1110 0.0284  227 GLU A CD    
1755 O OE1   . GLU A 227 ? 0.6641 0.5763 0.5423 0.0099  -0.1104 0.0255  227 GLU A OE1   
1756 O OE2   . GLU A 227 ? 0.6456 0.5286 0.4820 -0.0004 -0.1135 0.0267  227 GLU A OE2   
1757 N N     . LYS A 228 ? 0.6434 0.4122 0.3783 0.0116  -0.1281 0.0426  228 LYS A N     
1758 C CA    . LYS A 228 ? 0.6562 0.4166 0.3939 0.0234  -0.1400 0.0427  228 LYS A CA    
1759 C C     . LYS A 228 ? 0.6278 0.4033 0.3920 0.0395  -0.1623 0.0371  228 LYS A C     
1760 O O     . LYS A 228 ? 0.6475 0.4097 0.3973 0.0423  -0.1770 0.0358  228 LYS A O     
1761 C CB    . LYS A 228 ? 0.7443 0.4496 0.4256 0.0209  -0.1475 0.0479  228 LYS A CB    
1762 C CG    . LYS A 228 ? 0.7774 0.4758 0.4639 0.0318  -0.1556 0.0479  228 LYS A CG    
1763 C CD    . LYS A 228 ? 0.8538 0.4952 0.4871 0.0359  -0.1730 0.0519  228 LYS A CD    
1764 C CE    . LYS A 228 ? 0.8856 0.5243 0.5318 0.0517  -0.1872 0.0498  228 LYS A CE    
1765 N NZ    . LYS A 228 ? 0.9322 0.5602 0.5810 0.0716  -0.2188 0.0452  228 LYS A NZ    
1766 N N     . ASP A 229 ? 0.5710 0.3757 0.3753 0.0495  -0.1639 0.0323  229 ASP A N     
1767 C CA    . ASP A 229 ? 0.5445 0.3665 0.3797 0.0653  -0.1840 0.0240  229 ASP A CA    
1768 C C     . ASP A 229 ? 0.5976 0.3745 0.3956 0.0770  -0.2102 0.0246  229 ASP A C     
1769 O O     . ASP A 229 ? 0.6077 0.3553 0.3789 0.0783  -0.2113 0.0291  229 ASP A O     
1770 C CB    . ASP A 229 ? 0.4901 0.3483 0.3703 0.0705  -0.1753 0.0188  229 ASP A CB    
1771 C CG    . ASP A 229 ? 0.4612 0.3497 0.3848 0.0830  -0.1883 0.0073  229 ASP A CG    
1772 O OD1   . ASP A 229 ? 0.4838 0.3535 0.3977 0.0952  -0.2130 0.0029  229 ASP A OD1   
1773 O OD2   . ASP A 229 ? 0.4049 0.3336 0.3705 0.0804  -0.1740 0.0020  229 ASP A OD2   
1774 N N     . SER A 230 ? 0.6297 0.3991 0.4246 0.0856  -0.2321 0.0199  230 SER A N     
1775 C CA    . SER A 230 ? 0.7089 0.4322 0.4660 0.0984  -0.2607 0.0199  230 SER A CA    
1776 C C     . SER A 230 ? 0.7169 0.4427 0.4946 0.1157  -0.2754 0.0135  230 SER A C     
1777 O O     . SER A 230 ? 0.7954 0.4760 0.5353 0.1260  -0.2975 0.0150  230 SER A O     
1778 C CB    . SER A 230 ? 0.7322 0.4523 0.4888 0.1061  -0.2836 0.0138  230 SER A CB    
1779 O OG    . SER A 230 ? 0.7102 0.4846 0.5308 0.1133  -0.2845 0.0017  230 SER A OG    
1780 N N     . ARG A 231 ? 0.6764 0.4516 0.5106 0.1183  -0.2633 0.0061  231 ARG A N     
1781 C CA    . ARG A 231 ? 0.6804 0.4689 0.5464 0.1350  -0.2755 -0.0034 231 ARG A CA    
1782 C C     . ARG A 231 ? 0.7075 0.4777 0.5558 0.1326  -0.2638 0.0032  231 ARG A C     
1783 O O     . ARG A 231 ? 0.7602 0.5183 0.6116 0.1474  -0.2797 -0.0018 231 ARG A O     
1784 C CB    . ARG A 231 ? 0.6145 0.4650 0.5497 0.1374  -0.2662 -0.0163 231 ARG A CB    
1785 C CG    . ARG A 231 ? 0.6100 0.4829 0.5714 0.1418  -0.2798 -0.0266 231 ARG A CG    
1786 C CD    . ARG A 231 ? 0.5533 0.4845 0.5777 0.1390  -0.2648 -0.0386 231 ARG A CD    
1787 N NE    . ARG A 231 ? 0.5245 0.4722 0.5508 0.1213  -0.2331 -0.0297 231 ARG A NE    
1788 C CZ    . ARG A 231 ? 0.4779 0.4681 0.5470 0.1147  -0.2138 -0.0361 231 ARG A CZ    
1789 N NH1   . ARG A 231 ? 0.4598 0.4851 0.5779 0.1223  -0.2195 -0.0528 231 ARG A NH1   
1790 N NH2   . ARG A 231 ? 0.4557 0.4516 0.5170 0.1000  -0.1886 -0.0265 231 ARG A NH2   
1791 N N     . GLY A 232 ? 0.6849 0.4524 0.5151 0.1147  -0.2375 0.0135  232 GLY A N     
1792 C CA    . GLY A 232 ? 0.6753 0.4319 0.4952 0.1113  -0.2247 0.0182  232 GLY A CA    
1793 C C     . GLY A 232 ? 0.6514 0.4008 0.4469 0.0909  -0.1983 0.0283  232 GLY A C     
1794 O O     . GLY A 232 ? 0.6547 0.3943 0.4278 0.0794  -0.1921 0.0331  232 GLY A O     
1795 N N     . PRO A 233 ? 0.6477 0.3999 0.4462 0.0867  -0.1836 0.0304  233 PRO A N     
1796 C CA    . PRO A 233 ? 0.6378 0.3815 0.4140 0.0684  -0.1599 0.0379  233 PRO A CA    
1797 C C     . PRO A 233 ? 0.5803 0.3697 0.3921 0.0579  -0.1379 0.0366  233 PRO A C     
1798 O O     . PRO A 233 ? 0.5614 0.3683 0.3890 0.0529  -0.1219 0.0365  233 PRO A O     
1799 C CB    . PRO A 233 ? 0.6489 0.3787 0.4188 0.0715  -0.1575 0.0385  233 PRO A CB    
1800 C CG    . PRO A 233 ? 0.6256 0.3867 0.4414 0.0882  -0.1680 0.0294  233 PRO A CG    
1801 C CD    . PRO A 233 ? 0.6397 0.3998 0.4612 0.0999  -0.1902 0.0245  233 PRO A CD    
1802 N N     . TRP A 234 ? 0.5518 0.3576 0.3744 0.0552  -0.1385 0.0353  234 TRP A N     
1803 C CA    . TRP A 234 ? 0.5058 0.3537 0.3637 0.0482  -0.1216 0.0331  234 TRP A CA    
1804 C C     . TRP A 234 ? 0.5029 0.3450 0.3428 0.0366  -0.1149 0.0362  234 TRP A C     
1805 O O     . TRP A 234 ? 0.5232 0.3505 0.3477 0.0390  -0.1281 0.0361  234 TRP A O     
1806 C CB    . TRP A 234 ? 0.4827 0.3676 0.3865 0.0584  -0.1282 0.0250  234 TRP A CB    
1807 C CG    . TRP A 234 ? 0.5068 0.3985 0.4301 0.0699  -0.1345 0.0198  234 TRP A CG    
1808 C CD1   . TRP A 234 ? 0.5056 0.4050 0.4374 0.0680  -0.1220 0.0203  234 TRP A CD1   
1809 C CD2   . TRP A 234 ? 0.5336 0.4240 0.4704 0.0857  -0.1556 0.0120  234 TRP A CD2   
1810 N NE1   . TRP A 234 ? 0.5141 0.4167 0.4629 0.0811  -0.1328 0.0137  234 TRP A NE1   
1811 C CE2   . TRP A 234 ? 0.5307 0.4286 0.4844 0.0926  -0.1537 0.0080  234 TRP A CE2   
1812 C CE3   . TRP A 234 ? 0.5809 0.4649 0.5183 0.0953  -0.1770 0.0070  234 TRP A CE3   
1813 C CZ2   . TRP A 234 ? 0.5499 0.4502 0.5233 0.1092  -0.1719 -0.0017 234 TRP A CZ2   
1814 C CZ3   . TRP A 234 ? 0.6102 0.4967 0.5681 0.1130  -0.1973 -0.0033 234 TRP A CZ3   
1815 C CH2   . TRP A 234 ? 0.5755 0.4707 0.5518 0.1196  -0.1937 -0.0077 234 TRP A CH2   
1816 N N     . LEU A 235 ? 0.4622 0.3153 0.3040 0.0245  -0.0950 0.0380  235 LEU A N     
1817 C CA    . LEU A 235 ? 0.4633 0.3151 0.2928 0.0128  -0.0853 0.0393  235 LEU A CA    
1818 C C     . LEU A 235 ? 0.4078 0.2979 0.2735 0.0113  -0.0757 0.0362  235 LEU A C     
1819 O O     . LEU A 235 ? 0.3743 0.2889 0.2680 0.0141  -0.0692 0.0342  235 LEU A O     
1820 C CB    . LEU A 235 ? 0.4857 0.3183 0.2883 -0.0003 -0.0699 0.0416  235 LEU A CB    
1821 C CG    . LEU A 235 ? 0.5288 0.3199 0.2924 -0.0009 -0.0759 0.0450  235 LEU A CG    
1822 C CD1   . LEU A 235 ? 0.5449 0.3236 0.2887 -0.0165 -0.0566 0.0449  235 LEU A CD1   
1823 C CD2   . LEU A 235 ? 0.5726 0.3281 0.3001 0.0013  -0.0921 0.0476  235 LEU A CD2   
1824 N N     . TYR A 236 ? 0.4104 0.3023 0.2721 0.0065  -0.0755 0.0357  236 TYR A N     
1825 C CA    . TYR A 236 ? 0.3786 0.3009 0.2687 0.0043  -0.0675 0.0330  236 TYR A CA    
1826 C C     . TYR A 236 ? 0.3904 0.3037 0.2616 -0.0074 -0.0565 0.0335  236 TYR A C     
1827 O O     . TYR A 236 ? 0.4122 0.3088 0.2622 -0.0109 -0.0618 0.0339  236 TYR A O     
1828 C CB    . TYR A 236 ? 0.3677 0.3025 0.2751 0.0112  -0.0799 0.0300  236 TYR A CB    
1829 C CG    . TYR A 236 ? 0.3710 0.3091 0.2924 0.0229  -0.0936 0.0272  236 TYR A CG    
1830 C CD1   . TYR A 236 ? 0.3614 0.3156 0.3045 0.0269  -0.0882 0.0255  236 TYR A CD1   
1831 C CD2   . TYR A 236 ? 0.4043 0.3298 0.3185 0.0307  -0.1126 0.0248  236 TYR A CD2   
1832 C CE1   . TYR A 236 ? 0.3706 0.3303 0.3303 0.0379  -0.0995 0.0209  236 TYR A CE1   
1833 C CE2   . TYR A 236 ? 0.4063 0.3376 0.3385 0.0433  -0.1267 0.0196  236 TYR A CE2   
1834 C CZ    . TYR A 236 ? 0.3995 0.3490 0.3558 0.0466  -0.1190 0.0174  236 TYR A CZ    
1835 O OH    . TYR A 236 ? 0.3958 0.3542 0.3740 0.0586  -0.1300 0.0105  236 TYR A OH    
1836 N N     . TYR A 237 ? 0.3526 0.2777 0.2327 -0.0133 -0.0418 0.0321  237 TYR A N     
1837 C CA    . TYR A 237 ? 0.3373 0.2645 0.2126 -0.0229 -0.0303 0.0293  237 TYR A CA    
1838 C C     . TYR A 237 ? 0.3171 0.2663 0.2156 -0.0199 -0.0322 0.0276  237 TYR A C     
1839 O O     . TYR A 237 ? 0.2723 0.2421 0.1963 -0.0140 -0.0329 0.0272  237 TYR A O     
1840 C CB    . TYR A 237 ? 0.3219 0.2581 0.2048 -0.0285 -0.0160 0.0260  237 TYR A CB    
1841 C CG    . TYR A 237 ? 0.3137 0.2614 0.2041 -0.0352 -0.0056 0.0204  237 TYR A CG    
1842 C CD1   . TYR A 237 ? 0.3279 0.2609 0.1977 -0.0457 0.0023  0.0167  237 TYR A CD1   
1843 C CD2   . TYR A 237 ? 0.2929 0.2647 0.2103 -0.0309 -0.0042 0.0182  237 TYR A CD2   
1844 C CE1   . TYR A 237 ? 0.3289 0.2740 0.2085 -0.0513 0.0117  0.0096  237 TYR A CE1   
1845 C CE2   . TYR A 237 ? 0.2832 0.2646 0.2083 -0.0354 0.0036  0.0119  237 TYR A CE2   
1846 C CZ    . TYR A 237 ? 0.3009 0.2702 0.2086 -0.0453 0.0114  0.0070  237 TYR A CZ    
1847 O OH    . TYR A 237 ? 0.2871 0.2664 0.2041 -0.0494 0.0191  -0.0009 237 TYR A OH    
1848 N N     . THR A 238 ? 0.3401 0.2825 0.2267 -0.0254 -0.0314 0.0261  238 THR A N     
1849 C CA    . THR A 238 ? 0.3420 0.2969 0.2426 -0.0228 -0.0364 0.0250  238 THR A CA    
1850 C C     . THR A 238 ? 0.3352 0.2904 0.2307 -0.0307 -0.0275 0.0213  238 THR A C     
1851 O O     . THR A 238 ? 0.3561 0.2920 0.2261 -0.0382 -0.0237 0.0202  238 THR A O     
1852 C CB    . THR A 238 ? 0.3776 0.3177 0.2642 -0.0191 -0.0515 0.0267  238 THR A CB    
1853 O OG1   . THR A 238 ? 0.4235 0.3629 0.3162 -0.0104 -0.0615 0.0284  238 THR A OG1   
1854 C CG2   . THR A 238 ? 0.3797 0.3336 0.2817 -0.0177 -0.0564 0.0242  238 THR A CG2   
1855 N N     . VAL A 239 ? 0.3073 0.2820 0.2251 -0.0291 -0.0245 0.0189  239 VAL A N     
1856 C CA    . VAL A 239 ? 0.3141 0.2899 0.2299 -0.0344 -0.0189 0.0147  239 VAL A CA    
1857 C C     . VAL A 239 ? 0.3245 0.3073 0.2502 -0.0317 -0.0263 0.0151  239 VAL A C     
1858 O O     . VAL A 239 ? 0.2875 0.2849 0.2332 -0.0273 -0.0276 0.0156  239 VAL A O     
1859 C CB    . VAL A 239 ? 0.2987 0.2882 0.2303 -0.0351 -0.0086 0.0100  239 VAL A CB    
1860 C CG1   . VAL A 239 ? 0.3036 0.2939 0.2344 -0.0397 -0.0032 0.0039  239 VAL A CG1   
1861 C CG2   . VAL A 239 ? 0.3072 0.2922 0.2324 -0.0385 -0.0012 0.0080  239 VAL A CG2   
1862 N N     . THR A 240 ? 0.3687 0.3392 0.2776 -0.0357 -0.0300 0.0140  240 THR A N     
1863 C CA    . THR A 240 ? 0.3903 0.3658 0.3064 -0.0348 -0.0369 0.0130  240 THR A CA    
1864 C C     . THR A 240 ? 0.4060 0.3796 0.3174 -0.0406 -0.0307 0.0085  240 THR A C     
1865 O O     . THR A 240 ? 0.4339 0.4127 0.3530 -0.0404 -0.0347 0.0071  240 THR A O     
1866 C CB    . THR A 240 ? 0.4231 0.3838 0.3225 -0.0332 -0.0508 0.0147  240 THR A CB    
1867 O OG1   . THR A 240 ? 0.4232 0.3588 0.2901 -0.0379 -0.0502 0.0160  240 THR A OG1   
1868 C CG2   . THR A 240 ? 0.4102 0.3795 0.3249 -0.0252 -0.0599 0.0166  240 THR A CG2   
1869 N N     . ASN A 241 ? 0.3845 0.3510 0.2841 -0.0462 -0.0205 0.0050  241 ASN A N     
1870 C CA    . ASN A 241 ? 0.3761 0.3411 0.2722 -0.0514 -0.0138 -0.0009 241 ASN A CA    
1871 C C     . ASN A 241 ? 0.3436 0.3258 0.2644 -0.0474 -0.0094 -0.0041 241 ASN A C     
1872 O O     . ASN A 241 ? 0.3409 0.3315 0.2733 -0.0447 -0.0044 -0.0054 241 ASN A O     
1873 C CB    . ASN A 241 ? 0.4105 0.3632 0.2875 -0.0595 -0.0031 -0.0055 241 ASN A CB    
1874 C CG    . ASN A 241 ? 0.4195 0.3699 0.2918 -0.0660 0.0052  -0.0138 241 ASN A CG    
1875 O OD1   . ASN A 241 ? 0.4215 0.3867 0.3149 -0.0630 0.0094  -0.0191 241 ASN A OD1   
1876 N ND2   . ASN A 241 ? 0.4506 0.3806 0.2941 -0.0744 0.0071  -0.0154 241 ASN A ND2   
1877 N N     . PHE A 242 ? 0.3353 0.3207 0.2630 -0.0466 -0.0124 -0.0053 242 PHE A N     
1878 C CA    . PHE A 242 ? 0.3214 0.3180 0.2689 -0.0416 -0.0109 -0.0066 242 PHE A CA    
1879 C C     . PHE A 242 ? 0.3196 0.3196 0.2731 -0.0410 -0.0029 -0.0143 242 PHE A C     
1880 O O     . PHE A 242 ? 0.3036 0.3104 0.2703 -0.0354 -0.0026 -0.0150 242 PHE A O     
1881 C CB    . PHE A 242 ? 0.3193 0.3153 0.2701 -0.0420 -0.0155 -0.0065 242 PHE A CB    
1882 C CG    . PHE A 242 ? 0.3119 0.3115 0.2750 -0.0382 -0.0138 -0.0081 242 PHE A CG    
1883 C CD1   . PHE A 242 ? 0.2914 0.2955 0.2641 -0.0346 -0.0155 -0.0036 242 PHE A CD1   
1884 C CD2   . PHE A 242 ? 0.3134 0.3089 0.2759 -0.0385 -0.0109 -0.0146 242 PHE A CD2   
1885 C CE1   . PHE A 242 ? 0.2880 0.2888 0.2650 -0.0317 -0.0148 -0.0043 242 PHE A CE1   
1886 C CE2   . PHE A 242 ? 0.3134 0.3070 0.2832 -0.0338 -0.0115 -0.0158 242 PHE A CE2   
1887 C CZ    . PHE A 242 ? 0.3025 0.2968 0.2771 -0.0307 -0.0138 -0.0101 242 PHE A CZ    
1888 N N     . SER A 243 ? 0.3437 0.3382 0.2872 -0.0468 0.0033  -0.0212 243 SER A N     
1889 C CA    . SER A 243 ? 0.3510 0.3521 0.3052 -0.0460 0.0111  -0.0316 243 SER A CA    
1890 C C     . SER A 243 ? 0.3468 0.3552 0.3083 -0.0449 0.0158  -0.0337 243 SER A C     
1891 O O     . SER A 243 ? 0.3817 0.4003 0.3606 -0.0397 0.0178  -0.0411 243 SER A O     
1892 C CB    . SER A 243 ? 0.3611 0.3559 0.3050 -0.0535 0.0184  -0.0406 243 SER A CB    
1893 O OG    . SER A 243 ? 0.3896 0.3772 0.3173 -0.0615 0.0249  -0.0411 243 SER A OG    
1894 N N     . ASP A 244 ? 0.3362 0.3388 0.2851 -0.0486 0.0161  -0.0276 244 ASP A N     
1895 C CA    . ASP A 244 ? 0.3359 0.3446 0.2918 -0.0466 0.0184  -0.0268 244 ASP A CA    
1896 C C     . ASP A 244 ? 0.3023 0.3197 0.2735 -0.0370 0.0110  -0.0209 244 ASP A C     
1897 O O     . ASP A 244 ? 0.2771 0.3030 0.2610 -0.0331 0.0127  -0.0247 244 ASP A O     
1898 C CB    . ASP A 244 ? 0.3581 0.3538 0.2930 -0.0525 0.0188  -0.0206 244 ASP A CB    
1899 C CG    . ASP A 244 ? 0.4021 0.3851 0.3169 -0.0638 0.0286  -0.0271 244 ASP A CG    
1900 O OD1   . ASP A 244 ? 0.4187 0.4091 0.3427 -0.0674 0.0381  -0.0388 244 ASP A OD1   
1901 O OD2   . ASP A 244 ? 0.4444 0.4087 0.3333 -0.0692 0.0270  -0.0216 244 ASP A OD2   
1902 N N     . ILE A 245 ? 0.3015 0.3161 0.2708 -0.0341 0.0034  -0.0126 245 ILE A N     
1903 C CA    . ILE A 245 ? 0.3017 0.3218 0.2825 -0.0271 -0.0015 -0.0080 245 ILE A CA    
1904 C C     . ILE A 245 ? 0.3241 0.3480 0.3163 -0.0218 -0.0012 -0.0147 245 ILE A C     
1905 O O     . ILE A 245 ? 0.3284 0.3567 0.3290 -0.0163 -0.0024 -0.0157 245 ILE A O     
1906 C CB    . ILE A 245 ? 0.2928 0.3102 0.2718 -0.0268 -0.0076 -0.0014 245 ILE A CB    
1907 C CG1   . ILE A 245 ? 0.3030 0.3175 0.2740 -0.0293 -0.0113 0.0038  245 ILE A CG1   
1908 C CG2   . ILE A 245 ? 0.2850 0.3052 0.2727 -0.0219 -0.0099 0.0018  245 ILE A CG2   
1909 C CD1   . ILE A 245 ? 0.2865 0.3041 0.2602 -0.0263 -0.0116 0.0075  245 ILE A CD1   
1910 N N     . GLN A 246 ? 0.3455 0.3660 0.3368 -0.0227 -0.0013 -0.0193 246 GLN A N     
1911 C CA    . GLN A 246 ? 0.3790 0.4000 0.3794 -0.0167 -0.0031 -0.0266 246 GLN A CA    
1912 C C     . GLN A 246 ? 0.3457 0.3757 0.3579 -0.0146 0.0009  -0.0381 246 GLN A C     
1913 O O     . GLN A 246 ? 0.3591 0.3912 0.3813 -0.0066 -0.0036 -0.0424 246 GLN A O     
1914 C CB    . GLN A 246 ? 0.4165 0.4317 0.4133 -0.0188 -0.0030 -0.0308 246 GLN A CB    
1915 C CG    . GLN A 246 ? 0.4513 0.4574 0.4408 -0.0195 -0.0078 -0.0233 246 GLN A CG    
1916 C CD    . GLN A 246 ? 0.5188 0.5172 0.5094 -0.0157 -0.0106 -0.0290 246 GLN A CD    
1917 O OE1   . GLN A 246 ? 0.5345 0.5317 0.5237 -0.0188 -0.0078 -0.0359 246 GLN A OE1   
1918 N NE2   . GLN A 246 ? 0.5294 0.5195 0.5199 -0.0089 -0.0163 -0.0266 246 GLN A NE2   
1919 N N     . GLY A 247 ? 0.3350 0.3689 0.3450 -0.0223 0.0094  -0.0440 247 GLY A N     
1920 C CA    . GLY A 247 ? 0.3192 0.3637 0.3432 -0.0226 0.0158  -0.0587 247 GLY A CA    
1921 C C     . GLY A 247 ? 0.3146 0.3671 0.3458 -0.0218 0.0176  -0.0595 247 GLY A C     
1922 O O     . GLY A 247 ? 0.3198 0.3836 0.3689 -0.0180 0.0187  -0.0717 247 GLY A O     
1923 N N     . LYS A 248 ? 0.3012 0.3482 0.3195 -0.0257 0.0179  -0.0481 248 LYS A N     
1924 C CA    . LYS A 248 ? 0.2857 0.3381 0.3076 -0.0270 0.0212  -0.0488 248 LYS A CA    
1925 C C     . LYS A 248 ? 0.2698 0.3207 0.2908 -0.0207 0.0137  -0.0379 248 LYS A C     
1926 O O     . LYS A 248 ? 0.2363 0.2949 0.2692 -0.0157 0.0120  -0.0420 248 LYS A O     
1927 C CB    . LYS A 248 ? 0.3347 0.3792 0.3394 -0.0386 0.0301  -0.0473 248 LYS A CB    
1928 C CG    . LYS A 248 ? 0.3625 0.4074 0.3662 -0.0468 0.0400  -0.0597 248 LYS A CG    
1929 C CD    . LYS A 248 ? 0.4259 0.4555 0.4039 -0.0597 0.0486  -0.0571 248 LYS A CD    
1930 C CE    . LYS A 248 ? 0.4775 0.5034 0.4496 -0.0671 0.0564  -0.0668 248 LYS A CE    
1931 N NZ    . LYS A 248 ? 0.5253 0.5360 0.4727 -0.0825 0.0694  -0.0706 248 LYS A NZ    
1932 N N     . ILE A 249 ? 0.2580 0.3000 0.2667 -0.0206 0.0091  -0.0255 249 ILE A N     
1933 C CA    . ILE A 249 ? 0.2583 0.2995 0.2665 -0.0159 0.0040  -0.0164 249 ILE A CA    
1934 C C     . ILE A 249 ? 0.2556 0.2972 0.2715 -0.0072 -0.0026 -0.0166 249 ILE A C     
1935 O O     . ILE A 249 ? 0.2844 0.3288 0.3058 -0.0022 -0.0050 -0.0177 249 ILE A O     
1936 C CB    . ILE A 249 ? 0.2511 0.2851 0.2477 -0.0185 0.0014  -0.0059 249 ILE A CB    
1937 C CG1   . ILE A 249 ? 0.2578 0.2849 0.2408 -0.0261 0.0052  -0.0056 249 ILE A CG1   
1938 C CG2   . ILE A 249 ? 0.2456 0.2804 0.2439 -0.0144 -0.0020 0.0012  249 ILE A CG2   
1939 C CD1   . ILE A 249 ? 0.2645 0.2912 0.2447 -0.0292 0.0105  -0.0079 249 ILE A CD1   
1940 N N     . ILE A 250 ? 0.2586 0.2945 0.2722 -0.0055 -0.0060 -0.0157 250 ILE A N     
1941 C CA    . ILE A 250 ? 0.2655 0.2949 0.2794 0.0019  -0.0128 -0.0150 250 ILE A CA    
1942 C C     . ILE A 250 ? 0.2642 0.2979 0.2891 0.0096  -0.0167 -0.0251 250 ILE A C     
1943 O O     . ILE A 250 ? 0.2732 0.3027 0.2963 0.0154  -0.0221 -0.0231 250 ILE A O     
1944 C CB    . ILE A 250 ? 0.2666 0.2857 0.2735 0.0013  -0.0153 -0.0129 250 ILE A CB    
1945 C CG1   . ILE A 250 ? 0.2550 0.2709 0.2541 -0.0042 -0.0138 -0.0031 250 ILE A CG1   
1946 C CG2   . ILE A 250 ? 0.2772 0.2840 0.2806 0.0092  -0.0229 -0.0149 250 ILE A CG2   
1947 C CD1   . ILE A 250 ? 0.2563 0.2653 0.2500 -0.0080 -0.0143 -0.0018 250 ILE A CD1   
1948 N N     . PRO A 251 ? 0.2682 0.3106 0.3045 0.0093  -0.0141 -0.0369 251 PRO A N     
1949 C CA    . PRO A 251 ? 0.2562 0.3062 0.3076 0.0170  -0.0187 -0.0489 251 PRO A CA    
1950 C C     . PRO A 251 ? 0.2502 0.3090 0.3075 0.0163  -0.0166 -0.0499 251 PRO A C     
1951 O O     . PRO A 251 ? 0.2535 0.3121 0.3165 0.0250  -0.0249 -0.0541 251 PRO A O     
1952 C CB    . PRO A 251 ? 0.2529 0.3137 0.3183 0.0144  -0.0132 -0.0633 251 PRO A CB    
1953 C CG    . PRO A 251 ? 0.2590 0.3102 0.3121 0.0098  -0.0111 -0.0573 251 PRO A CG    
1954 C CD    . PRO A 251 ? 0.2561 0.3003 0.2927 0.0033  -0.0084 -0.0417 251 PRO A CD    
1955 N N     . PHE A 252 ? 0.2365 0.3002 0.2904 0.0068  -0.0070 -0.0465 252 PHE A N     
1956 C CA    . PHE A 252 ? 0.2363 0.3058 0.2938 0.0062  -0.0053 -0.0467 252 PHE A CA    
1957 C C     . PHE A 252 ? 0.2303 0.2912 0.2801 0.0133  -0.0138 -0.0376 252 PHE A C     
1958 O O     . PHE A 252 ? 0.2128 0.2768 0.2697 0.0194  -0.0192 -0.0429 252 PHE A O     
1959 C CB    . PHE A 252 ? 0.2404 0.3087 0.2878 -0.0041 0.0039  -0.0404 252 PHE A CB    
1960 C CG    . PHE A 252 ? 0.2400 0.3138 0.2918 -0.0057 0.0068  -0.0429 252 PHE A CG    
1961 C CD1   . PHE A 252 ? 0.2371 0.3223 0.3020 -0.0108 0.0141  -0.0571 252 PHE A CD1   
1962 C CD2   . PHE A 252 ? 0.2397 0.3078 0.2833 -0.0032 0.0035  -0.0326 252 PHE A CD2   
1963 C CE1   . PHE A 252 ? 0.2488 0.3387 0.3178 -0.0132 0.0172  -0.0602 252 PHE A CE1   
1964 C CE2   . PHE A 252 ? 0.2477 0.3200 0.2948 -0.0046 0.0059  -0.0352 252 PHE A CE2   
1965 C CZ    . PHE A 252 ? 0.2385 0.3211 0.2976 -0.0098 0.0126  -0.0486 252 PHE A CZ    
1966 N N     . PHE A 253 ? 0.2370 0.2871 0.2720 0.0114  -0.0140 -0.0249 253 PHE A N     
1967 C CA    . PHE A 253 ? 0.2474 0.2878 0.2726 0.0156  -0.0191 -0.0165 253 PHE A CA    
1968 C C     . PHE A 253 ? 0.2694 0.2968 0.2883 0.0241  -0.0289 -0.0176 253 PHE A C     
1969 O O     . PHE A 253 ? 0.2607 0.2776 0.2691 0.0275  -0.0331 -0.0129 253 PHE A O     
1970 C CB    . PHE A 253 ? 0.2358 0.2717 0.2508 0.0100  -0.0147 -0.0052 253 PHE A CB    
1971 C CG    . PHE A 253 ? 0.2319 0.2750 0.2488 0.0041  -0.0085 -0.0038 253 PHE A CG    
1972 C CD1   . PHE A 253 ? 0.2300 0.2760 0.2484 0.0047  -0.0073 -0.0036 253 PHE A CD1   
1973 C CD2   . PHE A 253 ? 0.2471 0.2911 0.2616 -0.0019 -0.0045 -0.0032 253 PHE A CD2   
1974 C CE1   . PHE A 253 ? 0.2314 0.2799 0.2484 -0.0003 -0.0023 -0.0024 253 PHE A CE1   
1975 C CE2   . PHE A 253 ? 0.2515 0.2961 0.2622 -0.0070 -0.0001 -0.0017 253 PHE A CE2   
1976 C CZ    . PHE A 253 ? 0.2578 0.3042 0.2697 -0.0062 0.0010  -0.0013 253 PHE A CZ    
1977 N N     . HIS A 254 ? 0.3010 0.3264 0.3237 0.0273  -0.0326 -0.0240 254 HIS A N     
1978 C CA    . HIS A 254 ? 0.3669 0.3776 0.3832 0.0370  -0.0441 -0.0272 254 HIS A CA    
1979 C C     . HIS A 254 ? 0.3614 0.3775 0.3878 0.0454  -0.0521 -0.0366 254 HIS A C     
1980 O O     . HIS A 254 ? 0.3761 0.3762 0.3892 0.0522  -0.0615 -0.0343 254 HIS A O     
1981 C CB    . HIS A 254 ? 0.3918 0.3995 0.4122 0.0397  -0.0473 -0.0338 254 HIS A CB    
1982 C CG    . HIS A 254 ? 0.4637 0.4524 0.4754 0.0513  -0.0615 -0.0379 254 HIS A CG    
1983 N ND1   . HIS A 254 ? 0.5121 0.4734 0.4971 0.0526  -0.0667 -0.0278 254 HIS A ND1   
1984 C CD2   . HIS A 254 ? 0.4946 0.4858 0.5196 0.0626  -0.0725 -0.0519 254 HIS A CD2   
1985 C CE1   . HIS A 254 ? 0.5420 0.4858 0.5198 0.0645  -0.0812 -0.0340 254 HIS A CE1   
1986 N NE2   . HIS A 254 ? 0.5268 0.4895 0.5306 0.0718  -0.0860 -0.0490 254 HIS A NE2   
1987 N N     . GLN A 255 ? 0.3551 0.3924 0.4035 0.0441  -0.0480 -0.0480 255 GLN A N     
1988 C CA    . GLN A 255 ? 0.3689 0.4165 0.4323 0.0505  -0.0542 -0.0594 255 GLN A CA    
1989 C C     . GLN A 255 ? 0.3357 0.3860 0.3950 0.0470  -0.0506 -0.0538 255 GLN A C     
1990 O O     . GLN A 255 ? 0.4023 0.4510 0.4635 0.0542  -0.0597 -0.0587 255 GLN A O     
1991 C CB    . GLN A 255 ? 0.3958 0.4661 0.4850 0.0471  -0.0476 -0.0748 255 GLN A CB    
1992 C CG    . GLN A 255 ? 0.4632 0.5452 0.5732 0.0559  -0.0566 -0.0913 255 GLN A CG    
1993 C CD    . GLN A 255 ? 0.5275 0.6289 0.6639 0.0548  -0.0521 -0.1097 255 GLN A CD    
1994 O OE1   . GLN A 255 ? 0.5425 0.6562 0.6852 0.0421  -0.0362 -0.1120 255 GLN A OE1   
1995 N NE2   . GLN A 255 ? 0.5617 0.6644 0.7126 0.0679  -0.0660 -0.1237 255 GLN A NE2   
1996 N N     . TYR A 256 ? 0.2932 0.3475 0.3475 0.0364  -0.0384 -0.0449 256 TYR A N     
1997 C CA    . TYR A 256 ? 0.2552 0.3102 0.3041 0.0329  -0.0345 -0.0388 256 TYR A CA    
1998 C C     . TYR A 256 ? 0.2531 0.2931 0.2814 0.0301  -0.0322 -0.0234 256 TYR A C     
1999 O O     . TYR A 256 ? 0.2356 0.2776 0.2611 0.0227  -0.0241 -0.0169 256 TYR A O     
2000 C CB    . TYR A 256 ? 0.2240 0.2946 0.2848 0.0237  -0.0231 -0.0436 256 TYR A CB    
2001 C CG    . TYR A 256 ? 0.2109 0.2981 0.2947 0.0246  -0.0230 -0.0616 256 TYR A CG    
2002 C CD1   . TYR A 256 ? 0.2248 0.3201 0.3211 0.0297  -0.0289 -0.0718 256 TYR A CD1   
2003 C CD2   . TYR A 256 ? 0.2046 0.2997 0.2988 0.0211  -0.0180 -0.0701 256 TYR A CD2   
2004 C CE1   . TYR A 256 ? 0.2231 0.3367 0.3450 0.0304  -0.0289 -0.0910 256 TYR A CE1   
2005 C CE2   . TYR A 256 ? 0.2068 0.3191 0.3250 0.0213  -0.0166 -0.0890 256 TYR A CE2   
2006 C CZ    . TYR A 256 ? 0.2223 0.3450 0.3560 0.0260  -0.0220 -0.1001 256 TYR A CZ    
2007 O OH    . TYR A 256 ? 0.2470 0.3900 0.4094 0.0264  -0.0209 -0.1218 256 TYR A OH    
2008 N N     . LYS A 257 ? 0.2710 0.2950 0.2845 0.0357  -0.0398 -0.0190 257 LYS A N     
2009 C CA    . LYS A 257 ? 0.2909 0.2989 0.2850 0.0327  -0.0375 -0.0074 257 LYS A CA    
2010 C C     . LYS A 257 ? 0.2849 0.2957 0.2753 0.0269  -0.0295 -0.0003 257 LYS A C     
2011 O O     . LYS A 257 ? 0.2720 0.2869 0.2652 0.0283  -0.0299 -0.0023 257 LYS A O     
2012 C CB    . LYS A 257 ? 0.3304 0.3154 0.3046 0.0393  -0.0473 -0.0059 257 LYS A CB    
2013 C CG    . LYS A 257 ? 0.3719 0.3467 0.3438 0.0459  -0.0567 -0.0111 257 LYS A CG    
2014 C CD    . LYS A 257 ? 0.4231 0.3706 0.3717 0.0543  -0.0696 -0.0108 257 LYS A CD    
2015 C CE    . LYS A 257 ? 0.4611 0.3899 0.3994 0.0610  -0.0800 -0.0137 257 LYS A CE    
2016 N NZ    . LYS A 257 ? 0.4770 0.4225 0.4362 0.0599  -0.0767 -0.0194 257 LYS A NZ    
2017 N N     . ILE A 258 ? 0.2788 0.2874 0.2642 0.0209  -0.0229 0.0068  258 ILE A N     
2018 C CA    . ILE A 258 ? 0.2863 0.2971 0.2697 0.0160  -0.0160 0.0127  258 ILE A CA    
2019 C C     . ILE A 258 ? 0.2995 0.2948 0.2664 0.0177  -0.0174 0.0152  258 ILE A C     
2020 O O     . ILE A 258 ? 0.2970 0.2753 0.2490 0.0204  -0.0227 0.0153  258 ILE A O     
2021 C CB    . ILE A 258 ? 0.3095 0.3217 0.2938 0.0102  -0.0109 0.0169  258 ILE A CB    
2022 C CG1   . ILE A 258 ? 0.3118 0.3360 0.3079 0.0082  -0.0100 0.0146  258 ILE A CG1   
2023 C CG2   . ILE A 258 ? 0.3189 0.3331 0.3031 0.0057  -0.0046 0.0211  258 ILE A CG2   
2024 C CD1   . ILE A 258 ? 0.3007 0.3347 0.3044 0.0073  -0.0077 0.0130  258 ILE A CD1   
2025 N N     . ILE A 259 ? 0.2803 0.2792 0.2477 0.0159  -0.0128 0.0170  259 ILE A N     
2026 C CA    . ILE A 259 ? 0.2986 0.2829 0.2491 0.0157  -0.0117 0.0191  259 ILE A CA    
2027 C C     . ILE A 259 ? 0.2947 0.2799 0.2441 0.0086  -0.0015 0.0228  259 ILE A C     
2028 O O     . ILE A 259 ? 0.2802 0.2798 0.2448 0.0056  0.0030  0.0232  259 ILE A O     
2029 C CB    . ILE A 259 ? 0.2924 0.2801 0.2450 0.0200  -0.0151 0.0157  259 ILE A CB    
2030 C CG1   . ILE A 259 ? 0.2728 0.2773 0.2410 0.0171  -0.0084 0.0160  259 ILE A CG1   
2031 C CG2   . ILE A 259 ? 0.2785 0.2685 0.2371 0.0268  -0.0255 0.0091  259 ILE A CG2   
2032 C CD1   . ILE A 259 ? 0.2710 0.2795 0.2425 0.0197  -0.0102 0.0124  259 ILE A CD1   
2033 N N     . GLY A 260 ? 0.3338 0.3019 0.2639 0.0057  0.0020  0.0244  260 GLY A N     
2034 C CA    . GLY A 260 ? 0.3391 0.3074 0.2686 -0.0027 0.0136  0.0253  260 GLY A CA    
2035 C C     . GLY A 260 ? 0.3549 0.3169 0.2801 -0.0086 0.0169  0.0263  260 GLY A C     
2036 O O     . GLY A 260 ? 0.3741 0.3295 0.2948 -0.0056 0.0097  0.0272  260 GLY A O     
2037 N N     . SER A 261 ? 0.3552 0.3202 0.2836 -0.0172 0.0281  0.0248  261 SER A N     
2038 C CA    . SER A 261 ? 0.3892 0.3482 0.3138 -0.0246 0.0328  0.0246  261 SER A CA    
2039 C C     . SER A 261 ? 0.3411 0.3169 0.2860 -0.0218 0.0271  0.0244  261 SER A C     
2040 O O     . SER A 261 ? 0.3484 0.3165 0.2877 -0.0256 0.0271  0.0249  261 SER A O     
2041 C CB    . SER A 261 ? 0.4223 0.3854 0.3514 -0.0356 0.0474  0.0201  261 SER A CB    
2042 O OG    . SER A 261 ? 0.4622 0.4537 0.4223 -0.0327 0.0480  0.0163  261 SER A OG    
2043 N N     . ALA A 262 ? 0.3026 0.2977 0.2672 -0.0155 0.0219  0.0239  262 ALA A N     
2044 C CA    . ALA A 262 ? 0.2890 0.2958 0.2672 -0.0129 0.0162  0.0238  262 ALA A CA    
2045 C C     . ALA A 262 ? 0.2920 0.2859 0.2580 -0.0097 0.0091  0.0253  262 ALA A C     
2046 O O     . ALA A 262 ? 0.2760 0.2749 0.2488 -0.0101 0.0065  0.0248  262 ALA A O     
2047 C CB    . ALA A 262 ? 0.2774 0.2995 0.2705 -0.0074 0.0121  0.0233  262 ALA A CB    
2048 N N     . TYR A 263 ? 0.2926 0.2701 0.2414 -0.0056 0.0049  0.0261  263 TYR A N     
2049 C CA    . TYR A 263 ? 0.3085 0.2728 0.2468 -0.0014 -0.0029 0.0258  263 TYR A CA    
2050 C C     . TYR A 263 ? 0.3263 0.2757 0.2524 -0.0075 -0.0002 0.0271  263 TYR A C     
2051 O O     . TYR A 263 ? 0.3231 0.2728 0.2527 -0.0055 -0.0049 0.0259  263 TYR A O     
2052 C CB    . TYR A 263 ? 0.3384 0.2865 0.2604 0.0052  -0.0102 0.0252  263 TYR A CB    
2053 C CG    . TYR A 263 ? 0.3700 0.3030 0.2820 0.0116  -0.0209 0.0231  263 TYR A CG    
2054 C CD1   . TYR A 263 ? 0.3585 0.3069 0.2892 0.0169  -0.0264 0.0183  263 TYR A CD1   
2055 C CD2   . TYR A 263 ? 0.4149 0.3163 0.2975 0.0117  -0.0248 0.0252  263 TYR A CD2   
2056 C CE1   . TYR A 263 ? 0.3867 0.3239 0.3123 0.0236  -0.0362 0.0144  263 TYR A CE1   
2057 C CE2   . TYR A 263 ? 0.4515 0.3373 0.3251 0.0195  -0.0367 0.0224  263 TYR A CE2   
2058 C CZ    . TYR A 263 ? 0.4481 0.3541 0.3459 0.0259  -0.0424 0.0164  263 TYR A CZ    
2059 O OH    . TYR A 263 ? 0.5012 0.3954 0.3952 0.0344  -0.0542 0.0115  263 TYR A OH    
2060 N N     . GLY A 264 ? 0.3507 0.2878 0.2635 -0.0162 0.0085  0.0285  264 GLY A N     
2061 C CA    . GLY A 264 ? 0.3583 0.2825 0.2609 -0.0250 0.0141  0.0288  264 GLY A CA    
2062 C C     . GLY A 264 ? 0.3446 0.2917 0.2719 -0.0280 0.0161  0.0265  264 GLY A C     
2063 O O     . GLY A 264 ? 0.3545 0.2948 0.2782 -0.0308 0.0149  0.0262  264 GLY A O     
2064 N N     . ASP A 265 ? 0.3320 0.3042 0.2827 -0.0269 0.0177  0.0247  265 ASP A N     
2065 C CA    . ASP A 265 ? 0.3445 0.3360 0.3161 -0.0285 0.0171  0.0224  265 ASP A CA    
2066 C C     . ASP A 265 ? 0.3342 0.3278 0.3083 -0.0224 0.0082  0.0229  265 ASP A C     
2067 O O     . ASP A 265 ? 0.3615 0.3566 0.3392 -0.0254 0.0073  0.0217  265 ASP A O     
2068 C CB    . ASP A 265 ? 0.3571 0.3706 0.3496 -0.0267 0.0181  0.0202  265 ASP A CB    
2069 C CG    . ASP A 265 ? 0.3814 0.3995 0.3797 -0.0338 0.0283  0.0164  265 ASP A CG    
2070 O OD1   . ASP A 265 ? 0.4050 0.4126 0.3942 -0.0428 0.0364  0.0144  265 ASP A OD1   
2071 O OD2   . ASP A 265 ? 0.3813 0.4132 0.3934 -0.0308 0.0286  0.0143  265 ASP A OD2   
2072 N N     . TYR A 266 ? 0.3101 0.3049 0.2837 -0.0147 0.0026  0.0235  266 TYR A N     
2073 C CA    . TYR A 266 ? 0.2924 0.2880 0.2678 -0.0095 -0.0039 0.0219  266 TYR A CA    
2074 C C     . TYR A 266 ? 0.2981 0.2760 0.2601 -0.0096 -0.0067 0.0215  266 TYR A C     
2075 O O     . TYR A 266 ? 0.2694 0.2506 0.2362 -0.0097 -0.0090 0.0194  266 TYR A O     
2076 C CB    . TYR A 266 ? 0.2806 0.2783 0.2569 -0.0022 -0.0082 0.0204  266 TYR A CB    
2077 C CG    . TYR A 266 ? 0.2790 0.2761 0.2574 0.0029  -0.0142 0.0159  266 TYR A CG    
2078 C CD1   . TYR A 266 ? 0.2815 0.2914 0.2713 0.0021  -0.0137 0.0127  266 TYR A CD1   
2079 C CD2   . TYR A 266 ? 0.2969 0.2796 0.2653 0.0087  -0.0204 0.0136  266 TYR A CD2   
2080 C CE1   . TYR A 266 ? 0.2854 0.2967 0.2795 0.0058  -0.0171 0.0062  266 TYR A CE1   
2081 C CE2   . TYR A 266 ? 0.3075 0.2921 0.2821 0.0146  -0.0264 0.0067  266 TYR A CE2   
2082 C CZ    . TYR A 266 ? 0.2965 0.2970 0.2856 0.0126  -0.0237 0.0024  266 TYR A CZ    
2083 O OH    . TYR A 266 ? 0.3172 0.3206 0.3142 0.0176  -0.0279 -0.0063 266 TYR A OH    
2084 N N     . GLN A 267 ? 0.3258 0.2825 0.2686 -0.0096 -0.0070 0.0232  267 GLN A N     
2085 C CA    . GLN A 267 ? 0.3688 0.3040 0.2952 -0.0095 -0.0106 0.0230  267 GLN A CA    
2086 C C     . GLN A 267 ? 0.3523 0.2875 0.2803 -0.0189 -0.0048 0.0231  267 GLN A C     
2087 O O     . GLN A 267 ? 0.3432 0.2726 0.2694 -0.0181 -0.0084 0.0214  267 GLN A O     
2088 C CB    . GLN A 267 ? 0.4332 0.3390 0.3319 -0.0090 -0.0123 0.0255  267 GLN A CB    
2089 C CG    . GLN A 267 ? 0.4710 0.3723 0.3658 0.0021  -0.0220 0.0238  267 GLN A CG    
2090 C CD    . GLN A 267 ? 0.5496 0.4178 0.4120 0.0022  -0.0245 0.0268  267 GLN A CD    
2091 O OE1   . GLN A 267 ? 0.5891 0.4477 0.4379 -0.0072 -0.0147 0.0303  267 GLN A OE1   
2092 N NE2   . GLN A 267 ? 0.6070 0.4556 0.4554 0.0126  -0.0379 0.0245  267 GLN A NE2   
2093 N N     . ASP A 268 ? 0.3446 0.2864 0.2768 -0.0277 0.0041  0.0238  268 ASP A N     
2094 C CA    . ASP A 268 ? 0.3456 0.2930 0.2851 -0.0371 0.0099  0.0219  268 ASP A CA    
2095 C C     . ASP A 268 ? 0.3181 0.2847 0.2764 -0.0346 0.0052  0.0196  268 ASP A C     
2096 O O     . ASP A 268 ? 0.3289 0.2921 0.2866 -0.0383 0.0046  0.0179  268 ASP A O     
2097 C CB    . ASP A 268 ? 0.3389 0.2949 0.2853 -0.0457 0.0201  0.0204  268 ASP A CB    
2098 C CG    . ASP A 268 ? 0.3793 0.3078 0.2990 -0.0527 0.0274  0.0219  268 ASP A CG    
2099 O OD1   . ASP A 268 ? 0.4270 0.3285 0.3225 -0.0514 0.0233  0.0244  268 ASP A OD1   
2100 O OD2   . ASP A 268 ? 0.3656 0.2958 0.2854 -0.0600 0.0372  0.0201  268 ASP A OD2   
2101 N N     . TRP A 269 ? 0.3003 0.2841 0.2720 -0.0286 0.0019  0.0195  269 TRP A N     
2102 C CA    . TRP A 269 ? 0.2748 0.2737 0.2597 -0.0270 -0.0020 0.0176  269 TRP A CA    
2103 C C     . TRP A 269 ? 0.2962 0.2859 0.2741 -0.0232 -0.0067 0.0160  269 TRP A C     
2104 O O     . TRP A 269 ? 0.2813 0.2739 0.2623 -0.0255 -0.0083 0.0138  269 TRP A O     
2105 C CB    . TRP A 269 ? 0.2533 0.2651 0.2471 -0.0224 -0.0035 0.0182  269 TRP A CB    
2106 C CG    . TRP A 269 ? 0.2420 0.2661 0.2449 -0.0212 -0.0070 0.0171  269 TRP A CG    
2107 C CD1   . TRP A 269 ? 0.2372 0.2713 0.2496 -0.0238 -0.0086 0.0160  269 TRP A CD1   
2108 C CD2   . TRP A 269 ? 0.2317 0.2570 0.2328 -0.0173 -0.0096 0.0163  269 TRP A CD2   
2109 N NE1   . TRP A 269 ? 0.2289 0.2662 0.2408 -0.0214 -0.0132 0.0159  269 TRP A NE1   
2110 C CE2   . TRP A 269 ? 0.2265 0.2584 0.2310 -0.0185 -0.0122 0.0161  269 TRP A CE2   
2111 C CE3   . TRP A 269 ? 0.2412 0.2622 0.2384 -0.0130 -0.0102 0.0144  269 TRP A CE3   
2112 C CZ2   . TRP A 269 ? 0.2348 0.2660 0.2346 -0.0176 -0.0131 0.0149  269 TRP A CZ2   
2113 C CZ3   . TRP A 269 ? 0.2375 0.2629 0.2359 -0.0121 -0.0104 0.0115  269 TRP A CZ3   
2114 C CH2   . TRP A 269 ? 0.2373 0.2663 0.2349 -0.0154 -0.0108 0.0123  269 TRP A CH2   
2115 N N     . CYS A 270 ? 0.3125 0.2909 0.2811 -0.0169 -0.0097 0.0160  270 CYS A N     
2116 C CA    . CYS A 270 ? 0.3166 0.2856 0.2803 -0.0116 -0.0151 0.0124  270 CYS A CA    
2117 C C     . CYS A 270 ? 0.3275 0.2800 0.2800 -0.0156 -0.0152 0.0123  270 CYS A C     
2118 O O     . CYS A 270 ? 0.3067 0.2585 0.2611 -0.0141 -0.0180 0.0085  270 CYS A O     
2119 C CB    . CYS A 270 ? 0.3371 0.2960 0.2937 -0.0030 -0.0204 0.0112  270 CYS A CB    
2120 S SG    . CYS A 270 ? 0.3560 0.3360 0.3288 0.0017  -0.0206 0.0084  270 CYS A SG    
2121 N N     . LYS A 271 ? 0.3448 0.2836 0.2850 -0.0218 -0.0110 0.0157  271 LYS A N     
2122 C CA    . LYS A 271 ? 0.3909 0.3127 0.3190 -0.0282 -0.0092 0.0156  271 LYS A CA    
2123 C C     . LYS A 271 ? 0.3588 0.2959 0.3007 -0.0353 -0.0062 0.0133  271 LYS A C     
2124 O O     . LYS A 271 ? 0.3723 0.3001 0.3089 -0.0371 -0.0077 0.0112  271 LYS A O     
2125 C CB    . LYS A 271 ? 0.4469 0.3482 0.3560 -0.0362 -0.0027 0.0189  271 LYS A CB    
2126 C CG    . LYS A 271 ? 0.5100 0.3806 0.3927 -0.0299 -0.0085 0.0210  271 LYS A CG    
2127 C CD    . LYS A 271 ? 0.5815 0.4270 0.4395 -0.0402 -0.0004 0.0243  271 LYS A CD    
2128 C CE    . LYS A 271 ? 0.6160 0.4655 0.4724 -0.0393 0.0026  0.0265  271 LYS A CE    
2129 N NZ    . LYS A 271 ? 0.6833 0.5051 0.5150 -0.0287 -0.0082 0.0284  271 LYS A NZ    
2130 N N     . ILE A 272 ? 0.3210 0.2798 0.2794 -0.0388 -0.0030 0.0131  272 ILE A N     
2131 C CA    . ILE A 272 ? 0.2949 0.2688 0.2666 -0.0433 -0.0035 0.0102  272 ILE A CA    
2132 C C     . ILE A 272 ? 0.2962 0.2723 0.2687 -0.0378 -0.0091 0.0079  272 ILE A C     
2133 O O     . ILE A 272 ? 0.2832 0.2567 0.2546 -0.0410 -0.0102 0.0054  272 ILE A O     
2134 C CB    . ILE A 272 ? 0.2705 0.2656 0.2589 -0.0444 -0.0026 0.0098  272 ILE A CB    
2135 C CG1   . ILE A 272 ? 0.2749 0.2701 0.2659 -0.0518 0.0049  0.0090  272 ILE A CG1   
2136 C CG2   . ILE A 272 ? 0.2642 0.2724 0.2639 -0.0468 -0.0067 0.0064  272 ILE A CG2   
2137 C CD1   . ILE A 272 ? 0.2570 0.2722 0.2659 -0.0517 0.0059  0.0072  272 ILE A CD1   
2138 N N     . ALA A 273 ? 0.3079 0.2883 0.2821 -0.0303 -0.0116 0.0080  273 ALA A N     
2139 C CA    . ALA A 273 ? 0.3118 0.2951 0.2875 -0.0266 -0.0144 0.0039  273 ALA A CA    
2140 C C     . ALA A 273 ? 0.3236 0.2924 0.2915 -0.0249 -0.0163 0.0004  273 ALA A C     
2141 O O     . ALA A 273 ? 0.3071 0.2777 0.2762 -0.0256 -0.0170 -0.0039 273 ALA A O     
2142 C CB    . ALA A 273 ? 0.3090 0.2986 0.2887 -0.0199 -0.0151 0.0026  273 ALA A CB    
2143 N N     . LEU A 274 ? 0.3654 0.3171 0.3228 -0.0225 -0.0176 0.0019  274 LEU A N     
2144 C CA    . LEU A 274 ? 0.3901 0.3229 0.3370 -0.0196 -0.0213 -0.0013 274 LEU A CA    
2145 C C     . LEU A 274 ? 0.3704 0.2976 0.3132 -0.0282 -0.0189 -0.0016 274 LEU A C     
2146 O O     . LEU A 274 ? 0.3425 0.2655 0.2845 -0.0271 -0.0210 -0.0063 274 LEU A O     
2147 C CB    . LEU A 274 ? 0.4656 0.3755 0.3961 -0.0158 -0.0244 0.0013  274 LEU A CB    
2148 C CG    . LEU A 274 ? 0.5545 0.4535 0.4820 -0.0036 -0.0332 -0.0041 274 LEU A CG    
2149 C CD1   . LEU A 274 ? 0.5726 0.4951 0.5193 0.0027  -0.0341 -0.0090 274 LEU A CD1   
2150 C CD2   . LEU A 274 ? 0.5903 0.4621 0.4962 0.0005  -0.0382 -0.0002 274 LEU A CD2   
2151 N N     . ILE A 275 ? 0.3588 0.2868 0.3004 -0.0373 -0.0140 0.0022  275 ILE A N     
2152 C CA    . ILE A 275 ? 0.3570 0.2832 0.2982 -0.0469 -0.0112 0.0006  275 ILE A CA    
2153 C C     . ILE A 275 ? 0.3460 0.2903 0.2995 -0.0471 -0.0134 -0.0028 275 ILE A C     
2154 O O     . ILE A 275 ? 0.3625 0.3020 0.3133 -0.0507 -0.0142 -0.0062 275 ILE A O     
2155 C CB    . ILE A 275 ? 0.3516 0.2826 0.2963 -0.0567 -0.0048 0.0026  275 ILE A CB    
2156 C CG1   . ILE A 275 ? 0.3822 0.2886 0.3077 -0.0597 -0.0006 0.0056  275 ILE A CG1   
2157 C CG2   . ILE A 275 ? 0.3576 0.2946 0.3091 -0.0666 -0.0026 -0.0012 275 ILE A CG2   
2158 C CD1   . ILE A 275 ? 0.3699 0.2836 0.2994 -0.0651 0.0062  0.0075  275 ILE A CD1   
2159 N N     . MET A 276 ? 0.3205 0.2822 0.2841 -0.0436 -0.0144 -0.0021 276 MET A N     
2160 C CA    . MET A 276 ? 0.3255 0.2986 0.2941 -0.0444 -0.0166 -0.0050 276 MET A CA    
2161 C C     . MET A 276 ? 0.3319 0.2999 0.2960 -0.0401 -0.0174 -0.0099 276 MET A C     
2162 O O     . MET A 276 ? 0.3326 0.3001 0.2940 -0.0438 -0.0181 -0.0135 276 MET A O     
2163 C CB    . MET A 276 ? 0.3002 0.2884 0.2763 -0.0430 -0.0176 -0.0027 276 MET A CB    
2164 C CG    . MET A 276 ? 0.2919 0.2895 0.2769 -0.0478 -0.0182 -0.0011 276 MET A CG    
2165 S SD    . MET A 276 ? 0.2849 0.2965 0.2775 -0.0439 -0.0211 0.0013  276 MET A SD    
2166 C CE    . MET A 276 ? 0.2938 0.3042 0.2782 -0.0446 -0.0269 -0.0010 276 MET A CE    
2167 N N     . GLN A 277 ? 0.3471 0.3117 0.3113 -0.0328 -0.0175 -0.0115 277 GLN A N     
2168 C CA    . GLN A 277 ? 0.3908 0.3517 0.3548 -0.0281 -0.0179 -0.0191 277 GLN A CA    
2169 C C     . GLN A 277 ? 0.4162 0.3624 0.3729 -0.0297 -0.0194 -0.0225 277 GLN A C     
2170 O O     . GLN A 277 ? 0.4634 0.4100 0.4202 -0.0303 -0.0185 -0.0292 277 GLN A O     
2171 C CB    . GLN A 277 ? 0.4196 0.3781 0.3872 -0.0187 -0.0200 -0.0216 277 GLN A CB    
2172 C CG    . GLN A 277 ? 0.4494 0.4065 0.4223 -0.0118 -0.0215 -0.0324 277 GLN A CG    
2173 C CD    . GLN A 277 ? 0.5027 0.4575 0.4802 -0.0014 -0.0265 -0.0346 277 GLN A CD    
2174 O OE1   . GLN A 277 ? 0.5012 0.4675 0.4853 -0.0002 -0.0250 -0.0330 277 GLN A OE1   
2175 N NE2   . GLN A 277 ? 0.5697 0.5068 0.5412 0.0060  -0.0336 -0.0374 277 GLN A NE2   
2176 N N     . ASN A 278 ? 0.4326 0.3644 0.3813 -0.0314 -0.0208 -0.0184 278 ASN A N     
2177 C CA    . ASN A 278 ? 0.4848 0.3996 0.4238 -0.0351 -0.0217 -0.0204 278 ASN A CA    
2178 C C     . ASN A 278 ? 0.4603 0.3807 0.3999 -0.0455 -0.0196 -0.0205 278 ASN A C     
2179 O O     . ASN A 278 ? 0.4318 0.3391 0.3639 -0.0493 -0.0199 -0.0229 278 ASN A O     
2180 C CB    . ASN A 278 ? 0.5220 0.4142 0.4471 -0.0352 -0.0229 -0.0159 278 ASN A CB    
2181 C CG    . ASN A 278 ? 0.5757 0.4562 0.4961 -0.0230 -0.0285 -0.0171 278 ASN A CG    
2182 O OD1   . ASN A 278 ? 0.5921 0.4701 0.5161 -0.0141 -0.0332 -0.0246 278 ASN A OD1   
2183 N ND2   . ASN A 278 ? 0.6056 0.4792 0.5189 -0.0224 -0.0285 -0.0112 278 ASN A ND2   
2184 N N     . LYS A 279 ? 0.4409 0.3794 0.3887 -0.0494 -0.0187 -0.0185 279 LYS A N     
2185 C CA    . LYS A 279 ? 0.4388 0.3832 0.3881 -0.0580 -0.0195 -0.0194 279 LYS A CA    
2186 C C     . LYS A 279 ? 0.4236 0.3638 0.3738 -0.0658 -0.0178 -0.0177 279 LYS A C     
2187 O O     . LYS A 279 ? 0.3982 0.3426 0.3514 -0.0732 -0.0191 -0.0206 279 LYS A O     
2188 C CB    . LYS A 279 ? 0.4671 0.4050 0.4101 -0.0600 -0.0205 -0.0255 279 LYS A CB    
2189 C CG    . LYS A 279 ? 0.5138 0.4540 0.4552 -0.0546 -0.0194 -0.0301 279 LYS A CG    
2190 C CD    . LYS A 279 ? 0.5376 0.4901 0.4795 -0.0561 -0.0195 -0.0293 279 LYS A CD    
2191 C CE    . LYS A 279 ? 0.5673 0.5253 0.5128 -0.0499 -0.0161 -0.0307 279 LYS A CE    
2192 N NZ    . LYS A 279 ? 0.5787 0.5429 0.5184 -0.0535 -0.0155 -0.0301 279 LYS A NZ    
2193 N N     . ASN A 280 ? 0.4057 0.3378 0.3529 -0.0651 -0.0148 -0.0139 280 ASN A N     
2194 C CA    . ASN A 280 ? 0.4136 0.3387 0.3590 -0.0750 -0.0104 -0.0138 280 ASN A CA    
2195 C C     . ASN A 280 ? 0.3812 0.3278 0.3433 -0.0804 -0.0089 -0.0141 280 ASN A C     
2196 O O     . ASN A 280 ? 0.3866 0.3350 0.3539 -0.0903 -0.0052 -0.0174 280 ASN A O     
2197 C CB    . ASN A 280 ? 0.4375 0.3395 0.3671 -0.0742 -0.0070 -0.0103 280 ASN A CB    
2198 C CG    . ASN A 280 ? 0.4761 0.3515 0.3879 -0.0714 -0.0095 -0.0121 280 ASN A CG    
2199 O OD1   . ASN A 280 ? 0.5088 0.3687 0.4098 -0.0617 -0.0132 -0.0107 280 ASN A OD1   
2200 N ND2   . ASN A 280 ? 0.4925 0.3613 0.4012 -0.0795 -0.0083 -0.0159 280 ASN A ND2   
2201 N N     . HIS A 281 ? 0.3491 0.3124 0.3208 -0.0740 -0.0121 -0.0121 281 HIS A N     
2202 C CA    . HIS A 281 ? 0.3311 0.3159 0.3207 -0.0771 -0.0141 -0.0143 281 HIS A CA    
2203 C C     . HIS A 281 ? 0.3348 0.3289 0.3332 -0.0829 -0.0191 -0.0205 281 HIS A C     
2204 O O     . HIS A 281 ? 0.3238 0.3350 0.3397 -0.0860 -0.0214 -0.0247 281 HIS A O     
2205 C CB    . HIS A 281 ? 0.3105 0.3072 0.3047 -0.0686 -0.0185 -0.0111 281 HIS A CB    
2206 C CG    . HIS A 281 ? 0.3064 0.3006 0.2921 -0.0636 -0.0237 -0.0111 281 HIS A CG    
2207 N ND1   . HIS A 281 ? 0.3099 0.2909 0.2836 -0.0610 -0.0219 -0.0114 281 HIS A ND1   
2208 C CD2   . HIS A 281 ? 0.3024 0.3041 0.2885 -0.0612 -0.0301 -0.0116 281 HIS A CD2   
2209 C CE1   . HIS A 281 ? 0.3158 0.2982 0.2842 -0.0588 -0.0251 -0.0129 281 HIS A CE1   
2210 N NE2   . HIS A 281 ? 0.3049 0.2974 0.2778 -0.0594 -0.0302 -0.0124 281 HIS A NE2   
2211 N N     . LEU A 282 ? 0.3460 0.3291 0.3336 -0.0840 -0.0214 -0.0224 282 LEU A N     
2212 C CA    . LEU A 282 ? 0.3449 0.3341 0.3378 -0.0893 -0.0272 -0.0286 282 LEU A CA    
2213 C C     . LEU A 282 ? 0.3592 0.3420 0.3540 -0.1003 -0.0222 -0.0337 282 LEU A C     
2214 O O     . LEU A 282 ? 0.3595 0.3442 0.3565 -0.1050 -0.0268 -0.0395 282 LEU A O     
2215 C CB    . LEU A 282 ? 0.3487 0.3299 0.3273 -0.0852 -0.0327 -0.0287 282 LEU A CB    
2216 C CG    . LEU A 282 ? 0.3409 0.3256 0.3143 -0.0769 -0.0361 -0.0248 282 LEU A CG    
2217 C CD1   . LEU A 282 ? 0.3520 0.3252 0.3090 -0.0753 -0.0365 -0.0262 282 LEU A CD1   
2218 C CD2   . LEU A 282 ? 0.3387 0.3368 0.3205 -0.0755 -0.0449 -0.0257 282 LEU A CD2   
2219 N N     . THR A 283 ? 0.3699 0.3420 0.3605 -0.1047 -0.0126 -0.0317 283 THR A N     
2220 C CA    . THR A 283 ? 0.3788 0.3407 0.3677 -0.1175 -0.0049 -0.0365 283 THR A CA    
2221 C C     . THR A 283 ? 0.3654 0.3411 0.3707 -0.1246 0.0023  -0.0397 283 THR A C     
2222 O O     . THR A 283 ? 0.3492 0.3309 0.3572 -0.1182 0.0034  -0.0350 283 THR A O     
2223 C CB    . THR A 283 ? 0.4013 0.3308 0.3638 -0.1175 0.0007  -0.0315 283 THR A CB    
2224 O OG1   . THR A 283 ? 0.3937 0.3152 0.3485 -0.1134 0.0054  -0.0253 283 THR A OG1   
2225 C CG2   . THR A 283 ? 0.3921 0.3106 0.3418 -0.1078 -0.0060 -0.0296 283 THR A CG2   
2226 N N     . PRO A 284 ? 0.3693 0.3494 0.3854 -0.1387 0.0087  -0.0486 284 PRO A N     
2227 C CA    . PRO A 284 ? 0.3667 0.3595 0.3990 -0.1476 0.0189  -0.0539 284 PRO A CA    
2228 C C     . PRO A 284 ? 0.3746 0.3459 0.3860 -0.1481 0.0296  -0.0459 284 PRO A C     
2229 O O     . PRO A 284 ? 0.3592 0.3433 0.3816 -0.1468 0.0335  -0.0460 284 PRO A O     
2230 C CB    . PRO A 284 ? 0.3831 0.3780 0.4255 -0.1649 0.0264  -0.0658 284 PRO A CB    
2231 C CG    . PRO A 284 ? 0.3877 0.3788 0.4258 -0.1629 0.0160  -0.0675 284 PRO A CG    
2232 C CD    . PRO A 284 ? 0.3873 0.3579 0.3993 -0.1489 0.0095  -0.0550 284 PRO A CD    
2233 N N     . GLU A 285 ? 0.3972 0.3347 0.3776 -0.1486 0.0325  -0.0393 285 GLU A N     
2234 C CA    . GLU A 285 ? 0.4209 0.3326 0.3768 -0.1495 0.0407  -0.0324 285 GLU A CA    
2235 C C     . GLU A 285 ? 0.3897 0.3092 0.3465 -0.1335 0.0336  -0.0246 285 GLU A C     
2236 O O     . GLU A 285 ? 0.3768 0.2978 0.3333 -0.1341 0.0397  -0.0227 285 GLU A O     
2237 C CB    . GLU A 285 ? 0.4675 0.3384 0.3887 -0.1514 0.0416  -0.0279 285 GLU A CB    
2238 C CG    . GLU A 285 ? 0.5173 0.3757 0.4337 -0.1690 0.0499  -0.0357 285 GLU A CG    
2239 C CD    . GLU A 285 ? 0.5269 0.3964 0.4553 -0.1675 0.0408  -0.0408 285 GLU A CD    
2240 O OE1   . GLU A 285 ? 0.4960 0.3835 0.4363 -0.1531 0.0281  -0.0387 285 GLU A OE1   
2241 O OE2   . GLU A 285 ? 0.5502 0.4090 0.4746 -0.1826 0.0479  -0.0476 285 GLU A OE2   
2242 N N     . GLY A 286 ? 0.3717 0.2975 0.3308 -0.1205 0.0217  -0.0215 286 GLY A N     
2243 C CA    . GLY A 286 ? 0.3519 0.2853 0.3124 -0.1059 0.0149  -0.0152 286 GLY A CA    
2244 C C     . GLY A 286 ? 0.3226 0.2855 0.3080 -0.1053 0.0151  -0.0178 286 GLY A C     
2245 O O     . GLY A 286 ? 0.3266 0.2909 0.3109 -0.1011 0.0173  -0.0141 286 GLY A O     
2246 N N     . LEU A 287 ? 0.3109 0.2969 0.3189 -0.1091 0.0116  -0.0252 287 LEU A N     
2247 C CA    . LEU A 287 ? 0.2815 0.2953 0.3154 -0.1079 0.0101  -0.0298 287 LEU A CA    
2248 C C     . LEU A 287 ? 0.2867 0.2991 0.3227 -0.1163 0.0233  -0.0318 287 LEU A C     
2249 O O     . LEU A 287 ? 0.2751 0.2979 0.3188 -0.1111 0.0238  -0.0302 287 LEU A O     
2250 C CB    . LEU A 287 ? 0.2766 0.3110 0.3335 -0.1128 0.0046  -0.0401 287 LEU A CB    
2251 C CG    . LEU A 287 ? 0.2625 0.3257 0.3480 -0.1086 -0.0012 -0.0466 287 LEU A CG    
2252 C CD1   . LEU A 287 ? 0.2454 0.3111 0.3260 -0.0939 -0.0118 -0.0389 287 LEU A CD1   
2253 C CD2   . LEU A 287 ? 0.2634 0.3429 0.3688 -0.1128 -0.0090 -0.0577 287 LEU A CD2   
2254 N N     . ASN A 288 ? 0.3047 0.3018 0.3312 -0.1303 0.0348  -0.0356 288 ASN A N     
2255 C CA    . ASN A 288 ? 0.3195 0.3120 0.3440 -0.1409 0.0496  -0.0385 288 ASN A CA    
2256 C C     . ASN A 288 ? 0.3389 0.3094 0.3377 -0.1346 0.0521  -0.0281 288 ASN A C     
2257 O O     . ASN A 288 ? 0.3233 0.3010 0.3280 -0.1361 0.0587  -0.0293 288 ASN A O     
2258 C CB    . ASN A 288 ? 0.3343 0.3138 0.3530 -0.1606 0.0632  -0.0466 288 ASN A CB    
2259 C CG    . ASN A 288 ? 0.3193 0.3331 0.3768 -0.1686 0.0639  -0.0619 288 ASN A CG    
2260 O OD1   . ASN A 288 ? 0.3004 0.3445 0.3875 -0.1636 0.0608  -0.0680 288 ASN A OD1   
2261 N ND2   . ASN A 288 ? 0.3260 0.3362 0.3850 -0.1793 0.0661  -0.0687 288 ASN A ND2   
2262 N N     . GLU A 289 ? 0.3740 0.3189 0.3461 -0.1263 0.0454  -0.0188 289 GLU A N     
2263 C CA    . GLU A 289 ? 0.3957 0.3226 0.3466 -0.1174 0.0441  -0.0100 289 GLU A CA    
2264 C C     . GLU A 289 ? 0.3495 0.3010 0.3190 -0.1059 0.0384  -0.0081 289 GLU A C     
2265 O O     . GLU A 289 ? 0.3470 0.2941 0.3097 -0.1043 0.0427  -0.0051 289 GLU A O     
2266 C CB    . GLU A 289 ? 0.4474 0.3497 0.3750 -0.1076 0.0347  -0.0034 289 GLU A CB    
2267 C CG    . GLU A 289 ? 0.5392 0.4027 0.4347 -0.1161 0.0398  -0.0021 289 GLU A CG    
2268 C CD    . GLU A 289 ? 0.6097 0.4498 0.4848 -0.1029 0.0279  0.0030  289 GLU A CD    
2269 O OE1   . GLU A 289 ? 0.6931 0.5211 0.5614 -0.1062 0.0262  0.0007  289 GLU A OE1   
2270 O OE2   . GLU A 289 ? 0.6020 0.4378 0.4706 -0.0896 0.0204  0.0077  289 GLU A OE2   
2271 N N     . ILE A 290 ? 0.3146 0.2883 0.3036 -0.0980 0.0282  -0.0095 290 ILE A N     
2272 C CA    . ILE A 290 ? 0.2861 0.2813 0.2915 -0.0878 0.0218  -0.0081 290 ILE A CA    
2273 C C     . ILE A 290 ? 0.2825 0.2983 0.3099 -0.0936 0.0285  -0.0149 290 ILE A C     
2274 O O     . ILE A 290 ? 0.2677 0.2888 0.2976 -0.0885 0.0298  -0.0125 290 ILE A O     
2275 C CB    . ILE A 290 ? 0.2707 0.2804 0.2877 -0.0805 0.0102  -0.0090 290 ILE A CB    
2276 C CG1   . ILE A 290 ? 0.2743 0.2662 0.2720 -0.0741 0.0049  -0.0039 290 ILE A CG1   
2277 C CG2   . ILE A 290 ? 0.2512 0.2810 0.2838 -0.0719 0.0041  -0.0085 290 ILE A CG2   
2278 C CD1   . ILE A 290 ? 0.2664 0.2679 0.2705 -0.0701 -0.0040 -0.0058 290 ILE A CD1   
2279 N N     . ARG A 291 ? 0.2861 0.3137 0.3302 -0.1042 0.0331  -0.0244 291 ARG A N     
2280 C CA    . ARG A 291 ? 0.2978 0.3449 0.3643 -0.1106 0.0413  -0.0333 291 ARG A CA    
2281 C C     . ARG A 291 ? 0.3171 0.3474 0.3663 -0.1171 0.0551  -0.0308 291 ARG A C     
2282 O O     . ARG A 291 ? 0.3039 0.3485 0.3666 -0.1149 0.0583  -0.0336 291 ARG A O     
2283 C CB    . ARG A 291 ? 0.3137 0.3743 0.4005 -0.1237 0.0471  -0.0462 291 ARG A CB    
2284 C CG    . ARG A 291 ? 0.3180 0.3973 0.4249 -0.1184 0.0331  -0.0512 291 ARG A CG    
2285 C CD    . ARG A 291 ? 0.3341 0.4415 0.4768 -0.1269 0.0355  -0.0681 291 ARG A CD    
2286 N NE    . ARG A 291 ? 0.3623 0.4697 0.5085 -0.1340 0.0326  -0.0739 291 ARG A NE    
2287 C CZ    . ARG A 291 ? 0.3777 0.5039 0.5447 -0.1290 0.0182  -0.0812 291 ARG A CZ    
2288 N NH1   . ARG A 291 ? 0.3833 0.5277 0.5672 -0.1152 0.0032  -0.0825 291 ARG A NH1   
2289 N NH2   . ARG A 291 ? 0.3955 0.5194 0.5638 -0.1383 0.0182  -0.0873 291 ARG A NH2   
2290 N N     . ALA A 292 ? 0.3472 0.3453 0.3647 -0.1249 0.0628  -0.0260 292 ALA A N     
2291 C CA    . ALA A 292 ? 0.3832 0.3602 0.3783 -0.1316 0.0754  -0.0235 292 ALA A CA    
2292 C C     . ALA A 292 ? 0.4030 0.3749 0.3871 -0.1171 0.0679  -0.0140 292 ALA A C     
2293 O O     . ALA A 292 ? 0.4411 0.4166 0.4267 -0.1185 0.0751  -0.0152 292 ALA A O     
2294 C CB    . ALA A 292 ? 0.4096 0.3483 0.3691 -0.1429 0.0836  -0.0206 292 ALA A CB    
2295 N N     . LEU A 293 ? 0.4044 0.3711 0.3808 -0.1035 0.0540  -0.0061 293 LEU A N     
2296 C CA    . LEU A 293 ? 0.4083 0.3697 0.3745 -0.0908 0.0473  0.0014  293 LEU A CA    
2297 C C     . LEU A 293 ? 0.3978 0.3876 0.3899 -0.0858 0.0466  -0.0016 293 LEU A C     
2298 O O     . LEU A 293 ? 0.4220 0.4085 0.4079 -0.0833 0.0499  0.0006  293 LEU A O     
2299 C CB    . LEU A 293 ? 0.3964 0.3545 0.3580 -0.0780 0.0334  0.0068  293 LEU A CB    
2300 C CG    . LEU A 293 ? 0.4149 0.3401 0.3468 -0.0777 0.0310  0.0109  293 LEU A CG    
2301 C CD1   . LEU A 293 ? 0.4036 0.3324 0.3401 -0.0694 0.0202  0.0113  293 LEU A CD1   
2302 C CD2   . LEU A 293 ? 0.4212 0.3231 0.3285 -0.0723 0.0299  0.0163  293 LEU A CD2   
2303 N N     . LYS A 294 ? 0.3879 0.4030 0.4068 -0.0840 0.0409  -0.0068 294 LYS A N     
2304 C CA    . LYS A 294 ? 0.3821 0.4247 0.4281 -0.0781 0.0367  -0.0111 294 LYS A CA    
2305 C C     . LYS A 294 ? 0.3996 0.4528 0.4592 -0.0862 0.0486  -0.0191 294 LYS A C     
2306 O O     . LYS A 294 ? 0.4103 0.4720 0.4769 -0.0807 0.0488  -0.0190 294 LYS A O     
2307 C CB    . LYS A 294 ? 0.3797 0.4404 0.4466 -0.0773 0.0285  -0.0169 294 LYS A CB    
2308 C CG    . LYS A 294 ? 0.3838 0.4622 0.4669 -0.0660 0.0168  -0.0171 294 LYS A CG    
2309 C CD    . LYS A 294 ? 0.3794 0.4682 0.4747 -0.0650 0.0065  -0.0217 294 LYS A CD    
2310 C CE    . LYS A 294 ? 0.3915 0.5041 0.5176 -0.0679 0.0054  -0.0342 294 LYS A CE    
2311 N NZ    . LYS A 294 ? 0.3944 0.5198 0.5334 -0.0564 -0.0048 -0.0351 294 LYS A NZ    
2312 N N     . GLY A 295 ? 0.4100 0.4621 0.4730 -0.1003 0.0599  -0.0271 295 GLY A N     
2313 C CA    . GLY A 295 ? 0.4525 0.5147 0.5287 -0.1100 0.0739  -0.0367 295 GLY A CA    
2314 C C     . GLY A 295 ? 0.4793 0.5222 0.5312 -0.1095 0.0811  -0.0301 295 GLY A C     
2315 O O     . GLY A 295 ? 0.5089 0.5661 0.5755 -0.1090 0.0865  -0.0356 295 GLY A O     
2316 N N     . GLY A 296 ? 0.5066 0.5166 0.5215 -0.1087 0.0799  -0.0193 296 GLY A N     
2317 C CA    . GLY A 296 ? 0.5182 0.5046 0.5045 -0.1075 0.0840  -0.0124 296 GLY A CA    
2318 C C     . GLY A 296 ? 0.5071 0.5035 0.4992 -0.0922 0.0739  -0.0070 296 GLY A C     
2319 O O     . GLY A 296 ? 0.4878 0.4674 0.4591 -0.0910 0.0770  -0.0027 296 GLY A O     
2320 N N     . MET A 297 ? 0.4955 0.5162 0.5127 -0.0813 0.0618  -0.0073 297 MET A N     
2321 C CA    . MET A 297 ? 0.5269 0.5514 0.5439 -0.0678 0.0518  -0.0011 297 MET A CA    
2322 C C     . MET A 297 ? 0.5602 0.6021 0.5954 -0.0675 0.0575  -0.0070 297 MET A C     
2323 O O     . MET A 297 ? 0.5618 0.6173 0.6151 -0.0762 0.0667  -0.0169 297 MET A O     
2324 C CB    . MET A 297 ? 0.5303 0.5665 0.5588 -0.0578 0.0377  0.0015  297 MET A CB    
2325 C CG    . MET A 297 ? 0.5397 0.5562 0.5467 -0.0546 0.0315  0.0082  297 MET A CG    
2326 S SD    . MET A 297 ? 0.5352 0.5639 0.5544 -0.0485 0.0194  0.0084  297 MET A SD    
2327 C CE    . MET A 297 ? 0.4668 0.5050 0.4913 -0.0368 0.0114  0.0119  297 MET A CE    
2328 N N     . ASN A 298 ? 0.5786 0.6185 0.6081 -0.0588 0.0536  -0.0023 298 ASN A N     
2329 C CA    . ASN A 298 ? 0.6223 0.6773 0.6681 -0.0574 0.0582  -0.0078 298 ASN A CA    
2330 C C     . ASN A 298 ? 0.6399 0.6904 0.6823 -0.0706 0.0755  -0.0152 298 ASN A C     
2331 O O     . ASN A 298 ? 0.6816 0.7533 0.7499 -0.0726 0.0811  -0.0254 298 ASN A O     
2332 C CB    . ASN A 298 ? 0.6835 0.7671 0.7640 -0.0521 0.0512  -0.0153 298 ASN A CB    
2333 C CG    . ASN A 298 ? 0.8001 0.8866 0.8821 -0.0406 0.0352  -0.0090 298 ASN A CG    
2334 O OD1   . ASN A 298 ? 0.8447 0.9223 0.9158 -0.0405 0.0299  -0.0042 298 ASN A OD1   
2335 N ND2   . ASN A 298 ? 0.8582 0.9556 0.9526 -0.0313 0.0279  -0.0098 298 ASN A ND2   
2336 N N     . LYS A 299 ? 0.6262 0.6486 0.6372 -0.0801 0.0841  -0.0117 299 LYS A N     
2337 C CA    . LYS A 299 ? 0.6460 0.6584 0.6469 -0.0953 0.1031  -0.0189 299 LYS A CA    
2338 C C     . LYS A 299 ? 0.7218 0.7046 0.6860 -0.0966 0.1080  -0.0127 299 LYS A C     
2339 O O     . LYS A 299 ? 0.7606 0.7250 0.7047 -0.1109 0.1241  -0.0169 299 LYS A O     
2340 C CB    . LYS A 299 ? 0.6431 0.6405 0.6312 -0.1101 0.1125  -0.0218 299 LYS A CB    
2341 C CG    . LYS A 299 ? 0.5787 0.6030 0.6010 -0.1132 0.1110  -0.0307 299 LYS A CG    
2342 C CD    . LYS A 299 ? 0.5365 0.5948 0.5989 -0.1166 0.1189  -0.0459 299 LYS A CD    
2343 C CE    . LYS A 299 ? 0.5046 0.5902 0.6022 -0.1172 0.1137  -0.0556 299 LYS A CE    
2344 N NZ    . LYS A 299 ? 0.4732 0.5670 0.5785 -0.1007 0.0923  -0.0474 299 LYS A NZ    
2345 N N     . GLY A 300 ? 0.7439 0.7209 0.6983 -0.0828 0.0947  -0.0038 300 GLY A N     
2346 C CA    . GLY A 300 ? 0.7775 0.7194 0.6905 -0.0819 0.0933  0.0040  300 GLY A CA    
2347 C C     . GLY A 300 ? 0.8122 0.7234 0.6946 -0.0858 0.0901  0.0097  300 GLY A C     
2348 O O     . GLY A 300 ? 0.8342 0.7095 0.6770 -0.0871 0.0890  0.0151  300 GLY A O     
2349 O "O5'" . DC  B 1   ? 0.4813 0.4496 0.4203 -0.1458 -0.0364 -0.0204 1   DC  B "O5'" 
2350 C "C5'" . DC  B 1   ? 0.4275 0.4213 0.3891 -0.1273 -0.0502 -0.0173 1   DC  B "C5'" 
2351 C "C4'" . DC  B 1   ? 0.4146 0.3840 0.3659 -0.1115 -0.0568 -0.0043 1   DC  B "C4'" 
2352 O "O4'" . DC  B 1   ? 0.3922 0.3790 0.3592 -0.0982 -0.0668 -0.0029 1   DC  B "O4'" 
2353 C "C3'" . DC  B 1   ? 0.4072 0.3712 0.3548 -0.1060 -0.0556 0.0000  1   DC  B "C3'" 
2354 O "O3'" . DC  B 1   ? 0.4129 0.3402 0.3369 -0.0994 -0.0567 0.0074  1   DC  B "O3'" 
2355 C "C2'" . DC  B 1   ? 0.3771 0.3657 0.3456 -0.0914 -0.0647 0.0013  1   DC  B "C2'" 
2356 C "C1'" . DC  B 1   ? 0.3721 0.3603 0.3436 -0.0857 -0.0709 0.0023  1   DC  B "C1'" 
2357 N N1    . DC  B 1   ? 0.3429 0.3512 0.3263 -0.0763 -0.0779 0.0001  1   DC  B N1    
2358 C C2    . DC  B 1   ? 0.3305 0.3274 0.3103 -0.0658 -0.0815 0.0051  1   DC  B C2    
2359 O O2    . DC  B 1   ? 0.3340 0.3139 0.3091 -0.0642 -0.0793 0.0088  1   DC  B O2    
2360 N N3    . DC  B 1   ? 0.3323 0.3353 0.3113 -0.0571 -0.0869 0.0038  1   DC  B N3    
2361 C C4    . DC  B 1   ? 0.3329 0.3568 0.3173 -0.0548 -0.0925 -0.0032 1   DC  B C4    
2362 N N4    . DC  B 1   ? 0.3370 0.3589 0.3123 -0.0421 -0.1003 -0.0046 1   DC  B N4    
2363 C C5    . DC  B 1   ? 0.3330 0.3788 0.3298 -0.0653 -0.0899 -0.0117 1   DC  B C5    
2364 C C6    . DC  B 1   ? 0.3437 0.3784 0.3379 -0.0780 -0.0808 -0.0092 1   DC  B C6    
2365 P P     . DG  B 2   ? 0.4178 0.3247 0.3232 -0.0970 -0.0536 0.0108  2   DG  B P     
2366 O OP1   . DG  B 2   ? 0.4508 0.3127 0.3224 -0.0912 -0.0557 0.0148  2   DG  B OP1   
2367 O OP2   . DG  B 2   ? 0.4124 0.3326 0.3198 -0.1126 -0.0424 0.0046  2   DG  B OP2   
2368 O "O5'" . DG  B 2   ? 0.3800 0.3064 0.3067 -0.0797 -0.0633 0.0139  2   DG  B "O5'" 
2369 C "C5'" . DG  B 2   ? 0.3728 0.2897 0.3001 -0.0658 -0.0718 0.0156  2   DG  B "C5'" 
2370 C "C4'" . DG  B 2   ? 0.3443 0.2861 0.2955 -0.0568 -0.0759 0.0151  2   DG  B "C4'" 
2371 O "O4'" . DG  B 2   ? 0.3260 0.2895 0.2915 -0.0616 -0.0749 0.0137  2   DG  B "O4'" 
2372 C "C3'" . DG  B 2   ? 0.3392 0.2894 0.2946 -0.0526 -0.0756 0.0165  2   DG  B "C3'" 
2373 O "O3'" . DG  B 2   ? 0.3498 0.2855 0.2983 -0.0412 -0.0809 0.0156  2   DG  B "O3'" 
2374 C "C2'" . DG  B 2   ? 0.3178 0.2930 0.2931 -0.0500 -0.0764 0.0156  2   DG  B "C2'" 
2375 C "C1'" . DG  B 2   ? 0.3211 0.2982 0.2987 -0.0534 -0.0772 0.0140  2   DG  B "C1'" 
2376 N N9    . DG  B 2   ? 0.3075 0.3033 0.2931 -0.0543 -0.0783 0.0121  2   DG  B N9    
2377 C C8    . DG  B 2   ? 0.3094 0.3227 0.3002 -0.0606 -0.0773 0.0075  2   DG  B C8    
2378 N N7    . DG  B 2   ? 0.3117 0.3408 0.3088 -0.0548 -0.0825 0.0036  2   DG  B N7    
2379 C C5    . DG  B 2   ? 0.3131 0.3274 0.3030 -0.0459 -0.0850 0.0081  2   DG  B C5    
2380 C C6    . DG  B 2   ? 0.3230 0.3336 0.3047 -0.0363 -0.0900 0.0074  2   DG  B C6    
2381 O O6    . DG  B 2   ? 0.3331 0.3559 0.3139 -0.0293 -0.0971 0.0023  2   DG  B O6    
2382 N N1    . DG  B 2   ? 0.3293 0.3172 0.3000 -0.0344 -0.0861 0.0110  2   DG  B N1    
2383 C C2    . DG  B 2   ? 0.3299 0.3095 0.3050 -0.0391 -0.0803 0.0121  2   DG  B C2    
2384 N N2    . DG  B 2   ? 0.3473 0.3110 0.3151 -0.0386 -0.0750 0.0105  2   DG  B N2    
2385 N N3    . DG  B 2   ? 0.3173 0.3018 0.3003 -0.0432 -0.0796 0.0125  2   DG  B N3    
2386 C C4    . DG  B 2   ? 0.3096 0.3072 0.2961 -0.0473 -0.0811 0.0119  2   DG  B C4    
2387 P P     . DT  B 3   ? 0.3578 0.3012 0.3125 -0.0328 -0.0829 0.0152  3   DT  B P     
2388 O OP1   . DT  B 3   ? 0.3805 0.3015 0.3182 -0.0212 -0.0901 0.0120  3   DT  B OP1   
2389 O OP2   . DT  B 3   ? 0.3518 0.3065 0.3084 -0.0405 -0.0770 0.0183  3   DT  B OP2   
2390 O "O5'" . DT  B 3   ? 0.3464 0.3107 0.3241 -0.0290 -0.0831 0.0117  3   DT  B "O5'" 
2391 C "C5'" . DT  B 3   ? 0.3505 0.3141 0.3348 -0.0263 -0.0846 0.0054  3   DT  B "C5'" 
2392 C "C4'" . DT  B 3   ? 0.3532 0.3294 0.3514 -0.0262 -0.0804 0.0014  3   DT  B "C4'" 
2393 O "O4'" . DT  B 3   ? 0.3524 0.3318 0.3482 -0.0319 -0.0771 0.0070  3   DT  B "O4'" 
2394 C "C3'" . DT  B 3   ? 0.3616 0.3454 0.3659 -0.0215 -0.0796 -0.0002 3   DT  B "C3'" 
2395 O "O3'" . DT  B 3   ? 0.3976 0.3864 0.4130 -0.0211 -0.0754 -0.0114 3   DT  B "O3'" 
2396 C "C2'" . DT  B 3   ? 0.3470 0.3358 0.3488 -0.0248 -0.0764 0.0073  3   DT  B "C2'" 
2397 C "C1'" . DT  B 3   ? 0.3491 0.3341 0.3469 -0.0296 -0.0746 0.0082  3   DT  B "C1'" 
2398 N N1    . DT  B 3   ? 0.3317 0.3221 0.3250 -0.0305 -0.0761 0.0131  3   DT  B N1    
2399 C C2    . DT  B 3   ? 0.3418 0.3262 0.3266 -0.0283 -0.0751 0.0131  3   DT  B C2    
2400 O O2    . DT  B 3   ? 0.3536 0.3242 0.3314 -0.0290 -0.0697 0.0101  3   DT  B O2    
2401 N N3    . DT  B 3   ? 0.3389 0.3324 0.3211 -0.0251 -0.0803 0.0144  3   DT  B N3    
2402 C C4    . DT  B 3   ? 0.3298 0.3420 0.3216 -0.0276 -0.0832 0.0134  3   DT  B C4    
2403 O O4    . DT  B 3   ? 0.3441 0.3698 0.3375 -0.0237 -0.0882 0.0097  3   DT  B O4    
2404 C C5    . DT  B 3   ? 0.3252 0.3377 0.3221 -0.0341 -0.0800 0.0145  3   DT  B C5    
2405 C C7    . DT  B 3   ? 0.3336 0.3589 0.3346 -0.0415 -0.0783 0.0120  3   DT  B C7    
2406 C C6    . DT  B 3   ? 0.3250 0.3244 0.3199 -0.0333 -0.0781 0.0153  3   DT  B C6    
2407 P P     . DA  B 4   ? 0.4166 0.4152 0.4427 -0.0165 -0.0742 -0.0207 4   DA  B P     
2408 O OP1   . DA  B 4   ? 0.4145 0.4217 0.4548 -0.0136 -0.0751 -0.0385 4   DA  B OP1   
2409 O OP2   . DA  B 4   ? 0.4238 0.4220 0.4437 -0.0107 -0.0798 -0.0129 4   DA  B OP2   
2410 O "O5'" . DA  B 4   ? 0.4145 0.4097 0.4366 -0.0234 -0.0638 -0.0178 4   DA  B "O5'" 
2411 C "C5'" . DA  B 4   ? 0.3988 0.3847 0.4162 -0.0317 -0.0542 -0.0231 4   DA  B "C5'" 
2412 C "C4'" . DA  B 4   ? 0.4004 0.3715 0.4003 -0.0340 -0.0474 -0.0163 4   DA  B "C4'" 
2413 O "O4'" . DA  B 4   ? 0.4058 0.3735 0.3942 -0.0292 -0.0550 -0.0029 4   DA  B "O4'" 
2414 C "C3'" . DA  B 4   ? 0.3792 0.3540 0.3817 -0.0314 -0.0448 -0.0181 4   DA  B "C3'" 
2415 O "O3'" . DA  B 4   ? 0.3855 0.3398 0.3710 -0.0379 -0.0318 -0.0223 4   DA  B "O3'" 
2416 C "C2'" . DA  B 4   ? 0.3715 0.3498 0.3686 -0.0234 -0.0538 -0.0046 4   DA  B "C2'" 
2417 C "C1'" . DA  B 4   ? 0.3755 0.3438 0.3587 -0.0235 -0.0565 0.0022  4   DA  B "C1'" 
2418 N N9    . DA  B 4   ? 0.3398 0.3206 0.3260 -0.0186 -0.0658 0.0099  4   DA  B N9    
2419 C C8    . DA  B 4   ? 0.3188 0.3143 0.3168 -0.0183 -0.0705 0.0116  4   DA  B C8    
2420 N N7    . DA  B 4   ? 0.3215 0.3266 0.3197 -0.0176 -0.0748 0.0153  4   DA  B N7    
2421 C C5    . DA  B 4   ? 0.3203 0.3201 0.3085 -0.0136 -0.0763 0.0155  4   DA  B C5    
2422 C C6    . DA  B 4   ? 0.3216 0.3316 0.3080 -0.0089 -0.0825 0.0147  4   DA  B C6    
2423 N N6    . DA  B 4   ? 0.3152 0.3473 0.3146 -0.0117 -0.0851 0.0121  4   DA  B N6    
2424 N N1    . DA  B 4   ? 0.3350 0.3304 0.3036 -0.0008 -0.0857 0.0142  4   DA  B N1    
2425 C C2    . DA  B 4   ? 0.3497 0.3173 0.3002 -0.0022 -0.0792 0.0153  4   DA  B C2    
2426 N N3    . DA  B 4   ? 0.3486 0.3082 0.3029 -0.0102 -0.0700 0.0142  4   DA  B N3    
2427 C C4    . DA  B 4   ? 0.3373 0.3169 0.3133 -0.0140 -0.0707 0.0139  4   DA  B C4    
2428 P P     . DC  B 5   ? 0.3946 0.3529 0.3898 -0.0455 -0.0198 -0.0386 5   DC  B P     
2429 O OP1   . DC  B 5   ? 0.3883 0.3557 0.3985 -0.0545 -0.0129 -0.0557 5   DC  B OP1   
2430 O OP2   . DC  B 5   ? 0.3785 0.3572 0.3901 -0.0371 -0.0280 -0.0379 5   DC  B OP2   
2431 O "O5'" . DC  B 5   ? 0.4464 0.3735 0.4106 -0.0483 -0.0090 -0.0341 5   DC  B "O5'" 
2432 C "C5'" . DC  B 5   ? 0.4978 0.3880 0.4259 -0.0512 -0.0023 -0.0284 5   DC  B "C5'" 
2433 C "C4'" . DC  B 5   ? 0.5185 0.3970 0.4260 -0.0360 -0.0147 -0.0120 5   DC  B "C4'" 
2434 O "O4'" . DC  B 5   ? 0.4885 0.3985 0.4197 -0.0257 -0.0318 -0.0037 5   DC  B "O4'" 
2435 C "C3'" . DC  B 5   ? 0.5464 0.4068 0.4337 -0.0298 -0.0123 -0.0087 5   DC  B "C3'" 
2436 O "O3'" . DC  B 5   ? 0.6265 0.4369 0.4647 -0.0292 -0.0052 -0.0061 5   DC  B "O3'" 
2437 C "C2'" . DC  B 5   ? 0.5172 0.4011 0.4170 -0.0135 -0.0307 0.0019  5   DC  B "C2'" 
2438 C "C1'" . DC  B 5   ? 0.4956 0.3961 0.4086 -0.0130 -0.0399 0.0050  5   DC  B "C1'" 
2439 N N1    . DC  B 5   ? 0.4617 0.3959 0.3996 -0.0056 -0.0534 0.0100  5   DC  B N1    
2440 C C2    . DC  B 5   ? 0.4562 0.3947 0.3875 0.0042  -0.0646 0.0145  5   DC  B C2    
2441 O O2    . DC  B 5   ? 0.4752 0.3877 0.3780 0.0099  -0.0660 0.0153  5   DC  B O2    
2442 N N3    . DC  B 5   ? 0.4199 0.3896 0.3740 0.0069  -0.0731 0.0156  5   DC  B N3    
2443 C C4    . DC  B 5   ? 0.4064 0.3941 0.3813 0.0013  -0.0710 0.0153  5   DC  B C4    
2444 N N4    . DC  B 5   ? 0.3956 0.4064 0.3857 0.0010  -0.0760 0.0157  5   DC  B N4    
2445 C C5    . DC  B 5   ? 0.4204 0.4021 0.3995 -0.0046 -0.0632 0.0121  5   DC  B C5    
2446 C C6    . DC  B 5   ? 0.4274 0.3863 0.3912 -0.0082 -0.0545 0.0083  5   DC  B C6    
2447 P P     . DA  B 6   ? 0.6874 0.4534 0.4818 -0.0245 0.0025  -0.0046 6   DA  B P     
2448 O OP1   . DA  B 6   ? 0.7568 0.4668 0.5026 -0.0369 0.0212  -0.0098 6   DA  B OP1   
2449 O OP2   . DA  B 6   ? 0.6528 0.4436 0.4740 -0.0271 0.0057  -0.0092 6   DA  B OP2   
2450 O "O5'" . DA  B 6   ? 0.6823 0.4436 0.4589 0.0001  -0.0188 0.0072  6   DA  B "O5'" 
2451 C "C5'" . DA  B 6   ? 0.6960 0.4522 0.4610 0.0079  -0.0297 0.0114  6   DA  B "C5'" 
2452 C "C4'" . DA  B 6   ? 0.7016 0.4541 0.4487 0.0334  -0.0497 0.0167  6   DA  B "C4'" 
2453 O "O4'" . DA  B 6   ? 0.6330 0.4452 0.4305 0.0396  -0.0646 0.0173  6   DA  B "O4'" 
2454 C "C3'" . DA  B 6   ? 0.7351 0.4561 0.4490 0.0464  -0.0496 0.0176  6   DA  B "C3'" 
2455 O "O3'" . DA  B 6   ? 0.7990 0.4939 0.4740 0.0717  -0.0673 0.0193  6   DA  B "O3'" 
2456 C "C2'" . DA  B 6   ? 0.6556 0.4314 0.4203 0.0487  -0.0563 0.0170  6   DA  B "C2'" 
2457 C "C1'" . DA  B 6   ? 0.6072 0.4324 0.4121 0.0512  -0.0704 0.0171  6   DA  B "C1'" 
2458 N N9    . DA  B 6   ? 0.5290 0.4050 0.3852 0.0416  -0.0702 0.0162  6   DA  B N9    
2459 C C8    . DA  B 6   ? 0.4908 0.3770 0.3680 0.0253  -0.0577 0.0148  6   DA  B C8    
2460 N N7    . DA  B 6   ? 0.4487 0.3754 0.3634 0.0222  -0.0622 0.0147  6   DA  B N7    
2461 C C5    . DA  B 6   ? 0.4313 0.3781 0.3530 0.0336  -0.0754 0.0151  6   DA  B C5    
2462 C C6    . DA  B 6   ? 0.3933 0.3793 0.3455 0.0333  -0.0820 0.0134  6   DA  B C6    
2463 N N6    . DA  B 6   ? 0.3499 0.3547 0.3246 0.0229  -0.0773 0.0141  6   DA  B N6    
2464 N N1    . DA  B 6   ? 0.3963 0.3995 0.3519 0.0439  -0.0931 0.0089  6   DA  B N1    
2465 C C2    . DA  B 6   ? 0.4287 0.4093 0.3564 0.0585  -0.1009 0.0072  6   DA  B C2    
2466 N N3    . DA  B 6   ? 0.4630 0.3979 0.3527 0.0621  -0.0968 0.0111  6   DA  B N3    
2467 C C4    . DA  B 6   ? 0.4731 0.3934 0.3627 0.0469  -0.0820 0.0148  6   DA  B C4    
2468 P P     . DC  B 7   ? 0.8816 0.5282 0.5035 0.0942  -0.0731 0.0198  7   DC  B P     
2469 O OP1   . DC  B 7   ? 0.9539 0.5496 0.5166 0.1137  -0.0847 0.0204  7   DC  B OP1   
2470 O OP2   . DC  B 7   ? 0.8996 0.5145 0.5044 0.0772  -0.0503 0.0197  7   DC  B OP2   
2471 O "O5'" . DC  B 7   ? 0.8001 0.5059 0.4685 0.1110  -0.0912 0.0166  7   DC  B "O5'" 
2472 C "C5'" . DC  B 7   ? 0.7548 0.5038 0.4491 0.1288  -0.1138 0.0114  7   DC  B "C5'" 
2473 C "C4'" . DC  B 7   ? 0.6851 0.4999 0.4372 0.1307  -0.1210 0.0061  7   DC  B "C4'" 
2474 O "O4'" . DC  B 7   ? 0.6264 0.4793 0.4270 0.1039  -0.1065 0.0093  7   DC  B "O4'" 
2475 C "C3'" . DC  B 7   ? 0.6868 0.4914 0.4252 0.1473  -0.1250 0.0034  7   DC  B "C3'" 
2476 O "O3'" . DC  B 7   ? 0.6677 0.5084 0.4222 0.1723  -0.1477 -0.0083 7   DC  B "O3'" 
2477 C "C2'" . DC  B 7   ? 0.6397 0.4838 0.4257 0.1264  -0.1117 0.0054  7   DC  B "C2'" 
2478 C "C1'" . DC  B 7   ? 0.5821 0.4708 0.4128 0.1084  -0.1098 0.0055  7   DC  B "C1'" 
2479 N N1    . DC  B 7   ? 0.5299 0.4434 0.3960 0.0852  -0.0957 0.0091  7   DC  B N1    
2480 C C2    . DC  B 7   ? 0.4669 0.4326 0.3783 0.0790  -0.0987 0.0055  7   DC  B C2    
2481 O O2    . DC  B 7   ? 0.4539 0.4486 0.3798 0.0900  -0.1110 -0.0024 7   DC  B O2    
2482 N N3    . DC  B 7   ? 0.4318 0.4128 0.3671 0.0618  -0.0880 0.0087  7   DC  B N3    
2483 C C4    . DC  B 7   ? 0.4440 0.3995 0.3675 0.0510  -0.0759 0.0127  7   DC  B C4    
2484 N N4    . DC  B 7   ? 0.4186 0.3920 0.3661 0.0377  -0.0689 0.0132  7   DC  B N4    
2485 C C5    . DC  B 7   ? 0.4874 0.3957 0.3711 0.0534  -0.0699 0.0140  7   DC  B C5    
2486 C C6    . DC  B 7   ? 0.5374 0.4217 0.3895 0.0704  -0.0794 0.0135  7   DC  B C6    
2487 P P     . DC  B 8   ? 0.6787 0.5206 0.4233 0.1995  -0.1609 -0.0171 8   DC  B P     
2488 O OP1   . DC  B 8   ? 0.7126 0.5502 0.4333 0.2335  -0.1868 -0.0297 8   DC  B OP1   
2489 O OP2   . DC  B 8   ? 0.7074 0.4984 0.4163 0.1938  -0.1452 -0.0077 8   DC  B OP2   
2490 O "O5'" . DC  B 8   ? 0.6084 0.5274 0.4238 0.1886  -0.1595 -0.0251 8   DC  B "O5'" 
2491 C "C5'" . DC  B 8   ? 0.5624 0.5435 0.4261 0.1852  -0.1680 -0.0371 8   DC  B "C5'" 
2492 C "C4'" . DC  B 8   ? 0.5049 0.5444 0.4220 0.1737  -0.1626 -0.0452 8   DC  B "C4'" 
2493 O "O4'" . DC  B 8   ? 0.4653 0.5039 0.3985 0.1432  -0.1420 -0.0314 8   DC  B "O4'" 
2494 C "C3'" . DC  B 8   ? 0.5257 0.5652 0.4378 0.1915  -0.1674 -0.0518 8   DC  B "C3'" 
2495 O "O3'" . DC  B 8   ? 0.5242 0.6292 0.4831 0.1967  -0.1758 -0.0730 8   DC  B "O3'" 
2496 C "C2'" . DC  B 8   ? 0.4993 0.5262 0.4165 0.1680  -0.1466 -0.0374 8   DC  B "C2'" 
2497 C "C1'" . DC  B 8   ? 0.4478 0.4999 0.3967 0.1391  -0.1347 -0.0318 8   DC  B "C1'" 
2498 N N1    . DC  B 8   ? 0.4245 0.4556 0.3709 0.1160  -0.1168 -0.0168 8   DC  B N1    
2499 C C2    . DC  B 8   ? 0.3776 0.4406 0.3579 0.0970  -0.1067 -0.0163 8   DC  B C2    
2500 O O2    . DC  B 8   ? 0.3617 0.4665 0.3712 0.0967  -0.1096 -0.0278 8   DC  B O2    
2501 N N3    . DC  B 8   ? 0.3625 0.4088 0.3409 0.0797  -0.0938 -0.0057 8   DC  B N3    
2502 C C4    . DC  B 8   ? 0.3771 0.3829 0.3274 0.0779  -0.0885 0.0019  8   DC  B C4    
2503 N N4    . DC  B 8   ? 0.3625 0.3605 0.3172 0.0617  -0.0768 0.0073  8   DC  B N4    
2504 C C5    . DC  B 8   ? 0.4216 0.3913 0.3353 0.0927  -0.0946 0.0021  8   DC  B C5    
2505 C C6    . DC  B 8   ? 0.4404 0.4213 0.3505 0.1128  -0.1099 -0.0061 8   DC  B C6    
2506 P P     . DT  B 9   ? 0.5711 0.6945 0.5341 0.2236  -0.1888 -0.0905 9   DT  B P     
2507 O OP1   . DT  B 9   ? 0.5831 0.7637 0.5789 0.2404  -0.2068 -0.1187 9   DT  B OP1   
2508 O OP2   . DT  B 9   ? 0.6334 0.6894 0.5366 0.2463  -0.1947 -0.0801 9   DT  B OP2   
2509 O "O5'" . DT  B 9   ? 0.5358 0.6885 0.5348 0.1990  -0.1698 -0.0879 9   DT  B "O5'" 
2510 C "C5'" . DT  B 9   ? 0.5129 0.7086 0.5547 0.1688  -0.1559 -0.0903 9   DT  B "C5'" 
2511 C "C4'" . DT  B 9   ? 0.4902 0.7019 0.5531 0.1509  -0.1400 -0.0881 9   DT  B "C4'" 
2512 O "O4'" . DT  B 9   ? 0.4817 0.6560 0.5277 0.1299  -0.1245 -0.0645 9   DT  B "O4'" 
2513 C "C3'" . DT  B 9   ? 0.5184 0.7273 0.5739 0.1714  -0.1457 -0.0950 9   DT  B "C3'" 
2514 O "O3'" . DT  B 9   ? 0.5096 0.7643 0.6042 0.1546  -0.1342 -0.1070 9   DT  B "O3'" 
2515 C "C2'" . DT  B 9   ? 0.5217 0.6738 0.5412 0.1656  -0.1355 -0.0711 9   DT  B "C2'" 
2516 C "C1'" . DT  B 9   ? 0.4920 0.6457 0.5250 0.1333  -0.1190 -0.0577 9   DT  B "C1'" 
2517 N N1    . DT  B 9   ? 0.4819 0.5870 0.4855 0.1233  -0.1100 -0.0374 9   DT  B N1    
2518 C C2    . DT  B 9   ? 0.4635 0.5699 0.4788 0.0997  -0.0955 -0.0279 9   DT  B C2    
2519 O O2    . DT  B 9   ? 0.4714 0.6090 0.5127 0.0867  -0.0891 -0.0331 9   DT  B O2    
2520 N N3    . DT  B 9   ? 0.4504 0.5179 0.4427 0.0922  -0.0884 -0.0144 9   DT  B N3    
2521 C C4    . DT  B 9   ? 0.4673 0.4927 0.4248 0.1016  -0.0907 -0.0091 9   DT  B C4    
2522 O O4    . DT  B 9   ? 0.4544 0.4521 0.3977 0.0898  -0.0809 -0.0009 9   DT  B O4    
2523 C C5    . DT  B 9   ? 0.5016 0.5186 0.4401 0.1258  -0.1051 -0.0165 9   DT  B C5    
2524 C C7    . DT  B 9   ? 0.5486 0.5087 0.4372 0.1374  -0.1072 -0.0109 9   DT  B C7    
2525 C C6    . DT  B 9   ? 0.5003 0.5590 0.4640 0.1372  -0.1157 -0.0305 9   DT  B C6    
2526 P P     . DG  B 10  ? 0.5259 0.8281 0.6482 0.1725  -0.1430 -0.1354 10  DG  B P     
2527 O OP1   . DG  B 10  ? 0.4851 0.8382 0.6385 0.1774  -0.1532 -0.1616 10  DG  B OP1   
2528 O OP2   . DG  B 10  ? 0.5346 0.8011 0.6238 0.2015  -0.1546 -0.1313 10  DG  B OP2   
2529 O "O5'" . DG  B 10  ? 0.4819 0.8045 0.6285 0.1431  -0.1206 -0.1344 10  DG  B "O5'" 
2530 C "C5'" . DG  B 10  ? 0.4592 0.7928 0.6212 0.1088  -0.1024 -0.1296 10  DG  B "C5'" 
2531 C "C4'" . DG  B 10  ? 0.4488 0.7685 0.6070 0.0881  -0.0841 -0.1177 10  DG  B "C4'" 
2532 O "O4'" . DG  B 10  ? 0.4392 0.7056 0.5639 0.0863  -0.0825 -0.0897 10  DG  B "O4'" 
2533 C "C3'" . DG  B 10  ? 0.4539 0.7873 0.6195 0.1009  -0.0850 -0.1286 10  DG  B "C3'" 
2534 O "O3'" . DG  B 10  ? 0.4597 0.7972 0.6321 0.0759  -0.0654 -0.1267 10  DG  B "O3'" 
2535 C "C2'" . DG  B 10  ? 0.4609 0.7428 0.5897 0.1183  -0.0925 -0.1073 10  DG  B "C2'" 
2536 C "C1'" . DG  B 10  ? 0.4480 0.6958 0.5593 0.0969  -0.0824 -0.0840 10  DG  B "C1'" 
2537 N N9    . DG  B 10  ? 0.4545 0.6536 0.5320 0.1066  -0.0875 -0.0651 10  DG  B N9    
2538 C C8    . DG  B 10  ? 0.4772 0.6506 0.5297 0.1309  -0.1012 -0.0640 10  DG  B C8    
2539 N N7    . DG  B 10  ? 0.4804 0.6070 0.5020 0.1286  -0.0975 -0.0466 10  DG  B N7    
2540 C C5    . DG  B 10  ? 0.4556 0.5831 0.4872 0.1042  -0.0834 -0.0369 10  DG  B C5    
2541 C C6    . DG  B 10  ? 0.4358 0.5304 0.4504 0.0918  -0.0746 -0.0222 10  DG  B C6    
2542 O O6    . DG  B 10  ? 0.4385 0.4958 0.4262 0.0961  -0.0741 -0.0148 10  DG  B O6    
2543 N N1    . DG  B 10  ? 0.4061 0.5139 0.4361 0.0723  -0.0652 -0.0188 10  DG  B N1    
2544 C C2    . DG  B 10  ? 0.4011 0.5411 0.4529 0.0631  -0.0612 -0.0269 10  DG  B C2    
2545 N N2    . DG  B 10  ? 0.3812 0.5181 0.4338 0.0464  -0.0523 -0.0215 10  DG  B N2    
2546 N N3    . DG  B 10  ? 0.4177 0.5895 0.4873 0.0700  -0.0654 -0.0418 10  DG  B N3    
2547 C C4    . DG  B 10  ? 0.4384 0.6057 0.4998 0.0916  -0.0778 -0.0467 10  DG  B C4    
2548 P P     . DA  B 11  ? 0.4646 0.8553 0.6727 0.0606  -0.0528 -0.1558 11  DA  B P     
2549 O OP1   . DA  B 11  ? 0.4629 0.8840 0.6914 0.0493  -0.0514 -0.1716 11  DA  B OP1   
2550 O OP2   . DA  B 11  ? 0.4498 0.8638 0.6711 0.0843  -0.0622 -0.1729 11  DA  B OP2   
2551 O "O5'" . DA  B 11  ? 0.4857 0.8511 0.6784 0.0299  -0.0301 -0.1414 11  DA  B "O5'" 
2552 C "C5'" . DA  B 11  ? 0.4987 0.8320 0.6705 0.0107  -0.0227 -0.1229 11  DA  B "C5'" 
2553 C "C4'" . DA  B 11  ? 0.5329 0.8262 0.6768 -0.0023 -0.0114 -0.1035 11  DA  B "C4'" 
2554 O "O4'" . DA  B 11  ? 0.5518 0.8117 0.6757 0.0156  -0.0233 -0.0830 11  DA  B "O4'" 
2555 C "C3'" . DA  B 11  ? 0.5510 0.8564 0.6998 -0.0125 0.0025  -0.1149 11  DA  B "C3'" 
2556 O "O3'" . DA  B 11  ? 0.5707 0.8376 0.6890 -0.0341 0.0161  -0.1002 11  DA  B "O3'" 
2557 C "C2'" . DA  B 11  ? 0.5348 0.8331 0.6809 0.0118  -0.0094 -0.1083 11  DA  B "C2'" 
2558 C "C1'" . DA  B 11  ? 0.5323 0.7919 0.6553 0.0236  -0.0219 -0.0845 11  DA  B "C1'" 
2559 N N9    . DA  B 11  ? 0.5279 0.7818 0.6484 0.0505  -0.0380 -0.0819 11  DA  B N9    
2560 C C8    . DA  B 11  ? 0.5227 0.8026 0.6585 0.0722  -0.0496 -0.0985 11  DA  B C8    
2561 N N7    . DA  B 11  ? 0.5234 0.7762 0.6394 0.0942  -0.0628 -0.0892 11  DA  B N7    
2562 C C5    . DA  B 11  ? 0.5098 0.7228 0.6023 0.0835  -0.0578 -0.0671 11  DA  B C5    
2563 C C6    . DA  B 11  ? 0.5187 0.6903 0.5835 0.0925  -0.0628 -0.0516 11  DA  B C6    
2564 N N6    . DA  B 11  ? 0.5500 0.7030 0.5970 0.1153  -0.0736 -0.0530 11  DA  B N6    
2565 N N1    . DA  B 11  ? 0.4906 0.6377 0.5434 0.0773  -0.0555 -0.0368 11  DA  B N1    
2566 C C2    . DA  B 11  ? 0.4856 0.6429 0.5473 0.0579  -0.0464 -0.0354 11  DA  B C2    
2567 N N3    . DA  B 11  ? 0.4785 0.6642 0.5574 0.0469  -0.0398 -0.0464 11  DA  B N3    
2568 C C4    . DA  B 11  ? 0.4989 0.7146 0.5956 0.0589  -0.0448 -0.0629 11  DA  B C4    
2569 P P     . DT  B 12  ? 0.6109 0.8609 0.7111 -0.0485 0.0321  -0.1001 12  DT  B P     
2570 O OP1   . DT  B 12  ? 0.6431 0.8597 0.7119 -0.0745 0.0482  -0.0951 12  DT  B OP1   
2571 O OP2   . DT  B 12  ? 0.5572 0.8483 0.6860 -0.0448 0.0365  -0.1224 12  DT  B OP2   
2572 O "O5'" . DT  B 12  ? 0.5859 0.8004 0.6642 -0.0316 0.0200  -0.0771 12  DT  B "O5'" 
2573 C "C5'" . DT  B 12  ? 0.5636 0.7414 0.6177 -0.0292 0.0122  -0.0571 12  DT  B "C5'" 
2574 C "C4'" . DT  B 12  ? 0.5506 0.7076 0.5929 -0.0149 0.0038  -0.0444 12  DT  B "C4'" 
2575 O "O4'" . DT  B 12  ? 0.5158 0.6893 0.5768 0.0051  -0.0081 -0.0460 12  DT  B "O4'" 
2576 C "C3'" . DT  B 12  ? 0.5477 0.7003 0.5810 -0.0198 0.0133  -0.0481 12  DT  B "C3'" 
2577 O "O3'" . DT  B 12  ? 0.5329 0.6510 0.5399 -0.0164 0.0090  -0.0342 12  DT  B "O3'" 
2578 C "C2'" . DT  B 12  ? 0.5238 0.7060 0.5828 -0.0043 0.0084  -0.0578 12  DT  B "C2'" 
2579 C "C1'" . DT  B 12  ? 0.5207 0.6957 0.5822 0.0127  -0.0069 -0.0483 12  DT  B "C1'" 
2580 N N1    . DT  B 12  ? 0.5129 0.7072 0.5912 0.0322  -0.0163 -0.0561 12  DT  B N1    
2581 C C2    . DT  B 12  ? 0.5069 0.6785 0.5734 0.0469  -0.0260 -0.0455 12  DT  B C2    
2582 O O2    . DT  B 12  ? 0.4851 0.6301 0.5356 0.0430  -0.0265 -0.0328 12  DT  B O2    
2583 N N3    . DT  B 12  ? 0.5056 0.6851 0.5772 0.0668  -0.0348 -0.0527 12  DT  B N3    
2584 C C4    . DT  B 12  ? 0.5098 0.7230 0.6016 0.0764  -0.0378 -0.0710 12  DT  B C4    
2585 O O4    . DT  B 12  ? 0.5453 0.7570 0.6338 0.0988  -0.0488 -0.0764 12  DT  B O4    
2586 C C5    . DT  B 12  ? 0.5026 0.7484 0.6151 0.0585  -0.0267 -0.0846 12  DT  B C5    
2587 C C7    . DT  B 12  ? 0.4984 0.7905 0.6403 0.0661  -0.0281 -0.1106 12  DT  B C7    
2588 C C6    . DT  B 12  ? 0.4955 0.7267 0.5974 0.0361  -0.0151 -0.0756 12  DT  B C6    
2589 P P     . DA  B 13  ? 0.5628 0.6428 0.5313 -0.0308 0.0160  -0.0280 13  DA  B P     
2590 O OP1   . DA  B 13  ? 0.5559 0.6323 0.5202 -0.0419 0.0196  -0.0289 13  DA  B OP1   
2591 O OP2   . DA  B 13  ? 0.5576 0.6307 0.5114 -0.0409 0.0290  -0.0341 13  DA  B OP2   
2592 O "O5'" . DA  B 13  ? 0.5594 0.6137 0.5123 -0.0171 0.0013  -0.0154 13  DA  B "O5'" 
2593 C "C5'" . DA  B 13  ? 0.5198 0.5706 0.4776 -0.0096 -0.0099 -0.0092 13  DA  B "C5'" 
2594 C "C4'" . DA  B 13  ? 0.5168 0.5678 0.4824 0.0045  -0.0204 -0.0063 13  DA  B "C4'" 
2595 O "O4'" . DA  B 13  ? 0.4733 0.5461 0.4606 0.0104  -0.0183 -0.0107 13  DA  B "O4'" 
2596 C "C3'" . DA  B 13  ? 0.5442 0.5742 0.4881 0.0086  -0.0241 -0.0054 13  DA  B "C3'" 
2597 O "O3'" . DA  B 13  ? 0.5448 0.5812 0.5026 0.0190  -0.0325 -0.0065 13  DA  B "O3'" 
2598 C "C2'" . DA  B 13  ? 0.5308 0.5715 0.4798 0.0068  -0.0156 -0.0098 13  DA  B "C2'" 
2599 C "C1'" . DA  B 13  ? 0.4867 0.5542 0.4666 0.0126  -0.0161 -0.0123 13  DA  B "C1'" 
2600 N N9    . DA  B 13  ? 0.4932 0.5807 0.4865 0.0114  -0.0082 -0.0193 13  DA  B N9    
2601 C C8    . DA  B 13  ? 0.5010 0.5936 0.4895 0.0008  0.0028  -0.0257 13  DA  B C8    
2602 N N7    . DA  B 13  ? 0.4931 0.6121 0.5027 0.0039  0.0069  -0.0353 13  DA  B N7    
2603 C C5    . DA  B 13  ? 0.4791 0.6046 0.5024 0.0190  -0.0031 -0.0331 13  DA  B C5    
2604 C C6    . DA  B 13  ? 0.4589 0.6029 0.4993 0.0325  -0.0068 -0.0402 13  DA  B C6    
2605 N N6    . DA  B 13  ? 0.4546 0.6237 0.5099 0.0339  -0.0018 -0.0536 13  DA  B N6    
2606 N N1    . DA  B 13  ? 0.4525 0.5853 0.4907 0.0452  -0.0157 -0.0349 13  DA  B N1    
2607 C C2    . DA  B 13  ? 0.4582 0.5704 0.4852 0.0421  -0.0191 -0.0251 13  DA  B C2    
2608 N N3    . DA  B 13  ? 0.4611 0.5618 0.4782 0.0316  -0.0179 -0.0198 13  DA  B N3    
2609 C C4    . DA  B 13  ? 0.4794 0.5848 0.4923 0.0215  -0.0106 -0.0232 13  DA  B C4    
2610 P P     . DA  B 14  ? 0.5612 0.5833 0.5061 0.0270  -0.0428 -0.0093 14  DA  B P     
2611 O OP1   . DA  B 14  ? 0.6120 0.6340 0.5630 0.0301  -0.0507 -0.0094 14  DA  B OP1   
2612 O OP2   . DA  B 14  ? 0.5984 0.5964 0.5107 0.0265  -0.0435 -0.0087 14  DA  B OP2   
2613 O "O5'" . DA  B 14  ? 0.5334 0.5697 0.4969 0.0318  -0.0422 -0.0155 14  DA  B "O5'" 
2614 C "C5'" . DA  B 14  ? 0.5465 0.5914 0.5170 0.0303  -0.0337 -0.0160 14  DA  B "C5'" 
2615 C "C4'" . DA  B 14  ? 0.5215 0.5759 0.5101 0.0325  -0.0308 -0.0178 14  DA  B "C4'" 
2616 O "O4'" . DA  B 14  ? 0.4881 0.5508 0.4828 0.0329  -0.0247 -0.0157 14  DA  B "O4'" 
2617 C "C3'" . DA  B 14  ? 0.4955 0.5490 0.4872 0.0348  -0.0288 -0.0252 14  DA  B "C3'" 
2618 O "O3'" . DA  B 14  ? 0.4847 0.5360 0.4841 0.0342  -0.0255 -0.0281 14  DA  B "O3'" 
2619 C "C2'" . DA  B 14  ? 0.4897 0.5456 0.4794 0.0358  -0.0221 -0.0241 14  DA  B "C2'" 
2620 C "C1'" . DA  B 14  ? 0.4730 0.5362 0.4683 0.0364  -0.0201 -0.0193 14  DA  B "C1'" 
2621 N N9    . DA  B 14  ? 0.4478 0.5203 0.4431 0.0348  -0.0152 -0.0202 14  DA  B N9    
2622 C C8    . DA  B 14  ? 0.4380 0.5083 0.4226 0.0276  -0.0124 -0.0202 14  DA  B C8    
2623 N N7    . DA  B 14  ? 0.4290 0.5111 0.4178 0.0248  -0.0049 -0.0245 14  DA  B N7    
2624 C C5    . DA  B 14  ? 0.4282 0.5233 0.4331 0.0341  -0.0059 -0.0276 14  DA  B C5    
2625 C C6    . DA  B 14  ? 0.4209 0.5351 0.4389 0.0394  -0.0025 -0.0358 14  DA  B C6    
2626 N N6    . DA  B 14  ? 0.4221 0.5513 0.4445 0.0321  0.0058  -0.0437 14  DA  B N6    
2627 N N1    . DA  B 14  ? 0.4220 0.5373 0.4456 0.0534  -0.0078 -0.0375 14  DA  B N1    
2628 C C2    . DA  B 14  ? 0.4285 0.5242 0.4432 0.0574  -0.0127 -0.0307 14  DA  B C2    
2629 N N3    . DA  B 14  ? 0.4213 0.5030 0.4287 0.0500  -0.0138 -0.0247 14  DA  B N3    
2630 C C4    . DA  B 14  ? 0.4156 0.4998 0.4199 0.0402  -0.0118 -0.0237 14  DA  B C4    
2631 P P     . DT  B 15  ? 0.4757 0.5222 0.4763 0.0321  -0.0188 -0.0384 15  DT  B P     
2632 O OP1   . DT  B 15  ? 0.4707 0.5136 0.4764 0.0268  -0.0160 -0.0454 15  DT  B OP1   
2633 O OP2   . DT  B 15  ? 0.4695 0.5222 0.4693 0.0331  -0.0223 -0.0453 15  DT  B OP2   
2634 O "O5'" . DT  B 15  ? 0.4926 0.5299 0.4856 0.0359  -0.0113 -0.0337 15  DT  B "O5'" 
2635 C "C5'" . DT  B 15  ? 0.4719 0.4974 0.4584 0.0398  -0.0093 -0.0285 15  DT  B "C5'" 
2636 C "C4'" . DT  B 15  ? 0.4740 0.4849 0.4475 0.0472  -0.0040 -0.0284 15  DT  B "C4'" 
2637 O "O4'" . DT  B 15  ? 0.4533 0.4806 0.4332 0.0535  -0.0071 -0.0266 15  DT  B "O4'" 
2638 C "C3'" . DT  B 15  ? 0.4931 0.4887 0.4572 0.0423  0.0054  -0.0361 15  DT  B "C3'" 
2639 O "O3'" . DT  B 15  ? 0.5121 0.4767 0.4523 0.0477  0.0123  -0.0360 15  DT  B "O3'" 
2640 C "C2'" . DT  B 15  ? 0.4824 0.4937 0.4535 0.0448  0.0039  -0.0370 15  DT  B "C2'" 
2641 C "C1'" . DT  B 15  ? 0.4758 0.4978 0.4501 0.0546  -0.0016 -0.0309 15  DT  B "C1'" 
2642 N N1    . DT  B 15  ? 0.4632 0.5063 0.4475 0.0538  -0.0034 -0.0310 15  DT  B N1    
2643 C C2    . DT  B 15  ? 0.4633 0.5167 0.4509 0.0617  -0.0032 -0.0326 15  DT  B C2    
2644 O O2    . DT  B 15  ? 0.4917 0.5371 0.4734 0.0733  -0.0043 -0.0342 15  DT  B O2    
2645 N N3    . DT  B 15  ? 0.4487 0.5200 0.4440 0.0563  -0.0017 -0.0343 15  DT  B N3    
2646 C C4    . DT  B 15  ? 0.4393 0.5111 0.4313 0.0462  -0.0017 -0.0324 15  DT  B C4    
2647 O O4    . DT  B 15  ? 0.4347 0.5147 0.4257 0.0409  0.0017  -0.0340 15  DT  B O4    
2648 C C5    . DT  B 15  ? 0.4455 0.5060 0.4331 0.0430  -0.0058 -0.0307 15  DT  B C5    
2649 C C7    . DT  B 15  ? 0.4524 0.5101 0.4320 0.0377  -0.0100 -0.0307 15  DT  B C7    
2650 C C6    . DT  B 15  ? 0.4474 0.4982 0.4352 0.0458  -0.0057 -0.0311 15  DT  B C6    
2651 P P     . DG  B 16  ? 0.5365 0.4729 0.4584 0.0382  0.0269  -0.0453 16  DG  B P     
2652 O OP1   . DG  B 16  ? 0.5986 0.4891 0.4827 0.0456  0.0332  -0.0424 16  DG  B OP1   
2653 O OP2   . DG  B 16  ? 0.5618 0.5098 0.4986 0.0224  0.0314  -0.0553 16  DG  B OP2   
2654 O "O5'" . DG  B 16  ? 0.5185 0.4624 0.4427 0.0420  0.0282  -0.0478 16  DG  B "O5'" 
2655 C "C5'" . DG  B 16  ? 0.5177 0.4507 0.4281 0.0578  0.0251  -0.0427 16  DG  B "C5'" 
2656 C "C4'" . DG  B 16  ? 0.4981 0.4521 0.4214 0.0598  0.0239  -0.0450 16  DG  B "C4'" 
2657 O "O4'" . DG  B 16  ? 0.4596 0.4501 0.4087 0.0575  0.0153  -0.0424 16  DG  B "O4'" 
2658 C "C3'" . DG  B 16  ? 0.4971 0.4445 0.4178 0.0478  0.0343  -0.0541 16  DG  B "C3'" 
2659 O "O3'" . DG  B 16  ? 0.5146 0.4427 0.4176 0.0548  0.0401  -0.0561 16  DG  B "O3'" 
2660 C "C2'" . DG  B 16  ? 0.4634 0.4465 0.4095 0.0427  0.0272  -0.0558 16  DG  B "C2'" 
2661 C "C1'" . DG  B 16  ? 0.4490 0.4489 0.4030 0.0530  0.0183  -0.0472 16  DG  B "C1'" 
2662 N N9    . DG  B 16  ? 0.4210 0.4463 0.3899 0.0495  0.0116  -0.0453 16  DG  B N9    
2663 C C8    . DG  B 16  ? 0.4035 0.4371 0.3778 0.0421  0.0078  -0.0486 16  DG  B C8    
2664 N N7    . DG  B 16  ? 0.3980 0.4429 0.3734 0.0418  0.0031  -0.0460 16  DG  B N7    
2665 C C5    . DG  B 16  ? 0.3975 0.4473 0.3736 0.0462  0.0063  -0.0426 16  DG  B C5    
2666 C C6    . DG  B 16  ? 0.3959 0.4565 0.3720 0.0443  0.0075  -0.0415 16  DG  B C6    
2667 O O6    . DG  B 16  ? 0.4006 0.4606 0.3687 0.0386  0.0059  -0.0403 16  DG  B O6    
2668 N N1    . DG  B 16  ? 0.3989 0.4693 0.3823 0.0502  0.0112  -0.0436 16  DG  B N1    
2669 C C2    . DG  B 16  ? 0.4069 0.4711 0.3909 0.0607  0.0110  -0.0451 16  DG  B C2    
2670 N N2    . DG  B 16  ? 0.4187 0.4958 0.4099 0.0696  0.0119  -0.0505 16  DG  B N2    
2671 N N3    . DG  B 16  ? 0.4059 0.4501 0.3809 0.0626  0.0107  -0.0436 16  DG  B N3    
2672 C C4    . DG  B 16  ? 0.4058 0.4463 0.3799 0.0531  0.0097  -0.0430 16  DG  B C4    
2673 P P     . DG  B 17  ? 0.5238 0.4410 0.4202 0.0429  0.0525  -0.0668 17  DG  B P     
2674 O OP1   . DG  B 17  ? 0.5701 0.4550 0.4389 0.0520  0.0591  -0.0669 17  DG  B OP1   
2675 O OP2   . DG  B 17  ? 0.5188 0.4297 0.4161 0.0259  0.0613  -0.0762 17  DG  B OP2   
2676 O "O5'" . DG  B 17  ? 0.5209 0.4764 0.4429 0.0425  0.0451  -0.0681 17  DG  B "O5'" 
2677 C "C5'" . DG  B 17  ? 0.5243 0.4842 0.4445 0.0504  0.0450  -0.0674 17  DG  B "C5'" 
2678 C "C4'" . DG  B 17  ? 0.5157 0.4783 0.4344 0.0665  0.0384  -0.0603 17  DG  B "C4'" 
2679 O "O4'" . DG  B 17  ? 0.4775 0.4652 0.4143 0.0669  0.0290  -0.0549 17  DG  B "O4'" 
2680 C "C3'" . DG  B 17  ? 0.5089 0.4846 0.4322 0.0734  0.0384  -0.0627 17  DG  B "C3'" 
2681 O "O3'" . DG  B 17  ? 0.5531 0.5011 0.4545 0.0854  0.0425  -0.0651 17  DG  B "O3'" 
2682 C "C2'" . DG  B 17  ? 0.4846 0.4884 0.4255 0.0805  0.0301  -0.0598 17  DG  B "C2'" 
2683 C "C1'" . DG  B 17  ? 0.4543 0.4674 0.4046 0.0713  0.0254  -0.0549 17  DG  B "C1'" 
2684 N N9    . DG  B 17  ? 0.4224 0.4523 0.3822 0.0598  0.0243  -0.0548 17  DG  B N9    
2685 C C8    . DG  B 17  ? 0.4164 0.4439 0.3764 0.0506  0.0227  -0.0561 17  DG  B C8    
2686 N N7    . DG  B 17  ? 0.4023 0.4418 0.3649 0.0459  0.0185  -0.0559 17  DG  B N7    
2687 C C5    . DG  B 17  ? 0.3975 0.4463 0.3611 0.0483  0.0208  -0.0542 17  DG  B C5    
2688 C C6    . DG  B 17  ? 0.3923 0.4479 0.3511 0.0430  0.0212  -0.0538 17  DG  B C6    
2689 O O6    . DG  B 17  ? 0.3911 0.4412 0.3389 0.0383  0.0170  -0.0530 17  DG  B O6    
2690 N N1    . DG  B 17  ? 0.3980 0.4651 0.3622 0.0443  0.0276  -0.0563 17  DG  B N1    
2691 C C2    . DG  B 17  ? 0.3950 0.4693 0.3698 0.0540  0.0292  -0.0596 17  DG  B C2    
2692 N N2    . DG  B 17  ? 0.3942 0.4866 0.3782 0.0549  0.0343  -0.0664 17  DG  B N2    
2693 N N3    . DG  B 17  ? 0.3995 0.4617 0.3728 0.0625  0.0262  -0.0583 17  DG  B N3    
2694 C C4    . DG  B 17  ? 0.4038 0.4522 0.3705 0.0571  0.0238  -0.0550 17  DG  B C4    
2695 P P     . DA  B 18  ? 0.5851 0.5238 0.4775 0.0843  0.0508  -0.0714 18  DA  B P     
2696 O OP1   . DA  B 18  ? 0.6287 0.5290 0.4905 0.1001  0.0533  -0.0728 18  DA  B OP1   
2697 O OP2   . DA  B 18  ? 0.5735 0.5123 0.4689 0.0656  0.0580  -0.0760 18  DA  B OP2   
2698 O "O5'" . DA  B 18  ? 0.5518 0.5281 0.4673 0.0882  0.0460  -0.0730 18  DA  B "O5'" 
2699 C "C5'" . DA  B 18  ? 0.5582 0.5470 0.4800 0.1053  0.0392  -0.0748 18  DA  B "C5'" 
2700 C "C4'" . DA  B 18  ? 0.5351 0.5623 0.4811 0.1020  0.0389  -0.0795 18  DA  B "C4'" 
2701 O "O4'" . DA  B 18  ? 0.5219 0.5675 0.4812 0.0880  0.0370  -0.0745 18  DA  B "O4'" 
2702 C "C3'" . DA  B 18  ? 0.5410 0.5704 0.4854 0.0944  0.0469  -0.0835 18  DA  B "C3'" 
2703 O "O3'" . DA  B 18  ? 0.5641 0.5902 0.5042 0.1101  0.0478  -0.0916 18  DA  B "O3'" 
2704 C "C2'" . DA  B 18  ? 0.5196 0.5792 0.4812 0.0828  0.0481  -0.0846 18  DA  B "C2'" 
2705 C "C1'" . DA  B 18  ? 0.4977 0.5603 0.4639 0.0768  0.0421  -0.0771 18  DA  B "C1'" 
2706 N N9    . DA  B 18  ? 0.4765 0.5304 0.4354 0.0637  0.0415  -0.0715 18  DA  B N9    
2707 C C8    . DA  B 18  ? 0.4778 0.5150 0.4296 0.0608  0.0390  -0.0683 18  DA  B C8    
2708 N N7    . DA  B 18  ? 0.4639 0.5027 0.4136 0.0514  0.0361  -0.0675 18  DA  B N7    
2709 C C5    . DA  B 18  ? 0.4586 0.5083 0.4072 0.0475  0.0375  -0.0675 18  DA  B C5    
2710 C C6    . DA  B 18  ? 0.4613 0.5089 0.3986 0.0402  0.0350  -0.0666 18  DA  B C6    
2711 N N6    . DA  B 18  ? 0.4639 0.5040 0.3938 0.0385  0.0270  -0.0669 18  DA  B N6    
2712 N N1    . DA  B 18  ? 0.4684 0.5198 0.3989 0.0351  0.0410  -0.0675 18  DA  B N1    
2713 C C2    . DA  B 18  ? 0.4657 0.5315 0.4089 0.0373  0.0487  -0.0719 18  DA  B C2    
2714 N N3    . DA  B 18  ? 0.4561 0.5302 0.4144 0.0476  0.0485  -0.0746 18  DA  B N3    
2715 C C4    . DA  B 18  ? 0.4677 0.5286 0.4240 0.0527  0.0427  -0.0708 18  DA  B C4    
2716 P P     . DG  B 19  ? 0.5699 0.5904 0.5031 0.1079  0.0559  -0.0970 19  DG  B P     
2717 O OP1   . DG  B 19  ? 0.6066 0.6272 0.5379 0.1292  0.0534  -0.1067 19  DG  B OP1   
2718 O OP2   . DG  B 19  ? 0.5873 0.5802 0.5028 0.0965  0.0613  -0.0925 19  DG  B OP2   
2719 O "O5'" . DG  B 19  ? 0.5667 0.6195 0.5183 0.0936  0.0602  -0.0999 19  DG  B "O5'" 
2720 C "C5'" . DG  B 19  ? 0.5674 0.6526 0.5390 0.0972  0.0615  -0.1101 19  DG  B "C5'" 
2721 C "C4'" . DG  B 19  ? 0.5657 0.6627 0.5387 0.0786  0.0706  -0.1115 19  DG  B "C4'" 
2722 O "O4'" . DG  B 19  ? 0.5590 0.6452 0.5226 0.0649  0.0681  -0.1003 19  DG  B "O4'" 
2723 C "C3'" . DG  B 19  ? 0.5954 0.6780 0.5548 0.0764  0.0773  -0.1138 19  DG  B "C3'" 
2724 O "O3'" . DG  B 19  ? 0.6357 0.7360 0.5997 0.0653  0.0870  -0.1217 19  DG  B "O3'" 
2725 C "C2'" . DG  B 19  ? 0.5901 0.6499 0.5326 0.0664  0.0747  -0.1035 19  DG  B "C2'" 
2726 C "C1'" . DG  B 19  ? 0.5678 0.6369 0.5142 0.0566  0.0711  -0.0977 19  DG  B "C1'" 
2727 N N9    . DG  B 19  ? 0.5446 0.5990 0.4822 0.0520  0.0639  -0.0893 19  DG  B N9    
2728 C C8    . DG  B 19  ? 0.5485 0.5887 0.4842 0.0568  0.0595  -0.0867 19  DG  B C8    
2729 N N7    . DG  B 19  ? 0.5301 0.5654 0.4620 0.0501  0.0539  -0.0831 19  DG  B N7    
2730 C C5    . DG  B 19  ? 0.5261 0.5670 0.4516 0.0429  0.0527  -0.0819 19  DG  B C5    
2731 C C6    . DG  B 19  ? 0.5169 0.5520 0.4311 0.0378  0.0451  -0.0796 19  DG  B C6    
2732 O O6    . DG  B 19  ? 0.5142 0.5463 0.4297 0.0383  0.0371  -0.0800 19  DG  B O6    
2733 N N1    . DG  B 19  ? 0.5295 0.5607 0.4275 0.0320  0.0475  -0.0785 19  DG  B N1    
2734 C C2    . DG  B 19  ? 0.5383 0.5756 0.4361 0.0280  0.0586  -0.0812 19  DG  B C2    
2735 N N2    . DG  B 19  ? 0.5538 0.5795 0.4286 0.0190  0.0630  -0.0807 19  DG  B N2    
2736 N N3    . DG  B 19  ? 0.5398 0.5909 0.4555 0.0330  0.0654  -0.0861 19  DG  B N3    
2737 C C4    . DG  B 19  ? 0.5332 0.5834 0.4600 0.0420  0.0606  -0.0853 19  DG  B C4    
2738 P P     . DG  B 20  ? 0.6873 0.7809 0.6405 0.0617  0.0961  -0.1277 20  DG  B P     
2739 O OP1   . DG  B 20  ? 0.7192 0.8364 0.6904 0.0718  0.1013  -0.1435 20  DG  B OP1   
2740 O OP2   . DG  B 20  ? 0.6807 0.7460 0.6152 0.0627  0.0931  -0.1207 20  DG  B OP2   
2741 O "O5'" . DG  B 20  ? 0.6736 0.7646 0.6127 0.0412  0.1036  -0.1255 20  DG  B "O5'" 
2742 C "C5'" . DG  B 20  ? 0.6478 0.7530 0.5920 0.0295  0.1090  -0.1283 20  DG  B "C5'" 
2743 C "C4'" . DG  B 20  ? 0.6573 0.7388 0.5697 0.0128  0.1142  -0.1226 20  DG  B "C4'" 
2744 O "O4'" . DG  B 20  ? 0.6438 0.7042 0.5416 0.0156  0.1007  -0.1093 20  DG  B "O4'" 
2745 C "C3'" . DG  B 20  ? 0.6680 0.7355 0.5618 0.0098  0.1208  -0.1262 20  DG  B "C3'" 
2746 O "O3'" . DG  B 20  ? 0.6930 0.7434 0.5573 -0.0076 0.1316  -0.1272 20  DG  B "O3'" 
2747 C "C2'" . DG  B 20  ? 0.6619 0.7103 0.5456 0.0188  0.1074  -0.1170 20  DG  B "C2'" 
2748 C "C1'" . DG  B 20  ? 0.6484 0.6885 0.5255 0.0166  0.0974  -0.1073 20  DG  B "C1'" 
2749 N N9    . DG  B 20  ? 0.6241 0.6580 0.5055 0.0254  0.0841  -0.1013 20  DG  B N9    
2750 C C8    . DG  B 20  ? 0.6068 0.6463 0.5061 0.0355  0.0812  -0.1023 20  DG  B C8    
2751 N N7    . DG  B 20  ? 0.5950 0.6261 0.4931 0.0375  0.0721  -0.0986 20  DG  B N7    
2752 C C5    . DG  B 20  ? 0.5954 0.6184 0.4765 0.0316  0.0657  -0.0956 20  DG  B C5    
2753 C C6    . DG  B 20  ? 0.5814 0.5976 0.4563 0.0327  0.0536  -0.0947 20  DG  B C6    
2754 O O6    . DG  B 20  ? 0.5732 0.5922 0.4599 0.0355  0.0486  -0.0974 20  DG  B O6    
2755 N N1    . DG  B 20  ? 0.6009 0.6039 0.4506 0.0300  0.0477  -0.0924 20  DG  B N1    
2756 C C2    . DG  B 20  ? 0.6226 0.6146 0.4508 0.0233  0.0560  -0.0905 20  DG  B C2    
2757 N N2    . DG  B 20  ? 0.6442 0.6123 0.4380 0.0220  0.0493  -0.0879 20  DG  B N2    
2758 N N3    . DG  B 20  ? 0.6258 0.6274 0.4630 0.0183  0.0704  -0.0930 20  DG  B N3    
2759 C C4    . DG  B 20  ? 0.6128 0.6324 0.4788 0.0245  0.0730  -0.0958 20  DG  B C4    
2760 P P     . DA  B 21  ? 0.7372 0.7585 0.5649 -0.0133 0.1354  -0.1267 21  DA  B P     
2761 O OP1   . DA  B 21  ? 0.7764 0.7881 0.5816 -0.0323 0.1547  -0.1346 21  DA  B OP1   
2762 O OP2   . DA  B 21  ? 0.7049 0.7332 0.5463 -0.0008 0.1311  -0.1297 21  DA  B OP2   
2763 O "O5'" . DA  B 21  ? 0.7577 0.7473 0.5534 -0.0109 0.1197  -0.1140 21  DA  B "O5'" 
2764 C "C5'" . DA  B 21  ? 0.7754 0.7459 0.5475 -0.0187 0.1182  -0.1075 21  DA  B "C5'" 
2765 C "C4'" . DA  B 21  ? 0.8019 0.7346 0.5305 -0.0138 0.1041  -0.1006 21  DA  B "C4'" 
2766 O "O4'" . DA  B 21  ? 0.7650 0.7086 0.5134 0.0012  0.0846  -0.0971 21  DA  B "O4'" 
2767 C "C3'" . DA  B 21  ? 0.8375 0.7473 0.5335 -0.0148 0.1070  -0.1050 21  DA  B "C3'" 
2768 O "O3'" . DA  B 21  ? 0.8992 0.7629 0.5382 -0.0164 0.1009  -0.0999 21  DA  B "O3'" 
2769 C "C2'" . DA  B 21  ? 0.8054 0.7335 0.5271 -0.0002 0.0934  -0.1074 21  DA  B "C2'" 
2770 C "C1'" . DA  B 21  ? 0.7707 0.7085 0.5107 0.0087  0.0772  -0.1018 21  DA  B "C1'" 
2771 N N9    . DA  B 21  ? 0.7233 0.6884 0.5036 0.0173  0.0713  -0.1045 21  DA  B N9    
2772 C C8    . DA  B 21  ? 0.6909 0.6785 0.5036 0.0181  0.0808  -0.1076 21  DA  B C8    
2773 N N7    . DA  B 21  ? 0.6658 0.6638 0.5003 0.0252  0.0740  -0.1089 21  DA  B N7    
2774 C C5    . DA  B 21  ? 0.6551 0.6447 0.4780 0.0283  0.0595  -0.1087 21  DA  B C5    
2775 C C6    . DA  B 21  ? 0.6274 0.6244 0.4647 0.0330  0.0493  -0.1132 21  DA  B C6    
2776 N N6    . DA  B 21  ? 0.6064 0.6132 0.4669 0.0335  0.0544  -0.1166 21  DA  B N6    
2777 N N1    . DA  B 21  ? 0.6381 0.6293 0.4617 0.0373  0.0341  -0.1163 21  DA  B N1    
2778 C C2    . DA  B 21  ? 0.6777 0.6484 0.4676 0.0384  0.0289  -0.1122 21  DA  B C2    
2779 N N3    . DA  B 21  ? 0.7018 0.6562 0.4688 0.0318  0.0398  -0.1060 21  DA  B N3    
2780 C C4    . DA  B 21  ? 0.6976 0.6668 0.4868 0.0259  0.0557  -0.1057 21  DA  B C4    
2781 P P     . DT  B 22  ? 0.9485 0.7709 0.5325 -0.0139 0.0975  -0.1023 22  DT  B P     
2782 O OP1   . DT  B 22  ? 0.9983 0.7664 0.5172 -0.0220 0.1018  -0.0974 22  DT  B OP1   
2783 O OP2   . DT  B 22  ? 0.9036 0.7446 0.5059 -0.0178 0.1097  -0.1105 22  DT  B OP2   
2784 O "O5'" . DT  B 22  ? 0.9373 0.7613 0.5233 0.0075  0.0688  -0.1022 22  DT  B "O5'" 
2785 C "C5'" . DT  B 22  ? 0.9350 0.7465 0.5088 0.0172  0.0512  -0.0970 22  DT  B "C5'" 
2786 C "C4'" . DT  B 22  ? 0.9210 0.7468 0.5080 0.0363  0.0270  -0.1046 22  DT  B "C4'" 
2787 O "O4'" . DT  B 22  ? 0.8515 0.7264 0.5021 0.0357  0.0301  -0.1087 22  DT  B "O4'" 
2788 C "C3'" . DT  B 22  ? 0.9501 0.7556 0.5033 0.0432  0.0208  -0.1132 22  DT  B "C3'" 
2789 O "O3'" . DT  B 22  ? 1.0217 0.7958 0.5307 0.0614  -0.0040 -0.1165 22  DT  B "O3'" 
2790 C "C2'" . DT  B 22  ? 0.8912 0.7414 0.4979 0.0438  0.0230  -0.1224 22  DT  B "C2'" 
2791 C "C1'" . DT  B 22  ? 0.8373 0.7227 0.4945 0.0447  0.0200  -0.1205 22  DT  B "C1'" 
2792 N N1    . DT  B 22  ? 0.7759 0.6986 0.4848 0.0397  0.0304  -0.1246 22  DT  B N1    
2793 C C2    . DT  B 22  ? 0.7269 0.6744 0.4679 0.0461  0.0196  -0.1332 22  DT  B C2    
2794 O O2    . DT  B 22  ? 0.7247 0.6724 0.4606 0.0558  0.0016  -0.1390 22  DT  B O2    
2795 N N3    . DT  B 22  ? 0.6978 0.6678 0.4747 0.0406  0.0315  -0.1368 22  DT  B N3    
2796 C C4    . DT  B 22  ? 0.6869 0.6590 0.4722 0.0334  0.0495  -0.1327 22  DT  B C4    
2797 O O4    . DT  B 22  ? 0.6678 0.6535 0.4791 0.0317  0.0573  -0.1362 22  DT  B O4    
2798 C C5    . DT  B 22  ? 0.7194 0.6736 0.4776 0.0282  0.0586  -0.1260 22  DT  B C5    
2799 C C7    . DT  B 22  ? 0.7181 0.6796 0.4880 0.0216  0.0775  -0.1258 22  DT  B C7    
2800 C C6    . DT  B 22  ? 0.7498 0.6791 0.4705 0.0297  0.0503  -0.1223 22  DT  B C6    
2801 P P     . DA  B 23  ? 1.0514 0.8093 0.5271 0.0794  -0.0243 -0.1302 23  DA  B P     
2802 O OP1   . DA  B 23  ? 1.0844 0.7916 0.4949 0.0969  -0.0456 -0.1295 23  DA  B OP1   
2803 O OP2   . DA  B 23  ? 1.0639 0.8150 0.5293 0.0677  -0.0062 -0.1316 23  DA  B OP2   
2804 O "O5'" . DA  B 23  ? 1.0152 0.8313 0.5564 0.0891  -0.0388 -0.1453 23  DA  B "O5'" 
2805 C "C5'" . DA  B 23  ? 0.9870 0.8296 0.5641 0.0945  -0.0494 -0.1462 23  DA  B "C5'" 
2806 C "C4'" . DA  B 23  ? 0.9805 0.8642 0.5967 0.1070  -0.0678 -0.1680 23  DA  B "C4'" 
2807 O "O4'" . DA  B 23  ? 0.9091 0.8363 0.5853 0.0924  -0.0509 -0.1722 23  DA  B "O4'" 
2808 C "C3'" . DA  B 23  ? 1.0409 0.9165 0.6299 0.1223  -0.0852 -0.1862 23  DA  B "C3'" 
2809 O "O3'" . DA  B 23  ? 1.0961 1.0021 0.7088 0.1398  -0.1102 -0.2085 23  DA  B "O3'" 
2810 C "C2'" . DA  B 23  ? 0.9890 0.8871 0.6081 0.1064  -0.0647 -0.1893 23  DA  B "C2'" 
2811 C "C1'" . DA  B 23  ? 0.9151 0.8534 0.5961 0.0924  -0.0499 -0.1869 23  DA  B "C1'" 
2812 N N9    . DA  B 23  ? 0.8609 0.8079 0.5650 0.0743  -0.0234 -0.1781 23  DA  B N9    
2813 C C8    . DA  B 23  ? 0.8424 0.7663 0.5237 0.0647  -0.0058 -0.1644 23  DA  B C8    
2814 N N7    . DA  B 23  ? 0.8044 0.7460 0.5172 0.0528  0.0135  -0.1623 23  DA  B N7    
2815 C C5    . DA  B 23  ? 0.7657 0.7378 0.5189 0.0529  0.0102  -0.1740 23  DA  B C5    
2816 C C6    . DA  B 23  ? 0.7216 0.7133 0.5109 0.0436  0.0252  -0.1775 23  DA  B C6    
2817 N N6    . DA  B 23  ? 0.7111 0.6980 0.5044 0.0360  0.0438  -0.1698 23  DA  B N6    
2818 N N1    . DA  B 23  ? 0.6977 0.7115 0.5156 0.0426  0.0209  -0.1915 23  DA  B N1    
2819 C C2    . DA  B 23  ? 0.7131 0.7369 0.5308 0.0519  0.0010  -0.2028 23  DA  B C2    
2820 N N3    . DA  B 23  ? 0.7475 0.7564 0.5342 0.0651  -0.0176 -0.2008 23  DA  B N3    
2821 C C4    . DA  B 23  ? 0.7932 0.7723 0.5448 0.0644  -0.0112 -0.1849 23  DA  B C4    
2822 P P     . DC  B 24  ? 1.2227 1.1371 0.8210 0.1620  -0.1369 -0.2376 24  DC  B P     
2823 O OP1   . DC  B 24  ? 1.2432 1.1412 0.8099 0.1896  -0.1687 -0.2472 24  DC  B OP1   
2824 O OP2   . DC  B 24  ? 1.1598 1.0443 0.7185 0.1588  -0.1289 -0.2342 24  DC  B OP2   
2825 O "O5'" . DC  B 24  ? 1.1794 1.1618 0.8551 0.1534  -0.1333 -0.2623 24  DC  B "O5'" 
2826 C "C5'" . DC  B 24  ? 1.1051 1.1208 0.8361 0.1357  -0.1162 -0.2581 24  DC  B "C5'" 
2827 C "C4'" . DC  B 24  ? 1.0786 1.1397 0.8634 0.1202  -0.1022 -0.2791 24  DC  B "C4'" 
2828 O "O4'" . DC  B 24  ? 1.0609 1.1111 0.8507 0.0991  -0.0730 -0.2609 24  DC  B "O4'" 
2829 C "C3'" . DC  B 24  ? 1.1197 1.2031 0.9074 0.1314  -0.1184 -0.3119 24  DC  B "C3'" 
2830 O "O3'" . DC  B 24  ? 1.0959 1.2324 0.9415 0.1215  -0.1141 -0.3426 24  DC  B "O3'" 
2831 C "C2'" . DC  B 24  ? 1.1017 1.1614 0.8668 0.1210  -0.1013 -0.2996 24  DC  B "C2'" 
2832 C "C1'" . DC  B 24  ? 1.0537 1.1140 0.8460 0.0964  -0.0699 -0.2782 24  DC  B "C1'" 
2833 N N1    . DC  B 24  ? 1.0346 1.0677 0.8080 0.0839  -0.0478 -0.2563 24  DC  B N1    
2834 C C2    . DC  B 24  ? 0.9691 1.0145 0.7741 0.0645  -0.0222 -0.2538 24  DC  B C2    
2835 O O2    . DC  B 24  ? 0.9328 1.0059 0.7755 0.0560  -0.0168 -0.2689 24  DC  B O2    
2836 N N3    . DC  B 24  ? 0.9242 0.9481 0.7148 0.0559  -0.0037 -0.2366 24  DC  B N3    
2837 C C4    . DC  B 24  ? 0.9411 0.9349 0.6906 0.0620  -0.0068 -0.2225 24  DC  B C4    
2838 N N4    . DC  B 24  ? 0.9158 0.8944 0.6569 0.0523  0.0128  -0.2092 24  DC  B N4    
2839 C C5    . DC  B 24  ? 0.9972 0.9716 0.7083 0.0787  -0.0298 -0.2237 24  DC  B C5    
2840 C C6    . DC  B 24  ? 1.0374 1.0311 0.7606 0.0910  -0.0511 -0.2402 24  DC  B C6    
2841 P P     . DC  B 25  ? 1.1425 1.3222 1.0082 0.1358  -0.1371 -0.3897 25  DC  B P     
2842 O OP1   . DC  B 25  ? 1.0816 1.2944 0.9742 0.1486  -0.1568 -0.4122 25  DC  B OP1   
2843 O OP2   . DC  B 25  ? 1.1340 1.2853 0.9492 0.1558  -0.1557 -0.3905 25  DC  B OP2   
2844 O "O5'" . DC  B 25  ? 1.1256 1.3415 1.0414 0.1064  -0.1085 -0.4096 25  DC  B "O5'" 
2845 C "C5'" . DC  B 25  ? 1.1340 1.3270 1.0497 0.0810  -0.0745 -0.3845 25  DC  B "C5'" 
2846 C "C4'" . DC  B 25  ? 1.1649 1.3729 1.0950 0.0661  -0.0593 -0.4052 25  DC  B "C4'" 
2847 O "O4'" . DC  B 25  ? 1.1815 1.3501 1.0863 0.0549  -0.0374 -0.3736 25  DC  B "O4'" 
2848 C "C3'" . DC  B 25  ? 1.2250 1.4515 1.1459 0.0841  -0.0836 -0.4354 25  DC  B "C3'" 
2849 O "O3'" . DC  B 25  ? 1.2166 1.4968 1.1845 0.0749  -0.0829 -0.4816 25  DC  B "O3'" 
2850 C "C2'" . DC  B 25  ? 1.2471 1.4415 1.1369 0.0786  -0.0708 -0.4185 25  DC  B "C2'" 
2851 C "C1'" . DC  B 25  ? 1.2282 1.3899 1.1127 0.0590  -0.0404 -0.3814 25  DC  B "C1'" 
2852 N N1    . DC  B 25  ? 1.2344 1.3497 1.0733 0.0655  -0.0381 -0.3458 25  DC  B N1    
2853 C C2    . DC  B 25  ? 1.1766 1.2699 1.0136 0.0483  -0.0100 -0.3230 25  DC  B C2    
2854 O O2    . DC  B 25  ? 1.1128 1.2181 0.9786 0.0301  0.0107  -0.3307 25  DC  B O2    
2855 N N3    . DC  B 25  ? 1.1993 1.2571 1.0005 0.0522  -0.0059 -0.2956 25  DC  B N3    
2856 C C4    . DC  B 25  ? 1.2392 1.2760 1.0015 0.0695  -0.0259 -0.2883 25  DC  B C4    
2857 N N4    . DC  B 25  ? 1.2300 1.2312 0.9573 0.0685  -0.0170 -0.2637 25  DC  B N4    
2858 C C5    . DC  B 25  ? 1.2760 1.3251 1.0308 0.0889  -0.0555 -0.3081 25  DC  B C5    
2859 C C6    . DC  B 25  ? 1.2730 1.3649 1.0698 0.0876  -0.0619 -0.3372 25  DC  B C6    
2860 O "O5'" . DG  C 1   ? 0.6703 0.6085 0.5329 0.1434  0.0380  -0.0623 1   DG  C "O5'" 
2861 C "C5'" . DG  C 1   ? 0.7157 0.6030 0.5324 0.1522  0.0289  -0.0615 1   DG  C "C5'" 
2862 C "C4'" . DG  C 1   ? 0.7244 0.5835 0.5211 0.1316  0.0404  -0.0503 1   DG  C "C4'" 
2863 O "O4'" . DG  C 1   ? 0.6742 0.5680 0.5056 0.1155  0.0548  -0.0454 1   DG  C "O4'" 
2864 C "C3'" . DG  C 1   ? 0.7391 0.5626 0.5071 0.1185  0.0417  -0.0449 1   DG  C "C3'" 
2865 O "O3'" . DG  C 1   ? 0.7579 0.5404 0.4875 0.1056  0.0471  -0.0410 1   DG  C "O3'" 
2866 C "C2'" . DG  C 1   ? 0.6942 0.5537 0.4994 0.1019  0.0534  -0.0406 1   DG  C "C2'" 
2867 C "C1'" . DG  C 1   ? 0.6595 0.5469 0.4899 0.0977  0.0622  -0.0394 1   DG  C "C1'" 
2868 N N9    . DG  C 1   ? 0.6094 0.5362 0.4779 0.0905  0.0691  -0.0379 1   DG  C N9    
2869 C C8    . DG  C 1   ? 0.5966 0.5578 0.4935 0.0965  0.0687  -0.0418 1   DG  C C8    
2870 N N7    . DG  C 1   ? 0.5671 0.5488 0.4850 0.0851  0.0763  -0.0385 1   DG  C N7    
2871 C C5    . DG  C 1   ? 0.5476 0.5124 0.4548 0.0742  0.0804  -0.0337 1   DG  C C5    
2872 C C6    . DG  C 1   ? 0.5263 0.5001 0.4445 0.0632  0.0860  -0.0311 1   DG  C C6    
2873 O O6    . DG  C 1   ? 0.5143 0.5050 0.4485 0.0602  0.0881  -0.0302 1   DG  C O6    
2874 N N1    . DG  C 1   ? 0.5506 0.5093 0.4554 0.0551  0.0886  -0.0316 1   DG  C N1    
2875 C C2    . DG  C 1   ? 0.5652 0.4981 0.4440 0.0534  0.0881  -0.0330 1   DG  C C2    
2876 N N2    . DG  C 1   ? 0.5746 0.4997 0.4432 0.0406  0.0934  -0.0363 1   DG  C N2    
2877 N N3    . DG  C 1   ? 0.5728 0.4876 0.4336 0.0633  0.0824  -0.0331 1   DG  C N3    
2878 C C4    . DG  C 1   ? 0.5724 0.5064 0.4509 0.0753  0.0777  -0.0340 1   DG  C C4    
2879 P P     . DG  C 2   ? 0.7957 0.5166 0.4670 0.0974  0.0432  -0.0399 2   DG  C P     
2880 O OP1   . DG  C 2   ? 0.8060 0.4828 0.4323 0.0872  0.0473  -0.0390 2   DG  C OP1   
2881 O OP2   . DG  C 2   ? 0.8133 0.5184 0.4700 0.1181  0.0262  -0.0441 2   DG  C OP2   
2882 O "O5'" . DG  C 2   ? 0.7612 0.5008 0.4515 0.0736  0.0565  -0.0368 2   DG  C "O5'" 
2883 C "C5'" . DG  C 2   ? 0.7403 0.4702 0.4230 0.0720  0.0524  -0.0367 2   DG  C "C5'" 
2884 C "C4'" . DG  C 2   ? 0.7047 0.4600 0.4108 0.0491  0.0666  -0.0358 2   DG  C "C4'" 
2885 O "O4'" . DG  C 2   ? 0.6447 0.4553 0.4056 0.0518  0.0714  -0.0350 2   DG  C "O4'" 
2886 C "C3'" . DG  C 2   ? 0.6971 0.4451 0.3978 0.0453  0.0638  -0.0356 2   DG  C "C3'" 
2887 O "O3'" . DG  C 2   ? 0.7137 0.4458 0.3932 0.0190  0.0762  -0.0381 2   DG  C "O3'" 
2888 C "C2'" . DG  C 2   ? 0.6394 0.4411 0.3955 0.0542  0.0627  -0.0346 2   DG  C "C2'" 
2889 C "C1'" . DG  C 2   ? 0.6051 0.4408 0.3926 0.0499  0.0715  -0.0344 2   DG  C "C1'" 
2890 N N9    . DG  C 2   ? 0.5628 0.4391 0.3914 0.0617  0.0691  -0.0335 2   DG  C N9    
2891 C C8    . DG  C 2   ? 0.5512 0.4377 0.3889 0.0796  0.0602  -0.0356 2   DG  C C8    
2892 N N7    . DG  C 2   ? 0.5194 0.4443 0.3931 0.0810  0.0631  -0.0359 2   DG  C N7    
2893 C C5    . DG  C 2   ? 0.4941 0.4293 0.3798 0.0662  0.0722  -0.0326 2   DG  C C5    
2894 C C6    . DG  C 2   ? 0.4773 0.4408 0.3906 0.0613  0.0771  -0.0313 2   DG  C C6    
2895 O O6    . DG  C 2   ? 0.4561 0.4413 0.3879 0.0649  0.0772  -0.0321 2   DG  C O6    
2896 N N1    . DG  C 2   ? 0.4769 0.4399 0.3909 0.0502  0.0823  -0.0309 2   DG  C N1    
2897 C C2    . DG  C 2   ? 0.4951 0.4404 0.3905 0.0416  0.0850  -0.0334 2   DG  C C2    
2898 N N2    . DG  C 2   ? 0.4998 0.4559 0.4032 0.0325  0.0894  -0.0373 2   DG  C N2    
2899 N N3    . DG  C 2   ? 0.5221 0.4393 0.3893 0.0413  0.0832  -0.0339 2   DG  C N3    
2900 C C4    . DG  C 2   ? 0.5224 0.4328 0.3844 0.0553  0.0757  -0.0325 2   DG  C C4    
2901 P P     . DT  C 3   ? 0.7310 0.4465 0.3926 0.0054  0.0782  -0.0397 3   DT  C P     
2902 O OP1   . DT  C 3   ? 0.7678 0.4459 0.3831 -0.0214 0.0897  -0.0449 3   DT  C OP1   
2903 O OP2   . DT  C 3   ? 0.7600 0.4535 0.4069 0.0255  0.0625  -0.0366 3   DT  C OP2   
2904 O "O5'" . DT  C 3   ? 0.6601 0.4362 0.3814 0.0030  0.0839  -0.0407 3   DT  C "O5'" 
2905 C "C5'" . DT  C 3   ? 0.6281 0.4361 0.3734 -0.0113 0.0958  -0.0465 3   DT  C "C5'" 
2906 C "C4'" . DT  C 3   ? 0.5801 0.4360 0.3753 -0.0047 0.0947  -0.0462 3   DT  C "C4'" 
2907 O "O4'" . DT  C 3   ? 0.5487 0.4205 0.3675 0.0155  0.0864  -0.0395 3   DT  C "O4'" 
2908 C "C3'" . DT  C 3   ? 0.5786 0.4361 0.3769 -0.0079 0.0926  -0.0464 3   DT  C "C3'" 
2909 O "O3'" . DT  C 3   ? 0.5654 0.4519 0.3838 -0.0217 0.1007  -0.0555 3   DT  C "O3'" 
2910 C "C2'" . DT  C 3   ? 0.5510 0.4296 0.3792 0.0114  0.0830  -0.0396 3   DT  C "C2'" 
2911 C "C1'" . DT  C 3   ? 0.5321 0.4307 0.3805 0.0194  0.0838  -0.0382 3   DT  C "C1'" 
2912 N N1    . DT  C 3   ? 0.5108 0.4232 0.3779 0.0362  0.0764  -0.0335 3   DT  C N1    
2913 C C2    . DT  C 3   ? 0.4893 0.4327 0.3879 0.0382  0.0776  -0.0325 3   DT  C C2    
2914 O O2    . DT  C 3   ? 0.4771 0.4340 0.3872 0.0307  0.0817  -0.0350 3   DT  C O2    
2915 N N3    . DT  C 3   ? 0.4732 0.4302 0.3862 0.0491  0.0731  -0.0304 3   DT  C N3    
2916 C C4    . DT  C 3   ? 0.4824 0.4320 0.3872 0.0610  0.0663  -0.0317 3   DT  C C4    
2917 O O4    . DT  C 3   ? 0.4783 0.4494 0.4011 0.0684  0.0641  -0.0337 3   DT  C O4    
2918 C C5    . DT  C 3   ? 0.5158 0.4300 0.3864 0.0631  0.0620  -0.0327 3   DT  C C5    
2919 C C7    . DT  C 3   ? 0.5337 0.4339 0.3890 0.0806  0.0505  -0.0364 3   DT  C C7    
2920 C C6    . DT  C 3   ? 0.5290 0.4233 0.3800 0.0491  0.0680  -0.0324 3   DT  C C6    
2921 P P     . DA  C 4   ? 0.5483 0.4431 0.3718 -0.0305 0.1019  -0.0601 4   DA  C P     
2922 O OP1   . DA  C 4   ? 0.5607 0.4687 0.3809 -0.0517 0.1135  -0.0754 4   DA  C OP1   
2923 O OP2   . DA  C 4   ? 0.5732 0.4315 0.3673 -0.0273 0.0958  -0.0531 4   DA  C OP2   
2924 O "O5'" . DA  C 4   ? 0.4966 0.4267 0.3625 -0.0145 0.0946  -0.0560 4   DA  C "O5'" 
2925 C "C5'" . DA  C 4   ? 0.4617 0.4234 0.3549 -0.0117 0.0957  -0.0618 4   DA  C "C5'" 
2926 C "C4'" . DA  C 4   ? 0.4352 0.4157 0.3545 0.0007  0.0881  -0.0571 4   DA  C "C4'" 
2927 O "O4'" . DA  C 4   ? 0.4270 0.4015 0.3497 0.0129  0.0832  -0.0459 4   DA  C "O4'" 
2928 C "C3'" . DA  C 4   ? 0.4259 0.4067 0.3473 -0.0016 0.0854  -0.0570 4   DA  C "C3'" 
2929 O "O3'" . DA  C 4   ? 0.4000 0.4053 0.3412 -0.0003 0.0832  -0.0654 4   DA  C "O3'" 
2930 C "C2'" . DA  C 4   ? 0.4313 0.4044 0.3561 0.0098  0.0786  -0.0450 4   DA  C "C2'" 
2931 C "C1'" . DA  C 4   ? 0.4302 0.4092 0.3634 0.0185  0.0777  -0.0408 4   DA  C "C1'" 
2932 N N9    . DA  C 4   ? 0.4386 0.4094 0.3684 0.0271  0.0741  -0.0339 4   DA  C N9    
2933 C C8    . DA  C 4   ? 0.4618 0.4105 0.3701 0.0294  0.0722  -0.0328 4   DA  C C8    
2934 N N7    . DA  C 4   ? 0.4618 0.4124 0.3736 0.0409  0.0670  -0.0304 4   DA  C N7    
2935 C C5    . DA  C 4   ? 0.4423 0.4180 0.3788 0.0423  0.0682  -0.0291 4   DA  C C5    
2936 C C6    . DA  C 4   ? 0.4376 0.4302 0.3887 0.0488  0.0665  -0.0291 4   DA  C C6    
2937 N N6    . DA  C 4   ? 0.4476 0.4411 0.3962 0.0591  0.0616  -0.0323 4   DA  C N6    
2938 N N1    . DA  C 4   ? 0.4244 0.4321 0.3896 0.0440  0.0697  -0.0279 4   DA  C N1    
2939 C C2    . DA  C 4   ? 0.4319 0.4367 0.3969 0.0379  0.0714  -0.0270 4   DA  C C2    
2940 N N3    . DA  C 4   ? 0.4356 0.4322 0.3933 0.0343  0.0718  -0.0293 4   DA  C N3    
2941 C C4    . DA  C 4   ? 0.4363 0.4195 0.3804 0.0346  0.0716  -0.0301 4   DA  C C4    
2942 P P     . DT  C 5   ? 0.3955 0.4077 0.3449 -0.0003 0.0790  -0.0670 5   DT  C P     
2943 O OP1   . DT  C 5   ? 0.3910 0.4282 0.3530 -0.0022 0.0785  -0.0838 5   DT  C OP1   
2944 O OP2   . DT  C 5   ? 0.4099 0.4018 0.3411 -0.0081 0.0815  -0.0627 5   DT  C OP2   
2945 O "O5'" . DT  C 5   ? 0.3909 0.4022 0.3510 0.0126  0.0711  -0.0554 5   DT  C "O5'" 
2946 C "C5'" . DT  C 5   ? 0.3921 0.4095 0.3595 0.0209  0.0676  -0.0551 5   DT  C "C5'" 
2947 C "C4'" . DT  C 5   ? 0.3955 0.4066 0.3653 0.0267  0.0633  -0.0444 5   DT  C "C4'" 
2948 O "O4'" . DT  C 5   ? 0.3970 0.4016 0.3636 0.0267  0.0663  -0.0365 5   DT  C "O4'" 
2949 C "C3'" . DT  C 5   ? 0.4049 0.4155 0.3778 0.0266  0.0587  -0.0425 5   DT  C "C3'" 
2950 O "O3'" . DT  C 5   ? 0.4223 0.4288 0.3931 0.0317  0.0527  -0.0421 5   DT  C "O3'" 
2951 C "C2'" . DT  C 5   ? 0.3988 0.4048 0.3716 0.0255  0.0603  -0.0339 5   DT  C "C2'" 
2952 C "C1'" . DT  C 5   ? 0.3989 0.4038 0.3698 0.0277  0.0636  -0.0310 5   DT  C "C1'" 
2953 N N1    . DT  C 5   ? 0.4054 0.4079 0.3742 0.0297  0.0645  -0.0282 5   DT  C N1    
2954 C C2    . DT  C 5   ? 0.4087 0.4187 0.3837 0.0323  0.0645  -0.0259 5   DT  C C2    
2955 O O2    . DT  C 5   ? 0.4086 0.4235 0.3874 0.0295  0.0656  -0.0248 5   DT  C O2    
2956 N N3    . DT  C 5   ? 0.4180 0.4283 0.3915 0.0381  0.0627  -0.0270 5   DT  C N3    
2957 C C4    . DT  C 5   ? 0.4353 0.4298 0.3944 0.0414  0.0600  -0.0280 5   DT  C C4    
2958 O O4    . DT  C 5   ? 0.4533 0.4444 0.4071 0.0501  0.0554  -0.0302 5   DT  C O4    
2959 C C5    . DT  C 5   ? 0.4312 0.4134 0.3797 0.0339  0.0624  -0.0287 5   DT  C C5    
2960 C C7    . DT  C 5   ? 0.4524 0.4101 0.3763 0.0320  0.0616  -0.0301 5   DT  C C7    
2961 C C6    . DT  C 5   ? 0.4123 0.4037 0.3696 0.0286  0.0649  -0.0298 5   DT  C C6    
2962 P P     . DC  C 6   ? 0.4315 0.4323 0.4004 0.0320  0.0467  -0.0403 6   DC  C P     
2963 O OP1   . DC  C 6   ? 0.4655 0.4614 0.4273 0.0398  0.0378  -0.0484 6   DC  C OP1   
2964 O OP2   . DC  C 6   ? 0.4262 0.4334 0.4016 0.0276  0.0486  -0.0406 6   DC  C OP2   
2965 O "O5'" . DC  C 6   ? 0.4403 0.4316 0.4034 0.0281  0.0488  -0.0306 6   DC  C "O5'" 
2966 C "C5'" . DC  C 6   ? 0.4537 0.4402 0.4107 0.0277  0.0521  -0.0279 6   DC  C "C5'" 
2967 C "C4'" . DC  C 6   ? 0.4655 0.4494 0.4187 0.0197  0.0566  -0.0225 6   DC  C "C4'" 
2968 O "O4'" . DC  C 6   ? 0.4479 0.4495 0.4159 0.0188  0.0619  -0.0221 6   DC  C "O4'" 
2969 C "C3'" . DC  C 6   ? 0.4842 0.4598 0.4302 0.0135  0.0542  -0.0208 6   DC  C "C3'" 
2970 O "O3'" . DC  C 6   ? 0.5150 0.4740 0.4413 0.0039  0.0569  -0.0186 6   DC  C "O3'" 
2971 C "C2'" . DC  C 6   ? 0.4616 0.4573 0.4259 0.0111  0.0576  -0.0207 6   DC  C "C2'" 
2972 C "C1'" . DC  C 6   ? 0.4483 0.4578 0.4224 0.0139  0.0625  -0.0218 6   DC  C "C1'" 
2973 N N1    . DC  C 6   ? 0.4321 0.4528 0.4176 0.0196  0.0615  -0.0234 6   DC  C N1    
2974 C C2    . DC  C 6   ? 0.4174 0.4537 0.4120 0.0211  0.0633  -0.0267 6   DC  C C2    
2975 O O2    . DC  C 6   ? 0.4215 0.4680 0.4187 0.0146  0.0678  -0.0292 6   DC  C O2    
2976 N N3    . DC  C 6   ? 0.4081 0.4469 0.4057 0.0293  0.0594  -0.0289 6   DC  C N3    
2977 C C4    . DC  C 6   ? 0.4173 0.4414 0.4064 0.0319  0.0565  -0.0269 6   DC  C C4    
2978 N N4    . DC  C 6   ? 0.4220 0.4395 0.4049 0.0389  0.0523  -0.0288 6   DC  C N4    
2979 C C5    . DC  C 6   ? 0.4160 0.4308 0.4002 0.0273  0.0573  -0.0250 6   DC  C C5    
2980 C C6    . DC  C 6   ? 0.4189 0.4335 0.4027 0.0235  0.0585  -0.0239 6   DC  C C6    
2981 P P     . DC  C 7   ? 0.5354 0.4759 0.4431 -0.0063 0.0551  -0.0171 7   DC  C P     
2982 O OP1   . DC  C 7   ? 0.5759 0.4850 0.4498 -0.0147 0.0560  -0.0156 7   DC  C OP1   
2983 O OP2   . DC  C 7   ? 0.5227 0.4605 0.4340 0.0022  0.0463  -0.0182 7   DC  C OP2   
2984 O "O5'" . DC  C 7   ? 0.4936 0.4610 0.4204 -0.0172 0.0638  -0.0187 7   DC  C "O5'" 
2985 C "C5'" . DC  C 7   ? 0.4845 0.4696 0.4188 -0.0246 0.0732  -0.0219 7   DC  C "C5'" 
2986 C "C4'" . DC  C 7   ? 0.4663 0.4838 0.4233 -0.0298 0.0780  -0.0281 7   DC  C "C4'" 
2987 O "O4'" . DC  C 7   ? 0.4418 0.4792 0.4224 -0.0143 0.0734  -0.0295 7   DC  C "O4'" 
2988 C "C3'" . DC  C 7   ? 0.4768 0.4915 0.4293 -0.0397 0.0775  -0.0291 7   DC  C "C3'" 
2989 O "O3'" . DC  C 7   ? 0.4936 0.5228 0.4438 -0.0586 0.0882  -0.0371 7   DC  C "O3'" 
2990 C "C2'" . DC  C 7   ? 0.4517 0.4879 0.4295 -0.0270 0.0718  -0.0308 7   DC  C "C2'" 
2991 C "C1'" . DC  C 7   ? 0.4364 0.4911 0.4308 -0.0148 0.0717  -0.0337 7   DC  C "C1'" 
2992 N N1    . DC  C 7   ? 0.4100 0.4655 0.4138 0.0003  0.0642  -0.0319 7   DC  C N1    
2993 C C2    . DC  C 7   ? 0.3945 0.4704 0.4131 0.0096  0.0616  -0.0386 7   DC  C C2    
2994 O O2    . DC  C 7   ? 0.3778 0.4782 0.4073 0.0063  0.0652  -0.0480 7   DC  C O2    
2995 N N3    . DC  C 7   ? 0.3883 0.4551 0.4055 0.0217  0.0548  -0.0366 7   DC  C N3    
2996 C C4    . DC  C 7   ? 0.3926 0.4385 0.3993 0.0220  0.0530  -0.0298 7   DC  C C4    
2997 N N4    . DC  C 7   ? 0.3886 0.4238 0.3894 0.0294  0.0486  -0.0292 7   DC  C N4    
2998 C C5    . DC  C 7   ? 0.3951 0.4288 0.3935 0.0146  0.0551  -0.0254 7   DC  C C5    
2999 C C6    . DC  C 7   ? 0.4069 0.4422 0.4017 0.0054  0.0596  -0.0258 7   DC  C C6    
3000 P P     . DT  C 8   ? 0.5116 0.5337 0.4469 -0.0785 0.0927  -0.0403 8   DT  C P     
3001 O OP1   . DT  C 8   ? 0.5487 0.5575 0.4571 -0.1019 0.1043  -0.0443 8   DT  C OP1   
3002 O OP2   . DT  C 8   ? 0.5109 0.5040 0.4327 -0.0713 0.0824  -0.0317 8   DT  C OP2   
3003 O "O5'" . DT  C 8   ? 0.4967 0.5692 0.4683 -0.0781 0.0956  -0.0531 8   DT  C "O5'" 
3004 C "C5'" . DT  C 8   ? 0.4843 0.5966 0.4806 -0.0748 0.1005  -0.0652 8   DT  C "C5'" 
3005 C "C4'" . DT  C 8   ? 0.4627 0.6136 0.4914 -0.0614 0.0945  -0.0757 8   DT  C "C4'" 
3006 O "O4'" . DT  C 8   ? 0.4379 0.5773 0.4733 -0.0370 0.0821  -0.0668 8   DT  C "O4'" 
3007 C "C3'" . DT  C 8   ? 0.4659 0.6250 0.4970 -0.0723 0.0950  -0.0807 8   DT  C "C3'" 
3008 O "O3'" . DT  C 8   ? 0.4765 0.6833 0.5284 -0.0829 0.1027  -0.1020 8   DT  C "O3'" 
3009 C "C2'" . DT  C 8   ? 0.4392 0.5959 0.4832 -0.0495 0.0813  -0.0752 8   DT  C "C2'" 
3010 C "C1'" . DT  C 8   ? 0.4261 0.5813 0.4766 -0.0286 0.0750  -0.0719 8   DT  C "C1'" 
3011 N N1    . DT  C 8   ? 0.4182 0.5467 0.4623 -0.0125 0.0650  -0.0595 8   DT  C N1    
3012 C C2    . DT  C 8   ? 0.4177 0.5535 0.4715 0.0068  0.0557  -0.0630 8   DT  C C2    
3013 O O2    . DT  C 8   ? 0.4173 0.5816 0.4862 0.0152  0.0528  -0.0766 8   DT  C O2    
3014 N N3    . DT  C 8   ? 0.4146 0.5220 0.4567 0.0161  0.0493  -0.0520 8   DT  C N3    
3015 C C4    . DT  C 8   ? 0.4105 0.4916 0.4387 0.0099  0.0506  -0.0408 8   DT  C C4    
3016 O O4    . DT  C 8   ? 0.4066 0.4700 0.4275 0.0172  0.0458  -0.0353 8   DT  C O4    
3017 C C5    . DT  C 8   ? 0.4216 0.4967 0.4414 -0.0055 0.0574  -0.0384 8   DT  C C5    
3018 C C7    . DT  C 8   ? 0.4263 0.4725 0.4288 -0.0082 0.0554  -0.0294 8   DT  C C7    
3019 C C6    . DT  C 8   ? 0.4284 0.5232 0.4533 -0.0170 0.0645  -0.0465 8   DT  C C6    
3020 P P     . DC  C 9   ? 0.5008 0.7309 0.5610 -0.0979 0.1062  -0.1144 9   DC  C P     
3021 O OP1   . DC  C 9   ? 0.4955 0.7675 0.5646 -0.1217 0.1212  -0.1372 9   DC  C OP1   
3022 O OP2   . DC  C 9   ? 0.4963 0.6795 0.5273 -0.1074 0.1047  -0.0975 9   DC  C OP2   
3023 O "O5'" . DC  C 9   ? 0.4748 0.7304 0.5647 -0.0685 0.0908  -0.1202 9   DC  C "O5'" 
3024 C "C5'" . DC  C 9   ? 0.4638 0.7527 0.5774 -0.0471 0.0840  -0.1337 9   DC  C "C5'" 
3025 C "C4'" . DC  C 9   ? 0.4551 0.7427 0.5789 -0.0190 0.0667  -0.1328 9   DC  C "C4'" 
3026 O "O4'" . DC  C 9   ? 0.4503 0.6874 0.5524 -0.0104 0.0609  -0.1088 9   DC  C "O4'" 
3027 C "C3'" . DC  C 9   ? 0.4573 0.7610 0.5912 -0.0218 0.0629  -0.1409 9   DC  C "C3'" 
3028 O "O3'" . DC  C 9   ? 0.4579 0.8081 0.6182 -0.0048 0.0534  -0.1655 9   DC  C "O3'" 
3029 C "C2'" . DC  C 9   ? 0.4483 0.7071 0.5656 -0.0086 0.0523  -0.1200 9   DC  C "C2'" 
3030 C "C1'" . DC  C 9   ? 0.4431 0.6732 0.5475 0.0049  0.0486  -0.1071 9   DC  C "C1'" 
3031 N N1    . DC  C 9   ? 0.4320 0.6157 0.5150 0.0064  0.0459  -0.0855 9   DC  C N1    
3032 C C2    . DC  C 9   ? 0.4278 0.5903 0.5031 0.0265  0.0343  -0.0795 9   DC  C C2    
3033 O O2    . DC  C 9   ? 0.4109 0.5870 0.4929 0.0443  0.0246  -0.0909 9   DC  C O2    
3034 N N3    . DC  C 9   ? 0.4343 0.5608 0.4921 0.0255  0.0335  -0.0635 9   DC  C N3    
3035 C C4    . DC  C 9   ? 0.4400 0.5522 0.4895 0.0101  0.0409  -0.0543 9   DC  C C4    
3036 N N4    . DC  C 9   ? 0.4470 0.5307 0.4828 0.0115  0.0387  -0.0429 9   DC  C N4    
3037 C C5    . DC  C 9   ? 0.4387 0.5637 0.4901 -0.0078 0.0505  -0.0583 9   DC  C C5    
3038 C C6    . DC  C 9   ? 0.4346 0.5948 0.5020 -0.0113 0.0541  -0.0735 9   DC  C C6    
3039 P P     . DC  C 10  ? 0.4884 0.8649 0.6634 -0.0071 0.0492  -0.1792 10  DC  C P     
3040 O OP1   . DC  C 10  ? 0.4743 0.9170 0.6805 -0.0028 0.0482  -0.2136 10  DC  C OP1   
3041 O OP2   . DC  C 10  ? 0.4842 0.8376 0.6430 -0.0357 0.0614  -0.1660 10  DC  C OP2   
3042 O "O5'" . DC  C 10  ? 0.4725 0.8134 0.6366 0.0210  0.0302  -0.1659 10  DC  C "O5'" 
3043 C "C5'" . DC  C 10  ? 0.4915 0.8206 0.6508 0.0513  0.0149  -0.1670 10  DC  C "C5'" 
3044 C "C4'" . DC  C 10  ? 0.5131 0.8153 0.6603 0.0725  -0.0020 -0.1617 10  DC  C "C4'" 
3045 O "O4'" . DC  C 10  ? 0.5331 0.7787 0.6522 0.0702  -0.0009 -0.1343 10  DC  C "O4'" 
3046 C "C3'" . DC  C 10  ? 0.5283 0.8468 0.6860 0.0643  -0.0026 -0.1679 10  DC  C "C3'" 
3047 O "O3'" . DC  C 10  ? 0.5566 0.8715 0.7116 0.0910  -0.0224 -0.1771 10  DC  C "O3'" 
3048 C "C2'" . DC  C 10  ? 0.5193 0.7920 0.6559 0.0474  0.0051  -0.1406 10  DC  C "C2'" 
3049 C "C1'" . DC  C 10  ? 0.5145 0.7427 0.6271 0.0631  -0.0017 -0.1246 10  DC  C "C1'" 
3050 N N1    . DC  C 10  ? 0.5047 0.6946 0.5990 0.0484  0.0074  -0.1016 10  DC  C N1    
3051 C C2    . DC  C 10  ? 0.5054 0.6533 0.5771 0.0574  0.0004  -0.0874 10  DC  C C2    
3052 O O2    . DC  C 10  ? 0.5277 0.6652 0.5902 0.0762  -0.0130 -0.0927 10  DC  C O2    
3053 N N3    . DC  C 10  ? 0.4820 0.6014 0.5400 0.0452  0.0079  -0.0704 10  DC  C N3    
3054 C C4    . DC  C 10  ? 0.4859 0.6111 0.5481 0.0278  0.0196  -0.0660 10  DC  C C4    
3055 N N4    . DC  C 10  ? 0.4788 0.5764 0.5268 0.0204  0.0238  -0.0522 10  DC  C N4    
3056 C C5    . DC  C 10  ? 0.4925 0.6513 0.5707 0.0171  0.0271  -0.0776 10  DC  C C5    
3057 C C6    . DC  C 10  ? 0.5013 0.6947 0.5972 0.0265  0.0219  -0.0958 10  DC  C C6    
3058 P P     . DA  C 11  ? 0.5913 0.9625 0.7722 0.1125  -0.0357 -0.2129 11  DA  C P     
3059 O OP1   . DA  C 11  ? 0.6093 0.9985 0.7963 0.1209  -0.0353 -0.2237 11  DA  C OP1   
3060 O OP2   . DA  C 11  ? 0.5730 0.9937 0.7815 0.0925  -0.0263 -0.2298 11  DA  C OP2   
3061 O "O5'" . DA  C 11  ? 0.5878 0.9201 0.7434 0.1475  -0.0612 -0.2121 11  DA  C "O5'" 
3062 C "C5'" . DA  C 11  ? 0.5833 0.8569 0.7020 0.1635  -0.0699 -0.1946 11  DA  C "C5'" 
3063 C "C4'" . DA  C 11  ? 0.5942 0.8152 0.6787 0.1799  -0.0860 -0.1845 11  DA  C "C4'" 
3064 O "O4'" . DA  C 11  ? 0.5823 0.7577 0.6460 0.1586  -0.0736 -0.1552 11  DA  C "O4'" 
3065 C "C3'" . DA  C 11  ? 0.5932 0.8397 0.6915 0.1895  -0.0976 -0.2016 11  DA  C "C3'" 
3066 O "O3'" . DA  C 11  ? 0.6353 0.8359 0.6962 0.2209  -0.1221 -0.2044 11  DA  C "O3'" 
3067 C "C2'" . DA  C 11  ? 0.5696 0.8088 0.6731 0.1593  -0.0806 -0.1822 11  DA  C "C2'" 
3068 C "C1'" . DA  C 11  ? 0.5711 0.7516 0.6423 0.1485  -0.0720 -0.1526 11  DA  C "C1'" 
3069 N N9    . DA  C 11  ? 0.5277 0.7083 0.6079 0.1173  -0.0510 -0.1347 11  DA  C N9    
3070 C C8    . DA  C 11  ? 0.5086 0.7294 0.6165 0.0951  -0.0350 -0.1391 11  DA  C C8    
3071 N N7    . DA  C 11  ? 0.5032 0.7036 0.6042 0.0727  -0.0210 -0.1198 11  DA  C N7    
3072 C C5    . DA  C 11  ? 0.5052 0.6566 0.5780 0.0800  -0.0270 -0.1033 11  DA  C C5    
3073 C C6    . DA  C 11  ? 0.4908 0.6073 0.5468 0.0667  -0.0192 -0.0832 11  DA  C C6    
3074 N N6    . DA  C 11  ? 0.4579 0.5788 0.5207 0.0462  -0.0062 -0.0749 11  DA  C N6    
3075 N N1    . DA  C 11  ? 0.5135 0.5889 0.5421 0.0752  -0.0261 -0.0742 11  DA  C N1    
3076 C C2    . DA  C 11  ? 0.5339 0.5948 0.5461 0.0963  -0.0409 -0.0823 11  DA  C C2    
3077 N N3    . DA  C 11  ? 0.5474 0.6331 0.5700 0.1145  -0.0524 -0.1005 11  DA  C N3    
3078 C C4    . DA  C 11  ? 0.5319 0.6677 0.5890 0.1052  -0.0442 -0.1114 11  DA  C C4    
3079 P P     . DT  C 12  ? 0.6740 0.8749 0.7308 0.2380  -0.1401 -0.2173 12  DT  C P     
3080 O OP1   . DT  C 12  ? 0.7253 0.8983 0.7502 0.2784  -0.1692 -0.2338 12  DT  C OP1   
3081 O OP2   . DT  C 12  ? 0.6202 0.8944 0.7277 0.2230  -0.1304 -0.2357 12  DT  C OP2   
3082 O "O5'" . DT  C 12  ? 0.6856 0.8232 0.7079 0.2210  -0.1330 -0.1861 12  DT  C "O5'" 
3083 C "C5'" . DT  C 12  ? 0.7140 0.7828 0.6894 0.2197  -0.1322 -0.1640 12  DT  C "C5'" 
3084 C "C4'" . DT  C 12  ? 0.7173 0.7494 0.6757 0.1968  -0.1204 -0.1402 12  DT  C "C4'" 
3085 O "O4'" . DT  C 12  ? 0.6774 0.7437 0.6708 0.1663  -0.0968 -0.1295 12  DT  C "O4'" 
3086 C "C3'" . DT  C 12  ? 0.7279 0.7531 0.6801 0.2043  -0.1320 -0.1451 12  DT  C "C3'" 
3087 O "O3'" . DT  C 12  ? 0.7801 0.7311 0.6761 0.2069  -0.1384 -0.1300 12  DT  C "O3'" 
3088 C "C2'" . DT  C 12  ? 0.6856 0.7525 0.6780 0.1764  -0.1129 -0.1389 12  DT  C "C2'" 
3089 C "C1'" . DT  C 12  ? 0.6733 0.7347 0.6692 0.1529  -0.0924 -0.1210 12  DT  C "C1'" 
3090 N N1    . DT  C 12  ? 0.6276 0.7306 0.6605 0.1269  -0.0731 -0.1173 12  DT  C N1    
3091 C C2    . DT  C 12  ? 0.6043 0.6851 0.6299 0.1049  -0.0588 -0.0970 12  DT  C C2    
3092 O O2    . DT  C 12  ? 0.6232 0.6590 0.6186 0.1037  -0.0595 -0.0838 12  DT  C O2    
3093 N N3    . DT  C 12  ? 0.5650 0.6774 0.6173 0.0837  -0.0439 -0.0950 12  DT  C N3    
3094 C C4    . DT  C 12  ? 0.5509 0.7128 0.6336 0.0777  -0.0391 -0.1104 12  DT  C C4    
3095 O O4    . DT  C 12  ? 0.5176 0.6937 0.6122 0.0556  -0.0251 -0.1060 12  DT  C O4    
3096 C C5    . DT  C 12  ? 0.5828 0.7742 0.6772 0.0990  -0.0524 -0.1333 12  DT  C C5    
3097 C C7    . DT  C 12  ? 0.5651 0.8178 0.6945 0.0912  -0.0463 -0.1554 12  DT  C C7    
3098 C C6    . DT  C 12  ? 0.6170 0.7779 0.6868 0.1245  -0.0699 -0.1357 12  DT  C C6    
3099 P P     . DT  C 13  ? 0.8258 0.7434 0.6956 0.2119  -0.1495 -0.1280 13  DT  C P     
3100 O OP1   . DT  C 13  ? 0.8887 0.7261 0.6892 0.2254  -0.1639 -0.1225 13  DT  C OP1   
3101 O OP2   . DT  C 13  ? 0.8094 0.7816 0.7172 0.2258  -0.1603 -0.1494 13  DT  C OP2   
3102 O "O5'" . DT  C 13  ? 0.8084 0.7216 0.6869 0.1774  -0.1263 -0.1062 13  DT  C "O5'" 
3103 C "C5'" . DT  C 13  ? 0.8099 0.6977 0.6738 0.1559  -0.1089 -0.0884 13  DT  C "C5'" 
3104 C "C4'" . DT  C 13  ? 0.7900 0.6798 0.6642 0.1305  -0.0933 -0.0748 13  DT  C "C4'" 
3105 O "O4'" . DT  C 13  ? 0.7288 0.6753 0.6540 0.1167  -0.0799 -0.0751 13  DT  C "O4'" 
3106 C "C3'" . DT  C 13  ? 0.8129 0.6916 0.6778 0.1361  -0.1036 -0.0777 13  DT  C "C3'" 
3107 O "O3'" . DT  C 13  ? 0.8263 0.6661 0.6627 0.1217  -0.0984 -0.0661 13  DT  C "O3'" 
3108 C "C2'" . DT  C 13  ? 0.7595 0.6999 0.6777 0.1298  -0.0979 -0.0840 13  DT  C "C2'" 
3109 C "C1'" . DT  C 13  ? 0.7165 0.6826 0.6608 0.1098  -0.0788 -0.0756 13  DT  C "C1'" 
3110 N N1    . DT  C 13  ? 0.6629 0.6865 0.6524 0.1038  -0.0724 -0.0844 13  DT  C N1    
3111 C C2    . DT  C 13  ? 0.6336 0.6733 0.6421 0.0814  -0.0557 -0.0747 13  DT  C C2    
3112 O O2    . DT  C 13  ? 0.6259 0.6407 0.6208 0.0691  -0.0471 -0.0611 13  DT  C O2    
3113 N N3    . DT  C 13  ? 0.6044 0.6897 0.6454 0.0736  -0.0498 -0.0840 13  DT  C N3    
3114 C C4    . DT  C 13  ? 0.6173 0.7417 0.6794 0.0843  -0.0571 -0.1039 13  DT  C C4    
3115 O O4    . DT  C 13  ? 0.5952 0.7593 0.6836 0.0707  -0.0479 -0.1122 13  DT  C O4    
3116 C C5    . DT  C 13  ? 0.6402 0.7525 0.6871 0.1113  -0.0763 -0.1155 13  DT  C C5    
3117 C C7    . DT  C 13  ? 0.6353 0.7942 0.7063 0.1277  -0.0875 -0.1419 13  DT  C C7    
3118 C C6    . DT  C 13  ? 0.6614 0.7202 0.6701 0.1201  -0.0835 -0.1041 13  DT  C C6    
3119 P P     . DA  C 14  ? 0.8829 0.6635 0.6681 0.1082  -0.0910 -0.0551 14  DA  C P     
3120 O OP1   . DA  C 14  ? 0.8877 0.6426 0.6453 0.1208  -0.0977 -0.0585 14  DA  C OP1   
3121 O OP2   . DA  C 14  ? 0.9159 0.6541 0.6639 0.1035  -0.0949 -0.0518 14  DA  C OP2   
3122 O "O5'" . DA  C 14  ? 0.8412 0.6546 0.6606 0.0829  -0.0688 -0.0460 14  DA  C "O5'" 
3123 C "C5'" . DA  C 14  ? 0.8091 0.5974 0.6067 0.0614  -0.0549 -0.0381 14  DA  C "C5'" 
3124 C "C4'" . DA  C 14  ? 0.7590 0.5824 0.5924 0.0455  -0.0432 -0.0344 14  DA  C "C4'" 
3125 O "O4'" . DA  C 14  ? 0.6977 0.5647 0.5731 0.0533  -0.0474 -0.0374 14  DA  C "O4'" 
3126 C "C3'" . DA  C 14  ? 0.7695 0.5669 0.5791 0.0355  -0.0422 -0.0327 14  DA  C "C3'" 
3127 O "O3'" . DA  C 14  ? 0.7350 0.5565 0.5675 0.0181  -0.0289 -0.0304 14  DA  C "O3'" 
3128 C "C2'" . DA  C 14  ? 0.7599 0.5694 0.5829 0.0506  -0.0555 -0.0362 14  DA  C "C2'" 
3129 C "C1'" . DA  C 14  ? 0.7082 0.5721 0.5827 0.0525  -0.0519 -0.0376 14  DA  C "C1'" 
3130 N N9    . DA  C 14  ? 0.6886 0.5774 0.5838 0.0684  -0.0638 -0.0455 14  DA  C N9    
3131 C C8    . DA  C 14  ? 0.7065 0.5779 0.5823 0.0875  -0.0806 -0.0535 14  DA  C C8    
3132 N N7    . DA  C 14  ? 0.6835 0.5943 0.5903 0.0991  -0.0881 -0.0642 14  DA  C N7    
3133 C C5    . DA  C 14  ? 0.6486 0.6001 0.5933 0.0840  -0.0740 -0.0613 14  DA  C C5    
3134 C C6    . DA  C 14  ? 0.6186 0.6195 0.6022 0.0820  -0.0714 -0.0698 14  DA  C C6    
3135 N N6    . DA  C 14  ? 0.6138 0.6419 0.6126 0.0962  -0.0827 -0.0857 14  DA  C N6    
3136 N N1    . DA  C 14  ? 0.5958 0.6167 0.5995 0.0642  -0.0567 -0.0634 14  DA  C N1    
3137 C C2    . DA  C 14  ? 0.5911 0.5889 0.5815 0.0529  -0.0474 -0.0510 14  DA  C C2    
3138 N N3    . DA  C 14  ? 0.6168 0.5768 0.5772 0.0530  -0.0478 -0.0446 14  DA  C N3    
3139 C C4    . DA  C 14  ? 0.6498 0.5858 0.5864 0.0673  -0.0606 -0.0494 14  DA  C C4    
3140 P P     . DT  C 15  ? 0.7905 0.5849 0.5930 -0.0009 -0.0199 -0.0312 15  DT  C P     
3141 O OP1   . DT  C 15  ? 0.7932 0.6036 0.6051 -0.0167 -0.0052 -0.0336 15  DT  C OP1   
3142 O OP2   . DT  C 15  ? 0.8040 0.5422 0.5514 0.0012  -0.0276 -0.0316 15  DT  C OP2   
3143 O "O5'" . DT  C 15  ? 0.7698 0.5921 0.6013 -0.0052 -0.0187 -0.0312 15  DT  C "O5'" 
3144 C "C5'" . DT  C 15  ? 0.7117 0.5607 0.5743 0.0065  -0.0271 -0.0297 15  DT  C "C5'" 
3145 C "C4'" . DT  C 15  ? 0.6547 0.5422 0.5553 0.0089  -0.0238 -0.0288 15  DT  C "C4'" 
3146 O "O4'" . DT  C 15  ? 0.6531 0.5538 0.5677 0.0230  -0.0333 -0.0300 15  DT  C "O4'" 
3147 C "C3'" . DT  C 15  ? 0.6166 0.5301 0.5437 0.0027  -0.0202 -0.0283 15  DT  C "C3'" 
3148 O "O3'" . DT  C 15  ? 0.5614 0.4977 0.5103 0.0029  -0.0165 -0.0275 15  DT  C "O3'" 
3149 C "C2'" . DT  C 15  ? 0.6028 0.5237 0.5401 0.0104  -0.0294 -0.0280 15  DT  C "C2'" 
3150 C "C1'" . DT  C 15  ? 0.6243 0.5496 0.5641 0.0223  -0.0352 -0.0301 15  DT  C "C1'" 
3151 N N1    . DT  C 15  ? 0.6290 0.5529 0.5664 0.0347  -0.0471 -0.0347 15  DT  C N1    
3152 C C2    . DT  C 15  ? 0.5912 0.5485 0.5566 0.0395  -0.0500 -0.0398 15  DT  C C2    
3153 O O2    . DT  C 15  ? 0.5620 0.5427 0.5483 0.0317  -0.0425 -0.0387 15  DT  C O2    
3154 N N3    . DT  C 15  ? 0.5980 0.5593 0.5634 0.0528  -0.0621 -0.0480 15  DT  C N3    
3155 C C4    . DT  C 15  ? 0.6408 0.5701 0.5770 0.0639  -0.0734 -0.0501 15  DT  C C4    
3156 O O4    . DT  C 15  ? 0.6528 0.5904 0.5919 0.0788  -0.0862 -0.0600 15  DT  C O4    
3157 C C5    . DT  C 15  ? 0.6634 0.5503 0.5643 0.0562  -0.0690 -0.0422 15  DT  C C5    
3158 C C7    . DT  C 15  ? 0.7084 0.5492 0.5662 0.0647  -0.0799 -0.0435 15  DT  C C7    
3159 C C6    . DT  C 15  ? 0.6501 0.5400 0.5557 0.0411  -0.0553 -0.0359 15  DT  C C6    
3160 P P     . DC  C 16  ? 0.5381 0.4865 0.4962 -0.0050 -0.0093 -0.0297 16  DC  C P     
3161 O OP1   . DC  C 16  ? 0.5166 0.4825 0.4934 -0.0022 -0.0097 -0.0276 16  DC  C OP1   
3162 O OP2   . DC  C 16  ? 0.5522 0.4893 0.4934 -0.0118 -0.0022 -0.0339 16  DC  C OP2   
3163 O "O5'" . DC  C 16  ? 0.5201 0.4722 0.4830 -0.0080 -0.0118 -0.0312 16  DC  C "O5'" 
3164 C "C5'" . DC  C 16  ? 0.5003 0.4657 0.4782 -0.0069 -0.0144 -0.0307 16  DC  C "C5'" 
3165 C "C4'" . DC  C 16  ? 0.5031 0.4730 0.4895 -0.0043 -0.0192 -0.0261 16  DC  C "C4'" 
3166 O "O4'" . DC  C 16  ? 0.5019 0.4672 0.4845 -0.0006 -0.0231 -0.0255 16  DC  C "O4'" 
3167 C "C3'" . DC  C 16  ? 0.5001 0.4712 0.4899 -0.0064 -0.0232 -0.0256 16  DC  C "C3'" 
3168 O "O3'" . DC  C 16  ? 0.5063 0.4821 0.5007 -0.0084 -0.0230 -0.0232 16  DC  C "O3'" 
3169 C "C2'" . DC  C 16  ? 0.4897 0.4577 0.4783 -0.0058 -0.0273 -0.0249 16  DC  C "C2'" 
3170 C "C1'" . DC  C 16  ? 0.4885 0.4588 0.4778 -0.0011 -0.0279 -0.0250 16  DC  C "C1'" 
3171 N N1    . DC  C 16  ? 0.4918 0.4519 0.4716 0.0036  -0.0333 -0.0264 16  DC  C N1    
3172 C C2    . DC  C 16  ? 0.4997 0.4688 0.4859 0.0109  -0.0396 -0.0296 16  DC  C C2    
3173 O O2    . DC  C 16  ? 0.5060 0.4961 0.5087 0.0095  -0.0383 -0.0319 16  DC  C O2    
3174 N N3    . DC  C 16  ? 0.5052 0.4599 0.4777 0.0188  -0.0474 -0.0321 16  DC  C N3    
3175 C C4    . DC  C 16  ? 0.5227 0.4503 0.4715 0.0165  -0.0469 -0.0299 16  DC  C C4    
3176 N N4    . DC  C 16  ? 0.5411 0.4466 0.4688 0.0244  -0.0556 -0.0321 16  DC  C N4    
3177 C C5    . DC  C 16  ? 0.5197 0.4420 0.4638 0.0055  -0.0379 -0.0276 16  DC  C C5    
3178 C C6    . DC  C 16  ? 0.5029 0.4438 0.4647 0.0012  -0.0324 -0.0267 16  DC  C C6    
3179 P P     . DA  C 17  ? 0.5545 0.5238 0.5442 -0.0130 -0.0265 -0.0219 17  DA  C P     
3180 O OP1   . DA  C 17  ? 0.5711 0.5384 0.5565 -0.0179 -0.0236 -0.0204 17  DA  C OP1   
3181 O OP2   . DA  C 17  ? 0.5401 0.5004 0.5228 -0.0096 -0.0311 -0.0247 17  DA  C OP2   
3182 O "O5'" . DA  C 17  ? 0.5400 0.5161 0.5358 -0.0161 -0.0285 -0.0218 17  DA  C "O5'" 
3183 C "C5'" . DA  C 17  ? 0.5764 0.5682 0.5823 -0.0183 -0.0262 -0.0240 17  DA  C "C5'" 
3184 C "C4'" . DA  C 17  ? 0.6040 0.6033 0.6154 -0.0202 -0.0300 -0.0268 17  DA  C "C4'" 
3185 O "O4'" . DA  C 17  ? 0.5980 0.5942 0.6093 -0.0107 -0.0348 -0.0276 17  DA  C "O4'" 
3186 C "C3'" . DA  C 17  ? 0.6233 0.6088 0.6247 -0.0268 -0.0322 -0.0241 17  DA  C "C3'" 
3187 O "O3'" . DA  C 17  ? 0.6753 0.6720 0.6820 -0.0349 -0.0323 -0.0280 17  DA  C "O3'" 
3188 C "C2'" . DA  C 17  ? 0.6187 0.5958 0.6177 -0.0193 -0.0370 -0.0231 17  DA  C "C2'" 
3189 C "C1'" . DA  C 17  ? 0.5939 0.5823 0.6012 -0.0127 -0.0387 -0.0264 17  DA  C "C1'" 
3190 N N9    . DA  C 17  ? 0.5533 0.5292 0.5520 -0.0060 -0.0418 -0.0260 17  DA  C N9    
3191 C C8    . DA  C 17  ? 0.5375 0.4999 0.5255 -0.0061 -0.0399 -0.0248 17  DA  C C8    
3192 N N7    . DA  C 17  ? 0.5292 0.4793 0.5056 -0.0032 -0.0420 -0.0258 17  DA  C N7    
3193 C C5    . DA  C 17  ? 0.5408 0.4953 0.5204 0.0031  -0.0480 -0.0276 17  DA  C C5    
3194 C C6    . DA  C 17  ? 0.5513 0.4923 0.5177 0.0110  -0.0551 -0.0300 17  DA  C C6    
3195 N N6    . DA  C 17  ? 0.5677 0.4820 0.5095 0.0101  -0.0552 -0.0291 17  DA  C N6    
3196 N N1    . DA  C 17  ? 0.5614 0.5161 0.5374 0.0197  -0.0625 -0.0354 17  DA  C N1    
3197 C C2    . DA  C 17  ? 0.5543 0.5374 0.5530 0.0162  -0.0599 -0.0386 17  DA  C C2    
3198 N N3    . DA  C 17  ? 0.5320 0.5246 0.5400 0.0054  -0.0517 -0.0351 17  DA  C N3    
3199 C C4    . DA  C 17  ? 0.5305 0.5059 0.5274 0.0012  -0.0474 -0.0291 17  DA  C C4    
3200 P P     . DG  C 18  ? 0.7142 0.7011 0.7072 -0.0509 -0.0284 -0.0277 18  DG  C P     
3201 O OP1   . DG  C 18  ? 0.6961 0.6955 0.6924 -0.0583 -0.0210 -0.0313 18  DG  C OP1   
3202 O OP2   . DG  C 18  ? 0.6695 0.6255 0.6413 -0.0483 -0.0331 -0.0216 18  DG  C OP2   
3203 O "O5'" . DG  C 18  ? 0.6736 0.6751 0.6744 -0.0587 -0.0294 -0.0337 18  DG  C "O5'" 
3204 C "C5'" . DG  C 18  ? 0.6267 0.6618 0.6505 -0.0554 -0.0294 -0.0437 18  DG  C "C5'" 
3205 C "C4'" . DG  C 18  ? 0.6032 0.6413 0.6335 -0.0466 -0.0375 -0.0453 18  DG  C "C4'" 
3206 O "O4'" . DG  C 18  ? 0.5780 0.6022 0.6053 -0.0302 -0.0432 -0.0396 18  DG  C "O4'" 
3207 C "C3'" . DG  C 18  ? 0.5957 0.6146 0.6121 -0.0554 -0.0391 -0.0408 18  DG  C "C3'" 
3208 O "O3'" . DG  C 18  ? 0.6065 0.6449 0.6321 -0.0638 -0.0394 -0.0499 18  DG  C "O3'" 
3209 C "C2'" . DG  C 18  ? 0.5770 0.5776 0.5882 -0.0412 -0.0462 -0.0338 18  DG  C "C2'" 
3210 C "C1'" . DG  C 18  ? 0.5514 0.5656 0.5744 -0.0277 -0.0490 -0.0377 18  DG  C "C1'" 
3211 N N9    . DG  C 18  ? 0.5311 0.5269 0.5449 -0.0169 -0.0525 -0.0324 18  DG  C N9    
3212 C C8    . DG  C 18  ? 0.5155 0.4929 0.5179 -0.0172 -0.0506 -0.0266 18  DG  C C8    
3213 N N7    . DG  C 18  ? 0.5219 0.4884 0.5170 -0.0107 -0.0525 -0.0258 18  DG  C N7    
3214 C C5    . DG  C 18  ? 0.5142 0.4848 0.5112 -0.0041 -0.0578 -0.0295 18  DG  C C5    
3215 C C6    . DG  C 18  ? 0.5254 0.4797 0.5084 0.0034  -0.0627 -0.0302 18  DG  C C6    
3216 O O6    . DG  C 18  ? 0.5397 0.4747 0.5062 0.0021  -0.0604 -0.0281 18  DG  C O6    
3217 N N1    . DG  C 18  ? 0.5264 0.4877 0.5124 0.0126  -0.0709 -0.0362 18  DG  C N1    
3218 C C2    . DG  C 18  ? 0.5220 0.5115 0.5282 0.0129  -0.0726 -0.0433 18  DG  C C2    
3219 N N2    . DG  C 18  ? 0.5180 0.5162 0.5268 0.0252  -0.0827 -0.0528 18  DG  C N2    
3220 N N3    . DG  C 18  ? 0.5198 0.5268 0.5394 0.0015  -0.0652 -0.0431 18  DG  C N3    
3221 C C4    . DG  C 18  ? 0.5233 0.5154 0.5347 -0.0059 -0.0588 -0.0348 18  DG  C C4    
3222 P P     . DG  C 19  ? 0.6332 0.6521 0.6430 -0.0750 -0.0408 -0.0465 19  DG  C P     
3223 O OP1   . DG  C 19  ? 0.6421 0.6896 0.6652 -0.0860 -0.0389 -0.0593 19  DG  C OP1   
3224 O OP2   . DG  C 19  ? 0.6917 0.6771 0.6737 -0.0852 -0.0373 -0.0383 19  DG  C OP2   
3225 O "O5'" . DG  C 19  ? 0.6385 0.6414 0.6466 -0.0580 -0.0502 -0.0393 19  DG  C "O5'" 
3226 C "C5'" . DG  C 19  ? 0.6088 0.6186 0.6243 -0.0529 -0.0567 -0.0426 19  DG  C "C5'" 
3227 C "C4'" . DG  C 19  ? 0.5799 0.6135 0.6135 -0.0390 -0.0616 -0.0510 19  DG  C "C4'" 
3228 O "O4'" . DG  C 19  ? 0.5659 0.5892 0.5959 -0.0262 -0.0628 -0.0462 19  DG  C "O4'" 
3229 C "C3'" . DG  C 19  ? 0.5683 0.6017 0.6042 -0.0296 -0.0708 -0.0537 19  DG  C "C3'" 
3230 O "O3'" . DG  C 19  ? 0.5665 0.6317 0.6191 -0.0340 -0.0719 -0.0678 19  DG  C "O3'" 
3231 C "C2'" . DG  C 19  ? 0.5589 0.5876 0.5933 -0.0108 -0.0778 -0.0547 19  DG  C "C2'" 
3232 C "C1'" . DG  C 19  ? 0.5359 0.5518 0.5628 -0.0112 -0.0715 -0.0471 19  DG  C "C1'" 
3233 N N9    . DG  C 19  ? 0.4980 0.4854 0.5081 -0.0088 -0.0709 -0.0373 19  DG  C N9    
3234 C C8    . DG  C 19  ? 0.4848 0.4599 0.4875 -0.0150 -0.0650 -0.0307 19  DG  C C8    
3235 N N7    . DG  C 19  ? 0.4653 0.4230 0.4563 -0.0111 -0.0653 -0.0274 19  DG  C N7    
3236 C C5    . DG  C 19  ? 0.4656 0.4172 0.4509 -0.0037 -0.0711 -0.0297 19  DG  C C5    
3237 C C6    . DG  C 19  ? 0.4617 0.3916 0.4286 -0.0006 -0.0725 -0.0286 19  DG  C C6    
3238 O O6    . DG  C 19  ? 0.4430 0.3619 0.3999 -0.0052 -0.0674 -0.0272 19  DG  C O6    
3239 N N1    . DG  C 19  ? 0.4717 0.3931 0.4297 0.0079  -0.0810 -0.0318 19  DG  C N1    
3240 C C2    . DG  C 19  ? 0.4717 0.4109 0.4428 0.0152  -0.0883 -0.0380 19  DG  C C2    
3241 N N2    . DG  C 19  ? 0.4780 0.4043 0.4356 0.0270  -0.0990 -0.0427 19  DG  C N2    
3242 N N3    . DG  C 19  ? 0.4690 0.4365 0.4623 0.0107  -0.0854 -0.0415 19  DG  C N3    
3243 C C4    . DG  C 19  ? 0.4762 0.4450 0.4730 0.0001  -0.0763 -0.0359 19  DG  C C4    
3244 P P     . DT  C 20  ? 0.5841 0.6524 0.6376 -0.0402 -0.0754 -0.0715 20  DT  C P     
3245 O OP1   . DT  C 20  ? 0.5827 0.6940 0.6575 -0.0475 -0.0738 -0.0908 20  DT  C OP1   
3246 O OP2   . DT  C 20  ? 0.5701 0.6071 0.6036 -0.0524 -0.0713 -0.0586 20  DT  C OP2   
3247 O "O5'" . DT  C 20  ? 0.5422 0.5984 0.5920 -0.0193 -0.0881 -0.0705 20  DT  C "O5'" 
3248 C "C5'" . DT  C 20  ? 0.5111 0.5841 0.5700 -0.0015 -0.0974 -0.0823 20  DT  C "C5'" 
3249 C "C4'" . DT  C 20  ? 0.5136 0.5589 0.5556 0.0145  -0.1089 -0.0781 20  DT  C "C4'" 
3250 O "O4'" . DT  C 20  ? 0.5075 0.5164 0.5277 0.0152  -0.1054 -0.0631 20  DT  C "O4'" 
3251 C "C3'" . DT  C 20  ? 0.5095 0.5497 0.5493 0.0095  -0.1122 -0.0770 20  DT  C "C3'" 
3252 O "O3'" . DT  C 20  ? 0.5215 0.5549 0.5540 0.0292  -0.1269 -0.0845 20  DT  C "O3'" 
3253 C "C2'" . DT  C 20  ? 0.4990 0.5046 0.5199 0.0017  -0.1059 -0.0600 20  DT  C "C2'" 
3254 C "C1'" . DT  C 20  ? 0.4974 0.4826 0.5036 0.0123  -0.1067 -0.0552 20  DT  C "C1'" 
3255 N N1    . DT  C 20  ? 0.4819 0.4458 0.4759 0.0046  -0.0981 -0.0436 20  DT  C N1    
3256 C C2    . DT  C 20  ? 0.4905 0.4252 0.4626 0.0088  -0.0994 -0.0384 20  DT  C C2    
3257 O O2    . DT  C 20  ? 0.5251 0.4436 0.4821 0.0179  -0.1076 -0.0408 20  DT  C O2    
3258 N N3    . DT  C 20  ? 0.4744 0.3989 0.4402 0.0012  -0.0908 -0.0321 20  DT  C N3    
3259 C C4    . DT  C 20  ? 0.4634 0.3990 0.4396 -0.0064 -0.0838 -0.0297 20  DT  C C4    
3260 O O4    . DT  C 20  ? 0.4591 0.3858 0.4285 -0.0097 -0.0786 -0.0270 20  DT  C O4    
3261 C C5    . DT  C 20  ? 0.4595 0.4168 0.4520 -0.0108 -0.0832 -0.0329 20  DT  C C5    
3262 C C7    . DT  C 20  ? 0.4535 0.4142 0.4485 -0.0204 -0.0764 -0.0301 20  DT  C C7    
3263 C C6    . DT  C 20  ? 0.4618 0.4345 0.4636 -0.0066 -0.0891 -0.0403 20  DT  C C6    
3264 P P     . DG  C 21  ? 0.5251 0.5555 0.5553 0.0316  -0.1353 -0.0879 21  DG  C P     
3265 O OP1   . DG  C 21  ? 0.5518 0.6016 0.5891 0.0519  -0.1507 -0.1066 21  DG  C OP1   
3266 O OP2   . DG  C 21  ? 0.5113 0.5573 0.5543 0.0101  -0.1252 -0.0859 21  DG  C OP2   
3267 O "O5'" . DG  C 21  ? 0.5377 0.5185 0.5353 0.0372  -0.1384 -0.0736 21  DG  C "O5'" 
3268 C "C5'" . DG  C 21  ? 0.5648 0.5169 0.5374 0.0535  -0.1461 -0.0732 21  DG  C "C5'" 
3269 C "C4'" . DG  C 21  ? 0.5841 0.4890 0.5212 0.0550  -0.1489 -0.0636 21  DG  C "C4'" 
3270 O "O4'" . DG  C 21  ? 0.5685 0.4584 0.4981 0.0392  -0.1345 -0.0509 21  DG  C "O4'" 
3271 C "C3'" . DG  C 21  ? 0.5899 0.4904 0.5248 0.0541  -0.1545 -0.0642 21  DG  C "C3'" 
3272 O "O3'" . DG  C 21  ? 0.6460 0.5007 0.5410 0.0647  -0.1639 -0.0625 21  DG  C "O3'" 
3273 C "C2'" . DG  C 21  ? 0.5640 0.4668 0.5072 0.0341  -0.1403 -0.0533 21  DG  C "C2'" 
3274 C "C1'" . DG  C 21  ? 0.5565 0.4402 0.4849 0.0286  -0.1306 -0.0453 21  DG  C "C1'" 
3275 N N9    . DG  C 21  ? 0.5202 0.4163 0.4626 0.0143  -0.1177 -0.0390 21  DG  C N9    
3276 C C8    . DG  C 21  ? 0.4949 0.4192 0.4617 0.0068  -0.1128 -0.0400 21  DG  C C8    
3277 N N7    . DG  C 21  ? 0.4780 0.3999 0.4452 -0.0023 -0.1038 -0.0341 21  DG  C N7    
3278 C C5    . DG  C 21  ? 0.4846 0.3830 0.4321 -0.0015 -0.1016 -0.0309 21  DG  C C5    
3279 C C6    . DG  C 21  ? 0.4763 0.3682 0.4182 -0.0082 -0.0935 -0.0283 21  DG  C C6    
3280 O O6    . DG  C 21  ? 0.4531 0.3550 0.4045 -0.0128 -0.0889 -0.0273 21  DG  C O6    
3281 N N1    . DG  C 21  ? 0.4863 0.3566 0.4061 -0.0093 -0.0914 -0.0291 21  DG  C N1    
3282 C C2    . DG  C 21  ? 0.5143 0.3625 0.4128 -0.0043 -0.0974 -0.0300 21  DG  C C2    
3283 N N2    . DG  C 21  ? 0.5363 0.3589 0.4070 -0.0105 -0.0926 -0.0310 21  DG  C N2    
3284 N N3    . DG  C 21  ? 0.5243 0.3741 0.4255 0.0057  -0.1078 -0.0318 21  DG  C N3    
3285 C C4    . DG  C 21  ? 0.5105 0.3901 0.4399 0.0065  -0.1089 -0.0331 21  DG  C C4    
3286 P P     . DT  C 22  ? 0.6752 0.5105 0.5549 0.0658  -0.1712 -0.0619 22  DT  C P     
3287 O OP1   . DT  C 22  ? 0.7359 0.5282 0.5739 0.0839  -0.1870 -0.0665 22  DT  C OP1   
3288 O OP2   . DT  C 22  ? 0.6516 0.5290 0.5676 0.0620  -0.1718 -0.0681 22  DT  C OP2   
3289 O "O5'" . DT  C 22  ? 0.6805 0.4937 0.5460 0.0463  -0.1565 -0.0489 22  DT  C "O5'" 
3290 C "C5'" . DT  C 22  ? 0.7013 0.4790 0.5342 0.0402  -0.1492 -0.0430 22  DT  C "C5'" 
3291 C "C4'" . DT  C 22  ? 0.6984 0.4684 0.5262 0.0220  -0.1364 -0.0366 22  DT  C "C4'" 
3292 O "O4'" . DT  C 22  ? 0.6517 0.4552 0.5117 0.0119  -0.1249 -0.0340 22  DT  C "O4'" 
3293 C "C3'" . DT  C 22  ? 0.7037 0.4734 0.5336 0.0202  -0.1406 -0.0366 22  DT  C "C3'" 
3294 O "O3'" . DT  C 22  ? 0.7538 0.4979 0.5582 0.0069  -0.1320 -0.0338 22  DT  C "O3'" 
3295 C "C2'" . DT  C 22  ? 0.6526 0.4633 0.5231 0.0133  -0.1348 -0.0354 22  DT  C "C2'" 
3296 C "C1'" . DT  C 22  ? 0.6321 0.4488 0.5068 0.0045  -0.1224 -0.0325 22  DT  C "C1'" 
3297 N N1    . DT  C 22  ? 0.5837 0.4326 0.4897 -0.0002 -0.1168 -0.0314 22  DT  C N1    
3298 C C2    . DT  C 22  ? 0.5509 0.4030 0.4589 -0.0087 -0.1067 -0.0298 22  DT  C C2    
3299 O O2    . DT  C 22  ? 0.5444 0.3810 0.4344 -0.0141 -0.1008 -0.0310 22  DT  C O2    
3300 N N3    . DT  C 22  ? 0.5245 0.3980 0.4537 -0.0114 -0.1040 -0.0288 22  DT  C N3    
3301 C C4    . DT  C 22  ? 0.5215 0.4123 0.4677 -0.0107 -0.1076 -0.0290 22  DT  C C4    
3302 O O4    . DT  C 22  ? 0.5151 0.4161 0.4709 -0.0158 -0.1040 -0.0277 22  DT  C O4    
3303 C C5    . DT  C 22  ? 0.5365 0.4307 0.4847 -0.0041 -0.1161 -0.0327 22  DT  C C5    
3304 C C7    . DT  C 22  ? 0.5246 0.4440 0.4927 -0.0064 -0.1184 -0.0374 22  DT  C C7    
3305 C C6    . DT  C 22  ? 0.5633 0.4367 0.4922 0.0027  -0.1215 -0.0338 22  DT  C C6    
3306 P P     . DA  C 23  ? 0.8174 0.5197 0.5816 0.0085  -0.1397 -0.0347 23  DA  C P     
3307 O OP1   . DA  C 23  ? 0.8464 0.5093 0.5716 0.0206  -0.1500 -0.0368 23  DA  C OP1   
3308 O OP2   . DA  C 23  ? 0.7696 0.4909 0.5555 0.0123  -0.1464 -0.0354 23  DA  C OP2   
3309 O "O5'" . DA  C 23  ? 0.8235 0.5083 0.5653 -0.0123 -0.1242 -0.0343 23  DA  C "O5'" 
3310 C "C5'" . DA  C 23  ? 0.8172 0.4900 0.5406 -0.0248 -0.1115 -0.0355 23  DA  C "C5'" 
3311 C "C4'" . DA  C 23  ? 0.7926 0.4904 0.5330 -0.0419 -0.0966 -0.0396 23  DA  C "C4'" 
3312 O "O4'" . DA  C 23  ? 0.7218 0.4644 0.5090 -0.0360 -0.0958 -0.0385 23  DA  C "O4'" 
3313 C "C3'" . DA  C 23  ? 0.7949 0.4943 0.5372 -0.0452 -0.0986 -0.0411 23  DA  C "C3'" 
3314 O "O3'" . DA  C 23  ? 0.8739 0.5449 0.5792 -0.0619 -0.0903 -0.0464 23  DA  C "O3'" 
3315 C "C2'" . DA  C 23  ? 0.7285 0.4745 0.5183 -0.0422 -0.0976 -0.0418 23  DA  C "C2'" 
3316 C "C1'" . DA  C 23  ? 0.6879 0.4559 0.4988 -0.0396 -0.0935 -0.0411 23  DA  C "C1'" 
3317 N N9    . DA  C 23  ? 0.6285 0.4238 0.4738 -0.0287 -0.1008 -0.0370 23  DA  C N9    
3318 C C8    . DA  C 23  ? 0.6217 0.4185 0.4756 -0.0180 -0.1122 -0.0331 23  DA  C C8    
3319 N N7    . DA  C 23  ? 0.5835 0.4067 0.4661 -0.0148 -0.1141 -0.0315 23  DA  C N7    
3320 C C5    . DA  C 23  ? 0.5529 0.3888 0.4443 -0.0210 -0.1056 -0.0334 23  DA  C C5    
3321 C C6    . DA  C 23  ? 0.5144 0.3701 0.4259 -0.0207 -0.1045 -0.0330 23  DA  C C6    
3322 N N6    . DA  C 23  ? 0.5021 0.3679 0.4276 -0.0183 -0.1094 -0.0298 23  DA  C N6    
3323 N N1    . DA  C 23  ? 0.5010 0.3642 0.4144 -0.0239 -0.0981 -0.0378 23  DA  C N1    
3324 C C2    . DA  C 23  ? 0.5196 0.3767 0.4191 -0.0300 -0.0909 -0.0440 23  DA  C C2    
3325 N N3    . DA  C 23  ? 0.5549 0.3913 0.4319 -0.0351 -0.0887 -0.0445 23  DA  C N3    
3326 C C4    . DA  C 23  ? 0.5819 0.4054 0.4542 -0.0287 -0.0975 -0.0380 23  DA  C C4    
3327 P P     . DC  C 24  ? 0.8905 0.5755 0.5923 -0.0847 -0.0710 -0.0579 24  DC  C P     
3328 O OP1   . DC  C 24  ? 0.9055 0.5761 0.5865 -0.0934 -0.0623 -0.0598 24  DC  C OP1   
3329 O OP2   . DC  C 24  ? 0.9460 0.6140 0.6231 -0.0983 -0.0664 -0.0639 24  DC  C OP2   
3330 O "O5'" . DC  C 24  ? 0.8239 0.5641 0.5794 -0.0789 -0.0702 -0.0619 24  DC  C "O5'" 
3331 C "C5'" . DC  C 24  ? 0.7738 0.5447 0.5466 -0.0875 -0.0584 -0.0724 24  DC  C "C5'" 
3332 C "C4'" . DC  C 24  ? 0.7130 0.5245 0.5268 -0.0776 -0.0632 -0.0765 24  DC  C "C4'" 
3333 O "O4'" . DC  C 24  ? 0.6623 0.4761 0.4957 -0.0602 -0.0765 -0.0634 24  DC  C "O4'" 
3334 C "C3'" . DC  C 24  ? 0.7120 0.5277 0.5251 -0.0812 -0.0642 -0.0832 24  DC  C "C3'" 
3335 O "O3'" . DC  C 24  ? 0.7313 0.5729 0.5485 -0.0941 -0.0521 -0.1027 24  DC  C "O3'" 
3336 C "C2'" . DC  C 24  ? 0.6670 0.4974 0.5087 -0.0634 -0.0782 -0.0753 24  DC  C "C2'" 
3337 C "C1'" . DC  C 24  ? 0.6283 0.4638 0.4846 -0.0536 -0.0822 -0.0663 24  DC  C "C1'" 
3338 N N1    . DC  C 24  ? 0.5930 0.4252 0.4612 -0.0414 -0.0940 -0.0541 24  DC  C N1    
3339 C C2    . DC  C 24  ? 0.5552 0.4058 0.4460 -0.0335 -0.0983 -0.0520 24  DC  C C2    
3340 O O2    . DC  C 24  ? 0.5361 0.4035 0.4358 -0.0333 -0.0946 -0.0601 24  DC  C O2    
3341 N N3    . DC  C 24  ? 0.5464 0.3954 0.4462 -0.0270 -0.1067 -0.0431 24  DC  C N3    
3342 C C4    . DC  C 24  ? 0.5503 0.3861 0.4425 -0.0255 -0.1119 -0.0380 24  DC  C C4    
3343 N N4    . DC  C 24  ? 0.5375 0.3788 0.4414 -0.0209 -0.1187 -0.0329 24  DC  C N4    
3344 C C5    . DC  C 24  ? 0.5727 0.3874 0.4415 -0.0293 -0.1103 -0.0395 24  DC  C C5    
3345 C C6    . DC  C 24  ? 0.5910 0.4016 0.4459 -0.0386 -0.1007 -0.0467 24  DC  C C6    
3346 P P     . DG  C 25  ? 0.7484 0.6084 0.5724 -0.0976 -0.0516 -0.1164 25  DG  C P     
3347 O OP1   . DG  C 25  ? 0.7612 0.6393 0.5754 -0.1188 -0.0344 -0.1391 25  DG  C OP1   
3348 O OP2   . DG  C 25  ? 0.7329 0.5624 0.5406 -0.0944 -0.0601 -0.1039 25  DG  C OP2   
3349 O "O5'" . DG  C 25  ? 0.6696 0.5649 0.5319 -0.0776 -0.0628 -0.1204 25  DG  C "O5'" 
3350 C "C5'" . DG  C 25  ? 0.6201 0.5464 0.5028 -0.0728 -0.0606 -0.1322 25  DG  C "C5'" 
3351 C "C4'" . DG  C 25  ? 0.5909 0.5333 0.4965 -0.0517 -0.0758 -0.1332 25  DG  C "C4'" 
3352 O "O4'" . DG  C 25  ? 0.5734 0.4911 0.4787 -0.0412 -0.0866 -0.1104 25  DG  C "O4'" 
3353 C "C3'" . DG  C 25  ? 0.5946 0.5459 0.5028 -0.0481 -0.0815 -0.1438 25  DG  C "C3'" 
3354 O "O3'" . DG  C 25  ? 0.5950 0.5738 0.5215 -0.0320 -0.0908 -0.1597 25  DG  C "O3'" 
3355 C "C2'" . DG  C 25  ? 0.5845 0.5058 0.4865 -0.0404 -0.0929 -0.1221 25  DG  C "C2'" 
3356 C "C1'" . DG  C 25  ? 0.5681 0.4794 0.4755 -0.0319 -0.0981 -0.1068 25  DG  C "C1'" 
3357 N N9    . DG  C 25  ? 0.5612 0.4463 0.4619 -0.0310 -0.1033 -0.0863 25  DG  C N9    
3358 C C8    . DG  C 25  ? 0.5653 0.4297 0.4506 -0.0392 -0.1003 -0.0777 25  DG  C C8    
3359 N N7    . DG  C 25  ? 0.5555 0.4058 0.4418 -0.0338 -0.1078 -0.0635 25  DG  C N7    
3360 C C5    . DG  C 25  ? 0.5472 0.4070 0.4476 -0.0252 -0.1139 -0.0613 25  DG  C C5    
3361 C C6    . DG  C 25  ? 0.5392 0.3928 0.4451 -0.0208 -0.1209 -0.0503 25  DG  C C6    
3362 O O6    . DG  C 25  ? 0.5477 0.3930 0.4527 -0.0219 -0.1237 -0.0420 25  DG  C O6    
3363 N N1    . DG  C 25  ? 0.5317 0.3896 0.4423 -0.0149 -0.1251 -0.0520 25  DG  C N1    
3364 C C2    . DG  C 25  ? 0.5336 0.4026 0.4460 -0.0096 -0.1252 -0.0639 25  DG  C C2    
3365 N N2    . DG  C 25  ? 0.5391 0.4034 0.4493 -0.0018 -0.1323 -0.0641 25  DG  C N2    
3366 N N3    . DG  C 25  ? 0.5392 0.4226 0.4529 -0.0122 -0.1190 -0.0769 25  DG  C N3    
3367 C C4    . DG  C 25  ? 0.5456 0.4228 0.4524 -0.0219 -0.1124 -0.0743 25  DG  C C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   ASN 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  PHE 23  23  23  PHE PHE A . n 
A 1 24  MET 24  24  24  MET MET A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  ASN 30  30  30  ASN ASN A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  THR 35  35  35  THR THR A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  TRP 37  37  37  TRP TRP A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  LYS 96  96  96  LYS LYS A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 PHE 110 110 110 PHE PHE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 GLU 145 145 145 GLU GLU A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 GLN 152 152 152 GLN GLN A . n 
A 1 153 CYS 153 153 153 CYS CYS A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 PRO 155 155 155 PRO PRO A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ARG 158 158 158 ARG ARG A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 TRP 171 171 171 TRP TRP A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 ALA 173 173 173 ALA ALA A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 SER 181 181 181 SER SER A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 GLU 190 190 190 GLU GLU A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 PHE 196 196 196 PHE PHE A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 PHE 202 202 202 PHE PHE A . n 
A 1 203 GLN 203 203 203 GLN GLN A . n 
A 1 204 ILE 204 204 204 ILE ILE A . n 
A 1 205 THR 205 205 205 THR THR A . n 
A 1 206 GLN 206 206 206 GLN GLN A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 LYS 212 212 212 LYS LYS A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 MET 214 214 214 MET MET A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 TYR 220 220 220 TYR TYR A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 CYS 223 223 223 CYS CYS A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 ARG 231 231 231 ARG ARG A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 PRO 233 233 233 PRO PRO A . n 
A 1 234 TRP 234 234 234 TRP TRP A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 TYR 236 236 236 TYR TYR A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ASN 241 241 241 ASN ASN A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 ASP 244 244 244 ASP ASP A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 GLN 246 246 246 GLN GLN A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 LYS 248 248 248 LYS LYS A . n 
A 1 249 ILE 249 249 249 ILE ILE A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 PHE 253 253 253 PHE PHE A . n 
A 1 254 HIS 254 254 254 HIS HIS A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 TYR 256 256 256 TYR TYR A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 ILE 259 259 259 ILE ILE A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ASP 265 265 265 ASP ASP A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 GLN 267 267 267 GLN GLN A . n 
A 1 268 ASP 268 268 268 ASP ASP A . n 
A 1 269 TRP 269 269 269 TRP TRP A . n 
A 1 270 CYS 270 270 270 CYS CYS A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 ILE 272 272 272 ILE ILE A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 GLN 277 277 277 GLN GLN A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 HIS 281 281 281 HIS HIS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 THR 283 283 283 THR THR A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 GLU 289 289 289 GLU GLU A . n 
A 1 290 ILE 290 290 290 ILE ILE A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 LEU 293 293 293 LEU LEU A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 GLY 295 295 295 GLY GLY A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 MET 297 297 297 MET MET A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 LYS 299 299 299 LYS LYS A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 ARG 301 301 ?   ?   ?   A . n 
A 1 302 LEU 302 302 ?   ?   ?   A . n 
B 2 1   DC  1   1   1   DC  DC  B . n 
B 2 2   DG  2   2   2   DG  DG  B . n 
B 2 3   DT  3   3   3   DT  DT  B . n 
B 2 4   DA  4   4   4   DA  DA  B . n 
B 2 5   DC  5   5   5   DC  DC  B . n 
B 2 6   DA  6   6   6   DA  DA  B . n 
B 2 7   DC  7   7   7   DC  DC  B . n 
B 2 8   DC  8   8   8   DC  DC  B . n 
B 2 9   DT  9   9   9   DT  DT  B . n 
B 2 10  DG  10  10  10  DG  DG  B . n 
B 2 11  DA  11  11  11  DA  DA  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DA  13  13  13  DA  DA  B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
B 2 15  DT  15  15  15  DT  DT  B . n 
B 2 16  DG  16  16  16  DG  DG  B . n 
B 2 17  DG  17  17  17  DG  DG  B . n 
B 2 18  DA  18  18  18  DA  DA  B . n 
B 2 19  DG  19  19  19  DG  DG  B . n 
B 2 20  DG  20  20  20  DG  DG  B . n 
B 2 21  DA  21  21  21  DA  DA  B . n 
B 2 22  DT  22  22  22  DT  DT  B . n 
B 2 23  DA  23  23  23  DA  DA  B . n 
B 2 24  DC  24  24  24  DC  DC  B . n 
B 2 25  DC  25  25  25  DC  DC  B . n 
C 3 1   DG  1   1   1   DG  DG  C . n 
C 3 2   DG  2   2   2   DG  DG  C . n 
C 3 3   DT  3   3   3   DT  DT  C . n 
C 3 4   DA  4   4   4   DA  DA  C . n 
C 3 5   DT  5   5   5   DT  DT  C . n 
C 3 6   DC  6   6   6   DC  DC  C . n 
C 3 7   DC  7   7   7   DC  DC  C . n 
C 3 8   DT  8   8   8   DT  DT  C . n 
C 3 9   DC  9   9   9   DC  DC  C . n 
C 3 10  DC  10  10  10  DC  DC  C . n 
C 3 11  DA  11  11  11  DA  DA  C . n 
C 3 12  DT  12  12  12  DT  DT  C . n 
C 3 13  DT  13  13  13  DT  DT  C . n 
C 3 14  DA  14  14  14  DA  DA  C . n 
C 3 15  DT  15  15  15  DT  DT  C . n 
C 3 16  DC  16  16  16  DC  DC  C . n 
C 3 17  DA  17  17  17  DA  DA  C . n 
C 3 18  DG  18  18  18  DG  DG  C . n 
C 3 19  DG  19  19  19  DG  DG  C . n 
C 3 20  DT  20  20  20  DT  DT  C . n 
C 3 21  DG  21  21  21  DG  DG  C . n 
C 3 22  DT  22  22  22  DT  DT  C . n 
C 3 23  DA  23  23  23  DA  DA  C . n 
C 3 24  DC  24  24  24  DC  DC  C . n 
C 3 25  DG  25  25  25  DG  DG  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   401 1   MG  MG  A . 
E 4 MG  1   402 3   MG  MG  A . 
F 5 MXE 1   403 1   MXE MXE A . 
G 6 PG0 1   101 1   PG0 PG0 B . 
H 7 HOH 1   501 76  HOH HOH A . 
H 7 HOH 2   502 51  HOH HOH A . 
H 7 HOH 3   503 192 HOH HOH A . 
H 7 HOH 4   504 58  HOH HOH A . 
H 7 HOH 5   505 132 HOH HOH A . 
H 7 HOH 6   506 25  HOH HOH A . 
H 7 HOH 7   507 152 HOH HOH A . 
H 7 HOH 8   508 194 HOH HOH A . 
H 7 HOH 9   509 47  HOH HOH A . 
H 7 HOH 10  510 13  HOH HOH A . 
H 7 HOH 11  511 69  HOH HOH A . 
H 7 HOH 12  512 114 HOH HOH A . 
H 7 HOH 13  513 46  HOH HOH A . 
H 7 HOH 14  514 33  HOH HOH A . 
H 7 HOH 15  515 105 HOH HOH A . 
H 7 HOH 16  516 87  HOH HOH A . 
H 7 HOH 17  517 70  HOH HOH A . 
H 7 HOH 18  518 72  HOH HOH A . 
H 7 HOH 19  519 141 HOH HOH A . 
H 7 HOH 20  520 1   HOH HOH A . 
H 7 HOH 21  521 60  HOH HOH A . 
H 7 HOH 22  522 162 HOH HOH A . 
H 7 HOH 23  523 24  HOH HOH A . 
H 7 HOH 24  524 54  HOH HOH A . 
H 7 HOH 25  525 43  HOH HOH A . 
H 7 HOH 26  526 63  HOH HOH A . 
H 7 HOH 27  527 113 HOH HOH A . 
H 7 HOH 28  528 135 HOH HOH A . 
H 7 HOH 29  529 96  HOH HOH A . 
H 7 HOH 30  530 59  HOH HOH A . 
H 7 HOH 31  531 2   HOH HOH A . 
H 7 HOH 32  532 111 HOH HOH A . 
H 7 HOH 33  533 18  HOH HOH A . 
H 7 HOH 34  534 163 HOH HOH A . 
H 7 HOH 35  535 139 HOH HOH A . 
H 7 HOH 36  536 29  HOH HOH A . 
H 7 HOH 37  537 35  HOH HOH A . 
H 7 HOH 38  538 15  HOH HOH A . 
H 7 HOH 39  539 16  HOH HOH A . 
H 7 HOH 40  540 182 HOH HOH A . 
H 7 HOH 41  541 30  HOH HOH A . 
H 7 HOH 42  542 106 HOH HOH A . 
H 7 HOH 43  543 6   HOH HOH A . 
H 7 HOH 44  544 22  HOH HOH A . 
H 7 HOH 45  545 39  HOH HOH A . 
H 7 HOH 46  546 181 HOH HOH A . 
H 7 HOH 47  547 144 HOH HOH A . 
H 7 HOH 48  548 62  HOH HOH A . 
H 7 HOH 49  549 145 HOH HOH A . 
H 7 HOH 50  550 122 HOH HOH A . 
H 7 HOH 51  551 52  HOH HOH A . 
H 7 HOH 52  552 100 HOH HOH A . 
H 7 HOH 53  553 78  HOH HOH A . 
H 7 HOH 54  554 168 HOH HOH A . 
H 7 HOH 55  555 83  HOH HOH A . 
H 7 HOH 56  556 12  HOH HOH A . 
H 7 HOH 57  557 26  HOH HOH A . 
H 7 HOH 58  558 186 HOH HOH A . 
H 7 HOH 59  559 126 HOH HOH A . 
H 7 HOH 60  560 5   HOH HOH A . 
H 7 HOH 61  561 61  HOH HOH A . 
H 7 HOH 62  562 20  HOH HOH A . 
H 7 HOH 63  563 170 HOH HOH A . 
H 7 HOH 64  564 159 HOH HOH A . 
H 7 HOH 65  565 191 HOH HOH A . 
H 7 HOH 66  566 115 HOH HOH A . 
H 7 HOH 67  567 110 HOH HOH A . 
H 7 HOH 68  568 103 HOH HOH A . 
H 7 HOH 69  569 125 HOH HOH A . 
H 7 HOH 70  570 31  HOH HOH A . 
H 7 HOH 71  571 123 HOH HOH A . 
H 7 HOH 72  572 28  HOH HOH A . 
H 7 HOH 73  573 37  HOH HOH A . 
H 7 HOH 74  574 174 HOH HOH A . 
H 7 HOH 75  575 187 HOH HOH A . 
H 7 HOH 76  576 155 HOH HOH A . 
H 7 HOH 77  577 112 HOH HOH A . 
H 7 HOH 78  578 11  HOH HOH A . 
H 7 HOH 79  579 104 HOH HOH A . 
H 7 HOH 80  580 93  HOH HOH A . 
H 7 HOH 81  581 166 HOH HOH A . 
H 7 HOH 82  582 134 HOH HOH A . 
H 7 HOH 83  583 55  HOH HOH A . 
H 7 HOH 84  584 92  HOH HOH A . 
H 7 HOH 85  585 119 HOH HOH A . 
H 7 HOH 86  586 65  HOH HOH A . 
H 7 HOH 87  587 160 HOH HOH A . 
H 7 HOH 88  588 98  HOH HOH A . 
H 7 HOH 89  589 19  HOH HOH A . 
H 7 HOH 90  590 9   HOH HOH A . 
H 7 HOH 91  591 108 HOH HOH A . 
H 7 HOH 92  592 99  HOH HOH A . 
H 7 HOH 93  593 175 HOH HOH A . 
H 7 HOH 94  594 138 HOH HOH A . 
H 7 HOH 95  595 143 HOH HOH A . 
H 7 HOH 96  596 53  HOH HOH A . 
H 7 HOH 97  597 101 HOH HOH A . 
H 7 HOH 98  598 146 HOH HOH A . 
H 7 HOH 99  599 142 HOH HOH A . 
H 7 HOH 100 600 71  HOH HOH A . 
H 7 HOH 101 601 21  HOH HOH A . 
H 7 HOH 102 602 50  HOH HOH A . 
H 7 HOH 103 603 116 HOH HOH A . 
H 7 HOH 104 604 23  HOH HOH A . 
H 7 HOH 105 605 165 HOH HOH A . 
H 7 HOH 106 606 130 HOH HOH A . 
H 7 HOH 107 607 172 HOH HOH A . 
H 7 HOH 108 608 173 HOH HOH A . 
H 7 HOH 109 609 124 HOH HOH A . 
H 7 HOH 110 610 118 HOH HOH A . 
H 7 HOH 111 611 161 HOH HOH A . 
H 7 HOH 112 612 140 HOH HOH A . 
H 7 HOH 113 613 7   HOH HOH A . 
H 7 HOH 114 614 8   HOH HOH A . 
H 7 HOH 115 615 107 HOH HOH A . 
H 7 HOH 116 616 167 HOH HOH A . 
H 7 HOH 117 617 193 HOH HOH A . 
H 7 HOH 118 618 176 HOH HOH A . 
H 7 HOH 119 619 85  HOH HOH A . 
H 7 HOH 120 620 95  HOH HOH A . 
H 7 HOH 121 621 38  HOH HOH A . 
H 7 HOH 122 622 171 HOH HOH A . 
H 7 HOH 123 623 177 HOH HOH A . 
H 7 HOH 124 624 17  HOH HOH A . 
H 7 HOH 125 625 3   HOH HOH A . 
H 7 HOH 126 626 68  HOH HOH A . 
H 7 HOH 127 627 121 HOH HOH A . 
H 7 HOH 128 628 84  HOH HOH A . 
H 7 HOH 129 629 184 HOH HOH A . 
H 7 HOH 130 630 180 HOH HOH A . 
H 7 HOH 131 631 178 HOH HOH A . 
H 7 HOH 132 632 189 HOH HOH A . 
H 7 HOH 133 633 64  HOH HOH A . 
I 7 HOH 1   201 57  HOH HOH B . 
I 7 HOH 2   202 49  HOH HOH B . 
I 7 HOH 3   203 45  HOH HOH B . 
I 7 HOH 4   204 127 HOH HOH B . 
I 7 HOH 5   205 79  HOH HOH B . 
I 7 HOH 6   206 48  HOH HOH B . 
I 7 HOH 7   207 34  HOH HOH B . 
I 7 HOH 8   208 156 HOH HOH B . 
I 7 HOH 9   209 157 HOH HOH B . 
I 7 HOH 10  210 4   HOH HOH B . 
I 7 HOH 11  211 27  HOH HOH B . 
I 7 HOH 12  212 81  HOH HOH B . 
I 7 HOH 13  213 154 HOH HOH B . 
I 7 HOH 14  214 188 HOH HOH B . 
I 7 HOH 15  215 75  HOH HOH B . 
I 7 HOH 16  216 41  HOH HOH B . 
I 7 HOH 17  217 36  HOH HOH B . 
I 7 HOH 18  218 169 HOH HOH B . 
I 7 HOH 19  219 120 HOH HOH B . 
I 7 HOH 20  220 88  HOH HOH B . 
I 7 HOH 21  221 158 HOH HOH B . 
I 7 HOH 22  222 151 HOH HOH B . 
I 7 HOH 23  223 86  HOH HOH B . 
I 7 HOH 24  224 179 HOH HOH B . 
I 7 HOH 25  225 42  HOH HOH B . 
I 7 HOH 26  226 164 HOH HOH B . 
I 7 HOH 27  227 183 HOH HOH B . 
J 7 HOH 1   101 190 HOH HOH C . 
J 7 HOH 2   102 77  HOH HOH C . 
J 7 HOH 3   103 14  HOH HOH C . 
J 7 HOH 4   104 147 HOH HOH C . 
J 7 HOH 5   105 89  HOH HOH C . 
J 7 HOH 6   106 150 HOH HOH C . 
J 7 HOH 7   107 136 HOH HOH C . 
J 7 HOH 8   108 10  HOH HOH C . 
J 7 HOH 9   109 133 HOH HOH C . 
J 7 HOH 10  110 90  HOH HOH C . 
J 7 HOH 11  111 32  HOH HOH C . 
J 7 HOH 12  112 137 HOH HOH C . 
J 7 HOH 13  113 97  HOH HOH C . 
J 7 HOH 14  114 102 HOH HOH C . 
J 7 HOH 15  115 185 HOH HOH C . 
J 7 HOH 16  116 149 HOH HOH C . 
J 7 HOH 17  117 131 HOH HOH C . 
J 7 HOH 18  118 129 HOH HOH C . 
J 7 HOH 19  119 56  HOH HOH C . 
J 7 HOH 20  120 117 HOH HOH C . 
J 7 HOH 21  121 40  HOH HOH C . 
J 7 HOH 22  122 109 HOH HOH C . 
J 7 HOH 23  123 80  HOH HOH C . 
J 7 HOH 24  124 82  HOH HOH C . 
J 7 HOH 25  125 153 HOH HOH C . 
J 7 HOH 26  126 148 HOH HOH C . 
J 7 HOH 27  127 66  HOH HOH C . 
J 7 HOH 28  128 67  HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8490  ? 
1 MORE         -57   ? 
1 'SSA (A^2)'  18790 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A ALA 19  ? A ALA 19  ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 104.2 ? 
2  O   ? A ALA 19  ? A ALA 19  ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OP2 ? C DC  16  ? C DC  16  ? 1_555 167.4 ? 
3  OD1 ? A ASP 179 ? A ASP 179 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OP2 ? C DC  16  ? C DC  16  ? 1_555 78.0  ? 
4  O   ? A ALA 19  ? A ALA 19  ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O   ? H HOH .   ? A HOH 525 ? 1_555 84.6  ? 
5  OD1 ? A ASP 179 ? A ASP 179 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O   ? H HOH .   ? A HOH 525 ? 1_555 104.5 ? 
6  OP2 ? C DC  16  ? C DC  16  ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O   ? H HOH .   ? A HOH 525 ? 1_555 82.8  ? 
7  OE2 ? A GLU 20  ? A GLU 20  ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? A GLY 178 ? A GLY 178 ? 1_555 91.3  ? 
8  OE2 ? A GLU 20  ? A GLU 20  ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 133.2 ? 
9  O   ? A GLY 178 ? A GLY 178 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 70.5  ? 
10 OE2 ? A GLU 20  ? A GLU 20  ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 OP1 ? C DC  16  ? C DC  16  ? 1_555 135.3 ? 
11 O   ? A GLY 178 ? A GLY 178 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 OP1 ? C DC  16  ? C DC  16  ? 1_555 100.5 ? 
12 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 OP1 ? C DC  16  ? C DC  16  ? 1_555 91.1  ? 
13 OE2 ? A GLU 20  ? A GLU 20  ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? J HOH .   ? C HOH 115 ? 1_555 77.6  ? 
14 O   ? A GLY 178 ? A GLY 178 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? J HOH .   ? C HOH 115 ? 1_555 72.6  ? 
15 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? J HOH .   ? C HOH 115 ? 1_555 131.2 ? 
16 OP1 ? C DC  16  ? C DC  16  ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? J HOH .   ? C HOH 115 ? 1_555 65.6  ? 
17 OE2 ? A GLU 20  ? A GLU 20  ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? I HOH .   ? B HOH 203 ? 1_555 104.4 ? 
18 O   ? A GLY 178 ? A GLY 178 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? I HOH .   ? B HOH 203 ? 1_555 154.3 ? 
19 OD1 ? A ASP 179 ? A ASP 179 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? I HOH .   ? B HOH 203 ? 1_555 84.0  ? 
20 OP1 ? C DC  16  ? C DC  16  ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? I HOH .   ? B HOH 203 ? 1_555 82.7  ? 
21 O   ? J HOH .   ? C HOH 115 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O   ? I HOH .   ? B HOH 203 ? 1_555 130.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-01-13 
2 'Structure model' 1 1 2016-02-10 
3 'Structure model' 1 2 2017-09-13 
4 'Structure model' 1 3 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Database references'        
4 3 'Structure model' 'Derived calculations'       
5 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation              
2 3 'Structure model' pdbx_audit_support    
3 3 'Structure model' pdbx_struct_oper_list 
4 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.journal_id_CSD'                  
2 3 'Structure model' '_pdbx_audit_support.funding_organization'  
3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 5.8802  -1.1600 -0.9494 0.0212 ? 0.0152 ? 0.0015  ? 0.0511 ? 0.0203  ? 0.0293 ? 0.4783 ? 0.3785  ? 
0.1875  ? 2.4869 ? 1.5005 ? 1.7188 ? -0.0292 ? -0.0163 ? 0.0686  ? -0.0770 ? 0.0173  ? 0.1646 ? -0.1456 ? -0.0766 ? 0.0119  ? 
2 'X-RAY DIFFRACTION' ? refined -4.2619 -0.8369 -0.6502 0.1549 ? 0.0391 ? -0.0245 ? 0.2252 ? -0.0141 ? 0.1613 ? 0.3319 ? -0.1990 ? 
-0.4846 ? 2.8147 ? 2.8981 ? 3.8031 ? 0.0882  ? -0.1153 ? 0.0736  ? 0.0688  ? -0.0620 ? 0.1170 ? -0.0931 ? -0.2736 ? -0.0262 ? 
3 'X-RAY DIFFRACTION' ? refined -4.3520 0.3497  -0.8656 0.2317 ? 0.0242 ? -0.0154 ? 0.2246 ? -0.0320 ? 0.2245 ? 0.0971 ? 0.3217  ? 
0.5895  ? 1.7489 ? 2.5113 ? 4.0991 ? -0.0009 ? -0.0664 ? -0.0088 ? -0.2351 ? -0.1199 ? 0.2436 ? -0.2977 ? -0.3579 ? 0.1208  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 7 ? ? A 300 ? ? 
2 'X-RAY DIFFRACTION' 2 ? ? B 1 ? ? B 25  ? ? 
3 'X-RAY DIFFRACTION' 3 ? ? C 1 ? ? C 25  ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC    ? ? ? 5.8.0124 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER    ? ? ? .        4 
# 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.entry_id             5E67 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'Mutation of L165N and M267Q were made to improve expression/purification.' 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 MG  A MG 401 ? ? O B HOH 203 ? ? 1.65 
2 1 OP1 B DA 4   ? ? O B HOH 201 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N     A GLY 21 ? ? CA A GLY 21 ? ? 1.554 1.456 0.098  0.015 N 
2 1 "O3'" B DA  18 ? ? P  B DG  19 ? ? 1.526 1.607 -0.081 0.012 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE    A ARG 126 ? ? CZ    A ARG 126 ? ? NH1   A ARG 126 ? ? 123.31 120.30 3.01   0.50 N 
2  1 CB    A ASP 168 ? ? CG    A ASP 168 ? ? OD1   A ASP 168 ? ? 123.71 118.30 5.41   0.90 N 
3  1 "O5'" B DC  5   ? ? P     B DC  5   ? ? OP1   B DC  5   ? ? 122.93 110.70 12.23  1.20 N 
4  1 "O5'" B DC  5   ? ? P     B DC  5   ? ? OP2   B DC  5   ? ? 93.13  105.70 -12.57 0.90 N 
5  1 "C1'" B DC  5   ? ? "O4'" B DC  5   ? ? "C4'" B DC  5   ? ? 102.88 110.10 -7.22  1.00 N 
6  1 "C1'" B DG  16  ? ? "O4'" B DG  16  ? ? "C4'" B DG  16  ? ? 102.76 110.10 -7.34  1.00 N 
7  1 "O4'" B DG  16  ? ? "C1'" B DG  16  ? ? N9    B DG  16  ? ? 111.07 108.30 2.77   0.30 N 
8  1 "O5'" C DT  15  ? ? P     C DT  15  ? ? OP1   C DT  15  ? ? 98.92  105.70 -6.78  0.90 N 
9  1 "O5'" C DC  16  ? ? P     C DC  16  ? ? OP1   C DC  16  ? ? 99.90  105.70 -5.80  0.90 N 
10 1 "C1'" C DG  18  ? ? "O4'" C DG  18  ? ? "C4'" C DG  18  ? ? 103.49 110.10 -6.61  1.00 N 
11 1 "O5'" C DC  24  ? ? P     C DC  24  ? ? OP2   C DC  24  ? ? 99.67  105.70 -6.03  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 30  ? ? -164.67 118.62  
2 1 PHE A 62  ? ? -89.80  44.71   
3 1 SER A 71  ? ? -103.96 -72.12  
4 1 ASN A 139 ? ? 45.86   -120.69 
5 1 CYS A 153 ? ? -47.03  85.13   
6 1 PRO A 159 ? ? -34.64  116.00  
7 1 ASN A 163 ? ? -10.78  96.02   
8 1 ASN A 163 ? ? -10.78  93.05   
9 1 ASP A 168 ? ? -176.52 143.68  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1   ? A SER 1   
2 1 Y 1 A LYS 2   ? A LYS 2   
3 1 Y 1 A GLY 3   ? A GLY 3   
4 1 Y 1 A GLU 4   ? A GLU 4   
5 1 Y 1 A ASN 5   ? A ASN 5   
6 1 Y 1 A SER 6   ? A SER 6   
7 1 Y 1 A ARG 301 ? A ARG 301 
8 1 Y 1 A LEU 302 ? A LEU 302 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5E67 'double helix'        
5E67 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 25 1_555 0.343  -0.153 0.358  -15.283 -5.745  -1.789 1  B_DC1:DG25_C  B 1  ? C 25 ? 19 1 
1 B DG 2  1_555 C DC 24 1_555 -0.101 -0.044 0.042  -8.597  -10.060 2.185  2  B_DG2:DC24_C  B 2  ? C 24 ? 19 1 
1 B DT 3  1_555 C DA 23 1_555 -0.350 -0.159 0.262  -1.694  -8.119  -2.229 3  B_DT3:DA23_C  B 3  ? C 23 ? 20 1 
1 B DA 4  1_555 C DT 22 1_555 -0.104 -0.188 0.099  1.883   -2.723  3.937  4  B_DA4:DT22_C  B 4  ? C 22 ? 20 1 
1 B DC 5  1_555 C DG 21 1_555 0.191  -0.089 -0.306 14.190  -13.101 -4.656 5  B_DC5:DG21_C  B 5  ? C 21 ? 19 1 
1 B DA 6  1_555 C DT 20 1_555 0.199  -0.190 0.266  10.305  -3.725  0.971  6  B_DA6:DT20_C  B 6  ? C 20 ? 20 1 
1 B DC 7  1_555 C DG 19 1_555 0.212  -0.248 0.087  8.681   -13.999 -0.150 7  B_DC7:DG19_C  B 7  ? C 19 ? 19 1 
1 B DC 8  1_555 C DG 18 1_555 0.161  -0.097 0.093  -12.516 -4.261  4.755  8  B_DC8:DG18_C  B 8  ? C 18 ? 19 1 
1 B DT 9  1_555 C DA 17 1_555 -0.040 -0.088 0.040  -6.522  -0.376  9.862  9  B_DT9:DA17_C  B 9  ? C 17 ? 20 1 
1 B DG 10 1_555 C DC 16 1_555 -0.306 -0.096 0.041  -4.675  -12.422 -0.561 10 B_DG10:DC16_C B 10 ? C 16 ? 19 1 
1 B DA 11 1_555 C DT 15 1_555 -0.031 -0.030 0.178  4.072   -24.003 -0.946 11 B_DA11:DT15_C B 11 ? C 15 ? 20 1 
1 B DT 12 1_555 C DA 14 1_555 0.334  -0.228 0.273  -2.984  -16.476 -4.025 12 B_DT12:DA14_C B 12 ? C 14 ? 20 1 
1 B DA 13 1_555 C DT 13 1_555 -0.257 -0.160 0.032  0.476   -20.836 -0.948 13 B_DA13:DT13_C B 13 ? C 13 ? 20 1 
1 B DA 14 1_555 C DT 12 1_555 0.400  -0.090 0.346  3.757   -16.327 -3.746 14 B_DA14:DT12_C B 14 ? C 12 ? 20 1 
1 B DT 15 1_555 C DA 11 1_555 -0.046 -0.142 0.097  -2.654  -12.896 0.683  15 B_DT15:DA11_C B 15 ? C 11 ? 20 1 
1 B DG 16 1_555 C DC 10 1_555 0.004  -0.036 -0.296 5.335   7.476   -1.962 16 B_DG16:DC10_C B 16 ? C 10 ? 19 1 
1 B DG 17 1_555 C DC 9  1_555 -0.282 0.011  -0.337 -9.269  -11.068 -2.771 17 B_DG17:DC9_C  B 17 ? C 9  ? 19 1 
1 B DA 18 1_555 C DT 8  1_555 0.164  -0.163 -0.046 -13.407 -6.159  3.028  18 B_DA18:DT8_C  B 18 ? C 8  ? 20 1 
1 B DG 19 1_555 C DC 7  1_555 -0.253 -0.188 -0.065 5.364   5.980   0.463  19 B_DG19:DC7_C  B 19 ? C 7  ? 19 1 
1 B DG 20 1_555 C DC 6  1_555 -0.445 -0.094 0.111  6.297   -5.726  1.891  20 B_DG20:DC6_C  B 20 ? C 6  ? 19 1 
1 B DA 21 1_555 C DT 5  1_555 -0.047 -0.099 0.100  0.390   -2.145  1.648  21 B_DA21:DT5_C  B 21 ? C 5  ? 20 1 
1 B DT 22 1_555 C DA 4  1_555 -0.202 -0.054 0.103  0.677   -8.338  2.173  22 B_DT22:DA4_C  B 22 ? C 4  ? 20 1 
1 B DA 23 1_555 C DT 3  1_555 0.339  -0.070 0.092  3.105   -15.438 1.869  23 B_DA23:DT3_C  B 23 ? C 3  ? 20 1 
1 B DC 24 1_555 C DG 2  1_555 0.216  0.076  -0.113 -2.549  -18.333 5.879  24 B_DC24:DG2_C  B 24 ? C 2  ? 19 1 
1 B DC 25 1_555 C DG 1  1_555 0.523  -0.155 -0.033 5.161   -12.287 2.351  25 B_DC25:DG1_C  B 25 ? C 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 C DG 25 1_555 B DG 2  1_555 C DC 24 1_555 0.537  -0.108 3.076 2.309  5.612   29.874 -1.262 -0.587 3.038 10.747  
-4.422  30.470 1  BB_DC1DG2:DC24DG25_CC   B 1  ? C 25 ? B 2  ? C 24 ? 
1 B DG 2  1_555 C DC 24 1_555 B DT 3  1_555 C DA 23 1_555 -0.737 -0.467 3.206 -0.979 0.227   29.882 -0.952 1.229  3.224 0.440   
1.897   29.899 2  BB_DG2DT3:DA23DC24_CC   B 2  ? C 24 ? B 3  ? C 23 ? 
1 B DT 3  1_555 C DA 23 1_555 B DA 4  1_555 C DT 22 1_555 1.091  0.682  3.300 4.152  -1.795  40.464 1.183  -1.100 3.359 -2.585  
-5.980  40.706 3  BB_DT3DA4:DT22DA23_CC   B 3  ? C 23 ? B 4  ? C 22 ? 
1 B DA 4  1_555 C DT 22 1_555 B DC 5  1_555 C DG 21 1_555 -0.511 0.172  3.066 3.513  -1.603  29.678 0.641  1.664  2.973 -3.113  
-6.822  29.923 4  BB_DA4DC5:DG21DT22_CC   B 4  ? C 22 ? B 5  ? C 21 ? 
1 B DC 5  1_555 C DG 21 1_555 B DA 6  1_555 C DT 20 1_555 0.541  -0.453 3.456 -2.782 0.173   41.774 -0.653 -1.062 3.413 0.242   
3.897   41.863 5  BB_DC5DA6:DT20DG21_CC   B 5  ? C 21 ? B 6  ? C 20 ? 
1 B DA 6  1_555 C DT 20 1_555 B DC 7  1_555 C DG 19 1_555 0.866  -1.119 3.375 0.116  3.360   33.039 -2.530 -1.497 3.252 5.889   
-0.203  33.205 6  BB_DA6DC7:DG19DT20_CC   B 6  ? C 20 ? B 7  ? C 19 ? 
1 B DC 7  1_555 C DG 19 1_555 B DC 8  1_555 C DG 18 1_555 -0.606 -1.769 3.658 -0.198 6.908   28.422 -5.088 1.156  3.153 13.813  
0.396   29.233 7  BB_DC7DC8:DG18DG19_CC   B 7  ? C 19 ? B 8  ? C 18 ? 
1 B DC 8  1_555 C DG 18 1_555 B DT 9  1_555 C DA 17 1_555 0.022  -0.452 3.274 1.357  2.574   29.574 -1.419 0.241  3.221 5.027   
-2.650  29.714 8  BB_DC8DT9:DA17DG18_CC   B 8  ? C 18 ? B 9  ? C 17 ? 
1 B DT 9  1_555 C DA 17 1_555 B DG 10 1_555 C DC 16 1_555 -1.697 0.389  3.440 -1.228 0.450   31.191 0.632  2.905  3.508 0.837   
2.283   31.218 9  BB_DT9DG10:DC16DA17_CC  B 9  ? C 17 ? B 10 ? C 16 ? 
1 B DG 10 1_555 C DC 16 1_555 B DA 11 1_555 C DT 15 1_555 -0.998 2.228  3.195 -4.380 -7.298  45.784 3.399  0.917  2.905 -9.286  
5.573   46.526 10 BB_DG10DA11:DT15DC16_CC B 10 ? C 16 ? B 11 ? C 15 ? 
1 B DA 11 1_555 C DT 15 1_555 B DT 12 1_555 C DA 14 1_555 -0.462 0.316  3.604 -3.822 -5.968  31.549 1.732  0.084  3.517 -10.806 
6.921   32.316 11 BB_DA11DT12:DA14DT15_CC B 11 ? C 15 ? B 12 ? C 14 ? 
1 B DT 12 1_555 C DA 14 1_555 B DA 13 1_555 C DT 13 1_555 -0.078 3.452  3.296 1.511  -17.093 50.666 4.770  0.169  2.108 -19.348 
-1.711  53.310 12 BB_DT12DA13:DT13DA14_CC B 12 ? C 14 ? B 13 ? C 13 ? 
1 B DA 13 1_555 C DT 13 1_555 B DA 14 1_555 C DT 12 1_555 0.080  -0.266 3.066 -2.450 -2.072  37.927 -0.161 -0.415 3.065 -3.182  
3.762   38.057 13 BB_DA13DA14:DT12DT13_CC B 13 ? C 13 ? B 14 ? C 12 ? 
1 B DA 14 1_555 C DT 12 1_555 B DT 15 1_555 C DA 11 1_555 -0.255 -0.474 3.474 2.309  -3.786  34.548 -0.178 0.801  3.481 -6.342  
-3.868  34.823 14 BB_DA14DT15:DA11DT12_CC B 14 ? C 12 ? B 15 ? C 11 ? 
1 B DT 15 1_555 C DA 11 1_555 B DG 16 1_555 C DC 10 1_555 2.235  0.691  3.158 5.957  -4.821  28.314 2.426  -3.107 3.386 -9.635  
-11.904 29.312 15 BB_DT15DG16:DC10DA11_CC B 15 ? C 11 ? B 16 ? C 10 ? 
1 B DG 16 1_555 C DC 10 1_555 B DG 17 1_555 C DC 9  1_555 0.638  -1.594 3.772 1.058  7.880   25.702 -5.629 -1.076 3.174 17.198  
-2.309  26.884 16 BB_DG16DG17:DC9DC10_CC  B 16 ? C 10 ? B 17 ? C 9  ? 
1 B DG 17 1_555 C DC 9  1_555 B DA 18 1_555 C DT 8  1_555 -0.191 -1.177 3.400 -0.912 0.705   34.115 -2.121 0.176  3.379 1.201   
1.554   34.134 17 BB_DG17DA18:DT8DC9_CC   B 17 ? C 9  ? B 18 ? C 8  ? 
1 B DA 18 1_555 C DT 8  1_555 B DG 19 1_555 C DC 7  1_555 0.013  -0.534 2.977 2.605  3.272   28.816 -1.708 0.487  2.889 6.531   
-5.200  29.111 18 BB_DA18DG19:DC7DT8_CC   B 18 ? C 8  ? B 19 ? C 7  ? 
1 B DG 19 1_555 C DC 7  1_555 B DG 20 1_555 C DC 6  1_555 -0.603 -0.488 3.384 -0.800 0.624   33.955 -0.938 0.900  3.387 1.068   
1.369   33.970 19 BB_DG19DG20:DC6DC7_CC   B 19 ? C 7  ? B 20 ? C 6  ? 
1 B DG 20 1_555 C DC 6  1_555 B DA 21 1_555 C DT 5  1_555 -0.015 -0.686 3.388 -1.653 -4.645  40.289 -0.447 -0.171 3.441 -6.713  
2.389   40.577 20 BB_DG20DA21:DT5DC6_CC   B 20 ? C 6  ? B 21 ? C 5  ? 
1 B DA 21 1_555 C DT 5  1_555 B DT 22 1_555 C DA 4  1_555 0.002  -0.868 3.393 0.255  -6.747  29.046 -0.185 0.052  3.501 -13.227 
-0.499  29.804 21 BB_DA21DT22:DA4DT5_CC   B 21 ? C 5  ? B 22 ? C 4  ? 
1 B DT 22 1_555 C DA 4  1_555 B DA 23 1_555 C DT 3  1_555 0.015  -0.722 3.141 -1.087 4.054   39.843 -1.495 -0.141 3.054 5.929   
1.590   40.054 22 BB_DT22DA23:DT3DA4_CC   B 22 ? C 4  ? B 23 ? C 3  ? 
1 B DA 23 1_555 C DT 3  1_555 B DC 24 1_555 C DG 2  1_555 -0.150 -0.651 3.331 1.301  -3.301  32.075 -0.569 0.507  3.371 -5.952  
-2.345  32.266 23 BB_DA23DC24:DG2DT3_CC   B 23 ? C 3  ? B 24 ? C 2  ? 
1 B DC 24 1_555 C DG 2  1_555 B DC 25 1_555 C DG 1  1_555 0.053  0.112  3.178 1.002  9.725   37.475 -1.000 0.041  3.111 14.829  
-1.528  38.685 24 BB_DC24DC25:DG1DG2_CC   B 24 ? C 2  ? B 25 ? C 1  ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'RO1 GM' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'              MG  
5 2-METHOXYETHANOL             MXE 
6 '2-(2-METHOXYETHOXY)ETHANOL' PG0 
7 water                        HOH 
#