data_5E6B
# 
_entry.id   5E6B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.300 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5E6B         
WWPDB D_1000209305 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5E69 PDB . 
unspecified 5E6A PDB . 
unspecified 5E6C PDB . 
unspecified 5E6D PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5E6B 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hudson, W.H.'  1 
'Rye, E.A.'     2 
'Herbst, A.G.'  3 
'Ortlund, E.A.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                1337 
_citation.page_last                 1337 
_citation.title                     'Cryptic glucocorticoid receptor-binding sites pervade genomic NF-kappa B response elements.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-018-03780-1 
_citation.pdbx_database_id_PubMed   29626214 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hudson, W.H.'    1  ?                   
primary 'Vera, I.M.S.'    2  ?                   
primary 'Nwachukwu, J.C.' 3  0000-0003-4313-9187 
primary 'Weikum, E.R.'    4  ?                   
primary 'Herbst, A.G.'    5  ?                   
primary 'Yang, Q.'        6  ?                   
primary 'Bain, D.L.'      7  ?                   
primary 'Nettles, K.W.'   8  ?                   
primary 'Kojetin, D.J.'   9  0000-0001-8058-6168 
primary 'Ortlund, E.A.'   10 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5E6B 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     39.185 
_cell.length_a_esd                 ? 
_cell.length_b                     97.045 
_cell.length_b_esd                 ? 
_cell.length_c                     103.329 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5E6B 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucocorticoid receptor'                                        12759.804 2  ? ? 'unp residues 391-480' ? 
2 polymer     syn 
;DNA (5'-D(*CP*GP*GP*CP*GP*GP*AP*AP*TP*TP*CP*CP*CP*CP*GP*G)-3')
;
4900.167  1  ? ? ?                      ? 
3 polymer     syn 
;DNA (5'-D(*CP*CP*GP*GP*GP*GP*AP*AP*TP*TP*CP*CP*GP*CP*CP*G)-3')
;
4900.167  1  ? ? ?                      ? 
4 non-polymer syn 'ZINC ION'                                                       65.409    4  ? ? ?                      ? 
5 water       nat water                                                            18.015    75 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GR,Nuclear receptor subfamily 3 group C member 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MHHHHHHSSGVDLGTENLYFQSNAPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKN
CPACRYRKCLQAGMNLEARKTKKKIKGIQQATTG
;
;MHHHHHHSSGVDLGTENLYFQSNAPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKN
CPACRYRKCLQAGMNLEARKTKKKIKGIQQATTG
;
A,B ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DC)(DC)(DG)(DG)' CGGCGGAATTCCCCGG C   ? 
3 polydeoxyribonucleotide no no '(DC)(DC)(DG)(DG)(DG)(DG)(DA)(DA)(DT)(DT)(DC)(DC)(DG)(DC)(DC)(DG)' CCGGGGAATTCCGCCG D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  ASN n 
1 24  ALA n 
1 25  PRO n 
1 26  PRO n 
1 27  LYS n 
1 28  LEU n 
1 29  CYS n 
1 30  LEU n 
1 31  VAL n 
1 32  CYS n 
1 33  SER n 
1 34  ASP n 
1 35  GLU n 
1 36  ALA n 
1 37  SER n 
1 38  GLY n 
1 39  CYS n 
1 40  HIS n 
1 41  TYR n 
1 42  GLY n 
1 43  VAL n 
1 44  LEU n 
1 45  THR n 
1 46  CYS n 
1 47  GLY n 
1 48  SER n 
1 49  CYS n 
1 50  LYS n 
1 51  VAL n 
1 52  PHE n 
1 53  PHE n 
1 54  LYS n 
1 55  ARG n 
1 56  ALA n 
1 57  VAL n 
1 58  GLU n 
1 59  GLY n 
1 60  GLN n 
1 61  HIS n 
1 62  ASN n 
1 63  TYR n 
1 64  LEU n 
1 65  CYS n 
1 66  ALA n 
1 67  GLY n 
1 68  ARG n 
1 69  ASN n 
1 70  ASP n 
1 71  CYS n 
1 72  ILE n 
1 73  ILE n 
1 74  ASP n 
1 75  LYS n 
1 76  ILE n 
1 77  ARG n 
1 78  ARG n 
1 79  LYS n 
1 80  ASN n 
1 81  CYS n 
1 82  PRO n 
1 83  ALA n 
1 84  CYS n 
1 85  ARG n 
1 86  TYR n 
1 87  ARG n 
1 88  LYS n 
1 89  CYS n 
1 90  LEU n 
1 91  GLN n 
1 92  ALA n 
1 93  GLY n 
1 94  MET n 
1 95  ASN n 
1 96  LEU n 
1 97  GLU n 
1 98  ALA n 
1 99  ARG n 
1 100 LYS n 
1 101 THR n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 ILE n 
1 106 LYS n 
1 107 GLY n 
1 108 ILE n 
1 109 GLN n 
1 110 GLN n 
1 111 ALA n 
1 112 THR n 
1 113 THR n 
1 114 GLY n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DG  n 
2 6   DG  n 
2 7   DA  n 
2 8   DA  n 
2 9   DT  n 
2 10  DT  n 
2 11  DC  n 
2 12  DC  n 
2 13  DC  n 
2 14  DC  n 
2 15  DG  n 
2 16  DG  n 
3 1   DC  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DG  n 
3 6   DG  n 
3 7   DA  n 
3 8   DA  n 
3 9   DT  n 
3 10  DT  n 
3 11  DC  n 
3 12  DC  n 
3 13  DG  n 
3 14  DC  n 
3 15  DC  n 
3 16  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   114 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR3C1, GRL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 16 'Homo sapiens' ? 9606 ? 
3 1 sample 1 16 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GCR_HUMAN P04150 P04150-8 1 
;PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKK
IKGIQQATTG
;
391 
2 PDB 5E6B      5E6B   ?        2 ?                                                                                             1 
3 PDB 5E6B      5E6B   ?        3 ?                                                                                             1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5E6B A 25 ? 114 ? P04150 391 ? 480 ? 417 506 
2 2 5E6B C 1  ? 16  ? 5E6B   1   ? 16  ? 1   16  
3 3 5E6B D 1  ? 16  ? 5E6B   1   ? 16  ? 1   16  
4 1 5E6B B 25 ? 114 ? P04150 391 ? 480 ? 417 506 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5E6B MET A 1  ? UNP P04150 ? ? 'initiating methionine' 393 1  
1 5E6B HIS A 2  ? UNP P04150 ? ? 'expression tag'        394 2  
1 5E6B HIS A 3  ? UNP P04150 ? ? 'expression tag'        395 3  
1 5E6B HIS A 4  ? UNP P04150 ? ? 'expression tag'        396 4  
1 5E6B HIS A 5  ? UNP P04150 ? ? 'expression tag'        397 5  
1 5E6B HIS A 6  ? UNP P04150 ? ? 'expression tag'        398 6  
1 5E6B HIS A 7  ? UNP P04150 ? ? 'expression tag'        399 7  
1 5E6B SER A 8  ? UNP P04150 ? ? 'expression tag'        400 8  
1 5E6B SER A 9  ? UNP P04150 ? ? 'expression tag'        401 9  
1 5E6B GLY A 10 ? UNP P04150 ? ? 'expression tag'        402 10 
1 5E6B VAL A 11 ? UNP P04150 ? ? 'expression tag'        403 11 
1 5E6B ASP A 12 ? UNP P04150 ? ? 'expression tag'        404 12 
1 5E6B LEU A 13 ? UNP P04150 ? ? 'expression tag'        405 13 
1 5E6B GLY A 14 ? UNP P04150 ? ? 'expression tag'        406 14 
1 5E6B THR A 15 ? UNP P04150 ? ? 'expression tag'        407 15 
1 5E6B GLU A 16 ? UNP P04150 ? ? 'expression tag'        408 16 
1 5E6B ASN A 17 ? UNP P04150 ? ? 'expression tag'        409 17 
1 5E6B LEU A 18 ? UNP P04150 ? ? 'expression tag'        410 18 
1 5E6B TYR A 19 ? UNP P04150 ? ? 'expression tag'        411 19 
1 5E6B PHE A 20 ? UNP P04150 ? ? 'expression tag'        412 20 
1 5E6B GLN A 21 ? UNP P04150 ? ? 'expression tag'        413 21 
1 5E6B SER A 22 ? UNP P04150 ? ? 'expression tag'        414 22 
1 5E6B ASN A 23 ? UNP P04150 ? ? 'expression tag'        415 23 
1 5E6B ALA A 24 ? UNP P04150 ? ? 'expression tag'        416 24 
4 5E6B MET B 1  ? UNP P04150 ? ? 'initiating methionine' 393 25 
4 5E6B HIS B 2  ? UNP P04150 ? ? 'expression tag'        394 26 
4 5E6B HIS B 3  ? UNP P04150 ? ? 'expression tag'        395 27 
4 5E6B HIS B 4  ? UNP P04150 ? ? 'expression tag'        396 28 
4 5E6B HIS B 5  ? UNP P04150 ? ? 'expression tag'        397 29 
4 5E6B HIS B 6  ? UNP P04150 ? ? 'expression tag'        398 30 
4 5E6B HIS B 7  ? UNP P04150 ? ? 'expression tag'        399 31 
4 5E6B SER B 8  ? UNP P04150 ? ? 'expression tag'        400 32 
4 5E6B SER B 9  ? UNP P04150 ? ? 'expression tag'        401 33 
4 5E6B GLY B 10 ? UNP P04150 ? ? 'expression tag'        402 34 
4 5E6B VAL B 11 ? UNP P04150 ? ? 'expression tag'        403 35 
4 5E6B ASP B 12 ? UNP P04150 ? ? 'expression tag'        404 36 
4 5E6B LEU B 13 ? UNP P04150 ? ? 'expression tag'        405 37 
4 5E6B GLY B 14 ? UNP P04150 ? ? 'expression tag'        406 38 
4 5E6B THR B 15 ? UNP P04150 ? ? 'expression tag'        407 39 
4 5E6B GLU B 16 ? UNP P04150 ? ? 'expression tag'        408 40 
4 5E6B ASN B 17 ? UNP P04150 ? ? 'expression tag'        409 41 
4 5E6B LEU B 18 ? UNP P04150 ? ? 'expression tag'        410 42 
4 5E6B TYR B 19 ? UNP P04150 ? ? 'expression tag'        411 43 
4 5E6B PHE B 20 ? UNP P04150 ? ? 'expression tag'        412 44 
4 5E6B GLN B 21 ? UNP P04150 ? ? 'expression tag'        413 45 
4 5E6B SER B 22 ? UNP P04150 ? ? 'expression tag'        414 46 
4 5E6B ASN B 23 ? UNP P04150 ? ? 'expression tag'        415 47 
4 5E6B ALA B 24 ? UNP P04150 ? ? 'expression tag'        416 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5E6B 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.78 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.77 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES pH 7.5, 7 uM spermine, 15% PEG 8000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5E6B 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.25 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19106 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.25 
_reflns_shell.d_res_low                   2.33 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        84.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5E6B 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.25 
_refine.ls_d_res_low                             32.459 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     19089 
_refine.ls_number_reflns_R_free                  1918 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.56 
_refine.ls_percent_reflns_R_free                 10.05 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2058 
_refine.ls_R_factor_R_free                       0.2274 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2035 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.09 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.28 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1127 
_refine_hist.pdbx_number_atoms_nucleic_acid   650 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             75 
_refine_hist.number_atoms_total               1856 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        32.459 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 1872 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.715  ? 2648 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 22.036 ? 750  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.031  ? 289  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 230  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2443 2.3004  . . 104 966  77.00  . . . 0.3419 . 0.2905 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3004 2.3626  . . 121 1133 93.00  . . . 0.3031 . 0.2585 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3626 2.4321  . . 148 1189 98.00  . . . 0.2824 . 0.2402 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4321 2.5105  . . 128 1223 99.00  . . . 0.2812 . 0.2451 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5105 2.6002  . . 141 1253 100.00 . . . 0.2573 . 0.2352 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6002 2.7043  . . 135 1227 100.00 . . . 0.2552 . 0.2267 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7043 2.8273  . . 140 1259 100.00 . . . 0.2794 . 0.2334 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8273 2.9763  . . 137 1232 100.00 . . . 0.2543 . 0.2377 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9763 3.1626  . . 145 1229 100.00 . . . 0.2374 . 0.2277 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1626 3.4065  . . 138 1250 99.00  . . . 0.2434 . 0.2192 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4065 3.7489  . . 144 1266 100.00 . . . 0.2336 . 0.2110 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7489 4.2903  . . 144 1283 100.00 . . . 0.2324 . 0.1860 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2903 5.4013  . . 142 1295 100.00 . . . 0.1908 . 0.1764 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4013 32.4626 . . 151 1366 100.00 . . . 0.1715 . 0.1619 . . . . . . . . . . 
# 
_struct.entry_id                     5E6B 
_struct.title                        'Glucocorticoid receptor DNA binding domain - RELB NF-kB response element complex' 
_struct.pdbx_descriptor              'Glucocorticoid receptor/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5E6B 
_struct_keywords.text            'DNA binding protein, dna binding protein-dna complex' 
_struct_keywords.pdbx_keywords   'dna binding protein/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 CYS A 46 ? GLU A 58 ? CYS A 438 GLU A 450 1 ? 13 
HELX_P HELX_P2 AA2 CYS A 81 ? GLY A 93 ? CYS A 473 GLY A 485 1 ? 13 
HELX_P HELX_P3 AA3 CYS D 46 ? GLN D 60 ? CYS B 438 GLN B 452 1 ? 15 
HELX_P HELX_P4 AA4 ILE D 76 ? ASN D 80 ? ILE B 468 ASN B 472 5 ? 5  
HELX_P HELX_P5 AA5 CYS D 81 ? ALA D 92 ? CYS B 473 ALA B 484 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 29 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 421 A ZN 601 1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc2  metalc ? ? A CYS 32 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 424 A ZN 601 1_555 ? ? ? ? ? ? ?            2.275 ? 
metalc3  metalc ? ? A CYS 46 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 438 A ZN 601 1_555 ? ? ? ? ? ? ?            2.370 ? 
metalc4  metalc ? ? A CYS 49 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 441 A ZN 601 1_555 ? ? ? ? ? ? ?            2.351 ? 
metalc5  metalc ? ? A CYS 65 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 457 A ZN 602 1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc6  metalc ? ? A CYS 71 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 463 A ZN 602 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc7  metalc ? ? A CYS 81 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 473 A ZN 602 1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc8  metalc ? ? A CYS 84 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 476 A ZN 602 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc9  metalc ? ? D CYS 29 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 421 B ZN 602 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc10 metalc ? ? D CYS 32 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 424 B ZN 602 1_555 ? ? ? ? ? ? ?            2.227 ? 
metalc11 metalc ? ? D CYS 46 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 438 B ZN 602 1_555 ? ? ? ? ? ? ?            2.430 ? 
metalc12 metalc ? ? D CYS 49 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 441 B ZN 602 1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc13 metalc ? ? D CYS 65 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 457 B ZN 601 1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc14 metalc ? ? D CYS 71 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 463 B ZN 601 1_555 ? ? ? ? ? ? ?            2.430 ? 
metalc15 metalc ? ? D CYS 81 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 473 B ZN 601 1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc16 metalc ? ? D CYS 84 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 476 B ZN 601 1_555 ? ? ? ? ? ? ?            2.277 ? 
hydrog1  hydrog ? ? B DC  1  N3 ? ? ? 1_555 C DG 16 N1 ? ? C DC  1   D DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1  N4 ? ? ? 1_555 C DG 16 O6 ? ? C DC  1   D DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1  O2 ? ? ? 1_555 C DG 16 N2 ? ? C DC  1   D DG 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2  N1 ? ? ? 1_555 C DC 15 N3 ? ? C DG  2   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2  N2 ? ? ? 1_555 C DC 15 O2 ? ? C DG  2   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2  O6 ? ? ? 1_555 C DC 15 N4 ? ? C DG  2   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3  N1 ? ? ? 1_555 C DC 14 N3 ? ? C DG  3   D DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3  N2 ? ? ? 1_555 C DC 14 O2 ? ? C DG  3   D DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3  O6 ? ? ? 1_555 C DC 14 N4 ? ? C DG  3   D DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  4  N3 ? ? ? 1_555 C DG 13 N1 ? ? C DC  4   D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  4  N4 ? ? ? 1_555 C DG 13 O6 ? ? C DC  4   D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  4  O2 ? ? ? 1_555 C DG 13 N2 ? ? C DC  4   D DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  5  N1 ? ? ? 1_555 C DC 12 N3 ? ? C DG  5   D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  5  N2 ? ? ? 1_555 C DC 12 O2 ? ? C DG  5   D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  5  O6 ? ? ? 1_555 C DC 12 N4 ? ? C DG  5   D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  6  N1 ? ? ? 1_555 C DC 11 N3 ? ? C DG  6   D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  6  N2 ? ? ? 1_555 C DC 11 O2 ? ? C DG  6   D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  6  O6 ? ? ? 1_555 C DC 11 N4 ? ? C DG  6   D DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  7  N1 ? ? ? 1_555 C DT 10 N3 ? ? C DA  7   D DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  7  N6 ? ? ? 1_555 C DT 10 O4 ? ? C DA  7   D DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  8  N1 ? ? ? 1_555 C DT 9  N3 ? ? C DA  8   D DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DA  8  N6 ? ? ? 1_555 C DT 9  O4 ? ? C DA  8   D DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  9  N3 ? ? ? 1_555 C DA 8  N1 ? ? C DT  9   D DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DT  9  O4 ? ? ? 1_555 C DA 8  N6 ? ? C DT  9   D DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DT  10 N3 ? ? ? 1_555 C DA 7  N1 ? ? C DT  10  D DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DT  10 O4 ? ? ? 1_555 C DA 7  N6 ? ? C DT  10  D DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  11 N3 ? ? ? 1_555 C DG 6  N1 ? ? C DC  11  D DG 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  11 N4 ? ? ? 1_555 C DG 6  O6 ? ? C DC  11  D DG 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DC  11 O2 ? ? ? 1_555 C DG 6  N2 ? ? C DC  11  D DG 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DC  12 N3 ? ? ? 1_555 C DG 5  N1 ? ? C DC  12  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DC  12 N4 ? ? ? 1_555 C DG 5  O6 ? ? C DC  12  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  12 O2 ? ? ? 1_555 C DG 5  N2 ? ? C DC  12  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  13 N3 ? ? ? 1_555 C DG 4  N1 ? ? C DC  13  D DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  13 N4 ? ? ? 1_555 C DG 4  O6 ? ? C DC  13  D DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DC  13 O2 ? ? ? 1_555 C DG 4  N2 ? ? C DC  13  D DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DC  14 N3 ? ? ? 1_555 C DG 3  N1 ? ? C DC  14  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? B DC  14 N4 ? ? ? 1_555 C DG 3  O6 ? ? C DC  14  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? B DC  14 O2 ? ? ? 1_555 C DG 3  N2 ? ? C DC  14  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? B DG  15 N1 ? ? ? 1_555 C DC 2  N3 ? ? C DG  15  D DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? B DG  15 N2 ? ? ? 1_555 C DC 2  O2 ? ? C DG  15  D DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? B DG  15 O6 ? ? ? 1_555 C DC 2  N4 ? ? C DG  15  D DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? B DG  16 N1 ? ? ? 1_555 C DC 1  N3 ? ? C DG  16  D DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? B DG  16 N2 ? ? ? 1_555 C DC 1  O2 ? ? C DG  16  D DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? B DG  16 O6 ? ? ? 1_555 C DC 1  N4 ? ? C DG  16  D DC 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PRO 
_struct_mon_prot_cis.label_seq_id           25 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PRO 
_struct_mon_prot_cis.auth_seq_id            417 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    26 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     418 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -13.34 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 38 ? HIS A 40 ? GLY A 430 HIS A 432 
AA1 2 VAL A 43 ? THR A 45 ? VAL A 435 THR A 437 
AA2 1 GLY D 38 ? HIS D 40 ? GLY B 430 HIS B 432 
AA2 2 VAL D 43 ? THR D 45 ? VAL B 435 THR B 437 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 40 ? N HIS A 432 O VAL A 43 ? O VAL A 435 
AA2 1 2 N HIS D 40 ? N HIS B 432 O VAL D 43 ? O VAL B 435 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 601 ? 4 'binding site for residue ZN A 601' 
AC2 Software A ZN 602 ? 4 'binding site for residue ZN A 602' 
AC3 Software B ZN 601 ? 4 'binding site for residue ZN B 601' 
AC4 Software B ZN 602 ? 4 'binding site for residue ZN B 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 29 ? CYS A 421 . ? 1_555 ? 
2  AC1 4 CYS A 32 ? CYS A 424 . ? 1_555 ? 
3  AC1 4 CYS A 46 ? CYS A 438 . ? 1_555 ? 
4  AC1 4 CYS A 49 ? CYS A 441 . ? 1_555 ? 
5  AC2 4 CYS A 65 ? CYS A 457 . ? 1_555 ? 
6  AC2 4 CYS A 71 ? CYS A 463 . ? 1_555 ? 
7  AC2 4 CYS A 81 ? CYS A 473 . ? 1_555 ? 
8  AC2 4 CYS A 84 ? CYS A 476 . ? 1_555 ? 
9  AC3 4 CYS D 65 ? CYS B 457 . ? 1_555 ? 
10 AC3 4 CYS D 71 ? CYS B 463 . ? 1_555 ? 
11 AC3 4 CYS D 81 ? CYS B 473 . ? 1_555 ? 
12 AC3 4 CYS D 84 ? CYS B 476 . ? 1_555 ? 
13 AC4 4 CYS D 29 ? CYS B 421 . ? 1_555 ? 
14 AC4 4 CYS D 32 ? CYS B 424 . ? 1_555 ? 
15 AC4 4 CYS D 46 ? CYS B 438 . ? 1_555 ? 
16 AC4 4 CYS D 49 ? CYS B 441 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5E6B 
_atom_sites.fract_transf_matrix[1][1]   0.025520 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010304 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009678 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 25 ? 25.895 -20.368 22.617  1.00 88.15  ? 417 PRO A N     1 
ATOM   2    C  CA    . PRO A 1 25 ? 25.661 -19.648 21.362  1.00 89.64  ? 417 PRO A CA    1 
ATOM   3    C  C     . PRO A 1 25 ? 26.114 -20.446 20.140  1.00 87.86  ? 417 PRO A C     1 
ATOM   4    O  O     . PRO A 1 25 ? 26.990 -21.301 20.273  1.00 89.39  ? 417 PRO A O     1 
ATOM   5    C  CB    . PRO A 1 25 ? 26.508 -18.374 21.519  1.00 86.99  ? 417 PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 25 ? 27.255 -18.517 22.841  1.00 85.02  ? 417 PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 25 ? 27.149 -19.949 23.258  1.00 82.87  ? 417 PRO A CD    1 
ATOM   8    N  N     . PRO A 1 26 ? 25.522 -20.180 18.965  1.00 84.89  ? 418 PRO A N     1 
ATOM   9    C  CA    . PRO A 1 26 ? 24.304 -19.410 18.694  1.00 79.79  ? 418 PRO A CA    1 
ATOM   10   C  C     . PRO A 1 26 ? 23.064 -20.302 18.586  1.00 76.04  ? 418 PRO A C     1 
ATOM   11   O  O     . PRO A 1 26 ? 23.163 -21.514 18.779  1.00 80.28  ? 418 PRO A O     1 
ATOM   12   C  CB    . PRO A 1 26 ? 24.604 -18.731 17.348  1.00 76.59  ? 418 PRO A CB    1 
ATOM   13   C  CG    . PRO A 1 26 ? 25.910 -19.352 16.843  1.00 76.37  ? 418 PRO A CG    1 
ATOM   14   C  CD    . PRO A 1 26 ? 26.201 -20.536 17.713  1.00 82.08  ? 418 PRO A CD    1 
ATOM   15   N  N     . LYS A 1 27 ? 21.915 -19.702 18.284  1.00 66.46  ? 419 LYS A N     1 
ATOM   16   C  CA    . LYS A 1 27 ? 20.700 -20.462 17.993  1.00 65.12  ? 419 LYS A CA    1 
ATOM   17   C  C     . LYS A 1 27 ? 20.167 -20.083 16.615  1.00 53.53  ? 419 LYS A C     1 
ATOM   18   O  O     . LYS A 1 27 ? 20.256 -18.925 16.208  1.00 51.75  ? 419 LYS A O     1 
ATOM   19   C  CB    . LYS A 1 27 ? 19.631 -20.221 19.058  1.00 66.44  ? 419 LYS A CB    1 
ATOM   20   C  CG    . LYS A 1 27 ? 20.140 -20.295 20.488  1.00 67.41  ? 419 LYS A CG    1 
ATOM   21   C  CD    . LYS A 1 27 ? 19.049 -19.922 21.479  1.00 65.72  ? 419 LYS A CD    1 
ATOM   22   C  CE    . LYS A 1 27 ? 18.463 -18.549 21.176  1.00 67.84  ? 419 LYS A CE    1 
ATOM   23   N  NZ    . LYS A 1 27 ? 19.510 -17.531 20.878  1.00 69.51  ? 419 LYS A NZ    1 
ATOM   24   N  N     . LEU A 1 28 ? 19.604 -21.055 15.904  1.00 49.08  ? 420 LEU A N     1 
ATOM   25   C  CA    . LEU A 1 28 ? 19.218 -20.846 14.512  1.00 47.67  ? 420 LEU A CA    1 
ATOM   26   C  C     . LEU A 1 28 ? 17.708 -20.806 14.298  1.00 42.88  ? 420 LEU A C     1 
ATOM   27   O  O     . LEU A 1 28 ? 16.952 -21.493 14.986  1.00 42.80  ? 420 LEU A O     1 
ATOM   28   C  CB    . LEU A 1 28 ? 19.827 -21.940 13.631  1.00 46.40  ? 420 LEU A CB    1 
ATOM   29   C  CG    . LEU A 1 28 ? 21.348 -22.089 13.696  1.00 48.07  ? 420 LEU A CG    1 
ATOM   30   C  CD1   . LEU A 1 28 ? 21.828 -23.141 12.708  1.00 46.40  ? 420 LEU A CD1   1 
ATOM   31   C  CD2   . LEU A 1 28 ? 22.025 -20.755 13.436  1.00 48.02  ? 420 LEU A CD2   1 
ATOM   32   N  N     . CYS A 1 29 ? 17.281 -19.995 13.333  1.00 41.27  ? 421 CYS A N     1 
ATOM   33   C  CA    . CYS A 1 29 ? 15.882 -19.942 12.921  1.00 40.73  ? 421 CYS A CA    1 
ATOM   34   C  C     . CYS A 1 29 ? 15.436 -21.294 12.377  1.00 36.79  ? 421 CYS A C     1 
ATOM   35   O  O     . CYS A 1 29 ? 16.083 -21.862 11.500  1.00 36.73  ? 421 CYS A O     1 
ATOM   36   C  CB    . CYS A 1 29 ? 15.670 -18.851 11.867  1.00 35.46  ? 421 CYS A CB    1 
ATOM   37   S  SG    . CYS A 1 29 ? 14.024 -18.821 11.113  1.00 33.62  ? 421 CYS A SG    1 
ATOM   38   N  N     . LEU A 1 30 ? 14.326 -21.805 12.895  1.00 34.60  ? 422 LEU A N     1 
ATOM   39   C  CA    . LEU A 1 30 ? 13.847 -23.126 12.510  1.00 34.85  ? 422 LEU A CA    1 
ATOM   40   C  C     . LEU A 1 30 ? 13.226 -23.132 11.117  1.00 38.36  ? 422 LEU A C     1 
ATOM   41   O  O     . LEU A 1 30 ? 12.880 -24.190 10.590  1.00 35.04  ? 422 LEU A O     1 
ATOM   42   C  CB    . LEU A 1 30 ? 12.844 -23.646 13.539  1.00 33.34  ? 422 LEU A CB    1 
ATOM   43   C  CG    . LEU A 1 30 ? 13.483 -24.118 14.847  1.00 41.61  ? 422 LEU A CG    1 
ATOM   44   C  CD1   . LEU A 1 30 ? 12.423 -24.481 15.875  1.00 43.88  ? 422 LEU A CD1   1 
ATOM   45   C  CD2   . LEU A 1 30 ? 14.411 -25.299 14.589  1.00 38.80  ? 422 LEU A CD2   1 
ATOM   46   N  N     . VAL A 1 31 ? 13.091 -21.951 10.521  1.00 34.57  ? 423 VAL A N     1 
ATOM   47   C  CA    . VAL A 1 31 ? 12.555 -21.838 9.170   1.00 32.53  ? 423 VAL A CA    1 
ATOM   48   C  C     . VAL A 1 31 ? 13.661 -21.724 8.117   1.00 36.77  ? 423 VAL A C     1 
ATOM   49   O  O     . VAL A 1 31 ? 13.771 -22.582 7.243   1.00 35.62  ? 423 VAL A O     1 
ATOM   50   C  CB    . VAL A 1 31 ? 11.604 -20.630 9.044   1.00 35.50  ? 423 VAL A CB    1 
ATOM   51   C  CG1   . VAL A 1 31 ? 11.104 -20.489 7.612   1.00 30.26  ? 423 VAL A CG1   1 
ATOM   52   C  CG2   . VAL A 1 31 ? 10.433 -20.780 10.006  1.00 36.23  ? 423 VAL A CG2   1 
ATOM   53   N  N     . CYS A 1 32 ? 14.434 -20.639 8.165   1.00 33.98  ? 424 CYS A N     1 
ATOM   54   C  CA    . CYS A 1 32 ? 15.513 -20.413 7.197   1.00 36.87  ? 424 CYS A CA    1 
ATOM   55   C  C     . CYS A 1 32 ? 16.957 -20.709 7.663   1.00 36.56  ? 424 CYS A C     1 
ATOM   56   O  O     . CYS A 1 32 ? 17.893 -20.515 6.888   1.00 36.34  ? 424 CYS A O     1 
ATOM   57   C  CB    . CYS A 1 32 ? 15.449 -18.972 6.693   1.00 32.90  ? 424 CYS A CB    1 
ATOM   58   S  SG    . CYS A 1 32 ? 15.968 -17.761 7.899   1.00 33.03  ? 424 CYS A SG    1 
ATOM   59   N  N     . SER A 1 33 ? 17.133 -21.129 8.917   1.00 37.39  ? 425 SER A N     1 
ATOM   60   C  CA    . SER A 1 33 ? 18.456 -21.455 9.492   1.00 43.15  ? 425 SER A CA    1 
ATOM   61   C  C     . SER A 1 33 ? 19.369 -20.245 9.749   1.00 41.24  ? 425 SER A C     1 
ATOM   62   O  O     . SER A 1 33 ? 20.488 -20.408 10.233  1.00 44.38  ? 425 SER A O     1 
ATOM   63   C  CB    . SER A 1 33 ? 19.203 -22.472 8.618   1.00 38.16  ? 425 SER A CB    1 
ATOM   64   O  OG    . SER A 1 33 ? 18.584 -23.743 8.676   1.00 45.38  ? 425 SER A OG    1 
ATOM   65   N  N     . ASP A 1 34 ? 18.906 -19.045 9.414   1.00 40.75  ? 426 ASP A N     1 
ATOM   66   C  CA    . ASP A 1 34 ? 19.605 -17.818 9.799   1.00 39.63  ? 426 ASP A CA    1 
ATOM   67   C  C     . ASP A 1 34 ? 19.548 -17.676 11.322  1.00 42.90  ? 426 ASP A C     1 
ATOM   68   O  O     . ASP A 1 34 ? 18.755 -18.352 11.975  1.00 41.33  ? 426 ASP A O     1 
ATOM   69   C  CB    . ASP A 1 34 ? 18.984 -16.599 9.109   1.00 42.20  ? 426 ASP A CB    1 
ATOM   70   C  CG    . ASP A 1 34 ? 19.850 -15.357 9.215   1.00 44.93  ? 426 ASP A CG    1 
ATOM   71   O  OD1   . ASP A 1 34 ? 21.036 -15.483 9.582   1.00 49.61  ? 426 ASP A OD1   1 
ATOM   72   O  OD2   . ASP A 1 34 ? 19.343 -14.252 8.922   1.00 47.69  ? 426 ASP A OD2   1 
ATOM   73   N  N     . GLU A 1 35 ? 20.412 -16.841 11.896  1.00 49.08  ? 427 GLU A N     1 
ATOM   74   C  CA    . GLU A 1 35 ? 20.429 -16.668 13.349  1.00 47.20  ? 427 GLU A CA    1 
ATOM   75   C  C     . GLU A 1 35 ? 19.091 -16.142 13.865  1.00 43.33  ? 427 GLU A C     1 
ATOM   76   O  O     . GLU A 1 35 ? 18.551 -15.169 13.341  1.00 41.74  ? 427 GLU A O     1 
ATOM   77   C  CB    . GLU A 1 35 ? 21.557 -15.727 13.779  1.00 46.54  ? 427 GLU A CB    1 
ATOM   78   C  CG    . GLU A 1 35 ? 21.736 -15.656 15.291  1.00 56.82  ? 427 GLU A CG    1 
ATOM   79   C  CD    . GLU A 1 35 ? 22.884 -14.760 15.715  1.00 68.84  ? 427 GLU A CD    1 
ATOM   80   O  OE1   . GLU A 1 35 ? 23.641 -14.296 14.836  1.00 65.81  ? 427 GLU A OE1   1 
ATOM   81   O  OE2   . GLU A 1 35 ? 23.030 -14.522 16.934  1.00 72.32  ? 427 GLU A OE2   1 
ATOM   82   N  N     . ALA A 1 36 ? 18.564 -16.795 14.898  1.00 45.45  ? 428 ALA A N     1 
ATOM   83   C  CA    . ALA A 1 36 ? 17.253 -16.454 15.444  1.00 45.31  ? 428 ALA A CA    1 
ATOM   84   C  C     . ALA A 1 36 ? 17.331 -15.314 16.455  1.00 45.47  ? 428 ALA A C     1 
ATOM   85   O  O     . ALA A 1 36 ? 18.265 -15.244 17.255  1.00 49.40  ? 428 ALA A O     1 
ATOM   86   C  CB    . ALA A 1 36 ? 16.619 -17.676 16.081  1.00 41.03  ? 428 ALA A CB    1 
ATOM   87   N  N     . SER A 1 37 ? 16.346 -14.423 16.409  1.00 45.32  ? 429 SER A N     1 
ATOM   88   C  CA    . SER A 1 37 ? 16.290 -13.287 17.323  1.00 43.51  ? 429 SER A CA    1 
ATOM   89   C  C     . SER A 1 37 ? 15.473 -13.586 18.578  1.00 41.76  ? 429 SER A C     1 
ATOM   90   O  O     . SER A 1 37 ? 15.468 -12.798 19.522  1.00 50.30  ? 429 SER A O     1 
ATOM   91   C  CB    . SER A 1 37 ? 15.713 -12.062 16.612  1.00 42.21  ? 429 SER A CB    1 
ATOM   92   O  OG    . SER A 1 37 ? 14.377 -12.293 16.204  1.00 47.99  ? 429 SER A OG    1 
ATOM   93   N  N     . GLY A 1 38 ? 14.784 -14.723 18.587  1.00 45.62  ? 430 GLY A N     1 
ATOM   94   C  CA    . GLY A 1 38 ? 13.958 -15.099 19.721  1.00 42.23  ? 430 GLY A CA    1 
ATOM   95   C  C     . GLY A 1 38 ? 12.823 -16.034 19.344  1.00 46.54  ? 430 GLY A C     1 
ATOM   96   O  O     . GLY A 1 38 ? 12.787 -16.566 18.235  1.00 42.31  ? 430 GLY A O     1 
ATOM   97   N  N     . CYS A 1 39 ? 11.892 -16.236 20.270  1.00 45.28  ? 431 CYS A N     1 
ATOM   98   C  CA    . CYS A 1 39 ? 10.747 -17.102 20.017  1.00 44.57  ? 431 CYS A CA    1 
ATOM   99   C  C     . CYS A 1 39 ? 9.568  -16.273 19.524  1.00 48.02  ? 431 CYS A C     1 
ATOM   100  O  O     . CYS A 1 39 ? 8.977  -15.501 20.280  1.00 46.85  ? 431 CYS A O     1 
ATOM   101  C  CB    . CYS A 1 39 ? 10.370 -17.877 21.283  1.00 44.96  ? 431 CYS A CB    1 
ATOM   102  S  SG    . CYS A 1 39 ? 9.028  -19.073 21.077  1.00 54.80  ? 431 CYS A SG    1 
ATOM   103  N  N     . HIS A 1 40 ? 9.223  -16.444 18.252  1.00 40.60  ? 432 HIS A N     1 
ATOM   104  C  CA    . HIS A 1 40 ? 8.177  -15.642 17.631  1.00 39.78  ? 432 HIS A CA    1 
ATOM   105  C  C     . HIS A 1 40 ? 7.034  -16.517 17.137  1.00 40.34  ? 432 HIS A C     1 
ATOM   106  O  O     . HIS A 1 40 ? 7.250  -17.477 16.393  1.00 34.00  ? 432 HIS A O     1 
ATOM   107  C  CB    . HIS A 1 40 ? 8.748  -14.816 16.478  1.00 37.13  ? 432 HIS A CB    1 
ATOM   108  C  CG    . HIS A 1 40 ? 9.855  -13.895 16.887  1.00 44.96  ? 432 HIS A CG    1 
ATOM   109  N  ND1   . HIS A 1 40 ? 9.662  -12.835 17.745  1.00 46.33  ? 432 HIS A ND1   1 
ATOM   110  C  CD2   . HIS A 1 40 ? 11.169 -13.877 16.556  1.00 40.16  ? 432 HIS A CD2   1 
ATOM   111  C  CE1   . HIS A 1 40 ? 10.808 -12.201 17.924  1.00 43.72  ? 432 HIS A CE1   1 
ATOM   112  N  NE2   . HIS A 1 40 ? 11.737 -12.813 17.215  1.00 44.56  ? 432 HIS A NE2   1 
ATOM   113  N  N     . TYR A 1 41 ? 5.823  -16.169 17.564  1.00 37.88  ? 433 TYR A N     1 
ATOM   114  C  CA    . TYR A 1 41 ? 4.617  -16.923 17.240  1.00 35.14  ? 433 TYR A CA    1 
ATOM   115  C  C     . TYR A 1 41 ? 4.784  -18.405 17.567  1.00 38.71  ? 433 TYR A C     1 
ATOM   116  O  O     . TYR A 1 41 ? 4.307  -19.271 16.835  1.00 35.35  ? 433 TYR A O     1 
ATOM   117  C  CB    . TYR A 1 41 ? 4.244  -16.727 15.770  1.00 33.60  ? 433 TYR A CB    1 
ATOM   118  C  CG    . TYR A 1 41 ? 4.010  -15.275 15.412  1.00 39.78  ? 433 TYR A CG    1 
ATOM   119  C  CD1   . TYR A 1 41 ? 2.977  -14.555 15.999  1.00 39.22  ? 433 TYR A CD1   1 
ATOM   120  C  CD2   . TYR A 1 41 ? 4.824  -14.623 14.494  1.00 35.13  ? 433 TYR A CD2   1 
ATOM   121  C  CE1   . TYR A 1 41 ? 2.760  -13.227 15.683  1.00 39.61  ? 433 TYR A CE1   1 
ATOM   122  C  CE2   . TYR A 1 41 ? 4.612  -13.293 14.169  1.00 40.97  ? 433 TYR A CE2   1 
ATOM   123  C  CZ    . TYR A 1 41 ? 3.578  -12.601 14.768  1.00 46.54  ? 433 TYR A CZ    1 
ATOM   124  O  OH    . TYR A 1 41 ? 3.360  -11.278 14.454  1.00 42.79  ? 433 TYR A OH    1 
ATOM   125  N  N     . GLY A 1 42 ? 5.474  -18.678 18.672  1.00 37.11  ? 434 GLY A N     1 
ATOM   126  C  CA    . GLY A 1 42 ? 5.615  -20.027 19.188  1.00 36.37  ? 434 GLY A CA    1 
ATOM   127  C  C     . GLY A 1 42 ? 6.874  -20.753 18.754  1.00 37.86  ? 434 GLY A C     1 
ATOM   128  O  O     . GLY A 1 42 ? 7.202  -21.808 19.294  1.00 38.44  ? 434 GLY A O     1 
ATOM   129  N  N     . VAL A 1 43 ? 7.585  -20.191 17.782  1.00 37.13  ? 435 VAL A N     1 
ATOM   130  C  CA    . VAL A 1 43 ? 8.725  -20.875 17.183  1.00 40.45  ? 435 VAL A CA    1 
ATOM   131  C  C     . VAL A 1 43 ? 9.975  -19.997 17.178  1.00 37.58  ? 435 VAL A C     1 
ATOM   132  O  O     . VAL A 1 43 ? 9.899  -18.789 16.951  1.00 34.83  ? 435 VAL A O     1 
ATOM   133  C  CB    . VAL A 1 43 ? 8.401  -21.321 15.735  1.00 34.43  ? 435 VAL A CB    1 
ATOM   134  C  CG1   . VAL A 1 43 ? 9.593  -22.005 15.088  1.00 35.69  ? 435 VAL A CG1   1 
ATOM   135  C  CG2   . VAL A 1 43 ? 7.194  -22.250 15.726  1.00 38.88  ? 435 VAL A CG2   1 
ATOM   136  N  N     . LEU A 1 44 ? 11.127 -20.612 17.424  1.00 41.20  ? 436 LEU A N     1 
ATOM   137  C  CA    . LEU A 1 44 ? 12.390 -19.895 17.367  1.00 39.71  ? 436 LEU A CA    1 
ATOM   138  C  C     . LEU A 1 44 ? 12.670 -19.507 15.918  1.00 36.60  ? 436 LEU A C     1 
ATOM   139  O  O     . LEU A 1 44 ? 12.778 -20.372 15.048  1.00 35.00  ? 436 LEU A O     1 
ATOM   140  C  CB    . LEU A 1 44 ? 13.515 -20.768 17.927  1.00 41.80  ? 436 LEU A CB    1 
ATOM   141  C  CG    . LEU A 1 44 ? 14.912 -20.173 18.095  1.00 48.29  ? 436 LEU A CG    1 
ATOM   142  C  CD1   . LEU A 1 44 ? 14.894 -19.052 19.119  1.00 47.18  ? 436 LEU A CD1   1 
ATOM   143  C  CD2   . LEU A 1 44 ? 15.900 -21.259 18.497  1.00 50.73  ? 436 LEU A CD2   1 
ATOM   144  N  N     . THR A 1 45 ? 12.798 -18.205 15.668  1.00 29.32  ? 437 THR A N     1 
ATOM   145  C  CA    . THR A 1 45 ? 12.940 -17.681 14.310  1.00 31.09  ? 437 THR A CA    1 
ATOM   146  C  C     . THR A 1 45 ? 13.758 -16.399 14.266  1.00 36.61  ? 437 THR A C     1 
ATOM   147  O  O     . THR A 1 45 ? 13.932 -15.721 15.278  1.00 38.89  ? 437 THR A O     1 
ATOM   148  C  CB    . THR A 1 45 ? 11.567 -17.366 13.648  1.00 38.57  ? 437 THR A CB    1 
ATOM   149  O  OG1   . THR A 1 45 ? 10.815 -16.479 14.487  1.00 37.34  ? 437 THR A OG1   1 
ATOM   150  C  CG2   . THR A 1 45 ? 10.759 -18.628 13.378  1.00 34.89  ? 437 THR A CG2   1 
ATOM   151  N  N     . CYS A 1 46 ? 14.255 -16.076 13.077  1.00 33.23  ? 438 CYS A N     1 
ATOM   152  C  CA    . CYS A 1 46 ? 14.861 -14.778 12.814  1.00 38.33  ? 438 CYS A CA    1 
ATOM   153  C  C     . CYS A 1 46 ? 13.778 -13.712 12.678  1.00 36.05  ? 438 CYS A C     1 
ATOM   154  O  O     . CYS A 1 46 ? 12.604 -14.030 12.485  1.00 35.06  ? 438 CYS A O     1 
ATOM   155  C  CB    . CYS A 1 46 ? 15.720 -14.821 11.549  1.00 34.89  ? 438 CYS A CB    1 
ATOM   156  S  SG    . CYS A 1 46 ? 14.783 -15.011 10.021  1.00 36.95  ? 438 CYS A SG    1 
ATOM   157  N  N     . GLY A 1 47 ? 14.175 -12.450 12.798  1.00 39.20  ? 439 GLY A N     1 
ATOM   158  C  CA    . GLY A 1 47 ? 13.253 -11.341 12.639  1.00 35.37  ? 439 GLY A CA    1 
ATOM   159  C  C     . GLY A 1 47 ? 12.539 -11.311 11.299  1.00 38.38  ? 439 GLY A C     1 
ATOM   160  O  O     . GLY A 1 47 ? 11.352 -10.991 11.237  1.00 33.58  ? 439 GLY A O     1 
ATOM   161  N  N     . SER A 1 48 ? 13.252 -11.650 10.226  1.00 32.65  ? 440 SER A N     1 
ATOM   162  C  CA    . SER A 1 48 ? 12.679 -11.566 8.883   1.00 34.70  ? 440 SER A CA    1 
ATOM   163  C  C     . SER A 1 48 ? 11.576 -12.601 8.673   1.00 32.89  ? 440 SER A C     1 
ATOM   164  O  O     . SER A 1 48 ? 10.597 -12.338 7.976   1.00 30.18  ? 440 SER A O     1 
ATOM   165  C  CB    . SER A 1 48 ? 13.764 -11.735 7.813   1.00 33.53  ? 440 SER A CB    1 
ATOM   166  O  OG    . SER A 1 48 ? 14.207 -13.076 7.728   1.00 37.12  ? 440 SER A OG    1 
ATOM   167  N  N     . CYS A 1 49 ? 11.738 -13.776 9.271   1.00 32.62  ? 441 CYS A N     1 
ATOM   168  C  CA    . CYS A 1 49 ? 10.718 -14.813 9.176   1.00 36.78  ? 441 CYS A CA    1 
ATOM   169  C  C     . CYS A 1 49 ? 9.529  -14.483 10.072  1.00 31.93  ? 441 CYS A C     1 
ATOM   170  O  O     . CYS A 1 49 ? 8.402  -14.897 9.799   1.00 31.15  ? 441 CYS A O     1 
ATOM   171  C  CB    . CYS A 1 49 ? 11.300 -16.184 9.533   1.00 28.74  ? 441 CYS A CB    1 
ATOM   172  S  SG    . CYS A 1 49 ? 12.303 -16.920 8.209   1.00 32.97  ? 441 CYS A SG    1 
ATOM   173  N  N     . LYS A 1 50 ? 9.782  -13.728 11.137  1.00 31.95  ? 442 LYS A N     1 
ATOM   174  C  CA    . LYS A 1 50 ? 8.710  -13.281 12.018  1.00 34.49  ? 442 LYS A CA    1 
ATOM   175  C  C     . LYS A 1 50 ? 7.716  -12.404 11.262  1.00 35.08  ? 442 LYS A C     1 
ATOM   176  O  O     . LYS A 1 50 ? 6.512  -12.657 11.285  1.00 33.06  ? 442 LYS A O     1 
ATOM   177  C  CB    . LYS A 1 50 ? 9.269  -12.513 13.215  1.00 34.60  ? 442 LYS A CB    1 
ATOM   178  C  CG    . LYS A 1 50 ? 8.190  -11.978 14.144  1.00 40.76  ? 442 LYS A CG    1 
ATOM   179  C  CD    . LYS A 1 50 ? 8.748  -10.994 15.157  1.00 43.05  ? 442 LYS A CD    1 
ATOM   180  C  CE    . LYS A 1 50 ? 8.926  -9.617  14.546  1.00 46.85  ? 442 LYS A CE    1 
ATOM   181  N  NZ    . LYS A 1 50 ? 9.387  -8.620  15.551  1.00 48.11  ? 442 LYS A NZ    1 
ATOM   182  N  N     . VAL A 1 51 ? 8.227  -11.377 10.588  1.00 30.91  ? 443 VAL A N     1 
ATOM   183  C  CA    . VAL A 1 51 ? 7.367  -10.442 9.873   1.00 30.77  ? 443 VAL A CA    1 
ATOM   184  C  C     . VAL A 1 51 ? 6.822  -11.053 8.586   1.00 31.70  ? 443 VAL A C     1 
ATOM   185  O  O     . VAL A 1 51 ? 5.765  -10.646 8.105   1.00 35.85  ? 443 VAL A O     1 
ATOM   186  C  CB    . VAL A 1 51 ? 8.103  -9.123  9.542   1.00 34.66  ? 443 VAL A CB    1 
ATOM   187  C  CG1   . VAL A 1 51 ? 8.466  -8.385  10.821  1.00 37.50  ? 443 VAL A CG1   1 
ATOM   188  C  CG2   . VAL A 1 51 ? 9.345  -9.390  8.700   1.00 34.39  ? 443 VAL A CG2   1 
ATOM   189  N  N     . PHE A 1 52 ? 7.535  -12.028 8.027   1.00 33.84  ? 444 PHE A N     1 
ATOM   190  C  CA    . PHE A 1 52 ? 7.035  -12.719 6.844   1.00 30.50  ? 444 PHE A CA    1 
ATOM   191  C  C     . PHE A 1 52 ? 5.774  -13.500 7.183   1.00 27.89  ? 444 PHE A C     1 
ATOM   192  O  O     . PHE A 1 52 ? 4.778  -13.428 6.465   1.00 28.35  ? 444 PHE A O     1 
ATOM   193  C  CB    . PHE A 1 52 ? 8.078  -13.672 6.254   1.00 29.03  ? 444 PHE A CB    1 
ATOM   194  C  CG    . PHE A 1 52 ? 7.525  -14.562 5.171   1.00 28.89  ? 444 PHE A CG    1 
ATOM   195  C  CD1   . PHE A 1 52 ? 7.421  -14.105 3.868   1.00 31.20  ? 444 PHE A CD1   1 
ATOM   196  C  CD2   . PHE A 1 52 ? 7.082  -15.844 5.462   1.00 28.27  ? 444 PHE A CD2   1 
ATOM   197  C  CE1   . PHE A 1 52 ? 6.901  -14.913 2.873   1.00 32.54  ? 444 PHE A CE1   1 
ATOM   198  C  CE2   . PHE A 1 52 ? 6.558  -16.657 4.472   1.00 30.34  ? 444 PHE A CE2   1 
ATOM   199  C  CZ    . PHE A 1 52 ? 6.469  -16.191 3.176   1.00 31.76  ? 444 PHE A CZ    1 
ATOM   200  N  N     . PHE A 1 53 ? 5.831  -14.263 8.269   1.00 27.28  ? 445 PHE A N     1 
ATOM   201  C  CA    . PHE A 1 53 ? 4.691  -15.073 8.676   1.00 31.20  ? 445 PHE A CA    1 
ATOM   202  C  C     . PHE A 1 53 ? 3.498  -14.180 8.993   1.00 30.84  ? 445 PHE A C     1 
ATOM   203  O  O     . PHE A 1 53 ? 2.368  -14.494 8.629   1.00 33.67  ? 445 PHE A O     1 
ATOM   204  C  CB    . PHE A 1 53 ? 5.041  -15.945 9.882   1.00 29.37  ? 445 PHE A CB    1 
ATOM   205  C  CG    . PHE A 1 53 ? 3.892  -16.776 10.376  1.00 29.03  ? 445 PHE A CG    1 
ATOM   206  C  CD1   . PHE A 1 53 ? 3.465  -17.886 9.663   1.00 27.64  ? 445 PHE A CD1   1 
ATOM   207  C  CD2   . PHE A 1 53 ? 3.234  -16.445 11.549  1.00 27.68  ? 445 PHE A CD2   1 
ATOM   208  C  CE1   . PHE A 1 53 ? 2.401  -18.652 10.112  1.00 24.39  ? 445 PHE A CE1   1 
ATOM   209  C  CE2   . PHE A 1 53 ? 2.171  -17.208 12.006  1.00 32.37  ? 445 PHE A CE2   1 
ATOM   210  C  CZ    . PHE A 1 53 ? 1.755  -18.312 11.286  1.00 28.24  ? 445 PHE A CZ    1 
ATOM   211  N  N     . LYS A 1 54 ? 3.768  -13.063 9.662   1.00 33.11  ? 446 LYS A N     1 
ATOM   212  C  CA    . LYS A 1 54 ? 2.745  -12.074 9.978   1.00 33.24  ? 446 LYS A CA    1 
ATOM   213  C  C     . LYS A 1 54 ? 2.026  -11.590 8.720   1.00 34.45  ? 446 LYS A C     1 
ATOM   214  O  O     . LYS A 1 54 ? 0.797  -11.543 8.679   1.00 35.92  ? 446 LYS A O     1 
ATOM   215  C  CB    . LYS A 1 54 ? 3.367  -10.886 10.718  1.00 41.68  ? 446 LYS A CB    1 
ATOM   216  C  CG    . LYS A 1 54 ? 2.419  -9.720  10.946  1.00 41.32  ? 446 LYS A CG    1 
ATOM   217  C  CD    . LYS A 1 54 ? 1.351  -10.062 11.969  1.00 49.61  ? 446 LYS A CD    1 
ATOM   218  C  CE    . LYS A 1 54 ? 0.468  -8.857  12.261  1.00 54.47  ? 446 LYS A CE    1 
ATOM   219  N  NZ    . LYS A 1 54 ? -0.592 -9.171  13.255  1.00 55.29  ? 446 LYS A NZ    1 
ATOM   220  N  N     . ARG A 1 55 ? 2.798  -11.243 7.694   1.00 31.48  ? 447 ARG A N     1 
ATOM   221  C  CA    . ARG A 1 55 ? 2.231  -10.776 6.431   1.00 35.47  ? 447 ARG A CA    1 
ATOM   222  C  C     . ARG A 1 55 ? 1.463  -11.881 5.709   1.00 33.52  ? 447 ARG A C     1 
ATOM   223  O  O     . ARG A 1 55 ? 0.381  -11.649 5.172   1.00 33.07  ? 447 ARG A O     1 
ATOM   224  C  CB    . ARG A 1 55 ? 3.331  -10.237 5.509   1.00 36.65  ? 447 ARG A CB    1 
ATOM   225  C  CG    . ARG A 1 55 ? 3.977  -8.941  5.971   1.00 39.53  ? 447 ARG A CG    1 
ATOM   226  C  CD    . ARG A 1 55 ? 4.826  -8.327  4.860   1.00 38.86  ? 447 ARG A CD    1 
ATOM   227  N  NE    . ARG A 1 55 ? 5.864  -9.239  4.386   1.00 41.86  ? 447 ARG A NE    1 
ATOM   228  C  CZ    . ARG A 1 55 ? 7.117  -9.246  4.834   1.00 42.22  ? 447 ARG A CZ    1 
ATOM   229  N  NH1   . ARG A 1 55 ? 7.495  -8.383  5.768   1.00 38.18  ? 447 ARG A NH1   1 
ATOM   230  N  NH2   . ARG A 1 55 ? 7.994  -10.113 4.345   1.00 37.40  ? 447 ARG A NH2   1 
ATOM   231  N  N     . ALA A 1 56 ? 2.033  -13.082 5.698   1.00 31.00  ? 448 ALA A N     1 
ATOM   232  C  CA    . ALA A 1 56 ? 1.471  -14.196 4.943   1.00 33.67  ? 448 ALA A CA    1 
ATOM   233  C  C     . ALA A 1 56 ? 0.183  -14.721 5.564   1.00 31.92  ? 448 ALA A C     1 
ATOM   234  O  O     . ALA A 1 56 ? -0.749 -15.100 4.856   1.00 37.09  ? 448 ALA A O     1 
ATOM   235  C  CB    . ALA A 1 56 ? 2.490  -15.320 4.830   1.00 34.39  ? 448 ALA A CB    1 
ATOM   236  N  N     . VAL A 1 57 ? 0.134  -14.742 6.889   1.00 34.34  ? 449 VAL A N     1 
ATOM   237  C  CA    . VAL A 1 57 ? -1.005 -15.312 7.592   1.00 38.98  ? 449 VAL A CA    1 
ATOM   238  C  C     . VAL A 1 57 ? -2.222 -14.387 7.490   1.00 44.73  ? 449 VAL A C     1 
ATOM   239  O  O     . VAL A 1 57 ? -3.365 -14.835 7.585   1.00 42.12  ? 449 VAL A O     1 
ATOM   240  C  CB    . VAL A 1 57 ? -0.657 -15.595 9.074   1.00 38.30  ? 449 VAL A CB    1 
ATOM   241  C  CG1   . VAL A 1 57 ? -0.651 -14.309 9.891   1.00 44.49  ? 449 VAL A CG1   1 
ATOM   242  C  CG2   . VAL A 1 57 ? -1.619 -16.600 9.667   1.00 42.74  ? 449 VAL A CG2   1 
ATOM   243  N  N     . GLU A 1 58 ? -1.971 -13.095 7.304   1.00 42.40  ? 450 GLU A N     1 
ATOM   244  C  CA    . GLU A 1 58 ? -3.043 -12.125 7.111   1.00 42.64  ? 450 GLU A CA    1 
ATOM   245  C  C     . GLU A 1 58 ? -3.252 -11.769 5.639   1.00 43.56  ? 450 GLU A C     1 
ATOM   246  O  O     . GLU A 1 58 ? -4.111 -10.954 5.308   1.00 50.74  ? 450 GLU A O     1 
ATOM   247  C  CB    . GLU A 1 58 ? -2.758 -10.866 7.930   1.00 44.80  ? 450 GLU A CB    1 
ATOM   248  C  CG    . GLU A 1 58 ? -2.524 -11.158 9.405   1.00 49.15  ? 450 GLU A CG    1 
ATOM   249  C  CD    . GLU A 1 58 ? -2.403 -9.905  10.246  1.00 61.39  ? 450 GLU A CD    1 
ATOM   250  O  OE1   . GLU A 1 58 ? -1.972 -8.864  9.708   1.00 65.13  ? 450 GLU A OE1   1 
ATOM   251  O  OE2   . GLU A 1 58 ? -2.733 -9.964  11.450  1.00 64.58  ? 450 GLU A OE2   1 
ATOM   252  N  N     . GLY A 1 59 ? -2.464 -12.381 4.759   1.00 45.96  ? 451 GLY A N     1 
ATOM   253  C  CA    . GLY A 1 59 ? -2.485 -12.045 3.345   1.00 46.68  ? 451 GLY A CA    1 
ATOM   254  C  C     . GLY A 1 59 ? -3.538 -12.775 2.528   1.00 49.91  ? 451 GLY A C     1 
ATOM   255  O  O     . GLY A 1 59 ? -4.529 -13.269 3.068   1.00 50.08  ? 451 GLY A O     1 
ATOM   256  N  N     . GLN A 1 60 ? -3.314 -12.842 1.218   1.00 50.81  ? 452 GLN A N     1 
ATOM   257  C  CA    . GLN A 1 60 ? -4.267 -13.454 0.295   1.00 58.94  ? 452 GLN A CA    1 
ATOM   258  C  C     . GLN A 1 60 ? -4.236 -14.979 0.352   1.00 55.25  ? 452 GLN A C     1 
ATOM   259  O  O     . GLN A 1 60 ? -5.154 -15.641 -0.140  1.00 54.85  ? 452 GLN A O     1 
ATOM   260  C  CB    . GLN A 1 60 ? -3.998 -12.980 -1.136  1.00 63.42  ? 452 GLN A CB    1 
ATOM   261  C  CG    . GLN A 1 60 ? -4.221 -11.491 -1.343  1.00 66.56  ? 452 GLN A CG    1 
ATOM   262  C  CD    . GLN A 1 60 ? -5.669 -11.085 -1.127  1.00 75.98  ? 452 GLN A CD    1 
ATOM   263  O  OE1   . GLN A 1 60 ? -6.548 -11.433 -1.917  1.00 80.21  ? 452 GLN A OE1   1 
ATOM   264  N  NE2   . GLN A 1 60 ? -5.924 -10.348 -0.052  1.00 77.47  ? 452 GLN A NE2   1 
ATOM   265  N  N     . HIS A 1 61 ? -3.167 -15.524 0.929   1.00 53.59  ? 453 HIS A N     1 
ATOM   266  C  CA    . HIS A 1 61 ? -3.065 -16.956 1.212   1.00 50.97  ? 453 HIS A CA    1 
ATOM   267  C  C     . HIS A 1 61 ? -3.108 -17.828 -0.050  1.00 56.64  ? 453 HIS A C     1 
ATOM   268  O  O     . HIS A 1 61 ? -3.445 -19.010 0.018   1.00 59.41  ? 453 HIS A O     1 
ATOM   269  C  CB    . HIS A 1 61 ? -4.197 -17.362 2.166   1.00 52.85  ? 453 HIS A CB    1 
ATOM   270  C  CG    . HIS A 1 61 ? -3.839 -18.467 3.108   1.00 45.35  ? 453 HIS A CG    1 
ATOM   271  N  ND1   . HIS A 1 61 ? -4.410 -19.720 3.036   1.00 41.05  ? 453 HIS A ND1   1 
ATOM   272  C  CD2   . HIS A 1 61 ? -2.985 -18.502 4.158   1.00 38.42  ? 453 HIS A CD2   1 
ATOM   273  C  CE1   . HIS A 1 61 ? -3.913 -20.483 3.993   1.00 44.27  ? 453 HIS A CE1   1 
ATOM   274  N  NE2   . HIS A 1 61 ? -3.046 -19.768 4.689   1.00 45.82  ? 453 HIS A NE2   1 
ATOM   275  N  N     . ASN A 1 62 ? -2.785 -17.231 -1.195  1.00 55.79  ? 454 ASN A N     1 
ATOM   276  C  CA    . ASN A 1 62 ? -2.821 -17.921 -2.487  1.00 54.55  ? 454 ASN A CA    1 
ATOM   277  C  C     . ASN A 1 62 ? -1.481 -18.413 -3.051  1.00 54.99  ? 454 ASN A C     1 
ATOM   278  O  O     . ASN A 1 62 ? -1.443 -18.899 -4.182  1.00 56.48  ? 454 ASN A O     1 
ATOM   279  C  CB    . ASN A 1 62 ? -3.498 -17.025 -3.526  1.00 58.38  ? 454 ASN A CB    1 
ATOM   280  C  CG    . ASN A 1 62 ? -2.925 -15.628 -3.551  1.00 56.96  ? 454 ASN A CG    1 
ATOM   281  O  OD1   . ASN A 1 62 ? -1.982 -15.321 -2.821  1.00 56.42  ? 454 ASN A OD1   1 
ATOM   282  N  ND2   . ASN A 1 62 ? -3.482 -14.773 -4.404  1.00 62.63  ? 454 ASN A ND2   1 
ATOM   283  N  N     . TYR A 1 63 ? -0.402 -18.287 -2.279  1.00 48.16  ? 455 TYR A N     1 
ATOM   284  C  CA    . TYR A 1 63 ? 0.968  -18.453 -2.780  1.00 48.38  ? 455 TYR A CA    1 
ATOM   285  C  C     . TYR A 1 63 ? 1.191  -19.693 -3.648  1.00 43.03  ? 455 TYR A C     1 
ATOM   286  O  O     . TYR A 1 63 ? 0.692  -20.778 -3.346  1.00 39.42  ? 455 TYR A O     1 
ATOM   287  C  CB    . TYR A 1 63 ? 1.939  -18.521 -1.601  1.00 44.28  ? 455 TYR A CB    1 
ATOM   288  C  CG    . TYR A 1 63 ? 2.059  -17.256 -0.781  1.00 50.96  ? 455 TYR A CG    1 
ATOM   289  C  CD1   . TYR A 1 63 ? 2.086  -16.008 -1.388  1.00 56.74  ? 455 TYR A CD1   1 
ATOM   290  C  CD2   . TYR A 1 63 ? 2.174  -17.314 0.603   1.00 53.10  ? 455 TYR A CD2   1 
ATOM   291  C  CE1   . TYR A 1 63 ? 2.211  -14.849 -0.640  1.00 58.49  ? 455 TYR A CE1   1 
ATOM   292  C  CE2   . TYR A 1 63 ? 2.299  -16.163 1.359   1.00 53.43  ? 455 TYR A CE2   1 
ATOM   293  C  CZ    . TYR A 1 63 ? 2.317  -14.933 0.734   1.00 58.41  ? 455 TYR A CZ    1 
ATOM   294  O  OH    . TYR A 1 63 ? 2.442  -13.780 1.481   1.00 62.44  ? 455 TYR A OH    1 
ATOM   295  N  N     . LEU A 1 64 ? 1.947  -19.510 -4.729  1.00 37.32  ? 456 LEU A N     1 
ATOM   296  C  CA    . LEU A 1 64 ? 2.246  -20.586 -5.673  1.00 42.54  ? 456 LEU A CA    1 
ATOM   297  C  C     . LEU A 1 64 ? 3.742  -20.884 -5.738  1.00 40.15  ? 456 LEU A C     1 
ATOM   298  O  O     . LEU A 1 64 ? 4.571  -19.973 -5.736  1.00 37.33  ? 456 LEU A O     1 
ATOM   299  C  CB    . LEU A 1 64 ? 1.729  -20.233 -7.070  1.00 38.50  ? 456 LEU A CB    1 
ATOM   300  C  CG    . LEU A 1 64 ? 0.221  -20.016 -7.206  1.00 45.30  ? 456 LEU A CG    1 
ATOM   301  C  CD1   . LEU A 1 64 ? -0.111 -19.510 -8.599  1.00 41.99  ? 456 LEU A CD1   1 
ATOM   302  C  CD2   . LEU A 1 64 ? -0.537 -21.300 -6.895  1.00 40.72  ? 456 LEU A CD2   1 
ATOM   303  N  N     . CYS A 1 65 ? 4.080  -22.169 -5.796  1.00 36.42  ? 457 CYS A N     1 
ATOM   304  C  CA    . CYS A 1 65 ? 5.468  -22.591 -5.934  1.00 36.93  ? 457 CYS A CA    1 
ATOM   305  C  C     . CYS A 1 65 ? 5.806  -22.853 -7.400  1.00 35.18  ? 457 CYS A C     1 
ATOM   306  O  O     . CYS A 1 65 ? 5.026  -23.470 -8.125  1.00 35.82  ? 457 CYS A O     1 
ATOM   307  C  CB    . CYS A 1 65 ? 5.739  -23.843 -5.093  1.00 33.97  ? 457 CYS A CB    1 
ATOM   308  S  SG    . CYS A 1 65 ? 7.430  -24.505 -5.230  1.00 30.85  ? 457 CYS A SG    1 
ATOM   309  N  N     . ALA A 1 66 ? 6.965  -22.370 -7.834  1.00 31.40  ? 458 ALA A N     1 
ATOM   310  C  CA    . ALA A 1 66 ? 7.426  -22.604 -9.199  1.00 31.06  ? 458 ALA A CA    1 
ATOM   311  C  C     . ALA A 1 66 ? 8.174  -23.930 -9.289  1.00 30.48  ? 458 ALA A C     1 
ATOM   312  O  O     . ALA A 1 66 ? 8.475  -24.416 -10.379 1.00 34.46  ? 458 ALA A O     1 
ATOM   313  C  CB    . ALA A 1 66 ? 8.312  -21.460 -9.666  1.00 32.14  ? 458 ALA A CB    1 
ATOM   314  N  N     . GLY A 1 67 ? 8.481  -24.498 -8.128  1.00 33.79  ? 459 GLY A N     1 
ATOM   315  C  CA    . GLY A 1 67 ? 9.181  -25.768 -8.034  1.00 34.65  ? 459 GLY A CA    1 
ATOM   316  C  C     . GLY A 1 67 ? 8.282  -26.952 -7.717  1.00 33.81  ? 459 GLY A C     1 
ATOM   317  O  O     . GLY A 1 67 ? 7.143  -27.031 -8.176  1.00 39.82  ? 459 GLY A O     1 
ATOM   318  N  N     . ARG A 1 68 ? 8.836  -27.896 -6.962  1.00 29.06  ? 460 ARG A N     1 
ATOM   319  C  CA    . ARG A 1 68 ? 8.145  -29.107 -6.509  1.00 32.38  ? 460 ARG A CA    1 
ATOM   320  C  C     . ARG A 1 68 ? 7.563  -29.001 -5.089  1.00 33.56  ? 460 ARG A C     1 
ATOM   321  O  O     . ARG A 1 68 ? 7.237  -30.016 -4.476  1.00 35.30  ? 460 ARG A O     1 
ATOM   322  C  CB    . ARG A 1 68 ? 9.084  -30.308 -6.613  1.00 33.65  ? 460 ARG A CB    1 
ATOM   323  C  CG    . ARG A 1 68 ? 9.476  -30.619 -8.051  1.00 36.78  ? 460 ARG A CG    1 
ATOM   324  C  CD    . ARG A 1 68 ? 10.320 -31.876 -8.153  1.00 46.58  ? 460 ARG A CD    1 
ATOM   325  N  NE    . ARG A 1 68 ? 10.925 -32.014 -9.475  1.00 50.21  ? 460 ARG A NE    1 
ATOM   326  C  CZ    . ARG A 1 68 ? 11.754 -32.995 -9.821  1.00 56.48  ? 460 ARG A CZ    1 
ATOM   327  N  NH1   . ARG A 1 68 ? 12.082 -33.935 -8.945  1.00 54.48  ? 460 ARG A NH1   1 
ATOM   328  N  NH2   . ARG A 1 68 ? 12.253 -33.032 -11.050 1.00 56.91  ? 460 ARG A NH2   1 
ATOM   329  N  N     . ASN A 1 69 ? 7.529  -27.781 -4.555  1.00 31.28  ? 461 ASN A N     1 
ATOM   330  C  CA    . ASN A 1 69 ? 7.150  -27.476 -3.167  1.00 32.20  ? 461 ASN A CA    1 
ATOM   331  C  C     . ASN A 1 69 ? 8.115  -28.045 -2.130  1.00 33.16  ? 461 ASN A C     1 
ATOM   332  O  O     . ASN A 1 69 ? 7.761  -28.181 -0.958  1.00 32.19  ? 461 ASN A O     1 
ATOM   333  C  CB    . ASN A 1 69 ? 5.738  -28.000 -2.845  1.00 33.59  ? 461 ASN A CB    1 
ATOM   334  C  CG    . ASN A 1 69 ? 4.652  -27.331 -3.667  1.00 32.82  ? 461 ASN A CG    1 
ATOM   335  O  OD1   . ASN A 1 69 ? 4.217  -27.862 -4.686  1.00 38.86  ? 461 ASN A OD1   1 
ATOM   336  N  ND2   . ASN A 1 69 ? 4.196  -26.169 -3.214  1.00 36.40  ? 461 ASN A ND2   1 
ATOM   337  N  N     . ASP A 1 70 ? 9.321  -28.398 -2.568  1.00 30.77  ? 462 ASP A N     1 
ATOM   338  C  CA    . ASP A 1 70 ? 10.435 -28.717 -1.673  1.00 32.48  ? 462 ASP A CA    1 
ATOM   339  C  C     . ASP A 1 70 ? 11.518 -27.630 -1.606  1.00 36.57  ? 462 ASP A C     1 
ATOM   340  O  O     . ASP A 1 70 ? 12.608 -27.895 -1.101  1.00 40.26  ? 462 ASP A O     1 
ATOM   341  C  CB    . ASP A 1 70 ? 11.061 -30.064 -2.037  1.00 40.88  ? 462 ASP A CB    1 
ATOM   342  C  CG    . ASP A 1 70 ? 11.280 -30.227 -3.514  1.00 34.90  ? 462 ASP A CG    1 
ATOM   343  O  OD1   . ASP A 1 70 ? 11.224 -29.215 -4.241  1.00 34.74  ? 462 ASP A OD1   1 
ATOM   344  O  OD2   . ASP A 1 70 ? 11.509 -31.375 -3.946  1.00 50.11  ? 462 ASP A OD2   1 
ATOM   345  N  N     . CYS A 1 71 ? 11.253 -26.453 -2.174  1.00 33.46  ? 463 CYS A N     1 
ATOM   346  C  CA    . CYS A 1 71 ? 12.284 -25.424 -2.374  1.00 30.83  ? 463 CYS A CA    1 
ATOM   347  C  C     . CYS A 1 71 ? 13.134 -25.154 -1.129  1.00 29.48  ? 463 CYS A C     1 
ATOM   348  O  O     . CYS A 1 71 ? 12.626 -25.096 -0.010  1.00 32.93  ? 463 CYS A O     1 
ATOM   349  C  CB    . CYS A 1 71 ? 11.647 -24.103 -2.828  1.00 26.31  ? 463 CYS A CB    1 
ATOM   350  S  SG    . CYS A 1 71 ? 10.936 -24.085 -4.494  1.00 29.14  ? 463 CYS A SG    1 
ATOM   351  N  N     . ILE A 1 72 ? 14.438 -25.014 -1.338  1.00 27.30  ? 464 ILE A N     1 
ATOM   352  C  CA    . ILE A 1 72 ? 15.368 -24.777 -0.243  1.00 31.83  ? 464 ILE A CA    1 
ATOM   353  C  C     . ILE A 1 72 ? 15.194 -23.370 0.312   1.00 31.97  ? 464 ILE A C     1 
ATOM   354  O  O     . ILE A 1 72 ? 15.304 -22.383 -0.414  1.00 32.59  ? 464 ILE A O     1 
ATOM   355  C  CB    . ILE A 1 72 ? 16.828 -24.974 -0.691  1.00 33.07  ? 464 ILE A CB    1 
ATOM   356  C  CG1   . ILE A 1 72 ? 17.083 -26.442 -1.034  1.00 34.35  ? 464 ILE A CG1   1 
ATOM   357  C  CG2   . ILE A 1 72 ? 17.791 -24.514 0.397   1.00 38.65  ? 464 ILE A CG2   1 
ATOM   358  C  CD1   . ILE A 1 72 ? 18.370 -26.671 -1.794  1.00 45.26  ? 464 ILE A CD1   1 
ATOM   359  N  N     . ILE A 1 73 ? 14.919 -23.286 1.607   1.00 28.58  ? 465 ILE A N     1 
ATOM   360  C  CA    . ILE A 1 73 ? 14.723 -21.999 2.250   1.00 29.80  ? 465 ILE A CA    1 
ATOM   361  C  C     . ILE A 1 73 ? 15.876 -21.716 3.202   1.00 32.72  ? 465 ILE A C     1 
ATOM   362  O  O     . ILE A 1 73 ? 15.986 -22.334 4.260   1.00 34.38  ? 465 ILE A O     1 
ATOM   363  C  CB    . ILE A 1 73 ? 13.385 -21.950 3.021   1.00 28.78  ? 465 ILE A CB    1 
ATOM   364  C  CG1   . ILE A 1 73 ? 12.211 -22.242 2.081   1.00 31.44  ? 465 ILE A CG1   1 
ATOM   365  C  CG2   . ILE A 1 73 ? 13.205 -20.604 3.704   1.00 30.27  ? 465 ILE A CG2   1 
ATOM   366  C  CD1   . ILE A 1 73 ? 12.008 -21.195 1.003   1.00 27.61  ? 465 ILE A CD1   1 
ATOM   367  N  N     . ASP A 1 74 ? 16.735 -20.777 2.815   1.00 31.17  ? 466 ASP A N     1 
ATOM   368  C  CA    . ASP A 1 74 ? 17.816 -20.316 3.679   1.00 37.76  ? 466 ASP A CA    1 
ATOM   369  C  C     . ASP A 1 74 ? 17.948 -18.807 3.540   1.00 36.49  ? 466 ASP A C     1 
ATOM   370  O  O     . ASP A 1 74 ? 17.121 -18.174 2.883   1.00 36.12  ? 466 ASP A O     1 
ATOM   371  C  CB    . ASP A 1 74 ? 19.143 -21.025 3.357   1.00 35.88  ? 466 ASP A CB    1 
ATOM   372  C  CG    . ASP A 1 74 ? 19.583 -20.859 1.905   1.00 37.08  ? 466 ASP A CG    1 
ATOM   373  O  OD1   . ASP A 1 74 ? 19.092 -19.951 1.201   1.00 33.81  ? 466 ASP A OD1   1 
ATOM   374  O  OD2   . ASP A 1 74 ? 20.452 -21.646 1.469   1.00 39.53  ? 466 ASP A OD2   1 
ATOM   375  N  N     . LYS A 1 75 ? 18.979 -18.233 4.151   1.00 37.43  ? 467 LYS A N     1 
ATOM   376  C  CA    . LYS A 1 75 ? 19.149 -16.782 4.150   1.00 39.64  ? 467 LYS A CA    1 
ATOM   377  C  C     . LYS A 1 75 ? 19.200 -16.221 2.732   1.00 37.38  ? 467 LYS A C     1 
ATOM   378  O  O     . LYS A 1 75 ? 18.678 -15.139 2.463   1.00 40.97  ? 467 LYS A O     1 
ATOM   379  C  CB    . LYS A 1 75 ? 20.415 -16.390 4.915   1.00 45.67  ? 467 LYS A CB    1 
ATOM   380  C  CG    . LYS A 1 75 ? 20.607 -14.888 5.064   1.00 42.66  ? 467 LYS A CG    1 
ATOM   381  C  CD    . LYS A 1 75 ? 21.841 -14.569 5.894   1.00 54.64  ? 467 LYS A CD    1 
ATOM   382  C  CE    . LYS A 1 75 ? 22.047 -13.070 6.021   1.00 54.79  ? 467 LYS A CE    1 
ATOM   383  N  NZ    . LYS A 1 75 ? 20.868 -12.404 6.638   1.00 57.99  ? 467 LYS A NZ    1 
ATOM   384  N  N     . ILE A 1 76 ? 19.815 -16.971 1.826   1.00 37.20  ? 468 ILE A N     1 
ATOM   385  C  CA    . ILE A 1 76 ? 19.959 -16.531 0.444   1.00 39.01  ? 468 ILE A CA    1 
ATOM   386  C  C     . ILE A 1 76 ? 18.682 -16.723 -0.375  1.00 39.78  ? 468 ILE A C     1 
ATOM   387  O  O     . ILE A 1 76 ? 18.280 -15.838 -1.131  1.00 40.04  ? 468 ILE A O     1 
ATOM   388  C  CB    . ILE A 1 76 ? 21.112 -17.283 -0.258  1.00 42.27  ? 468 ILE A CB    1 
ATOM   389  C  CG1   . ILE A 1 76 ? 22.418 -17.110 0.521   1.00 42.81  ? 468 ILE A CG1   1 
ATOM   390  C  CG2   . ILE A 1 76 ? 21.277 -16.800 -1.691  1.00 46.67  ? 468 ILE A CG2   1 
ATOM   391  C  CD1   . ILE A 1 76 ? 23.587 -17.875 -0.071  1.00 48.05  ? 468 ILE A CD1   1 
ATOM   392  N  N     . ARG A 1 77 ? 18.050 -17.883 -0.227  1.00 35.07  ? 469 ARG A N     1 
ATOM   393  C  CA    . ARG A 1 77 ? 16.955 -18.267 -1.115  1.00 33.81  ? 469 ARG A CA    1 
ATOM   394  C  C     . ARG A 1 77 ? 15.534 -18.038 -0.580  1.00 36.08  ? 469 ARG A C     1 
ATOM   395  O  O     . ARG A 1 77 ? 14.563 -18.279 -1.297  1.00 33.90  ? 469 ARG A O     1 
ATOM   396  C  CB    . ARG A 1 77 ? 17.126 -19.738 -1.505  1.00 32.43  ? 469 ARG A CB    1 
ATOM   397  C  CG    . ARG A 1 77 ? 18.286 -19.969 -2.472  1.00 31.73  ? 469 ARG A CG    1 
ATOM   398  C  CD    . ARG A 1 77 ? 18.701 -21.431 -2.544  1.00 33.34  ? 469 ARG A CD    1 
ATOM   399  N  NE    . ARG A 1 77 ? 19.662 -21.783 -1.501  1.00 34.99  ? 469 ARG A NE    1 
ATOM   400  C  CZ    . ARG A 1 77 ? 20.413 -22.879 -1.518  1.00 36.38  ? 469 ARG A CZ    1 
ATOM   401  N  NH1   . ARG A 1 77 ? 20.319 -23.735 -2.528  1.00 32.62  ? 469 ARG A NH1   1 
ATOM   402  N  NH2   . ARG A 1 77 ? 21.262 -23.120 -0.528  1.00 36.63  ? 469 ARG A NH2   1 
ATOM   403  N  N     . ARG A 1 78 ? 15.401 -17.560 0.655   1.00 34.05  ? 470 ARG A N     1 
ATOM   404  C  CA    . ARG A 1 78 ? 14.078 -17.439 1.276   1.00 34.24  ? 470 ARG A CA    1 
ATOM   405  C  C     . ARG A 1 78 ? 13.165 -16.435 0.567   1.00 35.19  ? 470 ARG A C     1 
ATOM   406  O  O     . ARG A 1 78 ? 11.945 -16.491 0.717   1.00 34.07  ? 470 ARG A O     1 
ATOM   407  C  CB    . ARG A 1 78 ? 14.209 -17.057 2.753   1.00 34.89  ? 470 ARG A CB    1 
ATOM   408  C  CG    . ARG A 1 78 ? 14.831 -15.693 2.995   1.00 34.23  ? 470 ARG A CG    1 
ATOM   409  C  CD    . ARG A 1 78 ? 15.187 -15.505 4.461   1.00 36.13  ? 470 ARG A CD    1 
ATOM   410  N  NE    . ARG A 1 78 ? 15.805 -14.205 4.705   1.00 38.48  ? 470 ARG A NE    1 
ATOM   411  C  CZ    . ARG A 1 78 ? 16.524 -13.909 5.782   1.00 35.95  ? 470 ARG A CZ    1 
ATOM   412  N  NH1   . ARG A 1 78 ? 16.725 -14.823 6.722   1.00 34.54  ? 470 ARG A NH1   1 
ATOM   413  N  NH2   . ARG A 1 78 ? 17.048 -12.700 5.915   1.00 36.25  ? 470 ARG A NH2   1 
ATOM   414  N  N     . LYS A 1 79 ? 13.752 -15.524 -0.203  1.00 34.54  ? 471 LYS A N     1 
ATOM   415  C  CA    . LYS A 1 79 ? 12.974 -14.559 -0.974  1.00 32.60  ? 471 LYS A CA    1 
ATOM   416  C  C     . LYS A 1 79 ? 12.250 -15.217 -2.144  1.00 36.10  ? 471 LYS A C     1 
ATOM   417  O  O     . LYS A 1 79 ? 11.187 -14.759 -2.563  1.00 35.10  ? 471 LYS A O     1 
ATOM   418  C  CB    . LYS A 1 79 ? 13.873 -13.441 -1.508  1.00 37.65  ? 471 LYS A CB    1 
ATOM   419  C  CG    . LYS A 1 79 ? 14.415 -12.486 -0.459  1.00 39.98  ? 471 LYS A CG    1 
ATOM   420  C  CD    . LYS A 1 79 ? 15.264 -11.401 -1.114  1.00 47.52  ? 471 LYS A CD    1 
ATOM   421  C  CE    . LYS A 1 79 ? 15.762 -10.383 -0.099  1.00 48.29  ? 471 LYS A CE    1 
ATOM   422  N  NZ    . LYS A 1 79 ? 16.697 -10.990 0.891   1.00 52.75  ? 471 LYS A NZ    1 
ATOM   423  N  N     . ASN A 1 80 ? 12.837 -16.288 -2.670  1.00 32.68  ? 472 ASN A N     1 
ATOM   424  C  CA    . ASN A 1 80 ? 12.377 -16.889 -3.918  1.00 30.78  ? 472 ASN A CA    1 
ATOM   425  C  C     . ASN A 1 80 ? 10.980 -17.500 -3.860  1.00 32.04  ? 472 ASN A C     1 
ATOM   426  O  O     . ASN A 1 80 ? 10.187 -17.329 -4.783  1.00 30.72  ? 472 ASN A O     1 
ATOM   427  C  CB    . ASN A 1 80 ? 13.365 -17.963 -4.376  1.00 32.54  ? 472 ASN A CB    1 
ATOM   428  C  CG    . ASN A 1 80 ? 14.728 -17.395 -4.720  1.00 38.25  ? 472 ASN A CG    1 
ATOM   429  O  OD1   . ASN A 1 80 ? 15.166 -16.401 -4.141  1.00 35.33  ? 472 ASN A OD1   1 
ATOM   430  N  ND2   . ASN A 1 80 ? 15.407 -18.029 -5.670  1.00 33.05  ? 472 ASN A ND2   1 
ATOM   431  N  N     . CYS A 1 81 ? 10.685 -18.235 -2.795  1.00 26.16  ? 473 CYS A N     1 
ATOM   432  C  CA    . CYS A 1 81 ? 9.420  -18.951 -2.730  1.00 28.49  ? 473 CYS A CA    1 
ATOM   433  C  C     . CYS A 1 81 ? 8.664  -18.716 -1.427  1.00 24.70  ? 473 CYS A C     1 
ATOM   434  O  O     . CYS A 1 81 ? 8.869  -19.431 -0.447  1.00 28.17  ? 473 CYS A O     1 
ATOM   435  C  CB    . CYS A 1 81 ? 9.649  -20.448 -2.930  1.00 29.69  ? 473 CYS A CB    1 
ATOM   436  S  SG    . CYS A 1 81 ? 8.141  -21.339 -3.353  1.00 31.85  ? 473 CYS A SG    1 
ATOM   437  N  N     . PRO A 1 82 ? 7.795  -17.697 -1.414  1.00 29.27  ? 474 PRO A N     1 
ATOM   438  C  CA    . PRO A 1 82 ? 6.907  -17.434 -0.277  1.00 28.01  ? 474 PRO A CA    1 
ATOM   439  C  C     . PRO A 1 82 ? 6.074  -18.659 0.093   1.00 26.81  ? 474 PRO A C     1 
ATOM   440  O  O     . PRO A 1 82 ? 5.847  -18.910 1.274   1.00 27.18  ? 474 PRO A O     1 
ATOM   441  C  CB    . PRO A 1 82 ? 6.015  -16.301 -0.787  1.00 30.27  ? 474 PRO A CB    1 
ATOM   442  C  CG    . PRO A 1 82 ? 6.861  -15.587 -1.783  1.00 35.17  ? 474 PRO A CG    1 
ATOM   443  C  CD    . PRO A 1 82 ? 7.693  -16.653 -2.450  1.00 28.95  ? 474 PRO A CD    1 
ATOM   444  N  N     . ALA A 1 83 ? 5.636  -19.411 -0.912  1.00 29.78  ? 475 ALA A N     1 
ATOM   445  C  CA    . ALA A 1 83 ? 4.823  -20.599 -0.687  1.00 29.76  ? 475 ALA A CA    1 
ATOM   446  C  C     . ALA A 1 83 ? 5.551  -21.623 0.180   1.00 27.16  ? 475 ALA A C     1 
ATOM   447  O  O     . ALA A 1 83 ? 5.006  -22.098 1.175   1.00 27.01  ? 475 ALA A O     1 
ATOM   448  C  CB    . ALA A 1 83 ? 4.418  -21.222 -2.016  1.00 27.90  ? 475 ALA A CB    1 
ATOM   449  N  N     . CYS A 1 84 ? 6.784  -21.958 -0.192  1.00 25.61  ? 476 CYS A N     1 
ATOM   450  C  CA    . CYS A 1 84 ? 7.549  -22.942 0.568   1.00 27.85  ? 476 CYS A CA    1 
ATOM   451  C  C     . CYS A 1 84 ? 7.971  -22.384 1.923   1.00 26.54  ? 476 CYS A C     1 
ATOM   452  O  O     . CYS A 1 84 ? 7.976  -23.103 2.920   1.00 27.21  ? 476 CYS A O     1 
ATOM   453  C  CB    . CYS A 1 84 ? 8.772  -23.410 -0.224  1.00 30.40  ? 476 CYS A CB    1 
ATOM   454  S  SG    . CYS A 1 84 ? 8.383  -24.597 -1.543  1.00 27.04  ? 476 CYS A SG    1 
ATOM   455  N  N     . ARG A 1 85 ? 8.313  -21.100 1.961   1.00 26.78  ? 477 ARG A N     1 
ATOM   456  C  CA    . ARG A 1 85 ? 8.670  -20.454 3.219   1.00 25.65  ? 477 ARG A CA    1 
ATOM   457  C  C     . ARG A 1 85 ? 7.494  -20.482 4.194   1.00 28.20  ? 477 ARG A C     1 
ATOM   458  O  O     . ARG A 1 85 ? 7.665  -20.773 5.379   1.00 25.91  ? 477 ARG A O     1 
ATOM   459  C  CB    . ARG A 1 85 ? 9.120  -19.013 2.979   1.00 31.71  ? 477 ARG A CB    1 
ATOM   460  C  CG    . ARG A 1 85 ? 9.727  -18.338 4.198   1.00 29.51  ? 477 ARG A CG    1 
ATOM   461  C  CD    . ARG A 1 85 ? 10.133 -16.907 3.884   1.00 30.56  ? 477 ARG A CD    1 
ATOM   462  N  NE    . ARG A 1 85 ? 10.872 -16.285 4.979   1.00 31.67  ? 477 ARG A NE    1 
ATOM   463  C  CZ    . ARG A 1 85 ? 11.408 -15.070 4.917   1.00 31.57  ? 477 ARG A CZ    1 
ATOM   464  N  NH1   . ARG A 1 85 ? 11.287 -14.348 3.812   1.00 32.56  ? 477 ARG A NH1   1 
ATOM   465  N  NH2   . ARG A 1 85 ? 12.067 -14.577 5.957   1.00 29.60  ? 477 ARG A NH2   1 
ATOM   466  N  N     . TYR A 1 86 ? 6.300  -20.190 3.682   1.00 28.97  ? 478 TYR A N     1 
ATOM   467  C  CA    . TYR A 1 86 ? 5.092  -20.188 4.500   1.00 24.92  ? 478 TYR A CA    1 
ATOM   468  C  C     . TYR A 1 86 ? 4.772  -21.589 5.000   1.00 26.08  ? 478 TYR A C     1 
ATOM   469  O  O     . TYR A 1 86 ? 4.378  -21.774 6.151   1.00 29.75  ? 478 TYR A O     1 
ATOM   470  C  CB    . TYR A 1 86 ? 3.907  -19.625 3.711   1.00 30.82  ? 478 TYR A CB    1 
ATOM   471  C  CG    . TYR A 1 86 ? 2.624  -19.536 4.506   1.00 27.30  ? 478 TYR A CG    1 
ATOM   472  C  CD1   . TYR A 1 86 ? 2.572  -18.831 5.701   1.00 27.20  ? 478 TYR A CD1   1 
ATOM   473  C  CD2   . TYR A 1 86 ? 1.460  -20.143 4.053   1.00 32.87  ? 478 TYR A CD2   1 
ATOM   474  C  CE1   . TYR A 1 86 ? 1.398  -18.740 6.430   1.00 30.05  ? 478 TYR A CE1   1 
ATOM   475  C  CE2   . TYR A 1 86 ? 0.281  -20.057 4.772   1.00 32.54  ? 478 TYR A CE2   1 
ATOM   476  C  CZ    . TYR A 1 86 ? 0.256  -19.354 5.959   1.00 35.97  ? 478 TYR A CZ    1 
ATOM   477  O  OH    . TYR A 1 86 ? -0.915 -19.270 6.679   1.00 32.41  ? 478 TYR A OH    1 
ATOM   478  N  N     . ARG A 1 87 ? 4.948  -22.573 4.124   1.00 28.58  ? 479 ARG A N     1 
ATOM   479  C  CA    . ARG A 1 87 ? 4.756  -23.971 4.486   1.00 29.54  ? 479 ARG A CA    1 
ATOM   480  C  C     . ARG A 1 87 ? 5.688  -24.369 5.629   1.00 27.82  ? 479 ARG A C     1 
ATOM   481  O  O     . ARG A 1 87 ? 5.263  -25.011 6.590   1.00 30.46  ? 479 ARG A O     1 
ATOM   482  C  CB    . ARG A 1 87 ? 4.982  -24.875 3.270   1.00 28.67  ? 479 ARG A CB    1 
ATOM   483  C  CG    . ARG A 1 87 ? 4.991  -26.356 3.595   1.00 29.75  ? 479 ARG A CG    1 
ATOM   484  C  CD    . ARG A 1 87 ? 5.223  -27.203 2.353   1.00 34.59  ? 479 ARG A CD    1 
ATOM   485  N  NE    . ARG A 1 87 ? 6.382  -26.756 1.586   1.00 37.46  ? 479 ARG A NE    1 
ATOM   486  C  CZ    . ARG A 1 87 ? 7.643  -27.047 1.892   1.00 38.81  ? 479 ARG A CZ    1 
ATOM   487  N  NH1   . ARG A 1 87 ? 7.920  -27.787 2.959   1.00 33.71  ? 479 ARG A NH1   1 
ATOM   488  N  NH2   . ARG A 1 87 ? 8.630  -26.594 1.131   1.00 34.17  ? 479 ARG A NH2   1 
ATOM   489  N  N     . LYS A 1 88 ? 6.954  -23.973 5.532   1.00 26.38  ? 480 LYS A N     1 
ATOM   490  C  CA    . LYS A 1 88 ? 7.921  -24.282 6.583   1.00 28.02  ? 480 LYS A CA    1 
ATOM   491  C  C     . LYS A 1 88 ? 7.576  -23.570 7.891   1.00 27.95  ? 480 LYS A C     1 
ATOM   492  O  O     . LYS A 1 88 ? 7.778  -24.128 8.969   1.00 30.55  ? 480 LYS A O     1 
ATOM   493  C  CB    . LYS A 1 88 ? 9.342  -23.920 6.140   1.00 27.80  ? 480 LYS A CB    1 
ATOM   494  C  CG    . LYS A 1 88 ? 9.907  -24.852 5.073   1.00 32.77  ? 480 LYS A CG    1 
ATOM   495  C  CD    . LYS A 1 88 ? 11.408 -24.663 4.899   1.00 35.26  ? 480 LYS A CD    1 
ATOM   496  C  CE    . LYS A 1 88 ? 12.180 -25.283 6.060   1.00 38.20  ? 480 LYS A CE    1 
ATOM   497  N  NZ    . LYS A 1 88 ? 13.656 -25.123 5.907   1.00 38.94  ? 480 LYS A NZ    1 
ATOM   498  N  N     . CYS A 1 89 ? 7.057  -22.346 7.796   1.00 25.24  ? 481 CYS A N     1 
ATOM   499  C  CA    . CYS A 1 89 ? 6.559  -21.636 8.975   1.00 27.96  ? 481 CYS A CA    1 
ATOM   500  C  C     . CYS A 1 89 ? 5.496  -22.458 9.695   1.00 26.97  ? 481 CYS A C     1 
ATOM   501  O  O     . CYS A 1 89 ? 5.557  -22.646 10.910  1.00 32.80  ? 481 CYS A O     1 
ATOM   502  C  CB    . CYS A 1 89 ? 5.975  -20.272 8.597   1.00 26.02  ? 481 CYS A CB    1 
ATOM   503  S  SG    . CYS A 1 89 ? 7.180  -19.005 8.153   1.00 29.91  ? 481 CYS A SG    1 
ATOM   504  N  N     . LEU A 1 90 ? 4.525  -22.945 8.928   1.00 26.24  ? 482 LEU A N     1 
ATOM   505  C  CA    . LEU A 1 90 ? 3.416  -23.718 9.474   1.00 29.81  ? 482 LEU A CA    1 
ATOM   506  C  C     . LEU A 1 90 ? 3.883  -25.060 10.025  1.00 29.15  ? 482 LEU A C     1 
ATOM   507  O  O     . LEU A 1 90 ? 3.472  -25.467 11.111  1.00 26.46  ? 482 LEU A O     1 
ATOM   508  C  CB    . LEU A 1 90 ? 2.341  -23.938 8.404   1.00 27.03  ? 482 LEU A CB    1 
ATOM   509  C  CG    . LEU A 1 90 ? 1.613  -22.684 7.911   1.00 31.85  ? 482 LEU A CG    1 
ATOM   510  C  CD1   . LEU A 1 90 ? 0.666  -23.029 6.775   1.00 27.17  ? 482 LEU A CD1   1 
ATOM   511  C  CD2   . LEU A 1 90 ? 0.861  -22.004 9.049   1.00 28.06  ? 482 LEU A CD2   1 
ATOM   512  N  N     . GLN A 1 91 ? 4.738  -25.744 9.268   1.00 28.44  ? 483 GLN A N     1 
ATOM   513  C  CA    . GLN A 1 91 ? 5.259  -27.041 9.684   1.00 29.77  ? 483 GLN A CA    1 
ATOM   514  C  C     . GLN A 1 91 ? 6.040  -26.913 10.988  1.00 32.32  ? 483 GLN A C     1 
ATOM   515  O  O     . GLN A 1 91 ? 5.990  -27.800 11.838  1.00 33.41  ? 483 GLN A O     1 
ATOM   516  C  CB    . GLN A 1 91 ? 6.142  -27.648 8.587   1.00 31.02  ? 483 GLN A CB    1 
ATOM   517  C  CG    . GLN A 1 91 ? 5.425  -28.654 7.693   1.00 42.54  ? 483 GLN A CG    1 
ATOM   518  C  CD    . GLN A 1 91 ? 6.196  -28.962 6.419   1.00 49.88  ? 483 GLN A CD    1 
ATOM   519  O  OE1   . GLN A 1 91 ? 7.215  -28.335 6.130   1.00 49.95  ? 483 GLN A OE1   1 
ATOM   520  N  NE2   . GLN A 1 91 ? 5.710  -29.931 5.652   1.00 43.05  ? 483 GLN A NE2   1 
ATOM   521  N  N     . ALA A 1 92 ? 6.748  -25.797 11.147  1.00 31.78  ? 484 ALA A N     1 
ATOM   522  C  CA    . ALA A 1 92 ? 7.500  -25.537 12.371  1.00 28.78  ? 484 ALA A CA    1 
ATOM   523  C  C     . ALA A 1 92 ? 6.565  -25.238 13.543  1.00 33.60  ? 484 ALA A C     1 
ATOM   524  O  O     . ALA A 1 92 ? 6.976  -25.295 14.701  1.00 32.11  ? 484 ALA A O     1 
ATOM   525  C  CB    . ALA A 1 92 ? 8.475  -24.389 12.163  1.00 29.34  ? 484 ALA A CB    1 
ATOM   526  N  N     . GLY A 1 93 ? 5.308  -24.922 13.240  1.00 30.12  ? 485 GLY A N     1 
ATOM   527  C  CA    . GLY A 1 93 ? 4.311  -24.732 14.279  1.00 28.59  ? 485 GLY A CA    1 
ATOM   528  C  C     . GLY A 1 93 ? 3.926  -23.298 14.591  1.00 30.26  ? 485 GLY A C     1 
ATOM   529  O  O     . GLY A 1 93 ? 3.236  -23.044 15.579  1.00 30.48  ? 485 GLY A O     1 
ATOM   530  N  N     . MET A 1 94 ? 4.370  -22.358 13.761  1.00 27.97  ? 486 MET A N     1 
ATOM   531  C  CA    . MET A 1 94 ? 4.056  -20.946 13.973  1.00 32.95  ? 486 MET A CA    1 
ATOM   532  C  C     . MET A 1 94 ? 2.552  -20.679 13.912  1.00 32.35  ? 486 MET A C     1 
ATOM   533  O  O     . MET A 1 94 ? 1.854  -21.195 13.040  1.00 27.42  ? 486 MET A O     1 
ATOM   534  C  CB    . MET A 1 94 ? 4.775  -20.073 12.941  1.00 25.86  ? 486 MET A CB    1 
ATOM   535  C  CG    . MET A 1 94 ? 6.290  -20.171 12.992  1.00 31.41  ? 486 MET A CG    1 
ATOM   536  S  SD    . MET A 1 94 ? 7.115  -19.031 11.867  1.00 32.34  ? 486 MET A SD    1 
ATOM   537  C  CE    . MET A 1 94 ? 6.795  -17.468 12.680  1.00 32.89  ? 486 MET A CE    1 
ATOM   538  N  N     . ASN A 1 95 ? 2.061  -19.873 14.849  1.00 32.46  ? 487 ASN A N     1 
ATOM   539  C  CA    . ASN A 1 95 ? 0.660  -19.466 14.864  1.00 35.16  ? 487 ASN A CA    1 
ATOM   540  C  C     . ASN A 1 95 ? 0.486  -18.120 15.557  1.00 35.63  ? 487 ASN A C     1 
ATOM   541  O  O     . ASN A 1 95 ? 1.268  -17.768 16.438  1.00 35.07  ? 487 ASN A O     1 
ATOM   542  C  CB    . ASN A 1 95 ? -0.196 -20.526 15.555  1.00 31.58  ? 487 ASN A CB    1 
ATOM   543  C  CG    . ASN A 1 95 ? 0.162  -20.694 17.015  1.00 43.05  ? 487 ASN A CG    1 
ATOM   544  O  OD1   . ASN A 1 95 ? 1.206  -21.253 17.350  1.00 43.83  ? 487 ASN A OD1   1 
ATOM   545  N  ND2   . ASN A 1 95 ? -0.703 -20.203 17.895  1.00 50.71  ? 487 ASN A ND2   1 
ATOM   546  N  N     . LEU A 1 96 ? -0.549 -17.379 15.172  1.00 42.27  ? 488 LEU A N     1 
ATOM   547  C  CA    . LEU A 1 96 ? -0.787 -16.046 15.721  1.00 45.23  ? 488 LEU A CA    1 
ATOM   548  C  C     . LEU A 1 96 ? -1.191 -16.066 17.192  1.00 50.43  ? 488 LEU A C     1 
ATOM   549  O  O     . LEU A 1 96 ? -1.002 -15.081 17.903  1.00 60.75  ? 488 LEU A O     1 
ATOM   550  C  CB    . LEU A 1 96 ? -1.866 -15.320 14.912  1.00 50.71  ? 488 LEU A CB    1 
ATOM   551  C  CG    . LEU A 1 96 ? -1.440 -14.679 13.591  1.00 50.27  ? 488 LEU A CG    1 
ATOM   552  C  CD1   . LEU A 1 96 ? -2.516 -13.726 13.091  1.00 52.68  ? 488 LEU A CD1   1 
ATOM   553  C  CD2   . LEU A 1 96 ? -0.114 -13.955 13.748  1.00 48.72  ? 488 LEU A CD2   1 
ATOM   554  N  N     . GLU A 1 97 ? -1.741 -17.187 17.647  1.00 49.14  ? 489 GLU A N     1 
ATOM   555  C  CA    . GLU A 1 97 ? -2.290 -17.266 18.997  1.00 58.77  ? 489 GLU A CA    1 
ATOM   556  C  C     . GLU A 1 97 ? -1.224 -17.509 20.063  1.00 62.95  ? 489 GLU A C     1 
ATOM   557  O  O     . GLU A 1 97 ? -1.523 -17.512 21.257  1.00 70.71  ? 489 GLU A O     1 
ATOM   558  C  CB    . GLU A 1 97 ? -3.354 -18.364 19.072  1.00 62.21  ? 489 GLU A CB    1 
ATOM   559  C  CG    . GLU A 1 97 ? -4.779 -17.846 18.948  1.00 69.10  ? 489 GLU A CG    1 
ATOM   560  C  CD    . GLU A 1 97 ? -4.938 -16.440 19.499  1.00 77.70  ? 489 GLU A CD    1 
ATOM   561  O  OE1   . GLU A 1 97 ? -4.936 -16.280 20.739  1.00 82.26  ? 489 GLU A OE1   1 
ATOM   562  O  OE2   . GLU A 1 97 ? -5.070 -15.495 18.692  1.00 77.98  ? 489 GLU A OE2   1 
ATOM   563  N  N     . ALA A 1 98 ? 0.017  -17.714 19.635  1.00 53.88  ? 490 ALA A N     1 
ATOM   564  C  CA    . ALA A 1 98 ? 1.111  -17.938 20.574  1.00 63.25  ? 490 ALA A CA    1 
ATOM   565  C  C     . ALA A 1 98 ? 1.669  -16.613 21.088  1.00 69.68  ? 490 ALA A C     1 
ATOM   566  O  O     . ALA A 1 98 ? 1.051  -15.950 21.923  1.00 73.12  ? 490 ALA A O     1 
ATOM   567  C  CB    . ALA A 1 98 ? 2.209  -18.760 19.923  1.00 56.17  ? 490 ALA A CB    1 
ATOM   568  O  "O5'" . DC  B 2 1  ? 16.566 -1.479  31.385  1.00 77.46  ? 1   DC  C "O5'" 1 
ATOM   569  C  "C5'" . DC  B 2 1  ? 17.582 -2.264  32.001  1.00 77.70  ? 1   DC  C "C5'" 1 
ATOM   570  C  "C4'" . DC  B 2 1  ? 17.016 -3.580  32.497  1.00 76.92  ? 1   DC  C "C4'" 1 
ATOM   571  O  "O4'" . DC  B 2 1  ? 15.749 -3.340  33.130  1.00 74.97  ? 1   DC  C "O4'" 1 
ATOM   572  C  "C3'" . DC  B 2 1  ? 16.729 -4.591  31.405  1.00 76.25  ? 1   DC  C "C3'" 1 
ATOM   573  O  "O3'" . DC  B 2 1  ? 17.874 -5.408  31.210  1.00 78.43  ? 1   DC  C "O3'" 1 
ATOM   574  C  "C2'" . DC  B 2 1  ? 15.548 -5.402  31.957  1.00 73.62  ? 1   DC  C "C2'" 1 
ATOM   575  C  "C1'" . DC  B 2 1  ? 14.952 -4.500  33.047  1.00 71.21  ? 1   DC  C "C1'" 1 
ATOM   576  N  N1    . DC  B 2 1  ? 13.542 -4.078  32.792  1.00 66.30  ? 1   DC  C N1    1 
ATOM   577  C  C2    . DC  B 2 1  ? 12.498 -4.995  32.955  1.00 67.75  ? 1   DC  C C2    1 
ATOM   578  O  O2    . DC  B 2 1  ? 12.760 -6.155  33.294  1.00 71.74  ? 1   DC  C O2    1 
ATOM   579  N  N3    . DC  B 2 1  ? 11.224 -4.587  32.729  1.00 67.58  ? 1   DC  C N3    1 
ATOM   580  C  C4    . DC  B 2 1  ? 10.982 -3.327  32.363  1.00 67.30  ? 1   DC  C C4    1 
ATOM   581  N  N4    . DC  B 2 1  ? 9.711  -2.970  32.152  1.00 69.65  ? 1   DC  C N4    1 
ATOM   582  C  C5    . DC  B 2 1  ? 12.032 -2.376  32.197  1.00 65.06  ? 1   DC  C C5    1 
ATOM   583  C  C6    . DC  B 2 1  ? 13.283 -2.790  32.422  1.00 68.66  ? 1   DC  C C6    1 
ATOM   584  P  P     . DG  B 2 2  ? 18.449 -5.663  29.732  1.00 92.67  ? 2   DG  C P     1 
ATOM   585  O  OP1   . DG  B 2 2  ? 19.891 -5.971  29.856  1.00 91.68  ? 2   DG  C OP1   1 
ATOM   586  O  OP2   . DG  B 2 2  ? 18.004 -4.545  28.871  1.00 85.91  ? 2   DG  C OP2   1 
ATOM   587  O  "O5'" . DG  B 2 2  ? 17.681 -6.979  29.256  1.00 83.08  ? 2   DG  C "O5'" 1 
ATOM   588  C  "C5'" . DG  B 2 2  ? 17.504 -8.058  30.162  1.00 77.02  ? 2   DG  C "C5'" 1 
ATOM   589  C  "C4'" . DG  B 2 2  ? 16.373 -8.956  29.705  1.00 75.30  ? 2   DG  C "C4'" 1 
ATOM   590  O  "O4'" . DG  B 2 2  ? 15.101 -8.324  30.002  1.00 72.07  ? 2   DG  C "O4'" 1 
ATOM   591  C  "C3'" . DG  B 2 2  ? 16.368 -9.260  28.211  1.00 74.64  ? 2   DG  C "C3'" 1 
ATOM   592  O  "O3'" . DG  B 2 2  ? 16.059 -10.623 27.998  1.00 76.86  ? 2   DG  C "O3'" 1 
ATOM   593  C  "C2'" . DG  B 2 2  ? 15.285 -8.336  27.655  1.00 72.24  ? 2   DG  C "C2'" 1 
ATOM   594  C  "C1'" . DG  B 2 2  ? 14.325 -8.204  28.829  1.00 71.03  ? 2   DG  C "C1'" 1 
ATOM   595  N  N9    . DG  B 2 2  ? 13.645 -6.912  28.864  1.00 68.55  ? 2   DG  C N9    1 
ATOM   596  C  C8    . DG  B 2 2  ? 14.220 -5.675  28.704  1.00 70.11  ? 2   DG  C C8    1 
ATOM   597  N  N7    . DG  B 2 2  ? 13.369 -4.691  28.783  1.00 66.76  ? 2   DG  C N7    1 
ATOM   598  C  C5    . DG  B 2 2  ? 12.150 -5.314  29.012  1.00 64.36  ? 2   DG  C C5    1 
ATOM   599  C  C6    . DG  B 2 2  ? 10.862 -4.756  29.185  1.00 64.56  ? 2   DG  C C6    1 
ATOM   600  O  O6    . DG  B 2 2  ? 10.536 -3.561  29.170  1.00 64.76  ? 2   DG  C O6    1 
ATOM   601  N  N1    . DG  B 2 2  ? 9.898  -5.739  29.394  1.00 63.17  ? 2   DG  C N1    1 
ATOM   602  C  C2    . DG  B 2 2  ? 10.148 -7.091  29.430  1.00 63.96  ? 2   DG  C C2    1 
ATOM   603  N  N2    . DG  B 2 2  ? 9.089  -7.886  29.642  1.00 62.30  ? 2   DG  C N2    1 
ATOM   604  N  N3    . DG  B 2 2  ? 11.352 -7.628  29.269  1.00 60.81  ? 2   DG  C N3    1 
ATOM   605  C  C4    . DG  B 2 2  ? 12.302 -6.683  29.065  1.00 63.26  ? 2   DG  C C4    1 
ATOM   606  P  P     . DG  B 2 3  ? 16.210 -11.268 26.535  1.00 79.50  ? 3   DG  C P     1 
ATOM   607  O  OP1   . DG  B 2 3  ? 16.921 -12.557 26.691  1.00 75.88  ? 3   DG  C OP1   1 
ATOM   608  O  OP2   . DG  B 2 3  ? 16.747 -10.236 25.621  1.00 73.27  ? 3   DG  C OP2   1 
ATOM   609  O  "O5'" . DG  B 2 3  ? 14.703 -11.566 26.108  1.00 68.13  ? 3   DG  C "O5'" 1 
ATOM   610  C  "C5'" . DG  B 2 3  ? 13.853 -12.284 26.989  1.00 62.15  ? 3   DG  C "C5'" 1 
ATOM   611  C  "C4'" . DG  B 2 3  ? 12.430 -12.279 26.476  1.00 61.98  ? 3   DG  C "C4'" 1 
ATOM   612  O  "O4'" . DG  B 2 3  ? 11.817 -10.997 26.761  1.00 61.16  ? 3   DG  C "O4'" 1 
ATOM   613  C  "C3'" . DG  B 2 3  ? 12.296 -12.502 24.970  1.00 61.97  ? 3   DG  C "C3'" 1 
ATOM   614  O  "O3'" . DG  B 2 3  ? 11.272 -13.443 24.713  1.00 66.23  ? 3   DG  C "O3'" 1 
ATOM   615  C  "C2'" . DG  B 2 3  ? 11.944 -11.118 24.425  1.00 57.25  ? 3   DG  C "C2'" 1 
ATOM   616  C  "C1'" . DG  B 2 3  ? 11.210 -10.485 25.598  1.00 59.34  ? 3   DG  C "C1'" 1 
ATOM   617  N  N9    . DG  B 2 3  ? 11.321 -9.030  25.629  1.00 60.33  ? 3   DG  C N9    1 
ATOM   618  C  C8    . DG  B 2 3  ? 12.470 -8.288  25.495  1.00 60.88  ? 3   DG  C C8    1 
ATOM   619  N  N7    . DG  B 2 3  ? 12.268 -7.001  25.563  1.00 62.76  ? 3   DG  C N7    1 
ATOM   620  C  C5    . DG  B 2 3  ? 10.898 -6.881  25.756  1.00 58.32  ? 3   DG  C C5    1 
ATOM   621  C  C6    . DG  B 2 3  ? 10.096 -5.725  25.903  1.00 56.99  ? 3   DG  C C6    1 
ATOM   622  O  O6    . DG  B 2 3  ? 10.452 -4.538  25.891  1.00 59.61  ? 3   DG  C O6    1 
ATOM   623  N  N1    . DG  B 2 3  ? 8.753  -6.047  26.077  1.00 55.20  ? 3   DG  C N1    1 
ATOM   624  C  C2    . DG  B 2 3  ? 8.248  -7.326  26.106  1.00 58.11  ? 3   DG  C C2    1 
ATOM   625  N  N2    . DG  B 2 3  ? 6.924  -7.438  26.284  1.00 58.27  ? 3   DG  C N2    1 
ATOM   626  N  N3    . DG  B 2 3  ? 8.988  -8.419  25.970  1.00 60.19  ? 3   DG  C N3    1 
ATOM   627  C  C4    . DG  B 2 3  ? 10.300 -8.122  25.799  1.00 58.79  ? 3   DG  C C4    1 
ATOM   628  P  P     . DC  B 2 4  ? 11.124 -14.099 23.256  1.00 64.40  ? 4   DC  C P     1 
ATOM   629  O  OP1   . DC  B 2 4  ? 10.886 -15.545 23.458  1.00 55.09  ? 4   DC  C OP1   1 
ATOM   630  O  OP2   . DC  B 2 4  ? 12.258 -13.642 22.421  1.00 52.63  ? 4   DC  C OP2   1 
ATOM   631  O  "O5'" . DC  B 2 4  ? 9.789  -13.436 22.685  1.00 52.76  ? 4   DC  C "O5'" 1 
ATOM   632  C  "C5'" . DC  B 2 4  ? 8.598  -13.498 23.451  1.00 55.15  ? 4   DC  C "C5'" 1 
ATOM   633  C  "C4'" . DC  B 2 4  ? 7.567  -12.522 22.926  1.00 52.58  ? 4   DC  C "C4'" 1 
ATOM   634  O  "O4'" . DC  B 2 4  ? 7.941  -11.167 23.286  1.00 57.51  ? 4   DC  C "O4'" 1 
ATOM   635  C  "C3'" . DC  B 2 4  ? 7.387  -12.525 21.404  1.00 52.65  ? 4   DC  C "C3'" 1 
ATOM   636  O  "O3'" . DC  B 2 4  ? 6.010  -12.615 21.095  1.00 57.47  ? 4   DC  C "O3'" 1 
ATOM   637  C  "C2'" . DC  B 2 4  ? 7.971  -11.177 20.973  1.00 52.31  ? 4   DC  C "C2'" 1 
ATOM   638  C  "C1'" . DC  B 2 4  ? 7.675  -10.328 22.193  1.00 55.87  ? 4   DC  C "C1'" 1 
ATOM   639  N  N1    . DC  B 2 4  ? 8.523  -9.106  22.297  1.00 54.87  ? 4   DC  C N1    1 
ATOM   640  C  C2    . DC  B 2 4  ? 7.921  -7.871  22.559  1.00 53.25  ? 4   DC  C C2    1 
ATOM   641  O  O2    . DC  B 2 4  ? 6.694  -7.819  22.708  1.00 57.33  ? 4   DC  C O2    1 
ATOM   642  N  N3    . DC  B 2 4  ? 8.700  -6.765  22.647  1.00 55.71  ? 4   DC  C N3    1 
ATOM   643  C  C4    . DC  B 2 4  ? 10.019 -6.864  22.480  1.00 55.94  ? 4   DC  C C4    1 
ATOM   644  N  N4    . DC  B 2 4  ? 10.745 -5.746  22.576  1.00 52.29  ? 4   DC  C N4    1 
ATOM   645  C  C5    . DC  B 2 4  ? 10.652 -8.114  22.208  1.00 53.21  ? 4   DC  C C5    1 
ATOM   646  C  C6    . DC  B 2 4  ? 9.873  -9.198  22.124  1.00 52.47  ? 4   DC  C C6    1 
ATOM   647  P  P     . DG  B 2 5  ? 5.527  -13.040 19.624  1.00 55.61  ? 5   DG  C P     1 
ATOM   648  O  OP1   . DG  B 2 5  ? 4.850  -14.348 19.747  1.00 54.09  ? 5   DG  C OP1   1 
ATOM   649  O  OP2   . DG  B 2 5  ? 6.661  -12.875 18.687  1.00 51.36  ? 5   DG  C OP2   1 
ATOM   650  O  "O5'" . DG  B 2 5  ? 4.438  -11.932 19.262  1.00 54.90  ? 5   DG  C "O5'" 1 
ATOM   651  C  "C5'" . DG  B 2 5  ? 3.455  -11.572 20.219  1.00 56.16  ? 5   DG  C "C5'" 1 
ATOM   652  C  "C4'" . DG  B 2 5  ? 2.887  -10.200 19.914  1.00 53.68  ? 5   DG  C "C4'" 1 
ATOM   653  O  "O4'" . DG  B 2 5  ? 3.867  -9.182  20.247  1.00 49.53  ? 5   DG  C "O4'" 1 
ATOM   654  C  "C3'" . DG  B 2 5  ? 2.509  -9.974  18.453  1.00 52.27  ? 5   DG  C "C3'" 1 
ATOM   655  O  "O3'" . DG  B 2 5  ? 1.265  -9.307  18.381  1.00 58.67  ? 5   DG  C "O3'" 1 
ATOM   656  C  "C2'" . DG  B 2 5  ? 3.650  -9.111  17.912  1.00 53.86  ? 5   DG  C "C2'" 1 
ATOM   657  C  "C1'" . DG  B 2 5  ? 4.066  -8.324  19.146  1.00 52.47  ? 5   DG  C "C1'" 1 
ATOM   658  N  N9    . DG  B 2 5  ? 5.471  -7.924  19.134  1.00 52.23  ? 5   DG  C N9    1 
ATOM   659  C  C8    . DG  B 2 5  ? 6.561  -8.742  18.959  1.00 49.13  ? 5   DG  C C8    1 
ATOM   660  N  N7    . DG  B 2 5  ? 7.699  -8.109  19.003  1.00 49.69  ? 5   DG  C N7    1 
ATOM   661  C  C5    . DG  B 2 5  ? 7.344  -6.785  19.225  1.00 54.92  ? 5   DG  C C5    1 
ATOM   662  C  C6    . DG  B 2 5  ? 8.157  -5.635  19.366  1.00 53.46  ? 5   DG  C C6    1 
ATOM   663  O  O6    . DG  B 2 5  ? 9.393  -5.556  19.320  1.00 53.37  ? 5   DG  C O6    1 
ATOM   664  N  N1    . DG  B 2 5  ? 7.395  -4.489  19.578  1.00 51.85  ? 5   DG  C N1    1 
ATOM   665  C  C2    . DG  B 2 5  ? 6.022  -4.459  19.648  1.00 54.48  ? 5   DG  C C2    1 
ATOM   666  N  N2    . DG  B 2 5  ? 5.465  -3.258  19.860  1.00 52.60  ? 5   DG  C N2    1 
ATOM   667  N  N3    . DG  B 2 5  ? 5.249  -5.529  19.518  1.00 53.39  ? 5   DG  C N3    1 
ATOM   668  C  C4    . DG  B 2 5  ? 5.975  -6.654  19.310  1.00 53.78  ? 5   DG  C C4    1 
ATOM   669  P  P     . DG  B 2 6  ? 0.513  -9.146  16.972  1.00 60.11  ? 6   DG  C P     1 
ATOM   670  O  OP1   . DG  B 2 6  ? -0.937 -9.070  17.260  1.00 65.77  ? 6   DG  C OP1   1 
ATOM   671  O  OP2   . DG  B 2 6  ? 1.036  -10.178 16.048  1.00 54.32  ? 6   DG  C OP2   1 
ATOM   672  O  "O5'" . DG  B 2 6  ? 1.007  -7.724  16.447  1.00 59.50  ? 6   DG  C "O5'" 1 
ATOM   673  C  "C5'" . DG  B 2 6  ? 0.946  -6.603  17.310  1.00 59.95  ? 6   DG  C "C5'" 1 
ATOM   674  C  "C4'" . DG  B 2 6  ? 1.584  -5.392  16.665  1.00 60.38  ? 6   DG  C "C4'" 1 
ATOM   675  O  "O4'" . DG  B 2 6  ? 3.007  -5.363  16.958  1.00 58.83  ? 6   DG  C "O4'" 1 
ATOM   676  C  "C3'" . DG  B 2 6  ? 1.470  -5.329  15.134  1.00 61.39  ? 6   DG  C "C3'" 1 
ATOM   677  O  "O3'" . DG  B 2 6  ? 1.088  -4.023  14.751  1.00 73.11  ? 6   DG  C "O3'" 1 
ATOM   678  C  "C2'" . DG  B 2 6  ? 2.895  -5.634  14.678  1.00 62.81  ? 6   DG  C "C2'" 1 
ATOM   679  C  "C1'" . DG  B 2 6  ? 3.671  -4.964  15.792  1.00 58.56  ? 6   DG  C "C1'" 1 
ATOM   680  N  N9    . DG  B 2 6  ? 5.077  -5.346  15.868  1.00 57.79  ? 6   DG  C N9    1 
ATOM   681  C  C8    . DG  B 2 6  ? 5.610  -6.604  15.722  1.00 52.67  ? 6   DG  C C8    1 
ATOM   682  N  N7    . DG  B 2 6  ? 6.912  -6.630  15.834  1.00 55.56  ? 6   DG  C N7    1 
ATOM   683  C  C5    . DG  B 2 6  ? 7.261  -5.304  16.065  1.00 50.57  ? 6   DG  C C5    1 
ATOM   684  C  C6    . DG  B 2 6  ? 8.534  -4.714  16.267  1.00 57.72  ? 6   DG  C C6    1 
ATOM   685  O  O6    . DG  B 2 6  ? 9.644  -5.265  16.283  1.00 55.25  ? 6   DG  C O6    1 
ATOM   686  N  N1    . DG  B 2 6  ? 8.438  -3.338  16.466  1.00 59.03  ? 6   DG  C N1    1 
ATOM   687  C  C2    . DG  B 2 6  ? 7.263  -2.624  16.469  1.00 58.15  ? 6   DG  C C2    1 
ATOM   688  N  N2    . DG  B 2 6  ? 7.371  -1.304  16.679  1.00 56.55  ? 6   DG  C N2    1 
ATOM   689  N  N3    . DG  B 2 6  ? 6.067  -3.164  16.281  1.00 58.06  ? 6   DG  C N3    1 
ATOM   690  C  C4    . DG  B 2 6  ? 6.143  -4.503  16.086  1.00 56.14  ? 6   DG  C C4    1 
ATOM   691  P  P     . DA  B 2 7  ? 0.137  -3.779  13.480  1.00 77.15  ? 7   DA  C P     1 
ATOM   692  O  OP1   . DA  B 2 7  ? -1.229 -4.219  13.844  1.00 60.91  ? 7   DA  C OP1   1 
ATOM   693  O  OP2   . DA  B 2 7  ? 0.805  -4.346  12.287  1.00 73.15  ? 7   DA  C OP2   1 
ATOM   694  O  "O5'" . DA  B 2 7  ? 0.147  -2.190  13.324  1.00 74.13  ? 7   DA  C "O5'" 1 
ATOM   695  C  "C5'" . DA  B 2 7  ? 0.335  -1.375  14.473  1.00 71.21  ? 7   DA  C "C5'" 1 
ATOM   696  C  "C4'" . DA  B 2 7  ? 1.524  -0.450  14.291  1.00 68.33  ? 7   DA  C "C4'" 1 
ATOM   697  O  "O4'" . DA  B 2 7  ? 2.756  -1.194  14.461  1.00 69.50  ? 7   DA  C "O4'" 1 
ATOM   698  C  "C3'" . DA  B 2 7  ? 1.612  0.222   12.918  1.00 71.80  ? 7   DA  C "C3'" 1 
ATOM   699  O  "O3'" . DA  B 2 7  ? 1.691  1.628   13.078  1.00 73.80  ? 7   DA  C "O3'" 1 
ATOM   700  C  "C2'" . DA  B 2 7  ? 2.891  -0.354  12.296  1.00 69.42  ? 7   DA  C "C2'" 1 
ATOM   701  C  "C1'" . DA  B 2 7  ? 3.699  -0.746  13.521  1.00 67.97  ? 7   DA  C "C1'" 1 
ATOM   702  N  N9    . DA  B 2 7  ? 4.652  -1.826  13.272  1.00 63.16  ? 7   DA  C N9    1 
ATOM   703  C  C8    . DA  B 2 7  ? 4.360  -3.119  12.937  1.00 62.15  ? 7   DA  C C8    1 
ATOM   704  N  N7    . DA  B 2 7  ? 5.418  -3.878  12.778  1.00 59.14  ? 7   DA  C N7    1 
ATOM   705  C  C5    . DA  B 2 7  ? 6.480  -3.024  13.024  1.00 57.37  ? 7   DA  C C5    1 
ATOM   706  C  C6    . DA  B 2 7  ? 7.877  -3.219  13.016  1.00 55.49  ? 7   DA  C C6    1 
ATOM   707  N  N6    . DA  B 2 7  ? 8.455  -4.391  12.737  1.00 53.39  ? 7   DA  C N6    1 
ATOM   708  N  N1    . DA  B 2 7  ? 8.657  -2.158  13.307  1.00 58.04  ? 7   DA  C N1    1 
ATOM   709  C  C2    . DA  B 2 7  ? 8.075  -0.985  13.585  1.00 58.10  ? 7   DA  C C2    1 
ATOM   710  N  N3    . DA  B 2 7  ? 6.777  -0.681  13.624  1.00 60.31  ? 7   DA  C N3    1 
ATOM   711  C  C4    . DA  B 2 7  ? 6.027  -1.755  13.331  1.00 58.55  ? 7   DA  C C4    1 
ATOM   712  P  P     . DA  B 2 8  ? 1.632  2.594   11.797  1.00 81.19  ? 8   DA  C P     1 
ATOM   713  O  OP1   . DA  B 2 8  ? 0.895  3.815   12.190  1.00 88.04  ? 8   DA  C OP1   1 
ATOM   714  O  OP2   . DA  B 2 8  ? 1.165  1.794   10.642  1.00 75.04  ? 8   DA  C OP2   1 
ATOM   715  O  "O5'" . DA  B 2 8  ? 3.163  2.976   11.553  1.00 75.93  ? 8   DA  C "O5'" 1 
ATOM   716  C  "C5'" . DA  B 2 8  ? 3.983  3.320   12.660  1.00 71.37  ? 8   DA  C "C5'" 1 
ATOM   717  C  "C4'" . DA  B 2 8  ? 5.412  3.569   12.218  1.00 73.53  ? 8   DA  C "C4'" 1 
ATOM   718  O  "O4'" . DA  B 2 8  ? 6.121  2.305   12.117  1.00 71.31  ? 8   DA  C "O4'" 1 
ATOM   719  C  "C3'" . DA  B 2 8  ? 5.557  4.258   10.862  1.00 74.65  ? 8   DA  C "C3'" 1 
ATOM   720  O  "O3'" . DA  B 2 8  ? 6.531  5.287   10.950  1.00 76.65  ? 8   DA  C "O3'" 1 
ATOM   721  C  "C2'" . DA  B 2 8  ? 5.999  3.127   9.928   1.00 71.22  ? 8   DA  C "C2'" 1 
ATOM   722  C  "C1'" . DA  B 2 8  ? 6.772  2.216   10.870  1.00 68.16  ? 8   DA  C "C1'" 1 
ATOM   723  N  N9    . DA  B 2 8  ? 6.771  0.813   10.455  1.00 62.52  ? 8   DA  C N9    1 
ATOM   724  C  C8    . DA  B 2 8  ? 5.687  0.065   10.089  1.00 60.10  ? 8   DA  C C8    1 
ATOM   725  N  N7    . DA  B 2 8  ? 5.980  -1.173  9.771   1.00 59.77  ? 8   DA  C N7    1 
ATOM   726  C  C5    . DA  B 2 8  ? 7.351  -1.246  9.944   1.00 56.02  ? 8   DA  C C5    1 
ATOM   727  C  C6    . DA  B 2 8  ? 8.275  -2.297  9.771   1.00 54.54  ? 8   DA  C C6    1 
ATOM   728  N  N6    . DA  B 2 8  ? 7.928  -3.523  9.367   1.00 52.94  ? 8   DA  C N6    1 
ATOM   729  N  N1    . DA  B 2 8  ? 9.573  -2.037  10.030  1.00 54.94  ? 8   DA  C N1    1 
ATOM   730  C  C2    . DA  B 2 8  ? 9.917  -0.809  10.434  1.00 54.49  ? 8   DA  C C2    1 
ATOM   731  N  N3    . DA  B 2 8  ? 9.141  0.257   10.632  1.00 60.11  ? 8   DA  C N3    1 
ATOM   732  C  C4    . DA  B 2 8  ? 7.857  -0.031  10.366  1.00 58.27  ? 8   DA  C C4    1 
ATOM   733  P  P     . DT  B 2 9  ? 6.769  6.292   9.719   1.00 84.09  ? 9   DT  C P     1 
ATOM   734  O  OP1   . DT  B 2 9  ? 6.930  7.653   10.279  1.00 85.03  ? 9   DT  C OP1   1 
ATOM   735  O  OP2   . DT  B 2 9  ? 5.730  6.035   8.696   1.00 75.65  ? 9   DT  C OP2   1 
ATOM   736  O  "O5'" . DT  B 2 9  ? 8.168  5.813   9.124   1.00 76.41  ? 9   DT  C "O5'" 1 
ATOM   737  C  "C5'" . DT  B 2 9  ? 9.226  5.490   10.011  1.00 72.79  ? 9   DT  C "C5'" 1 
ATOM   738  C  "C4'" . DT  B 2 9  ? 10.299 4.696   9.297   1.00 70.66  ? 9   DT  C "C4'" 1 
ATOM   739  O  "O4'" . DT  B 2 9  ? 9.872  3.324   9.141   1.00 66.57  ? 9   DT  C "O4'" 1 
ATOM   740  C  "C3'" . DT  B 2 9  ? 10.636 5.204   7.894   1.00 70.04  ? 9   DT  C "C3'" 1 
ATOM   741  O  "O3'" . DT  B 2 9  ? 11.978 5.680   7.864   1.00 72.58  ? 9   DT  C "O3'" 1 
ATOM   742  C  "C2'" . DT  B 2 9  ? 10.427 3.984   6.976   1.00 64.73  ? 9   DT  C "C2'" 1 
ATOM   743  C  "C1'" . DT  B 2 9  ? 10.419 2.816   7.953   1.00 64.02  ? 9   DT  C "C1'" 1 
ATOM   744  N  N1    . DT  B 2 9  ? 9.582  1.667   7.498   1.00 59.16  ? 9   DT  C N1    1 
ATOM   745  C  C2    . DT  B 2 9  ? 10.166 0.433   7.326   1.00 54.28  ? 9   DT  C C2    1 
ATOM   746  O  O2    . DT  B 2 9  ? 11.348 0.218   7.530   1.00 50.83  ? 9   DT  C O2    1 
ATOM   747  N  N3    . DT  B 2 9  ? 9.310  -0.553  6.909   1.00 52.20  ? 9   DT  C N3    1 
ATOM   748  C  C4    . DT  B 2 9  ? 7.958  -0.430  6.647   1.00 54.57  ? 9   DT  C C4    1 
ATOM   749  O  O4    . DT  B 2 9  ? 7.274  -1.377  6.275   1.00 52.99  ? 9   DT  C O4    1 
ATOM   750  C  C5    . DT  B 2 9  ? 7.409  0.892   6.843   1.00 58.92  ? 9   DT  C C5    1 
ATOM   751  C  C7    . DT  B 2 9  ? 5.952  1.149   6.592   1.00 50.21  ? 9   DT  C C7    1 
ATOM   752  C  C6    . DT  B 2 9  ? 8.238  1.865   7.253   1.00 58.31  ? 9   DT  C C6    1 
ATOM   753  P  P     . DT  B 2 10 ? 12.557 6.399   6.551   1.00 81.19  ? 10  DT  C P     1 
ATOM   754  O  OP1   . DT  B 2 10 ? 13.519 7.439   6.997   1.00 74.09  ? 10  DT  C OP1   1 
ATOM   755  O  OP2   . DT  B 2 10 ? 11.416 6.747   5.678   1.00 72.96  ? 10  DT  C OP2   1 
ATOM   756  O  "O5'" . DT  B 2 10 ? 13.371 5.236   5.825   1.00 73.97  ? 10  DT  C "O5'" 1 
ATOM   757  C  "C5'" . DT  B 2 10 ? 14.305 4.470   6.565   1.00 72.35  ? 10  DT  C "C5'" 1 
ATOM   758  C  "C4'" . DT  B 2 10 ? 14.807 3.298   5.750   1.00 70.58  ? 10  DT  C "C4'" 1 
ATOM   759  O  "O4'" . DT  B 2 10 ? 13.775 2.282   5.658   1.00 65.23  ? 10  DT  C "O4'" 1 
ATOM   760  C  "C3'" . DT  B 2 10 ? 15.221 3.633   4.317   1.00 67.92  ? 10  DT  C "C3'" 1 
ATOM   761  O  "O3'" . DT  B 2 10 ? 16.490 3.059   4.049   1.00 71.25  ? 10  DT  C "O3'" 1 
ATOM   762  C  "C2'" . DT  B 2 10 ? 14.116 2.998   3.467   1.00 66.97  ? 10  DT  C "C2'" 1 
ATOM   763  C  "C1'" . DT  B 2 10 ? 13.697 1.820   4.335   1.00 66.37  ? 10  DT  C "C1'" 1 
ATOM   764  N  N1    . DT  B 2 10 ? 12.300 1.350   4.084   1.00 62.32  ? 10  DT  C N1    1 
ATOM   765  C  C2    . DT  B 2 10 ? 12.056 0.003   3.916   1.00 54.80  ? 10  DT  C C2    1 
ATOM   766  O  O2    . DT  B 2 10 ? 12.930 -0.846  3.955   1.00 54.78  ? 10  DT  C O2    1 
ATOM   767  N  N3    . DT  B 2 10 ? 10.742 -0.318  3.693   1.00 51.76  ? 10  DT  C N3    1 
ATOM   768  C  C4    . DT  B 2 10 ? 9.669  0.552   3.628   1.00 55.08  ? 10  DT  C C4    1 
ATOM   769  O  O4    . DT  B 2 10 ? 8.521  0.167   3.422   1.00 52.99  ? 10  DT  C O4    1 
ATOM   770  C  C5    . DT  B 2 10 ? 9.992  1.947   3.820   1.00 57.35  ? 10  DT  C C5    1 
ATOM   771  C  C7    . DT  B 2 10 ? 8.910  2.985   3.771   1.00 51.47  ? 10  DT  C C7    1 
ATOM   772  C  C6    . DT  B 2 10 ? 11.276 2.273   4.039   1.00 58.26  ? 10  DT  C C6    1 
ATOM   773  P  P     . DC  B 2 11 ? 17.351 3.547   2.786   1.00 77.32  ? 11  DC  C P     1 
ATOM   774  O  OP1   . DC  B 2 11 ? 18.733 3.791   3.255   1.00 73.51  ? 11  DC  C OP1   1 
ATOM   775  O  OP2   . DC  B 2 11 ? 16.586 4.621   2.106   1.00 73.64  ? 11  DC  C OP2   1 
ATOM   776  O  "O5'" . DC  B 2 11 ? 17.358 2.270   1.828   1.00 73.12  ? 11  DC  C "O5'" 1 
ATOM   777  C  "C5'" . DC  B 2 11 ? 17.659 0.986   2.356   1.00 69.28  ? 11  DC  C "C5'" 1 
ATOM   778  C  "C4'" . DC  B 2 11 ? 17.106 -0.100  1.455   1.00 68.60  ? 11  DC  C "C4'" 1 
ATOM   779  O  "O4'" . DC  B 2 11 ? 15.684 -0.212  1.654   1.00 65.54  ? 11  DC  C "O4'" 1 
ATOM   780  C  "C3'" . DC  B 2 11 ? 17.298 0.154   -0.041  1.00 67.35  ? 11  DC  C "C3'" 1 
ATOM   781  O  "O3'" . DC  B 2 11 ? 18.286 -0.725  -0.554  1.00 74.82  ? 11  DC  C "O3'" 1 
ATOM   782  C  "C2'" . DC  B 2 11 ? 15.916 -0.109  -0.669  1.00 64.46  ? 11  DC  C "C2'" 1 
ATOM   783  C  "C1'" . DC  B 2 11 ? 15.112 -0.713  0.478   1.00 62.71  ? 11  DC  C "C1'" 1 
ATOM   784  N  N1    . DC  B 2 11 ? 13.673 -0.333  0.456   1.00 60.17  ? 11  DC  C N1    1 
ATOM   785  C  C2    . DC  B 2 11 ? 12.701 -1.317  0.253   1.00 57.36  ? 11  DC  C C2    1 
ATOM   786  O  O2    . DC  B 2 11 ? 13.055 -2.492  0.096   1.00 53.60  ? 11  DC  C O2    1 
ATOM   787  N  N3    . DC  B 2 11 ? 11.394 -0.954  0.237   1.00 54.88  ? 11  DC  C N3    1 
ATOM   788  C  C4    . DC  B 2 11 ? 11.054 0.324   0.411   1.00 54.46  ? 11  DC  C C4    1 
ATOM   789  N  N4    . DC  B 2 11 ? 9.753  0.633   0.386   1.00 53.77  ? 11  DC  C N4    1 
ATOM   790  C  C5    . DC  B 2 11 ? 12.031 1.341   0.618   1.00 57.21  ? 11  DC  C C5    1 
ATOM   791  C  C6    . DC  B 2 11 ? 13.316 0.971   0.632   1.00 58.76  ? 11  DC  C C6    1 
ATOM   792  P  P     . DC  B 2 12 ? 18.787 -0.580  -2.073  1.00 78.15  ? 12  DC  C P     1 
ATOM   793  O  OP1   . DC  B 2 12 ? 20.185 -1.059  -2.133  1.00 74.40  ? 12  DC  C OP1   1 
ATOM   794  O  OP2   . DC  B 2 12 ? 18.455 0.790   -2.527  1.00 70.43  ? 12  DC  C OP2   1 
ATOM   795  O  "O5'" . DC  B 2 12 ? 17.850 -1.595  -2.872  1.00 71.89  ? 12  DC  C "O5'" 1 
ATOM   796  C  "C5'" . DC  B 2 12 ? 17.577 -2.877  -2.329  1.00 68.50  ? 12  DC  C "C5'" 1 
ATOM   797  C  "C4'" . DC  B 2 12 ? 16.482 -3.567  -3.118  1.00 65.83  ? 12  DC  C "C4'" 1 
ATOM   798  O  "O4'" . DC  B 2 12 ? 15.183 -3.045  -2.724  1.00 61.33  ? 12  DC  C "O4'" 1 
ATOM   799  C  "C3'" . DC  B 2 12 ? 16.573 -3.386  -4.637  1.00 65.52  ? 12  DC  C "C3'" 1 
ATOM   800  O  "O3'" . DC  B 2 12 ? 16.443 -4.643  -5.272  1.00 69.85  ? 12  DC  C "O3'" 1 
ATOM   801  C  "C2'" . DC  B 2 12 ? 15.394 -2.463  -4.958  1.00 63.58  ? 12  DC  C "C2'" 1 
ATOM   802  C  "C1'" . DC  B 2 12 ? 14.404 -2.855  -3.880  1.00 61.89  ? 12  DC  C "C1'" 1 
ATOM   803  N  N1    . DC  B 2 12 ? 13.383 -1.807  -3.611  1.00 59.28  ? 12  DC  C N1    1 
ATOM   804  C  C2    . DC  B 2 12 ? 12.028 -2.149  -3.597  1.00 55.85  ? 12  DC  C C2    1 
ATOM   805  O  O2    . DC  B 2 12 ? 11.701 -3.325  -3.795  1.00 52.58  ? 12  DC  C O2    1 
ATOM   806  N  N3    . DC  B 2 12 ? 11.109 -1.180  -3.358  1.00 55.41  ? 12  DC  C N3    1 
ATOM   807  C  C4    . DC  B 2 12 ? 11.503 0.077   -3.147  1.00 54.33  ? 12  DC  C C4    1 
ATOM   808  N  N4    . DC  B 2 12 ? 10.561 0.998   -2.915  1.00 57.56  ? 12  DC  C N4    1 
ATOM   809  C  C5    . DC  B 2 12 ? 12.880 0.446   -3.166  1.00 58.66  ? 12  DC  C C5    1 
ATOM   810  C  C6    . DC  B 2 12 ? 13.776 -0.518  -3.404  1.00 60.81  ? 12  DC  C C6    1 
ATOM   811  P  P     . DC  B 2 13 ? 16.879 -4.841  -6.805  1.00 72.46  ? 13  DC  C P     1 
ATOM   812  O  OP1   . DC  B 2 13 ? 18.115 -5.664  -6.811  1.00 69.99  ? 13  DC  C OP1   1 
ATOM   813  O  OP2   . DC  B 2 13 ? 16.846 -3.526  -7.487  1.00 63.54  ? 13  DC  C OP2   1 
ATOM   814  O  "O5'" . DC  B 2 13 ? 15.689 -5.715  -7.403  1.00 66.46  ? 13  DC  C "O5'" 1 
ATOM   815  C  "C5'" . DC  B 2 13 ? 15.228 -6.852  -6.688  1.00 60.84  ? 13  DC  C "C5'" 1 
ATOM   816  C  "C4'" . DC  B 2 13 ? 13.805 -7.187  -7.081  1.00 57.36  ? 13  DC  C "C4'" 1 
ATOM   817  O  "O4'" . DC  B 2 13 ? 12.904 -6.159  -6.591  1.00 57.56  ? 13  DC  C "O4'" 1 
ATOM   818  C  "C3'" . DC  B 2 13 ? 13.564 -7.303  -8.583  1.00 56.10  ? 13  DC  C "C3'" 1 
ATOM   819  O  "O3'" . DC  B 2 13 ? 12.797 -8.466  -8.852  1.00 51.83  ? 13  DC  C "O3'" 1 
ATOM   820  C  "C2'" . DC  B 2 13 ? 12.805 -6.017  -8.927  1.00 54.92  ? 13  DC  C "C2'" 1 
ATOM   821  C  "C1'" . DC  B 2 13 ? 12.063 -5.721  -7.629  1.00 53.62  ? 13  DC  C "C1'" 1 
ATOM   822  N  N1    . DC  B 2 13 ? 11.788 -4.266  -7.415  1.00 54.59  ? 13  DC  C N1    1 
ATOM   823  C  C2    . DC  B 2 13 ? 10.472 -3.818  -7.225  1.00 53.04  ? 13  DC  C C2    1 
ATOM   824  O  O2    . DC  B 2 13 ? 9.543  -4.635  -7.245  1.00 52.00  ? 13  DC  C O2    1 
ATOM   825  N  N3    . DC  B 2 13 ? 10.254 -2.492  -7.031  1.00 54.31  ? 13  DC  C N3    1 
ATOM   826  C  C4    . DC  B 2 13 ? 11.282 -1.640  -7.016  1.00 54.09  ? 13  DC  C C4    1 
ATOM   827  N  N4    . DC  B 2 13 ? 11.016 -0.344  -6.822  1.00 53.65  ? 13  DC  C N4    1 
ATOM   828  C  C5    . DC  B 2 13 ? 12.625 -2.080  -7.200  1.00 53.10  ? 13  DC  C C5    1 
ATOM   829  C  C6    . DC  B 2 13 ? 12.829 -3.386  -7.389  1.00 53.11  ? 13  DC  C C6    1 
ATOM   830  P  P     . DC  B 2 14 ? 12.643 -9.007  -10.355 1.00 55.34  ? 14  DC  C P     1 
ATOM   831  O  OP1   . DC  B 2 14 ? 12.588 -10.484 -10.290 1.00 52.03  ? 14  DC  C OP1   1 
ATOM   832  O  OP2   . DC  B 2 14 ? 13.665 -8.328  -11.190 1.00 54.37  ? 14  DC  C OP2   1 
ATOM   833  O  "O5'" . DC  B 2 14 ? 11.201 -8.478  -10.786 1.00 53.58  ? 14  DC  C "O5'" 1 
ATOM   834  C  "C5'" . DC  B 2 14 ? 10.090 -8.705  -9.933  1.00 52.98  ? 14  DC  C "C5'" 1 
ATOM   835  C  "C4'" . DC  B 2 14 ? 8.946  -7.774  -10.277 1.00 52.88  ? 14  DC  C "C4'" 1 
ATOM   836  O  "O4'" . DC  B 2 14 ? 9.266  -6.435  -9.869  1.00 56.33  ? 14  DC  C "O4'" 1 
ATOM   837  C  "C3'" . DC  B 2 14 ? 8.618  -7.682  -11.765 1.00 49.99  ? 14  DC  C "C3'" 1 
ATOM   838  O  "O3'" . DC  B 2 14 ? 7.427  -8.400  -12.028 1.00 51.21  ? 14  DC  C "O3'" 1 
ATOM   839  C  "C2'" . DC  B 2 14 ? 8.452  -6.170  -12.038 1.00 54.59  ? 14  DC  C "C2'" 1 
ATOM   840  C  "C1'" . DC  B 2 14 ? 8.499  -5.556  -10.641 1.00 56.90  ? 14  DC  C "C1'" 1 
ATOM   841  N  N1    . DC  B 2 14 ? 9.134  -4.207  -10.589 1.00 57.08  ? 14  DC  C N1    1 
ATOM   842  C  C2    . DC  B 2 14 ? 8.340  -3.076  -10.367 1.00 55.78  ? 14  DC  C C2    1 
ATOM   843  O  O2    . DC  B 2 14 ? 7.118  -3.214  -10.229 1.00 55.80  ? 14  DC  C O2    1 
ATOM   844  N  N3    . DC  B 2 14 ? 8.933  -1.859  -10.314 1.00 54.39  ? 14  DC  C N3    1 
ATOM   845  C  C4    . DC  B 2 14 ? 10.253 -1.752  -10.468 1.00 52.92  ? 14  DC  C C4    1 
ATOM   846  N  N4    . DC  B 2 14 ? 10.792 -0.531  -10.407 1.00 53.75  ? 14  DC  C N4    1 
ATOM   847  C  C5    . DC  B 2 14 ? 11.080 -2.893  -10.690 1.00 55.67  ? 14  DC  C C5    1 
ATOM   848  C  C6    . DC  B 2 14 ? 10.484 -4.089  -10.741 1.00 54.34  ? 14  DC  C C6    1 
ATOM   849  P  P     . DG  B 2 15 ? 7.040  -8.811  -13.530 1.00 47.62  ? 15  DG  C P     1 
ATOM   850  O  OP1   . DG  B 2 15 ? 6.178  -10.012 -13.452 1.00 51.93  ? 15  DG  C OP1   1 
ATOM   851  O  OP2   . DG  B 2 15 ? 8.285  -8.851  -14.327 1.00 45.10  ? 15  DG  C OP2   1 
ATOM   852  O  "O5'" . DG  B 2 15 ? 6.147  -7.581  -14.028 1.00 52.32  ? 15  DG  C "O5'" 1 
ATOM   853  C  "C5'" . DG  B 2 15 ? 4.977  -7.230  -13.302 1.00 54.37  ? 15  DG  C "C5'" 1 
ATOM   854  C  "C4'" . DG  B 2 15 ? 4.440  -5.880  -13.740 1.00 57.54  ? 15  DG  C "C4'" 1 
ATOM   855  O  "O4'" . DG  B 2 15 ? 5.325  -4.822  -13.284 1.00 56.12  ? 15  DG  C "O4'" 1 
ATOM   856  C  "C3'" . DG  B 2 15 ? 4.298  -5.689  -15.254 1.00 56.30  ? 15  DG  C "C3'" 1 
ATOM   857  O  "O3'" . DG  B 2 15 ? 3.051  -5.079  -15.532 1.00 65.93  ? 15  DG  C "O3'" 1 
ATOM   858  C  "C2'" . DG  B 2 15 ? 5.458  -4.752  -15.590 1.00 57.36  ? 15  DG  C "C2'" 1 
ATOM   859  C  "C1'" . DG  B 2 15 ? 5.500  -3.908  -14.334 1.00 57.50  ? 15  DG  C "C1'" 1 
ATOM   860  N  N9    . DG  B 2 15 ? 6.755  -3.191  -14.140 1.00 57.18  ? 15  DG  C N9    1 
ATOM   861  C  C8    . DG  B 2 15 ? 8.025  -3.650  -14.393 1.00 56.90  ? 15  DG  C C8    1 
ATOM   862  N  N7    . DG  B 2 15 ? 8.956  -2.776  -14.123 1.00 57.95  ? 15  DG  C N7    1 
ATOM   863  C  C5    . DG  B 2 15 ? 8.257  -1.666  -13.664 1.00 56.85  ? 15  DG  C C5    1 
ATOM   864  C  C6    . DG  B 2 15 ? 8.729  -0.406  -13.223 1.00 59.37  ? 15  DG  C C6    1 
ATOM   865  O  O6    . DG  B 2 15 ? 9.900  -0.008  -13.146 1.00 54.67  ? 15  DG  C O6    1 
ATOM   866  N  N1    . DG  B 2 15 ? 7.683  0.433   -12.844 1.00 60.49  ? 15  DG  C N1    1 
ATOM   867  C  C2    . DG  B 2 15 ? 6.351  0.097   -12.887 1.00 60.02  ? 15  DG  C C2    1 
ATOM   868  N  N2    . DG  B 2 15 ? 5.487  1.039   -12.482 1.00 63.62  ? 15  DG  C N2    1 
ATOM   869  N  N3    . DG  B 2 15 ? 5.896  -1.078  -13.299 1.00 59.08  ? 15  DG  C N3    1 
ATOM   870  C  C4    . DG  B 2 15 ? 6.902  -1.906  -13.670 1.00 58.61  ? 15  DG  C C4    1 
ATOM   871  P  P     . DG  B 2 16 ? 2.398  -5.169  -16.997 1.00 67.25  ? 16  DG  C P     1 
ATOM   872  O  OP1   . DG  B 2 16 ? 1.407  -6.268  -16.973 1.00 72.96  ? 16  DG  C OP1   1 
ATOM   873  O  OP2   . DG  B 2 16 ? 3.487  -5.187  -17.998 1.00 61.71  ? 16  DG  C OP2   1 
ATOM   874  O  "O5'" . DG  B 2 16 ? 1.621  -3.779  -17.138 1.00 75.39  ? 16  DG  C "O5'" 1 
ATOM   875  C  "C5'" . DG  B 2 16 ? 0.761  -3.338  -16.090 1.00 74.26  ? 16  DG  C "C5'" 1 
ATOM   876  C  "C4'" . DG  B 2 16 ? 0.705  -1.821  -16.033 1.00 71.44  ? 16  DG  C "C4'" 1 
ATOM   877  O  "O4'" . DG  B 2 16 ? 1.998  -1.300  -15.619 1.00 70.85  ? 16  DG  C "O4'" 1 
ATOM   878  C  "C3'" . DG  B 2 16 ? 0.378  -1.137  -17.359 1.00 75.03  ? 16  DG  C "C3'" 1 
ATOM   879  O  "O3'" . DG  B 2 16 ? -0.482 -0.026  -17.134 1.00 78.96  ? 16  DG  C "O3'" 1 
ATOM   880  C  "C2'" . DG  B 2 16 ? 1.749  -0.690  -17.857 1.00 71.09  ? 16  DG  C "C2'" 1 
ATOM   881  C  "C1'" . DG  B 2 16 ? 2.436  -0.335  -16.550 1.00 70.06  ? 16  DG  C "C1'" 1 
ATOM   882  N  N9    . DG  B 2 16 ? 3.894  -0.384  -16.624 1.00 69.31  ? 16  DG  C N9    1 
ATOM   883  C  C8    . DG  B 2 16 ? 4.666  -1.443  -17.039 1.00 69.55  ? 16  DG  C C8    1 
ATOM   884  N  N7    . DG  B 2 16 ? 5.947  -1.198  -17.000 1.00 64.46  ? 16  DG  C N7    1 
ATOM   885  C  C5    . DG  B 2 16 ? 6.031  0.106   -16.529 1.00 62.52  ? 16  DG  C C5    1 
ATOM   886  C  C6    . DG  B 2 16 ? 7.165  0.913   -16.279 1.00 62.31  ? 16  DG  C C6    1 
ATOM   887  O  O6    . DG  B 2 16 ? 8.360  0.625   -16.430 1.00 66.61  ? 16  DG  C O6    1 
ATOM   888  N  N1    . DG  B 2 16 ? 6.807  2.173   -15.807 1.00 64.16  ? 16  DG  C N1    1 
ATOM   889  C  C2    . DG  B 2 16 ? 5.517  2.599   -15.602 1.00 66.60  ? 16  DG  C C2    1 
ATOM   890  N  N2    . DG  B 2 16 ? 5.371  3.850   -15.141 1.00 68.43  ? 16  DG  C N2    1 
ATOM   891  N  N3    . DG  B 2 16 ? 4.444  1.852   -15.832 1.00 68.06  ? 16  DG  C N3    1 
ATOM   892  C  C4    . DG  B 2 16 ? 4.775  0.621   -16.293 1.00 67.38  ? 16  DG  C C4    1 
ATOM   893  O  "O5'" . DC  C 3 1  ? 13.019 10.233  -13.451 1.00 86.50  ? 1   DC  D "O5'" 1 
ATOM   894  C  "C5'" . DC  C 3 1  ? 12.597 9.091   -14.185 1.00 80.09  ? 1   DC  D "C5'" 1 
ATOM   895  C  "C4'" . DC  C 3 1  ? 11.151 9.236   -14.625 1.00 77.82  ? 1   DC  D "C4'" 1 
ATOM   896  O  "O4'" . DC  C 3 1  ? 10.875 8.267   -15.660 1.00 77.48  ? 1   DC  D "O4'" 1 
ATOM   897  C  "C3'" . DC  C 3 1  ? 10.124 8.996   -13.528 1.00 80.62  ? 1   DC  D "C3'" 1 
ATOM   898  O  "O3'" . DC  C 3 1  ? 9.739  10.244  -12.956 1.00 84.31  ? 1   DC  D "O3'" 1 
ATOM   899  C  "C2'" . DC  C 3 1  ? 8.950  8.342   -14.258 1.00 76.69  ? 1   DC  D "C2'" 1 
ATOM   900  C  "C1'" . DC  C 3 1  ? 9.595  7.696   -15.484 1.00 73.66  ? 1   DC  D "C1'" 1 
ATOM   901  N  N1    . DC  C 3 1  ? 9.752  6.210   -15.392 1.00 68.60  ? 1   DC  D N1    1 
ATOM   902  C  C2    . DC  C 3 1  ? 8.627  5.383   -15.500 1.00 69.79  ? 1   DC  D C2    1 
ATOM   903  O  O2    . DC  C 3 1  ? 7.511  5.895   -15.649 1.00 71.44  ? 1   DC  D O2    1 
ATOM   904  N  N3    . DC  C 3 1  ? 8.794  4.038   -15.429 1.00 67.51  ? 1   DC  D N3    1 
ATOM   905  C  C4    . DC  C 3 1  ? 10.014 3.523   -15.268 1.00 68.06  ? 1   DC  D C4    1 
ATOM   906  N  N4    . DC  C 3 1  ? 10.127 2.193   -15.204 1.00 65.05  ? 1   DC  D N4    1 
ATOM   907  C  C5    . DC  C 3 1  ? 11.171 4.350   -15.165 1.00 65.38  ? 1   DC  D C5    1 
ATOM   908  C  C6    . DC  C 3 1  ? 10.996 5.673   -15.234 1.00 66.49  ? 1   DC  D C6    1 
ATOM   909  P  P     . DC  C 3 2  ? 9.413  10.360  -11.386 1.00 91.89  ? 2   DC  D P     1 
ATOM   910  O  OP1   . DC  C 3 2  ? 8.972  11.749  -11.128 1.00 91.19  ? 2   DC  D OP1   1 
ATOM   911  O  OP2   . DC  C 3 2  ? 10.565 9.802   -10.643 1.00 85.11  ? 2   DC  D OP2   1 
ATOM   912  O  "O5'" . DC  C 3 2  ? 8.167  9.381   -11.173 1.00 79.37  ? 2   DC  D "O5'" 1 
ATOM   913  C  "C5'" . DC  C 3 2  ? 6.885  9.726   -11.691 1.00 78.45  ? 2   DC  D "C5'" 1 
ATOM   914  C  "C4'" . DC  C 3 2  ? 5.942  8.543   -11.591 1.00 79.41  ? 2   DC  D "C4'" 1 
ATOM   915  O  "O4'" . DC  C 3 2  ? 6.501  7.441   -12.326 1.00 79.18  ? 2   DC  D "O4'" 1 
ATOM   916  C  "C3'" . DC  C 3 2  ? 5.723  8.033   -10.176 1.00 78.94  ? 2   DC  D "C3'" 1 
ATOM   917  O  "O3'" . DC  C 3 2  ? 4.532  8.606   -9.643  1.00 84.09  ? 2   DC  D "O3'" 1 
ATOM   918  C  "C2'" . DC  C 3 2  ? 5.592  6.511   -10.331 1.00 76.03  ? 2   DC  D "C2'" 1 
ATOM   919  C  "C1'" . DC  C 3 2  ? 6.130  6.218   -11.735 1.00 73.11  ? 2   DC  D "C1'" 1 
ATOM   920  N  N1    . DC  C 3 2  ? 7.321  5.320   -11.753 1.00 67.79  ? 2   DC  D N1    1 
ATOM   921  C  C2    . DC  C 3 2  ? 7.157  3.952   -11.997 1.00 64.42  ? 2   DC  D C2    1 
ATOM   922  O  O2    . DC  C 3 2  ? 6.018  3.505   -12.180 1.00 62.44  ? 2   DC  D O2    1 
ATOM   923  N  N3    . DC  C 3 2  ? 8.253  3.153   -12.021 1.00 62.47  ? 2   DC  D N3    1 
ATOM   924  C  C4    . DC  C 3 2  ? 9.464  3.675   -11.818 1.00 63.99  ? 2   DC  D C4    1 
ATOM   925  N  N4    . DC  C 3 2  ? 10.515 2.848   -11.850 1.00 61.56  ? 2   DC  D N4    1 
ATOM   926  C  C5    . DC  C 3 2  ? 9.652  5.067   -11.573 1.00 68.08  ? 2   DC  D C5    1 
ATOM   927  C  C6    . DC  C 3 2  ? 8.564  5.844   -11.552 1.00 69.86  ? 2   DC  D C6    1 
ATOM   928  P  P     . DG  C 3 3  ? 4.207  8.502   -8.073  1.00 83.58  ? 3   DG  D P     1 
ATOM   929  O  OP1   . DG  C 3 3  ? 3.233  9.568   -7.746  1.00 87.65  ? 3   DG  D OP1   1 
ATOM   930  O  OP2   . DG  C 3 3  ? 5.496  8.429   -7.349  1.00 77.12  ? 3   DG  D OP2   1 
ATOM   931  O  "O5'" . DG  C 3 3  ? 3.477  7.089   -7.925  1.00 74.33  ? 3   DG  D "O5'" 1 
ATOM   932  C  "C5'" . DG  C 3 3  ? 2.349  6.788   -8.733  1.00 74.06  ? 3   DG  D "C5'" 1 
ATOM   933  C  "C4'" . DG  C 3 3  ? 1.987  5.319   -8.623  1.00 77.43  ? 3   DG  D "C4'" 1 
ATOM   934  O  "O4'" . DG  C 3 3  ? 3.084  4.508   -9.120  1.00 76.09  ? 3   DG  D "O4'" 1 
ATOM   935  C  "C3'" . DG  C 3 3  ? 1.699  4.832   -7.204  1.00 76.71  ? 3   DG  D "C3'" 1 
ATOM   936  O  "O3'" . DG  C 3 3  ? 0.568  3.974   -7.213  1.00 78.24  ? 3   DG  D "O3'" 1 
ATOM   937  C  "C2'" . DG  C 3 3  ? 2.978  4.088   -6.817  1.00 71.93  ? 3   DG  D "C2'" 1 
ATOM   938  C  "C1'" . DG  C 3 3  ? 3.443  3.541   -8.158  1.00 69.57  ? 3   DG  D "C1'" 1 
ATOM   939  N  N9    . DG  C 3 3  ? 4.887  3.337   -8.231  1.00 67.50  ? 3   DG  D N9    1 
ATOM   940  C  C8    . DG  C 3 3  ? 5.867  4.236   -7.887  1.00 64.90  ? 3   DG  D C8    1 
ATOM   941  N  N7    . DG  C 3 3  ? 7.076  3.780   -8.062  1.00 60.64  ? 3   DG  D N7    1 
ATOM   942  C  C5    . DG  C 3 3  ? 6.887  2.495   -8.553  1.00 62.05  ? 3   DG  D C5    1 
ATOM   943  C  C6    . DG  C 3 3  ? 7.835  1.514   -8.927  1.00 60.20  ? 3   DG  D C6    1 
ATOM   944  O  O6    . DG  C 3 3  ? 9.071  1.590   -8.897  1.00 58.09  ? 3   DG  D O6    1 
ATOM   945  N  N1    . DG  C 3 3  ? 7.220  0.346   -9.374  1.00 57.36  ? 3   DG  D N1    1 
ATOM   946  C  C2    . DG  C 3 3  ? 5.861  0.152   -9.449  1.00 60.96  ? 3   DG  D C2    1 
ATOM   947  N  N2    . DG  C 3 3  ? 5.455  -1.042  -9.906  1.00 58.03  ? 3   DG  D N2    1 
ATOM   948  N  N3    . DG  C 3 3  ? 4.960  1.064   -9.102  1.00 60.31  ? 3   DG  D N3    1 
ATOM   949  C  C4    . DG  C 3 3  ? 5.544  2.207   -8.664  1.00 62.69  ? 3   DG  D C4    1 
ATOM   950  P  P     . DG  C 3 4  ? -0.063 3.437   -5.836  1.00 84.88  ? 4   DG  D P     1 
ATOM   951  O  OP1   . DG  C 3 4  ? -1.533 3.567   -5.945  1.00 76.52  ? 4   DG  D OP1   1 
ATOM   952  O  OP2   . DG  C 3 4  ? 0.650  4.070   -4.704  1.00 77.86  ? 4   DG  D OP2   1 
ATOM   953  O  "O5'" . DG  C 3 4  ? 0.308  1.885   -5.840  1.00 79.23  ? 4   DG  D "O5'" 1 
ATOM   954  C  "C5'" . DG  C 3 4  ? -0.006 1.091   -6.974  1.00 73.09  ? 4   DG  D "C5'" 1 
ATOM   955  C  "C4'" . DG  C 3 4  ? 0.470  -0.334  -6.779  1.00 71.56  ? 4   DG  D "C4'" 1 
ATOM   956  O  "O4'" . DG  C 3 4  ? 1.896  -0.410  -7.031  1.00 69.95  ? 4   DG  D "O4'" 1 
ATOM   957  C  "C3'" . DG  C 3 4  ? 0.247  -0.899  -5.378  1.00 68.10  ? 4   DG  D "C3'" 1 
ATOM   958  O  "O3'" . DG  C 3 4  ? -0.231 -2.230  -5.466  1.00 68.78  ? 4   DG  D "O3'" 1 
ATOM   959  C  "C2'" . DG  C 3 4  ? 1.633  -0.830  -4.736  1.00 64.89  ? 4   DG  D "C2'" 1 
ATOM   960  C  "C1'" . DG  C 3 4  ? 2.552  -1.010  -5.937  1.00 63.85  ? 4   DG  D "C1'" 1 
ATOM   961  N  N9    . DG  C 3 4  ? 3.849  -0.360  -5.779  1.00 62.73  ? 4   DG  D N9    1 
ATOM   962  C  C8    . DG  C 3 4  ? 4.083  0.916   -5.325  1.00 61.08  ? 4   DG  D C8    1 
ATOM   963  N  N7    . DG  C 3 4  ? 5.348  1.233   -5.296  1.00 60.79  ? 4   DG  D N7    1 
ATOM   964  C  C5    . DG  C 3 4  ? 5.995  0.097   -5.766  1.00 56.83  ? 4   DG  D C5    1 
ATOM   965  C  C6    . DG  C 3 4  ? 7.375  -0.152  -5.957  1.00 55.74  ? 4   DG  D C6    1 
ATOM   966  O  O6    . DG  C 3 4  ? 8.329  0.607   -5.742  1.00 57.86  ? 4   DG  D O6    1 
ATOM   967  N  N1    . DG  C 3 4  ? 7.603  -1.434  -6.451  1.00 56.62  ? 4   DG  D N1    1 
ATOM   968  C  C2    . DG  C 3 4  ? 6.623  -2.358  -6.724  1.00 57.95  ? 4   DG  D C2    1 
ATOM   969  N  N2    . DG  C 3 4  ? 7.038  -3.543  -7.195  1.00 58.20  ? 4   DG  D N2    1 
ATOM   970  N  N3    . DG  C 3 4  ? 5.325  -2.137  -6.550  1.00 58.21  ? 4   DG  D N3    1 
ATOM   971  C  C4    . DG  C 3 4  ? 5.086  -0.892  -6.069  1.00 60.65  ? 4   DG  D C4    1 
ATOM   972  P  P     . DG  C 3 5  ? -0.832 -2.959  -4.168  1.00 71.07  ? 5   DG  D P     1 
ATOM   973  O  OP1   . DG  C 3 5  ? -1.991 -3.770  -4.604  1.00 72.26  ? 5   DG  D OP1   1 
ATOM   974  O  OP2   . DG  C 3 5  ? -0.996 -1.939  -3.108  1.00 70.99  ? 5   DG  D OP2   1 
ATOM   975  O  "O5'" . DG  C 3 5  ? 0.343  -3.940  -3.720  1.00 69.93  ? 5   DG  D "O5'" 1 
ATOM   976  C  "C5'" . DG  C 3 5  ? 0.989  -4.746  -4.691  1.00 65.12  ? 5   DG  D "C5'" 1 
ATOM   977  C  "C4'" . DG  C 3 5  ? 2.235  -5.379  -4.112  1.00 61.73  ? 5   DG  D "C4'" 1 
ATOM   978  O  "O4'" . DG  C 3 5  ? 3.351  -4.451  -4.201  1.00 61.15  ? 5   DG  D "O4'" 1 
ATOM   979  C  "C3'" . DG  C 3 5  ? 2.126  -5.772  -2.638  1.00 63.01  ? 5   DG  D "C3'" 1 
ATOM   980  O  "O3'" . DG  C 3 5  ? 2.652  -7.070  -2.461  1.00 61.01  ? 5   DG  D "O3'" 1 
ATOM   981  C  "C2'" . DG  C 3 5  ? 2.980  -4.718  -1.931  1.00 58.35  ? 5   DG  D "C2'" 1 
ATOM   982  C  "C1'" . DG  C 3 5  ? 4.044  -4.461  -2.978  1.00 59.37  ? 5   DG  D "C1'" 1 
ATOM   983  N  N9    . DG  C 3 5  ? 4.732  -3.187  -2.809  1.00 56.95  ? 5   DG  D N9    1 
ATOM   984  C  C8    . DG  C 3 5  ? 4.175  -1.990  -2.429  1.00 55.38  ? 5   DG  D C8    1 
ATOM   985  N  N7    . DG  C 3 5  ? 5.039  -1.016  -2.355  1.00 57.37  ? 5   DG  D N7    1 
ATOM   986  C  C5    . DG  C 3 5  ? 6.248  -1.606  -2.704  1.00 56.76  ? 5   DG  D C5    1 
ATOM   987  C  C6    . DG  C 3 5  ? 7.543  -1.044  -2.801  1.00 54.81  ? 5   DG  D C6    1 
ATOM   988  O  O6    . DG  C 3 5  ? 7.890  0.126   -2.591  1.00 55.84  ? 5   DG  D O6    1 
ATOM   989  N  N1    . DG  C 3 5  ? 8.488  -1.992  -3.187  1.00 52.90  ? 5   DG  D N1    1 
ATOM   990  C  C2    . DG  C 3 5  ? 8.217  -3.315  -3.445  1.00 54.09  ? 5   DG  D C2    1 
ATOM   991  N  N2    . DG  C 3 5  ? 9.261  -4.077  -3.804  1.00 48.46  ? 5   DG  D N2    1 
ATOM   992  N  N3    . DG  C 3 5  ? 7.007  -3.854  -3.358  1.00 56.18  ? 5   DG  D N3    1 
ATOM   993  C  C4    . DG  C 3 5  ? 6.075  -2.944  -2.983  1.00 58.23  ? 5   DG  D C4    1 
ATOM   994  P  P     . DG  C 3 6  ? 2.284  -7.935  -1.161  1.00 61.16  ? 6   DG  D P     1 
ATOM   995  O  OP1   . DG  C 3 6  ? 1.278  -8.945  -1.571  1.00 58.98  ? 6   DG  D OP1   1 
ATOM   996  O  OP2   . DG  C 3 6  ? 2.017  -7.009  -0.037  1.00 61.14  ? 6   DG  D OP2   1 
ATOM   997  O  "O5'" . DG  C 3 6  ? 3.653  -8.684  -0.835  1.00 60.00  ? 6   DG  D "O5'" 1 
ATOM   998  C  "C5'" . DG  C 3 6  ? 4.349  -9.352  -1.876  1.00 52.62  ? 6   DG  D "C5'" 1 
ATOM   999  C  "C4'" . DG  C 3 6  ? 5.843  -9.321  -1.630  1.00 47.48  ? 6   DG  D "C4'" 1 
ATOM   1000 O  "O4'" . DG  C 3 6  ? 6.330  -7.958  -1.734  1.00 47.84  ? 6   DG  D "O4'" 1 
ATOM   1001 C  "C3'" . DG  C 3 6  ? 6.283  -9.836  -0.260  1.00 51.13  ? 6   DG  D "C3'" 1 
ATOM   1002 O  "O3'" . DG  C 3 6  ? 7.387  -10.716 -0.418  1.00 42.06  ? 6   DG  D "O3'" 1 
ATOM   1003 C  "C2'" . DG  C 3 6  ? 6.669  -8.563  0.495   1.00 46.00  ? 6   DG  D "C2'" 1 
ATOM   1004 C  "C1'" . DG  C 3 6  ? 7.155  -7.667  -0.634  1.00 48.19  ? 6   DG  D "C1'" 1 
ATOM   1005 N  N9    . DG  C 3 6  ? 7.039  -6.240  -0.341  1.00 49.13  ? 6   DG  D N9    1 
ATOM   1006 C  C8    . DG  C 3 6  ? 5.889  -5.544  -0.065  1.00 49.88  ? 6   DG  D C8    1 
ATOM   1007 N  N7    . DG  C 3 6  ? 6.089  -4.273  0.154   1.00 52.59  ? 6   DG  D N7    1 
ATOM   1008 C  C5    . DG  C 3 6  ? 7.462  -4.115  0.006   1.00 51.54  ? 6   DG  D C5    1 
ATOM   1009 C  C6    . DG  C 3 6  ? 8.267  -2.956  0.125   1.00 50.50  ? 6   DG  D C6    1 
ATOM   1010 O  O6    . DG  C 3 6  ? 7.915  -1.799  0.394   1.00 53.08  ? 6   DG  D O6    1 
ATOM   1011 N  N1    . DG  C 3 6  ? 9.612  -3.238  -0.103  1.00 49.56  ? 6   DG  D N1    1 
ATOM   1012 C  C2    . DG  C 3 6  ? 10.115 -4.481  -0.407  1.00 48.82  ? 6   DG  D C2    1 
ATOM   1013 N  N2    . DG  C 3 6  ? 11.441 -4.556  -0.593  1.00 46.35  ? 6   DG  D N2    1 
ATOM   1014 N  N3    . DG  C 3 6  ? 9.373  -5.573  -0.522  1.00 48.67  ? 6   DG  D N3    1 
ATOM   1015 C  C4    . DG  C 3 6  ? 8.060  -5.317  -0.302  1.00 48.02  ? 6   DG  D C4    1 
ATOM   1016 P  P     . DA  C 3 7  ? 7.934  -11.566 0.829   1.00 42.08  ? 7   DA  D P     1 
ATOM   1017 O  OP1   . DA  C 3 7  ? 8.274  -12.919 0.334   1.00 47.22  ? 7   DA  D OP1   1 
ATOM   1018 O  OP2   . DA  C 3 7  ? 6.989  -11.399 1.959   1.00 39.48  ? 7   DA  D OP2   1 
ATOM   1019 O  "O5'" . DA  C 3 7  ? 9.290  -10.824 1.212   1.00 40.03  ? 7   DA  D "O5'" 1 
ATOM   1020 C  "C5'" . DA  C 3 7  ? 10.234 -10.511 0.203   1.00 37.05  ? 7   DA  D "C5'" 1 
ATOM   1021 C  "C4'" . DA  C 3 7  ? 11.476 -9.898  0.814   1.00 42.55  ? 7   DA  D "C4'" 1 
ATOM   1022 O  "O4'" . DA  C 3 7  ? 11.304 -8.463  0.921   1.00 40.70  ? 7   DA  D "O4'" 1 
ATOM   1023 C  "C3'" . DA  C 3 7  ? 11.809 -10.400 2.214   1.00 42.09  ? 7   DA  D "C3'" 1 
ATOM   1024 O  "O3'" . DA  C 3 7  ? 13.203 -10.596 2.340   1.00 37.56  ? 7   DA  D "O3'" 1 
ATOM   1025 C  "C2'" . DA  C 3 7  ? 11.304 -9.284  3.130   1.00 41.53  ? 7   DA  D "C2'" 1 
ATOM   1026 C  "C1'" . DA  C 3 7  ? 11.461 -8.045  2.258   1.00 43.52  ? 7   DA  D "C1'" 1 
ATOM   1027 N  N9    . DA  C 3 7  ? 10.459 -7.017  2.526   1.00 45.63  ? 7   DA  D N9    1 
ATOM   1028 C  C8    . DA  C 3 7  ? 9.104  -7.184  2.589   1.00 45.69  ? 7   DA  D C8    1 
ATOM   1029 N  N7    . DA  C 3 7  ? 8.444  -6.078  2.840   1.00 45.94  ? 7   DA  D N7    1 
ATOM   1030 C  C5    . DA  C 3 7  ? 9.436  -5.117  2.943   1.00 44.72  ? 7   DA  D C5    1 
ATOM   1031 C  C6    . DA  C 3 7  ? 9.392  -3.732  3.198   1.00 47.81  ? 7   DA  D C6    1 
ATOM   1032 N  N6    . DA  C 3 7  ? 8.256  -3.057  3.405   1.00 43.80  ? 7   DA  D N6    1 
ATOM   1033 N  N1    . DA  C 3 7  ? 10.565 -3.066  3.235   1.00 47.63  ? 7   DA  D N1    1 
ATOM   1034 C  C2    . DA  C 3 7  ? 11.699 -3.746  3.028   1.00 47.69  ? 7   DA  D C2    1 
ATOM   1035 N  N3    . DA  C 3 7  ? 11.866 -5.044  2.779   1.00 47.00  ? 7   DA  D N3    1 
ATOM   1036 C  C4    . DA  C 3 7  ? 10.684 -5.678  2.749   1.00 44.28  ? 7   DA  D C4    1 
ATOM   1037 P  P     . DA  C 3 8  ? 13.791 -11.351 3.628   1.00 40.45  ? 8   DA  D P     1 
ATOM   1038 O  OP1   . DA  C 3 8  ? 14.953 -12.160 3.193   1.00 39.07  ? 8   DA  D OP1   1 
ATOM   1039 O  OP2   . DA  C 3 8  ? 12.657 -12.009 4.317   1.00 38.84  ? 8   DA  D OP2   1 
ATOM   1040 O  "O5'" . DA  C 3 8  ? 14.310 -10.157 4.551   1.00 42.27  ? 8   DA  D "O5'" 1 
ATOM   1041 C  "C5'" . DA  C 3 8  ? 15.213 -9.202  4.017   1.00 41.78  ? 8   DA  D "C5'" 1 
ATOM   1042 C  "C4'" . DA  C 3 8  ? 15.404 -8.040  4.973   1.00 40.09  ? 8   DA  D "C4'" 1 
ATOM   1043 O  "O4'" . DA  C 3 8  ? 14.244 -7.169  4.927   1.00 38.97  ? 8   DA  D "O4'" 1 
ATOM   1044 C  "C3'" . DA  C 3 8  ? 15.586 -8.428  6.445   1.00 41.39  ? 8   DA  D "C3'" 1 
ATOM   1045 O  "O3'" . DA  C 3 8  ? 16.625 -7.645  7.006   1.00 45.22  ? 8   DA  D "O3'" 1 
ATOM   1046 C  "C2'" . DA  C 3 8  ? 14.231 -8.073  7.058   1.00 39.23  ? 8   DA  D "C2'" 1 
ATOM   1047 C  "C1'" . DA  C 3 8  ? 13.868 -6.849  6.242   1.00 38.82  ? 8   DA  D "C1'" 1 
ATOM   1048 N  N9    . DA  C 3 8  ? 12.446 -6.518  6.262   1.00 43.33  ? 8   DA  D N9    1 
ATOM   1049 C  C8    . DA  C 3 8  ? 11.393 -7.388  6.211   1.00 41.14  ? 8   DA  D C8    1 
ATOM   1050 N  N7    . DA  C 3 8  ? 10.220 -6.800  6.245   1.00 36.85  ? 8   DA  D N7    1 
ATOM   1051 C  C5    . DA  C 3 8  ? 10.525 -5.451  6.324   1.00 42.70  ? 8   DA  D C5    1 
ATOM   1052 C  C6    . DA  C 3 8  ? 9.720  -4.296  6.394   1.00 41.56  ? 8   DA  D C6    1 
ATOM   1053 N  N6    . DA  C 3 8  ? 8.384  -4.328  6.391   1.00 41.97  ? 8   DA  D N6    1 
ATOM   1054 N  N1    . DA  C 3 8  ? 10.345 -3.103  6.463   1.00 46.08  ? 8   DA  D N1    1 
ATOM   1055 C  C2    . DA  C 3 8  ? 11.682 -3.074  6.465   1.00 45.47  ? 8   DA  D C2    1 
ATOM   1056 N  N3    . DA  C 3 8  ? 12.543 -4.089  6.405   1.00 43.94  ? 8   DA  D N3    1 
ATOM   1057 C  C4    . DA  C 3 8  ? 11.893 -5.261  6.336   1.00 44.69  ? 8   DA  D C4    1 
ATOM   1058 P  P     . DT  C 3 9  ? 17.364 -8.089  8.363   1.00 49.58  ? 9   DT  D P     1 
ATOM   1059 O  OP1   . DT  C 3 9  ? 18.599 -8.807  7.980   1.00 51.24  ? 9   DT  D OP1   1 
ATOM   1060 O  OP2   . DT  C 3 9  ? 16.390 -8.746  9.263   1.00 45.97  ? 9   DT  D OP2   1 
ATOM   1061 O  "O5'" . DT  C 3 9  ? 17.765 -6.689  9.020   1.00 57.63  ? 9   DT  D "O5'" 1 
ATOM   1062 C  "C5'" . DT  C 3 9  ? 18.161 -5.611  8.178   1.00 50.57  ? 9   DT  D "C5'" 1 
ATOM   1063 C  "C4'" . DT  C 3 9  ? 17.606 -4.291  8.682   1.00 51.79  ? 9   DT  D "C4'" 1 
ATOM   1064 O  "O4'" . DT  C 3 9  ? 16.167 -4.256  8.502   1.00 50.23  ? 9   DT  D "O4'" 1 
ATOM   1065 C  "C3'" . DT  C 3 9  ? 17.865 -4.005  10.164  1.00 56.25  ? 9   DT  D "C3'" 1 
ATOM   1066 O  "O3'" . DT  C 3 9  ? 18.500 -2.742  10.302  1.00 58.10  ? 9   DT  D "O3'" 1 
ATOM   1067 C  "C2'" . DT  C 3 9  ? 16.468 -4.016  10.798  1.00 51.19  ? 9   DT  D "C2'" 1 
ATOM   1068 C  "C1'" . DT  C 3 9  ? 15.578 -3.646  9.623   1.00 49.61  ? 9   DT  D "C1'" 1 
ATOM   1069 N  N1    . DT  C 3 9  ? 14.176 -4.147  9.755   1.00 47.97  ? 9   DT  D N1    1 
ATOM   1070 C  C2    . DT  C 3 9  ? 13.132 -3.253  9.691   1.00 48.99  ? 9   DT  D C2    1 
ATOM   1071 O  O2    . DT  C 3 9  ? 13.286 -2.057  9.528   1.00 54.88  ? 9   DT  D O2    1 
ATOM   1072 N  N3    . DT  C 3 9  ? 11.890 -3.814  9.821   1.00 47.80  ? 9   DT  D N3    1 
ATOM   1073 C  C4    . DT  C 3 9  ? 11.591 -5.151  10.007  1.00 46.42  ? 9   DT  D C4    1 
ATOM   1074 O  O4    . DT  C 3 9  ? 10.439 -5.558  10.113  1.00 46.91  ? 9   DT  D O4    1 
ATOM   1075 C  C5    . DT  C 3 9  ? 12.731 -6.035  10.069  1.00 46.79  ? 9   DT  D C5    1 
ATOM   1076 C  C7    . DT  C 3 9  ? 12.532 -7.508  10.270  1.00 38.44  ? 9   DT  D C7    1 
ATOM   1077 C  C6    . DT  C 3 9  ? 13.954 -5.496  9.941   1.00 49.18  ? 9   DT  D C6    1 
ATOM   1078 P  P     . DT  C 3 10 ? 18.966 -2.218  11.747  1.00 58.07  ? 10  DT  D P     1 
ATOM   1079 O  OP1   . DT  C 3 10 ? 20.173 -1.388  11.542  1.00 67.20  ? 10  DT  D OP1   1 
ATOM   1080 O  OP2   . DT  C 3 10 ? 19.018 -3.374  12.669  1.00 57.18  ? 10  DT  D OP2   1 
ATOM   1081 O  "O5'" . DT  C 3 10 ? 17.768 -1.266  12.202  1.00 54.61  ? 10  DT  D "O5'" 1 
ATOM   1082 C  "C5'" . DT  C 3 10 ? 17.325 -0.235  11.332  1.00 55.23  ? 10  DT  D "C5'" 1 
ATOM   1083 C  "C4'" . DT  C 3 10 ? 16.189 0.546   11.959  1.00 60.23  ? 10  DT  D "C4'" 1 
ATOM   1084 O  "O4'" . DT  C 3 10 ? 14.957 -0.210  11.847  1.00 58.84  ? 10  DT  D "O4'" 1 
ATOM   1085 C  "C3'" . DT  C 3 10 ? 16.369 0.864   13.446  1.00 62.95  ? 10  DT  D "C3'" 1 
ATOM   1086 O  "O3'" . DT  C 3 10 ? 16.099 2.240   13.674  1.00 71.11  ? 10  DT  D "O3'" 1 
ATOM   1087 C  "C2'" . DT  C 3 10 ? 15.348 -0.044  14.140  1.00 56.70  ? 10  DT  D "C2'" 1 
ATOM   1088 C  "C1'" . DT  C 3 10 ? 14.272 -0.175  13.075  1.00 59.71  ? 10  DT  D "C1'" 1 
ATOM   1089 N  N1    . DT  C 3 10 ? 13.458 -1.420  13.190  1.00 57.76  ? 10  DT  D N1    1 
ATOM   1090 C  C2    . DT  C 3 10 ? 12.086 -1.328  13.183  1.00 54.29  ? 10  DT  D C2    1 
ATOM   1091 O  O2    . DT  C 3 10 ? 11.490 -0.271  13.094  1.00 60.04  ? 10  DT  D O2    1 
ATOM   1092 N  N3    . DT  C 3 10 ? 11.430 -2.524  13.285  1.00 53.42  ? 10  DT  D N3    1 
ATOM   1093 C  C4    . DT  C 3 10 ? 11.996 -3.781  13.391  1.00 53.79  ? 10  DT  D C4    1 
ATOM   1094 O  O4    . DT  C 3 10 ? 11.318 -4.801  13.479  1.00 50.88  ? 10  DT  D O4    1 
ATOM   1095 C  C5    . DT  C 3 10 ? 13.441 -3.809  13.391  1.00 51.91  ? 10  DT  D C5    1 
ATOM   1096 C  C7    . DT  C 3 10 ? 14.169 -5.116  13.501  1.00 45.12  ? 10  DT  D C7    1 
ATOM   1097 C  C6    . DT  C 3 10 ? 14.094 -2.641  13.291  1.00 53.50  ? 10  DT  D C6    1 
ATOM   1098 P  P     . DC  C 3 11 ? 16.402 2.909   15.104  1.00 68.84  ? 11  DC  D P     1 
ATOM   1099 O  OP1   . DC  C 3 11 ? 16.985 4.245   14.852  1.00 65.73  ? 11  DC  D OP1   1 
ATOM   1100 O  OP2   . DC  C 3 11 ? 17.137 1.932   15.940  1.00 62.61  ? 11  DC  D OP2   1 
ATOM   1101 O  "O5'" . DC  C 3 11 ? 14.949 3.097   15.732  1.00 61.51  ? 11  DC  D "O5'" 1 
ATOM   1102 C  "C5'" . DC  C 3 11 ? 13.913 3.657   14.943  1.00 60.01  ? 11  DC  D "C5'" 1 
ATOM   1103 C  "C4'" . DC  C 3 11 ? 12.575 3.490   15.629  1.00 64.26  ? 11  DC  D "C4'" 1 
ATOM   1104 O  "O4'" . DC  C 3 11 ? 12.098 2.134   15.441  1.00 61.80  ? 11  DC  D "O4'" 1 
ATOM   1105 C  "C3'" . DC  C 3 11 ? 12.597 3.740   17.139  1.00 63.95  ? 11  DC  D "C3'" 1 
ATOM   1106 O  "O3'" . DC  C 3 11 ? 11.572 4.654   17.488  1.00 68.15  ? 11  DC  D "O3'" 1 
ATOM   1107 C  "C2'" . DC  C 3 11 ? 12.358 2.355   17.748  1.00 57.96  ? 11  DC  D "C2'" 1 
ATOM   1108 C  "C1'" . DC  C 3 11 ? 11.575 1.651   16.652  1.00 64.16  ? 11  DC  D "C1'" 1 
ATOM   1109 N  N1    . DC  C 3 11 ? 11.735 0.170   16.674  1.00 58.75  ? 11  DC  D N1    1 
ATOM   1110 C  C2    . DC  C 3 11 ? 10.614 -0.650  16.518  1.00 56.72  ? 11  DC  D C2    1 
ATOM   1111 O  O2    . DC  C 3 11 ? 9.503  -0.129  16.360  1.00 55.42  ? 11  DC  D O2    1 
ATOM   1112 N  N3    . DC  C 3 11 ? 10.778 -1.997  16.542  1.00 58.20  ? 11  DC  D N3    1 
ATOM   1113 C  C4    . DC  C 3 11 ? 11.994 -2.518  16.715  1.00 54.53  ? 11  DC  D C4    1 
ATOM   1114 N  N4    . DC  C 3 11 ? 12.108 -3.849  16.733  1.00 61.04  ? 11  DC  D N4    1 
ATOM   1115 C  C5    . DC  C 3 11 ? 13.148 -1.697  16.878  1.00 60.09  ? 11  DC  D C5    1 
ATOM   1116 C  C6    . DC  C 3 11 ? 12.973 -0.372  16.852  1.00 60.85  ? 11  DC  D C6    1 
ATOM   1117 P  P     . DC  C 3 12 ? 11.472 5.239   18.981  1.00 61.69  ? 12  DC  D P     1 
ATOM   1118 O  OP1   . DC  C 3 12 ? 11.270 6.700   18.853  1.00 65.88  ? 12  DC  D OP1   1 
ATOM   1119 O  OP2   . DC  C 3 12 ? 12.611 4.729   19.778  1.00 55.66  ? 12  DC  D OP2   1 
ATOM   1120 O  "O5'" . DC  C 3 12 ? 10.129 4.582   19.542  1.00 53.94  ? 12  DC  D "O5'" 1 
ATOM   1121 C  "C5'" . DC  C 3 12 ? 8.930  4.697   18.791  1.00 56.14  ? 12  DC  D "C5'" 1 
ATOM   1122 C  "C4'" . DC  C 3 12 ? 7.874  3.732   19.295  1.00 58.04  ? 12  DC  D "C4'" 1 
ATOM   1123 O  "O4'" . DC  C 3 12 ? 8.271  2.367   19.008  1.00 57.56  ? 12  DC  D "O4'" 1 
ATOM   1124 C  "C3'" . DC  C 3 12 ? 7.600  3.791   20.803  1.00 55.97  ? 12  DC  D "C3'" 1 
ATOM   1125 O  "O3'" . DC  C 3 12 ? 6.207  3.945   21.024  1.00 57.84  ? 12  DC  D "O3'" 1 
ATOM   1126 C  "C2'" . DC  C 3 12 ? 8.107  2.439   21.318  1.00 56.00  ? 12  DC  D "C2'" 1 
ATOM   1127 C  "C1'" . DC  C 3 12 ? 7.908  1.560   20.098  1.00 57.08  ? 12  DC  D "C1'" 1 
ATOM   1128 N  N1    . DC  C 3 12 ? 8.757  0.336   20.090  1.00 54.06  ? 12  DC  D N1    1 
ATOM   1129 C  C2    . DC  C 3 12 ? 8.152  -0.923  20.011  1.00 55.23  ? 12  DC  D C2    1 
ATOM   1130 O  O2    . DC  C 3 12 ? 6.918  -0.995  19.949  1.00 53.71  ? 12  DC  D O2    1 
ATOM   1131 N  N3    . DC  C 3 12 ? 8.936  -2.029  20.002  1.00 50.84  ? 12  DC  D N3    1 
ATOM   1132 C  C4    . DC  C 3 12 ? 10.262 -1.907  20.069  1.00 56.05  ? 12  DC  D C4    1 
ATOM   1133 N  N4    . DC  C 3 12 ? 10.993 -3.026  20.057  1.00 55.32  ? 12  DC  D N4    1 
ATOM   1134 C  C5    . DC  C 3 12 ? 10.897 -0.632  20.151  1.00 56.47  ? 12  DC  D C5    1 
ATOM   1135 C  C6    . DC  C 3 12 ? 10.114 0.452   20.158  1.00 54.72  ? 12  DC  D C6    1 
ATOM   1136 P  P     . DG  C 3 13 ? 5.648  4.359   22.471  1.00 55.89  ? 13  DG  D P     1 
ATOM   1137 O  OP1   . DG  C 3 13 ? 4.785  5.547   22.284  1.00 54.93  ? 13  DG  D OP1   1 
ATOM   1138 O  OP2   . DG  C 3 13 ? 6.786  4.407   23.417  1.00 51.92  ? 13  DG  D OP2   1 
ATOM   1139 O  "O5'" . DG  C 3 13 ? 4.717  3.128   22.880  1.00 53.41  ? 13  DG  D "O5'" 1 
ATOM   1140 C  "C5'" . DG  C 3 13 ? 3.669  2.720   22.011  1.00 55.69  ? 13  DG  D "C5'" 1 
ATOM   1141 C  "C4'" . DG  C 3 13 ? 2.983  1.476   22.542  1.00 60.14  ? 13  DG  D "C4'" 1 
ATOM   1142 O  "O4'" . DG  C 3 13 ? 3.797  0.311   22.252  1.00 58.14  ? 13  DG  D "O4'" 1 
ATOM   1143 C  "C3'" . DG  C 3 13 ? 2.736  1.474   24.047  1.00 60.79  ? 13  DG  D "C3'" 1 
ATOM   1144 O  "O3'" . DG  C 3 13 ? 1.445  0.958   24.327  1.00 68.15  ? 13  DG  D "O3'" 1 
ATOM   1145 C  "C2'" . DG  C 3 13 ? 3.842  0.574   24.597  1.00 62.53  ? 13  DG  D "C2'" 1 
ATOM   1146 C  "C1'" . DG  C 3 13 ? 4.113  -0.382  23.441  1.00 59.31  ? 13  DG  D "C1'" 1 
ATOM   1147 N  N9    . DG  C 3 13 ? 5.510  -0.797  23.362  1.00 58.93  ? 13  DG  D N9    1 
ATOM   1148 C  C8    . DG  C 3 13 ? 6.612  0.023   23.374  1.00 56.92  ? 13  DG  D C8    1 
ATOM   1149 N  N7    . DG  C 3 13 ? 7.741  -0.622  23.291  1.00 59.36  ? 13  DG  D N7    1 
ATOM   1150 C  C5    . DG  C 3 13 ? 7.366  -1.957  23.218  1.00 57.41  ? 13  DG  D C5    1 
ATOM   1151 C  C6    . DG  C 3 13 ? 8.163  -3.120  23.113  1.00 56.94  ? 13  DG  D C6    1 
ATOM   1152 O  O6    . DG  C 3 13 ? 9.399  -3.201  23.062  1.00 54.30  ? 13  DG  D O6    1 
ATOM   1153 N  N1    . DG  C 3 13 ? 7.386  -4.275  23.066  1.00 56.78  ? 13  DG  D N1    1 
ATOM   1154 C  C2    . DG  C 3 13 ? 6.012  -4.301  23.115  1.00 59.91  ? 13  DG  D C2    1 
ATOM   1155 N  N2    . DG  C 3 13 ? 5.438  -5.513  23.057  1.00 55.49  ? 13  DG  D N2    1 
ATOM   1156 N  N3    . DG  C 3 13 ? 5.252  -3.215  23.214  1.00 56.11  ? 13  DG  D N3    1 
ATOM   1157 C  C4    . DG  C 3 13 ? 5.995  -2.083  23.260  1.00 57.58  ? 13  DG  D C4    1 
ATOM   1158 P  P     . DC  C 3 14 ? 0.837  1.058   25.810  1.00 68.39  ? 14  DC  D P     1 
ATOM   1159 O  OP1   . DC  C 3 14 ? -0.583 1.456   25.687  1.00 73.31  ? 14  DC  D OP1   1 
ATOM   1160 O  OP2   . DC  C 3 14 ? 1.760  1.866   26.637  1.00 65.82  ? 14  DC  D OP2   1 
ATOM   1161 O  "O5'" . DC  C 3 14 ? 0.897  -0.446  26.335  1.00 69.06  ? 14  DC  D "O5'" 1 
ATOM   1162 C  "C5'" . DC  C 3 14 ? 0.429  -1.495  25.504  1.00 65.22  ? 14  DC  D "C5'" 1 
ATOM   1163 C  "C4'" . DC  C 3 14 ? 0.975  -2.825  25.973  1.00 65.91  ? 14  DC  D "C4'" 1 
ATOM   1164 O  "O4'" . DC  C 3 14 ? 2.374  -2.913  25.642  1.00 65.16  ? 14  DC  D "O4'" 1 
ATOM   1165 C  "C3'" . DC  C 3 14 ? 0.883  -3.051  27.481  1.00 67.58  ? 14  DC  D "C3'" 1 
ATOM   1166 O  "O3'" . DC  C 3 14 ? -0.079 -4.055  27.758  1.00 74.34  ? 14  DC  D "O3'" 1 
ATOM   1167 C  "C2'" . DC  C 3 14 ? 2.298  -3.482  27.905  1.00 68.12  ? 14  DC  D "C2'" 1 
ATOM   1168 C  "C1'" . DC  C 3 14 ? 3.003  -3.741  26.579  1.00 65.51  ? 14  DC  D "C1'" 1 
ATOM   1169 N  N1    . DC  C 3 14 ? 4.455  -3.404  26.601  1.00 62.32  ? 14  DC  D N1    1 
ATOM   1170 C  C2    . DC  C 3 14 ? 5.405  -4.428  26.533  1.00 60.69  ? 14  DC  D C2    1 
ATOM   1171 O  O2    . DC  C 3 14 ? 5.023  -5.600  26.455  1.00 63.77  ? 14  DC  D O2    1 
ATOM   1172 N  N3    . DC  C 3 14 ? 6.722  -4.104  26.553  1.00 60.00  ? 14  DC  D N3    1 
ATOM   1173 C  C4    . DC  C 3 14 ? 7.094  -2.826  26.638  1.00 58.58  ? 14  DC  D C4    1 
ATOM   1174 N  N4    . DC  C 3 14 ? 8.403  -2.556  26.655  1.00 57.65  ? 14  DC  D N4    1 
ATOM   1175 C  C5    . DC  C 3 14 ? 6.140  -1.768  26.709  1.00 58.82  ? 14  DC  D C5    1 
ATOM   1176 C  C6    . DC  C 3 14 ? 4.845  -2.100  26.688  1.00 59.95  ? 14  DC  D C6    1 
ATOM   1177 P  P     . DC  C 3 15 ? -0.527 -4.349  29.272  1.00 77.01  ? 15  DC  D P     1 
ATOM   1178 O  OP1   . DC  C 3 15 ? -1.889 -4.926  29.227  1.00 82.54  ? 15  DC  D OP1   1 
ATOM   1179 O  OP2   . DC  C 3 15 ? -0.266 -3.125  30.064  1.00 71.59  ? 15  DC  D OP2   1 
ATOM   1180 O  "O5'" . DC  C 3 15 ? 0.495  -5.479  29.753  1.00 76.42  ? 15  DC  D "O5'" 1 
ATOM   1181 C  "C5'" . DC  C 3 15 ? 0.697  -6.633  28.949  1.00 78.59  ? 15  DC  D "C5'" 1 
ATOM   1182 C  "C4'" . DC  C 3 15 ? 1.780  -7.520  29.535  1.00 77.97  ? 15  DC  D "C4'" 1 
ATOM   1183 O  "O4'" . DC  C 3 15 ? 3.091  -6.986  29.204  1.00 78.24  ? 15  DC  D "O4'" 1 
ATOM   1184 C  "C3'" . DC  C 3 15 ? 1.751  -7.656  31.060  1.00 80.77  ? 15  DC  D "C3'" 1 
ATOM   1185 O  "O3'" . DC  C 3 15 ? 1.991  -9.007  31.419  1.00 89.58  ? 15  DC  D "O3'" 1 
ATOM   1186 C  "C2'" . DC  C 3 15 ? 2.899  -6.751  31.505  1.00 77.66  ? 15  DC  D "C2'" 1 
ATOM   1187 C  "C1'" . DC  C 3 15 ? 3.882  -6.964  30.368  1.00 75.02  ? 15  DC  D "C1'" 1 
ATOM   1188 N  N1    . DC  C 3 15 ? 4.905  -5.884  30.237  1.00 68.83  ? 15  DC  D N1    1 
ATOM   1189 C  C2    . DC  C 3 15 ? 6.241  -6.225  29.993  1.00 67.29  ? 15  DC  D C2    1 
ATOM   1190 O  O2    . DC  C 3 15 ? 6.548  -7.418  29.888  1.00 69.95  ? 15  DC  D O2    1 
ATOM   1191 N  N3    . DC  C 3 15 ? 7.161  -5.237  29.875  1.00 65.46  ? 15  DC  D N3    1 
ATOM   1192 C  C4    . DC  C 3 15 ? 6.790  -3.961  29.994  1.00 66.88  ? 15  DC  D C4    1 
ATOM   1193 N  N4    . DC  C 3 15 ? 7.734  -3.022  29.870  1.00 62.50  ? 15  DC  D N4    1 
ATOM   1194 C  C5    . DC  C 3 15 ? 5.434  -3.593  30.244  1.00 62.37  ? 15  DC  D C5    1 
ATOM   1195 C  C6    . DC  C 3 15 ? 4.534  -4.577  30.359  1.00 65.38  ? 15  DC  D C6    1 
ATOM   1196 P  P     . DG  C 3 16 ? 1.308  -9.640  32.727  1.00 95.49  ? 16  DG  D P     1 
ATOM   1197 O  OP1   . DG  C 3 16 ? 0.165  -10.463 32.273  1.00 89.64  ? 16  DG  D OP1   1 
ATOM   1198 O  OP2   . DG  C 3 16 ? 1.088  -8.550  33.703  1.00 89.52  ? 16  DG  D OP2   1 
ATOM   1199 O  "O5'" . DG  C 3 16 ? 2.440  -10.612 33.307  1.00 93.07  ? 16  DG  D "O5'" 1 
ATOM   1200 C  "C5'" . DG  C 3 16 ? 3.012  -11.611 32.467  1.00 91.27  ? 16  DG  D "C5'" 1 
ATOM   1201 C  "C4'" . DG  C 3 16 ? 4.488  -11.808 32.775  1.00 92.51  ? 16  DG  D "C4'" 1 
ATOM   1202 O  "O4'" . DG  C 3 16 ? 5.227  -10.605 32.429  1.00 89.81  ? 16  DG  D "O4'" 1 
ATOM   1203 C  "C3'" . DG  C 3 16 ? 4.813  -12.105 34.240  1.00 95.22  ? 16  DG  D "C3'" 1 
ATOM   1204 O  "O3'" . DG  C 3 16 ? 5.783  -13.143 34.322  1.00 100.68 ? 16  DG  D "O3'" 1 
ATOM   1205 C  "C2'" . DG  C 3 16 ? 5.367  -10.777 34.755  1.00 89.19  ? 16  DG  D "C2'" 1 
ATOM   1206 C  "C1'" . DG  C 3 16 ? 6.043  -10.220 33.512  1.00 86.51  ? 16  DG  D "C1'" 1 
ATOM   1207 N  N9    . DG  C 3 16 ? 6.148  -8.763  33.512  1.00 79.07  ? 16  DG  D N9    1 
ATOM   1208 C  C8    . DG  C 3 16 ? 5.136  -7.867  33.747  1.00 78.00  ? 16  DG  D C8    1 
ATOM   1209 N  N7    . DG  C 3 16 ? 5.515  -6.622  33.680  1.00 75.25  ? 16  DG  D N7    1 
ATOM   1210 C  C5    . DG  C 3 16 ? 6.869  -6.694  33.383  1.00 71.08  ? 16  DG  D C5    1 
ATOM   1211 C  C6    . DG  C 3 16 ? 7.816  -5.660  33.189  1.00 70.23  ? 16  DG  D C6    1 
ATOM   1212 O  O6    . DG  C 3 16 ? 7.638  -4.434  33.247  1.00 68.70  ? 16  DG  D O6    1 
ATOM   1213 N  N1    . DG  C 3 16 ? 9.082  -6.166  32.906  1.00 69.03  ? 16  DG  D N1    1 
ATOM   1214 C  C2    . DG  C 3 16 ? 9.392  -7.504  32.818  1.00 69.99  ? 16  DG  D C2    1 
ATOM   1215 N  N2    . DG  C 3 16 ? 10.670 -7.799  32.536  1.00 67.10  ? 16  DG  D N2    1 
ATOM   1216 N  N3    . DG  C 3 16 ? 8.514  -8.484  32.997  1.00 75.11  ? 16  DG  D N3    1 
ATOM   1217 C  C4    . DG  C 3 16 ? 7.276  -8.007  33.275  1.00 74.39  ? 16  DG  D C4    1 
ATOM   1218 N  N     . PRO D 1 26 ? -3.673 -14.293 -30.030 1.00 82.24  ? 418 PRO B N     1 
ATOM   1219 C  CA    . PRO D 1 26 ? -3.139 -15.593 -30.442 1.00 84.75  ? 418 PRO B CA    1 
ATOM   1220 C  C     . PRO D 1 26 ? -1.696 -15.839 -29.998 1.00 82.95  ? 418 PRO B C     1 
ATOM   1221 O  O     . PRO D 1 26 ? -1.319 -16.979 -29.749 1.00 80.91  ? 418 PRO B O     1 
ATOM   1222 C  CB    . PRO D 1 26 ? -3.219 -15.530 -31.969 1.00 78.13  ? 418 PRO B CB    1 
ATOM   1223 C  CG    . PRO D 1 26 ? -4.338 -14.620 -32.251 1.00 81.42  ? 418 PRO B CG    1 
ATOM   1224 C  CD    . PRO D 1 26 ? -4.312 -13.585 -31.152 1.00 82.92  ? 418 PRO B CD    1 
ATOM   1225 N  N     . LYS D 1 27 ? -0.904 -14.777 -29.897 1.00 77.16  ? 419 LYS B N     1 
ATOM   1226 C  CA    . LYS D 1 27 ? 0.534  -14.925 -29.704 1.00 74.17  ? 419 LYS B CA    1 
ATOM   1227 C  C     . LYS D 1 27 ? 1.001  -14.671 -28.268 1.00 71.47  ? 419 LYS B C     1 
ATOM   1228 O  O     . LYS D 1 27 ? 0.569  -13.717 -27.620 1.00 71.87  ? 419 LYS B O     1 
ATOM   1229 C  CB    . LYS D 1 27 ? 1.295  -14.003 -30.661 1.00 70.93  ? 419 LYS B CB    1 
ATOM   1230 C  CG    . LYS D 1 27 ? 1.710  -14.697 -31.944 1.00 75.29  ? 419 LYS B CG    1 
ATOM   1231 C  CD    . LYS D 1 27 ? 2.761  -13.901 -32.696 1.00 79.02  ? 419 LYS B CD    1 
ATOM   1232 C  CE    . LYS D 1 27 ? 3.242  -14.677 -33.914 1.00 80.01  ? 419 LYS B CE    1 
ATOM   1233 N  NZ    . LYS D 1 27 ? 4.382  -14.013 -34.604 1.00 77.38  ? 419 LYS B NZ    1 
ATOM   1234 N  N     . LEU D 1 28 ? 1.911  -15.526 -27.797 1.00 68.71  ? 420 LEU B N     1 
ATOM   1235 C  CA    . LEU D 1 28 ? 2.361  -15.517 -26.406 1.00 61.46  ? 420 LEU B CA    1 
ATOM   1236 C  C     . LEU D 1 28 ? 3.872  -15.315 -26.249 1.00 55.55  ? 420 LEU B C     1 
ATOM   1237 O  O     . LEU D 1 28 ? 4.647  -15.604 -27.160 1.00 56.19  ? 420 LEU B O     1 
ATOM   1238 C  CB    . LEU D 1 28 ? 1.964  -16.828 -25.730 1.00 60.83  ? 420 LEU B CB    1 
ATOM   1239 C  CG    . LEU D 1 28 ? 0.511  -17.277 -25.882 1.00 61.50  ? 420 LEU B CG    1 
ATOM   1240 C  CD1   . LEU D 1 28 ? 0.316  -18.667 -25.300 1.00 56.54  ? 420 LEU B CD1   1 
ATOM   1241 C  CD2   . LEU D 1 28 ? -0.424 -16.281 -25.219 1.00 62.77  ? 420 LEU B CD2   1 
ATOM   1242 N  N     . CYS D 1 29 ? 4.283  -14.836 -25.076 1.00 53.72  ? 421 CYS B N     1 
ATOM   1243 C  CA    . CYS D 1 29 ? 5.702  -14.703 -24.739 1.00 52.71  ? 421 CYS B CA    1 
ATOM   1244 C  C     . CYS D 1 29 ? 6.368  -16.076 -24.663 1.00 47.79  ? 421 CYS B C     1 
ATOM   1245 O  O     . CYS D 1 29 ? 5.839  -16.995 -24.044 1.00 48.25  ? 421 CYS B O     1 
ATOM   1246 C  CB    . CYS D 1 29 ? 5.872  -13.956 -23.409 1.00 46.05  ? 421 CYS B CB    1 
ATOM   1247 S  SG    . CYS D 1 29 ? 7.549  -13.932 -22.729 1.00 46.57  ? 421 CYS B SG    1 
ATOM   1248 N  N     . LEU D 1 30 ? 7.530  -16.213 -25.292 1.00 46.68  ? 422 LEU B N     1 
ATOM   1249 C  CA    . LEU D 1 30 ? 8.227  -17.497 -25.327 1.00 50.02  ? 422 LEU B CA    1 
ATOM   1250 C  C     . LEU D 1 30 ? 8.898  -17.832 -23.998 1.00 51.30  ? 422 LEU B C     1 
ATOM   1251 O  O     . LEU D 1 30 ? 9.441  -18.923 -23.826 1.00 46.70  ? 422 LEU B O     1 
ATOM   1252 C  CB    . LEU D 1 30 ? 9.265  -17.515 -26.451 1.00 48.18  ? 422 LEU B CB    1 
ATOM   1253 C  CG    . LEU D 1 30 ? 8.701  -17.658 -27.866 1.00 56.37  ? 422 LEU B CG    1 
ATOM   1254 C  CD1   . LEU D 1 30 ? 9.813  -17.572 -28.898 1.00 58.27  ? 422 LEU B CD1   1 
ATOM   1255 C  CD2   . LEU D 1 30 ? 7.933  -18.964 -28.005 1.00 59.16  ? 422 LEU B CD2   1 
ATOM   1256 N  N     . VAL D 1 31 ? 8.868  -16.891 -23.061 1.00 46.56  ? 423 VAL B N     1 
ATOM   1257 C  CA    . VAL D 1 31 ? 9.452  -17.121 -21.747 1.00 46.10  ? 423 VAL B CA    1 
ATOM   1258 C  C     . VAL D 1 31 ? 8.390  -17.479 -20.706 1.00 48.30  ? 423 VAL B C     1 
ATOM   1259 O  O     . VAL D 1 31 ? 8.392  -18.587 -20.172 1.00 48.56  ? 423 VAL B O     1 
ATOM   1260 C  CB    . VAL D 1 31 ? 10.245 -15.894 -21.261 1.00 45.56  ? 423 VAL B CB    1 
ATOM   1261 C  CG1   . VAL D 1 31 ? 10.801 -16.141 -19.867 1.00 44.16  ? 423 VAL B CG1   1 
ATOM   1262 C  CG2   . VAL D 1 31 ? 11.367 -15.573 -22.235 1.00 43.12  ? 423 VAL B CG2   1 
ATOM   1263 N  N     . CYS D 1 32 ? 7.506  -16.533 -20.397 1.00 42.64  ? 424 CYS B N     1 
ATOM   1264 C  CA    . CYS D 1 32 ? 6.479  -16.750 -19.377 1.00 44.20  ? 424 CYS B CA    1 
ATOM   1265 C  C     . CYS D 1 32 ? 5.081  -17.103 -19.910 1.00 47.01  ? 424 CYS B C     1 
ATOM   1266 O  O     . CYS D 1 32 ? 4.154  -17.272 -19.118 1.00 46.40  ? 424 CYS B O     1 
ATOM   1267 C  CB    . CYS D 1 32 ? 6.376  -15.518 -18.479 1.00 42.04  ? 424 CYS B CB    1 
ATOM   1268 S  SG    . CYS D 1 32 ? 5.614  -14.097 -19.267 1.00 41.25  ? 424 CYS B SG    1 
ATOM   1269 N  N     . SER D 1 33 ? 4.930  -17.174 -21.233 1.00 48.24  ? 425 SER B N     1 
ATOM   1270 C  CA    . SER D 1 33 ? 3.657  -17.520 -21.891 1.00 51.68  ? 425 SER B CA    1 
ATOM   1271 C  C     . SER D 1 33 ? 2.577  -16.432 -21.804 1.00 53.03  ? 425 SER B C     1 
ATOM   1272 O  O     . SER D 1 33 ? 1.482  -16.602 -22.337 1.00 54.19  ? 425 SER B O     1 
ATOM   1273 C  CB    . SER D 1 33 ? 3.096  -18.838 -21.344 1.00 47.81  ? 425 SER B CB    1 
ATOM   1274 O  OG    . SER D 1 33 ? 3.922  -19.929 -21.706 1.00 51.94  ? 425 SER B OG    1 
ATOM   1275 N  N     . ASP D 1 34 ? 2.877  -15.325 -21.131 1.00 54.69  ? 426 ASP B N     1 
ATOM   1276 C  CA    . ASP D 1 34 ? 1.979  -14.172 -21.123 1.00 50.02  ? 426 ASP B CA    1 
ATOM   1277 C  C     . ASP D 1 34 ? 1.912  -13.587 -22.532 1.00 55.70  ? 426 ASP B C     1 
ATOM   1278 O  O     . ASP D 1 34 ? 2.779  -13.864 -23.358 1.00 53.80  ? 426 ASP B O     1 
ATOM   1279 C  CB    . ASP D 1 34 ? 2.454  -13.119 -20.118 1.00 50.78  ? 426 ASP B CB    1 
ATOM   1280 C  CG    . ASP D 1 34 ? 1.393  -12.082 -19.802 1.00 59.77  ? 426 ASP B CG    1 
ATOM   1281 O  OD1   . ASP D 1 34 ? 0.205  -12.330 -20.101 1.00 60.62  ? 426 ASP B OD1   1 
ATOM   1282 O  OD2   . ASP D 1 34 ? 1.750  -11.020 -19.246 1.00 56.00  ? 426 ASP B OD2   1 
ATOM   1283 N  N     . GLU D 1 35 ? 0.876  -12.807 -22.820 1.00 58.20  ? 427 GLU B N     1 
ATOM   1284 C  CA    . GLU D 1 35 ? 0.708  -12.240 -24.156 1.00 62.23  ? 427 GLU B CA    1 
ATOM   1285 C  C     . GLU D 1 35 ? 1.874  -11.325 -24.526 1.00 53.69  ? 427 GLU B C     1 
ATOM   1286 O  O     . GLU D 1 35 ? 2.232  -10.417 -23.775 1.00 54.70  ? 427 GLU B O     1 
ATOM   1287 C  CB    . GLU D 1 35 ? -0.618 -11.484 -24.253 1.00 64.51  ? 427 GLU B CB    1 
ATOM   1288 C  CG    . GLU D 1 35 ? -1.763 -12.173 -23.519 1.00 73.91  ? 427 GLU B CG    1 
ATOM   1289 C  CD    . GLU D 1 35 ? -3.116 -11.900 -24.148 1.00 85.53  ? 427 GLU B CD    1 
ATOM   1290 O  OE1   . GLU D 1 35 ? -3.283 -10.830 -24.768 1.00 84.34  ? 427 GLU B OE1   1 
ATOM   1291 O  OE2   . GLU D 1 35 ? -4.015 -12.758 -24.020 1.00 89.83  ? 427 GLU B OE2   1 
ATOM   1292 N  N     . ALA D 1 36 ? 2.463  -11.575 -25.692 1.00 58.47  ? 428 ALA B N     1 
ATOM   1293 C  CA    . ALA D 1 36 ? 3.673  -10.875 -26.112 1.00 60.02  ? 428 ALA B CA    1 
ATOM   1294 C  C     . ALA D 1 36 ? 3.374  -9.500  -26.701 1.00 62.01  ? 428 ALA B C     1 
ATOM   1295 O  O     . ALA D 1 36 ? 2.372  -9.312  -27.388 1.00 62.31  ? 428 ALA B O     1 
ATOM   1296 C  CB    . ALA D 1 36 ? 4.438  -11.717 -27.115 1.00 55.60  ? 428 ALA B CB    1 
ATOM   1297 N  N     . SER D 1 37 ? 4.253  -8.542  -26.421 1.00 61.31  ? 429 SER B N     1 
ATOM   1298 C  CA    . SER D 1 37 ? 4.106  -7.189  -26.943 1.00 59.50  ? 429 SER B CA    1 
ATOM   1299 C  C     . SER D 1 37 ? 4.847  -7.013  -28.267 1.00 63.39  ? 429 SER B C     1 
ATOM   1300 O  O     . SER D 1 37 ? 4.711  -5.985  -28.931 1.00 67.63  ? 429 SER B O     1 
ATOM   1301 C  CB    . SER D 1 37 ? 4.610  -6.164  -25.925 1.00 60.20  ? 429 SER B CB    1 
ATOM   1302 O  OG    . SER D 1 37 ? 6.000  -6.315  -25.691 1.00 57.98  ? 429 SER B OG    1 
ATOM   1303 N  N     . GLY D 1 38 ? 5.632  -8.016  -28.646 1.00 59.29  ? 430 GLY B N     1 
ATOM   1304 C  CA    . GLY D 1 38 ? 6.377  -7.969  -29.892 1.00 59.22  ? 430 GLY B CA    1 
ATOM   1305 C  C     . GLY D 1 38 ? 7.681  -8.741  -29.830 1.00 59.59  ? 430 GLY B C     1 
ATOM   1306 O  O     . GLY D 1 38 ? 7.901  -9.533  -28.914 1.00 57.28  ? 430 GLY B O     1 
ATOM   1307 N  N     . CYS D 1 39 ? 8.550  -8.507  -30.807 1.00 57.61  ? 431 CYS B N     1 
ATOM   1308 C  CA    . CYS D 1 39 ? 9.850  -9.166  -30.841 1.00 59.08  ? 431 CYS B CA    1 
ATOM   1309 C  C     . CYS D 1 39 ? 10.893 -8.285  -30.165 1.00 60.04  ? 431 CYS B C     1 
ATOM   1310 O  O     . CYS D 1 39 ? 11.253 -7.227  -30.679 1.00 61.93  ? 431 CYS B O     1 
ATOM   1311 C  CB    . CYS D 1 39 ? 10.260 -9.475  -32.284 1.00 59.23  ? 431 CYS B CB    1 
ATOM   1312 S  SG    . CYS D 1 39 ? 11.856 -10.313 -32.459 1.00 66.89  ? 431 CYS B SG    1 
ATOM   1313 N  N     . HIS D 1 40 ? 11.378 -8.732  -29.011 1.00 57.11  ? 432 HIS B N     1 
ATOM   1314 C  CA    . HIS D 1 40 ? 12.310 -7.941  -28.217 1.00 58.29  ? 432 HIS B CA    1 
ATOM   1315 C  C     . HIS D 1 40 ? 13.624 -8.680  -28.008 1.00 56.18  ? 432 HIS B C     1 
ATOM   1316 O  O     . HIS D 1 40 ? 13.637 -9.811  -27.519 1.00 57.83  ? 432 HIS B O     1 
ATOM   1317 C  CB    . HIS D 1 40 ? 11.688 -7.580  -26.867 1.00 55.53  ? 432 HIS B CB    1 
ATOM   1318 C  CG    . HIS D 1 40 ? 10.402 -6.824  -26.980 1.00 54.32  ? 432 HIS B CG    1 
ATOM   1319 N  ND1   . HIS D 1 40 ? 10.330 -5.551  -27.501 1.00 56.23  ? 432 HIS B ND1   1 
ATOM   1320 C  CD2   . HIS D 1 40 ? 9.135  -7.167  -26.645 1.00 56.59  ? 432 HIS B CD2   1 
ATOM   1321 C  CE1   . HIS D 1 40 ? 9.075  -5.139  -27.478 1.00 54.52  ? 432 HIS B CE1   1 
ATOM   1322 N  NE2   . HIS D 1 40 ? 8.329  -6.100  -26.965 1.00 58.85  ? 432 HIS B NE2   1 
ATOM   1323 N  N     . TYR D 1 41 ? 14.720 -8.028  -28.385 1.00 55.80  ? 433 TYR B N     1 
ATOM   1324 C  CA    . TYR D 1 41 ? 16.060 -8.600  -28.290 1.00 53.19  ? 433 TYR B CA    1 
ATOM   1325 C  C     . TYR D 1 41 ? 16.148 -9.937  -29.024 1.00 56.39  ? 433 TYR B C     1 
ATOM   1326 O  O     . TYR D 1 41 ? 16.844 -10.855 -28.588 1.00 57.18  ? 433 TYR B O     1 
ATOM   1327 C  CB    . TYR D 1 41 ? 16.474 -8.755  -26.824 1.00 52.01  ? 433 TYR B CB    1 
ATOM   1328 C  CG    . TYR D 1 41 ? 16.421 -7.454  -26.056 1.00 56.21  ? 433 TYR B CG    1 
ATOM   1329 C  CD1   . TYR D 1 41 ? 17.300 -6.419  -26.347 1.00 57.98  ? 433 TYR B CD1   1 
ATOM   1330 C  CD2   . TYR D 1 41 ? 15.486 -7.255  -25.047 1.00 50.89  ? 433 TYR B CD2   1 
ATOM   1331 C  CE1   . TYR D 1 41 ? 17.253 -5.224  -25.655 1.00 56.66  ? 433 TYR B CE1   1 
ATOM   1332 C  CE2   . TYR D 1 41 ? 15.432 -6.063  -24.348 1.00 50.38  ? 433 TYR B CE2   1 
ATOM   1333 C  CZ    . TYR D 1 41 ? 16.318 -5.051  -24.657 1.00 55.78  ? 433 TYR B CZ    1 
ATOM   1334 O  OH    . TYR D 1 41 ? 16.271 -3.862  -23.965 1.00 60.13  ? 433 TYR B OH    1 
ATOM   1335 N  N     . GLY D 1 42 ? 15.428 -10.035 -30.139 1.00 53.14  ? 434 GLY B N     1 
ATOM   1336 C  CA    . GLY D 1 42 ? 15.496 -11.199 -31.004 1.00 54.54  ? 434 GLY B CA    1 
ATOM   1337 C  C     . GLY D 1 42 ? 14.397 -12.223 -30.787 1.00 55.62  ? 434 GLY B C     1 
ATOM   1338 O  O     . GLY D 1 42 ? 14.192 -13.106 -31.619 1.00 57.34  ? 434 GLY B O     1 
ATOM   1339 N  N     . VAL D 1 43 ? 13.686 -12.105 -29.671 1.00 53.91  ? 435 VAL B N     1 
ATOM   1340 C  CA    . VAL D 1 43 ? 12.712 -13.116 -29.275 1.00 50.94  ? 435 VAL B CA    1 
ATOM   1341 C  C     . VAL D 1 43 ? 11.348 -12.496 -28.985 1.00 54.32  ? 435 VAL B C     1 
ATOM   1342 O  O     . VAL D 1 43 ? 11.264 -11.399 -28.433 1.00 57.42  ? 435 VAL B O     1 
ATOM   1343 C  CB    . VAL D 1 43 ? 13.204 -13.893 -28.028 1.00 52.26  ? 435 VAL B CB    1 
ATOM   1344 C  CG1   . VAL D 1 43 ? 12.188 -14.939 -27.591 1.00 51.94  ? 435 VAL B CG1   1 
ATOM   1345 C  CG2   . VAL D 1 43 ? 14.548 -14.543 -28.308 1.00 53.57  ? 435 VAL B CG2   1 
ATOM   1346 N  N     . LEU D 1 44 ? 10.283 -13.201 -29.355 1.00 48.51  ? 436 LEU B N     1 
ATOM   1347 C  CA    . LEU D 1 44 ? 8.933  -12.752 -29.050 1.00 52.17  ? 436 LEU B CA    1 
ATOM   1348 C  C     . LEU D 1 44 ? 8.694  -12.848 -27.545 1.00 56.03  ? 436 LEU B C     1 
ATOM   1349 O  O     . LEU D 1 44 ? 8.762  -13.935 -26.969 1.00 51.54  ? 436 LEU B O     1 
ATOM   1350 C  CB    . LEU D 1 44 ? 7.913  -13.602 -29.813 1.00 50.36  ? 436 LEU B CB    1 
ATOM   1351 C  CG    . LEU D 1 44 ? 6.428  -13.260 -29.716 1.00 58.95  ? 436 LEU B CG    1 
ATOM   1352 C  CD1   . LEU D 1 44 ? 6.136  -11.922 -30.378 1.00 58.81  ? 436 LEU B CD1   1 
ATOM   1353 C  CD2   . LEU D 1 44 ? 5.586  -14.368 -30.332 1.00 59.10  ? 436 LEU B CD2   1 
ATOM   1354 N  N     . THR D 1 45 ? 8.391  -11.712 -26.917 1.00 51.81  ? 437 THR B N     1 
ATOM   1355 C  CA    . THR D 1 45 ? 8.264  -11.637 -25.460 1.00 49.31  ? 437 THR B CA    1 
ATOM   1356 C  C     . THR D 1 45 ? 7.255  -10.586 -25.012 1.00 52.21  ? 437 THR B C     1 
ATOM   1357 O  O     . THR D 1 45 ? 6.928  -9.664  -25.759 1.00 59.97  ? 437 THR B O     1 
ATOM   1358 C  CB    . THR D 1 45 ? 9.615  -11.301 -24.771 1.00 51.99  ? 437 THR B CB    1 
ATOM   1359 O  OG1   . THR D 1 45 ? 10.146 -10.087 -25.316 1.00 53.21  ? 437 THR B OG1   1 
ATOM   1360 C  CG2   . THR D 1 45 ? 10.633 -12.425 -24.933 1.00 47.92  ? 437 THR B CG2   1 
ATOM   1361 N  N     . CYS D 1 46 ? 6.764  -10.739 -23.786 1.00 48.29  ? 438 CYS B N     1 
ATOM   1362 C  CA    . CYS D 1 46 ? 5.958  -9.713  -23.134 1.00 48.65  ? 438 CYS B CA    1 
ATOM   1363 C  C     . CYS D 1 46 ? 6.851  -8.573  -22.650 1.00 43.87  ? 438 CYS B C     1 
ATOM   1364 O  O     . CYS D 1 46 ? 8.068  -8.729  -22.554 1.00 44.13  ? 438 CYS B O     1 
ATOM   1365 C  CB    . CYS D 1 46 ? 5.165  -10.299 -21.965 1.00 44.66  ? 438 CYS B CB    1 
ATOM   1366 S  SG    . CYS D 1 46 ? 6.163  -10.754 -20.533 1.00 46.62  ? 438 CYS B SG    1 
ATOM   1367 N  N     . GLY D 1 47 ? 6.246  -7.424  -22.366 1.00 48.36  ? 439 GLY B N     1 
ATOM   1368 C  CA    . GLY D 1 47 ? 6.980  -6.263  -21.894 1.00 42.05  ? 439 GLY B CA    1 
ATOM   1369 C  C     . GLY D 1 47 ? 7.764  -6.475  -20.609 1.00 44.95  ? 439 GLY B C     1 
ATOM   1370 O  O     . GLY D 1 47 ? 8.863  -5.943  -20.455 1.00 44.18  ? 439 GLY B O     1 
ATOM   1371 N  N     . SER D 1 48 ? 7.206  -7.248  -19.682 1.00 41.56  ? 440 SER B N     1 
ATOM   1372 C  CA    . SER D 1 48 ? 7.867  -7.484  -18.400 1.00 42.00  ? 440 SER B CA    1 
ATOM   1373 C  C     . SER D 1 48 ? 9.151  -8.295  -18.566 1.00 38.50  ? 440 SER B C     1 
ATOM   1374 O  O     . SER D 1 48 ? 10.159 -8.008  -17.922 1.00 40.18  ? 440 SER B O     1 
ATOM   1375 C  CB    . SER D 1 48 ? 6.920  -8.191  -17.427 1.00 40.57  ? 440 SER B CB    1 
ATOM   1376 O  OG    . SER D 1 48 ? 6.640  -9.511  -17.852 1.00 43.74  ? 440 SER B OG    1 
ATOM   1377 N  N     . CYS D 1 49 ? 9.116  -9.300  -19.435 1.00 39.92  ? 441 CYS B N     1 
ATOM   1378 C  CA    . CYS D 1 49 ? 10.298 -10.117 -19.695 1.00 43.23  ? 441 CYS B CA    1 
ATOM   1379 C  C     . CYS D 1 49 ? 11.346 -9.332  -20.475 1.00 43.61  ? 441 CYS B C     1 
ATOM   1380 O  O     . CYS D 1 49 ? 12.548 -9.521  -20.280 1.00 40.85  ? 441 CYS B O     1 
ATOM   1381 C  CB    . CYS D 1 49 ? 9.919  -11.392 -20.451 1.00 38.44  ? 441 CYS B CB    1 
ATOM   1382 S  SG    . CYS D 1 49 ? 9.076  -12.622 -19.430 1.00 43.28  ? 441 CYS B SG    1 
ATOM   1383 N  N     . LYS D 1 50 ? 10.882 -8.455  -21.360 1.00 43.04  ? 442 LYS B N     1 
ATOM   1384 C  CA    . LYS D 1 50 ? 11.768 -7.551  -22.085 1.00 47.10  ? 442 LYS B CA    1 
ATOM   1385 C  C     . LYS D 1 50 ? 12.579 -6.705  -21.111 1.00 43.15  ? 442 LYS B C     1 
ATOM   1386 O  O     . LYS D 1 50 ? 13.805 -6.635  -21.199 1.00 42.58  ? 442 LYS B O     1 
ATOM   1387 C  CB    . LYS D 1 50 ? 10.963 -6.647  -23.021 1.00 47.03  ? 442 LYS B CB    1 
ATOM   1388 C  CG    . LYS D 1 50 ? 11.771 -5.523  -23.650 1.00 50.99  ? 442 LYS B CG    1 
ATOM   1389 C  CD    . LYS D 1 50 ? 10.860 -4.480  -24.283 1.00 50.84  ? 442 LYS B CD    1 
ATOM   1390 C  CE    . LYS D 1 50 ? 10.164 -3.645  -23.217 1.00 51.50  ? 442 LYS B CE    1 
ATOM   1391 N  NZ    . LYS D 1 50 ? 9.067  -2.808  -23.779 1.00 54.31  ? 442 LYS B NZ    1 
ATOM   1392 N  N     . VAL D 1 51 ? 11.879 -6.073  -20.175 1.00 39.57  ? 443 VAL B N     1 
ATOM   1393 C  CA    . VAL D 1 51 ? 12.510 -5.205  -19.189 1.00 45.39  ? 443 VAL B CA    1 
ATOM   1394 C  C     . VAL D 1 51 ? 13.362 -6.011  -18.207 1.00 43.37  ? 443 VAL B C     1 
ATOM   1395 O  O     . VAL D 1 51 ? 14.433 -5.565  -17.789 1.00 42.92  ? 443 VAL B O     1 
ATOM   1396 C  CB    . VAL D 1 51 ? 11.451 -4.386  -18.417 1.00 47.45  ? 443 VAL B CB    1 
ATOM   1397 C  CG1   . VAL D 1 51 ? 12.091 -3.598  -17.288 1.00 52.19  ? 443 VAL B CG1   1 
ATOM   1398 C  CG2   . VAL D 1 51 ? 10.710 -3.455  -19.365 1.00 44.47  ? 443 VAL B CG2   1 
ATOM   1399 N  N     . PHE D 1 52 ? 12.893 -7.205  -17.854 1.00 43.42  ? 444 PHE B N     1 
ATOM   1400 C  CA    . PHE D 1 52 ? 13.636 -8.072  -16.942 1.00 42.01  ? 444 PHE B CA    1 
ATOM   1401 C  C     . PHE D 1 52 ? 14.984 -8.473  -17.530 1.00 39.36  ? 444 PHE B C     1 
ATOM   1402 O  O     . PHE D 1 52 ? 16.012 -8.390  -16.858 1.00 40.45  ? 444 PHE B O     1 
ATOM   1403 C  CB    . PHE D 1 52 ? 12.828 -9.326  -16.600 1.00 40.04  ? 444 PHE B CB    1 
ATOM   1404 C  CG    . PHE D 1 52 ? 13.606 -10.352 -15.822 1.00 37.72  ? 444 PHE B CG    1 
ATOM   1405 C  CD1   . PHE D 1 52 ? 13.725 -10.253 -14.446 1.00 35.24  ? 444 PHE B CD1   1 
ATOM   1406 C  CD2   . PHE D 1 52 ? 14.224 -11.412 -16.469 1.00 33.98  ? 444 PHE B CD2   1 
ATOM   1407 C  CE1   . PHE D 1 52 ? 14.444 -11.192 -13.728 1.00 38.02  ? 444 PHE B CE1   1 
ATOM   1408 C  CE2   . PHE D 1 52 ? 14.945 -12.353 -15.756 1.00 38.64  ? 444 PHE B CE2   1 
ATOM   1409 C  CZ    . PHE D 1 52 ? 15.055 -12.244 -14.385 1.00 35.31  ? 444 PHE B CZ    1 
ATOM   1410 N  N     . PHE D 1 53 ? 14.972 -8.918  -18.782 1.00 41.20  ? 445 PHE B N     1 
ATOM   1411 C  CA    . PHE D 1 53 ? 16.195 -9.347  -19.452 1.00 45.27  ? 445 PHE B CA    1 
ATOM   1412 C  C     . PHE D 1 53 ? 17.187 -8.196  -19.567 1.00 49.77  ? 445 PHE B C     1 
ATOM   1413 O  O     . PHE D 1 53 ? 18.389 -8.381  -19.382 1.00 51.58  ? 445 PHE B O     1 
ATOM   1414 C  CB    . PHE D 1 53 ? 15.879 -9.912  -20.836 1.00 43.18  ? 445 PHE B CB    1 
ATOM   1415 C  CG    . PHE D 1 53 ? 17.096 -10.316 -21.619 1.00 49.02  ? 445 PHE B CG    1 
ATOM   1416 C  CD1   . PHE D 1 53 ? 17.785 -11.475 -21.304 1.00 44.78  ? 445 PHE B CD1   1 
ATOM   1417 C  CD2   . PHE D 1 53 ? 17.547 -9.540  -22.675 1.00 48.10  ? 445 PHE B CD2   1 
ATOM   1418 C  CE1   . PHE D 1 53 ? 18.904 -11.851 -22.023 1.00 47.99  ? 445 PHE B CE1   1 
ATOM   1419 C  CE2   . PHE D 1 53 ? 18.665 -9.911  -23.398 1.00 51.95  ? 445 PHE B CE2   1 
ATOM   1420 C  CZ    . PHE D 1 53 ? 19.344 -11.068 -23.072 1.00 51.74  ? 445 PHE B CZ    1 
ATOM   1421 N  N     . LYS D 1 54 ? 16.668 -7.010  -19.870 1.00 50.41  ? 446 LYS B N     1 
ATOM   1422 C  CA    . LYS D 1 54 ? 17.479 -5.803  -19.970 1.00 50.46  ? 446 LYS B CA    1 
ATOM   1423 C  C     . LYS D 1 54 ? 18.188 -5.499  -18.653 1.00 49.11  ? 446 LYS B C     1 
ATOM   1424 O  O     . LYS D 1 54 ? 19.393 -5.252  -18.629 1.00 54.15  ? 446 LYS B O     1 
ATOM   1425 C  CB    . LYS D 1 54 ? 16.604 -4.618  -20.390 1.00 55.19  ? 446 LYS B CB    1 
ATOM   1426 C  CG    . LYS D 1 54 ? 17.269 -3.255  -20.275 1.00 60.98  ? 446 LYS B CG    1 
ATOM   1427 C  CD    . LYS D 1 54 ? 18.307 -3.036  -21.361 1.00 63.89  ? 446 LYS B CD    1 
ATOM   1428 C  CE    . LYS D 1 54 ? 18.800 -1.596  -21.356 1.00 68.22  ? 446 LYS B CE    1 
ATOM   1429 N  NZ    . LYS D 1 54 ? 19.849 -1.360  -22.384 1.00 68.91  ? 446 LYS B NZ    1 
ATOM   1430 N  N     . ARG D 1 55 ? 17.433 -5.528  -17.560 1.00 51.08  ? 447 ARG B N     1 
ATOM   1431 C  CA    . ARG D 1 55 ? 17.980 -5.251  -16.236 1.00 50.41  ? 447 ARG B CA    1 
ATOM   1432 C  C     . ARG D 1 55 ? 18.955 -6.333  -15.778 1.00 55.28  ? 447 ARG B C     1 
ATOM   1433 O  O     . ARG D 1 55 ? 19.903 -6.054  -15.042 1.00 56.67  ? 447 ARG B O     1 
ATOM   1434 C  CB    . ARG D 1 55 ? 16.848 -5.106  -15.216 1.00 52.20  ? 447 ARG B CB    1 
ATOM   1435 C  CG    . ARG D 1 55 ? 16.018 -3.843  -15.384 1.00 53.98  ? 447 ARG B CG    1 
ATOM   1436 C  CD    . ARG D 1 55 ? 14.802 -3.850  -14.470 1.00 59.68  ? 447 ARG B CD    1 
ATOM   1437 N  NE    . ARG D 1 55 ? 14.108 -2.564  -14.473 1.00 60.10  ? 447 ARG B NE    1 
ATOM   1438 C  CZ    . ARG D 1 55 ? 12.825 -2.404  -14.164 1.00 57.45  ? 447 ARG B CZ    1 
ATOM   1439 N  NH1   . ARG D 1 55 ? 12.084 -3.451  -13.832 1.00 62.16  ? 447 ARG B NH1   1 
ATOM   1440 N  NH2   . ARG D 1 55 ? 12.281 -1.195  -14.193 1.00 60.23  ? 447 ARG B NH2   1 
ATOM   1441 N  N     . ALA D 1 56 ? 18.721 -7.566  -16.216 1.00 48.61  ? 448 ALA B N     1 
ATOM   1442 C  CA    . ALA D 1 56 ? 19.547 -8.696  -15.802 1.00 51.42  ? 448 ALA B CA    1 
ATOM   1443 C  C     . ALA D 1 56 ? 20.930 -8.657  -16.446 1.00 55.31  ? 448 ALA B C     1 
ATOM   1444 O  O     . ALA D 1 56 ? 21.940 -8.876  -15.776 1.00 52.45  ? 448 ALA B O     1 
ATOM   1445 C  CB    . ALA D 1 56 ? 18.851 -10.006 -16.133 1.00 44.96  ? 448 ALA B CB    1 
ATOM   1446 N  N     . VAL D 1 57 ? 20.970 -8.380  -17.745 1.00 54.60  ? 449 VAL B N     1 
ATOM   1447 C  CA    . VAL D 1 57 ? 22.229 -8.356  -18.484 1.00 57.02  ? 449 VAL B CA    1 
ATOM   1448 C  C     . VAL D 1 57 ? 23.141 -7.223  -18.017 1.00 60.89  ? 449 VAL B C     1 
ATOM   1449 O  O     . VAL D 1 57 ? 24.336 -7.425  -17.799 1.00 64.62  ? 449 VAL B O     1 
ATOM   1450 C  CB    . VAL D 1 57 ? 21.987 -8.215  -19.999 1.00 55.95  ? 449 VAL B CB    1 
ATOM   1451 C  CG1   . VAL D 1 57 ? 23.307 -8.055  -20.738 1.00 63.92  ? 449 VAL B CG1   1 
ATOM   1452 C  CG2   . VAL D 1 57 ? 21.223 -9.415  -20.526 1.00 53.65  ? 449 VAL B CG2   1 
ATOM   1453 N  N     . GLU D 1 58 ? 22.569 -6.035  -17.853 1.00 62.37  ? 450 GLU B N     1 
ATOM   1454 C  CA    . GLU D 1 58 ? 23.350 -4.855  -17.499 1.00 64.45  ? 450 GLU B CA    1 
ATOM   1455 C  C     . GLU D 1 58 ? 23.632 -4.770  -16.005 1.00 66.92  ? 450 GLU B C     1 
ATOM   1456 O  O     . GLU D 1 58 ? 24.505 -4.017  -15.573 1.00 70.67  ? 450 GLU B O     1 
ATOM   1457 C  CB    . GLU D 1 58 ? 22.634 -3.590  -17.968 1.00 62.55  ? 450 GLU B CB    1 
ATOM   1458 C  CG    . GLU D 1 58 ? 22.259 -3.622  -19.437 1.00 69.11  ? 450 GLU B CG    1 
ATOM   1459 C  CD    . GLU D 1 58 ? 21.885 -2.258  -19.974 1.00 76.83  ? 450 GLU B CD    1 
ATOM   1460 O  OE1   . GLU D 1 58 ? 21.405 -1.418  -19.184 1.00 79.62  ? 450 GLU B OE1   1 
ATOM   1461 O  OE2   . GLU D 1 58 ? 22.071 -2.027  -21.188 1.00 77.30  ? 450 GLU B OE2   1 
ATOM   1462 N  N     . GLY D 1 59 ? 22.892 -5.540  -15.218 1.00 65.69  ? 451 GLY B N     1 
ATOM   1463 C  CA    . GLY D 1 59 ? 23.131 -5.599  -13.790 1.00 63.81  ? 451 GLY B CA    1 
ATOM   1464 C  C     . GLY D 1 59 ? 24.209 -6.615  -13.477 1.00 63.83  ? 451 GLY B C     1 
ATOM   1465 O  O     . GLY D 1 59 ? 24.699 -6.685  -12.348 1.00 65.93  ? 451 GLY B O     1 
ATOM   1466 N  N     . GLN D 1 60 ? 24.575 -7.397  -14.493 1.00 65.69  ? 452 GLN B N     1 
ATOM   1467 C  CA    . GLN D 1 60 ? 25.527 -8.497  -14.353 1.00 68.88  ? 452 GLN B CA    1 
ATOM   1468 C  C     . GLN D 1 60 ? 25.103 -9.415  -13.214 1.00 66.33  ? 452 GLN B C     1 
ATOM   1469 O  O     . GLN D 1 60 ? 25.937 -9.942  -12.477 1.00 68.94  ? 452 GLN B O     1 
ATOM   1470 C  CB    . GLN D 1 60 ? 26.945 -7.969  -14.118 1.00 72.43  ? 452 GLN B CB    1 
ATOM   1471 C  CG    . GLN D 1 60 ? 27.487 -7.079  -15.236 1.00 75.81  ? 452 GLN B CG    1 
ATOM   1472 C  CD    . GLN D 1 60 ? 27.721 -7.819  -16.546 1.00 79.06  ? 452 GLN B CD    1 
ATOM   1473 O  OE1   . GLN D 1 60 ? 27.499 -9.026  -16.648 1.00 79.44  ? 452 GLN B OE1   1 
ATOM   1474 N  NE2   . GLN D 1 60 ? 28.177 -7.089  -17.557 1.00 81.81  ? 452 GLN B NE2   1 
ATOM   1475 N  N     . HIS D 1 61 ? 23.793 -9.595  -13.085 1.00 67.16  ? 453 HIS B N     1 
ATOM   1476 C  CA    . HIS D 1 61 ? 23.209 -10.305 -11.957 1.00 62.83  ? 453 HIS B CA    1 
ATOM   1477 C  C     . HIS D 1 61 ? 23.611 -11.771 -11.901 1.00 60.40  ? 453 HIS B C     1 
ATOM   1478 O  O     . HIS D 1 61 ? 23.662 -12.457 -12.923 1.00 57.90  ? 453 HIS B O     1 
ATOM   1479 C  CB    . HIS D 1 61 ? 21.685 -10.199 -12.004 1.00 56.73  ? 453 HIS B CB    1 
ATOM   1480 C  CG    . HIS D 1 61 ? 21.167 -8.822  -11.718 1.00 61.33  ? 453 HIS B CG    1 
ATOM   1481 N  ND1   . HIS D 1 61 ? 20.006 -8.335  -12.280 1.00 57.69  ? 453 HIS B ND1   1 
ATOM   1482 C  CD2   . HIS D 1 61 ? 21.650 -7.837  -10.930 1.00 63.77  ? 453 HIS B CD2   1 
ATOM   1483 C  CE1   . HIS D 1 61 ? 19.799 -7.103  -11.849 1.00 61.41  ? 453 HIS B CE1   1 
ATOM   1484 N  NE2   . HIS D 1 61 ? 20.779 -6.775  -11.030 1.00 64.81  ? 453 HIS B NE2   1 
ATOM   1485 N  N     . ASN D 1 62 ? 23.908 -12.235 -10.693 1.00 62.20  ? 454 ASN B N     1 
ATOM   1486 C  CA    . ASN D 1 62 ? 24.082 -13.654 -10.438 1.00 57.25  ? 454 ASN B CA    1 
ATOM   1487 C  C     . ASN D 1 62 ? 22.906 -14.157 -9.613  1.00 53.31  ? 454 ASN B C     1 
ATOM   1488 O  O     . ASN D 1 62 ? 22.779 -13.836 -8.432  1.00 57.03  ? 454 ASN B O     1 
ATOM   1489 C  CB    . ASN D 1 62 ? 25.405 -13.922 -9.721  1.00 63.89  ? 454 ASN B CB    1 
ATOM   1490 C  CG    . ASN D 1 62 ? 26.605 -13.460 -10.525 1.00 72.82  ? 454 ASN B CG    1 
ATOM   1491 O  OD1   . ASN D 1 62 ? 27.388 -12.625 -10.070 1.00 71.75  ? 454 ASN B OD1   1 
ATOM   1492 N  ND2   . ASN D 1 62 ? 26.756 -14.001 -11.729 1.00 66.29  ? 454 ASN B ND2   1 
ATOM   1493 N  N     . TYR D 1 63 ? 22.045 -14.946 -10.245 1.00 50.98  ? 455 TYR B N     1 
ATOM   1494 C  CA    . TYR D 1 63 ? 20.822 -15.408 -9.606  1.00 42.05  ? 455 TYR B CA    1 
ATOM   1495 C  C     . TYR D 1 63 ? 20.963 -16.842 -9.111  1.00 41.12  ? 455 TYR B C     1 
ATOM   1496 O  O     . TYR D 1 63 ? 21.631 -17.662 -9.742  1.00 33.59  ? 455 TYR B O     1 
ATOM   1497 C  CB    . TYR D 1 63 ? 19.644 -15.318 -10.573 1.00 41.34  ? 455 TYR B CB    1 
ATOM   1498 C  CG    . TYR D 1 63 ? 19.225 -13.920 -10.968 1.00 42.33  ? 455 TYR B CG    1 
ATOM   1499 C  CD1   . TYR D 1 63 ? 19.105 -12.910 -10.023 1.00 39.58  ? 455 TYR B CD1   1 
ATOM   1500 C  CD2   . TYR D 1 63 ? 18.929 -13.618 -12.292 1.00 40.19  ? 455 TYR B CD2   1 
ATOM   1501 C  CE1   . TYR D 1 63 ? 18.711 -11.635 -10.388 1.00 40.19  ? 455 TYR B CE1   1 
ATOM   1502 C  CE2   . TYR D 1 63 ? 18.537 -12.348 -12.666 1.00 41.88  ? 455 TYR B CE2   1 
ATOM   1503 C  CZ    . TYR D 1 63 ? 18.429 -11.361 -11.712 1.00 42.37  ? 455 TYR B CZ    1 
ATOM   1504 O  OH    . TYR D 1 63 ? 18.037 -10.098 -12.088 1.00 47.91  ? 455 TYR B OH    1 
ATOM   1505 N  N     . LEU D 1 64 ? 20.325 -17.139 -7.984  1.00 37.14  ? 456 LEU B N     1 
ATOM   1506 C  CA    . LEU D 1 64 ? 20.343 -18.486 -7.432  1.00 37.11  ? 456 LEU B CA    1 
ATOM   1507 C  C     . LEU D 1 64 ? 18.938 -19.079 -7.352  1.00 33.56  ? 456 LEU B C     1 
ATOM   1508 O  O     . LEU D 1 64 ? 18.034 -18.493 -6.752  1.00 30.43  ? 456 LEU B O     1 
ATOM   1509 C  CB    . LEU D 1 64 ? 20.993 -18.488 -6.046  1.00 35.34  ? 456 LEU B CB    1 
ATOM   1510 C  CG    . LEU D 1 64 ? 21.042 -19.844 -5.339  1.00 34.86  ? 456 LEU B CG    1 
ATOM   1511 C  CD1   . LEU D 1 64 ? 21.726 -20.884 -6.218  1.00 34.57  ? 456 LEU B CD1   1 
ATOM   1512 C  CD2   . LEU D 1 64 ? 21.748 -19.724 -3.998  1.00 36.50  ? 456 LEU B CD2   1 
ATOM   1513 N  N     . CYS D 1 65 ? 18.766 -20.246 -7.962  1.00 34.39  ? 457 CYS B N     1 
ATOM   1514 C  CA    . CYS D 1 65 ? 17.498 -20.966 -7.919  1.00 31.51  ? 457 CYS B CA    1 
ATOM   1515 C  C     . CYS D 1 65 ? 17.352 -21.722 -6.599  1.00 32.28  ? 457 CYS B C     1 
ATOM   1516 O  O     . CYS D 1 65 ? 18.301 -22.346 -6.129  1.00 33.47  ? 457 CYS B O     1 
ATOM   1517 C  CB    . CYS D 1 65 ? 17.399 -21.931 -9.105  1.00 27.49  ? 457 CYS B CB    1 
ATOM   1518 S  SG    . CYS D 1 65 ? 15.927 -22.992 -9.144  1.00 29.49  ? 457 CYS B SG    1 
ATOM   1519 N  N     . ALA D 1 66 ? 16.167 -21.657 -6.000  1.00 29.54  ? 458 ALA B N     1 
ATOM   1520 C  CA    . ALA D 1 66 ? 15.899 -22.374 -4.755  1.00 32.65  ? 458 ALA B CA    1 
ATOM   1521 C  C     . ALA D 1 66 ? 15.431 -23.791 -5.060  1.00 29.43  ? 458 ALA B C     1 
ATOM   1522 O  O     . ALA D 1 66 ? 15.253 -24.615 -4.163  1.00 31.10  ? 458 ALA B O     1 
ATOM   1523 C  CB    . ALA D 1 66 ? 14.863 -21.636 -3.925  1.00 26.04  ? 458 ALA B CB    1 
ATOM   1524 N  N     . GLY D 1 67 ? 15.209 -24.043 -6.344  1.00 31.99  ? 459 GLY B N     1 
ATOM   1525 C  CA    . GLY D 1 67 ? 14.796 -25.337 -6.849  1.00 31.81  ? 459 GLY B CA    1 
ATOM   1526 C  C     . GLY D 1 67 ? 15.906 -26.140 -7.506  1.00 32.04  ? 459 GLY B C     1 
ATOM   1527 O  O     . GLY D 1 67 ? 17.046 -26.165 -7.050  1.00 34.53  ? 459 GLY B O     1 
ATOM   1528 N  N     . ARG D 1 68 ? 15.517 -26.863 -8.549  1.00 31.56  ? 460 ARG B N     1 
ATOM   1529 C  CA    . ARG D 1 68 ? 16.394 -27.711 -9.354  1.00 28.41  ? 460 ARG B CA    1 
ATOM   1530 C  C     . ARG D 1 68 ? 16.885 -27.075 -10.671 1.00 29.00  ? 460 ARG B C     1 
ATOM   1531 O  O     . ARG D 1 68 ? 17.369 -27.784 -11.551 1.00 30.55  ? 460 ARG B O     1 
ATOM   1532 C  CB    . ARG D 1 68 ? 15.686 -29.038 -9.618  1.00 35.67  ? 460 ARG B CB    1 
ATOM   1533 C  CG    . ARG D 1 68 ? 15.453 -29.815 -8.324  1.00 32.61  ? 460 ARG B CG    1 
ATOM   1534 C  CD    . ARG D 1 68 ? 14.470 -30.958 -8.487  1.00 36.53  ? 460 ARG B CD    1 
ATOM   1535 N  NE    . ARG D 1 68 ? 14.336 -31.722 -7.249  1.00 32.05  ? 460 ARG B NE    1 
ATOM   1536 C  CZ    . ARG D 1 68 ? 13.579 -31.353 -6.219  1.00 34.99  ? 460 ARG B CZ    1 
ATOM   1537 N  NH1   . ARG D 1 68 ? 12.885 -30.224 -6.269  1.00 32.69  ? 460 ARG B NH1   1 
ATOM   1538 N  NH2   . ARG D 1 68 ? 13.520 -32.113 -5.134  1.00 37.89  ? 460 ARG B NH2   1 
ATOM   1539 N  N     . ASN D 1 69 ? 16.675 -25.766 -10.822 1.00 32.34  ? 461 ASN B N     1 
ATOM   1540 C  CA    . ASN D 1 69 ? 16.926 -25.012 -12.063 1.00 32.01  ? 461 ASN B CA    1 
ATOM   1541 C  C     . ASN D 1 69 ? 16.027 -25.425 -13.230 1.00 36.06  ? 461 ASN B C     1 
ATOM   1542 O  O     . ASN D 1 69 ? 16.352 -25.160 -14.386 1.00 36.08  ? 461 ASN B O     1 
ATOM   1543 C  CB    . ASN D 1 69 ? 18.386 -25.180 -12.527 1.00 29.96  ? 461 ASN B CB    1 
ATOM   1544 C  CG    . ASN D 1 69 ? 19.332 -24.144 -11.949 1.00 33.54  ? 461 ASN B CG    1 
ATOM   1545 O  OD1   . ASN D 1 69 ? 18.933 -23.041 -11.583 1.00 33.80  ? 461 ASN B OD1   1 
ATOM   1546 N  ND2   . ASN D 1 69 ? 20.610 -24.498 -11.884 1.00 32.22  ? 461 ASN B ND2   1 
ATOM   1547 N  N     . ASP D 1 70 ? 14.928 -26.112 -12.937 1.00 37.07  ? 462 ASP B N     1 
ATOM   1548 C  CA    . ASP D 1 70 ? 13.892 -26.395 -13.934 1.00 40.32  ? 462 ASP B CA    1 
ATOM   1549 C  C     . ASP D 1 70 ? 12.576 -25.622 -13.743 1.00 40.14  ? 462 ASP B C     1 
ATOM   1550 O  O     . ASP D 1 70 ? 11.564 -25.992 -14.337 1.00 45.88  ? 462 ASP B O     1 
ATOM   1551 C  CB    . ASP D 1 70 ? 13.624 -27.894 -14.022 1.00 42.25  ? 462 ASP B CB    1 
ATOM   1552 C  CG    . ASP D 1 70 ? 13.151 -28.479 -12.728 1.00 52.76  ? 462 ASP B CG    1 
ATOM   1553 O  OD1   . ASP D 1 70 ? 13.124 -27.756 -11.710 1.00 53.29  ? 462 ASP B OD1   1 
ATOM   1554 O  OD2   . ASP D 1 70 ? 12.803 -29.677 -12.738 1.00 59.61  ? 462 ASP B OD2   1 
ATOM   1555 N  N     . CYS D 1 71 ? 12.570 -24.607 -12.879 1.00 37.22  ? 463 CYS B N     1 
ATOM   1556 C  CA    . CYS D 1 71 ? 11.329 -23.977 -12.404 1.00 35.34  ? 463 CYS B CA    1 
ATOM   1557 C  C     . CYS D 1 71 ? 10.314 -23.585 -13.483 1.00 35.47  ? 463 CYS B C     1 
ATOM   1558 O  O     . CYS D 1 71 ? 10.676 -23.177 -14.588 1.00 34.37  ? 463 CYS B O     1 
ATOM   1559 C  CB    . CYS D 1 71 ? 11.659 -22.715 -11.598 1.00 31.18  ? 463 CYS B CB    1 
ATOM   1560 S  SG    . CYS D 1 71 ? 12.288 -22.993 -9.939  1.00 28.51  ? 463 CYS B SG    1 
ATOM   1561 N  N     . ILE D 1 72 ? 9.036  -23.739 -13.142 1.00 30.45  ? 464 ILE B N     1 
ATOM   1562 C  CA    . ILE D 1 72 ? 7.938  -23.293 -13.993 1.00 34.10  ? 464 ILE B CA    1 
ATOM   1563 C  C     . ILE D 1 72 ? 7.887  -21.772 -14.048 1.00 31.11  ? 464 ILE B C     1 
ATOM   1564 O  O     . ILE D 1 72 ? 7.792  -21.110 -13.015 1.00 35.57  ? 464 ILE B O     1 
ATOM   1565 C  CB    . ILE D 1 72 ? 6.574  -23.808 -13.486 1.00 33.98  ? 464 ILE B CB    1 
ATOM   1566 C  CG1   . ILE D 1 72 ? 6.554  -25.335 -13.430 1.00 34.83  ? 464 ILE B CG1   1 
ATOM   1567 C  CG2   . ILE D 1 72 ? 5.445  -23.286 -14.367 1.00 31.07  ? 464 ILE B CG2   1 
ATOM   1568 C  CD1   . ILE D 1 72 ? 6.472  -25.985 -14.785 1.00 44.68  ? 464 ILE B CD1   1 
ATOM   1569 N  N     . ILE D 1 73 ? 7.943  -21.217 -15.251 1.00 35.06  ? 465 ILE B N     1 
ATOM   1570 C  CA    . ILE D 1 73 ? 7.875  -19.772 -15.412 1.00 34.57  ? 465 ILE B CA    1 
ATOM   1571 C  C     . ILE D 1 73 ? 6.608  -19.371 -16.162 1.00 40.01  ? 465 ILE B C     1 
ATOM   1572 O  O     . ILE D 1 73 ? 6.479  -19.621 -17.359 1.00 36.39  ? 465 ILE B O     1 
ATOM   1573 C  CB    . ILE D 1 73 ? 9.111  -19.229 -16.159 1.00 32.44  ? 465 ILE B CB    1 
ATOM   1574 C  CG1   . ILE D 1 73 ? 10.393 -19.582 -15.398 1.00 35.49  ? 465 ILE B CG1   1 
ATOM   1575 C  CG2   . ILE D 1 73 ? 9.005  -17.725 -16.349 1.00 34.15  ? 465 ILE B CG2   1 
ATOM   1576 C  CD1   . ILE D 1 73 ? 10.511 -18.920 -14.037 1.00 32.06  ? 465 ILE B CD1   1 
ATOM   1577 N  N     . ASP D 1 74 ? 5.674  -18.754 -15.445 1.00 40.24  ? 466 ASP B N     1 
ATOM   1578 C  CA    . ASP D 1 74 ? 4.466  -18.213 -16.061 1.00 43.53  ? 466 ASP B CA    1 
ATOM   1579 C  C     . ASP D 1 74 ? 4.174  -16.834 -15.481 1.00 42.88  ? 466 ASP B C     1 
ATOM   1580 O  O     . ASP D 1 74 ? 4.976  -16.304 -14.713 1.00 39.73  ? 466 ASP B O     1 
ATOM   1581 C  CB    . ASP D 1 74 ? 3.268  -19.161 -15.881 1.00 38.67  ? 466 ASP B CB    1 
ATOM   1582 C  CG    . ASP D 1 74 ? 2.970  -19.489 -14.421 1.00 46.29  ? 466 ASP B CG    1 
ATOM   1583 O  OD1   . ASP D 1 74 ? 3.205  -18.643 -13.531 1.00 50.67  ? 466 ASP B OD1   1 
ATOM   1584 O  OD2   . ASP D 1 74 ? 2.486  -20.611 -14.163 1.00 51.26  ? 466 ASP B OD2   1 
ATOM   1585 N  N     . LYS D 1 75 ? 3.031  -16.265 -15.852 1.00 46.74  ? 467 LYS B N     1 
ATOM   1586 C  CA    . LYS D 1 75 ? 2.672  -14.903 -15.459 1.00 47.22  ? 467 LYS B CA    1 
ATOM   1587 C  C     . LYS D 1 75 ? 2.805  -14.665 -13.958 1.00 45.14  ? 467 LYS B C     1 
ATOM   1588 O  O     . LYS D 1 75 ? 3.349  -13.647 -13.531 1.00 50.23  ? 467 LYS B O     1 
ATOM   1589 C  CB    . LYS D 1 75 ? 1.244  -14.583 -15.909 1.00 54.04  ? 467 LYS B CB    1 
ATOM   1590 C  CG    . LYS D 1 75 ? 0.811  -13.153 -15.627 1.00 53.43  ? 467 LYS B CG    1 
ATOM   1591 C  CD    . LYS D 1 75 ? -0.554 -12.858 -16.229 1.00 59.10  ? 467 LYS B CD    1 
ATOM   1592 C  CE    . LYS D 1 75 ? -1.016 -11.451 -15.886 1.00 61.81  ? 467 LYS B CE    1 
ATOM   1593 N  NZ    . LYS D 1 75 ? -0.058 -10.417 -16.369 1.00 65.09  ? 467 LYS B NZ    1 
ATOM   1594 N  N     . ILE D 1 76 ? 2.305  -15.601 -13.159 1.00 48.05  ? 468 ILE B N     1 
ATOM   1595 C  CA    . ILE D 1 76 ? 2.407  -15.492 -11.708 1.00 45.66  ? 468 ILE B CA    1 
ATOM   1596 C  C     . ILE D 1 76 ? 3.781  -15.903 -11.172 1.00 46.79  ? 468 ILE B C     1 
ATOM   1597 O  O     . ILE D 1 76 ? 4.377  -15.192 -10.362 1.00 46.19  ? 468 ILE B O     1 
ATOM   1598 C  CB    . ILE D 1 76 ? 1.331  -16.346 -11.010 1.00 51.52  ? 468 ILE B CB    1 
ATOM   1599 C  CG1   . ILE D 1 76 ? -0.065 -15.925 -11.475 1.00 54.85  ? 468 ILE B CG1   1 
ATOM   1600 C  CG2   . ILE D 1 76 ? 1.452  -16.224 -9.497  1.00 50.82  ? 468 ILE B CG2   1 
ATOM   1601 C  CD1   . ILE D 1 76 ? -1.190 -16.656 -10.778 1.00 59.45  ? 468 ILE B CD1   1 
ATOM   1602 N  N     . ARG D 1 77 ? 4.286  -17.041 -11.639 1.00 43.72  ? 469 ARG B N     1 
ATOM   1603 C  CA    . ARG D 1 77 ? 5.471  -17.656 -11.041 1.00 38.75  ? 469 ARG B CA    1 
ATOM   1604 C  C     . ARG D 1 77 ? 6.801  -17.052 -11.489 1.00 39.73  ? 469 ARG B C     1 
ATOM   1605 O  O     . ARG D 1 77 ? 7.839  -17.338 -10.890 1.00 39.47  ? 469 ARG B O     1 
ATOM   1606 C  CB    . ARG D 1 77 ? 5.482  -19.159 -11.335 1.00 39.99  ? 469 ARG B CB    1 
ATOM   1607 C  CG    . ARG D 1 77 ? 4.399  -19.946 -10.613 1.00 36.57  ? 469 ARG B CG    1 
ATOM   1608 C  CD    . ARG D 1 77 ? 4.365  -21.392 -11.083 1.00 37.73  ? 469 ARG B CD    1 
ATOM   1609 N  NE    . ARG D 1 77 ? 3.438  -22.203 -10.298 1.00 39.48  ? 469 ARG B NE    1 
ATOM   1610 C  CZ    . ARG D 1 77 ? 2.162  -22.401 -10.615 1.00 44.91  ? 469 ARG B CZ    1 
ATOM   1611 N  NH1   . ARG D 1 77 ? 1.651  -21.844 -11.706 1.00 36.99  ? 469 ARG B NH1   1 
ATOM   1612 N  NH2   . ARG D 1 77 ? 1.393  -23.154 -9.839  1.00 40.08  ? 469 ARG B NH2   1 
ATOM   1613 N  N     . ARG D 1 78 ? 6.780  -16.222 -12.529 1.00 39.19  ? 470 ARG B N     1 
ATOM   1614 C  CA    . ARG D 1 78 ? 8.014  -15.637 -13.053 1.00 39.44  ? 470 ARG B CA    1 
ATOM   1615 C  C     . ARG D 1 78 ? 8.721  -14.770 -12.010 1.00 40.64  ? 470 ARG B C     1 
ATOM   1616 O  O     . ARG D 1 78 ? 9.941  -14.609 -12.050 1.00 43.74  ? 470 ARG B O     1 
ATOM   1617 C  CB    . ARG D 1 78 ? 7.729  -14.818 -14.314 1.00 39.48  ? 470 ARG B CB    1 
ATOM   1618 C  CG    . ARG D 1 78 ? 6.827  -13.620 -14.091 1.00 45.19  ? 470 ARG B CG    1 
ATOM   1619 C  CD    . ARG D 1 78 ? 6.390  -13.002 -15.409 1.00 43.37  ? 470 ARG B CD    1 
ATOM   1620 N  NE    . ARG D 1 78 ? 5.596  -11.795 -15.200 1.00 47.80  ? 470 ARG B NE    1 
ATOM   1621 C  CZ    . ARG D 1 78 ? 4.744  -11.295 -16.089 1.00 48.60  ? 470 ARG B CZ    1 
ATOM   1622 N  NH1   . ARG D 1 78 ? 4.566  -11.901 -17.256 1.00 41.89  ? 470 ARG B NH1   1 
ATOM   1623 N  NH2   . ARG D 1 78 ? 4.065  -10.192 -15.808 1.00 48.17  ? 470 ARG B NH2   1 
ATOM   1624 N  N     . LYS D 1 79 ? 7.949  -14.226 -11.073 1.00 38.58  ? 471 LYS B N     1 
ATOM   1625 C  CA    . LYS D 1 79 ? 8.498  -13.444 -9.970  1.00 41.59  ? 471 LYS B CA    1 
ATOM   1626 C  C     . LYS D 1 79 ? 9.360  -14.289 -9.033  1.00 41.41  ? 471 LYS B C     1 
ATOM   1627 O  O     . LYS D 1 79 ? 10.291 -13.782 -8.409  1.00 40.15  ? 471 LYS B O     1 
ATOM   1628 C  CB    . LYS D 1 79 ? 7.371  -12.795 -9.161  1.00 45.00  ? 471 LYS B CB    1 
ATOM   1629 C  CG    . LYS D 1 79 ? 6.762  -11.551 -9.779  1.00 50.30  ? 471 LYS B CG    1 
ATOM   1630 C  CD    . LYS D 1 79 ? 5.742  -10.934 -8.831  1.00 51.67  ? 471 LYS B CD    1 
ATOM   1631 C  CE    . LYS D 1 79 ? 5.238  -9.592  -9.341  1.00 61.07  ? 471 LYS B CE    1 
ATOM   1632 N  NZ    . LYS D 1 79 ? 4.451  -9.724  -10.599 1.00 53.06  ? 471 LYS B NZ    1 
ATOM   1633 N  N     . ASN D 1 80 ? 9.037  -15.573 -8.931  1.00 38.87  ? 472 ASN B N     1 
ATOM   1634 C  CA    . ASN D 1 80 ? 9.679  -16.448 -7.955  1.00 41.24  ? 472 ASN B CA    1 
ATOM   1635 C  C     . ASN D 1 80 ? 11.147 -16.729 -8.245  1.00 38.83  ? 472 ASN B C     1 
ATOM   1636 O  O     . ASN D 1 80 ? 11.982 -16.674 -7.342  1.00 40.33  ? 472 ASN B O     1 
ATOM   1637 C  CB    . ASN D 1 80 ? 8.922  -17.773 -7.862  1.00 37.48  ? 472 ASN B CB    1 
ATOM   1638 C  CG    . ASN D 1 80 ? 7.515  -17.600 -7.336  1.00 43.68  ? 472 ASN B CG    1 
ATOM   1639 O  OD1   . ASN D 1 80 ? 6.947  -16.510 -7.398  1.00 43.98  ? 472 ASN B OD1   1 
ATOM   1640 N  ND2   . ASN D 1 80 ? 6.941  -18.678 -6.814  1.00 41.01  ? 472 ASN B ND2   1 
ATOM   1641 N  N     . CYS D 1 81 ? 11.467 -17.037 -9.497  1.00 32.72  ? 473 CYS B N     1 
ATOM   1642 C  CA    . CYS D 1 81 ? 12.830 -17.434 -9.821  1.00 35.37  ? 473 CYS B CA    1 
ATOM   1643 C  C     . CYS D 1 81 ? 13.434 -16.656 -10.982 1.00 30.16  ? 473 CYS B C     1 
ATOM   1644 O  O     . CYS D 1 81 ? 13.326 -17.071 -12.138 1.00 29.37  ? 473 CYS B O     1 
ATOM   1645 C  CB    . CYS D 1 81 ? 12.882 -18.929 -10.131 1.00 31.81  ? 473 CYS B CB    1 
ATOM   1646 S  SG    . CYS D 1 81 ? 14.553 -19.600 -10.123 1.00 32.00  ? 473 CYS B SG    1 
ATOM   1647 N  N     . PRO D 1 82 ? 14.083 -15.524 -10.671 1.00 31.79  ? 474 PRO B N     1 
ATOM   1648 C  CA    . PRO D 1 82 ? 14.854 -14.755 -11.652 1.00 33.29  ? 474 PRO B CA    1 
ATOM   1649 C  C     . PRO D 1 82 ? 15.896 -15.622 -12.355 1.00 34.00  ? 474 PRO B C     1 
ATOM   1650 O  O     . PRO D 1 82 ? 16.180 -15.407 -13.531 1.00 34.07  ? 474 PRO B O     1 
ATOM   1651 C  CB    . PRO D 1 82 ? 15.526 -13.673 -10.800 1.00 32.45  ? 474 PRO B CB    1 
ATOM   1652 C  CG    . PRO D 1 82 ? 14.607 -13.494 -9.642  1.00 40.29  ? 474 PRO B CG    1 
ATOM   1653 C  CD    . PRO D 1 82 ? 14.044 -14.860 -9.355  1.00 34.89  ? 474 PRO B CD    1 
ATOM   1654 N  N     . ALA D 1 83 ? 16.445 -16.597 -11.636 1.00 32.17  ? 475 ALA B N     1 
ATOM   1655 C  CA    . ALA D 1 83 ? 17.457 -17.490 -12.192 1.00 33.58  ? 475 ALA B CA    1 
ATOM   1656 C  C     . ALA D 1 83 ? 16.928 -18.270 -13.388 1.00 32.51  ? 475 ALA B C     1 
ATOM   1657 O  O     . ALA D 1 83 ? 17.505 -18.222 -14.473 1.00 34.51  ? 475 ALA B O     1 
ATOM   1658 C  CB    . ALA D 1 83 ? 17.964 -18.448 -11.120 1.00 34.17  ? 475 ALA B CB    1 
ATOM   1659 N  N     . CYS D 1 84 ? 15.827 -18.987 -13.188 1.00 32.73  ? 476 CYS B N     1 
ATOM   1660 C  CA    . CYS D 1 84 ? 15.248 -19.790 -14.258 1.00 32.80  ? 476 CYS B CA    1 
ATOM   1661 C  C     . CYS D 1 84 ? 14.628 -18.909 -15.342 1.00 33.48  ? 476 CYS B C     1 
ATOM   1662 O  O     . CYS D 1 84 ? 14.634 -19.267 -16.519 1.00 33.13  ? 476 CYS B O     1 
ATOM   1663 C  CB    . CYS D 1 84 ? 14.213 -20.762 -13.691 1.00 32.92  ? 476 CYS B CB    1 
ATOM   1664 S  SG    . CYS D 1 84 ? 14.949 -22.108 -12.716 1.00 29.21  ? 476 CYS B SG    1 
ATOM   1665 N  N     . ARG D 1 85 ? 14.104 -17.754 -14.945 1.00 30.71  ? 477 ARG B N     1 
ATOM   1666 C  CA    . ARG D 1 85 ? 13.548 -16.807 -15.907 1.00 33.63  ? 477 ARG B CA    1 
ATOM   1667 C  C     . ARG D 1 85 ? 14.645 -16.275 -16.824 1.00 35.40  ? 477 ARG B C     1 
ATOM   1668 O  O     . ARG D 1 85 ? 14.475 -16.209 -18.042 1.00 33.13  ? 477 ARG B O     1 
ATOM   1669 C  CB    . ARG D 1 85 ? 12.852 -15.651 -15.188 1.00 31.47  ? 477 ARG B CB    1 
ATOM   1670 C  CG    . ARG D 1 85 ? 12.068 -14.728 -16.105 1.00 37.05  ? 477 ARG B CG    1 
ATOM   1671 C  CD    . ARG D 1 85 ? 11.466 -13.568 -15.324 1.00 39.46  ? 477 ARG B CD    1 
ATOM   1672 N  NE    . ARG D 1 85 ? 10.556 -12.765 -16.136 1.00 38.93  ? 477 ARG B NE    1 
ATOM   1673 C  CZ    . ARG D 1 85 ? 9.894  -11.704 -15.685 1.00 39.43  ? 477 ARG B CZ    1 
ATOM   1674 N  NH1   . ARG D 1 85 ? 10.041 -11.318 -14.426 1.00 40.30  ? 477 ARG B NH1   1 
ATOM   1675 N  NH2   . ARG D 1 85 ? 9.086  -11.030 -16.492 1.00 41.30  ? 477 ARG B NH2   1 
ATOM   1676 N  N     . TYR D 1 86 ? 15.772 -15.902 -16.225 1.00 36.11  ? 478 TYR B N     1 
ATOM   1677 C  CA    . TYR D 1 86 ? 16.919 -15.398 -16.971 1.00 37.96  ? 478 TYR B CA    1 
ATOM   1678 C  C     . TYR D 1 86 ? 17.481 -16.485 -17.879 1.00 39.18  ? 478 TYR B C     1 
ATOM   1679 O  O     . TYR D 1 86 ? 17.825 -16.227 -19.032 1.00 40.62  ? 478 TYR B O     1 
ATOM   1680 C  CB    . TYR D 1 86 ? 17.995 -14.887 -16.009 1.00 39.22  ? 478 TYR B CB    1 
ATOM   1681 C  CG    . TYR D 1 86 ? 19.179 -14.217 -16.669 1.00 44.47  ? 478 TYR B CG    1 
ATOM   1682 C  CD1   . TYR D 1 86 ? 19.006 -13.356 -17.744 1.00 41.72  ? 478 TYR B CD1   1 
ATOM   1683 C  CD2   . TYR D 1 86 ? 20.468 -14.426 -16.197 1.00 48.80  ? 478 TYR B CD2   1 
ATOM   1684 C  CE1   . TYR D 1 86 ? 20.088 -12.736 -18.344 1.00 50.20  ? 478 TYR B CE1   1 
ATOM   1685 C  CE2   . TYR D 1 86 ? 21.555 -13.809 -16.788 1.00 53.42  ? 478 TYR B CE2   1 
ATOM   1686 C  CZ    . TYR D 1 86 ? 21.359 -12.965 -17.861 1.00 51.46  ? 478 TYR B CZ    1 
ATOM   1687 O  OH    . TYR D 1 86 ? 22.438 -12.351 -18.453 1.00 54.84  ? 478 TYR B OH    1 
ATOM   1688 N  N     . ARG D 1 87 ? 17.558 -17.704 -17.353 1.00 36.11  ? 479 ARG B N     1 
ATOM   1689 C  CA    . ARG D 1 87 ? 18.041 -18.847 -18.122 1.00 37.51  ? 479 ARG B CA    1 
ATOM   1690 C  C     . ARG D 1 87 ? 17.150 -19.117 -19.335 1.00 41.57  ? 479 ARG B C     1 
ATOM   1691 O  O     . ARG D 1 87 ? 17.645 -19.415 -20.422 1.00 44.72  ? 479 ARG B O     1 
ATOM   1692 C  CB    . ARG D 1 87 ? 18.120 -20.093 -17.235 1.00 39.88  ? 479 ARG B CB    1 
ATOM   1693 C  CG    . ARG D 1 87 ? 18.492 -21.366 -17.979 1.00 42.77  ? 479 ARG B CG    1 
ATOM   1694 C  CD    . ARG D 1 87 ? 18.464 -22.586 -17.064 1.00 46.20  ? 479 ARG B CD    1 
ATOM   1695 N  NE    . ARG D 1 87 ? 17.232 -22.672 -16.280 1.00 40.08  ? 479 ARG B NE    1 
ATOM   1696 C  CZ    . ARG D 1 87 ? 16.064 -23.094 -16.757 1.00 46.31  ? 479 ARG B CZ    1 
ATOM   1697 N  NH1   . ARG D 1 87 ? 15.954 -23.468 -18.026 1.00 47.43  ? 479 ARG B NH1   1 
ATOM   1698 N  NH2   . ARG D 1 87 ? 15.001 -23.140 -15.965 1.00 45.09  ? 479 ARG B NH2   1 
ATOM   1699 N  N     . LYS D 1 88 ? 15.839 -19.005 -19.146 1.00 38.24  ? 480 LYS B N     1 
ATOM   1700 C  CA    . LYS D 1 88 ? 14.895 -19.207 -20.242 1.00 42.69  ? 480 LYS B CA    1 
ATOM   1701 C  C     . LYS D 1 88 ? 15.035 -18.122 -21.306 1.00 42.96  ? 480 LYS B C     1 
ATOM   1702 O  O     . LYS D 1 88 ? 14.859 -18.387 -22.493 1.00 44.03  ? 480 LYS B O     1 
ATOM   1703 C  CB    . LYS D 1 88 ? 13.455 -19.243 -19.724 1.00 40.54  ? 480 LYS B CB    1 
ATOM   1704 C  CG    . LYS D 1 88 ? 13.049 -20.568 -19.104 1.00 43.64  ? 480 LYS B CG    1 
ATOM   1705 C  CD    . LYS D 1 88 ? 11.573 -20.570 -18.738 1.00 46.23  ? 480 LYS B CD    1 
ATOM   1706 C  CE    . LYS D 1 88 ? 11.166 -21.873 -18.062 1.00 48.95  ? 480 LYS B CE    1 
ATOM   1707 N  NZ    . LYS D 1 88 ? 11.297 -23.049 -18.968 1.00 53.63  ? 480 LYS B NZ    1 
ATOM   1708 N  N     . CYS D 1 89 ? 15.347 -16.903 -20.873 1.00 40.88  ? 481 CYS B N     1 
ATOM   1709 C  CA    . CYS D 1 89 ? 15.583 -15.798 -21.796 1.00 41.33  ? 481 CYS B CA    1 
ATOM   1710 C  C     . CYS D 1 89 ? 16.761 -16.099 -22.713 1.00 46.00  ? 481 CYS B C     1 
ATOM   1711 O  O     . CYS D 1 89 ? 16.670 -15.939 -23.930 1.00 47.68  ? 481 CYS B O     1 
ATOM   1712 C  CB    . CYS D 1 89 ? 15.840 -14.497 -21.033 1.00 42.64  ? 481 CYS B CB    1 
ATOM   1713 S  SG    . CYS D 1 89 ? 14.386 -13.784 -20.231 1.00 43.90  ? 481 CYS B SG    1 
ATOM   1714 N  N     . LEU D 1 90 ? 17.865 -16.541 -22.117 1.00 43.17  ? 482 LEU B N     1 
ATOM   1715 C  CA    . LEU D 1 90 ? 19.080 -16.842 -22.864 1.00 46.81  ? 482 LEU B CA    1 
ATOM   1716 C  C     . LEU D 1 90 ? 18.891 -18.044 -23.783 1.00 50.28  ? 482 LEU B C     1 
ATOM   1717 O  O     . LEU D 1 90 ? 19.357 -18.045 -24.923 1.00 52.64  ? 482 LEU B O     1 
ATOM   1718 C  CB    . LEU D 1 90 ? 20.244 -17.094 -21.904 1.00 41.48  ? 482 LEU B CB    1 
ATOM   1719 C  CG    . LEU D 1 90 ? 20.657 -15.909 -21.032 1.00 42.37  ? 482 LEU B CG    1 
ATOM   1720 C  CD1   . LEU D 1 90 ? 21.692 -16.331 -20.003 1.00 45.32  ? 482 LEU B CD1   1 
ATOM   1721 C  CD2   . LEU D 1 90 ? 21.186 -14.773 -21.893 1.00 45.00  ? 482 LEU B CD2   1 
ATOM   1722 N  N     . GLN D 1 91 ? 18.204 -19.064 -23.282 1.00 47.56  ? 483 GLN B N     1 
ATOM   1723 C  CA    . GLN D 1 91 ? 17.969 -20.277 -24.055 1.00 50.68  ? 483 GLN B CA    1 
ATOM   1724 C  C     . GLN D 1 91 ? 17.005 -20.024 -25.209 1.00 51.33  ? 483 GLN B C     1 
ATOM   1725 O  O     . GLN D 1 91 ? 17.040 -20.723 -26.221 1.00 53.91  ? 483 GLN B O     1 
ATOM   1726 C  CB    . GLN D 1 91 ? 17.436 -21.391 -23.152 1.00 49.21  ? 483 GLN B CB    1 
ATOM   1727 C  CG    . GLN D 1 91 ? 18.517 -22.098 -22.350 1.00 50.38  ? 483 GLN B CG    1 
ATOM   1728 C  CD    . GLN D 1 91 ? 17.951 -22.995 -21.266 1.00 54.47  ? 483 GLN B CD    1 
ATOM   1729 O  OE1   . GLN D 1 91 ? 16.737 -23.062 -21.068 1.00 54.91  ? 483 GLN B OE1   1 
ATOM   1730 N  NE2   . GLN D 1 91 ? 18.832 -23.697 -20.561 1.00 51.20  ? 483 GLN B NE2   1 
ATOM   1731 N  N     . ALA D 1 92 ? 16.146 -19.020 -25.055 1.00 50.81  ? 484 ALA B N     1 
ATOM   1732 C  CA    . ALA D 1 92 ? 15.215 -18.650 -26.115 1.00 50.25  ? 484 ALA B CA    1 
ATOM   1733 C  C     . ALA D 1 92 ? 15.920 -17.830 -27.191 1.00 51.41  ? 484 ALA B C     1 
ATOM   1734 O  O     . ALA D 1 92 ? 15.387 -17.635 -28.281 1.00 56.66  ? 484 ALA B O     1 
ATOM   1735 C  CB    . ALA D 1 92 ? 14.035 -17.880 -25.546 1.00 47.34  ? 484 ALA B CB    1 
ATOM   1736 N  N     . GLY D 1 93 ? 17.124 -17.357 -26.880 1.00 51.65  ? 485 GLY B N     1 
ATOM   1737 C  CA    . GLY D 1 93 ? 17.931 -16.636 -27.848 1.00 55.04  ? 485 GLY B CA    1 
ATOM   1738 C  C     . GLY D 1 93 ? 18.003 -15.129 -27.675 1.00 55.95  ? 485 GLY B C     1 
ATOM   1739 O  O     . GLY D 1 93 ? 18.515 -14.432 -28.551 1.00 55.51  ? 485 GLY B O     1 
ATOM   1740 N  N     . MET D 1 94 ? 17.494 -14.619 -26.557 1.00 51.03  ? 486 MET B N     1 
ATOM   1741 C  CA    . MET D 1 94 ? 17.530 -13.182 -26.292 1.00 50.99  ? 486 MET B CA    1 
ATOM   1742 C  C     . MET D 1 94 ? 18.965 -12.667 -26.186 1.00 55.37  ? 486 MET B C     1 
ATOM   1743 O  O     . MET D 1 94 ? 19.810 -13.282 -25.535 1.00 55.17  ? 486 MET B O     1 
ATOM   1744 C  CB    . MET D 1 94 ? 16.757 -12.847 -25.012 1.00 48.23  ? 486 MET B CB    1 
ATOM   1745 C  CG    . MET D 1 94 ? 15.274 -13.172 -25.077 1.00 51.36  ? 486 MET B CG    1 
ATOM   1746 S  SD    . MET D 1 94 ? 14.329 -12.537 -23.678 1.00 50.07  ? 486 MET B SD    1 
ATOM   1747 C  CE    . MET D 1 94 ? 14.344 -10.779 -24.028 1.00 51.64  ? 486 MET B CE    1 
ATOM   1748 N  N     . ASN D 1 95 ? 19.231 -11.540 -26.840 1.00 57.00  ? 487 ASN B N     1 
ATOM   1749 C  CA    . ASN D 1 95 ? 20.556 -10.926 -26.830 1.00 60.01  ? 487 ASN B CA    1 
ATOM   1750 C  C     . ASN D 1 95 ? 20.457 -9.410  -26.994 1.00 62.91  ? 487 ASN B C     1 
ATOM   1751 O  O     . ASN D 1 95 ? 19.569 -8.918  -27.688 1.00 63.70  ? 487 ASN B O     1 
ATOM   1752 C  CB    . ASN D 1 95 ? 21.426 -11.525 -27.938 1.00 57.35  ? 487 ASN B CB    1 
ATOM   1753 C  CG    . ASN D 1 95 ? 22.877 -11.102 -27.835 1.00 69.43  ? 487 ASN B CG    1 
ATOM   1754 O  OD1   . ASN D 1 95 ? 23.240 -9.986  -28.205 1.00 73.39  ? 487 ASN B OD1   1 
ATOM   1755 N  ND2   . ASN D 1 95 ? 23.718 -11.998 -27.330 1.00 69.59  ? 487 ASN B ND2   1 
ATOM   1756 N  N     . LEU D 1 96 ? 21.370 -8.672  -26.367 1.00 64.35  ? 488 LEU B N     1 
ATOM   1757 C  CA    . LEU D 1 96 ? 21.310 -7.211  -26.399 1.00 64.53  ? 488 LEU B CA    1 
ATOM   1758 C  C     . LEU D 1 96 ? 21.537 -6.644  -27.800 1.00 73.45  ? 488 LEU B C     1 
ATOM   1759 O  O     . LEU D 1 96 ? 20.762 -5.805  -28.261 1.00 73.31  ? 488 LEU B O     1 
ATOM   1760 C  CB    . LEU D 1 96 ? 22.317 -6.607  -25.418 1.00 64.85  ? 488 LEU B CB    1 
ATOM   1761 C  CG    . LEU D 1 96 ? 21.812 -6.463  -23.979 1.00 66.33  ? 488 LEU B CG    1 
ATOM   1762 C  CD1   . LEU D 1 96 ? 22.653 -5.455  -23.209 1.00 64.43  ? 488 LEU B CD1   1 
ATOM   1763 C  CD2   . LEU D 1 96 ? 20.342 -6.064  -23.959 1.00 63.73  ? 488 LEU B CD2   1 
ATOM   1764 N  N     . GLU D 1 97 ? 22.595 -7.088  -28.474 1.00 74.89  ? 489 GLU B N     1 
ATOM   1765 C  CA    . GLU D 1 97 ? 22.780 -6.726  -29.875 1.00 79.43  ? 489 GLU B CA    1 
ATOM   1766 C  C     . GLU D 1 97 ? 22.196 -7.836  -30.741 1.00 78.84  ? 489 GLU B C     1 
ATOM   1767 O  O     . GLU D 1 97 ? 22.737 -8.941  -30.803 1.00 80.59  ? 489 GLU B O     1 
ATOM   1768 C  CB    . GLU D 1 97 ? 24.260 -6.487  -30.202 1.00 83.48  ? 489 GLU B CB    1 
ATOM   1769 C  CG    . GLU D 1 97 ? 24.615 -6.645  -31.679 1.00 88.86  ? 489 GLU B CG    1 
ATOM   1770 C  CD    . GLU D 1 97 ? 24.483 -5.349  -32.461 1.00 93.81  ? 489 GLU B CD    1 
ATOM   1771 O  OE1   . GLU D 1 97 ? 24.908 -4.294  -31.945 1.00 93.84  ? 489 GLU B OE1   1 
ATOM   1772 O  OE2   . GLU D 1 97 ? 23.949 -5.388  -33.591 1.00 93.32  ? 489 GLU B OE2   1 
ATOM   1773 N  N     . ALA D 1 98 ? 21.088 -7.529  -31.411 1.00 79.53  ? 490 ALA B N     1 
ATOM   1774 C  CA    . ALA D 1 98 ? 20.367 -8.517  -32.210 1.00 82.64  ? 490 ALA B CA    1 
ATOM   1775 C  C     . ALA D 1 98 ? 19.322 -7.852  -33.099 1.00 84.28  ? 490 ALA B C     1 
ATOM   1776 O  O     . ALA D 1 98 ? 19.655 -7.060  -33.980 1.00 81.48  ? 490 ALA B O     1 
ATOM   1777 C  CB    . ALA D 1 98 ? 19.708 -9.555  -31.307 1.00 70.22  ? 490 ALA B CB    1 
HETATM 1778 ZN ZN    . ZN  E 4 .  ? 14.318 -17.244 9.377   1.00 32.44  ? 601 ZN  A ZN    1 
HETATM 1779 ZN ZN    . ZN  F 4 .  ? 8.753  -23.564 -3.575  1.00 28.36  ? 602 ZN  A ZN    1 
HETATM 1780 ZN ZN    . ZN  G 4 .  ? 14.355 -21.862 -10.532 1.00 28.07  ? 601 ZN  B ZN    1 
HETATM 1781 ZN ZN    . ZN  H 4 .  ? 7.067  -13.009 -20.558 1.00 43.89  ? 602 ZN  B ZN    1 
HETATM 1782 O  O     . HOH I 5 .  ? 0.382  -15.995 23.945  1.00 68.47  ? 701 HOH A O     1 
HETATM 1783 O  O     . HOH I 5 .  ? 11.200 -27.296 -5.408  1.00 35.88  ? 702 HOH A O     1 
HETATM 1784 O  O     . HOH I 5 .  ? 11.255 -7.636  14.352  1.00 50.06  ? 703 HOH A O     1 
HETATM 1785 O  O     . HOH I 5 .  ? 14.190 -34.495 -10.562 1.00 56.16  ? 704 HOH A O     1 
HETATM 1786 O  O     . HOH I 5 .  ? 10.631 -10.846 5.944   1.00 35.57  ? 705 HOH A O     1 
HETATM 1787 O  O     . HOH I 5 .  ? 5.486  -18.492 -3.877  1.00 37.83  ? 706 HOH A O     1 
HETATM 1788 O  O     . HOH I 5 .  ? 2.463  -22.466 1.125   1.00 33.38  ? 707 HOH A O     1 
HETATM 1789 O  O     . HOH I 5 .  ? 7.920  -30.159 0.801   1.00 39.04  ? 708 HOH A O     1 
HETATM 1790 O  O     . HOH I 5 .  ? 8.701  -21.026 -6.324  1.00 31.79  ? 709 HOH A O     1 
HETATM 1791 O  O     . HOH I 5 .  ? 2.310  -26.547 -6.054  1.00 46.95  ? 710 HOH A O     1 
HETATM 1792 O  O     . HOH I 5 .  ? 17.414 -24.030 5.826   1.00 39.39  ? 711 HOH A O     1 
HETATM 1793 O  O     . HOH I 5 .  ? 5.368  -25.425 -0.563  1.00 36.14  ? 712 HOH A O     1 
HETATM 1794 O  O     . HOH I 5 .  ? 20.396 -19.604 6.174   1.00 40.43  ? 713 HOH A O     1 
HETATM 1795 O  O     . HOH I 5 .  ? 13.695 -9.629  15.593  1.00 48.45  ? 714 HOH A O     1 
HETATM 1796 O  O     . HOH I 5 .  ? 18.410 -24.683 -4.411  1.00 38.27  ? 715 HOH A O     1 
HETATM 1797 O  O     . HOH I 5 .  ? -0.711 -9.008  4.787   1.00 46.41  ? 716 HOH A O     1 
HETATM 1798 O  O     . HOH I 5 .  ? -3.755 -20.123 -5.396  1.00 56.27  ? 717 HOH A O     1 
HETATM 1799 O  O     . HOH I 5 .  ? 16.135 -11.608 10.094  1.00 37.81  ? 718 HOH A O     1 
HETATM 1800 O  O     . HOH I 5 .  ? 2.574  -16.718 -5.282  1.00 44.46  ? 719 HOH A O     1 
HETATM 1801 O  O     . HOH I 5 .  ? 6.457  -31.336 3.169   1.00 49.91  ? 720 HOH A O     1 
HETATM 1802 O  O     . HOH I 5 .  ? 16.904 -11.369 13.115  1.00 45.08  ? 721 HOH A O     1 
HETATM 1803 O  O     . HOH I 5 .  ? 14.743 -25.773 3.201   1.00 34.24  ? 722 HOH A O     1 
HETATM 1804 O  O     . HOH I 5 .  ? 4.276  -26.973 -9.021  1.00 50.57  ? 723 HOH A O     1 
HETATM 1805 O  O     . HOH I 5 .  ? 10.574 -28.392 4.196   1.00 46.27  ? 724 HOH A O     1 
HETATM 1806 O  O     . HOH I 5 .  ? 5.441  -9.203  13.863  1.00 43.38  ? 725 HOH A O     1 
HETATM 1807 O  O     . HOH I 5 .  ? 11.499 -26.915 2.123   1.00 37.48  ? 726 HOH A O     1 
HETATM 1808 O  O     . HOH I 5 .  ? 11.138 -23.320 18.806  1.00 46.76  ? 727 HOH A O     1 
HETATM 1809 O  O     . HOH I 5 .  ? 9.681  -26.531 9.252   1.00 40.83  ? 728 HOH A O     1 
HETATM 1810 O  O     . HOH I 5 .  ? 17.963 -24.289 15.873  1.00 58.99  ? 729 HOH A O     1 
HETATM 1811 O  O     . HOH I 5 .  ? 9.004  -27.210 -11.629 1.00 34.53  ? 730 HOH A O     1 
HETATM 1812 O  O     . HOH I 5 .  ? 22.685 -18.677 7.801   1.00 45.97  ? 731 HOH A O     1 
HETATM 1813 O  O     . HOH I 5 .  ? 11.341 -21.901 -6.911  1.00 38.09  ? 732 HOH A O     1 
HETATM 1814 O  O     . HOH J 5 .  ? 9.882  -7.213  -15.302 1.00 44.61  ? 101 HOH C O     1 
HETATM 1815 O  O     . HOH J 5 .  ? 1.964  -6.320  11.038  1.00 55.56  ? 102 HOH C O     1 
HETATM 1816 O  O     . HOH J 5 .  ? 11.465 -12.146 -11.999 1.00 41.54  ? 103 HOH C O     1 
HETATM 1817 O  O     . HOH J 5 .  ? 7.718  -10.730 26.542  1.00 66.44  ? 104 HOH C O     1 
HETATM 1818 O  O     . HOH J 5 .  ? 17.340 -7.294  -4.693  1.00 71.80  ? 105 HOH C O     1 
HETATM 1819 O  O     . HOH J 5 .  ? 6.056  -16.695 20.810  1.00 47.65  ? 106 HOH C O     1 
HETATM 1820 O  O     . HOH J 5 .  ? 5.045  -7.360  11.771  1.00 39.76  ? 107 HOH C O     1 
HETATM 1821 O  O     . HOH K 5 .  ? 10.972 1.598   12.175  1.00 59.14  ? 101 HOH D O     1 
HETATM 1822 O  O     . HOH K 5 .  ? 9.806  -14.770 1.326   1.00 31.06  ? 102 HOH D O     1 
HETATM 1823 O  O     . HOH K 5 .  ? 14.297 -5.491  1.970   1.00 43.92  ? 103 HOH D O     1 
HETATM 1824 O  O     . HOH K 5 .  ? 5.810  -5.230  4.008   1.00 43.02  ? 104 HOH D O     1 
HETATM 1825 O  O     . HOH L 5 .  ? 11.741 -30.558 -11.224 1.00 56.08  ? 701 HOH B O     1 
HETATM 1826 O  O     . HOH L 5 .  ? 13.444 -25.925 -10.145 1.00 34.44  ? 702 HOH B O     1 
HETATM 1827 O  O     . HOH L 5 .  ? 21.549 -13.024 -6.358  1.00 53.81  ? 703 HOH B O     1 
HETATM 1828 O  O     . HOH L 5 .  ? 6.674  -3.568  -24.344 1.00 54.80  ? 704 HOH B O     1 
HETATM 1829 O  O     . HOH L 5 .  ? 9.949  -27.166 -15.977 1.00 45.72  ? 705 HOH B O     1 
HETATM 1830 O  O     . HOH L 5 .  ? 8.592  -21.172 -19.983 1.00 46.98  ? 706 HOH B O     1 
HETATM 1831 O  O     . HOH L 5 .  ? 13.597 -24.165 -19.554 1.00 54.71  ? 707 HOH B O     1 
HETATM 1832 O  O     . HOH L 5 .  ? 14.551 -23.402 -22.547 1.00 54.09  ? 708 HOH B O     1 
HETATM 1833 O  O     . HOH L 5 .  ? 18.011 -21.714 -13.915 1.00 37.18  ? 709 HOH B O     1 
HETATM 1834 O  O     . HOH L 5 .  ? 12.464 -27.964 -7.660  1.00 30.18  ? 710 HOH B O     1 
HETATM 1835 O  O     . HOH L 5 .  ? 13.907 -20.739 -23.413 1.00 48.31  ? 711 HOH B O     1 
HETATM 1836 O  O     . HOH L 5 .  ? 13.983 -20.343 -7.087  1.00 29.58  ? 712 HOH B O     1 
HETATM 1837 O  O     . HOH L 5 .  ? 17.268 -30.079 -13.127 1.00 37.43  ? 713 HOH B O     1 
HETATM 1838 O  O     . HOH L 5 .  ? 1.495  -17.317 -17.946 1.00 49.68  ? 714 HOH B O     1 
HETATM 1839 O  O     . HOH L 5 .  ? 12.464 -24.476 -16.518 1.00 43.05  ? 715 HOH B O     1 
HETATM 1840 O  O     . HOH L 5 .  ? 4.748  -20.950 -19.138 1.00 47.61  ? 716 HOH B O     1 
HETATM 1841 O  O     . HOH L 5 .  ? 3.646  -17.584 -28.935 1.00 65.45  ? 717 HOH B O     1 
HETATM 1842 O  O     . HOH L 5 .  ? 20.508 -21.219 -10.053 1.00 30.80  ? 718 HOH B O     1 
HETATM 1843 O  O     . HOH L 5 .  ? 20.324 -3.423  -13.946 1.00 65.06  ? 719 HOH B O     1 
HETATM 1844 O  O     . HOH L 5 .  ? 2.164  -24.195 -7.250  1.00 46.78  ? 720 HOH B O     1 
HETATM 1845 O  O     . HOH L 5 .  ? 9.402  -24.856 -17.731 1.00 50.71  ? 721 HOH B O     1 
HETATM 1846 O  O     . HOH L 5 .  ? 19.122 -14.998 -6.448  1.00 45.88  ? 722 HOH B O     1 
HETATM 1847 O  O     . HOH L 5 .  ? 16.513 -16.772 -8.707  1.00 34.68  ? 723 HOH B O     1 
HETATM 1848 O  O     . HOH L 5 .  ? 20.400 -17.667 -14.511 1.00 43.35  ? 724 HOH B O     1 
HETATM 1849 O  O     . HOH L 5 .  ? 10.852 -15.554 -31.160 1.00 56.72  ? 725 HOH B O     1 
HETATM 1850 O  O     . HOH L 5 .  ? 13.903 -31.341 -15.019 1.00 52.24  ? 726 HOH B O     1 
HETATM 1851 O  O     . HOH L 5 .  ? 16.044 -26.921 -16.836 1.00 43.17  ? 727 HOH B O     1 
HETATM 1852 O  O     . HOH L 5 .  ? 25.508 -10.626 -30.194 1.00 73.45  ? 728 HOH B O     1 
HETATM 1853 O  O     . HOH L 5 .  ? 7.726  -22.776 -17.934 1.00 42.85  ? 729 HOH B O     1 
HETATM 1854 O  O     . HOH L 5 .  ? 22.362 -19.917 -12.009 1.00 47.91  ? 730 HOH B O     1 
HETATM 1855 O  O     . HOH L 5 .  ? 20.846 -20.922 -14.353 1.00 44.05  ? 731 HOH B O     1 
HETATM 1856 O  O     . HOH L 5 .  ? 8.784  -29.087 -13.068 1.00 55.99  ? 732 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   393 ?   ?   ?   A . n 
A 1 2   HIS 2   394 ?   ?   ?   A . n 
A 1 3   HIS 3   395 ?   ?   ?   A . n 
A 1 4   HIS 4   396 ?   ?   ?   A . n 
A 1 5   HIS 5   397 ?   ?   ?   A . n 
A 1 6   HIS 6   398 ?   ?   ?   A . n 
A 1 7   HIS 7   399 ?   ?   ?   A . n 
A 1 8   SER 8   400 ?   ?   ?   A . n 
A 1 9   SER 9   401 ?   ?   ?   A . n 
A 1 10  GLY 10  402 ?   ?   ?   A . n 
A 1 11  VAL 11  403 ?   ?   ?   A . n 
A 1 12  ASP 12  404 ?   ?   ?   A . n 
A 1 13  LEU 13  405 ?   ?   ?   A . n 
A 1 14  GLY 14  406 ?   ?   ?   A . n 
A 1 15  THR 15  407 ?   ?   ?   A . n 
A 1 16  GLU 16  408 ?   ?   ?   A . n 
A 1 17  ASN 17  409 ?   ?   ?   A . n 
A 1 18  LEU 18  410 ?   ?   ?   A . n 
A 1 19  TYR 19  411 ?   ?   ?   A . n 
A 1 20  PHE 20  412 ?   ?   ?   A . n 
A 1 21  GLN 21  413 ?   ?   ?   A . n 
A 1 22  SER 22  414 ?   ?   ?   A . n 
A 1 23  ASN 23  415 ?   ?   ?   A . n 
A 1 24  ALA 24  416 ?   ?   ?   A . n 
A 1 25  PRO 25  417 417 PRO PRO A . n 
A 1 26  PRO 26  418 418 PRO PRO A . n 
A 1 27  LYS 27  419 419 LYS LYS A . n 
A 1 28  LEU 28  420 420 LEU LEU A . n 
A 1 29  CYS 29  421 421 CYS CYS A . n 
A 1 30  LEU 30  422 422 LEU LEU A . n 
A 1 31  VAL 31  423 423 VAL VAL A . n 
A 1 32  CYS 32  424 424 CYS CYS A . n 
A 1 33  SER 33  425 425 SER SER A . n 
A 1 34  ASP 34  426 426 ASP ASP A . n 
A 1 35  GLU 35  427 427 GLU GLU A . n 
A 1 36  ALA 36  428 428 ALA ALA A . n 
A 1 37  SER 37  429 429 SER SER A . n 
A 1 38  GLY 38  430 430 GLY GLY A . n 
A 1 39  CYS 39  431 431 CYS CYS A . n 
A 1 40  HIS 40  432 432 HIS HIS A . n 
A 1 41  TYR 41  433 433 TYR TYR A . n 
A 1 42  GLY 42  434 434 GLY GLY A . n 
A 1 43  VAL 43  435 435 VAL VAL A . n 
A 1 44  LEU 44  436 436 LEU LEU A . n 
A 1 45  THR 45  437 437 THR THR A . n 
A 1 46  CYS 46  438 438 CYS CYS A . n 
A 1 47  GLY 47  439 439 GLY GLY A . n 
A 1 48  SER 48  440 440 SER SER A . n 
A 1 49  CYS 49  441 441 CYS CYS A . n 
A 1 50  LYS 50  442 442 LYS LYS A . n 
A 1 51  VAL 51  443 443 VAL VAL A . n 
A 1 52  PHE 52  444 444 PHE PHE A . n 
A 1 53  PHE 53  445 445 PHE PHE A . n 
A 1 54  LYS 54  446 446 LYS LYS A . n 
A 1 55  ARG 55  447 447 ARG ARG A . n 
A 1 56  ALA 56  448 448 ALA ALA A . n 
A 1 57  VAL 57  449 449 VAL VAL A . n 
A 1 58  GLU 58  450 450 GLU GLU A . n 
A 1 59  GLY 59  451 451 GLY GLY A . n 
A 1 60  GLN 60  452 452 GLN GLN A . n 
A 1 61  HIS 61  453 453 HIS HIS A . n 
A 1 62  ASN 62  454 454 ASN ASN A . n 
A 1 63  TYR 63  455 455 TYR TYR A . n 
A 1 64  LEU 64  456 456 LEU LEU A . n 
A 1 65  CYS 65  457 457 CYS CYS A . n 
A 1 66  ALA 66  458 458 ALA ALA A . n 
A 1 67  GLY 67  459 459 GLY GLY A . n 
A 1 68  ARG 68  460 460 ARG ARG A . n 
A 1 69  ASN 69  461 461 ASN ASN A . n 
A 1 70  ASP 70  462 462 ASP ASP A . n 
A 1 71  CYS 71  463 463 CYS CYS A . n 
A 1 72  ILE 72  464 464 ILE ILE A . n 
A 1 73  ILE 73  465 465 ILE ILE A . n 
A 1 74  ASP 74  466 466 ASP ASP A . n 
A 1 75  LYS 75  467 467 LYS LYS A . n 
A 1 76  ILE 76  468 468 ILE ILE A . n 
A 1 77  ARG 77  469 469 ARG ARG A . n 
A 1 78  ARG 78  470 470 ARG ARG A . n 
A 1 79  LYS 79  471 471 LYS LYS A . n 
A 1 80  ASN 80  472 472 ASN ASN A . n 
A 1 81  CYS 81  473 473 CYS CYS A . n 
A 1 82  PRO 82  474 474 PRO PRO A . n 
A 1 83  ALA 83  475 475 ALA ALA A . n 
A 1 84  CYS 84  476 476 CYS CYS A . n 
A 1 85  ARG 85  477 477 ARG ARG A . n 
A 1 86  TYR 86  478 478 TYR TYR A . n 
A 1 87  ARG 87  479 479 ARG ARG A . n 
A 1 88  LYS 88  480 480 LYS LYS A . n 
A 1 89  CYS 89  481 481 CYS CYS A . n 
A 1 90  LEU 90  482 482 LEU LEU A . n 
A 1 91  GLN 91  483 483 GLN GLN A . n 
A 1 92  ALA 92  484 484 ALA ALA A . n 
A 1 93  GLY 93  485 485 GLY GLY A . n 
A 1 94  MET 94  486 486 MET MET A . n 
A 1 95  ASN 95  487 487 ASN ASN A . n 
A 1 96  LEU 96  488 488 LEU LEU A . n 
A 1 97  GLU 97  489 489 GLU GLU A . n 
A 1 98  ALA 98  490 490 ALA ALA A . n 
A 1 99  ARG 99  491 ?   ?   ?   A . n 
A 1 100 LYS 100 492 ?   ?   ?   A . n 
A 1 101 THR 101 493 ?   ?   ?   A . n 
A 1 102 LYS 102 494 ?   ?   ?   A . n 
A 1 103 LYS 103 495 ?   ?   ?   A . n 
A 1 104 LYS 104 496 ?   ?   ?   A . n 
A 1 105 ILE 105 497 ?   ?   ?   A . n 
A 1 106 LYS 106 498 ?   ?   ?   A . n 
A 1 107 GLY 107 499 ?   ?   ?   A . n 
A 1 108 ILE 108 500 ?   ?   ?   A . n 
A 1 109 GLN 109 501 ?   ?   ?   A . n 
A 1 110 GLN 110 502 ?   ?   ?   A . n 
A 1 111 ALA 111 503 ?   ?   ?   A . n 
A 1 112 THR 112 504 ?   ?   ?   A . n 
A 1 113 THR 113 505 ?   ?   ?   A . n 
A 1 114 GLY 114 506 ?   ?   ?   A . n 
B 2 1   DC  1   1   1   DC  DC  C . n 
B 2 2   DG  2   2   2   DG  DG  C . n 
B 2 3   DG  3   3   3   DG  DG  C . n 
B 2 4   DC  4   4   4   DC  DC  C . n 
B 2 5   DG  5   5   5   DG  DG  C . n 
B 2 6   DG  6   6   6   DG  DG  C . n 
B 2 7   DA  7   7   7   DA  DA  C . n 
B 2 8   DA  8   8   8   DA  DA  C . n 
B 2 9   DT  9   9   9   DT  DT  C . n 
B 2 10  DT  10  10  10  DT  DT  C . n 
B 2 11  DC  11  11  11  DC  DC  C . n 
B 2 12  DC  12  12  12  DC  DC  C . n 
B 2 13  DC  13  13  13  DC  DC  C . n 
B 2 14  DC  14  14  14  DC  DC  C . n 
B 2 15  DG  15  15  15  DG  DG  C . n 
B 2 16  DG  16  16  16  DG  DG  C . n 
C 3 1   DC  1   1   1   DC  DC  D . n 
C 3 2   DC  2   2   2   DC  DC  D . n 
C 3 3   DG  3   3   3   DG  DG  D . n 
C 3 4   DG  4   4   4   DG  DG  D . n 
C 3 5   DG  5   5   5   DG  DG  D . n 
C 3 6   DG  6   6   6   DG  DG  D . n 
C 3 7   DA  7   7   7   DA  DA  D . n 
C 3 8   DA  8   8   8   DA  DA  D . n 
C 3 9   DT  9   9   9   DT  DT  D . n 
C 3 10  DT  10  10  10  DT  DT  D . n 
C 3 11  DC  11  11  11  DC  DC  D . n 
C 3 12  DC  12  12  12  DC  DC  D . n 
C 3 13  DG  13  13  13  DG  DG  D . n 
C 3 14  DC  14  14  14  DC  DC  D . n 
C 3 15  DC  15  15  15  DC  DC  D . n 
C 3 16  DG  16  16  16  DG  DG  D . n 
D 1 1   MET 1   393 ?   ?   ?   B . n 
D 1 2   HIS 2   394 ?   ?   ?   B . n 
D 1 3   HIS 3   395 ?   ?   ?   B . n 
D 1 4   HIS 4   396 ?   ?   ?   B . n 
D 1 5   HIS 5   397 ?   ?   ?   B . n 
D 1 6   HIS 6   398 ?   ?   ?   B . n 
D 1 7   HIS 7   399 ?   ?   ?   B . n 
D 1 8   SER 8   400 ?   ?   ?   B . n 
D 1 9   SER 9   401 ?   ?   ?   B . n 
D 1 10  GLY 10  402 ?   ?   ?   B . n 
D 1 11  VAL 11  403 ?   ?   ?   B . n 
D 1 12  ASP 12  404 ?   ?   ?   B . n 
D 1 13  LEU 13  405 ?   ?   ?   B . n 
D 1 14  GLY 14  406 ?   ?   ?   B . n 
D 1 15  THR 15  407 ?   ?   ?   B . n 
D 1 16  GLU 16  408 ?   ?   ?   B . n 
D 1 17  ASN 17  409 ?   ?   ?   B . n 
D 1 18  LEU 18  410 ?   ?   ?   B . n 
D 1 19  TYR 19  411 ?   ?   ?   B . n 
D 1 20  PHE 20  412 ?   ?   ?   B . n 
D 1 21  GLN 21  413 ?   ?   ?   B . n 
D 1 22  SER 22  414 ?   ?   ?   B . n 
D 1 23  ASN 23  415 ?   ?   ?   B . n 
D 1 24  ALA 24  416 ?   ?   ?   B . n 
D 1 25  PRO 25  417 ?   ?   ?   B . n 
D 1 26  PRO 26  418 418 PRO PRO B . n 
D 1 27  LYS 27  419 419 LYS LYS B . n 
D 1 28  LEU 28  420 420 LEU LEU B . n 
D 1 29  CYS 29  421 421 CYS CYS B . n 
D 1 30  LEU 30  422 422 LEU LEU B . n 
D 1 31  VAL 31  423 423 VAL VAL B . n 
D 1 32  CYS 32  424 424 CYS CYS B . n 
D 1 33  SER 33  425 425 SER SER B . n 
D 1 34  ASP 34  426 426 ASP ASP B . n 
D 1 35  GLU 35  427 427 GLU GLU B . n 
D 1 36  ALA 36  428 428 ALA ALA B . n 
D 1 37  SER 37  429 429 SER SER B . n 
D 1 38  GLY 38  430 430 GLY GLY B . n 
D 1 39  CYS 39  431 431 CYS CYS B . n 
D 1 40  HIS 40  432 432 HIS HIS B . n 
D 1 41  TYR 41  433 433 TYR TYR B . n 
D 1 42  GLY 42  434 434 GLY GLY B . n 
D 1 43  VAL 43  435 435 VAL VAL B . n 
D 1 44  LEU 44  436 436 LEU LEU B . n 
D 1 45  THR 45  437 437 THR THR B . n 
D 1 46  CYS 46  438 438 CYS CYS B . n 
D 1 47  GLY 47  439 439 GLY GLY B . n 
D 1 48  SER 48  440 440 SER SER B . n 
D 1 49  CYS 49  441 441 CYS CYS B . n 
D 1 50  LYS 50  442 442 LYS LYS B . n 
D 1 51  VAL 51  443 443 VAL VAL B . n 
D 1 52  PHE 52  444 444 PHE PHE B . n 
D 1 53  PHE 53  445 445 PHE PHE B . n 
D 1 54  LYS 54  446 446 LYS LYS B . n 
D 1 55  ARG 55  447 447 ARG ARG B . n 
D 1 56  ALA 56  448 448 ALA ALA B . n 
D 1 57  VAL 57  449 449 VAL VAL B . n 
D 1 58  GLU 58  450 450 GLU GLU B . n 
D 1 59  GLY 59  451 451 GLY GLY B . n 
D 1 60  GLN 60  452 452 GLN GLN B . n 
D 1 61  HIS 61  453 453 HIS HIS B . n 
D 1 62  ASN 62  454 454 ASN ASN B . n 
D 1 63  TYR 63  455 455 TYR TYR B . n 
D 1 64  LEU 64  456 456 LEU LEU B . n 
D 1 65  CYS 65  457 457 CYS CYS B . n 
D 1 66  ALA 66  458 458 ALA ALA B . n 
D 1 67  GLY 67  459 459 GLY GLY B . n 
D 1 68  ARG 68  460 460 ARG ARG B . n 
D 1 69  ASN 69  461 461 ASN ASN B . n 
D 1 70  ASP 70  462 462 ASP ASP B . n 
D 1 71  CYS 71  463 463 CYS CYS B . n 
D 1 72  ILE 72  464 464 ILE ILE B . n 
D 1 73  ILE 73  465 465 ILE ILE B . n 
D 1 74  ASP 74  466 466 ASP ASP B . n 
D 1 75  LYS 75  467 467 LYS LYS B . n 
D 1 76  ILE 76  468 468 ILE ILE B . n 
D 1 77  ARG 77  469 469 ARG ARG B . n 
D 1 78  ARG 78  470 470 ARG ARG B . n 
D 1 79  LYS 79  471 471 LYS LYS B . n 
D 1 80  ASN 80  472 472 ASN ASN B . n 
D 1 81  CYS 81  473 473 CYS CYS B . n 
D 1 82  PRO 82  474 474 PRO PRO B . n 
D 1 83  ALA 83  475 475 ALA ALA B . n 
D 1 84  CYS 84  476 476 CYS CYS B . n 
D 1 85  ARG 85  477 477 ARG ARG B . n 
D 1 86  TYR 86  478 478 TYR TYR B . n 
D 1 87  ARG 87  479 479 ARG ARG B . n 
D 1 88  LYS 88  480 480 LYS LYS B . n 
D 1 89  CYS 89  481 481 CYS CYS B . n 
D 1 90  LEU 90  482 482 LEU LEU B . n 
D 1 91  GLN 91  483 483 GLN GLN B . n 
D 1 92  ALA 92  484 484 ALA ALA B . n 
D 1 93  GLY 93  485 485 GLY GLY B . n 
D 1 94  MET 94  486 486 MET MET B . n 
D 1 95  ASN 95  487 487 ASN ASN B . n 
D 1 96  LEU 96  488 488 LEU LEU B . n 
D 1 97  GLU 97  489 489 GLU GLU B . n 
D 1 98  ALA 98  490 490 ALA ALA B . n 
D 1 99  ARG 99  491 ?   ?   ?   B . n 
D 1 100 LYS 100 492 ?   ?   ?   B . n 
D 1 101 THR 101 493 ?   ?   ?   B . n 
D 1 102 LYS 102 494 ?   ?   ?   B . n 
D 1 103 LYS 103 495 ?   ?   ?   B . n 
D 1 104 LYS 104 496 ?   ?   ?   B . n 
D 1 105 ILE 105 497 ?   ?   ?   B . n 
D 1 106 LYS 106 498 ?   ?   ?   B . n 
D 1 107 GLY 107 499 ?   ?   ?   B . n 
D 1 108 ILE 108 500 ?   ?   ?   B . n 
D 1 109 GLN 109 501 ?   ?   ?   B . n 
D 1 110 GLN 110 502 ?   ?   ?   B . n 
D 1 111 ALA 111 503 ?   ?   ?   B . n 
D 1 112 THR 112 504 ?   ?   ?   B . n 
D 1 113 THR 113 505 ?   ?   ?   B . n 
D 1 114 GLY 114 506 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1  601 601 ZN  ZN  A . 
F 4 ZN  1  602 602 ZN  ZN  A . 
G 4 ZN  1  601 601 ZN  ZN  B . 
H 4 ZN  1  602 602 ZN  ZN  B . 
I 5 HOH 1  701 55  HOH HOH A . 
I 5 HOH 2  702 24  HOH HOH A . 
I 5 HOH 3  703 58  HOH HOH A . 
I 5 HOH 4  704 44  HOH HOH A . 
I 5 HOH 5  705 6   HOH HOH A . 
I 5 HOH 6  706 8   HOH HOH A . 
I 5 HOH 7  707 9   HOH HOH A . 
I 5 HOH 8  708 30  HOH HOH A . 
I 5 HOH 9  709 2   HOH HOH A . 
I 5 HOH 10 710 60  HOH HOH A . 
I 5 HOH 11 711 32  HOH HOH A . 
I 5 HOH 12 712 43  HOH HOH A . 
I 5 HOH 13 713 10  HOH HOH A . 
I 5 HOH 14 714 53  HOH HOH A . 
I 5 HOH 15 715 36  HOH HOH A . 
I 5 HOH 16 716 49  HOH HOH A . 
I 5 HOH 17 717 75  HOH HOH A . 
I 5 HOH 18 718 34  HOH HOH A . 
I 5 HOH 19 719 39  HOH HOH A . 
I 5 HOH 20 720 37  HOH HOH A . 
I 5 HOH 21 721 33  HOH HOH A . 
I 5 HOH 22 722 35  HOH HOH A . 
I 5 HOH 23 723 64  HOH HOH A . 
I 5 HOH 24 724 61  HOH HOH A . 
I 5 HOH 25 725 42  HOH HOH A . 
I 5 HOH 26 726 29  HOH HOH A . 
I 5 HOH 27 727 51  HOH HOH A . 
I 5 HOH 28 728 31  HOH HOH A . 
I 5 HOH 29 729 74  HOH HOH A . 
I 5 HOH 30 730 16  HOH HOH A . 
I 5 HOH 31 731 70  HOH HOH A . 
I 5 HOH 32 732 23  HOH HOH A . 
J 5 HOH 1  101 19  HOH HOH C . 
J 5 HOH 2  102 68  HOH HOH C . 
J 5 HOH 3  103 13  HOH HOH C . 
J 5 HOH 4  104 71  HOH HOH C . 
J 5 HOH 5  105 69  HOH HOH C . 
J 5 HOH 6  106 57  HOH HOH C . 
J 5 HOH 7  107 41  HOH HOH C . 
K 5 HOH 1  101 52  HOH HOH D . 
K 5 HOH 2  102 7   HOH HOH D . 
K 5 HOH 3  103 22  HOH HOH D . 
K 5 HOH 4  104 11  HOH HOH D . 
L 5 HOH 1  701 66  HOH HOH B . 
L 5 HOH 2  702 4   HOH HOH B . 
L 5 HOH 3  703 48  HOH HOH B . 
L 5 HOH 4  704 45  HOH HOH B . 
L 5 HOH 5  705 56  HOH HOH B . 
L 5 HOH 6  706 14  HOH HOH B . 
L 5 HOH 7  707 59  HOH HOH B . 
L 5 HOH 8  708 25  HOH HOH B . 
L 5 HOH 9  709 26  HOH HOH B . 
L 5 HOH 10 710 5   HOH HOH B . 
L 5 HOH 11 711 67  HOH HOH B . 
L 5 HOH 12 712 1   HOH HOH B . 
L 5 HOH 13 713 12  HOH HOH B . 
L 5 HOH 14 714 17  HOH HOH B . 
L 5 HOH 15 715 15  HOH HOH B . 
L 5 HOH 16 716 54  HOH HOH B . 
L 5 HOH 17 717 62  HOH HOH B . 
L 5 HOH 18 718 18  HOH HOH B . 
L 5 HOH 19 719 72  HOH HOH B . 
L 5 HOH 20 720 63  HOH HOH B . 
L 5 HOH 21 721 46  HOH HOH B . 
L 5 HOH 22 722 20  HOH HOH B . 
L 5 HOH 23 723 3   HOH HOH B . 
L 5 HOH 24 724 47  HOH HOH B . 
L 5 HOH 25 725 40  HOH HOH B . 
L 5 HOH 26 726 73  HOH HOH B . 
L 5 HOH 27 727 28  HOH HOH B . 
L 5 HOH 28 728 65  HOH HOH B . 
L 5 HOH 29 729 27  HOH HOH B . 
L 5 HOH 30 730 21  HOH HOH B . 
L 5 HOH 31 731 38  HOH HOH B . 
L 5 HOH 32 732 50  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4500  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  12700 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 29 ? A CYS 421 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 32 ? A CYS 424 ? 1_555 114.6 ? 
2  SG ? A CYS 29 ? A CYS 421 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 46 ? A CYS 438 ? 1_555 117.0 ? 
3  SG ? A CYS 32 ? A CYS 424 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 46 ? A CYS 438 ? 1_555 104.4 ? 
4  SG ? A CYS 29 ? A CYS 421 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 49 ? A CYS 441 ? 1_555 110.5 ? 
5  SG ? A CYS 32 ? A CYS 424 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 49 ? A CYS 441 ? 1_555 109.3 ? 
6  SG ? A CYS 46 ? A CYS 438 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 49 ? A CYS 441 ? 1_555 100.0 ? 
7  SG ? A CYS 65 ? A CYS 457 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 71 ? A CYS 463 ? 1_555 99.0  ? 
8  SG ? A CYS 65 ? A CYS 457 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 81 ? A CYS 473 ? 1_555 107.9 ? 
9  SG ? A CYS 71 ? A CYS 463 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 81 ? A CYS 473 ? 1_555 118.7 ? 
10 SG ? A CYS 65 ? A CYS 457 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 84 ? A CYS 476 ? 1_555 110.8 ? 
11 SG ? A CYS 71 ? A CYS 463 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 84 ? A CYS 476 ? 1_555 112.4 ? 
12 SG ? A CYS 81 ? A CYS 473 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 84 ? A CYS 476 ? 1_555 107.6 ? 
13 SG ? D CYS 29 ? B CYS 421 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? D CYS 32 ? B CYS 424 ? 1_555 117.8 ? 
14 SG ? D CYS 29 ? B CYS 421 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? D CYS 46 ? B CYS 438 ? 1_555 116.1 ? 
15 SG ? D CYS 32 ? B CYS 424 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? D CYS 46 ? B CYS 438 ? 1_555 101.8 ? 
16 SG ? D CYS 29 ? B CYS 421 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? D CYS 49 ? B CYS 441 ? 1_555 109.1 ? 
17 SG ? D CYS 32 ? B CYS 424 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? D CYS 49 ? B CYS 441 ? 1_555 111.2 ? 
18 SG ? D CYS 46 ? B CYS 438 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? D CYS 49 ? B CYS 441 ? 1_555 99.3  ? 
19 SG ? D CYS 65 ? B CYS 457 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? D CYS 71 ? B CYS 463 ? 1_555 101.4 ? 
20 SG ? D CYS 65 ? B CYS 457 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? D CYS 81 ? B CYS 473 ? 1_555 107.8 ? 
21 SG ? D CYS 71 ? B CYS 463 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? D CYS 81 ? B CYS 473 ? 1_555 119.1 ? 
22 SG ? D CYS 65 ? B CYS 457 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? D CYS 84 ? B CYS 476 ? 1_555 109.6 ? 
23 SG ? D CYS 71 ? B CYS 463 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? D CYS 84 ? B CYS 476 ? 1_555 113.9 ? 
24 SG ? D CYS 81 ? B CYS 473 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? D CYS 84 ? B CYS 476 ? 1_555 104.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-02-08 
2 'Structure model' 1 1 2017-11-22 
3 'Structure model' 1 2 2018-10-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Refinement description' 
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' software        
2 3 'Structure model' citation        
3 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_software.classification'          
2  3 'Structure model' '_citation.country'                 
3  3 'Structure model' '_citation.journal_abbrev'          
4  3 'Structure model' '_citation.journal_id_CSD'          
5  3 'Structure model' '_citation.journal_id_ISSN'         
6  3 'Structure model' '_citation.journal_volume'          
7  3 'Structure model' '_citation.page_first'              
8  3 'Structure model' '_citation.page_last'               
9  3 'Structure model' '_citation.pdbx_database_id_DOI'    
10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 3 'Structure model' '_citation.title'                   
12 3 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.9_1692 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SERGUI   ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 B ASP 462 ? ? O B HOH 701 ? ? 2.05 
2 1 O   A ALA 490 ? ? O A HOH 701 ? ? 2.13 
3 1 O2  D DT  10  ? ? O D HOH 101 ? ? 2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 423 ? ? -97.57 -64.50 
2 1 SER A 425 ? ? 70.99  -1.25  
3 1 VAL B 423 ? ? -99.98 -65.90 
4 1 SER B 425 ? ? 71.19  -1.62  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 393 ? A MET 1   
2  1 Y 1 A HIS 394 ? A HIS 2   
3  1 Y 1 A HIS 395 ? A HIS 3   
4  1 Y 1 A HIS 396 ? A HIS 4   
5  1 Y 1 A HIS 397 ? A HIS 5   
6  1 Y 1 A HIS 398 ? A HIS 6   
7  1 Y 1 A HIS 399 ? A HIS 7   
8  1 Y 1 A SER 400 ? A SER 8   
9  1 Y 1 A SER 401 ? A SER 9   
10 1 Y 1 A GLY 402 ? A GLY 10  
11 1 Y 1 A VAL 403 ? A VAL 11  
12 1 Y 1 A ASP 404 ? A ASP 12  
13 1 Y 1 A LEU 405 ? A LEU 13  
14 1 Y 1 A GLY 406 ? A GLY 14  
15 1 Y 1 A THR 407 ? A THR 15  
16 1 Y 1 A GLU 408 ? A GLU 16  
17 1 Y 1 A ASN 409 ? A ASN 17  
18 1 Y 1 A LEU 410 ? A LEU 18  
19 1 Y 1 A TYR 411 ? A TYR 19  
20 1 Y 1 A PHE 412 ? A PHE 20  
21 1 Y 1 A GLN 413 ? A GLN 21  
22 1 Y 1 A SER 414 ? A SER 22  
23 1 Y 1 A ASN 415 ? A ASN 23  
24 1 Y 1 A ALA 416 ? A ALA 24  
25 1 Y 1 A ARG 491 ? A ARG 99  
26 1 Y 1 A LYS 492 ? A LYS 100 
27 1 Y 1 A THR 493 ? A THR 101 
28 1 Y 1 A LYS 494 ? A LYS 102 
29 1 Y 1 A LYS 495 ? A LYS 103 
30 1 Y 1 A LYS 496 ? A LYS 104 
31 1 Y 1 A ILE 497 ? A ILE 105 
32 1 Y 1 A LYS 498 ? A LYS 106 
33 1 Y 1 A GLY 499 ? A GLY 107 
34 1 Y 1 A ILE 500 ? A ILE 108 
35 1 Y 1 A GLN 501 ? A GLN 109 
36 1 Y 1 A GLN 502 ? A GLN 110 
37 1 Y 1 A ALA 503 ? A ALA 111 
38 1 Y 1 A THR 504 ? A THR 112 
39 1 Y 1 A THR 505 ? A THR 113 
40 1 Y 1 A GLY 506 ? A GLY 114 
41 1 Y 1 B MET 393 ? D MET 1   
42 1 Y 1 B HIS 394 ? D HIS 2   
43 1 Y 1 B HIS 395 ? D HIS 3   
44 1 Y 1 B HIS 396 ? D HIS 4   
45 1 Y 1 B HIS 397 ? D HIS 5   
46 1 Y 1 B HIS 398 ? D HIS 6   
47 1 Y 1 B HIS 399 ? D HIS 7   
48 1 Y 1 B SER 400 ? D SER 8   
49 1 Y 1 B SER 401 ? D SER 9   
50 1 Y 1 B GLY 402 ? D GLY 10  
51 1 Y 1 B VAL 403 ? D VAL 11  
52 1 Y 1 B ASP 404 ? D ASP 12  
53 1 Y 1 B LEU 405 ? D LEU 13  
54 1 Y 1 B GLY 406 ? D GLY 14  
55 1 Y 1 B THR 407 ? D THR 15  
56 1 Y 1 B GLU 408 ? D GLU 16  
57 1 Y 1 B ASN 409 ? D ASN 17  
58 1 Y 1 B LEU 410 ? D LEU 18  
59 1 Y 1 B TYR 411 ? D TYR 19  
60 1 Y 1 B PHE 412 ? D PHE 20  
61 1 Y 1 B GLN 413 ? D GLN 21  
62 1 Y 1 B SER 414 ? D SER 22  
63 1 Y 1 B ASN 415 ? D ASN 23  
64 1 Y 1 B ALA 416 ? D ALA 24  
65 1 Y 1 B PRO 417 ? D PRO 25  
66 1 Y 1 B ARG 491 ? D ARG 99  
67 1 Y 1 B LYS 492 ? D LYS 100 
68 1 Y 1 B THR 493 ? D THR 101 
69 1 Y 1 B LYS 494 ? D LYS 102 
70 1 Y 1 B LYS 495 ? D LYS 103 
71 1 Y 1 B LYS 496 ? D LYS 104 
72 1 Y 1 B ILE 497 ? D ILE 105 
73 1 Y 1 B LYS 498 ? D LYS 106 
74 1 Y 1 B GLY 499 ? D GLY 107 
75 1 Y 1 B ILE 500 ? D ILE 108 
76 1 Y 1 B GLN 501 ? D GLN 109 
77 1 Y 1 B GLN 502 ? D GLN 110 
78 1 Y 1 B ALA 503 ? D ALA 111 
79 1 Y 1 B THR 504 ? D THR 112 
80 1 Y 1 B THR 505 ? D THR 113 
81 1 Y 1 B GLY 506 ? D GLY 114 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5E6B 'double helix'        
5E6B 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 16 1_555 -0.174 -0.325 0.128  -5.632  -22.818 -0.378 1  C_DC1:DG16_D C 1  ? D 16 ? 19 1 
1 B DG 2  1_555 C DC 15 1_555 0.132  -0.138 0.062  -1.511  -5.451  2.415  2  C_DG2:DC15_D C 2  ? D 15 ? 19 1 
1 B DG 3  1_555 C DC 14 1_555 0.102  -0.133 0.373  4.701   -6.531  1.389  3  C_DG3:DC14_D C 3  ? D 14 ? 19 1 
1 B DC 4  1_555 C DG 13 1_555 0.157  -0.151 -0.030 6.416   -2.446  1.528  4  C_DC4:DG13_D C 4  ? D 13 ? 19 1 
1 B DG 5  1_555 C DC 12 1_555 -0.375 -0.098 0.320  4.396   -7.144  2.761  5  C_DG5:DC12_D C 5  ? D 12 ? 19 1 
1 B DG 6  1_555 C DC 11 1_555 -0.317 -0.310 -0.149 3.470   -8.446  4.714  6  C_DG6:DC11_D C 6  ? D 11 ? 19 1 
1 B DA 7  1_555 C DT 10 1_555 -0.172 -0.203 0.174  2.998   -18.816 -0.721 7  C_DA7:DT10_D C 7  ? D 10 ? 20 1 
1 B DA 8  1_555 C DT 9  1_555 0.157  0.021  -0.026 -4.968  -25.139 4.225  8  C_DA8:DT9_D  C 8  ? D 9  ? 20 1 
1 B DT 9  1_555 C DA 8  1_555 -0.223 -0.107 0.049  -5.228  -14.559 5.395  9  C_DT9:DA8_D  C 9  ? D 8  ? 20 1 
1 B DT 10 1_555 C DA 7  1_555 0.244  -0.127 0.046  1.348   -12.865 7.020  10 C_DT10:DA7_D C 10 ? D 7  ? 20 1 
1 B DC 11 1_555 C DG 6  1_555 0.385  -0.111 0.167  -6.593  -8.301  2.695  11 C_DC11:DG6_D C 11 ? D 6  ? 19 1 
1 B DC 12 1_555 C DG 5  1_555 0.166  -0.253 0.149  -5.842  -3.241  1.651  12 C_DC12:DG5_D C 12 ? D 5  ? 19 1 
1 B DC 13 1_555 C DG 4  1_555 -0.105 -0.058 0.279  -4.545  -12.080 1.704  13 C_DC13:DG4_D C 13 ? D 4  ? 19 1 
1 B DC 14 1_555 C DG 3  1_555 0.173  -0.066 0.569  -10.013 -13.087 1.445  14 C_DC14:DG3_D C 14 ? D 3  ? 19 1 
1 B DG 15 1_555 C DC 2  1_555 -0.261 -0.049 0.348  10.905  -9.104  6.345  15 C_DG15:DC2_D C 15 ? D 2  ? 19 1 
1 B DG 16 1_555 C DC 1  1_555 0.216  -0.287 0.322  10.462  -21.229 -6.386 16 C_DG16:DC1_D C 16 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 C DG 16 1_555 B DG 2  1_555 C DC 15 1_555 0.437  0.783  3.302 3.930  7.966  40.093 0.215  -0.178 3.416 11.450 
-5.649 41.026 1  CC_DC1DG2:DC15DG16_DD C 1  ? D 16 ? C 2  ? D 15 ? 
1 B DG 2  1_555 C DC 15 1_555 B DG 3  1_555 C DC 14 1_555 -0.336 -0.192 3.216 -3.743 5.120  32.176 -1.208 -0.040 3.167 9.126  
6.673  32.779 2  CC_DG2DG3:DC14DC15_DD C 2  ? D 15 ? C 3  ? D 14 ? 
1 B DG 3  1_555 C DC 14 1_555 B DC 4  1_555 C DG 13 1_555 0.048  -0.434 3.325 3.128  1.718  31.028 -1.137 0.513  3.286 3.197  
-5.823 31.228 3  CC_DG3DC4:DG13DC14_DD C 3  ? D 14 ? C 4  ? D 13 ? 
1 B DC 4  1_555 C DG 13 1_555 B DG 5  1_555 C DC 12 1_555 0.248  0.053  3.296 -0.785 4.305  37.840 -0.469 -0.481 3.276 6.611  
1.206  38.083 4  CC_DC4DG5:DC12DG13_DD C 4  ? D 13 ? C 5  ? D 12 ? 
1 B DG 5  1_555 C DC 12 1_555 B DG 6  1_555 C DC 11 1_555 0.469  -0.647 3.390 2.513  6.175  28.805 -2.609 -0.374 3.213 12.207 
-4.969 29.551 5  CC_DG5DG6:DC11DC12_DD C 5  ? D 12 ? C 6  ? D 11 ? 
1 B DG 6  1_555 C DC 11 1_555 B DA 7  1_555 C DT 10 1_555 -0.696 0.182  3.221 -5.146 -2.610 38.253 0.594  0.420  3.265 -3.955 
7.799  38.670 6  CC_DG6DA7:DT10DC11_DD C 6  ? D 11 ? C 7  ? D 10 ? 
1 B DA 7  1_555 C DT 10 1_555 B DA 8  1_555 C DT 9  1_555 0.083  -0.455 3.465 1.814  -0.164 39.203 -0.657 0.106  3.467 -0.245 
-2.702 39.244 7  CC_DA7DA8:DT9DT10_DD  C 7  ? D 10 ? C 8  ? D 9  ? 
1 B DA 8  1_555 C DT 9  1_555 B DT 9  1_555 C DA 8  1_555 0.475  -0.199 3.288 -1.138 -5.093 34.703 0.440  -0.960 3.267 -8.478 
1.895  35.081 8  CC_DA8DT9:DA8DT9_DD   C 8  ? D 9  ? C 9  ? D 8  ? 
1 B DT 9  1_555 C DA 8  1_555 B DT 10 1_555 C DA 7  1_555 -0.006 -0.036 3.142 0.004  3.938  34.100 -0.654 0.010  3.119 6.688  
-0.007 34.320 9  CC_DT9DT10:DA7DA8_DD  C 9  ? D 8  ? C 10 ? D 7  ? 
1 B DT 10 1_555 C DA 7  1_555 B DC 11 1_555 C DG 6  1_555 0.207  -0.411 3.348 0.835  4.304  36.865 -1.231 -0.212 3.284 6.776  
-1.314 37.116 10 CC_DT10DC11:DG6DA7_DD C 10 ? D 7  ? C 11 ? D 6  ? 
1 B DC 11 1_555 C DG 6  1_555 B DC 12 1_555 C DG 5  1_555 0.534  -0.144 3.332 3.350  3.668  32.516 -0.896 -0.356 3.333 6.503  
-5.940 32.883 11 CC_DC11DC12:DG5DG6_DD C 11 ? D 6  ? C 12 ? D 5  ? 
1 B DC 12 1_555 C DG 5  1_555 B DC 13 1_555 C DG 4  1_555 -0.729 -0.003 3.338 -1.548 2.517  33.587 -0.425 1.000  3.358 4.346  
2.673  33.713 12 CC_DC12DC13:DG4DG5_DD C 12 ? D 5  ? C 13 ? D 4  ? 
1 B DC 13 1_555 C DG 4  1_555 B DC 14 1_555 C DG 3  1_555 0.388  -0.394 3.434 -1.110 0.421  35.818 -0.703 -0.798 3.416 0.684  
1.804  35.837 13 CC_DC13DC14:DG3DG4_DD C 13 ? D 4  ? C 14 ? D 3  ? 
1 B DC 14 1_555 C DG 3  1_555 B DG 15 1_555 C DC 2  1_555 0.425  0.139  2.864 0.365  4.777  28.686 -0.646 -0.775 2.854 9.557  
-0.730 29.075 14 CC_DC14DG15:DC2DG3_DD C 14 ? D 3  ? C 15 ? D 2  ? 
1 B DG 15 1_555 C DC 2  1_555 B DG 16 1_555 C DC 1  1_555 -1.231 -0.142 3.315 -5.003 3.366  40.110 -0.593 1.198  3.416 4.875  
7.245  40.542 15 CC_DG15DG16:DC1DC2_DD C 15 ? D 2  ? C 16 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#