data_5E6C
# 
_entry.id   5E6C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.300 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5E6C         
WWPDB D_1000209306 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5E69 PDB . 
unspecified 5E6A PDB . 
unspecified 5E6B PDB . 
unspecified 5E6D PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5E6C 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hudson, W.H.'  1 
'Rye, E.A.'     2 
'Herbst, A.G.'  3 
'Ortlund, E.A.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                1337 
_citation.page_last                 1337 
_citation.title                     'Cryptic glucocorticoid receptor-binding sites pervade genomic NF-kappa B response elements.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-018-03780-1 
_citation.pdbx_database_id_PubMed   29626214 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hudson, W.H.'    1  ?                   
primary 'Vera, I.M.S.'    2  ?                   
primary 'Nwachukwu, J.C.' 3  0000-0003-4313-9187 
primary 'Weikum, E.R.'    4  ?                   
primary 'Herbst, A.G.'    5  ?                   
primary 'Yang, Q.'        6  ?                   
primary 'Bain, D.L.'      7  ?                   
primary 'Nettles, K.W.'   8  ?                   
primary 'Kojetin, D.J.'   9  0000-0001-8058-6168 
primary 'Ortlund, E.A.'   10 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5E6C 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     39.083 
_cell.length_a_esd                 ? 
_cell.length_b                     97.407 
_cell.length_b_esd                 ? 
_cell.length_c                     103.852 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5E6C 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucocorticoid receptor'                                        12759.804 2  ? ? 'unp residues 391-480' ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*TP*GP*GP*AP*AP*AP*TP*TP*CP*CP*CP*AP*CP*T)-3')
;
4882.192  1  ? ? ?                      ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*TP*GP*GP*GP*AP*AP*TP*TP*TP*CP*CP*AP*CP*T)-3')
;
4913.202  1  ? ? ?                      ? 
4 non-polymer syn 'ZINC ION'                                                       65.409    4  ? ? ?                      ? 
5 water       nat water                                                            18.015    29 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GR,Nuclear receptor subfamily 3 group C member 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MHHHHHHSSGVDLGTENLYFQSNAPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKN
CPACRYRKCLQAGMNLEARKTKKKIKGIQQATTG
;
;MHHHHHHSSGVDLGTENLYFQSNAPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKN
CPACRYRKCLQAGMNLEARKTKKKIKGIQQATTG
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DT)(DG)(DG)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DC)(DA)(DC)(DT)' AGTGGAAATTCCCACT C   ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DT)(DG)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DC)(DC)(DA)(DC)(DT)' AGTGGGAATTTCCACT D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  ASN n 
1 24  ALA n 
1 25  PRO n 
1 26  PRO n 
1 27  LYS n 
1 28  LEU n 
1 29  CYS n 
1 30  LEU n 
1 31  VAL n 
1 32  CYS n 
1 33  SER n 
1 34  ASP n 
1 35  GLU n 
1 36  ALA n 
1 37  SER n 
1 38  GLY n 
1 39  CYS n 
1 40  HIS n 
1 41  TYR n 
1 42  GLY n 
1 43  VAL n 
1 44  LEU n 
1 45  THR n 
1 46  CYS n 
1 47  GLY n 
1 48  SER n 
1 49  CYS n 
1 50  LYS n 
1 51  VAL n 
1 52  PHE n 
1 53  PHE n 
1 54  LYS n 
1 55  ARG n 
1 56  ALA n 
1 57  VAL n 
1 58  GLU n 
1 59  GLY n 
1 60  GLN n 
1 61  HIS n 
1 62  ASN n 
1 63  TYR n 
1 64  LEU n 
1 65  CYS n 
1 66  ALA n 
1 67  GLY n 
1 68  ARG n 
1 69  ASN n 
1 70  ASP n 
1 71  CYS n 
1 72  ILE n 
1 73  ILE n 
1 74  ASP n 
1 75  LYS n 
1 76  ILE n 
1 77  ARG n 
1 78  ARG n 
1 79  LYS n 
1 80  ASN n 
1 81  CYS n 
1 82  PRO n 
1 83  ALA n 
1 84  CYS n 
1 85  ARG n 
1 86  TYR n 
1 87  ARG n 
1 88  LYS n 
1 89  CYS n 
1 90  LEU n 
1 91  GLN n 
1 92  ALA n 
1 93  GLY n 
1 94  MET n 
1 95  ASN n 
1 96  LEU n 
1 97  GLU n 
1 98  ALA n 
1 99  ARG n 
1 100 LYS n 
1 101 THR n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 ILE n 
1 106 LYS n 
1 107 GLY n 
1 108 ILE n 
1 109 GLN n 
1 110 GLN n 
1 111 ALA n 
1 112 THR n 
1 113 THR n 
1 114 GLY n 
2 1   DA  n 
2 2   DG  n 
2 3   DT  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DA  n 
2 9   DT  n 
2 10  DT  n 
2 11  DC  n 
2 12  DC  n 
2 13  DC  n 
2 14  DA  n 
2 15  DC  n 
2 16  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DT  n 
3 4   DG  n 
3 5   DG  n 
3 6   DG  n 
3 7   DA  n 
3 8   DA  n 
3 9   DT  n 
3 10  DT  n 
3 11  DT  n 
3 12  DC  n 
3 13  DC  n 
3 14  DA  n 
3 15  DC  n 
3 16  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   114 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NR3C1, GRL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 16 'Homo sapiens' ? 9606 ? 
3 1 sample 1 16 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GCR_HUMAN P04150 P04150-8 1 
;PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKK
IKGIQQATTG
;
391 
2 PDB 5E6C      5E6C   ?        2 ?                                                                                             1 
3 PDB 5E6C      5E6C   ?        3 ?                                                                                             1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5E6C A 25 ? 114 ? P04150 391 ? 480 ? 417 506 
2 1 5E6C B 25 ? 114 ? P04150 391 ? 480 ? 417 506 
3 2 5E6C C 1  ? 16  ? 5E6C   1   ? 16  ? 1   16  
4 3 5E6C D 1  ? 16  ? 5E6C   1   ? 16  ? 1   16  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5E6C MET A 1  ? UNP P04150 ? ? 'initiating methionine' 393 1  
1 5E6C HIS A 2  ? UNP P04150 ? ? 'expression tag'        394 2  
1 5E6C HIS A 3  ? UNP P04150 ? ? 'expression tag'        395 3  
1 5E6C HIS A 4  ? UNP P04150 ? ? 'expression tag'        396 4  
1 5E6C HIS A 5  ? UNP P04150 ? ? 'expression tag'        397 5  
1 5E6C HIS A 6  ? UNP P04150 ? ? 'expression tag'        398 6  
1 5E6C HIS A 7  ? UNP P04150 ? ? 'expression tag'        399 7  
1 5E6C SER A 8  ? UNP P04150 ? ? 'expression tag'        400 8  
1 5E6C SER A 9  ? UNP P04150 ? ? 'expression tag'        401 9  
1 5E6C GLY A 10 ? UNP P04150 ? ? 'expression tag'        402 10 
1 5E6C VAL A 11 ? UNP P04150 ? ? 'expression tag'        403 11 
1 5E6C ASP A 12 ? UNP P04150 ? ? 'expression tag'        404 12 
1 5E6C LEU A 13 ? UNP P04150 ? ? 'expression tag'        405 13 
1 5E6C GLY A 14 ? UNP P04150 ? ? 'expression tag'        406 14 
1 5E6C THR A 15 ? UNP P04150 ? ? 'expression tag'        407 15 
1 5E6C GLU A 16 ? UNP P04150 ? ? 'expression tag'        408 16 
1 5E6C ASN A 17 ? UNP P04150 ? ? 'expression tag'        409 17 
1 5E6C LEU A 18 ? UNP P04150 ? ? 'expression tag'        410 18 
1 5E6C TYR A 19 ? UNP P04150 ? ? 'expression tag'        411 19 
1 5E6C PHE A 20 ? UNP P04150 ? ? 'expression tag'        412 20 
1 5E6C GLN A 21 ? UNP P04150 ? ? 'expression tag'        413 21 
1 5E6C SER A 22 ? UNP P04150 ? ? 'expression tag'        414 22 
1 5E6C ASN A 23 ? UNP P04150 ? ? 'expression tag'        415 23 
1 5E6C ALA A 24 ? UNP P04150 ? ? 'expression tag'        416 24 
2 5E6C MET B 1  ? UNP P04150 ? ? 'initiating methionine' 393 25 
2 5E6C HIS B 2  ? UNP P04150 ? ? 'expression tag'        394 26 
2 5E6C HIS B 3  ? UNP P04150 ? ? 'expression tag'        395 27 
2 5E6C HIS B 4  ? UNP P04150 ? ? 'expression tag'        396 28 
2 5E6C HIS B 5  ? UNP P04150 ? ? 'expression tag'        397 29 
2 5E6C HIS B 6  ? UNP P04150 ? ? 'expression tag'        398 30 
2 5E6C HIS B 7  ? UNP P04150 ? ? 'expression tag'        399 31 
2 5E6C SER B 8  ? UNP P04150 ? ? 'expression tag'        400 32 
2 5E6C SER B 9  ? UNP P04150 ? ? 'expression tag'        401 33 
2 5E6C GLY B 10 ? UNP P04150 ? ? 'expression tag'        402 34 
2 5E6C VAL B 11 ? UNP P04150 ? ? 'expression tag'        403 35 
2 5E6C ASP B 12 ? UNP P04150 ? ? 'expression tag'        404 36 
2 5E6C LEU B 13 ? UNP P04150 ? ? 'expression tag'        405 37 
2 5E6C GLY B 14 ? UNP P04150 ? ? 'expression tag'        406 38 
2 5E6C THR B 15 ? UNP P04150 ? ? 'expression tag'        407 39 
2 5E6C GLU B 16 ? UNP P04150 ? ? 'expression tag'        408 40 
2 5E6C ASN B 17 ? UNP P04150 ? ? 'expression tag'        409 41 
2 5E6C LEU B 18 ? UNP P04150 ? ? 'expression tag'        410 42 
2 5E6C TYR B 19 ? UNP P04150 ? ? 'expression tag'        411 43 
2 5E6C PHE B 20 ? UNP P04150 ? ? 'expression tag'        412 44 
2 5E6C GLN B 21 ? UNP P04150 ? ? 'expression tag'        413 45 
2 5E6C SER B 22 ? UNP P04150 ? ? 'expression tag'        414 46 
2 5E6C ASN B 23 ? UNP P04150 ? ? 'expression tag'        415 47 
2 5E6C ALA B 24 ? UNP P04150 ? ? 'expression tag'        416 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5E6C 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.05 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M sodium malonate, 6% glycerol, 5% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-02 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5E6C 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.20 
_reflns.d_resolution_low                 48.7 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       20451 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.20 
_reflns_shell.d_res_low                   2.28 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        87.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5E6C 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.20 
_refine.ls_d_res_low                             35.523 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20451 
_refine.ls_number_reflns_R_free                  1998 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.59 
_refine.ls_percent_reflns_R_free                 9.77 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2370 
_refine.ls_R_factor_R_free                       0.2706 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2334 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.36 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1158 
_refine_hist.pdbx_number_atoms_nucleic_acid   650 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             29 
_refine_hist.number_atoms_total               1841 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        35.523 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  ? 1901 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.178  ? 2682 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 23.853 ? 765  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.050  ? 293  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 233  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1966 2.2515  . . 111 1043 80.00  . . . 0.3377 . 0.3233 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2515 2.3124  . . 146 1220 91.00  . . . 0.3567 . 0.2929 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3124 2.3804  . . 132 1287 98.00  . . . 0.3083 . 0.2928 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3804 2.4572  . . 142 1338 100.00 . . . 0.2698 . 0.2607 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4572 2.5450  . . 140 1321 100.00 . . . 0.2558 . 0.2584 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5450 2.6469  . . 135 1329 100.00 . . . 0.2890 . 0.2647 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6469 2.7673  . . 150 1340 100.00 . . . 0.2631 . 0.2453 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7673 2.9132  . . 146 1331 100.00 . . . 0.3187 . 0.2713 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9132 3.0956  . . 153 1325 100.00 . . . 0.3013 . 0.2703 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0956 3.3344  . . 136 1338 98.00  . . . 0.3258 . 0.2484 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3344 3.6697  . . 148 1350 100.00 . . . 0.2623 . 0.2308 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6697 4.2000  . . 145 1380 100.00 . . . 0.2678 . 0.2380 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2000 5.2887  . . 153 1384 100.00 . . . 0.2512 . 0.2060 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.2887 35.5278 . . 161 1467 100.00 . . . 0.2294 . 0.1933 . . . . . . . . . . 
# 
_struct.entry_id                     5E6C 
_struct.title                        'Glucocorticoid receptor DNA binding domain - CCL2 NF-kB response element complex' 
_struct.pdbx_descriptor              'Glucocorticoid receptor DNA binding domain/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5E6C 
_struct_keywords.text            'DNA binding protein, dna binding protein-dna complex' 
_struct_keywords.pdbx_keywords   'dna binding protein/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 CYS A 46 ? GLY A 59 ? CYS A 438 GLY A 451 1 ? 14 
HELX_P HELX_P2 AA2 CYS A 81 ? GLY A 93 ? CYS A 473 GLY A 485 1 ? 13 
HELX_P HELX_P3 AA3 CYS B 46 ? GLY B 59 ? CYS B 438 GLY B 451 1 ? 14 
HELX_P HELX_P4 AA4 CYS B 81 ? ALA B 92 ? CYS B 473 ALA B 484 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 29 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 421 A ZN 601 1_555 ? ? ? ? ? ? ?               2.053 ? 
metalc2  metalc ? ? A CYS 32 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 424 A ZN 601 1_555 ? ? ? ? ? ? ?               2.295 ? 
metalc3  metalc ? ? A CYS 46 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 438 A ZN 601 1_555 ? ? ? ? ? ? ?               2.327 ? 
metalc4  metalc ? ? A CYS 49 SG ? ? ? 1_555 E ZN .  ZN ? ? A CYS 441 A ZN 601 1_555 ? ? ? ? ? ? ?               2.217 ? 
metalc5  metalc ? ? A CYS 65 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 457 A ZN 602 1_555 ? ? ? ? ? ? ?               2.317 ? 
metalc6  metalc ? ? A CYS 71 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 463 A ZN 602 1_555 ? ? ? ? ? ? ?               2.369 ? 
metalc7  metalc ? ? A CYS 81 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 473 A ZN 602 1_555 ? ? ? ? ? ? ?               2.307 ? 
metalc8  metalc ? ? A CYS 84 SG ? ? ? 1_555 F ZN .  ZN ? ? A CYS 476 A ZN 602 1_555 ? ? ? ? ? ? ?               2.176 ? 
metalc9  metalc ? ? B CYS 29 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 421 B ZN 602 1_555 ? ? ? ? ? ? ?               2.301 ? 
metalc10 metalc ? ? B CYS 32 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 424 B ZN 602 1_555 ? ? ? ? ? ? ?               2.237 ? 
metalc11 metalc ? ? B CYS 46 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 438 B ZN 602 1_555 ? ? ? ? ? ? ?               2.291 ? 
metalc12 metalc ? ? B CYS 49 SG ? ? ? 1_555 H ZN .  ZN ? ? B CYS 441 B ZN 602 1_555 ? ? ? ? ? ? ?               2.255 ? 
metalc13 metalc ? ? B CYS 65 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 457 B ZN 601 1_555 ? ? ? ? ? ? ?               2.291 ? 
metalc14 metalc ? ? B CYS 71 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 463 B ZN 601 1_555 ? ? ? ? ? ? ?               2.343 ? 
metalc15 metalc ? ? B CYS 81 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 473 B ZN 601 1_555 ? ? ? ? ? ? ?               2.311 ? 
metalc16 metalc ? ? B CYS 84 SG ? ? ? 1_555 G ZN .  ZN ? ? B CYS 476 B ZN 601 1_555 ? ? ? ? ? ? ?               2.328 ? 
hydrog1  hydrog ? ? C DG  2  N1 ? ? ? 1_555 D DC 15 N3 ? ? C DG  2   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? C DG  2  N2 ? ? ? 1_555 D DC 15 O2 ? ? C DG  2   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? C DG  2  O6 ? ? ? 1_555 D DC 15 N4 ? ? C DG  2   D DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? C DT  3  N3 ? ? ? 1_555 D DA 14 N1 ? ? C DT  3   D DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? C DT  3  O4 ? ? ? 1_555 D DA 14 N6 ? ? C DT  3   D DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? C DG  4  N1 ? ? ? 1_555 D DC 13 N3 ? ? C DG  4   D DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? C DG  4  N2 ? ? ? 1_555 D DC 13 O2 ? ? C DG  4   D DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? C DG  4  O6 ? ? ? 1_555 D DC 13 N4 ? ? C DG  4   D DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? C DG  5  N1 ? ? ? 1_555 D DC 12 N3 ? ? C DG  5   D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? C DG  5  N2 ? ? ? 1_555 D DC 12 O2 ? ? C DG  5   D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? C DG  5  O6 ? ? ? 1_555 D DC 12 N4 ? ? C DG  5   D DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? C DA  6  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA  6   D DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? C DA  6  N6 ? ? ? 1_555 D DT 11 O4 ? ? C DA  6   D DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? C DA  7  N1 ? ? ? 1_555 D DT 10 N3 ? ? C DA  7   D DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? C DA  7  N6 ? ? ? 1_555 D DT 10 O4 ? ? C DA  7   D DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? C DA  8  N1 ? ? ? 1_555 D DT 9  N3 ? ? C DA  8   D DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? C DA  8  N6 ? ? ? 1_555 D DT 9  O4 ? ? C DA  8   D DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? C DT  9  N3 ? ? ? 1_555 D DA 8  N1 ? ? C DT  9   D DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? C DT  9  O4 ? ? ? 1_555 D DA 8  N6 ? ? C DT  9   D DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? C DT  10 N3 ? ? ? 1_555 D DA 7  N1 ? ? C DT  10  D DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? C DT  10 O4 ? ? ? 1_555 D DA 7  N6 ? ? C DT  10  D DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? C DC  11 O2 ? ? ? 1_555 D DG 6  N2 ? ? C DC  11  D DG 6   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog23 hydrog ? ? C DC  12 N3 ? ? ? 1_555 D DG 5  N1 ? ? C DC  12  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? C DC  12 N4 ? ? ? 1_555 D DG 5  O6 ? ? C DC  12  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? C DC  12 O2 ? ? ? 1_555 D DG 5  N2 ? ? C DC  12  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? C DC  13 O2 ? ? ? 1_555 D DG 4  N2 ? ? C DC  13  D DG 4   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog27 hydrog ? ? C DA  14 N1 ? ? ? 1_555 D DT 3  N3 ? ? C DA  14  D DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? C DA  14 N6 ? ? ? 1_555 D DT 3  O4 ? ? C DA  14  D DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? C DT  16 N3 ? ? ? 1_555 D DA 1  N1 ? ? C DT  16  D DA 1   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog30 hydrog ? ? C DT  16 O2 ? ? ? 1_555 D DG 2  N2 ? ? C DT  16  D DG 2   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          THR 
_struct_mon_prot_cis.label_seq_id           101 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           THR 
_struct_mon_prot_cis.auth_seq_id            493 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    102 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     494 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.59 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 38 ? HIS A 40 ? GLY A 430 HIS A 432 
AA1 2 VAL A 43 ? THR A 45 ? VAL A 435 THR A 437 
AA2 1 GLY B 38 ? HIS B 40 ? GLY B 430 HIS B 432 
AA2 2 VAL B 43 ? THR B 45 ? VAL B 435 THR B 437 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 40 ? N HIS A 432 O VAL A 43 ? O VAL A 435 
AA2 1 2 N GLY B 38 ? N GLY B 430 O THR B 45 ? O THR B 437 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 601 ? 4 'binding site for residue ZN A 601' 
AC2 Software A ZN 602 ? 4 'binding site for residue ZN A 602' 
AC3 Software B ZN 601 ? 4 'binding site for residue ZN B 601' 
AC4 Software B ZN 602 ? 4 'binding site for residue ZN B 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 29 ? CYS A 421 . ? 1_555 ? 
2  AC1 4 CYS A 32 ? CYS A 424 . ? 1_555 ? 
3  AC1 4 CYS A 46 ? CYS A 438 . ? 1_555 ? 
4  AC1 4 CYS A 49 ? CYS A 441 . ? 1_555 ? 
5  AC2 4 CYS A 65 ? CYS A 457 . ? 1_555 ? 
6  AC2 4 CYS A 71 ? CYS A 463 . ? 1_555 ? 
7  AC2 4 CYS A 81 ? CYS A 473 . ? 1_555 ? 
8  AC2 4 CYS A 84 ? CYS A 476 . ? 1_555 ? 
9  AC3 4 CYS B 65 ? CYS B 457 . ? 1_555 ? 
10 AC3 4 CYS B 71 ? CYS B 463 . ? 1_555 ? 
11 AC3 4 CYS B 81 ? CYS B 473 . ? 1_555 ? 
12 AC3 4 CYS B 84 ? CYS B 476 . ? 1_555 ? 
13 AC4 4 CYS B 29 ? CYS B 421 . ? 1_555 ? 
14 AC4 4 CYS B 32 ? CYS B 424 . ? 1_555 ? 
15 AC4 4 CYS B 46 ? CYS B 438 . ? 1_555 ? 
16 AC4 4 CYS B 49 ? CYS B 441 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5E6C 
_atom_sites.fract_transf_matrix[1][1]   0.025587 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010266 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009629 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 26  ? -25.443 17.886  18.954  1.00 85.84  ? 418 PRO A N     1 
ATOM   2    C  CA    . PRO A 1 26  ? -25.088 18.240  17.570  1.00 84.51  ? 418 PRO A CA    1 
ATOM   3    C  C     . PRO A 1 26  ? -23.642 18.791  17.448  1.00 83.90  ? 418 PRO A C     1 
ATOM   4    O  O     . PRO A 1 26  ? -23.414 19.996  17.639  1.00 84.14  ? 418 PRO A O     1 
ATOM   5    C  CB    . PRO A 1 26  ? -26.142 19.315  17.200  1.00 85.69  ? 418 PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 26  ? -26.611 19.887  18.525  1.00 83.15  ? 418 PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 26  ? -26.505 18.754  19.504  1.00 83.69  ? 418 PRO A CD    1 
ATOM   8    N  N     . LYS A 1 27  ? -22.672 17.902  17.204  1.00 77.72  ? 419 LYS A N     1 
ATOM   9    C  CA    . LYS A 1 27  ? -21.245 18.285  17.106  1.00 76.62  ? 419 LYS A CA    1 
ATOM   10   C  C     . LYS A 1 27  ? -20.634 17.848  15.750  1.00 70.21  ? 419 LYS A C     1 
ATOM   11   O  O     . LYS A 1 27  ? -20.598 16.656  15.422  1.00 67.32  ? 419 LYS A O     1 
ATOM   12   C  CB    . LYS A 1 27  ? -20.412 17.693  18.264  1.00 76.36  ? 419 LYS A CB    1 
ATOM   13   C  CG    . LYS A 1 27  ? -21.139 17.138  19.499  1.00 77.60  ? 419 LYS A CG    1 
ATOM   14   C  CD    . LYS A 1 27  ? -22.086 18.126  20.178  1.00 83.12  ? 419 LYS A CD    1 
ATOM   15   C  CE    . LYS A 1 27  ? -22.561 17.571  21.522  1.00 84.15  ? 419 LYS A CE    1 
ATOM   16   N  NZ    . LYS A 1 27  ? -23.464 18.477  22.312  1.00 82.88  ? 419 LYS A NZ    1 
ATOM   17   N  N     . LEU A 1 28  ? -20.143 18.809  14.968  1.00 68.66  ? 420 LEU A N     1 
ATOM   18   C  CA    . LEU A 1 28  ? -19.709 18.534  13.585  1.00 64.75  ? 420 LEU A CA    1 
ATOM   19   C  C     . LEU A 1 28  ? -18.224 18.788  13.262  1.00 59.28  ? 420 LEU A C     1 
ATOM   20   O  O     . LEU A 1 28  ? -17.592 19.696  13.826  1.00 49.15  ? 420 LEU A O     1 
ATOM   21   C  CB    . LEU A 1 28  ? -20.555 19.362  12.623  1.00 63.15  ? 420 LEU A CB    1 
ATOM   22   C  CG    . LEU A 1 28  ? -22.061 19.139  12.768  1.00 65.61  ? 420 LEU A CG    1 
ATOM   23   C  CD1   . LEU A 1 28  ? -22.853 20.236  12.064  1.00 55.68  ? 420 LEU A CD1   1 
ATOM   24   C  CD2   . LEU A 1 28  ? -22.447 17.756  12.232  1.00 63.21  ? 420 LEU A CD2   1 
ATOM   25   N  N     . CYS A 1 29  ? -17.689 17.992  12.330  1.00 55.73  ? 421 CYS A N     1 
ATOM   26   C  CA    . CYS A 1 29  ? -16.289 18.115  11.892  1.00 53.82  ? 421 CYS A CA    1 
ATOM   27   C  C     . CYS A 1 29  ? -15.993 19.535  11.441  1.00 49.61  ? 421 CYS A C     1 
ATOM   28   O  O     . CYS A 1 29  ? -16.612 20.012  10.490  1.00 55.99  ? 421 CYS A O     1 
ATOM   29   C  CB    . CYS A 1 29  ? -15.986 17.127  10.758  1.00 54.28  ? 421 CYS A CB    1 
ATOM   30   S  SG    . CYS A 1 29  ? -14.344 17.293  9.978   1.00 39.36  ? 421 CYS A SG    1 
ATOM   31   N  N     . LEU A 1 30  ? -15.087 20.223  12.140  1.00 51.10  ? 422 LEU A N     1 
ATOM   32   C  CA    . LEU A 1 30  ? -14.728 21.614  11.819  1.00 42.37  ? 422 LEU A CA    1 
ATOM   33   C  C     . LEU A 1 30  ? -14.043 21.753  10.466  1.00 46.62  ? 422 LEU A C     1 
ATOM   34   O  O     . LEU A 1 30  ? -13.706 22.865  10.042  1.00 51.70  ? 422 LEU A O     1 
ATOM   35   C  CB    . LEU A 1 30  ? -13.801 22.209  12.878  1.00 47.20  ? 422 LEU A CB    1 
ATOM   36   C  CG    . LEU A 1 30  ? -14.399 22.872  14.120  1.00 56.90  ? 422 LEU A CG    1 
ATOM   37   C  CD1   . LEU A 1 30  ? -13.348 23.711  14.861  1.00 53.44  ? 422 LEU A CD1   1 
ATOM   38   C  CD2   . LEU A 1 30  ? -15.588 23.745  13.735  1.00 52.79  ? 422 LEU A CD2   1 
ATOM   39   N  N     . VAL A 1 31  ? -13.812 20.628  9.797   1.00 46.46  ? 423 VAL A N     1 
ATOM   40   C  CA    . VAL A 1 31  ? -13.196 20.665  8.493   1.00 48.95  ? 423 VAL A CA    1 
ATOM   41   C  C     . VAL A 1 31  ? -14.245 20.335  7.427   1.00 48.09  ? 423 VAL A C     1 
ATOM   42   O  O     . VAL A 1 31  ? -14.397 21.077  6.464   1.00 44.05  ? 423 VAL A O     1 
ATOM   43   C  CB    . VAL A 1 31  ? -11.980 19.705  8.410   1.00 42.37  ? 423 VAL A CB    1 
ATOM   44   C  CG1   . VAL A 1 31  ? -11.324 19.749  7.023   1.00 40.10  ? 423 VAL A CG1   1 
ATOM   45   C  CG2   . VAL A 1 31  ? -10.982 20.060  9.463   1.00 45.02  ? 423 VAL A CG2   1 
ATOM   46   N  N     . CYS A 1 32  ? -14.993 19.250  7.595   1.00 53.71  ? 424 CYS A N     1 
ATOM   47   C  CA    . CYS A 1 32  ? -15.918 18.864  6.525   1.00 50.17  ? 424 CYS A CA    1 
ATOM   48   C  C     . CYS A 1 32  ? -17.395 18.808  6.926   1.00 54.83  ? 424 CYS A C     1 
ATOM   49   O  O     . CYS A 1 32  ? -18.229 18.400  6.118   1.00 57.52  ? 424 CYS A O     1 
ATOM   50   C  CB    . CYS A 1 32  ? -15.510 17.513  5.957   1.00 49.69  ? 424 CYS A CB    1 
ATOM   51   S  SG    . CYS A 1 32  ? -15.920 16.088  7.001   1.00 55.42  ? 424 CYS A SG    1 
ATOM   52   N  N     . SER A 1 33  ? -17.707 19.211  8.160   1.00 58.91  ? 425 SER A N     1 
ATOM   53   C  CA    . SER A 1 33  ? -19.081 19.238  8.687   1.00 57.28  ? 425 SER A CA    1 
ATOM   54   C  C     . SER A 1 33  ? -19.761 17.866  8.770   1.00 56.24  ? 425 SER A C     1 
ATOM   55   O  O     . SER A 1 33  ? -20.951 17.787  9.054   1.00 61.56  ? 425 SER A O     1 
ATOM   56   C  CB    . SER A 1 33  ? -19.956 20.172  7.847   1.00 60.79  ? 425 SER A CB    1 
ATOM   57   O  OG    . SER A 1 33  ? -19.377 21.460  7.737   1.00 60.50  ? 425 SER A OG    1 
ATOM   58   N  N     . ASP A 1 34  ? -19.021 16.789  8.525   1.00 56.95  ? 426 ASP A N     1 
ATOM   59   C  CA    . ASP A 1 34  ? -19.515 15.435  8.812   1.00 59.52  ? 426 ASP A CA    1 
ATOM   60   C  C     . ASP A 1 34  ? -19.776 15.355  10.312  1.00 59.73  ? 426 ASP A C     1 
ATOM   61   O  O     . ASP A 1 34  ? -19.602 16.344  11.048  1.00 57.95  ? 426 ASP A O     1 
ATOM   62   C  CB    . ASP A 1 34  ? -18.506 14.353  8.377   1.00 54.42  ? 426 ASP A CB    1 
ATOM   63   C  CG    . ASP A 1 34  ? -19.150 12.979  8.188   1.00 64.77  ? 426 ASP A CG    1 
ATOM   64   O  OD1   . ASP A 1 34  ? -20.367 12.859  8.465   1.00 72.21  ? 426 ASP A OD1   1 
ATOM   65   O  OD2   . ASP A 1 34  ? -18.444 12.020  7.777   1.00 60.40  ? 426 ASP A OD2   1 
ATOM   66   N  N     . GLU A 1 35  ? -20.206 14.200  10.795  1.00 59.85  ? 427 GLU A N     1 
ATOM   67   C  CA    . GLU A 1 35  ? -20.448 14.130  12.226  1.00 65.21  ? 427 GLU A CA    1 
ATOM   68   C  C     . GLU A 1 35  ? -19.096 13.954  12.912  1.00 58.36  ? 427 GLU A C     1 
ATOM   69   O  O     . GLU A 1 35  ? -18.324 13.053  12.568  1.00 55.70  ? 427 GLU A O     1 
ATOM   70   C  CB    . GLU A 1 35  ? -21.435 13.008  12.584  1.00 70.34  ? 427 GLU A CB    1 
ATOM   71   C  CG    . GLU A 1 35  ? -20.996 11.598  12.199  1.00 71.57  ? 427 GLU A CG    1 
ATOM   72   C  CD    . GLU A 1 35  ? -22.039 10.547  12.551  1.00 81.15  ? 427 GLU A CD    1 
ATOM   73   O  OE1   . GLU A 1 35  ? -22.952 10.861  13.347  1.00 85.61  ? 427 GLU A OE1   1 
ATOM   74   O  OE2   . GLU A 1 35  ? -21.933 9.404   12.051  1.00 85.93  ? 427 GLU A OE2   1 
ATOM   75   N  N     . ALA A 1 36  ? -18.797 14.851  13.844  1.00 55.08  ? 428 ALA A N     1 
ATOM   76   C  CA    . ALA A 1 36  ? -17.542 14.784  14.588  1.00 58.34  ? 428 ALA A CA    1 
ATOM   77   C  C     . ALA A 1 36  ? -17.505 13.555  15.506  1.00 64.54  ? 428 ALA A C     1 
ATOM   78   O  O     . ALA A 1 36  ? -18.547 13.084  15.967  1.00 66.29  ? 428 ALA A O     1 
ATOM   79   C  CB    . ALA A 1 36  ? -17.349 16.038  15.378  1.00 57.04  ? 428 ALA A CB    1 
ATOM   80   N  N     . SER A 1 37  ? -16.308 13.027  15.753  1.00 63.77  ? 429 SER A N     1 
ATOM   81   C  CA    . SER A 1 37  ? -16.151 11.865  16.614  1.00 60.89  ? 429 SER A CA    1 
ATOM   82   C  C     . SER A 1 37  ? -15.328 12.205  17.858  1.00 64.33  ? 429 SER A C     1 
ATOM   83   O  O     . SER A 1 37  ? -15.195 11.383  18.765  1.00 73.02  ? 429 SER A O     1 
ATOM   84   C  CB    . SER A 1 37  ? -15.507 10.707  15.846  1.00 59.51  ? 429 SER A CB    1 
ATOM   85   O  OG    . SER A 1 37  ? -14.143 10.966  15.572  1.00 63.11  ? 429 SER A OG    1 
ATOM   86   N  N     . GLY A 1 38  ? -14.789 13.419  17.907  1.00 59.53  ? 430 GLY A N     1 
ATOM   87   C  CA    . GLY A 1 38  ? -14.068 13.881  19.079  1.00 54.61  ? 430 GLY A CA    1 
ATOM   88   C  C     . GLY A 1 38  ? -13.063 14.978  18.763  1.00 58.07  ? 430 GLY A C     1 
ATOM   89   O  O     . GLY A 1 38  ? -13.026 15.495  17.642  1.00 56.17  ? 430 GLY A O     1 
ATOM   90   N  N     . CYS A 1 39  ? -12.254 15.348  19.751  1.00 49.12  ? 431 CYS A N     1 
ATOM   91   C  CA    . CYS A 1 39  ? -11.191 16.327  19.540  1.00 51.05  ? 431 CYS A CA    1 
ATOM   92   C  C     . CYS A 1 39  ? -9.951  15.558  19.105  1.00 54.09  ? 431 CYS A C     1 
ATOM   93   O  O     . CYS A 1 39  ? -9.371  14.803  19.897  1.00 52.91  ? 431 CYS A O     1 
ATOM   94   C  CB    . CYS A 1 39  ? -10.921 17.143  20.809  1.00 51.77  ? 431 CYS A CB    1 
ATOM   95   S  SG    . CYS A 1 39  ? -9.778  18.571  20.613  1.00 65.06  ? 431 CYS A SG    1 
ATOM   96   N  N     . HIS A 1 40  ? -9.583  15.703  17.832  1.00 44.35  ? 432 HIS A N     1 
ATOM   97   C  CA    . HIS A 1 40  ? -8.452  14.990  17.255  1.00 43.31  ? 432 HIS A CA    1 
ATOM   98   C  C     . HIS A 1 40  ? -7.395  15.983  16.793  1.00 46.26  ? 432 HIS A C     1 
ATOM   99   O  O     . HIS A 1 40  ? -7.687  16.908  16.020  1.00 39.75  ? 432 HIS A O     1 
ATOM   100  C  CB    . HIS A 1 40  ? -8.889  14.123  16.084  1.00 43.64  ? 432 HIS A CB    1 
ATOM   101  C  CG    . HIS A 1 40  ? -9.948  13.124  16.437  1.00 54.91  ? 432 HIS A CG    1 
ATOM   102  N  ND1   . HIS A 1 40  ? -9.696  12.022  17.220  1.00 51.81  ? 432 HIS A ND1   1 
ATOM   103  C  CD2   . HIS A 1 40  ? -11.255 13.050  16.082  1.00 55.81  ? 432 HIS A CD2   1 
ATOM   104  C  CE1   . HIS A 1 40  ? -10.810 11.318  17.357  1.00 50.08  ? 432 HIS A CE1   1 
ATOM   105  N  NE2   . HIS A 1 40  ? -11.764 11.917  16.673  1.00 56.20  ? 432 HIS A NE2   1 
ATOM   106  N  N     . TYR A 1 41  ? -6.173  15.798  17.280  1.00 44.79  ? 433 TYR A N     1 
ATOM   107  C  CA    . TYR A 1 41  ? -5.067  16.682  16.940  1.00 42.74  ? 433 TYR A CA    1 
ATOM   108  C  C     . TYR A 1 41  ? -5.427  18.117  17.293  1.00 42.42  ? 433 TYR A C     1 
ATOM   109  O  O     . TYR A 1 41  ? -4.980  19.060  16.656  1.00 44.71  ? 433 TYR A O     1 
ATOM   110  C  CB    . TYR A 1 41  ? -4.699  16.523  15.453  1.00 38.60  ? 433 TYR A CB    1 
ATOM   111  C  CG    . TYR A 1 41  ? -4.348  15.083  15.115  1.00 40.61  ? 433 TYR A CG    1 
ATOM   112  C  CD1   . TYR A 1 41  ? -3.478  14.360  15.922  1.00 45.78  ? 433 TYR A CD1   1 
ATOM   113  C  CD2   . TYR A 1 41  ? -4.914  14.433  14.019  1.00 41.63  ? 433 TYR A CD2   1 
ATOM   114  C  CE1   . TYR A 1 41  ? -3.152  13.037  15.636  1.00 48.03  ? 433 TYR A CE1   1 
ATOM   115  C  CE2   . TYR A 1 41  ? -4.600  13.111  13.721  1.00 42.58  ? 433 TYR A CE2   1 
ATOM   116  C  CZ    . TYR A 1 41  ? -3.717  12.411  14.539  1.00 49.59  ? 433 TYR A CZ    1 
ATOM   117  O  OH    . TYR A 1 41  ? -3.399  11.086  14.273  1.00 44.92  ? 433 TYR A OH    1 
ATOM   118  N  N     . GLY A 1 42  ? -6.249  18.264  18.325  1.00 43.15  ? 434 GLY A N     1 
ATOM   119  C  CA    . GLY A 1 42  ? -6.506  19.550  18.930  1.00 40.24  ? 434 GLY A CA    1 
ATOM   120  C  C     . GLY A 1 42  ? -7.740  20.231  18.400  1.00 44.13  ? 434 GLY A C     1 
ATOM   121  O  O     . GLY A 1 42  ? -8.043  21.355  18.785  1.00 49.74  ? 434 GLY A O     1 
ATOM   122  N  N     . VAL A 1 43  ? -8.469  19.540  17.533  1.00 44.89  ? 435 VAL A N     1 
ATOM   123  C  CA    . VAL A 1 43  ? -9.572  20.151  16.807  1.00 46.88  ? 435 VAL A CA    1 
ATOM   124  C  C     . VAL A 1 43  ? -10.761 19.200  16.682  1.00 44.97  ? 435 VAL A C     1 
ATOM   125  O  O     . VAL A 1 43  ? -10.580 18.017  16.470  1.00 44.17  ? 435 VAL A O     1 
ATOM   126  C  CB    . VAL A 1 43  ? -9.117  20.592  15.376  1.00 41.77  ? 435 VAL A CB    1 
ATOM   127  C  CG1   . VAL A 1 43  ? -10.302 20.992  14.523  1.00 43.25  ? 435 VAL A CG1   1 
ATOM   128  C  CG2   . VAL A 1 43  ? -8.123  21.732  15.456  1.00 42.19  ? 435 VAL A CG2   1 
ATOM   129  N  N     . LEU A 1 44  ? -11.976 19.730  16.796  1.00 49.32  ? 436 LEU A N     1 
ATOM   130  C  CA    . LEU A 1 44  ? -13.183 18.935  16.598  1.00 46.24  ? 436 LEU A CA    1 
ATOM   131  C  C     . LEU A 1 44  ? -13.341 18.463  15.152  1.00 51.29  ? 436 LEU A C     1 
ATOM   132  O  O     . LEU A 1 44  ? -13.566 19.270  14.239  1.00 48.34  ? 436 LEU A O     1 
ATOM   133  C  CB    . LEU A 1 44  ? -14.412 19.741  17.030  1.00 54.18  ? 436 LEU A CB    1 
ATOM   134  C  CG    . LEU A 1 44  ? -15.715 18.945  17.054  1.00 56.17  ? 436 LEU A CG    1 
ATOM   135  C  CD1   . LEU A 1 44  ? -15.510 17.666  17.870  1.00 54.27  ? 436 LEU A CD1   1 
ATOM   136  C  CD2   . LEU A 1 44  ? -16.826 19.799  17.654  1.00 54.83  ? 436 LEU A CD2   1 
ATOM   137  N  N     . THR A 1 45  ? -13.206 17.151  14.941  1.00 47.11  ? 437 THR A N     1 
ATOM   138  C  CA    . THR A 1 45  ? -13.189 16.584  13.605  1.00 45.14  ? 437 THR A CA    1 
ATOM   139  C  C     . THR A 1 45  ? -13.752 15.174  13.573  1.00 53.85  ? 437 THR A C     1 
ATOM   140  O  O     . THR A 1 45  ? -13.927 14.533  14.605  1.00 56.68  ? 437 THR A O     1 
ATOM   141  C  CB    . THR A 1 45  ? -11.742 16.500  13.013  1.00 48.92  ? 437 THR A CB    1 
ATOM   142  O  OG1   . THR A 1 45  ? -10.964 15.581  13.781  1.00 49.42  ? 437 THR A OG1   1 
ATOM   143  C  CG2   . THR A 1 45  ? -11.048 17.836  13.013  1.00 42.64  ? 437 THR A CG2   1 
ATOM   144  N  N     . CYS A 1 46  ? -13.974 14.685  12.364  1.00 51.61  ? 438 CYS A N     1 
ATOM   145  C  CA    . CYS A 1 46  ? -14.483 13.347  12.122  1.00 51.28  ? 438 CYS A CA    1 
ATOM   146  C  C     . CYS A 1 46  ? -13.346 12.352  11.924  1.00 50.32  ? 438 CYS A C     1 
ATOM   147  O  O     . CYS A 1 46  ? -12.196 12.737  11.745  1.00 48.69  ? 438 CYS A O     1 
ATOM   148  C  CB    . CYS A 1 46  ? -15.388 13.350  10.888  1.00 52.37  ? 438 CYS A CB    1 
ATOM   149  S  SG    . CYS A 1 46  ? -14.489 13.626  9.323   1.00 55.42  ? 438 CYS A SG    1 
ATOM   150  N  N     . GLY A 1 47  ? -13.682 11.072  11.953  1.00 49.11  ? 439 GLY A N     1 
ATOM   151  C  CA    . GLY A 1 47  ? -12.723 10.017  11.729  1.00 41.86  ? 439 GLY A CA    1 
ATOM   152  C  C     . GLY A 1 47  ? -11.947 10.162  10.439  1.00 48.47  ? 439 GLY A C     1 
ATOM   153  O  O     . GLY A 1 47  ? -10.730 9.934   10.421  1.00 49.56  ? 439 GLY A O     1 
ATOM   154  N  N     . SER A 1 48  ? -12.626 10.544  9.358   1.00 43.79  ? 440 SER A N     1 
ATOM   155  C  CA    . SER A 1 48  ? -11.974 10.597  8.065   1.00 45.62  ? 440 SER A CA    1 
ATOM   156  C  C     . SER A 1 48  ? -10.974 11.757  8.006   1.00 40.27  ? 440 SER A C     1 
ATOM   157  O  O     . SER A 1 48  ? -9.911  11.622  7.431   1.00 40.87  ? 440 SER A O     1 
ATOM   158  C  CB    . SER A 1 48  ? -13.000 10.734  6.935   1.00 48.94  ? 440 SER A CB    1 
ATOM   159  O  OG    . SER A 1 48  ? -13.715 11.957  7.064   1.00 51.22  ? 440 SER A OG    1 
ATOM   160  N  N     . CYS A 1 49  ? -11.332 12.892  8.580   1.00 35.93  ? 441 CYS A N     1 
ATOM   161  C  CA    . CYS A 1 49  ? -10.448 14.046  8.546   1.00 44.95  ? 441 CYS A CA    1 
ATOM   162  C  C     . CYS A 1 49  ? -9.229  13.830  9.474   1.00 45.27  ? 441 CYS A C     1 
ATOM   163  O  O     . CYS A 1 49  ? -8.096  14.155  9.100   1.00 38.10  ? 441 CYS A O     1 
ATOM   164  C  CB    . CYS A 1 49  ? -11.225 15.322  8.897   1.00 42.63  ? 441 CYS A CB    1 
ATOM   165  S  SG    . CYS A 1 49  ? -12.326 15.880  7.472   1.00 45.71  ? 441 CYS A SG    1 
ATOM   166  N  N     . LYS A 1 50  ? -9.465  13.231  10.640  1.00 42.05  ? 442 LYS A N     1 
ATOM   167  C  CA    . LYS A 1 50  ? -8.394  12.728  11.509  1.00 43.42  ? 442 LYS A CA    1 
ATOM   168  C  C     . LYS A 1 50  ? -7.302  11.973  10.746  1.00 39.50  ? 442 LYS A C     1 
ATOM   169  O  O     . LYS A 1 50  ? -6.139  12.370  10.741  1.00 38.57  ? 442 LYS A O     1 
ATOM   170  C  CB    . LYS A 1 50  ? -8.992  11.819  12.588  1.00 46.56  ? 442 LYS A CB    1 
ATOM   171  C  CG    . LYS A 1 50  ? -7.988  11.130  13.502  1.00 47.17  ? 442 LYS A CG    1 
ATOM   172  C  CD    . LYS A 1 50  ? -8.691  10.179  14.468  1.00 52.21  ? 442 LYS A CD    1 
ATOM   173  C  CE    . LYS A 1 50  ? -7.704  9.594   15.489  1.00 59.72  ? 442 LYS A CE    1 
ATOM   174  N  NZ    . LYS A 1 50  ? -6.543  8.899   14.845  1.00 58.14  ? 442 LYS A NZ    1 
ATOM   175  N  N     . VAL A 1 51  ? -7.670  10.896  10.075  1.00 39.54  ? 443 VAL A N     1 
ATOM   176  C  CA    . VAL A 1 51  ? -6.667  10.075  9.419   1.00 35.39  ? 443 VAL A CA    1 
ATOM   177  C  C     . VAL A 1 51  ? -6.216  10.672  8.079   1.00 36.80  ? 443 VAL A C     1 
ATOM   178  O  O     . VAL A 1 51  ? -5.093  10.430  7.630   1.00 37.59  ? 443 VAL A O     1 
ATOM   179  C  CB    . VAL A 1 51  ? -7.189  8.628   9.219   1.00 45.10  ? 443 VAL A CB    1 
ATOM   180  C  CG1   . VAL A 1 51  ? -8.380  8.605   8.237   1.00 43.03  ? 443 VAL A CG1   1 
ATOM   181  C  CG2   . VAL A 1 51  ? -6.053  7.705   8.761   1.00 46.61  ? 443 VAL A CG2   1 
ATOM   182  N  N     . PHE A 1 52  ? -7.071  11.448  7.417   1.00 39.55  ? 444 PHE A N     1 
ATOM   183  C  CA    . PHE A 1 52  ? -6.575  12.240  6.290   1.00 39.13  ? 444 PHE A CA    1 
ATOM   184  C  C     . PHE A 1 52  ? -5.396  13.119  6.758   1.00 32.12  ? 444 PHE A C     1 
ATOM   185  O  O     . PHE A 1 52  ? -4.367  13.190  6.113   1.00 34.04  ? 444 PHE A O     1 
ATOM   186  C  CB    . PHE A 1 52  ? -7.668  13.130  5.678   1.00 38.04  ? 444 PHE A CB    1 
ATOM   187  C  CG    . PHE A 1 52  ? -7.128  14.160  4.700   1.00 37.09  ? 444 PHE A CG    1 
ATOM   188  C  CD1   . PHE A 1 52  ? -6.841  13.806  3.389   1.00 35.15  ? 444 PHE A CD1   1 
ATOM   189  C  CD2   . PHE A 1 52  ? -6.870  15.464  5.106   1.00 34.88  ? 444 PHE A CD2   1 
ATOM   190  C  CE1   . PHE A 1 52  ? -6.322  14.738  2.471   1.00 37.98  ? 444 PHE A CE1   1 
ATOM   191  C  CE2   . PHE A 1 52  ? -6.357  16.410  4.187   1.00 36.27  ? 444 PHE A CE2   1 
ATOM   192  C  CZ    . PHE A 1 52  ? -6.074  16.031  2.862   1.00 31.46  ? 444 PHE A CZ    1 
ATOM   193  N  N     . PHE A 1 53  ? -5.556  13.789  7.881   1.00 32.91  ? 445 PHE A N     1 
ATOM   194  C  CA    . PHE A 1 53  ? -4.507  14.702  8.359   1.00 35.03  ? 445 PHE A CA    1 
ATOM   195  C  C     . PHE A 1 53  ? -3.227  13.952  8.765   1.00 33.79  ? 445 PHE A C     1 
ATOM   196  O  O     . PHE A 1 53  ? -2.123  14.309  8.349   1.00 33.87  ? 445 PHE A O     1 
ATOM   197  C  CB    . PHE A 1 53  ? -5.005  15.528  9.526   1.00 33.51  ? 445 PHE A CB    1 
ATOM   198  C  CG    . PHE A 1 53  ? -3.998  16.538  10.019  1.00 33.68  ? 445 PHE A CG    1 
ATOM   199  C  CD1   . PHE A 1 53  ? -3.682  17.627  9.251   1.00 30.59  ? 445 PHE A CD1   1 
ATOM   200  C  CD2   . PHE A 1 53  ? -3.364  16.381  11.241  1.00 34.44  ? 445 PHE A CD2   1 
ATOM   201  C  CE1   . PHE A 1 53  ? -2.744  18.557  9.693   1.00 33.56  ? 445 PHE A CE1   1 
ATOM   202  C  CE2   . PHE A 1 53  ? -2.438  17.304  11.676  1.00 36.23  ? 445 PHE A CE2   1 
ATOM   203  C  CZ    . PHE A 1 53  ? -2.128  18.393  10.895  1.00 30.23  ? 445 PHE A CZ    1 
ATOM   204  N  N     . LYS A 1 54  ? -3.394  12.892  9.540   1.00 34.73  ? 446 LYS A N     1 
ATOM   205  C  CA    . LYS A 1 54  ? -2.294  12.007  9.877   1.00 37.48  ? 446 LYS A CA    1 
ATOM   206  C  C     . LYS A 1 54  ? -1.578  11.540  8.625   1.00 37.35  ? 446 LYS A C     1 
ATOM   207  O  O     . LYS A 1 54  ? -0.358  11.622  8.560   1.00 39.54  ? 446 LYS A O     1 
ATOM   208  C  CB    . LYS A 1 54  ? -2.786  10.796  10.678  1.00 40.58  ? 446 LYS A CB    1 
ATOM   209  C  CG    . LYS A 1 54  ? -1.673  9.795   11.002  1.00 38.70  ? 446 LYS A CG    1 
ATOM   210  C  CD    . LYS A 1 54  ? -0.692  10.385  12.011  1.00 47.85  ? 446 LYS A CD    1 
ATOM   211  C  CE    . LYS A 1 54  ? 0.464   9.416   12.292  1.00 49.52  ? 446 LYS A CE    1 
ATOM   212  N  NZ    . LYS A 1 54  ? 1.315   9.863   13.439  1.00 56.12  ? 446 LYS A NZ    1 
ATOM   213  N  N     . ARG A 1 55  ? -2.324  11.075  7.621   1.00 33.45  ? 447 ARG A N     1 
ATOM   214  C  CA    . ARG A 1 55  ? -1.697  10.619  6.389   1.00 36.57  ? 447 ARG A CA    1 
ATOM   215  C  C     . ARG A 1 55  ? -0.949  11.765  5.706   1.00 40.60  ? 447 ARG A C     1 
ATOM   216  O  O     . ARG A 1 55  ? 0.166   11.594  5.210   1.00 40.85  ? 447 ARG A O     1 
ATOM   217  C  CB    . ARG A 1 55  ? -2.732  10.034  5.400   1.00 46.01  ? 447 ARG A CB    1 
ATOM   218  C  CG    . ARG A 1 55  ? -3.114  8.556   5.565   1.00 46.84  ? 447 ARG A CG    1 
ATOM   219  C  CD    . ARG A 1 55  ? -3.860  8.045   4.305   1.00 45.96  ? 447 ARG A CD    1 
ATOM   220  N  NE    . ARG A 1 55  ? -5.075  8.825   4.055   1.00 51.48  ? 447 ARG A NE    1 
ATOM   221  C  CZ    . ARG A 1 55  ? -6.258  8.553   4.596   1.00 47.73  ? 447 ARG A CZ    1 
ATOM   222  N  NH1   . ARG A 1 55  ? -6.394  7.493   5.391   1.00 48.56  ? 447 ARG A NH1   1 
ATOM   223  N  NH2   . ARG A 1 55  ? -7.305  9.330   4.347   1.00 44.36  ? 447 ARG A NH2   1 
ATOM   224  N  N     . ALA A 1 56  ? -1.577  12.932  5.660   1.00 37.72  ? 448 ALA A N     1 
ATOM   225  C  CA    . ALA A 1 56  ? -0.986  14.060  4.947   1.00 38.02  ? 448 ALA A CA    1 
ATOM   226  C  C     . ALA A 1 56  ? 0.301   14.571  5.601   1.00 34.57  ? 448 ALA A C     1 
ATOM   227  O  O     . ALA A 1 56  ? 1.241   14.922  4.887   1.00 38.12  ? 448 ALA A O     1 
ATOM   228  C  CB    . ALA A 1 56  ? -2.004  15.201  4.819   1.00 32.04  ? 448 ALA A CB    1 
ATOM   229  N  N     . VAL A 1 57  ? 0.362   14.604  6.931   1.00 34.80  ? 449 VAL A N     1 
ATOM   230  C  CA    . VAL A 1 57  ? 1.567   15.098  7.616   1.00 36.93  ? 449 VAL A CA    1 
ATOM   231  C  C     . VAL A 1 57  ? 2.708   14.106  7.775   1.00 41.47  ? 449 VAL A C     1 
ATOM   232  O  O     . VAL A 1 57  ? 3.840   14.518  7.970   1.00 44.23  ? 449 VAL A O     1 
ATOM   233  C  CB    . VAL A 1 57  ? 1.270   15.625  9.033   1.00 39.27  ? 449 VAL A CB    1 
ATOM   234  C  CG1   . VAL A 1 57  ? 0.349   16.841  8.967   1.00 39.73  ? 449 VAL A CG1   1 
ATOM   235  C  CG2   . VAL A 1 57  ? 0.661   14.548  9.865   1.00 45.24  ? 449 VAL A CG2   1 
ATOM   236  N  N     . GLU A 1 58  ? 2.445   12.806  7.717   1.00 46.79  ? 450 GLU A N     1 
ATOM   237  C  CA    . GLU A 1 58  ? 3.565   11.878  7.801   1.00 46.73  ? 450 GLU A CA    1 
ATOM   238  C  C     . GLU A 1 58  ? 4.115   11.563  6.411   1.00 46.52  ? 450 GLU A C     1 
ATOM   239  O  O     . GLU A 1 58  ? 5.246   11.111  6.291   1.00 57.71  ? 450 GLU A O     1 
ATOM   240  C  CB    . GLU A 1 58  ? 3.183   10.594  8.549   1.00 46.26  ? 450 GLU A CB    1 
ATOM   241  C  CG    . GLU A 1 58  ? 3.361   10.680  10.081  1.00 53.85  ? 450 GLU A CG    1 
ATOM   242  C  CD    . GLU A 1 58  ? 4.773   11.125  10.525  1.00 65.54  ? 450 GLU A CD    1 
ATOM   243  O  OE1   . GLU A 1 58  ? 5.781   10.663  9.939   1.00 76.53  ? 450 GLU A OE1   1 
ATOM   244  O  OE2   . GLU A 1 58  ? 4.876   11.928  11.477  1.00 66.94  ? 450 GLU A OE2   1 
ATOM   245  N  N     . GLY A 1 59  ? 3.331   11.837  5.372   1.00 41.03  ? 451 GLY A N     1 
ATOM   246  C  CA    . GLY A 1 59  ? 3.753   11.666  3.996   1.00 41.41  ? 451 GLY A CA    1 
ATOM   247  C  C     . GLY A 1 59  ? 4.092   13.008  3.349   1.00 44.71  ? 451 GLY A C     1 
ATOM   248  O  O     . GLY A 1 59  ? 4.560   13.901  4.033   1.00 45.70  ? 451 GLY A O     1 
ATOM   249  N  N     . GLN A 1 60  ? 3.862   13.174  2.049   1.00 44.16  ? 452 GLN A N     1 
ATOM   250  C  CA    . GLN A 1 60  ? 4.464   14.321  1.366   1.00 53.03  ? 452 GLN A CA    1 
ATOM   251  C  C     . GLN A 1 60  ? 3.534   15.538  1.054   1.00 57.79  ? 452 GLN A C     1 
ATOM   252  O  O     . GLN A 1 60  ? 4.063   16.655  0.819   1.00 60.89  ? 452 GLN A O     1 
ATOM   253  C  CB    . GLN A 1 60  ? 5.138   13.854  0.069   1.00 44.47  ? 452 GLN A CB    1 
ATOM   254  C  CG    . GLN A 1 60  ? 6.274   12.845  0.265   1.00 56.35  ? 452 GLN A CG    1 
ATOM   255  C  CD    . GLN A 1 60  ? 7.262   12.820  -0.907  1.00 72.03  ? 452 GLN A CD    1 
ATOM   256  O  OE1   . GLN A 1 60  ? 8.421   13.231  -0.763  1.00 80.44  ? 452 GLN A OE1   1 
ATOM   257  N  NE2   . GLN A 1 60  ? 6.805   12.352  -2.071  1.00 69.54  ? 452 GLN A NE2   1 
ATOM   258  N  N     . HIS A 1 61  ? 2.207   15.355  1.040   1.00 49.30  ? 453 HIS A N     1 
ATOM   259  C  CA    . HIS A 1 61  ? 1.235   16.487  0.886   1.00 48.27  ? 453 HIS A CA    1 
ATOM   260  C  C     . HIS A 1 61  ? 1.488   17.537  -0.234  1.00 48.12  ? 453 HIS A C     1 
ATOM   261  O  O     . HIS A 1 61  ? 1.031   18.683  -0.152  1.00 46.80  ? 453 HIS A O     1 
ATOM   262  C  CB    . HIS A 1 61  ? 1.039   17.195  2.282   1.00 48.80  ? 453 HIS A CB    1 
ATOM   263  C  CG    . HIS A 1 61  ? 2.040   18.277  2.628   1.00 55.95  ? 453 HIS A CG    1 
ATOM   264  N  ND1   . HIS A 1 61  ? 3.401   18.065  2.668   1.00 65.78  ? 453 HIS A ND1   1 
ATOM   265  C  CD2   . HIS A 1 61  ? 1.852   19.529  3.119   1.00 53.40  ? 453 HIS A CD2   1 
ATOM   266  C  CE1   . HIS A 1 61  ? 4.017   19.167  3.078   1.00 58.65  ? 453 HIS A CE1   1 
ATOM   267  N  NE2   . HIS A 1 61  ? 3.092   20.068  3.358   1.00 56.10  ? 453 HIS A NE2   1 
ATOM   268  N  N     . ASN A 1 62  ? 2.139   17.152  -1.320  1.00 47.48  ? 454 ASN A N     1 
ATOM   269  C  CA    . ASN A 1 62  ? 2.281   18.106  -2.421  1.00 48.46  ? 454 ASN A CA    1 
ATOM   270  C  C     . ASN A 1 62  ? 1.045   18.139  -3.341  1.00 50.12  ? 454 ASN A C     1 
ATOM   271  O  O     . ASN A 1 62  ? 1.140   17.819  -4.519  1.00 48.59  ? 454 ASN A O     1 
ATOM   272  C  CB    . ASN A 1 62  ? 3.536   17.808  -3.265  1.00 46.55  ? 454 ASN A CB    1 
ATOM   273  C  CG    . ASN A 1 62  ? 3.891   18.953  -4.223  1.00 59.71  ? 454 ASN A CG    1 
ATOM   274  O  OD1   . ASN A 1 62  ? 3.179   19.960  -4.309  1.00 56.15  ? 454 ASN A OD1   1 
ATOM   275  N  ND2   . ASN A 1 62  ? 4.991   18.789  -4.964  1.00 60.76  ? 454 ASN A ND2   1 
ATOM   276  N  N     . TYR A 1 63  ? -0.113  18.514  -2.803  1.00 51.33  ? 455 TYR A N     1 
ATOM   277  C  CA    . TYR A 1 63  ? -1.350  18.505  -3.586  1.00 45.55  ? 455 TYR A CA    1 
ATOM   278  C  C     . TYR A 1 63  ? -1.484  19.770  -4.408  1.00 42.92  ? 455 TYR A C     1 
ATOM   279  O  O     . TYR A 1 63  ? -0.917  20.805  -4.060  1.00 42.80  ? 455 TYR A O     1 
ATOM   280  C  CB    . TYR A 1 63  ? -2.583  18.370  -2.681  1.00 42.89  ? 455 TYR A CB    1 
ATOM   281  C  CG    . TYR A 1 63  ? -2.504  17.270  -1.658  1.00 43.69  ? 455 TYR A CG    1 
ATOM   282  C  CD1   . TYR A 1 63  ? -2.335  15.940  -2.037  1.00 44.90  ? 455 TYR A CD1   1 
ATOM   283  C  CD2   . TYR A 1 63  ? -2.619  17.556  -0.314  1.00 39.36  ? 455 TYR A CD2   1 
ATOM   284  C  CE1   . TYR A 1 63  ? -2.262  14.935  -1.080  1.00 45.22  ? 455 TYR A CE1   1 
ATOM   285  C  CE2   . TYR A 1 63  ? -2.556  16.560  0.649   1.00 43.25  ? 455 TYR A CE2   1 
ATOM   286  C  CZ    . TYR A 1 63  ? -2.373  15.262  0.274   1.00 48.12  ? 455 TYR A CZ    1 
ATOM   287  O  OH    . TYR A 1 63  ? -2.313  14.287  1.262   1.00 50.65  ? 455 TYR A OH    1 
ATOM   288  N  N     . LEU A 1 64  ? -2.266  19.700  -5.478  1.00 37.43  ? 456 LEU A N     1 
ATOM   289  C  CA    . LEU A 1 64  ? -2.501  20.875  -6.310  1.00 41.54  ? 456 LEU A CA    1 
ATOM   290  C  C     . LEU A 1 64  ? -3.992  21.156  -6.504  1.00 43.43  ? 456 LEU A C     1 
ATOM   291  O  O     . LEU A 1 64  ? -4.749  20.292  -6.976  1.00 44.90  ? 456 LEU A O     1 
ATOM   292  C  CB    . LEU A 1 64  ? -1.837  20.711  -7.676  1.00 49.89  ? 456 LEU A CB    1 
ATOM   293  C  CG    . LEU A 1 64  ? -0.340  20.421  -7.654  1.00 57.91  ? 456 LEU A CG    1 
ATOM   294  C  CD1   . LEU A 1 64  ? 0.074   19.650  -8.894  1.00 68.93  ? 456 LEU A CD1   1 
ATOM   295  C  CD2   . LEU A 1 64  ? 0.442   21.715  -7.538  1.00 56.65  ? 456 LEU A CD2   1 
ATOM   296  N  N     . CYS A 1 65  ? -4.403  22.369  -6.148  1.00 39.06  ? 457 CYS A N     1 
ATOM   297  C  CA    . CYS A 1 65  ? -5.799  22.810  -6.277  1.00 37.21  ? 457 CYS A CA    1 
ATOM   298  C  C     . CYS A 1 65  ? -6.166  23.099  -7.714  1.00 39.37  ? 457 CYS A C     1 
ATOM   299  O  O     . CYS A 1 65  ? -5.401  23.728  -8.447  1.00 36.97  ? 457 CYS A O     1 
ATOM   300  C  CB    . CYS A 1 65  ? -6.056  24.065  -5.422  1.00 34.68  ? 457 CYS A CB    1 
ATOM   301  S  SG    . CYS A 1 65  ? -7.777  24.620  -5.434  1.00 34.63  ? 457 CYS A SG    1 
ATOM   302  N  N     . ALA A 1 66  ? -7.351  22.657  -8.127  1.00 36.10  ? 458 ALA A N     1 
ATOM   303  C  CA    . ALA A 1 66  ? -7.788  22.903  -9.491  1.00 35.77  ? 458 ALA A CA    1 
ATOM   304  C  C     . ALA A 1 66  ? -8.573  24.204  -9.612  1.00 34.92  ? 458 ALA A C     1 
ATOM   305  O  O     . ALA A 1 66  ? -8.885  24.647  -10.711 1.00 34.91  ? 458 ALA A O     1 
ATOM   306  C  CB    . ALA A 1 66  ? -8.615  21.746  -9.973  1.00 40.48  ? 458 ALA A CB    1 
ATOM   307  N  N     . GLY A 1 67  ? -8.915  24.797  -8.477  1.00 34.87  ? 459 GLY A N     1 
ATOM   308  C  CA    . GLY A 1 67  ? -9.725  26.002  -8.453  1.00 35.63  ? 459 GLY A CA    1 
ATOM   309  C  C     . GLY A 1 67  ? -8.876  27.169  -8.002  1.00 35.15  ? 459 GLY A C     1 
ATOM   310  O  O     . GLY A 1 67  ? -7.839  27.437  -8.602  1.00 41.77  ? 459 GLY A O     1 
ATOM   311  N  N     . ARG A 1 68  ? -9.294  27.862  -6.953  1.00 34.09  ? 460 ARG A N     1 
ATOM   312  C  CA    . ARG A 1 68  ? -8.525  29.004  -6.461  1.00 39.78  ? 460 ARG A CA    1 
ATOM   313  C  C     . ARG A 1 68  ? -8.168  28.886  -4.988  1.00 42.71  ? 460 ARG A C     1 
ATOM   314  O  O     . ARG A 1 68  ? -8.175  29.875  -4.260  1.00 39.49  ? 460 ARG A O     1 
ATOM   315  C  CB    . ARG A 1 68  ? -9.301  30.291  -6.702  1.00 38.12  ? 460 ARG A CB    1 
ATOM   316  C  CG    . ARG A 1 68  ? -9.671  30.479  -8.191  1.00 44.65  ? 460 ARG A CG    1 
ATOM   317  C  CD    . ARG A 1 68  ? -10.030 31.934  -8.483  1.00 47.54  ? 460 ARG A CD    1 
ATOM   318  N  NE    . ARG A 1 68  ? -11.005 32.048  -9.556  1.00 53.78  ? 460 ARG A NE    1 
ATOM   319  C  CZ    . ARG A 1 68  ? -11.974 32.961  -9.584  1.00 54.33  ? 460 ARG A CZ    1 
ATOM   320  N  NH1   . ARG A 1 68  ? -12.093 33.836  -8.587  1.00 49.62  ? 460 ARG A NH1   1 
ATOM   321  N  NH2   . ARG A 1 68  ? -12.826 32.988  -10.600 1.00 55.07  ? 460 ARG A NH2   1 
ATOM   322  N  N     . ASN A 1 69  ? -7.872  27.670  -4.542  1.00 38.97  ? 461 ASN A N     1 
ATOM   323  C  CA    . ASN A 1 69  ? -7.475  27.455  -3.148  1.00 38.31  ? 461 ASN A CA    1 
ATOM   324  C  C     . ASN A 1 69  ? -8.485  27.888  -2.120  1.00 38.68  ? 461 ASN A C     1 
ATOM   325  O  O     . ASN A 1 69  ? -8.107  28.292  -1.024  1.00 38.46  ? 461 ASN A O     1 
ATOM   326  C  CB    . ASN A 1 69  ? -6.167  28.175  -2.872  1.00 35.89  ? 461 ASN A CB    1 
ATOM   327  C  CG    . ASN A 1 69  ? -5.103  27.730  -3.798  1.00 40.71  ? 461 ASN A CG    1 
ATOM   328  O  OD1   . ASN A 1 69  ? -4.617  26.606  -3.702  1.00 38.75  ? 461 ASN A OD1   1 
ATOM   329  N  ND2   . ASN A 1 69  ? -4.761  28.582  -4.750  1.00 56.14  ? 461 ASN A ND2   1 
ATOM   330  N  N     . ASP A 1 70  ? -9.763  27.818  -2.471  1.00 35.96  ? 462 ASP A N     1 
ATOM   331  C  CA    . ASP A 1 70  ? -10.809 28.058  -1.489  1.00 34.79  ? 462 ASP A CA    1 
ATOM   332  C  C     . ASP A 1 70  ? -11.994 27.137  -1.755  1.00 38.60  ? 462 ASP A C     1 
ATOM   333  O  O     . ASP A 1 70  ? -13.139 27.547  -1.632  1.00 37.84  ? 462 ASP A O     1 
ATOM   334  C  CB    . ASP A 1 70  ? -11.258 29.517  -1.519  1.00 34.26  ? 462 ASP A CB    1 
ATOM   335  C  CG    . ASP A 1 70  ? -12.015 29.876  -2.818  1.00 45.18  ? 462 ASP A CG    1 
ATOM   336  O  OD1   . ASP A 1 70  ? -11.871 29.159  -3.843  1.00 39.01  ? 462 ASP A OD1   1 
ATOM   337  O  OD2   . ASP A 1 70  ? -12.773 30.871  -2.809  1.00 45.24  ? 462 ASP A OD2   1 
ATOM   338  N  N     . CYS A 1 71  ? -11.705 25.898  -2.125  1.00 34.84  ? 463 CYS A N     1 
ATOM   339  C  CA    . CYS A 1 71  ? -12.733 24.939  -2.493  1.00 37.62  ? 463 CYS A CA    1 
ATOM   340  C  C     . CYS A 1 71  ? -13.621 24.666  -1.260  1.00 44.85  ? 463 CYS A C     1 
ATOM   341  O  O     . CYS A 1 71  ? -13.141 24.717  -0.124  1.00 42.34  ? 463 CYS A O     1 
ATOM   342  C  CB    . CYS A 1 71  ? -12.094 23.635  -3.037  1.00 33.66  ? 463 CYS A CB    1 
ATOM   343  S  SG    . CYS A 1 71  ? -11.187 23.738  -4.670  1.00 30.95  ? 463 CYS A SG    1 
ATOM   344  N  N     . ILE A 1 72  ? -14.907 24.384  -1.486  1.00 42.00  ? 464 ILE A N     1 
ATOM   345  C  CA    . ILE A 1 72  ? -15.834 24.067  -0.394  1.00 35.25  ? 464 ILE A CA    1 
ATOM   346  C  C     . ILE A 1 72  ? -15.596 22.644  0.115   1.00 43.54  ? 464 ILE A C     1 
ATOM   347  O  O     . ILE A 1 72  ? -15.732 21.670  -0.644  1.00 38.28  ? 464 ILE A O     1 
ATOM   348  C  CB    . ILE A 1 72  ? -17.310 24.214  -0.853  1.00 41.13  ? 464 ILE A CB    1 
ATOM   349  C  CG1   . ILE A 1 72  ? -17.607 25.657  -1.264  1.00 41.41  ? 464 ILE A CG1   1 
ATOM   350  C  CG2   . ILE A 1 72  ? -18.286 23.810  0.257   1.00 40.19  ? 464 ILE A CG2   1 
ATOM   351  C  CD1   . ILE A 1 72  ? -18.667 25.715  -2.358  1.00 44.91  ? 464 ILE A CD1   1 
ATOM   352  N  N     . ILE A 1 73  ? -15.241 22.502  1.393   1.00 40.82  ? 465 ILE A N     1 
ATOM   353  C  CA    . ILE A 1 73  ? -15.007 21.154  1.922   1.00 42.36  ? 465 ILE A CA    1 
ATOM   354  C  C     . ILE A 1 73  ? -16.234 20.641  2.687   1.00 41.81  ? 465 ILE A C     1 
ATOM   355  O  O     . ILE A 1 73  ? -16.580 21.171  3.717   1.00 41.80  ? 465 ILE A O     1 
ATOM   356  C  CB    . ILE A 1 73  ? -13.764 21.100  2.854   1.00 41.54  ? 465 ILE A CB    1 
ATOM   357  C  CG1   . ILE A 1 73  ? -12.523 21.667  2.144   1.00 36.74  ? 465 ILE A CG1   1 
ATOM   358  C  CG2   . ILE A 1 73  ? -13.507 19.661  3.302   1.00 45.27  ? 465 ILE A CG2   1 
ATOM   359  C  CD1   . ILE A 1 73  ? -12.193 20.992  0.778   1.00 34.29  ? 465 ILE A CD1   1 
ATOM   360  N  N     . ASP A 1 74  ? -16.903 19.620  2.164   1.00 46.39  ? 466 ASP A N     1 
ATOM   361  C  CA    . ASP A 1 74  ? -17.968 18.960  2.917   1.00 47.41  ? 466 ASP A CA    1 
ATOM   362  C  C     . ASP A 1 74  ? -17.949 17.489  2.606   1.00 53.19  ? 466 ASP A C     1 
ATOM   363  O  O     . ASP A 1 74  ? -17.111 17.035  1.822   1.00 51.15  ? 466 ASP A O     1 
ATOM   364  C  CB    . ASP A 1 74  ? -19.345 19.575  2.621   1.00 51.08  ? 466 ASP A CB    1 
ATOM   365  C  CG    . ASP A 1 74  ? -19.789 19.408  1.170   1.00 53.07  ? 466 ASP A CG    1 
ATOM   366  O  OD1   . ASP A 1 74  ? -19.275 18.529  0.422   1.00 57.51  ? 466 ASP A OD1   1 
ATOM   367  O  OD2   . ASP A 1 74  ? -20.668 20.201  0.764   1.00 60.12  ? 466 ASP A OD2   1 
ATOM   368  N  N     . LYS A 1 75  ? -18.880 16.746  3.195   1.00 52.53  ? 467 LYS A N     1 
ATOM   369  C  CA    . LYS A 1 75  ? -18.752 15.304  3.205   1.00 52.69  ? 467 LYS A CA    1 
ATOM   370  C  C     . LYS A 1 75  ? -18.677 14.740  1.801   1.00 56.29  ? 467 LYS A C     1 
ATOM   371  O  O     . LYS A 1 75  ? -17.875 13.847  1.538   1.00 62.49  ? 467 LYS A O     1 
ATOM   372  C  CB    . LYS A 1 75  ? -19.898 14.655  3.984   1.00 59.53  ? 467 LYS A CB    1 
ATOM   373  C  CG    . LYS A 1 75  ? -19.926 13.138  3.837   1.00 61.72  ? 467 LYS A CG    1 
ATOM   374  C  CD    . LYS A 1 75  ? -20.815 12.466  4.878   1.00 69.56  ? 467 LYS A CD    1 
ATOM   375  C  CE    . LYS A 1 75  ? -20.580 10.957  4.879   1.00 69.72  ? 467 LYS A CE    1 
ATOM   376  N  NZ    . LYS A 1 75  ? -21.105 10.327  3.631   1.00 73.85  ? 467 LYS A NZ    1 
ATOM   377  N  N     . ILE A 1 76  ? -19.486 15.263  0.889   1.00 59.51  ? 468 ILE A N     1 
ATOM   378  C  CA    . ILE A 1 76  ? -19.493 14.733  -0.469  1.00 60.84  ? 468 ILE A CA    1 
ATOM   379  C  C     . ILE A 1 76  ? -18.335 15.266  -1.326  1.00 61.41  ? 468 ILE A C     1 
ATOM   380  O  O     . ILE A 1 76  ? -17.939 14.627  -2.296  1.00 61.68  ? 468 ILE A O     1 
ATOM   381  C  CB    . ILE A 1 76  ? -20.817 15.047  -1.196  1.00 65.37  ? 468 ILE A CB    1 
ATOM   382  C  CG1   . ILE A 1 76  ? -20.989 16.555  -1.386  1.00 64.87  ? 468 ILE A CG1   1 
ATOM   383  C  CG2   . ILE A 1 76  ? -21.999 14.482  -0.415  1.00 70.04  ? 468 ILE A CG2   1 
ATOM   384  C  CD1   . ILE A 1 76  ? -22.017 16.913  -2.416  1.00 58.51  ? 468 ILE A CD1   1 
ATOM   385  N  N     . ARG A 1 77  ? -17.799 16.429  -0.964  1.00 54.08  ? 469 ARG A N     1 
ATOM   386  C  CA    . ARG A 1 77  ? -16.780 17.076  -1.782  1.00 55.80  ? 469 ARG A CA    1 
ATOM   387  C  C     . ARG A 1 77  ? -15.354 16.991  -1.240  1.00 52.19  ? 469 ARG A C     1 
ATOM   388  O  O     . ARG A 1 77  ? -14.400 17.178  -2.004  1.00 50.68  ? 469 ARG A O     1 
ATOM   389  C  CB    . ARG A 1 77  ? -17.156 18.545  -1.993  1.00 51.68  ? 469 ARG A CB    1 
ATOM   390  C  CG    . ARG A 1 77  ? -18.329 18.715  -2.966  1.00 49.16  ? 469 ARG A CG    1 
ATOM   391  C  CD    . ARG A 1 77  ? -18.670 20.176  -3.165  1.00 49.99  ? 469 ARG A CD    1 
ATOM   392  N  NE    . ARG A 1 77  ? -19.534 20.711  -2.118  1.00 44.11  ? 469 ARG A NE    1 
ATOM   393  C  CZ    . ARG A 1 77  ? -20.156 21.887  -2.213  1.00 47.70  ? 469 ARG A CZ    1 
ATOM   394  N  NH1   . ARG A 1 77  ? -20.006 22.619  -3.309  1.00 38.49  ? 469 ARG A NH1   1 
ATOM   395  N  NH2   . ARG A 1 77  ? -20.931 22.328  -1.226  1.00 43.69  ? 469 ARG A NH2   1 
ATOM   396  N  N     . ARG A 1 78  ? -15.205 16.674  0.048   1.00 49.23  ? 470 ARG A N     1 
ATOM   397  C  CA    . ARG A 1 78  ? -13.895 16.678  0.711   1.00 40.14  ? 470 ARG A CA    1 
ATOM   398  C  C     . ARG A 1 78  ? -12.863 15.795  0.003   1.00 38.97  ? 470 ARG A C     1 
ATOM   399  O  O     . ARG A 1 78  ? -11.673 15.913  0.246   1.00 42.21  ? 470 ARG A O     1 
ATOM   400  C  CB    . ARG A 1 78  ? -14.039 16.241  2.169   1.00 45.65  ? 470 ARG A CB    1 
ATOM   401  C  CG    . ARG A 1 78  ? -14.379 14.766  2.342   1.00 48.12  ? 470 ARG A CG    1 
ATOM   402  C  CD    . ARG A 1 78  ? -14.746 14.400  3.803   1.00 48.18  ? 470 ARG A CD    1 
ATOM   403  N  NE    . ARG A 1 78  ? -14.987 12.965  3.865   1.00 52.40  ? 470 ARG A NE    1 
ATOM   404  C  CZ    . ARG A 1 78  ? -15.758 12.366  4.759   1.00 53.52  ? 470 ARG A CZ    1 
ATOM   405  N  NH1   . ARG A 1 78  ? -16.373 13.071  5.703   1.00 49.06  ? 470 ARG A NH1   1 
ATOM   406  N  NH2   . ARG A 1 78  ? -15.905 11.051  4.698   1.00 53.37  ? 470 ARG A NH2   1 
ATOM   407  N  N     . LYS A 1 79  ? -13.316 14.922  -0.885  1.00 36.13  ? 471 LYS A N     1 
ATOM   408  C  CA    . LYS A 1 79  ? -12.425 14.093  -1.658  1.00 36.53  ? 471 LYS A CA    1 
ATOM   409  C  C     . LYS A 1 79  ? -11.934 14.812  -2.932  1.00 43.94  ? 471 LYS A C     1 
ATOM   410  O  O     . LYS A 1 79  ? -10.967 14.394  -3.568  1.00 40.59  ? 471 LYS A O     1 
ATOM   411  C  CB    . LYS A 1 79  ? -13.146 12.798  -2.020  1.00 50.27  ? 471 LYS A CB    1 
ATOM   412  C  CG    . LYS A 1 79  ? -12.313 11.762  -2.751  1.00 57.38  ? 471 LYS A CG    1 
ATOM   413  C  CD    . LYS A 1 79  ? -13.037 10.402  -2.791  1.00 63.42  ? 471 LYS A CD    1 
ATOM   414  C  CE    . LYS A 1 79  ? -13.904 10.165  -1.549  1.00 52.09  ? 471 LYS A CE    1 
ATOM   415  N  NZ    . LYS A 1 79  ? -14.400 8.743   -1.463  1.00 58.99  ? 471 LYS A NZ    1 
ATOM   416  N  N     . ASN A 1 80  ? -12.595 15.901  -3.303  1.00 39.38  ? 472 ASN A N     1 
ATOM   417  C  CA    . ASN A 1 80  ? -12.232 16.604  -4.533  1.00 37.65  ? 472 ASN A CA    1 
ATOM   418  C  C     . ASN A 1 80  ? -10.878 17.288  -4.446  1.00 35.25  ? 472 ASN A C     1 
ATOM   419  O  O     . ASN A 1 80  ? -10.095 17.229  -5.387  1.00 41.49  ? 472 ASN A O     1 
ATOM   420  C  CB    . ASN A 1 80  ? -13.300 17.647  -4.894  1.00 37.32  ? 472 ASN A CB    1 
ATOM   421  C  CG    . ASN A 1 80  ? -14.574 17.017  -5.451  1.00 46.14  ? 472 ASN A CG    1 
ATOM   422  O  OD1   . ASN A 1 80  ? -14.765 15.793  -5.384  1.00 41.66  ? 472 ASN A OD1   1 
ATOM   423  N  ND2   . ASN A 1 80  ? -15.448 17.858  -6.023  1.00 43.17  ? 472 ASN A ND2   1 
ATOM   424  N  N     . CYS A 1 81  ? -10.624 17.955  -3.334  1.00 30.02  ? 473 CYS A N     1 
ATOM   425  C  CA    . CYS A 1 81  ? -9.452  18.797  -3.215  1.00 35.88  ? 473 CYS A CA    1 
ATOM   426  C  C     . CYS A 1 81  ? -8.674  18.553  -1.935  1.00 29.77  ? 473 CYS A C     1 
ATOM   427  O  O     . CYS A 1 81  ? -8.889  19.213  -0.944  1.00 31.53  ? 473 CYS A O     1 
ATOM   428  C  CB    . CYS A 1 81  ? -9.832  20.275  -3.285  1.00 35.35  ? 473 CYS A CB    1 
ATOM   429  S  SG    . CYS A 1 81  ? -8.385  21.283  -3.687  1.00 36.31  ? 473 CYS A SG    1 
ATOM   430  N  N     . PRO A 1 82  ? -7.778  17.568  -1.966  1.00 35.27  ? 474 PRO A N     1 
ATOM   431  C  CA    . PRO A 1 82  ? -6.854  17.305  -0.855  1.00 32.20  ? 474 PRO A CA    1 
ATOM   432  C  C     . PRO A 1 82  ? -6.140  18.589  -0.430  1.00 30.13  ? 474 PRO A C     1 
ATOM   433  O  O     . PRO A 1 82  ? -6.014  18.844  0.760   1.00 34.15  ? 474 PRO A O     1 
ATOM   434  C  CB    . PRO A 1 82  ? -5.863  16.305  -1.440  1.00 32.88  ? 474 PRO A CB    1 
ATOM   435  C  CG    . PRO A 1 82  ? -6.559  15.718  -2.676  1.00 34.71  ? 474 PRO A CG    1 
ATOM   436  C  CD    . PRO A 1 82  ? -7.552  16.706  -3.147  1.00 33.76  ? 474 PRO A CD    1 
ATOM   437  N  N     . ALA A 1 83  ? -5.724  19.412  -1.392  1.00 32.61  ? 475 ALA A N     1 
ATOM   438  C  CA    . ALA A 1 83  ? -5.018  20.669  -1.089  1.00 33.34  ? 475 ALA A CA    1 
ATOM   439  C  C     . ALA A 1 83  ? -5.775  21.595  -0.162  1.00 26.71  ? 475 ALA A C     1 
ATOM   440  O  O     . ALA A 1 83  ? -5.209  22.138  0.788   1.00 29.26  ? 475 ALA A O     1 
ATOM   441  C  CB    . ALA A 1 83  ? -4.694  21.418  -2.383  1.00 26.92  ? 475 ALA A CB    1 
ATOM   442  N  N     . CYS A 1 84  ? -7.049  21.813  -0.463  1.00 30.52  ? 476 CYS A N     1 
ATOM   443  C  CA    . CYS A 1 84  ? -7.840  22.752  0.327   1.00 30.47  ? 476 CYS A CA    1 
ATOM   444  C  C     . CYS A 1 84  ? -8.224  22.067  1.624   1.00 31.62  ? 476 CYS A C     1 
ATOM   445  O  O     . CYS A 1 84  ? -8.229  22.681  2.664   1.00 30.65  ? 476 CYS A O     1 
ATOM   446  C  CB    . CYS A 1 84  ? -9.077  23.248  -0.434  1.00 32.44  ? 476 CYS A CB    1 
ATOM   447  S  SG    . CYS A 1 84  ? -8.718  24.392  -1.839  1.00 30.88  ? 476 CYS A SG    1 
ATOM   448  N  N     . ARG A 1 85  ? -8.514  20.772  1.565   1.00 35.68  ? 477 ARG A N     1 
ATOM   449  C  CA    . ARG A 1 85  ? -8.809  20.037  2.788   1.00 33.82  ? 477 ARG A CA    1 
ATOM   450  C  C     . ARG A 1 85  ? -7.624  20.139  3.777   1.00 28.67  ? 477 ARG A C     1 
ATOM   451  O  O     . ARG A 1 85  ? -7.801  20.437  4.932   1.00 30.85  ? 477 ARG A O     1 
ATOM   452  C  CB    . ARG A 1 85  ? -9.114  18.569  2.463   1.00 35.47  ? 477 ARG A CB    1 
ATOM   453  C  CG    . ARG A 1 85  ? -9.822  17.840  3.610   1.00 41.80  ? 477 ARG A CG    1 
ATOM   454  C  CD    . ARG A 1 85  ? -9.872  16.342  3.383   1.00 36.97  ? 477 ARG A CD    1 
ATOM   455  N  NE    . ARG A 1 85  ? -10.703 15.634  4.355   1.00 36.59  ? 477 ARG A NE    1 
ATOM   456  C  CZ    . ARG A 1 85  ? -10.974 14.331  4.260   1.00 41.37  ? 477 ARG A CZ    1 
ATOM   457  N  NH1   . ARG A 1 85  ? -10.479 13.638  3.250   1.00 41.98  ? 477 ARG A NH1   1 
ATOM   458  N  NH2   . ARG A 1 85  ? -11.740 13.721  5.154   1.00 44.62  ? 477 ARG A NH2   1 
ATOM   459  N  N     . TYR A 1 86  ? -6.414  19.897  3.302   1.00 30.67  ? 478 TYR A N     1 
ATOM   460  C  CA    . TYR A 1 86  ? -5.247  19.986  4.166   1.00 30.40  ? 478 TYR A CA    1 
ATOM   461  C  C     . TYR A 1 86  ? -5.095  21.403  4.678   1.00 28.74  ? 478 TYR A C     1 
ATOM   462  O  O     . TYR A 1 86  ? -4.810  21.623  5.845   1.00 32.93  ? 478 TYR A O     1 
ATOM   463  C  CB    . TYR A 1 86  ? -3.993  19.552  3.416   1.00 35.08  ? 478 TYR A CB    1 
ATOM   464  C  CG    . TYR A 1 86  ? -2.766  19.546  4.287   1.00 31.39  ? 478 TYR A CG    1 
ATOM   465  C  CD1   . TYR A 1 86  ? -2.663  18.666  5.355   1.00 27.77  ? 478 TYR A CD1   1 
ATOM   466  C  CD2   . TYR A 1 86  ? -1.705  20.409  4.032   1.00 32.19  ? 478 TYR A CD2   1 
ATOM   467  C  CE1   . TYR A 1 86  ? -1.539  18.634  6.156   1.00 31.36  ? 478 TYR A CE1   1 
ATOM   468  C  CE2   . TYR A 1 86  ? -0.555  20.400  4.853   1.00 33.22  ? 478 TYR A CE2   1 
ATOM   469  C  CZ    . TYR A 1 86  ? -0.477  19.501  5.906   1.00 36.23  ? 478 TYR A CZ    1 
ATOM   470  O  OH    . TYR A 1 86  ? 0.632   19.487  6.740   1.00 34.13  ? 478 TYR A OH    1 
ATOM   471  N  N     . ARG A 1 87  ? -5.364  22.363  3.815   1.00 26.03  ? 479 ARG A N     1 
ATOM   472  C  CA    . ARG A 1 87  ? -5.298  23.765  4.204   1.00 28.29  ? 479 ARG A CA    1 
ATOM   473  C  C     . ARG A 1 87  ? -6.309  24.064  5.296   1.00 29.98  ? 479 ARG A C     1 
ATOM   474  O  O     . ARG A 1 87  ? -5.981  24.741  6.265   1.00 33.46  ? 479 ARG A O     1 
ATOM   475  C  CB    . ARG A 1 87  ? -5.527  24.698  2.994   1.00 30.67  ? 479 ARG A CB    1 
ATOM   476  C  CG    . ARG A 1 87  ? -5.482  26.211  3.377   1.00 35.22  ? 479 ARG A CG    1 
ATOM   477  C  CD    . ARG A 1 87  ? -5.871  27.131  2.211   1.00 36.27  ? 479 ARG A CD    1 
ATOM   478  N  NE    . ARG A 1 87  ? -7.049  26.589  1.551   1.00 46.13  ? 479 ARG A NE    1 
ATOM   479  C  CZ    . ARG A 1 87  ? -8.287  26.696  2.029   1.00 57.01  ? 479 ARG A CZ    1 
ATOM   480  N  NH1   . ARG A 1 87  ? -8.513  27.373  3.149   1.00 61.02  ? 479 ARG A NH1   1 
ATOM   481  N  NH2   . ARG A 1 87  ? -9.298  26.130  1.384   1.00 50.21  ? 479 ARG A NH2   1 
ATOM   482  N  N     . LYS A 1 88  ? -7.528  23.553  5.178   1.00 30.70  ? 480 LYS A N     1 
ATOM   483  C  CA    . LYS A 1 88  ? -8.500  23.801  6.254   1.00 34.19  ? 480 LYS A CA    1 
ATOM   484  C  C     . LYS A 1 88  ? -8.037  23.128  7.548   1.00 33.88  ? 480 LYS A C     1 
ATOM   485  O  O     . LYS A 1 88  ? -8.190  23.684  8.607   1.00 36.83  ? 480 LYS A O     1 
ATOM   486  C  CB    . LYS A 1 88  ? -9.897  23.314  5.852   1.00 38.11  ? 480 LYS A CB    1 
ATOM   487  C  CG    . LYS A 1 88  ? -10.631 24.249  4.901   1.00 41.13  ? 480 LYS A CG    1 
ATOM   488  C  CD    . LYS A 1 88  ? -12.123 23.896  4.778   1.00 44.78  ? 480 LYS A CD    1 
ATOM   489  C  CE    . LYS A 1 88  ? -12.934 24.299  6.025   1.00 46.81  ? 480 LYS A CE    1 
ATOM   490  N  NZ    . LYS A 1 88  ? -14.395 23.935  5.897   1.00 45.22  ? 480 LYS A NZ    1 
ATOM   491  N  N     . CYS A 1 89  ? -7.439  21.944  7.464   1.00 33.37  ? 481 CYS A N     1 
ATOM   492  C  CA    . CYS A 1 89  ? -6.902  21.309  8.674   1.00 33.39  ? 481 CYS A CA    1 
ATOM   493  C  C     . CYS A 1 89  ? -5.879  22.188  9.356   1.00 31.59  ? 481 CYS A C     1 
ATOM   494  O  O     . CYS A 1 89  ? -5.986  22.415  10.543  1.00 34.32  ? 481 CYS A O     1 
ATOM   495  C  CB    . CYS A 1 89  ? -6.249  19.956  8.363   1.00 32.94  ? 481 CYS A CB    1 
ATOM   496  S  SG    . CYS A 1 89  ? -7.391  18.699  7.798   1.00 38.45  ? 481 CYS A SG    1 
ATOM   497  N  N     . LEU A 1 90  ? -4.870  22.657  8.616   1.00 29.97  ? 482 LEU A N     1 
ATOM   498  C  CA    . LEU A 1 90  ? -3.861  23.552  9.205   1.00 33.96  ? 482 LEU A CA    1 
ATOM   499  C  C     . LEU A 1 90  ? -4.482  24.850  9.710   1.00 33.92  ? 482 LEU A C     1 
ATOM   500  O  O     . LEU A 1 90  ? -4.110  25.353  10.750  1.00 31.37  ? 482 LEU A O     1 
ATOM   501  C  CB    . LEU A 1 90  ? -2.760  23.914  8.190   1.00 29.34  ? 482 LEU A CB    1 
ATOM   502  C  CG    . LEU A 1 90  ? -1.906  22.763  7.687   1.00 31.22  ? 482 LEU A CG    1 
ATOM   503  C  CD1   . LEU A 1 90  ? -0.953  23.302  6.702   1.00 32.57  ? 482 LEU A CD1   1 
ATOM   504  C  CD2   . LEU A 1 90  ? -1.168  22.034  8.836   1.00 27.14  ? 482 LEU A CD2   1 
ATOM   505  N  N     . GLN A 1 91  ? -5.399  25.416  8.941   1.00 32.77  ? 483 GLN A N     1 
ATOM   506  C  CA    . GLN A 1 91  ? -6.007  26.670  9.367   1.00 39.04  ? 483 GLN A CA    1 
ATOM   507  C  C     . GLN A 1 91  ? -6.800  26.477  10.668  1.00 38.38  ? 483 GLN A C     1 
ATOM   508  O  O     . GLN A 1 91  ? -6.847  27.353  11.503  1.00 42.63  ? 483 GLN A O     1 
ATOM   509  C  CB    . GLN A 1 91  ? -6.917  27.220  8.271   1.00 39.22  ? 483 GLN A CB    1 
ATOM   510  C  CG    . GLN A 1 91  ? -7.487  28.574  8.595   1.00 45.89  ? 483 GLN A CG    1 
ATOM   511  C  CD    . GLN A 1 91  ? -6.507  29.693  8.334   1.00 46.61  ? 483 GLN A CD    1 
ATOM   512  O  OE1   . GLN A 1 91  ? -6.231  30.030  7.181   1.00 55.01  ? 483 GLN A OE1   1 
ATOM   513  N  NE2   . GLN A 1 91  ? -5.965  30.274  9.403   1.00 52.78  ? 483 GLN A NE2   1 
ATOM   514  N  N     . ALA A 1 92  ? -7.401  25.307  10.842  1.00 37.74  ? 484 ALA A N     1 
ATOM   515  C  CA    . ALA A 1 92  ? -8.157  25.022  12.056  1.00 36.08  ? 484 ALA A CA    1 
ATOM   516  C  C     . ALA A 1 92  ? -7.250  24.775  13.264  1.00 37.81  ? 484 ALA A C     1 
ATOM   517  O  O     . ALA A 1 92  ? -7.731  24.761  14.384  1.00 38.66  ? 484 ALA A O     1 
ATOM   518  C  CB    . ALA A 1 92  ? -9.077  23.810  11.834  1.00 38.82  ? 484 ALA A CB    1 
ATOM   519  N  N     . GLY A 1 93  ? -5.945  24.588  13.044  1.00 38.26  ? 485 GLY A N     1 
ATOM   520  C  CA    . GLY A 1 93  ? -4.992  24.452  14.151  1.00 32.03  ? 485 GLY A CA    1 
ATOM   521  C  C     . GLY A 1 93  ? -4.569  23.018  14.437  1.00 31.43  ? 485 GLY A C     1 
ATOM   522  O  O     . GLY A 1 93  ? -3.927  22.719  15.444  1.00 35.77  ? 485 GLY A O     1 
ATOM   523  N  N     . MET A 1 94  ? -4.909  22.108  13.545  1.00 33.94  ? 486 MET A N     1 
ATOM   524  C  CA    . MET A 1 94  ? -4.570  20.715  13.772  1.00 35.28  ? 486 MET A CA    1 
ATOM   525  C  C     . MET A 1 94  ? -3.067  20.516  13.831  1.00 35.82  ? 486 MET A C     1 
ATOM   526  O  O     . MET A 1 94  ? -2.304  21.111  13.025  1.00 32.01  ? 486 MET A O     1 
ATOM   527  C  CB    . MET A 1 94  ? -5.168  19.829  12.674  1.00 32.86  ? 486 MET A CB    1 
ATOM   528  C  CG    . MET A 1 94  ? -6.654  19.682  12.786  1.00 36.32  ? 486 MET A CG    1 
ATOM   529  S  SD    . MET A 1 94  ? -7.388  18.667  11.489  1.00 39.07  ? 486 MET A SD    1 
ATOM   530  C  CE    . MET A 1 94  ? -6.991  16.987  12.008  1.00 35.56  ? 486 MET A CE    1 
ATOM   531  N  N     . ASN A 1 95  ? -2.640  19.675  14.765  1.00 31.88  ? 487 ASN A N     1 
ATOM   532  C  CA    . ASN A 1 95  ? -1.212  19.371  14.907  1.00 37.55  ? 487 ASN A CA    1 
ATOM   533  C  C     . ASN A 1 95  ? -1.029  18.076  15.682  1.00 38.80  ? 487 ASN A C     1 
ATOM   534  O  O     . ASN A 1 95  ? -1.786  17.820  16.607  1.00 41.23  ? 487 ASN A O     1 
ATOM   535  C  CB    . ASN A 1 95  ? -0.478  20.521  15.597  1.00 40.02  ? 487 ASN A CB    1 
ATOM   536  C  CG    . ASN A 1 95  ? -0.962  20.759  17.031  1.00 44.05  ? 487 ASN A CG    1 
ATOM   537  O  OD1   . ASN A 1 95  ? -2.085  21.225  17.261  1.00 45.69  ? 487 ASN A OD1   1 
ATOM   538  N  ND2   . ASN A 1 95  ? -0.112  20.434  17.996  1.00 46.12  ? 487 ASN A ND2   1 
ATOM   539  N  N     . LEU A 1 96  ? -0.042  17.268  15.301  1.00 40.55  ? 488 LEU A N     1 
ATOM   540  C  CA    . LEU A 1 96  ? 0.107   15.921  15.865  1.00 50.48  ? 488 LEU A CA    1 
ATOM   541  C  C     . LEU A 1 96  ? 0.390   15.962  17.353  1.00 56.23  ? 488 LEU A C     1 
ATOM   542  O  O     . LEU A 1 96  ? -0.023  15.074  18.089  1.00 60.64  ? 488 LEU A O     1 
ATOM   543  C  CB    . LEU A 1 96  ? 1.227   15.134  15.180  1.00 49.45  ? 488 LEU A CB    1 
ATOM   544  C  CG    . LEU A 1 96  ? 1.019   14.592  13.769  1.00 55.62  ? 488 LEU A CG    1 
ATOM   545  C  CD1   . LEU A 1 96  ? 1.990   13.446  13.505  1.00 55.95  ? 488 LEU A CD1   1 
ATOM   546  C  CD2   . LEU A 1 96  ? -0.420  14.155  13.565  1.00 51.00  ? 488 LEU A CD2   1 
ATOM   547  N  N     . GLU A 1 97  ? 1.090   17.009  17.777  1.00 54.78  ? 489 GLU A N     1 
ATOM   548  C  CA    . GLU A 1 97  ? 1.621   17.128  19.119  1.00 57.90  ? 489 GLU A CA    1 
ATOM   549  C  C     . GLU A 1 97  ? 0.578   17.659  20.110  1.00 64.43  ? 489 GLU A C     1 
ATOM   550  O  O     . GLU A 1 97  ? 0.901   17.900  21.270  1.00 69.99  ? 489 GLU A O     1 
ATOM   551  C  CB    . GLU A 1 97  ? 2.838   18.059  19.096  1.00 61.19  ? 489 GLU A CB    1 
ATOM   552  C  CG    . GLU A 1 97  ? 3.998   17.587  18.180  1.00 66.65  ? 489 GLU A CG    1 
ATOM   553  C  CD    . GLU A 1 97  ? 3.743   17.805  16.655  1.00 73.70  ? 489 GLU A CD    1 
ATOM   554  O  OE1   . GLU A 1 97  ? 2.773   18.525  16.272  1.00 56.68  ? 489 GLU A OE1   1 
ATOM   555  O  OE2   . GLU A 1 97  ? 4.524   17.245  15.833  1.00 67.06  ? 489 GLU A OE2   1 
ATOM   556  N  N     . ALA A 1 98  ? -0.666  17.844  19.659  1.00 57.41  ? 490 ALA A N     1 
ATOM   557  C  CA    . ALA A 1 98  ? -1.678  18.562  20.454  1.00 58.42  ? 490 ALA A CA    1 
ATOM   558  C  C     . ALA A 1 98  ? -2.083  17.873  21.768  1.00 68.88  ? 490 ALA A C     1 
ATOM   559  O  O     . ALA A 1 98  ? -2.107  18.527  22.817  1.00 74.48  ? 490 ALA A O     1 
ATOM   560  C  CB    . ALA A 1 98  ? -2.917  18.810  19.622  1.00 46.48  ? 490 ALA A CB    1 
ATOM   561  N  N     . ARG A 1 99  ? -2.414  16.581  21.717  1.00 64.23  ? 491 ARG A N     1 
ATOM   562  C  CA    . ARG A 1 99  ? -2.817  15.846  22.925  1.00 66.88  ? 491 ARG A CA    1 
ATOM   563  C  C     . ARG A 1 99  ? -1.697  15.852  23.962  1.00 71.34  ? 491 ARG A C     1 
ATOM   564  O  O     . ARG A 1 99  ? -1.956  15.963  25.162  1.00 76.87  ? 491 ARG A O     1 
ATOM   565  C  CB    . ARG A 1 99  ? -3.214  14.400  22.599  1.00 62.40  ? 491 ARG A CB    1 
ATOM   566  C  CG    . ARG A 1 99  ? -3.904  13.642  23.750  1.00 62.41  ? 491 ARG A CG    1 
ATOM   567  C  CD    . ARG A 1 99  ? -3.867  12.109  23.538  1.00 61.74  ? 491 ARG A CD    1 
ATOM   568  N  NE    . ARG A 1 99  ? -4.809  11.416  24.416  1.00 61.63  ? 491 ARG A NE    1 
ATOM   569  C  CZ    . ARG A 1 99  ? -5.139  10.126  24.330  1.00 61.26  ? 491 ARG A CZ    1 
ATOM   570  N  NH1   . ARG A 1 99  ? -4.593  9.339   23.403  1.00 52.78  ? 491 ARG A NH1   1 
ATOM   571  N  NH2   . ARG A 1 99  ? -6.027  9.622   25.186  1.00 55.65  ? 491 ARG A NH2   1 
ATOM   572  N  N     . LYS A 1 100 ? -0.457  15.756  23.488  1.00 73.74  ? 492 LYS A N     1 
ATOM   573  C  CA    . LYS A 1 100 ? 0.740   15.694  24.332  1.00 75.60  ? 492 LYS A CA    1 
ATOM   574  C  C     . LYS A 1 100 ? 0.896   16.892  25.307  1.00 83.53  ? 492 LYS A C     1 
ATOM   575  O  O     . LYS A 1 100 ? 1.826   16.930  26.120  1.00 88.34  ? 492 LYS A O     1 
ATOM   576  C  CB    . LYS A 1 100 ? 1.973   15.577  23.417  1.00 82.56  ? 492 LYS A CB    1 
ATOM   577  C  CG    . LYS A 1 100 ? 3.299   15.222  24.084  1.00 86.22  ? 492 LYS A CG    1 
ATOM   578  C  CD    . LYS A 1 100 ? 4.464   15.619  23.184  1.00 82.54  ? 492 LYS A CD    1 
ATOM   579  C  CE    . LYS A 1 100 ? 4.294   17.044  22.665  1.00 80.64  ? 492 LYS A CE    1 
ATOM   580  N  NZ    . LYS A 1 100 ? 5.300   17.379  21.612  1.00 83.40  ? 492 LYS A NZ    1 
ATOM   581  N  N     . THR A 1 101 ? -0.015  17.863  25.239  1.00 84.86  ? 493 THR A N     1 
ATOM   582  C  CA    . THR A 1 101 ? 0.025   19.041  26.120  1.00 87.04  ? 493 THR A CA    1 
ATOM   583  C  C     . THR A 1 101 ? -1.370  19.587  26.483  1.00 84.70  ? 493 THR A C     1 
ATOM   584  O  O     . THR A 1 101 ? -1.909  20.323  25.659  1.00 77.12  ? 493 THR A O     1 
ATOM   585  C  CB    . THR A 1 101 ? 0.813   20.216  25.455  1.00 88.40  ? 493 THR A CB    1 
ATOM   586  O  OG1   . THR A 1 101 ? 0.228   20.523  24.181  1.00 83.27  ? 493 THR A OG1   1 
ATOM   587  C  CG2   . THR A 1 101 ? 2.284   19.861  25.249  1.00 89.92  ? 493 THR A CG2   1 
ATOM   588  N  N     . LYS A 1 102 ? -2.016  19.295  27.629  1.00 83.05  ? 494 LYS A N     1 
ATOM   589  C  CA    . LYS A 1 102 ? -1.777  18.327  28.732  1.00 85.20  ? 494 LYS A CA    1 
ATOM   590  C  C     . LYS A 1 102 ? -0.777  18.784  29.829  1.00 88.15  ? 494 LYS A C     1 
ATOM   591  O  O     . LYS A 1 102 ? -0.830  18.269  30.956  1.00 85.63  ? 494 LYS A O     1 
ATOM   592  C  CB    . LYS A 1 102 ? -1.381  16.932  28.215  1.00 83.15  ? 494 LYS A CB    1 
ATOM   593  C  CG    . LYS A 1 102 ? -1.396  15.904  29.339  1.00 81.91  ? 494 LYS A CG    1 
ATOM   594  C  CD    . LYS A 1 102 ? -0.846  14.547  29.003  1.00 81.92  ? 494 LYS A CD    1 
ATOM   595  C  CE    . LYS A 1 102 ? -1.050  13.646  30.217  1.00 85.27  ? 494 LYS A CE    1 
ATOM   596  N  NZ    . LYS A 1 102 ? -2.145  14.166  31.104  1.00 86.30  ? 494 LYS A NZ    1 
ATOM   597  N  N     . LYS A 1 103 ? 0.082   19.765  29.552  1.00 88.11  ? 495 LYS A N     1 
ATOM   598  C  CA    . LYS A 1 103 ? 0.887   20.369  30.624  1.00 87.49  ? 495 LYS A CA    1 
ATOM   599  C  C     . LYS A 1 103 ? 1.314   21.794  30.288  1.00 88.31  ? 495 LYS A C     1 
ATOM   600  O  O     . LYS A 1 103 ? 0.546   22.571  29.714  1.00 86.28  ? 495 LYS A O     1 
ATOM   601  C  CB    . LYS A 1 103 ? 2.120   19.512  30.923  1.00 87.09  ? 495 LYS A CB    1 
ATOM   602  C  CG    . LYS A 1 103 ? 2.883   19.049  29.684  1.00 89.56  ? 495 LYS A CG    1 
ATOM   603  C  CD    . LYS A 1 103 ? 4.377   18.956  29.970  1.00 92.78  ? 495 LYS A CD    1 
ATOM   604  C  CE    . LYS A 1 103 ? 5.185   19.025  28.692  1.00 85.08  ? 495 LYS A CE    1 
ATOM   605  N  NZ    . LYS A 1 103 ? 5.102   20.397  28.122  1.00 84.48  ? 495 LYS A NZ    1 
ATOM   606  N  N     . LYS B 1 27  ? -2.451  15.507  -31.456 1.00 65.27  ? 419 LYS B N     1 
ATOM   607  C  CA    . LYS B 1 27  ? -1.484  15.174  -30.413 1.00 72.29  ? 419 LYS B CA    1 
ATOM   608  C  C     . LYS B 1 27  ? -2.122  15.002  -29.018 1.00 72.72  ? 419 LYS B C     1 
ATOM   609  O  O     . LYS B 1 27  ? -1.825  14.030  -28.309 1.00 72.72  ? 419 LYS B O     1 
ATOM   610  C  CB    . LYS B 1 27  ? -0.386  16.252  -30.346 1.00 71.21  ? 419 LYS B CB    1 
ATOM   611  C  CG    . LYS B 1 27  ? 0.994   15.800  -30.819 1.00 75.47  ? 419 LYS B CG    1 
ATOM   612  C  CD    . LYS B 1 27  ? 1.860   16.994  -31.229 1.00 73.67  ? 419 LYS B CD    1 
ATOM   613  C  CE    . LYS B 1 27  ? 3.236   16.554  -31.729 1.00 75.46  ? 419 LYS B CE    1 
ATOM   614  N  NZ    . LYS B 1 27  ? 3.219   15.177  -32.296 1.00 73.73  ? 419 LYS B NZ    1 
ATOM   615  N  N     . LEU B 1 28  ? -2.998  15.932  -28.628 1.00 69.61  ? 420 LEU B N     1 
ATOM   616  C  CA    . LEU B 1 28  ? -3.423  16.048  -27.219 1.00 63.89  ? 420 LEU B CA    1 
ATOM   617  C  C     . LEU B 1 28  ? -4.924  15.875  -26.943 1.00 60.16  ? 420 LEU B C     1 
ATOM   618  O  O     . LEU B 1 28  ? -5.779  16.261  -27.749 1.00 61.73  ? 420 LEU B O     1 
ATOM   619  C  CB    . LEU B 1 28  ? -2.980  17.407  -26.674 1.00 61.60  ? 420 LEU B CB    1 
ATOM   620  C  CG    . LEU B 1 28  ? -1.490  17.706  -26.843 1.00 65.90  ? 420 LEU B CG    1 
ATOM   621  C  CD1   . LEU B 1 28  ? -1.177  19.100  -26.348 1.00 60.94  ? 420 LEU B CD1   1 
ATOM   622  C  CD2   . LEU B 1 28  ? -0.637  16.665  -26.110 1.00 64.01  ? 420 LEU B CD2   1 
ATOM   623  N  N     . CYS B 1 29  ? -5.231  15.289  -25.788 1.00 59.42  ? 421 CYS B N     1 
ATOM   624  C  CA    . CYS B 1 29  ? -6.608  15.156  -25.311 1.00 54.79  ? 421 CYS B CA    1 
ATOM   625  C  C     . CYS B 1 29  ? -7.282  16.522  -25.219 1.00 51.06  ? 421 CYS B C     1 
ATOM   626  O  O     . CYS B 1 29  ? -6.739  17.462  -24.654 1.00 54.24  ? 421 CYS B O     1 
ATOM   627  C  CB    . CYS B 1 29  ? -6.641  14.454  -23.940 1.00 55.47  ? 421 CYS B CB    1 
ATOM   628  S  SG    . CYS B 1 29  ? -8.290  14.338  -23.166 1.00 48.18  ? 421 CYS B SG    1 
ATOM   629  N  N     . LEU B 1 30  ? -8.471  16.629  -25.781 1.00 51.58  ? 422 LEU B N     1 
ATOM   630  C  CA    . LEU B 1 30  ? -9.161  17.899  -25.826 1.00 49.91  ? 422 LEU B CA    1 
ATOM   631  C  C     . LEU B 1 30  ? -9.794  18.241  -24.474 1.00 50.91  ? 422 LEU B C     1 
ATOM   632  O  O     . LEU B 1 30  ? -10.315 19.334  -24.301 1.00 50.68  ? 422 LEU B O     1 
ATOM   633  C  CB    . LEU B 1 30  ? -10.225 17.891  -26.935 1.00 53.54  ? 422 LEU B CB    1 
ATOM   634  C  CG    . LEU B 1 30  ? -9.767  18.380  -28.321 1.00 58.86  ? 422 LEU B CG    1 
ATOM   635  C  CD1   . LEU B 1 30  ? -8.592  17.563  -28.834 1.00 59.06  ? 422 LEU B CD1   1 
ATOM   636  C  CD2   . LEU B 1 30  ? -10.903 18.344  -29.332 1.00 58.09  ? 422 LEU B CD2   1 
ATOM   637  N  N     . VAL B 1 31  ? -9.754  17.305  -23.529 1.00 46.50  ? 423 VAL B N     1 
ATOM   638  C  CA    . VAL B 1 31  ? -10.319 17.533  -22.209 1.00 44.78  ? 423 VAL B CA    1 
ATOM   639  C  C     . VAL B 1 31  ? -9.227  17.876  -21.193 1.00 49.81  ? 423 VAL B C     1 
ATOM   640  O  O     . VAL B 1 31  ? -9.348  18.857  -20.475 1.00 46.66  ? 423 VAL B O     1 
ATOM   641  C  CB    . VAL B 1 31  ? -11.130 16.316  -21.721 1.00 45.38  ? 423 VAL B CB    1 
ATOM   642  C  CG1   . VAL B 1 31  ? -11.521 16.469  -20.244 1.00 47.23  ? 423 VAL B CG1   1 
ATOM   643  C  CG2   . VAL B 1 31  ? -12.369 16.167  -22.570 1.00 46.74  ? 423 VAL B CG2   1 
ATOM   644  N  N     . CYS B 1 32  ? -8.152  17.096  -21.150 1.00 47.96  ? 424 CYS B N     1 
ATOM   645  C  CA    . CYS B 1 32  ? -7.119  17.336  -20.154 1.00 46.46  ? 424 CYS B CA    1 
ATOM   646  C  C     . CYS B 1 32  ? -5.742  17.679  -20.715 1.00 53.12  ? 424 CYS B C     1 
ATOM   647  O  O     . CYS B 1 32  ? -4.813  17.911  -19.940 1.00 53.81  ? 424 CYS B O     1 
ATOM   648  C  CB    . CYS B 1 32  ? -6.975  16.114  -19.255 1.00 48.15  ? 424 CYS B CB    1 
ATOM   649  S  SG    . CYS B 1 32  ? -6.257  14.693  -20.082 1.00 48.94  ? 424 CYS B SG    1 
ATOM   650  N  N     . SER B 1 33  ? -5.602  17.695  -22.042 1.00 54.95  ? 425 SER B N     1 
ATOM   651  C  CA    . SER B 1 33  ? -4.317  17.974  -22.696 1.00 53.18  ? 425 SER B CA    1 
ATOM   652  C  C     . SER B 1 33  ? -3.234  16.920  -22.437 1.00 55.90  ? 425 SER B C     1 
ATOM   653  O  O     . SER B 1 33  ? -2.073  17.127  -22.791 1.00 60.50  ? 425 SER B O     1 
ATOM   654  C  CB    . SER B 1 33  ? -3.787  19.353  -22.281 1.00 56.78  ? 425 SER B CB    1 
ATOM   655  O  OG    . SER B 1 33  ? -4.766  20.358  -22.509 1.00 59.87  ? 425 SER B OG    1 
ATOM   656  N  N     . ASP B 1 34  ? -3.602  15.789  -21.841 1.00 51.79  ? 426 ASP B N     1 
ATOM   657  C  CA    . ASP B 1 34  ? -2.693  14.650  -21.792 1.00 56.56  ? 426 ASP B CA    1 
ATOM   658  C  C     . ASP B 1 34  ? -2.510  14.146  -23.228 1.00 61.85  ? 426 ASP B C     1 
ATOM   659  O  O     . ASP B 1 34  ? -3.200  14.603  -24.137 1.00 54.15  ? 426 ASP B O     1 
ATOM   660  C  CB    . ASP B 1 34  ? -3.239  13.548  -20.886 1.00 51.53  ? 426 ASP B CB    1 
ATOM   661  C  CG    . ASP B 1 34  ? -2.203  12.528  -20.513 1.00 59.41  ? 426 ASP B CG    1 
ATOM   662  O  OD1   . ASP B 1 34  ? -1.055  12.644  -21.006 1.00 64.32  ? 426 ASP B OD1   1 
ATOM   663  O  OD2   . ASP B 1 34  ? -2.537  11.609  -19.725 1.00 61.42  ? 426 ASP B OD2   1 
ATOM   664  N  N     . GLU B 1 35  ? -1.594  13.207  -23.441 1.00 65.48  ? 427 GLU B N     1 
ATOM   665  C  CA    . GLU B 1 35  ? -1.388  12.698  -24.790 1.00 68.33  ? 427 GLU B CA    1 
ATOM   666  C  C     . GLU B 1 35  ? -2.579  11.834  -25.209 1.00 64.36  ? 427 GLU B C     1 
ATOM   667  O  O     . GLU B 1 35  ? -2.971  10.899  -24.503 1.00 61.56  ? 427 GLU B O     1 
ATOM   668  C  CB    . GLU B 1 35  ? -0.070  11.925  -24.887 1.00 69.87  ? 427 GLU B CB    1 
ATOM   669  C  CG    . GLU B 1 35  ? 1.173   12.826  -24.852 1.00 71.64  ? 427 GLU B CG    1 
ATOM   670  C  CD    . GLU B 1 35  ? 2.438   12.113  -25.319 1.00 84.01  ? 427 GLU B CD    1 
ATOM   671  O  OE1   . GLU B 1 35  ? 2.327   10.976  -25.840 1.00 84.54  ? 427 GLU B OE1   1 
ATOM   672  O  OE2   . GLU B 1 35  ? 3.543   12.689  -25.167 1.00 82.64  ? 427 GLU B OE2   1 
ATOM   673  N  N     . ALA B 1 36  ? -3.166  12.182  -26.352 1.00 62.05  ? 428 ALA B N     1 
ATOM   674  C  CA    . ALA B 1 36  ? -4.366  11.506  -26.839 1.00 66.15  ? 428 ALA B CA    1 
ATOM   675  C  C     . ALA B 1 36  ? -4.052  10.115  -27.370 1.00 66.77  ? 428 ALA B C     1 
ATOM   676  O  O     . ALA B 1 36  ? -2.921  9.825   -27.752 1.00 69.32  ? 428 ALA B O     1 
ATOM   677  C  CB    . ALA B 1 36  ? -5.039  12.335  -27.914 1.00 60.60  ? 428 ALA B CB    1 
ATOM   678  N  N     . SER B 1 37  ? -5.059  9.254   -27.387 1.00 62.68  ? 429 SER B N     1 
ATOM   679  C  CA    . SER B 1 37  ? -4.864  7.901   -27.867 1.00 60.92  ? 429 SER B CA    1 
ATOM   680  C  C     . SER B 1 37  ? -5.642  7.681   -29.157 1.00 67.01  ? 429 SER B C     1 
ATOM   681  O  O     . SER B 1 37  ? -5.319  6.782   -29.929 1.00 71.65  ? 429 SER B O     1 
ATOM   682  C  CB    . SER B 1 37  ? -5.280  6.883   -26.802 1.00 60.59  ? 429 SER B CB    1 
ATOM   683  O  OG    . SER B 1 37  ? -6.677  6.915   -26.573 1.00 59.18  ? 429 SER B OG    1 
ATOM   684  N  N     . GLY B 1 38  ? -6.658  8.510   -29.396 1.00 62.29  ? 430 GLY B N     1 
ATOM   685  C  CA    . GLY B 1 38  ? -7.452  8.416   -30.611 1.00 58.09  ? 430 GLY B CA    1 
ATOM   686  C  C     . GLY B 1 38  ? -8.765  9.175   -30.510 1.00 59.40  ? 430 GLY B C     1 
ATOM   687  O  O     . GLY B 1 38  ? -8.949  9.984   -29.620 1.00 60.65  ? 430 GLY B O     1 
ATOM   688  N  N     . CYS B 1 39  ? -9.689  8.920   -31.421 1.00 53.32  ? 431 CYS B N     1 
ATOM   689  C  CA    . CYS B 1 39  ? -10.952 9.639   -31.418 1.00 56.90  ? 431 CYS B CA    1 
ATOM   690  C  C     . CYS B 1 39  ? -12.054 8.819   -30.740 1.00 60.21  ? 431 CYS B C     1 
ATOM   691  O  O     . CYS B 1 39  ? -12.726 7.997   -31.383 1.00 61.40  ? 431 CYS B O     1 
ATOM   692  C  CB    . CYS B 1 39  ? -11.349 10.007  -32.847 1.00 57.52  ? 431 CYS B CB    1 
ATOM   693  S  SG    . CYS B 1 39  ? -13.001 10.699  -32.996 1.00 73.32  ? 431 CYS B SG    1 
ATOM   694  N  N     . HIS B 1 40  ? -12.233 9.059   -29.442 1.00 53.39  ? 432 HIS B N     1 
ATOM   695  C  CA    . HIS B 1 40  ? -13.151 8.286   -28.604 1.00 58.43  ? 432 HIS B CA    1 
ATOM   696  C  C     . HIS B 1 40  ? -14.451 9.015   -28.392 1.00 58.80  ? 432 HIS B C     1 
ATOM   697  O  O     . HIS B 1 40  ? -14.452 10.187  -28.020 1.00 61.68  ? 432 HIS B O     1 
ATOM   698  C  CB    . HIS B 1 40  ? -12.523 7.991   -27.247 1.00 56.81  ? 432 HIS B CB    1 
ATOM   699  C  CG    . HIS B 1 40  ? -11.139 7.438   -27.338 1.00 58.08  ? 432 HIS B CG    1 
ATOM   700  N  ND1   . HIS B 1 40  ? -10.861 6.228   -27.935 1.00 58.97  ? 432 HIS B ND1   1 
ATOM   701  C  CD2   . HIS B 1 40  ? -9.954  7.932   -26.912 1.00 56.67  ? 432 HIS B CD2   1 
ATOM   702  C  CE1   . HIS B 1 40  ? -9.561  5.997   -27.867 1.00 60.58  ? 432 HIS B CE1   1 
ATOM   703  N  NE2   . HIS B 1 40  ? -8.989  7.017   -27.254 1.00 62.56  ? 432 HIS B NE2   1 
ATOM   704  N  N     . TYR B 1 41  ? -15.558 8.323   -28.629 1.00 58.59  ? 433 TYR B N     1 
ATOM   705  C  CA    . TYR B 1 41  ? -16.883 8.904   -28.455 1.00 59.26  ? 433 TYR B CA    1 
ATOM   706  C  C     . TYR B 1 41  ? -17.057 10.231  -29.206 1.00 61.19  ? 433 TYR B C     1 
ATOM   707  O  O     . TYR B 1 41  ? -17.818 11.100  -28.774 1.00 63.73  ? 433 TYR B O     1 
ATOM   708  C  CB    . TYR B 1 41  ? -17.164 9.094   -26.966 1.00 57.13  ? 433 TYR B CB    1 
ATOM   709  C  CG    . TYR B 1 41  ? -17.010 7.817   -26.188 1.00 55.98  ? 433 TYR B CG    1 
ATOM   710  C  CD1   . TYR B 1 41  ? -17.578 6.636   -26.651 1.00 61.02  ? 433 TYR B CD1   1 
ATOM   711  C  CD2   . TYR B 1 41  ? -16.280 7.777   -25.008 1.00 52.57  ? 433 TYR B CD2   1 
ATOM   712  C  CE1   . TYR B 1 41  ? -17.443 5.452   -25.952 1.00 58.52  ? 433 TYR B CE1   1 
ATOM   713  C  CE2   . TYR B 1 41  ? -16.136 6.596   -24.300 1.00 56.92  ? 433 TYR B CE2   1 
ATOM   714  C  CZ    . TYR B 1 41  ? -16.720 5.435   -24.779 1.00 57.97  ? 433 TYR B CZ    1 
ATOM   715  O  OH    . TYR B 1 41  ? -16.590 4.254   -24.089 1.00 58.49  ? 433 TYR B OH    1 
ATOM   716  N  N     . GLY B 1 42  ? -16.335 10.382  -30.314 1.00 61.40  ? 434 GLY B N     1 
ATOM   717  C  CA    . GLY B 1 42  ? -16.514 11.511  -31.215 1.00 61.04  ? 434 GLY B CA    1 
ATOM   718  C  C     . GLY B 1 42  ? -15.487 12.613  -31.063 1.00 61.75  ? 434 GLY B C     1 
ATOM   719  O  O     . GLY B 1 42  ? -15.508 13.602  -31.801 1.00 64.12  ? 434 GLY B O     1 
ATOM   720  N  N     . VAL B 1 43  ? -14.577 12.441  -30.106 1.00 62.89  ? 435 VAL B N     1 
ATOM   721  C  CA    . VAL B 1 43  ? -13.647 13.497  -29.734 1.00 56.39  ? 435 VAL B CA    1 
ATOM   722  C  C     . VAL B 1 43  ? -12.258 12.948  -29.476 1.00 54.33  ? 435 VAL B C     1 
ATOM   723  O  O     . VAL B 1 43  ? -12.111 11.884  -28.887 1.00 55.25  ? 435 VAL B O     1 
ATOM   724  C  CB    . VAL B 1 43  ? -14.141 14.239  -28.474 1.00 54.73  ? 435 VAL B CB    1 
ATOM   725  C  CG1   . VAL B 1 43  ? -13.078 15.178  -27.946 1.00 56.44  ? 435 VAL B CG1   1 
ATOM   726  C  CG2   . VAL B 1 43  ? -15.431 14.990  -28.766 1.00 56.34  ? 435 VAL B CG2   1 
ATOM   727  N  N     . LEU B 1 44  ? -11.241 13.680  -29.907 1.00 51.40  ? 436 LEU B N     1 
ATOM   728  C  CA    . LEU B 1 44  ? -9.863  13.304  -29.641 1.00 51.00  ? 436 LEU B CA    1 
ATOM   729  C  C     . LEU B 1 44  ? -9.563  13.370  -28.140 1.00 58.81  ? 436 LEU B C     1 
ATOM   730  O  O     . LEU B 1 44  ? -9.484  14.460  -27.559 1.00 54.56  ? 436 LEU B O     1 
ATOM   731  C  CB    . LEU B 1 44  ? -8.920  14.219  -30.417 1.00 47.81  ? 436 LEU B CB    1 
ATOM   732  C  CG    . LEU B 1 44  ? -7.417  13.979  -30.294 1.00 58.08  ? 436 LEU B CG    1 
ATOM   733  C  CD1   . LEU B 1 44  ? -7.052  12.612  -30.865 1.00 60.66  ? 436 LEU B CD1   1 
ATOM   734  C  CD2   . LEU B 1 44  ? -6.636  15.094  -30.997 1.00 56.50  ? 436 LEU B CD2   1 
ATOM   735  N  N     . THR B 1 45  ? -9.415  12.211  -27.500 1.00 53.48  ? 437 THR B N     1 
ATOM   736  C  CA    . THR B 1 45  ? -9.162  12.187  -26.064 1.00 53.73  ? 437 THR B CA    1 
ATOM   737  C  C     . THR B 1 45  ? -8.076  11.202  -25.673 1.00 58.29  ? 437 THR B C     1 
ATOM   738  O  O     . THR B 1 45  ? -7.650  10.380  -26.492 1.00 56.71  ? 437 THR B O     1 
ATOM   739  C  CB    . THR B 1 45  ? -10.418 11.813  -25.275 1.00 54.41  ? 437 THR B CB    1 
ATOM   740  O  OG1   . THR B 1 45  ? -10.863 10.518  -25.693 1.00 62.30  ? 437 THR B OG1   1 
ATOM   741  C  CG2   . THR B 1 45  ? -11.529 12.816  -25.492 1.00 55.89  ? 437 THR B CG2   1 
ATOM   742  N  N     . CYS B 1 46  ? -7.650  11.286  -24.410 1.00 52.22  ? 438 CYS B N     1 
ATOM   743  C  CA    . CYS B 1 46  ? -6.761  10.299  -23.804 1.00 48.42  ? 438 CYS B CA    1 
ATOM   744  C  C     . CYS B 1 46  ? -7.552  9.096   -23.313 1.00 49.62  ? 438 CYS B C     1 
ATOM   745  O  O     . CYS B 1 46  ? -8.787  9.096   -23.345 1.00 49.25  ? 438 CYS B O     1 
ATOM   746  C  CB    . CYS B 1 46  ? -5.981  10.912  -22.639 1.00 52.06  ? 438 CYS B CB    1 
ATOM   747  S  SG    . CYS B 1 46  ? -6.973  11.300  -21.124 1.00 47.04  ? 438 CYS B SG    1 
ATOM   748  N  N     . GLY B 1 47  ? -6.833  8.086   -22.827 1.00 52.28  ? 439 GLY B N     1 
ATOM   749  C  CA    . GLY B 1 47  ? -7.438  6.896   -22.260 1.00 47.98  ? 439 GLY B CA    1 
ATOM   750  C  C     . GLY B 1 47  ? -8.261  7.091   -20.989 1.00 47.46  ? 439 GLY B C     1 
ATOM   751  O  O     . GLY B 1 47  ? -9.384  6.586   -20.898 1.00 47.31  ? 439 GLY B O     1 
ATOM   752  N  N     . SER B 1 48  ? -7.739  7.801   -19.991 1.00 49.06  ? 440 SER B N     1 
ATOM   753  C  CA    . SER B 1 48  ? -8.535  7.959   -18.770 1.00 47.24  ? 440 SER B CA    1 
ATOM   754  C  C     . SER B 1 48  ? -9.777  8.813   -19.033 1.00 42.77  ? 440 SER B C     1 
ATOM   755  O  O     . SER B 1 48  ? -10.840 8.530   -18.496 1.00 44.49  ? 440 SER B O     1 
ATOM   756  C  CB    . SER B 1 48  ? -7.700  8.536   -17.610 1.00 54.35  ? 440 SER B CB    1 
ATOM   757  O  OG    . SER B 1 48  ? -7.286  9.857   -17.834 1.00 55.54  ? 440 SER B OG    1 
ATOM   758  N  N     . CYS B 1 49  ? -9.682  9.815   -19.895 1.00 43.74  ? 441 CYS B N     1 
ATOM   759  C  CA    . CYS B 1 49  ? -10.871 10.627  -20.168 1.00 46.34  ? 441 CYS B CA    1 
ATOM   760  C  C     . CYS B 1 49  ? -11.979 9.825   -20.860 1.00 51.38  ? 441 CYS B C     1 
ATOM   761  O  O     . CYS B 1 49  ? -13.175 10.047  -20.585 1.00 48.43  ? 441 CYS B O     1 
ATOM   762  C  CB    . CYS B 1 49  ? -10.504 11.870  -20.983 1.00 48.67  ? 441 CYS B CB    1 
ATOM   763  S  SG    . CYS B 1 49  ? -9.718  13.173  -19.951 1.00 46.81  ? 441 CYS B SG    1 
ATOM   764  N  N     . LYS B 1 50  ? -11.590 8.872   -21.713 1.00 47.85  ? 442 LYS B N     1 
ATOM   765  C  CA    . LYS B 1 50  ? -12.543 7.951   -22.350 1.00 46.97  ? 442 LYS B CA    1 
ATOM   766  C  C     . LYS B 1 50  ? -13.332 7.121   -21.341 1.00 48.15  ? 442 LYS B C     1 
ATOM   767  O  O     . LYS B 1 50  ? -14.569 7.099   -21.351 1.00 49.81  ? 442 LYS B O     1 
ATOM   768  C  CB    . LYS B 1 50  ? -11.809 7.006   -23.317 1.00 49.01  ? 442 LYS B CB    1 
ATOM   769  C  CG    . LYS B 1 50  ? -12.689 5.915   -23.916 1.00 56.08  ? 442 LYS B CG    1 
ATOM   770  C  CD    . LYS B 1 50  ? -11.919 5.021   -24.908 1.00 57.29  ? 442 LYS B CD    1 
ATOM   771  C  CE    . LYS B 1 50  ? -12.818 3.938   -25.523 1.00 63.58  ? 442 LYS B CE    1 
ATOM   772  N  NZ    . LYS B 1 50  ? -12.268 3.332   -26.807 1.00 62.27  ? 442 LYS B NZ    1 
ATOM   773  N  N     . VAL B 1 51  ? -12.618 6.421   -20.472 1.00 44.68  ? 443 VAL B N     1 
ATOM   774  C  CA    . VAL B 1 51  ? -13.275 5.576   -19.489 1.00 45.03  ? 443 VAL B CA    1 
ATOM   775  C  C     . VAL B 1 51  ? -14.084 6.416   -18.500 1.00 49.69  ? 443 VAL B C     1 
ATOM   776  O  O     . VAL B 1 51  ? -15.206 6.046   -18.129 1.00 49.31  ? 443 VAL B O     1 
ATOM   777  C  CB    . VAL B 1 51  ? -12.254 4.710   -18.736 1.00 44.66  ? 443 VAL B CB    1 
ATOM   778  C  CG1   . VAL B 1 51  ? -12.939 3.871   -17.694 1.00 47.67  ? 443 VAL B CG1   1 
ATOM   779  C  CG2   . VAL B 1 51  ? -11.514 3.809   -19.719 1.00 47.29  ? 443 VAL B CG2   1 
ATOM   780  N  N     . PHE B 1 52  ? -13.526 7.548   -18.076 1.00 44.98  ? 444 PHE B N     1 
ATOM   781  C  CA    . PHE B 1 52  ? -14.257 8.438   -17.180 1.00 42.82  ? 444 PHE B CA    1 
ATOM   782  C  C     . PHE B 1 52  ? -15.592 8.830   -17.802 1.00 44.08  ? 444 PHE B C     1 
ATOM   783  O  O     . PHE B 1 52  ? -16.628 8.758   -17.146 1.00 43.98  ? 444 PHE B O     1 
ATOM   784  C  CB    . PHE B 1 52  ? -13.425 9.681   -16.859 1.00 44.37  ? 444 PHE B CB    1 
ATOM   785  C  CG    . PHE B 1 52  ? -14.218 10.800  -16.252 1.00 45.80  ? 444 PHE B CG    1 
ATOM   786  C  CD1   . PHE B 1 52  ? -14.391 10.875  -14.876 1.00 43.27  ? 444 PHE B CD1   1 
ATOM   787  C  CD2   . PHE B 1 52  ? -14.790 11.785  -17.055 1.00 43.22  ? 444 PHE B CD2   1 
ATOM   788  C  CE1   . PHE B 1 52  ? -15.126 11.911  -14.301 1.00 40.50  ? 444 PHE B CE1   1 
ATOM   789  C  CE2   . PHE B 1 52  ? -15.521 12.838  -16.486 1.00 44.59  ? 444 PHE B CE2   1 
ATOM   790  C  CZ    . PHE B 1 52  ? -15.686 12.897  -15.099 1.00 40.07  ? 444 PHE B CZ    1 
ATOM   791  N  N     . PHE B 1 53  ? -15.571 9.232   -19.070 1.00 40.73  ? 445 PHE B N     1 
ATOM   792  C  CA    . PHE B 1 53  ? -16.792 9.698   -19.718 1.00 44.97  ? 445 PHE B CA    1 
ATOM   793  C  C     . PHE B 1 53  ? -17.850 8.603   -19.779 1.00 52.68  ? 445 PHE B C     1 
ATOM   794  O  O     . PHE B 1 53  ? -19.008 8.832   -19.433 1.00 49.71  ? 445 PHE B O     1 
ATOM   795  C  CB    . PHE B 1 53  ? -16.506 10.199  -21.120 1.00 49.53  ? 445 PHE B CB    1 
ATOM   796  C  CG    . PHE B 1 53  ? -17.720 10.727  -21.824 1.00 57.10  ? 445 PHE B CG    1 
ATOM   797  C  CD1   . PHE B 1 53  ? -18.284 11.934  -21.445 1.00 52.41  ? 445 PHE B CD1   1 
ATOM   798  C  CD2   . PHE B 1 53  ? -18.306 10.014  -22.859 1.00 53.30  ? 445 PHE B CD2   1 
ATOM   799  C  CE1   . PHE B 1 53  ? -19.406 12.421  -22.085 1.00 53.54  ? 445 PHE B CE1   1 
ATOM   800  C  CE2   . PHE B 1 53  ? -19.424 10.496  -23.494 1.00 53.07  ? 445 PHE B CE2   1 
ATOM   801  C  CZ    . PHE B 1 53  ? -19.974 11.700  -23.112 1.00 56.91  ? 445 PHE B CZ    1 
ATOM   802  N  N     . LYS B 1 54  ? -17.435 7.419   -20.228 1.00 53.19  ? 446 LYS B N     1 
ATOM   803  C  CA    . LYS B 1 54  ? -18.290 6.232   -20.242 1.00 54.53  ? 446 LYS B CA    1 
ATOM   804  C  C     . LYS B 1 54  ? -18.956 6.016   -18.900 1.00 54.32  ? 446 LYS B C     1 
ATOM   805  O  O     . LYS B 1 54  ? -20.191 5.956   -18.800 1.00 53.08  ? 446 LYS B O     1 
ATOM   806  C  CB    . LYS B 1 54  ? -17.476 4.981   -20.595 1.00 55.19  ? 446 LYS B CB    1 
ATOM   807  C  CG    . LYS B 1 54  ? -18.307 3.695   -20.694 1.00 61.58  ? 446 LYS B CG    1 
ATOM   808  C  CD    . LYS B 1 54  ? -19.093 3.641   -22.003 1.00 64.69  ? 446 LYS B CD    1 
ATOM   809  C  CE    . LYS B 1 54  ? -19.984 2.417   -22.064 1.00 64.52  ? 446 LYS B CE    1 
ATOM   810  N  NZ    . LYS B 1 54  ? -19.189 1.187   -21.885 1.00 70.99  ? 446 LYS B NZ    1 
ATOM   811  N  N     . ARG B 1 55  ? -18.119 5.893   -17.873 1.00 47.69  ? 447 ARG B N     1 
ATOM   812  C  CA    . ARG B 1 55  ? -18.594 5.640   -16.525 1.00 53.96  ? 447 ARG B CA    1 
ATOM   813  C  C     . ARG B 1 55  ? -19.566 6.736   -16.040 1.00 58.84  ? 447 ARG B C     1 
ATOM   814  O  O     . ARG B 1 55  ? -20.558 6.444   -15.368 1.00 59.43  ? 447 ARG B O     1 
ATOM   815  C  CB    . ARG B 1 55  ? -17.391 5.497   -15.579 1.00 60.26  ? 447 ARG B CB    1 
ATOM   816  C  CG    . ARG B 1 55  ? -17.739 5.462   -14.099 1.00 71.17  ? 447 ARG B CG    1 
ATOM   817  C  CD    . ARG B 1 55  ? -16.484 5.352   -13.208 1.00 77.38  ? 447 ARG B CD    1 
ATOM   818  N  NE    . ARG B 1 55  ? -16.683 5.914   -11.866 1.00 79.00  ? 447 ARG B NE    1 
ATOM   819  C  CZ    . ARG B 1 55  ? -17.523 5.429   -10.952 1.00 88.05  ? 447 ARG B CZ    1 
ATOM   820  N  NH1   . ARG B 1 55  ? -18.267 4.359   -11.213 1.00 87.01  ? 447 ARG B NH1   1 
ATOM   821  N  NH2   . ARG B 1 55  ? -17.620 6.016   -9.765  1.00 84.65  ? 447 ARG B NH2   1 
ATOM   822  N  N     . ALA B 1 56  ? -19.305 7.987   -16.413 1.00 52.95  ? 448 ALA B N     1 
ATOM   823  C  CA    . ALA B 1 56  ? -20.161 9.100   -16.010 1.00 56.28  ? 448 ALA B CA    1 
ATOM   824  C  C     . ALA B 1 56  ? -21.551 9.032   -16.653 1.00 57.38  ? 448 ALA B C     1 
ATOM   825  O  O     . ALA B 1 56  ? -22.570 9.174   -15.977 1.00 62.67  ? 448 ALA B O     1 
ATOM   826  C  CB    . ALA B 1 56  ? -19.488 10.438  -16.349 1.00 46.15  ? 448 ALA B CB    1 
ATOM   827  N  N     . VAL B 1 57  ? -21.592 8.833   -17.961 1.00 54.67  ? 449 VAL B N     1 
ATOM   828  C  CA    . VAL B 1 57  ? -22.866 8.781   -18.672 1.00 60.35  ? 449 VAL B CA    1 
ATOM   829  C  C     . VAL B 1 57  ? -23.708 7.567   -18.265 1.00 66.41  ? 449 VAL B C     1 
ATOM   830  O  O     . VAL B 1 57  ? -24.923 7.676   -18.103 1.00 68.06  ? 449 VAL B O     1 
ATOM   831  C  CB    . VAL B 1 57  ? -22.650 8.758   -20.189 1.00 57.30  ? 449 VAL B CB    1 
ATOM   832  C  CG1   . VAL B 1 57  ? -23.983 8.838   -20.912 1.00 65.90  ? 449 VAL B CG1   1 
ATOM   833  C  CG2   . VAL B 1 57  ? -21.782 9.916   -20.601 1.00 54.53  ? 449 VAL B CG2   1 
ATOM   834  N  N     . GLU B 1 58  ? -23.062 6.415   -18.095 1.00 64.75  ? 450 GLU B N     1 
ATOM   835  C  CA    . GLU B 1 58  ? -23.774 5.183   -17.755 1.00 70.52  ? 450 GLU B CA    1 
ATOM   836  C  C     . GLU B 1 58  ? -24.213 5.162   -16.303 1.00 72.51  ? 450 GLU B C     1 
ATOM   837  O  O     . GLU B 1 58  ? -25.100 4.395   -15.921 1.00 75.86  ? 450 GLU B O     1 
ATOM   838  C  CB    . GLU B 1 58  ? -22.905 3.957   -18.036 1.00 72.64  ? 450 GLU B CB    1 
ATOM   839  C  CG    . GLU B 1 58  ? -23.676 2.784   -18.631 1.00 83.78  ? 450 GLU B CG    1 
ATOM   840  C  CD    . GLU B 1 58  ? -23.833 2.887   -20.143 1.00 87.50  ? 450 GLU B CD    1 
ATOM   841  O  OE1   . GLU B 1 58  ? -22.803 2.864   -20.848 1.00 85.58  ? 450 GLU B OE1   1 
ATOM   842  O  OE2   . GLU B 1 58  ? -24.985 2.993   -20.625 1.00 92.80  ? 450 GLU B OE2   1 
ATOM   843  N  N     . GLY B 1 59  ? -23.573 6.000   -15.496 1.00 69.25  ? 451 GLY B N     1 
ATOM   844  C  CA    . GLY B 1 59  ? -23.866 6.072   -14.082 1.00 72.71  ? 451 GLY B CA    1 
ATOM   845  C  C     . GLY B 1 59  ? -24.969 7.064   -13.782 1.00 76.51  ? 451 GLY B C     1 
ATOM   846  O  O     . GLY B 1 59  ? -25.334 7.892   -14.625 1.00 76.51  ? 451 GLY B O     1 
ATOM   847  N  N     . GLN B 1 60  ? -25.507 6.959   -12.572 1.00 80.72  ? 452 GLN B N     1 
ATOM   848  C  CA    . GLN B 1 60  ? -26.543 7.855   -12.067 1.00 88.63  ? 452 GLN B CA    1 
ATOM   849  C  C     . GLN B 1 60  ? -25.877 9.132   -11.575 1.00 83.98  ? 452 GLN B C     1 
ATOM   850  O  O     . GLN B 1 60  ? -26.155 9.602   -10.469 1.00 83.98  ? 452 GLN B O     1 
ATOM   851  C  CB    . GLN B 1 60  ? -27.321 7.178   -10.918 1.00 88.86  ? 452 GLN B CB    1 
ATOM   852  C  CG    . GLN B 1 60  ? -28.849 7.035   -11.071 1.00 92.60  ? 452 GLN B CG    1 
ATOM   853  C  CD    . GLN B 1 60  ? -29.598 8.354   -11.244 1.00 97.10  ? 452 GLN B CD    1 
ATOM   854  O  OE1   . GLN B 1 60  ? -29.017 9.440   -11.167 1.00 95.04  ? 452 GLN B OE1   1 
ATOM   855  N  NE2   . GLN B 1 60  ? -30.906 8.258   -11.470 1.00 98.15  ? 452 GLN B NE2   1 
ATOM   856  N  N     . HIS B 1 61  ? -24.982 9.690   -12.384 1.00 81.55  ? 453 HIS B N     1 
ATOM   857  C  CA    . HIS B 1 61  ? -23.978 10.574  -11.805 1.00 78.35  ? 453 HIS B CA    1 
ATOM   858  C  C     . HIS B 1 61  ? -24.234 12.057  -11.979 1.00 72.44  ? 453 HIS B C     1 
ATOM   859  O  O     . HIS B 1 61  ? -24.177 12.621  -13.083 1.00 72.66  ? 453 HIS B O     1 
ATOM   860  C  CB    . HIS B 1 61  ? -22.601 10.194  -12.340 1.00 72.73  ? 453 HIS B CB    1 
ATOM   861  C  CG    . HIS B 1 61  ? -22.061 8.949   -11.708 1.00 73.35  ? 453 HIS B CG    1 
ATOM   862  N  ND1   . HIS B 1 61  ? -21.234 8.069   -12.368 1.00 75.85  ? 453 HIS B ND1   1 
ATOM   863  C  CD2   . HIS B 1 61  ? -22.264 8.428   -10.473 1.00 73.53  ? 453 HIS B CD2   1 
ATOM   864  C  CE1   . HIS B 1 61  ? -20.940 7.058   -11.564 1.00 76.92  ? 453 HIS B CE1   1 
ATOM   865  N  NE2   . HIS B 1 61  ? -21.552 7.254   -10.411 1.00 80.54  ? 453 HIS B NE2   1 
ATOM   866  N  N     . ASN B 1 62  ? -24.542 12.652  -10.830 1.00 72.85  ? 454 ASN B N     1 
ATOM   867  C  CA    . ASN B 1 62  ? -24.656 14.086  -10.661 1.00 68.02  ? 454 ASN B CA    1 
ATOM   868  C  C     . ASN B 1 62  ? -23.512 14.565  -9.800  1.00 61.33  ? 454 ASN B C     1 
ATOM   869  O  O     . ASN B 1 62  ? -23.546 14.470  -8.575  1.00 65.56  ? 454 ASN B O     1 
ATOM   870  C  CB    . ASN B 1 62  ? -25.992 14.458  -10.035 1.00 68.14  ? 454 ASN B CB    1 
ATOM   871  C  CG    . ASN B 1 62  ? -27.095 14.529  -11.058 1.00 75.07  ? 454 ASN B CG    1 
ATOM   872  O  OD1   . ASN B 1 62  ? -26.849 14.849  -12.222 1.00 73.63  ? 454 ASN B OD1   1 
ATOM   873  N  ND2   . ASN B 1 62  ? -28.316 14.217  -10.640 1.00 79.56  ? 454 ASN B ND2   1 
ATOM   874  N  N     . TYR B 1 63  ? -22.480 15.053  -10.462 1.00 55.66  ? 455 TYR B N     1 
ATOM   875  C  CA    . TYR B 1 63  ? -21.307 15.526  -9.775  1.00 47.45  ? 455 TYR B CA    1 
ATOM   876  C  C     . TYR B 1 63  ? -21.500 16.959  -9.373  1.00 45.30  ? 455 TYR B C     1 
ATOM   877  O  O     . TYR B 1 63  ? -22.252 17.708  -10.018 1.00 42.57  ? 455 TYR B O     1 
ATOM   878  C  CB    . TYR B 1 63  ? -20.076 15.418  -10.658 1.00 41.90  ? 455 TYR B CB    1 
ATOM   879  C  CG    . TYR B 1 63  ? -19.779 14.040  -11.182 1.00 44.72  ? 455 TYR B CG    1 
ATOM   880  C  CD1   . TYR B 1 63  ? -19.279 13.053  -10.348 1.00 48.14  ? 455 TYR B CD1   1 
ATOM   881  C  CD2   . TYR B 1 63  ? -19.955 13.741  -12.521 1.00 45.07  ? 455 TYR B CD2   1 
ATOM   882  C  CE1   . TYR B 1 63  ? -18.977 11.799  -10.833 1.00 48.19  ? 455 TYR B CE1   1 
ATOM   883  C  CE2   . TYR B 1 63  ? -19.656 12.488  -13.018 1.00 53.04  ? 455 TYR B CE2   1 
ATOM   884  C  CZ    . TYR B 1 63  ? -19.173 11.522  -12.171 1.00 48.52  ? 455 TYR B CZ    1 
ATOM   885  O  OH    . TYR B 1 63  ? -18.877 10.280  -12.676 1.00 52.49  ? 455 TYR B OH    1 
ATOM   886  N  N     . LEU B 1 64  ? -20.775 17.350  -8.336  1.00 38.80  ? 456 LEU B N     1 
ATOM   887  C  CA    . LEU B 1 64  ? -20.857 18.697  -7.819  1.00 36.97  ? 456 LEU B CA    1 
ATOM   888  C  C     . LEU B 1 64  ? -19.469 19.305  -7.643  1.00 37.12  ? 456 LEU B C     1 
ATOM   889  O  O     . LEU B 1 64  ? -18.616 18.718  -6.977  1.00 30.53  ? 456 LEU B O     1 
ATOM   890  C  CB    . LEU B 1 64  ? -21.603 18.692  -6.488  1.00 35.33  ? 456 LEU B CB    1 
ATOM   891  C  CG    . LEU B 1 64  ? -21.749 20.061  -5.844  1.00 37.36  ? 456 LEU B CG    1 
ATOM   892  C  CD1   . LEU B 1 64  ? -22.478 21.055  -6.799  1.00 35.23  ? 456 LEU B CD1   1 
ATOM   893  C  CD2   . LEU B 1 64  ? -22.474 19.920  -4.526  1.00 40.88  ? 456 LEU B CD2   1 
ATOM   894  N  N     . CYS B 1 65  ? -19.267 20.497  -8.204  1.00 37.25  ? 457 CYS B N     1 
ATOM   895  C  CA    . CYS B 1 65  ? -17.977 21.208  -8.132  1.00 33.91  ? 457 CYS B CA    1 
ATOM   896  C  C     . CYS B 1 65  ? -17.748 21.809  -6.749  1.00 32.59  ? 457 CYS B C     1 
ATOM   897  O  O     . CYS B 1 65  ? -18.683 22.300  -6.129  1.00 34.18  ? 457 CYS B O     1 
ATOM   898  C  CB    . CYS B 1 65  ? -17.936 22.314  -9.203  1.00 29.52  ? 457 CYS B CB    1 
ATOM   899  S  SG    . CYS B 1 65  ? -16.387 23.255  -9.281  1.00 31.21  ? 457 CYS B SG    1 
ATOM   900  N  N     . ALA B 1 66  ? -16.514 21.821  -6.265  1.00 30.44  ? 458 ALA B N     1 
ATOM   901  C  CA    . ALA B 1 66  ? -16.279 22.439  -4.959  1.00 33.20  ? 458 ALA B CA    1 
ATOM   902  C  C     . ALA B 1 66  ? -15.877 23.904  -5.118  1.00 30.26  ? 458 ALA B C     1 
ATOM   903  O  O     . ALA B 1 66  ? -15.624 24.578  -4.129  1.00 28.19  ? 458 ALA B O     1 
ATOM   904  C  CB    . ALA B 1 66  ? -15.227 21.691  -4.185  1.00 29.14  ? 458 ALA B CB    1 
ATOM   905  N  N     . GLY B 1 67  ? -15.818 24.370  -6.359  1.00 27.33  ? 459 GLY B N     1 
ATOM   906  C  CA    . GLY B 1 67  ? -15.320 25.702  -6.642  1.00 30.50  ? 459 GLY B CA    1 
ATOM   907  C  C     . GLY B 1 67  ? -16.337 26.572  -7.334  1.00 32.11  ? 459 GLY B C     1 
ATOM   908  O  O     . GLY B 1 67  ? -17.302 27.025  -6.693  1.00 33.00  ? 459 GLY B O     1 
ATOM   909  N  N     . ARG B 1 68  ? -16.132 26.807  -8.629  1.00 28.88  ? 460 ARG B N     1 
ATOM   910  C  CA    . ARG B 1 68  ? -16.924 27.788  -9.371  1.00 29.55  ? 460 ARG B CA    1 
ATOM   911  C  C     . ARG B 1 68  ? -17.406 27.274  -10.718 1.00 30.09  ? 460 ARG B C     1 
ATOM   912  O  O     . ARG B 1 68  ? -17.744 28.061  -11.578 1.00 34.21  ? 460 ARG B O     1 
ATOM   913  C  CB    . ARG B 1 68  ? -16.107 29.065  -9.582  1.00 28.38  ? 460 ARG B CB    1 
ATOM   914  C  CG    . ARG B 1 68  ? -15.838 29.841  -8.302  1.00 35.00  ? 460 ARG B CG    1 
ATOM   915  C  CD    . ARG B 1 68  ? -14.658 30.801  -8.464  1.00 36.92  ? 460 ARG B CD    1 
ATOM   916  N  NE    . ARG B 1 68  ? -14.518 31.655  -7.292  1.00 32.74  ? 460 ARG B NE    1 
ATOM   917  C  CZ    . ARG B 1 68  ? -13.904 31.313  -6.164  1.00 35.64  ? 460 ARG B CZ    1 
ATOM   918  N  NH1   . ARG B 1 68  ? -13.396 30.102  -6.017  1.00 35.17  ? 460 ARG B NH1   1 
ATOM   919  N  NH2   . ARG B 1 68  ? -13.844 32.172  -5.148  1.00 37.71  ? 460 ARG B NH2   1 
ATOM   920  N  N     . ASN B 1 69  ? -17.431 25.960  -10.901 1.00 27.78  ? 461 ASN B N     1 
ATOM   921  C  CA    . ASN B 1 69  ? -17.702 25.350  -12.217 1.00 33.70  ? 461 ASN B CA    1 
ATOM   922  C  C     . ASN B 1 69  ? -16.726 25.813  -13.301 1.00 32.56  ? 461 ASN B C     1 
ATOM   923  O  O     . ASN B 1 69  ? -17.103 25.921  -14.470 1.00 32.76  ? 461 ASN B O     1 
ATOM   924  C  CB    . ASN B 1 69  ? -19.149 25.625  -12.682 1.00 31.07  ? 461 ASN B CB    1 
ATOM   925  C  CG    . ASN B 1 69  ? -20.151 24.671  -12.063 1.00 32.42  ? 461 ASN B CG    1 
ATOM   926  O  OD1   . ASN B 1 69  ? -19.791 23.580  -11.658 1.00 32.37  ? 461 ASN B OD1   1 
ATOM   927  N  ND2   . ASN B 1 69  ? -21.429 25.059  -12.035 1.00 33.61  ? 461 ASN B ND2   1 
ATOM   928  N  N     . ASP B 1 70  ? -15.487 26.100  -12.915 1.00 31.25  ? 462 ASP B N     1 
ATOM   929  C  CA    . ASP B 1 70  ? -14.446 26.453  -13.901 1.00 36.45  ? 462 ASP B CA    1 
ATOM   930  C  C     . ASP B 1 70  ? -13.059 25.920  -13.488 1.00 42.12  ? 462 ASP B C     1 
ATOM   931  O  O     . ASP B 1 70  ? -12.076 26.657  -13.509 1.00 38.67  ? 462 ASP B O     1 
ATOM   932  C  CB    . ASP B 1 70  ? -14.383 27.982  -14.096 1.00 40.82  ? 462 ASP B CB    1 
ATOM   933  C  CG    . ASP B 1 70  ? -13.965 28.724  -12.820 1.00 45.94  ? 462 ASP B CG    1 
ATOM   934  O  OD1   . ASP B 1 70  ? -14.029 28.105  -11.740 1.00 57.15  ? 462 ASP B OD1   1 
ATOM   935  O  OD2   . ASP B 1 70  ? -13.561 29.913  -12.884 1.00 50.85  ? 462 ASP B OD2   1 
ATOM   936  N  N     . CYS B 1 71  ? -12.988 24.649  -13.089 1.00 37.13  ? 463 CYS B N     1 
ATOM   937  C  CA    . CYS B 1 71  ? -11.768 24.099  -12.513 1.00 36.52  ? 463 CYS B CA    1 
ATOM   938  C  C     . CYS B 1 71  ? -10.767 23.869  -13.656 1.00 36.29  ? 463 CYS B C     1 
ATOM   939  O  O     . CYS B 1 71  ? -11.155 23.697  -14.796 1.00 37.76  ? 463 CYS B O     1 
ATOM   940  C  CB    . CYS B 1 71  ? -12.067 22.786  -11.718 1.00 32.40  ? 463 CYS B CB    1 
ATOM   941  S  SG    . CYS B 1 71  ? -12.879 22.962  -10.081 1.00 32.38  ? 463 CYS B SG    1 
ATOM   942  N  N     . ILE B 1 72  ? -9.478  23.920  -13.357 1.00 36.67  ? 464 ILE B N     1 
ATOM   943  C  CA    . ILE B 1 72  ? -8.434  23.585  -14.335 1.00 35.89  ? 464 ILE B CA    1 
ATOM   944  C  C     . ILE B 1 72  ? -8.378  22.083  -14.533 1.00 40.09  ? 464 ILE B C     1 
ATOM   945  O  O     . ILE B 1 72  ? -8.134  21.346  -13.589 1.00 41.05  ? 464 ILE B O     1 
ATOM   946  C  CB    . ILE B 1 72  ? -7.046  24.085  -13.873 1.00 43.40  ? 464 ILE B CB    1 
ATOM   947  C  CG1   . ILE B 1 72  ? -6.973  25.607  -13.980 1.00 44.32  ? 464 ILE B CG1   1 
ATOM   948  C  CG2   . ILE B 1 72  ? -5.923  23.436  -14.691 1.00 44.69  ? 464 ILE B CG2   1 
ATOM   949  C  CD1   . ILE B 1 72  ? -5.978  26.210  -13.062 1.00 44.07  ? 464 ILE B CD1   1 
ATOM   950  N  N     . ILE B 1 73  ? -8.650  21.612  -15.740 1.00 39.13  ? 465 ILE B N     1 
ATOM   951  C  CA    . ILE B 1 73  ? -8.605  20.183  -15.969 1.00 38.82  ? 465 ILE B CA    1 
ATOM   952  C  C     . ILE B 1 73  ? -7.358  19.827  -16.773 1.00 46.06  ? 465 ILE B C     1 
ATOM   953  O  O     . ILE B 1 73  ? -7.290  20.092  -17.966 1.00 46.83  ? 465 ILE B O     1 
ATOM   954  C  CB    . ILE B 1 73  ? -9.865  19.689  -16.692 1.00 37.33  ? 465 ILE B CB    1 
ATOM   955  C  CG1   . ILE B 1 73  ? -11.109 20.030  -15.864 1.00 42.83  ? 465 ILE B CG1   1 
ATOM   956  C  CG2   . ILE B 1 73  ? -9.792  18.192  -16.903 1.00 42.68  ? 465 ILE B CG2   1 
ATOM   957  C  CD1   . ILE B 1 73  ? -11.176 19.338  -14.444 1.00 37.80  ? 465 ILE B CD1   1 
ATOM   958  N  N     . ASP B 1 74  ? -6.357  19.263  -16.104 1.00 46.58  ? 466 ASP B N     1 
ATOM   959  C  CA    . ASP B 1 74  ? -5.144  18.804  -16.789 1.00 48.67  ? 466 ASP B CA    1 
ATOM   960  C  C     . ASP B 1 74  ? -4.748  17.448  -16.239 1.00 47.15  ? 466 ASP B C     1 
ATOM   961  O  O     . ASP B 1 74  ? -5.463  16.894  -15.421 1.00 49.50  ? 466 ASP B O     1 
ATOM   962  C  CB    . ASP B 1 74  ? -3.996  19.808  -16.633 1.00 49.05  ? 466 ASP B CB    1 
ATOM   963  C  CG    . ASP B 1 74  ? -3.597  20.048  -15.170 1.00 47.06  ? 466 ASP B CG    1 
ATOM   964  O  OD1   . ASP B 1 74  ? -3.852  19.202  -14.288 1.00 52.95  ? 466 ASP B OD1   1 
ATOM   965  O  OD2   . ASP B 1 74  ? -3.003  21.100  -14.901 1.00 53.47  ? 466 ASP B OD2   1 
ATOM   966  N  N     . LYS B 1 75  ? -3.599  16.933  -16.648 1.00 50.05  ? 467 LYS B N     1 
ATOM   967  C  CA    . LYS B 1 75  ? -3.230  15.566  -16.302 1.00 50.40  ? 467 LYS B CA    1 
ATOM   968  C  C     . LYS B 1 75  ? -3.170  15.334  -14.790 1.00 50.00  ? 467 LYS B C     1 
ATOM   969  O  O     . LYS B 1 75  ? -3.562  14.282  -14.296 1.00 57.16  ? 467 LYS B O     1 
ATOM   970  C  CB    . LYS B 1 75  ? -1.892  15.198  -16.940 1.00 54.46  ? 467 LYS B CB    1 
ATOM   971  C  CG    . LYS B 1 75  ? -1.480  13.752  -16.655 1.00 60.31  ? 467 LYS B CG    1 
ATOM   972  C  CD    . LYS B 1 75  ? -0.088  13.438  -17.191 1.00 66.56  ? 467 LYS B CD    1 
ATOM   973  C  CE    . LYS B 1 75  ? 0.397   12.090  -16.687 1.00 65.38  ? 467 LYS B CE    1 
ATOM   974  N  NZ    . LYS B 1 75  ? 1.779   12.216  -16.136 1.00 73.88  ? 467 LYS B NZ    1 
ATOM   975  N  N     . ILE B 1 76  ? -2.689  16.317  -14.053 1.00 51.98  ? 468 ILE B N     1 
ATOM   976  C  CA    . ILE B 1 76  ? -2.550  16.150  -12.617 1.00 56.66  ? 468 ILE B CA    1 
ATOM   977  C  C     . ILE B 1 76  ? -3.854  16.445  -11.886 1.00 55.40  ? 468 ILE B C     1 
ATOM   978  O  O     . ILE B 1 76  ? -4.207  15.742  -10.946 1.00 57.66  ? 468 ILE B O     1 
ATOM   979  C  CB    . ILE B 1 76  ? -1.442  17.051  -12.067 1.00 61.91  ? 468 ILE B CB    1 
ATOM   980  C  CG1   . ILE B 1 76  ? -0.154  16.799  -12.851 1.00 64.78  ? 468 ILE B CG1   1 
ATOM   981  C  CG2   . ILE B 1 76  ? -1.217  16.775  -10.586 1.00 56.70  ? 468 ILE B CG2   1 
ATOM   982  C  CD1   . ILE B 1 76  ? 0.385   15.393  -12.646 1.00 65.88  ? 468 ILE B CD1   1 
ATOM   983  N  N     . ARG B 1 77  ? -4.579  17.464  -12.338 1.00 49.40  ? 469 ARG B N     1 
ATOM   984  C  CA    . ARG B 1 77  ? -5.762  17.918  -11.613 1.00 49.07  ? 469 ARG B CA    1 
ATOM   985  C  C     . ARG B 1 77  ? -7.068  17.316  -12.075 1.00 47.16  ? 469 ARG B C     1 
ATOM   986  O  O     . ARG B 1 77  ? -8.078  17.479  -11.394 1.00 47.50  ? 469 ARG B O     1 
ATOM   987  C  CB    . ARG B 1 77  ? -5.896  19.429  -11.711 1.00 46.50  ? 469 ARG B CB    1 
ATOM   988  C  CG    . ARG B 1 77  ? -4.700  20.179  -11.217 1.00 45.20  ? 469 ARG B CG    1 
ATOM   989  C  CD    . ARG B 1 77  ? -4.853  21.629  -11.553 1.00 45.30  ? 469 ARG B CD    1 
ATOM   990  N  NE    . ARG B 1 77  ? -3.933  22.381  -10.730 1.00 51.69  ? 469 ARG B NE    1 
ATOM   991  C  CZ    . ARG B 1 77  ? -2.837  22.946  -11.204 1.00 59.27  ? 469 ARG B CZ    1 
ATOM   992  N  NH1   . ARG B 1 77  ? -2.575  22.882  -12.512 1.00 54.07  ? 469 ARG B NH1   1 
ATOM   993  N  NH2   . ARG B 1 77  ? -2.024  23.582  -10.377 1.00 55.06  ? 469 ARG B NH2   1 
ATOM   994  N  N     . ARG B 1 78  ? -7.070  16.630  -13.217 1.00 47.38  ? 470 ARG B N     1 
ATOM   995  C  CA    . ARG B 1 78  ? -8.337  16.239  -13.840 1.00 42.14  ? 470 ARG B CA    1 
ATOM   996  C  C     . ARG B 1 78  ? -9.172  15.370  -12.916 1.00 43.63  ? 470 ARG B C     1 
ATOM   997  O  O     . ARG B 1 78  ? -10.395 15.331  -13.024 1.00 46.62  ? 470 ARG B O     1 
ATOM   998  C  CB    . ARG B 1 78  ? -8.105  15.515  -15.166 1.00 45.51  ? 470 ARG B CB    1 
ATOM   999  C  CG    . ARG B 1 78  ? -7.477  14.145  -15.031 1.00 47.35  ? 470 ARG B CG    1 
ATOM   1000 C  CD    . ARG B 1 78  ? -7.008  13.611  -16.384 1.00 47.18  ? 470 ARG B CD    1 
ATOM   1001 N  NE    . ARG B 1 78  ? -6.255  12.372  -16.207 1.00 55.59  ? 470 ARG B NE    1 
ATOM   1002 C  CZ    . ARG B 1 78  ? -5.310  11.936  -17.033 1.00 56.04  ? 470 ARG B CZ    1 
ATOM   1003 N  NH1   . ARG B 1 78  ? -5.003  12.626  -18.120 1.00 56.68  ? 470 ARG B NH1   1 
ATOM   1004 N  NH2   . ARG B 1 78  ? -4.678  10.802  -16.773 1.00 60.96  ? 470 ARG B NH2   1 
ATOM   1005 N  N     . LYS B 1 79  ? -8.533  14.701  -11.973 1.00 44.89  ? 471 LYS B N     1 
ATOM   1006 C  CA    . LYS B 1 79  ? -9.277  13.801  -11.118 1.00 43.19  ? 471 LYS B CA    1 
ATOM   1007 C  C     . LYS B 1 79  ? -9.938  14.555  -9.975  1.00 43.62  ? 471 LYS B C     1 
ATOM   1008 O  O     . LYS B 1 79  ? -10.865 14.043  -9.356  1.00 43.13  ? 471 LYS B O     1 
ATOM   1009 C  CB    . LYS B 1 79  ? -8.363  12.695  -10.585 1.00 47.68  ? 471 LYS B CB    1 
ATOM   1010 C  CG    . LYS B 1 79  ? -7.247  13.181  -9.690  1.00 50.32  ? 471 LYS B CG    1 
ATOM   1011 C  CD    . LYS B 1 79  ? -6.379  11.985  -9.282  1.00 60.33  ? 471 LYS B CD    1 
ATOM   1012 C  CE    . LYS B 1 79  ? -5.295  12.397  -8.313  1.00 61.27  ? 471 LYS B CE    1 
ATOM   1013 N  NZ    . LYS B 1 79  ? -4.475  13.506  -8.897  1.00 73.99  ? 471 LYS B NZ    1 
ATOM   1014 N  N     . ASN B 1 80  ? -9.486  15.783  -9.719  1.00 42.58  ? 472 ASN B N     1 
ATOM   1015 C  CA    . ASN B 1 80  ? -10.048 16.597  -8.644  1.00 41.76  ? 472 ASN B CA    1 
ATOM   1016 C  C     . ASN B 1 80  ? -11.513 16.965  -8.800  1.00 39.23  ? 472 ASN B C     1 
ATOM   1017 O  O     . ASN B 1 80  ? -12.232 17.039  -7.807  1.00 41.36  ? 472 ASN B O     1 
ATOM   1018 C  CB    . ASN B 1 80  ? -9.251  17.882  -8.487  1.00 43.08  ? 472 ASN B CB    1 
ATOM   1019 C  CG    . ASN B 1 80  ? -7.878  17.634  -7.930  1.00 45.40  ? 472 ASN B CG    1 
ATOM   1020 O  OD1   . ASN B 1 80  ? -7.402  16.504  -7.932  1.00 47.84  ? 472 ASN B OD1   1 
ATOM   1021 N  ND2   . ASN B 1 80  ? -7.227  18.689  -7.453  1.00 41.21  ? 472 ASN B ND2   1 
ATOM   1022 N  N     . CYS B 1 81  ? -11.961 17.210  -10.026 1.00 38.30  ? 473 CYS B N     1 
ATOM   1023 C  CA    . CYS B 1 81  ? -13.326 17.651  -10.217 1.00 36.24  ? 473 CYS B CA    1 
ATOM   1024 C  C     . CYS B 1 81  ? -14.036 16.944  -11.355 1.00 36.60  ? 473 CYS B C     1 
ATOM   1025 O  O     . CYS B 1 81  ? -14.005 17.406  -12.486 1.00 34.14  ? 473 CYS B O     1 
ATOM   1026 C  CB    . CYS B 1 81  ? -13.356 19.148  -10.470 1.00 39.40  ? 473 CYS B CB    1 
ATOM   1027 S  SG    . CYS B 1 81  ? -15.005 19.822  -10.356 1.00 33.83  ? 473 CYS B SG    1 
ATOM   1028 N  N     . PRO B 1 82  ? -14.715 15.841  -11.044 1.00 37.04  ? 474 PRO B N     1 
ATOM   1029 C  CA    . PRO B 1 82  ? -15.468 15.120  -12.067 1.00 34.12  ? 474 PRO B CA    1 
ATOM   1030 C  C     . PRO B 1 82  ? -16.526 16.020  -12.694 1.00 35.41  ? 474 PRO B C     1 
ATOM   1031 O  O     . PRO B 1 82  ? -16.741 15.920  -13.896 1.00 36.34  ? 474 PRO B O     1 
ATOM   1032 C  CB    . PRO B 1 82  ? -16.104 13.964  -11.292 1.00 37.49  ? 474 PRO B CB    1 
ATOM   1033 C  CG    . PRO B 1 82  ? -15.242 13.813  -10.038 1.00 35.98  ? 474 PRO B CG    1 
ATOM   1034 C  CD    . PRO B 1 82  ? -14.821 15.210  -9.713  1.00 34.06  ? 474 PRO B CD    1 
ATOM   1035 N  N     . ALA B 1 83  ? -17.128 16.924  -11.920 1.00 36.12  ? 475 ALA B N     1 
ATOM   1036 C  CA    . ALA B 1 83  ? -18.127 17.836  -12.483 1.00 34.67  ? 475 ALA B CA    1 
ATOM   1037 C  C     . ALA B 1 83  ? -17.552 18.691  -13.597 1.00 33.40  ? 475 ALA B C     1 
ATOM   1038 O  O     . ALA B 1 83  ? -18.117 18.763  -14.674 1.00 35.36  ? 475 ALA B O     1 
ATOM   1039 C  CB    . ALA B 1 83  ? -18.729 18.731  -11.383 1.00 37.17  ? 475 ALA B CB    1 
ATOM   1040 N  N     . CYS B 1 84  ? -16.435 19.361  -13.357 1.00 33.04  ? 476 CYS B N     1 
ATOM   1041 C  CA    . CYS B 1 84  ? -15.874 20.190  -14.416 1.00 30.02  ? 476 CYS B CA    1 
ATOM   1042 C  C     . CYS B 1 84  ? -15.312 19.324  -15.556 1.00 34.36  ? 476 CYS B C     1 
ATOM   1043 O  O     . CYS B 1 84  ? -15.449 19.674  -16.729 1.00 35.65  ? 476 CYS B O     1 
ATOM   1044 C  CB    . CYS B 1 84  ? -14.817 21.138  -13.870 1.00 30.53  ? 476 CYS B CB    1 
ATOM   1045 S  SG    . CYS B 1 84  ? -15.547 22.556  -12.891 1.00 31.54  ? 476 CYS B SG    1 
ATOM   1046 N  N     . ARG B 1 85  ? -14.746 18.177  -15.220 1.00 33.00  ? 477 ARG B N     1 
ATOM   1047 C  CA    . ARG B 1 85  ? -14.246 17.251  -16.248 1.00 37.55  ? 477 ARG B CA    1 
ATOM   1048 C  C     . ARG B 1 85  ? -15.375 16.738  -17.140 1.00 36.73  ? 477 ARG B C     1 
ATOM   1049 O  O     . ARG B 1 85  ? -15.259 16.696  -18.362 1.00 38.88  ? 477 ARG B O     1 
ATOM   1050 C  CB    . ARG B 1 85  ? -13.529 16.075  -15.586 1.00 36.07  ? 477 ARG B CB    1 
ATOM   1051 C  CG    . ARG B 1 85  ? -12.708 15.236  -16.545 1.00 42.82  ? 477 ARG B CG    1 
ATOM   1052 C  CD    . ARG B 1 85  ? -12.230 13.949  -15.862 1.00 42.21  ? 477 ARG B CD    1 
ATOM   1053 N  NE    . ARG B 1 85  ? -11.209 13.251  -16.638 1.00 44.07  ? 477 ARG B NE    1 
ATOM   1054 C  CZ    . ARG B 1 85  ? -10.477 12.238  -16.174 1.00 46.10  ? 477 ARG B CZ    1 
ATOM   1055 N  NH1   . ARG B 1 85  ? -10.642 11.819  -14.931 1.00 44.08  ? 477 ARG B NH1   1 
ATOM   1056 N  NH2   . ARG B 1 85  ? -9.575  11.647  -16.949 1.00 41.36  ? 477 ARG B NH2   1 
ATOM   1057 N  N     . TYR B 1 86  ? -16.477 16.347  -16.520 1.00 38.69  ? 478 TYR B N     1 
ATOM   1058 C  CA    . TYR B 1 86  ? -17.634 15.888  -17.271 1.00 38.11  ? 478 TYR B CA    1 
ATOM   1059 C  C     . TYR B 1 86  ? -18.159 17.008  -18.159 1.00 43.28  ? 478 TYR B C     1 
ATOM   1060 O  O     . TYR B 1 86  ? -18.393 16.800  -19.343 1.00 44.30  ? 478 TYR B O     1 
ATOM   1061 C  CB    . TYR B 1 86  ? -18.711 15.392  -16.309 1.00 40.86  ? 478 TYR B CB    1 
ATOM   1062 C  CG    . TYR B 1 86  ? -19.906 14.725  -16.962 1.00 50.50  ? 478 TYR B CG    1 
ATOM   1063 C  CD1   . TYR B 1 86  ? -19.749 13.892  -18.063 1.00 48.78  ? 478 TYR B CD1   1 
ATOM   1064 C  CD2   . TYR B 1 86  ? -21.186 14.893  -16.445 1.00 52.07  ? 478 TYR B CD2   1 
ATOM   1065 C  CE1   . TYR B 1 86  ? -20.838 13.271  -18.652 1.00 51.23  ? 478 TYR B CE1   1 
ATOM   1066 C  CE2   . TYR B 1 86  ? -22.278 14.279  -17.027 1.00 55.57  ? 478 TYR B CE2   1 
ATOM   1067 C  CZ    . TYR B 1 86  ? -22.100 13.468  -18.129 1.00 57.84  ? 478 TYR B CZ    1 
ATOM   1068 O  OH    . TYR B 1 86  ? -23.190 12.854  -18.708 1.00 61.77  ? 478 TYR B OH    1 
ATOM   1069 N  N     . ARG B 1 87  ? -18.317 18.206  -17.598 1.00 40.52  ? 479 ARG B N     1 
ATOM   1070 C  CA    . ARG B 1 87  ? -18.786 19.357  -18.383 1.00 40.35  ? 479 ARG B CA    1 
ATOM   1071 C  C     . ARG B 1 87  ? -17.862 19.635  -19.580 1.00 41.40  ? 479 ARG B C     1 
ATOM   1072 O  O     . ARG B 1 87  ? -18.330 19.948  -20.671 1.00 44.69  ? 479 ARG B O     1 
ATOM   1073 C  CB    . ARG B 1 87  ? -18.912 20.601  -17.489 1.00 40.23  ? 479 ARG B CB    1 
ATOM   1074 C  CG    . ARG B 1 87  ? -19.211 21.894  -18.237 1.00 41.65  ? 479 ARG B CG    1 
ATOM   1075 C  CD    . ARG B 1 87  ? -19.184 23.140  -17.325 1.00 43.10  ? 479 ARG B CD    1 
ATOM   1076 N  NE    . ARG B 1 87  ? -17.935 23.262  -16.573 1.00 47.90  ? 479 ARG B NE    1 
ATOM   1077 C  CZ    . ARG B 1 87  ? -16.772 23.634  -17.112 1.00 51.75  ? 479 ARG B CZ    1 
ATOM   1078 N  NH1   . ARG B 1 87  ? -16.699 23.927  -18.405 1.00 52.30  ? 479 ARG B NH1   1 
ATOM   1079 N  NH2   . ARG B 1 87  ? -15.677 23.705  -16.369 1.00 47.92  ? 479 ARG B NH2   1 
ATOM   1080 N  N     . LYS B 1 88  ? -16.554 19.500  -19.401 1.00 40.66  ? 480 LYS B N     1 
ATOM   1081 C  CA    . LYS B 1 88  ? -15.644 19.682  -20.542 1.00 42.68  ? 480 LYS B CA    1 
ATOM   1082 C  C     . LYS B 1 88  ? -15.823 18.562  -21.584 1.00 47.84  ? 480 LYS B C     1 
ATOM   1083 O  O     . LYS B 1 88  ? -15.694 18.813  -22.782 1.00 47.70  ? 480 LYS B O     1 
ATOM   1084 C  CB    . LYS B 1 88  ? -14.180 19.748  -20.085 1.00 46.11  ? 480 LYS B CB    1 
ATOM   1085 C  CG    . LYS B 1 88  ? -13.656 21.159  -19.834 1.00 48.72  ? 480 LYS B CG    1 
ATOM   1086 C  CD    . LYS B 1 88  ? -12.145 21.198  -19.470 1.00 50.98  ? 480 LYS B CD    1 
ATOM   1087 C  CE    . LYS B 1 88  ? -11.241 21.436  -20.708 1.00 55.82  ? 480 LYS B CE    1 
ATOM   1088 N  NZ    . LYS B 1 88  ? -9.758  21.672  -20.408 1.00 44.98  ? 480 LYS B NZ    1 
ATOM   1089 N  N     . CYS B 1 89  ? -16.130 17.343  -21.134 1.00 40.98  ? 481 CYS B N     1 
ATOM   1090 C  CA    . CYS B 1 89  ? -16.395 16.243  -22.056 1.00 45.51  ? 481 CYS B CA    1 
ATOM   1091 C  C     . CYS B 1 89  ? -17.570 16.586  -22.970 1.00 53.84  ? 481 CYS B C     1 
ATOM   1092 O  O     . CYS B 1 89  ? -17.472 16.443  -24.186 1.00 51.19  ? 481 CYS B O     1 
ATOM   1093 C  CB    . CYS B 1 89  ? -16.703 14.947  -21.313 1.00 42.94  ? 481 CYS B CB    1 
ATOM   1094 S  SG    . CYS B 1 89  ? -15.302 14.137  -20.511 1.00 45.91  ? 481 CYS B SG    1 
ATOM   1095 N  N     . LEU B 1 90  ? -18.673 17.028  -22.364 1.00 49.11  ? 482 LEU B N     1 
ATOM   1096 C  CA    . LEU B 1 90  ? -19.888 17.401  -23.083 1.00 48.33  ? 482 LEU B CA    1 
ATOM   1097 C  C     . LEU B 1 90  ? -19.695 18.576  -24.019 1.00 51.22  ? 482 LEU B C     1 
ATOM   1098 O  O     . LEU B 1 90  ? -20.192 18.562  -25.137 1.00 58.36  ? 482 LEU B O     1 
ATOM   1099 C  CB    . LEU B 1 90  ? -21.010 17.725  -22.097 1.00 48.69  ? 482 LEU B CB    1 
ATOM   1100 C  CG    . LEU B 1 90  ? -21.523 16.512  -21.335 1.00 49.66  ? 482 LEU B CG    1 
ATOM   1101 C  CD1   . LEU B 1 90  ? -22.656 16.882  -20.377 1.00 49.98  ? 482 LEU B CD1   1 
ATOM   1102 C  CD2   . LEU B 1 90  ? -21.965 15.455  -22.341 1.00 48.62  ? 482 LEU B CD2   1 
ATOM   1103 N  N     . GLN B 1 91  ? -18.975 19.595  -23.571 1.00 52.95  ? 483 GLN B N     1 
ATOM   1104 C  CA    . GLN B 1 91  ? -18.775 20.791  -24.383 1.00 54.36  ? 483 GLN B CA    1 
ATOM   1105 C  C     . GLN B 1 91  ? -17.882 20.490  -25.574 1.00 58.91  ? 483 GLN B C     1 
ATOM   1106 O  O     . GLN B 1 91  ? -17.890 21.213  -26.571 1.00 61.27  ? 483 GLN B O     1 
ATOM   1107 C  CB    . GLN B 1 91  ? -18.159 21.923  -23.553 1.00 51.08  ? 483 GLN B CB    1 
ATOM   1108 C  CG    . GLN B 1 91  ? -19.105 22.510  -22.518 1.00 56.59  ? 483 GLN B CG    1 
ATOM   1109 C  CD    . GLN B 1 91  ? -18.432 23.536  -21.619 1.00 62.15  ? 483 GLN B CD    1 
ATOM   1110 O  OE1   . GLN B 1 91  ? -17.245 23.850  -21.783 1.00 63.02  ? 483 GLN B OE1   1 
ATOM   1111 N  NE2   . GLN B 1 91  ? -19.192 24.072  -20.668 1.00 59.10  ? 483 GLN B NE2   1 
ATOM   1112 N  N     . ALA B 1 92  ? -17.090 19.432  -25.461 1.00 53.42  ? 484 ALA B N     1 
ATOM   1113 C  CA    . ALA B 1 92  ? -16.181 19.059  -26.533 1.00 53.59  ? 484 ALA B CA    1 
ATOM   1114 C  C     . ALA B 1 92  ? -16.946 18.255  -27.579 1.00 57.22  ? 484 ALA B C     1 
ATOM   1115 O  O     . ALA B 1 92  ? -16.451 18.011  -28.679 1.00 54.88  ? 484 ALA B O     1 
ATOM   1116 C  CB    . ALA B 1 92  ? -15.017 18.273  -25.999 1.00 53.23  ? 484 ALA B CB    1 
ATOM   1117 N  N     . GLY B 1 93  ? -18.160 17.855  -27.213 1.00 56.59  ? 485 GLY B N     1 
ATOM   1118 C  CA    . GLY B 1 93  ? -19.050 17.135  -28.102 1.00 57.51  ? 485 GLY B CA    1 
ATOM   1119 C  C     . GLY B 1 93  ? -19.080 15.627  -27.899 1.00 61.89  ? 485 GLY B C     1 
ATOM   1120 O  O     . GLY B 1 93  ? -19.579 14.903  -28.755 1.00 61.47  ? 485 GLY B O     1 
ATOM   1121 N  N     . MET B 1 94  ? -18.559 15.137  -26.778 1.00 57.42  ? 486 MET B N     1 
ATOM   1122 C  CA    . MET B 1 94  ? -18.487 13.694  -26.594 1.00 56.07  ? 486 MET B CA    1 
ATOM   1123 C  C     . MET B 1 94  ? -19.873 13.101  -26.460 1.00 61.82  ? 486 MET B C     1 
ATOM   1124 O  O     . MET B 1 94  ? -20.777 13.702  -25.878 1.00 60.01  ? 486 MET B O     1 
ATOM   1125 C  CB    . MET B 1 94  ? -17.636 13.322  -25.383 1.00 53.28  ? 486 MET B CB    1 
ATOM   1126 C  CG    . MET B 1 94  ? -16.158 13.489  -25.620 1.00 55.07  ? 486 MET B CG    1 
ATOM   1127 S  SD    . MET B 1 94  ? -15.149 13.115  -24.169 1.00 57.40  ? 486 MET B SD    1 
ATOM   1128 C  CE    . MET B 1 94  ? -15.075 11.319  -24.230 1.00 54.45  ? 486 MET B CE    1 
ATOM   1129 N  N     . ASN B 1 95  ? -20.027 11.911  -27.024 1.00 62.53  ? 487 ASN B N     1 
ATOM   1130 C  CA    . ASN B 1 95  ? -21.305 11.226  -27.048 1.00 67.52  ? 487 ASN B CA    1 
ATOM   1131 C  C     . ASN B 1 95  ? -21.049 9.763   -27.347 1.00 69.26  ? 487 ASN B C     1 
ATOM   1132 O  O     . ASN B 1 95  ? -20.147 9.444   -28.116 1.00 68.68  ? 487 ASN B O     1 
ATOM   1133 C  CB    . ASN B 1 95  ? -22.235 11.847  -28.094 1.00 68.83  ? 487 ASN B CB    1 
ATOM   1134 C  CG    . ASN B 1 95  ? -23.575 11.171  -28.144 1.00 74.81  ? 487 ASN B CG    1 
ATOM   1135 O  OD1   . ASN B 1 95  ? -24.117 10.764  -27.114 1.00 76.75  ? 487 ASN B OD1   1 
ATOM   1136 N  ND2   . ASN B 1 95  ? -24.123 11.036  -29.346 1.00 83.89  ? 487 ASN B ND2   1 
ATOM   1137 N  N     . LEU B 1 96  ? -21.835 8.876   -26.750 1.00 69.28  ? 488 LEU B N     1 
ATOM   1138 C  CA    . LEU B 1 96  ? -21.596 7.445   -26.895 1.00 72.64  ? 488 LEU B CA    1 
ATOM   1139 C  C     . LEU B 1 96  ? -21.713 6.952   -28.350 1.00 77.97  ? 488 LEU B C     1 
ATOM   1140 O  O     . LEU B 1 96  ? -21.408 5.795   -28.647 1.00 75.11  ? 488 LEU B O     1 
ATOM   1141 C  CB    . LEU B 1 96  ? -22.551 6.678   -25.989 1.00 71.71  ? 488 LEU B CB    1 
ATOM   1142 C  CG    . LEU B 1 96  ? -22.318 6.995   -24.516 1.00 69.57  ? 488 LEU B CG    1 
ATOM   1143 C  CD1   . LEU B 1 96  ? -23.206 6.140   -23.643 1.00 75.36  ? 488 LEU B CD1   1 
ATOM   1144 C  CD2   . LEU B 1 96  ? -20.854 6.808   -24.132 1.00 62.90  ? 488 LEU B CD2   1 
ATOM   1145 N  N     . GLU B 1 97  ? -22.138 7.844   -29.246 1.00 80.02  ? 489 GLU B N     1 
ATOM   1146 C  CA    . GLU B 1 97  ? -22.167 7.577   -30.683 1.00 79.00  ? 489 GLU B CA    1 
ATOM   1147 C  C     . GLU B 1 97  ? -21.113 8.399   -31.442 1.00 82.52  ? 489 GLU B C     1 
ATOM   1148 O  O     . GLU B 1 97  ? -21.080 9.632   -31.351 1.00 79.19  ? 489 GLU B O     1 
ATOM   1149 C  CB    . GLU B 1 97  ? -23.564 7.862   -31.240 1.00 79.19  ? 489 GLU B CB    1 
ATOM   1150 C  CG    . GLU B 1 97  ? -24.604 6.833   -30.834 1.00 81.77  ? 489 GLU B CG    1 
ATOM   1151 C  CD    . GLU B 1 97  ? -25.048 6.962   -29.385 1.00 86.27  ? 489 GLU B CD    1 
ATOM   1152 O  OE1   . GLU B 1 97  ? -24.559 7.872   -28.677 1.00 82.03  ? 489 GLU B OE1   1 
ATOM   1153 O  OE2   . GLU B 1 97  ? -25.887 6.141   -28.950 1.00 90.29  ? 489 GLU B OE2   1 
ATOM   1154 N  N     . ALA B 1 98  ? -20.255 7.706   -32.190 1.00 87.32  ? 490 ALA B N     1 
ATOM   1155 C  CA    . ALA B 1 98  ? -19.205 8.357   -32.976 1.00 84.88  ? 490 ALA B CA    1 
ATOM   1156 C  C     . ALA B 1 98  ? -19.728 8.846   -34.325 1.00 88.39  ? 490 ALA B C     1 
ATOM   1157 O  O     . ALA B 1 98  ? -19.086 8.637   -35.359 1.00 88.94  ? 490 ALA B O     1 
ATOM   1158 C  CB    . ALA B 1 98  ? -18.033 7.405   -33.185 1.00 83.13  ? 490 ALA B CB    1 
ATOM   1159 O  "O5'" . DA  C 2 1   ? -18.263 2.740   35.492  1.00 90.00  ? 1   DA  C "O5'" 1 
ATOM   1160 C  "C5'" . DA  C 2 1   ? -18.558 3.019   34.114  1.00 88.66  ? 1   DA  C "C5'" 1 
ATOM   1161 C  "C4'" . DA  C 2 1   ? -17.913 4.322   33.658  1.00 86.16  ? 1   DA  C "C4'" 1 
ATOM   1162 O  "O4'" . DA  C 2 1   ? -16.486 4.126   33.464  1.00 83.71  ? 1   DA  C "O4'" 1 
ATOM   1163 C  "C3'" . DA  C 2 1   ? -18.417 4.844   32.325  1.00 90.04  ? 1   DA  C "C3'" 1 
ATOM   1164 O  "O3'" . DA  C 2 1   ? -18.232 6.244   32.256  1.00 91.87  ? 1   DA  C "O3'" 1 
ATOM   1165 C  "C2'" . DA  C 2 1   ? -17.517 4.117   31.334  1.00 84.70  ? 1   DA  C "C2'" 1 
ATOM   1166 C  "C1'" . DA  C 2 1   ? -16.182 4.123   32.077  1.00 82.11  ? 1   DA  C "C1'" 1 
ATOM   1167 N  N9    . DA  C 2 1   ? -15.365 2.952   31.792  1.00 79.88  ? 1   DA  C N9    1 
ATOM   1168 C  C8    . DA  C 2 1   ? -15.813 1.711   31.420  1.00 80.16  ? 1   DA  C C8    1 
ATOM   1169 N  N7    . DA  C 2 1   ? -14.852 0.838   31.225  1.00 76.62  ? 1   DA  C N7    1 
ATOM   1170 C  C5    . DA  C 2 1   ? -13.695 1.553   31.491  1.00 71.31  ? 1   DA  C C5    1 
ATOM   1171 C  C6    . DA  C 2 1   ? -12.344 1.191   31.462  1.00 71.11  ? 1   DA  C C6    1 
ATOM   1172 N  N6    . DA  C 2 1   ? -11.926 -0.036  31.140  1.00 71.53  ? 1   DA  C N6    1 
ATOM   1173 N  N1    . DA  C 2 1   ? -11.435 2.137   31.776  1.00 67.57  ? 1   DA  C N1    1 
ATOM   1174 C  C2    . DA  C 2 1   ? -11.867 3.363   32.093  1.00 69.88  ? 1   DA  C C2    1 
ATOM   1175 N  N3    . DA  C 2 1   ? -13.114 3.824   32.156  1.00 72.28  ? 1   DA  C N3    1 
ATOM   1176 C  C4    . DA  C 2 1   ? -13.990 2.859   31.840  1.00 73.28  ? 1   DA  C C4    1 
ATOM   1177 P  P     . DG  C 2 2   ? -19.079 7.102   31.199  1.00 98.81  ? 2   DG  C P     1 
ATOM   1178 O  OP1   . DG  C 2 2   ? -19.739 8.206   31.945  1.00 93.25  ? 2   DG  C OP1   1 
ATOM   1179 O  OP2   . DG  C 2 2   ? -19.873 6.127   30.406  1.00 90.40  ? 2   DG  C OP2   1 
ATOM   1180 O  "O5'" . DG  C 2 2   ? -17.964 7.723   30.229  1.00 92.39  ? 2   DG  C "O5'" 1 
ATOM   1181 C  "C5'" . DG  C 2 2   ? -17.072 8.716   30.724  1.00 86.70  ? 2   DG  C "C5'" 1 
ATOM   1182 C  "C4'" . DG  C 2 2   ? -15.904 8.906   29.779  1.00 79.30  ? 2   DG  C "C4'" 1 
ATOM   1183 O  "O4'" . DG  C 2 2   ? -14.960 7.808   29.914  1.00 80.00  ? 2   DG  C "O4'" 1 
ATOM   1184 C  "C3'" . DG  C 2 2   ? -16.265 8.968   28.281  1.00 78.04  ? 2   DG  C "C3'" 1 
ATOM   1185 O  "O3'" . DG  C 2 2   ? -15.658 10.115  27.728  1.00 83.11  ? 2   DG  C "O3'" 1 
ATOM   1186 C  "C2'" . DG  C 2 2   ? -15.637 7.691   27.717  1.00 72.28  ? 2   DG  C "C2'" 1 
ATOM   1187 C  "C1'" . DG  C 2 2   ? -14.442 7.557   28.641  1.00 70.73  ? 2   DG  C "C1'" 1 
ATOM   1188 N  N9    . DG  C 2 2   ? -13.786 6.256   28.610  1.00 68.15  ? 2   DG  C N9    1 
ATOM   1189 C  C8    . DG  C 2 2   ? -14.362 5.024   28.402  1.00 67.30  ? 2   DG  C C8    1 
ATOM   1190 N  N7    . DG  C 2 2   ? -13.495 4.043   28.402  1.00 67.64  ? 2   DG  C N7    1 
ATOM   1191 C  C5    . DG  C 2 2   ? -12.270 4.673   28.620  1.00 65.59  ? 2   DG  C C5    1 
ATOM   1192 C  C6    . DG  C 2 2   ? -10.958 4.135   28.720  1.00 64.69  ? 2   DG  C C6    1 
ATOM   1193 O  O6    . DG  C 2 2   ? -10.598 2.949   28.635  1.00 64.74  ? 2   DG  C O6    1 
ATOM   1194 N  N1    . DG  C 2 2   ? -10.012 5.133   28.939  1.00 62.42  ? 2   DG  C N1    1 
ATOM   1195 C  C2    . DG  C 2 2   ? -10.293 6.475   29.035  1.00 61.71  ? 2   DG  C C2    1 
ATOM   1196 N  N2    . DG  C 2 2   ? -9.256  7.287   29.243  1.00 61.14  ? 2   DG  C N2    1 
ATOM   1197 N  N3    . DG  C 2 2   ? -11.504 6.985   28.944  1.00 62.74  ? 2   DG  C N3    1 
ATOM   1198 C  C4    . DG  C 2 2   ? -12.440 6.032   28.739  1.00 65.04  ? 2   DG  C C4    1 
ATOM   1199 P  P     . DT  C 2 3   ? -16.092 10.714  26.298  1.00 87.65  ? 3   DT  C P     1 
ATOM   1200 O  OP1   . DT  C 2 3   ? -16.995 11.862  26.575  1.00 69.72  ? 3   DT  C OP1   1 
ATOM   1201 O  OP2   . DT  C 2 3   ? -16.479 9.637   25.352  1.00 73.02  ? 3   DT  C OP2   1 
ATOM   1202 O  "O5'" . DT  C 2 3   ? -14.715 11.301  25.762  1.00 74.09  ? 3   DT  C "O5'" 1 
ATOM   1203 C  "C5'" . DT  C 2 3   ? -13.790 11.870  26.679  1.00 63.87  ? 3   DT  C "C5'" 1 
ATOM   1204 C  "C4'" . DT  C 2 3   ? -12.380 11.569  26.235  1.00 61.36  ? 3   DT  C "C4'" 1 
ATOM   1205 O  "O4'" . DT  C 2 3   ? -12.077 10.196  26.505  1.00 58.71  ? 3   DT  C "O4'" 1 
ATOM   1206 C  "C3'" . DT  C 2 3   ? -12.139 11.731  24.730  1.00 58.48  ? 3   DT  C "C3'" 1 
ATOM   1207 O  "O3'" . DT  C 2 3   ? -11.542 12.972  24.490  1.00 59.95  ? 3   DT  C "O3'" 1 
ATOM   1208 C  "C2'" . DT  C 2 3   ? -11.190 10.577  24.372  1.00 57.31  ? 3   DT  C "C2'" 1 
ATOM   1209 C  "C1'" . DT  C 2 3   ? -10.985 9.856   25.709  1.00 57.60  ? 3   DT  C "C1'" 1 
ATOM   1210 N  N1    . DT  C 2 3   ? -10.925 8.388   25.590  1.00 57.70  ? 3   DT  C N1    1 
ATOM   1211 C  C2    . DT  C 2 3   ? -9.714  7.784   25.728  1.00 56.50  ? 3   DT  C C2    1 
ATOM   1212 O  O2    . DT  C 2 3   ? -8.693  8.408   25.949  1.00 58.36  ? 3   DT  C O2    1 
ATOM   1213 N  N3    . DT  C 2 3   ? -9.733  6.424   25.611  1.00 55.90  ? 3   DT  C N3    1 
ATOM   1214 C  C4    . DT  C 2 3   ? -10.828 5.621   25.366  1.00 56.57  ? 3   DT  C C4    1 
ATOM   1215 O  O4    . DT  C 2 3   ? -10.736 4.406   25.269  1.00 57.80  ? 3   DT  C O4    1 
ATOM   1216 C  C5    . DT  C 2 3   ? -12.084 6.314   25.216  1.00 61.21  ? 3   DT  C C5    1 
ATOM   1217 C  C7    . DT  C 2 3   ? -13.342 5.537   24.935  1.00 57.02  ? 3   DT  C C7    1 
ATOM   1218 C  C6    . DT  C 2 3   ? -12.076 7.659   25.334  1.00 59.24  ? 3   DT  C C6    1 
ATOM   1219 P  P     . DG  C 2 4   ? -11.446 13.570  22.999  1.00 65.68  ? 4   DG  C P     1 
ATOM   1220 O  OP1   . DG  C 2 4   ? -11.180 15.000  23.256  1.00 55.31  ? 4   DG  C OP1   1 
ATOM   1221 O  OP2   . DG  C 2 4   ? -12.561 13.051  22.155  1.00 51.70  ? 4   DG  C OP2   1 
ATOM   1222 O  "O5'" . DG  C 2 4   ? -10.121 12.923  22.408  1.00 51.60  ? 4   DG  C "O5'" 1 
ATOM   1223 C  "C5'" . DG  C 2 4   ? -8.893  13.213  22.999  1.00 51.16  ? 4   DG  C "C5'" 1 
ATOM   1224 C  "C4'" . DG  C 2 4   ? -7.867  12.246  22.481  1.00 53.98  ? 4   DG  C "C4'" 1 
ATOM   1225 O  "O4'" . DG  C 2 4   ? -8.248  10.898  22.871  1.00 50.37  ? 4   DG  C "O4'" 1 
ATOM   1226 C  "C3'" . DG  C 2 4   ? -7.733  12.217  20.941  1.00 49.95  ? 4   DG  C "C3'" 1 
ATOM   1227 O  "O3'" . DG  C 2 4   ? -6.364  12.204  20.599  1.00 54.54  ? 4   DG  C "O3'" 1 
ATOM   1228 C  "C2'" . DG  C 2 4   ? -8.400  10.896  20.563  1.00 48.16  ? 4   DG  C "C2'" 1 
ATOM   1229 C  "C1'" . DG  C 2 4   ? -8.011  10.062  21.778  1.00 52.37  ? 4   DG  C "C1'" 1 
ATOM   1230 N  N9    . DG  C 2 4   ? -8.748  8.820   21.927  1.00 53.08  ? 4   DG  C N9    1 
ATOM   1231 C  C8    . DG  C 2 4   ? -10.102 8.619   21.797  1.00 53.32  ? 4   DG  C C8    1 
ATOM   1232 N  N7    . DG  C 2 4   ? -10.454 7.370   21.967  1.00 51.24  ? 4   DG  C N7    1 
ATOM   1233 C  C5    . DG  C 2 4   ? -9.260  6.711   22.213  1.00 52.04  ? 4   DG  C C5    1 
ATOM   1234 C  C6    . DG  C 2 4   ? -9.002  5.342   22.474  1.00 54.58  ? 4   DG  C C6    1 
ATOM   1235 O  O6    . DG  C 2 4   ? -9.809  4.409   22.533  1.00 54.74  ? 4   DG  C O6    1 
ATOM   1236 N  N1    . DG  C 2 4   ? -7.641  5.100   22.662  1.00 53.48  ? 4   DG  C N1    1 
ATOM   1237 C  C2    . DG  C 2 4   ? -6.661  6.062   22.619  1.00 52.50  ? 4   DG  C C2    1 
ATOM   1238 N  N2    . DG  C 2 4   ? -5.408  5.651   22.831  1.00 51.85  ? 4   DG  C N2    1 
ATOM   1239 N  N3    . DG  C 2 4   ? -6.894  7.342   22.384  1.00 53.12  ? 4   DG  C N3    1 
ATOM   1240 C  C4    . DG  C 2 4   ? -8.204  7.591   22.186  1.00 53.08  ? 4   DG  C C4    1 
ATOM   1241 P  P     . DG  C 2 5   ? -5.857  12.617  19.126  1.00 50.47  ? 5   DG  C P     1 
ATOM   1242 O  OP1   . DG  C 2 5   ? -5.667  14.075  19.136  1.00 50.53  ? 5   DG  C OP1   1 
ATOM   1243 O  OP2   . DG  C 2 5   ? -6.615  11.903  18.063  1.00 44.80  ? 5   DG  C OP2   1 
ATOM   1244 O  "O5'" . DG  C 2 5   ? -4.423  12.002  19.101  1.00 54.46  ? 5   DG  C "O5'" 1 
ATOM   1245 C  "C5'" . DG  C 2 5   ? -4.245  10.869  18.420  1.00 55.73  ? 5   DG  C "C5'" 1 
ATOM   1246 C  "C4'" . DG  C 2 5   ? -3.131  10.087  19.019  1.00 56.23  ? 5   DG  C "C4'" 1 
ATOM   1247 O  "O4'" . DG  C 2 5   ? -3.632  9.312   20.119  1.00 52.60  ? 5   DG  C "O4'" 1 
ATOM   1248 C  "C3'" . DG  C 2 5   ? -2.517  9.129   18.029  1.00 57.00  ? 5   DG  C "C3'" 1 
ATOM   1249 O  "O3'" . DG  C 2 5   ? -1.198  9.494   17.826  1.00 60.03  ? 5   DG  C "O3'" 1 
ATOM   1250 C  "C2'" . DG  C 2 5   ? -2.631  7.753   18.666  1.00 57.08  ? 5   DG  C "C2'" 1 
ATOM   1251 C  "C1'" . DG  C 2 5   ? -3.637  7.956   19.773  1.00 55.86  ? 5   DG  C "C1'" 1 
ATOM   1252 N  N9    . DG  C 2 5   ? -4.999  7.520   19.466  1.00 56.75  ? 5   DG  C N9    1 
ATOM   1253 C  C8    . DG  C 2 5   ? -6.111  8.306   19.234  1.00 56.64  ? 5   DG  C C8    1 
ATOM   1254 N  N7    . DG  C 2 5   ? -7.207  7.614   19.039  1.00 53.79  ? 5   DG  C N7    1 
ATOM   1255 C  C5    . DG  C 2 5   ? -6.793  6.289   19.173  1.00 51.71  ? 5   DG  C C5    1 
ATOM   1256 C  C6    . DG  C 2 5   ? -7.530  5.091   19.082  1.00 49.36  ? 5   DG  C C6    1 
ATOM   1257 O  O6    . DG  C 2 5   ? -8.735  4.948   18.867  1.00 49.71  ? 5   DG  C O6    1 
ATOM   1258 N  N1    . DG  C 2 5   ? -6.724  3.973   19.261  1.00 52.99  ? 5   DG  C N1    1 
ATOM   1259 C  C2    . DG  C 2 5   ? -5.375  4.010   19.525  1.00 56.97  ? 5   DG  C C2    1 
ATOM   1260 N  N2    . DG  C 2 5   ? -4.760  2.826   19.673  1.00 53.96  ? 5   DG  C N2    1 
ATOM   1261 N  N3    . DG  C 2 5   ? -4.672  5.131   19.620  1.00 56.92  ? 5   DG  C N3    1 
ATOM   1262 C  C4    . DG  C 2 5   ? -5.441  6.223   19.430  1.00 53.05  ? 5   DG  C C4    1 
ATOM   1263 P  P     . DA  C 2 6   ? -0.621  9.524   16.343  1.00 61.98  ? 6   DA  C P     1 
ATOM   1264 O  OP1   . DA  C 2 6   ? 0.695   10.199  16.346  1.00 71.77  ? 6   DA  C OP1   1 
ATOM   1265 O  OP2   . DA  C 2 6   ? -1.690  10.009  15.441  1.00 55.44  ? 6   DA  C OP2   1 
ATOM   1266 O  "O5'" . DA  C 2 6   ? -0.418  7.998   16.031  1.00 58.56  ? 6   DA  C "O5'" 1 
ATOM   1267 C  "C5'" . DA  C 2 6   ? 0.206   7.178   16.951  1.00 62.61  ? 6   DA  C "C5'" 1 
ATOM   1268 C  "C4'" . DA  C 2 6   ? -0.127  5.750   16.608  1.00 65.30  ? 6   DA  C "C4'" 1 
ATOM   1269 O  "O4'" . DA  C 2 6   ? -1.506  5.492   16.940  1.00 61.22  ? 6   DA  C "O4'" 1 
ATOM   1270 C  "C3'" . DA  C 2 6   ? 0.029   5.443   15.127  1.00 64.50  ? 6   DA  C "C3'" 1 
ATOM   1271 O  "O3'" . DA  C 2 6   ? 0.993   4.434   14.974  1.00 71.01  ? 6   DA  C "O3'" 1 
ATOM   1272 C  "C2'" . DA  C 2 6   ? -1.369  5.004   14.658  1.00 63.59  ? 6   DA  C "C2'" 1 
ATOM   1273 C  "C1'" . DA  C 2 6   ? -2.102  4.700   15.956  1.00 60.27  ? 6   DA  C "C1'" 1 
ATOM   1274 N  N9    . DA  C 2 6   ? -3.504  5.059   15.909  1.00 55.59  ? 6   DA  C N9    1 
ATOM   1275 C  C8    . DA  C 2 6   ? -4.018  6.310   15.737  1.00 58.82  ? 6   DA  C C8    1 
ATOM   1276 N  N7    . DA  C 2 6   ? -5.332  6.347   15.722  1.00 57.25  ? 6   DA  C N7    1 
ATOM   1277 C  C5    . DA  C 2 6   ? -5.702  5.029   15.910  1.00 54.63  ? 6   DA  C C5    1 
ATOM   1278 C  C6    . DA  C 2 6   ? -6.951  4.409   15.999  1.00 53.49  ? 6   DA  C C6    1 
ATOM   1279 N  N6    . DA  C 2 6   ? -8.105  5.075   15.907  1.00 53.05  ? 6   DA  C N6    1 
ATOM   1280 N  N1    . DA  C 2 6   ? -6.975  3.066   16.188  1.00 58.26  ? 6   DA  C N1    1 
ATOM   1281 C  C2    . DA  C 2 6   ? -5.811  2.404   16.276  1.00 59.59  ? 6   DA  C C2    1 
ATOM   1282 N  N3    . DA  C 2 6   ? -4.571  2.886   16.210  1.00 60.59  ? 6   DA  C N3    1 
ATOM   1283 C  C4    . DA  C 2 6   ? -4.586  4.218   16.029  1.00 58.35  ? 6   DA  C C4    1 
ATOM   1284 P  P     . DA  C 2 7   ? 1.202   3.694   13.568  1.00 74.93  ? 7   DA  C P     1 
ATOM   1285 O  OP1   . DA  C 2 7   ? 2.581   3.165   13.662  1.00 77.86  ? 7   DA  C OP1   1 
ATOM   1286 O  OP2   . DA  C 2 7   ? 0.813   4.571   12.433  1.00 70.96  ? 7   DA  C OP2   1 
ATOM   1287 O  "O5'" . DA  C 2 7   ? 0.176   2.474   13.635  1.00 71.94  ? 7   DA  C "O5'" 1 
ATOM   1288 C  "C5'" . DA  C 2 7   ? 0.152   1.649   14.788  1.00 65.43  ? 7   DA  C "C5'" 1 
ATOM   1289 C  "C4'" . DA  C 2 7   ? -0.624  0.377   14.522  1.00 66.48  ? 7   DA  C "C4'" 1 
ATOM   1290 O  "O4'" . DA  C 2 7   ? -2.049  0.642   14.590  1.00 66.54  ? 7   DA  C "O4'" 1 
ATOM   1291 C  "C3'" . DA  C 2 7   ? -0.377  -0.258  13.163  1.00 71.68  ? 7   DA  C "C3'" 1 
ATOM   1292 O  "O3'" . DA  C 2 7   ? -0.410  -1.687  13.300  1.00 72.91  ? 7   DA  C "O3'" 1 
ATOM   1293 C  "C2'" . DA  C 2 7   ? -1.538  0.280   12.314  1.00 68.95  ? 7   DA  C "C2'" 1 
ATOM   1294 C  "C1'" . DA  C 2 7   ? -2.663  0.399   13.336  1.00 66.06  ? 7   DA  C "C1'" 1 
ATOM   1295 N  N9    . DA  C 2 7   ? -3.578  1.503   13.075  1.00 62.06  ? 7   DA  C N9    1 
ATOM   1296 C  C8    . DA  C 2 7   ? -3.239  2.795   12.797  1.00 61.92  ? 7   DA  C C8    1 
ATOM   1297 N  N7    . DA  C 2 7   ? -4.271  3.588   12.626  1.00 61.16  ? 7   DA  C N7    1 
ATOM   1298 C  C5    . DA  C 2 7   ? -5.365  2.762   12.825  1.00 58.07  ? 7   DA  C C5    1 
ATOM   1299 C  C6    . DA  C 2 7   ? -6.752  3.001   12.787  1.00 55.05  ? 7   DA  C C6    1 
ATOM   1300 N  N6    . DA  C 2 7   ? -7.284  4.199   12.525  1.00 59.55  ? 7   DA  C N6    1 
ATOM   1301 N  N1    . DA  C 2 7   ? -7.574  1.962   13.029  1.00 57.65  ? 7   DA  C N1    1 
ATOM   1302 C  C2    . DA  C 2 7   ? -7.036  0.763   13.288  1.00 60.35  ? 7   DA  C C2    1 
ATOM   1303 N  N3    . DA  C 2 7   ? -5.747  0.416   13.345  1.00 62.19  ? 7   DA  C N3    1 
ATOM   1304 C  C4    . DA  C 2 7   ? -4.956  1.472   13.103  1.00 60.13  ? 7   DA  C C4    1 
ATOM   1305 P  P     . DA  C 2 8   ? -0.213  -2.659  12.033  1.00 79.01  ? 8   DA  C P     1 
ATOM   1306 O  OP1   . DA  C 2 8   ? 0.491   -3.866  12.522  1.00 82.18  ? 8   DA  C OP1   1 
ATOM   1307 O  OP2   . DA  C 2 8   ? 0.390   -1.899  10.914  1.00 72.70  ? 8   DA  C OP2   1 
ATOM   1308 O  "O5'" . DA  C 2 8   ? -1.723  -3.072  11.671  1.00 70.43  ? 8   DA  C "O5'" 1 
ATOM   1309 C  "C5'" . DA  C 2 8   ? -2.638  -3.346  12.723  1.00 65.53  ? 8   DA  C "C5'" 1 
ATOM   1310 C  "C4'" . DA  C 2 8   ? -3.995  -3.751  12.183  1.00 70.16  ? 8   DA  C "C4'" 1 
ATOM   1311 O  "O4'" . DA  C 2 8   ? -4.818  -2.573  11.970  1.00 69.74  ? 8   DA  C "O4'" 1 
ATOM   1312 C  "C3'" . DA  C 2 8   ? -3.978  -4.508  10.857  1.00 72.35  ? 8   DA  C "C3'" 1 
ATOM   1313 O  "O3'" . DA  C 2 8   ? -4.952  -5.562  10.913  1.00 77.65  ? 8   DA  C "O3'" 1 
ATOM   1314 C  "C2'" . DA  C 2 8   ? -4.353  -3.423  9.832   1.00 67.20  ? 8   DA  C "C2'" 1 
ATOM   1315 C  "C1'" . DA  C 2 8   ? -5.308  -2.550  10.640  1.00 66.61  ? 8   DA  C "C1'" 1 
ATOM   1316 N  N9    . DA  C 2 8   ? -5.358  -1.144  10.218  1.00 65.21  ? 8   DA  C N9    1 
ATOM   1317 C  C8    . DA  C 2 8   ? -4.294  -0.342  9.902   1.00 62.01  ? 8   DA  C C8    1 
ATOM   1318 N  N7    . DA  C 2 8   ? -4.630  0.892   9.603   1.00 60.29  ? 8   DA  C N7    1 
ATOM   1319 C  C5    . DA  C 2 8   ? -6.013  0.905   9.735   1.00 59.05  ? 8   DA  C C5    1 
ATOM   1320 C  C6    . DA  C 2 8   ? -6.971  1.920   9.555   1.00 58.36  ? 8   DA  C C6    1 
ATOM   1321 N  N6    . DA  C 2 8   ? -6.656  3.167   9.185   1.00 58.33  ? 8   DA  C N6    1 
ATOM   1322 N  N1    . DA  C 2 8   ? -8.268  1.610   9.784   1.00 58.94  ? 8   DA  C N1    1 
ATOM   1323 C  C2    . DA  C 2 8   ? -8.574  0.360   10.152  1.00 58.24  ? 8   DA  C C2    1 
ATOM   1324 N  N3    . DA  C 2 8   ? -7.760  -0.679  10.345  1.00 61.12  ? 8   DA  C N3    1 
ATOM   1325 C  C4    . DA  C 2 8   ? -6.480  -0.337  10.120  1.00 61.31  ? 8   DA  C C4    1 
ATOM   1326 P  P     . DT  C 2 9   ? -4.996  -6.732  9.807   1.00 79.99  ? 9   DT  C P     1 
ATOM   1327 O  OP1   . DT  C 2 9   ? -5.027  -8.015  10.548  1.00 82.53  ? 9   DT  C OP1   1 
ATOM   1328 O  OP2   . DT  C 2 9   ? -3.935  -6.497  8.800   1.00 67.80  ? 9   DT  C OP2   1 
ATOM   1329 O  "O5'" . DT  C 2 9   ? -6.436  -6.537  9.145   1.00 68.55  ? 9   DT  C "O5'" 1 
ATOM   1330 C  "C5'" . DT  C 2 9   ? -7.532  -6.172  9.977   1.00 66.29  ? 9   DT  C "C5'" 1 
ATOM   1331 C  "C4'" . DT  C 2 9   ? -8.607  -5.474  9.171   1.00 67.30  ? 9   DT  C "C4'" 1 
ATOM   1332 O  "O4'" . DT  C 2 9   ? -8.254  -4.083  8.945   1.00 66.30  ? 9   DT  C "O4'" 1 
ATOM   1333 C  "C3'" . DT  C 2 9   ? -8.870  -6.079  7.789   1.00 68.52  ? 9   DT  C "C3'" 1 
ATOM   1334 O  "O3'" . DT  C 2 9   ? -10.223 -6.505  7.726   1.00 74.14  ? 9   DT  C "O3'" 1 
ATOM   1335 C  "C2'" . DT  C 2 9   ? -8.576  -4.925  6.796   1.00 63.37  ? 9   DT  C "C2'" 1 
ATOM   1336 C  "C1'" . DT  C 2 9   ? -8.759  -3.696  7.676   1.00 66.47  ? 9   DT  C "C1'" 1 
ATOM   1337 N  N1    . DT  C 2 9   ? -8.005  -2.459  7.203   1.00 61.15  ? 9   DT  C N1    1 
ATOM   1338 C  C2    . DT  C 2 9   ? -8.689  -1.272  6.992   1.00 57.69  ? 9   DT  C C2    1 
ATOM   1339 O  O2    . DT  C 2 9   ? -9.897  -1.149  7.146   1.00 56.19  ? 9   DT  C O2    1 
ATOM   1340 N  N3    . DT  C 2 9   ? -7.898  -0.226  6.598   1.00 56.47  ? 9   DT  C N3    1 
ATOM   1341 C  C4    . DT  C 2 9   ? -6.526  -0.248  6.395   1.00 59.02  ? 9   DT  C C4    1 
ATOM   1342 O  O4    . DT  C 2 9   ? -5.894  0.740   6.033   1.00 58.88  ? 9   DT  C O4    1 
ATOM   1343 C  C5    . DT  C 2 9   ? -5.883  -1.511  6.632   1.00 58.34  ? 9   DT  C C5    1 
ATOM   1344 C  C7    . DT  C 2 9   ? -4.398  -1.647  6.439   1.00 59.64  ? 9   DT  C C7    1 
ATOM   1345 C  C6    . DT  C 2 9   ? -6.641  -2.539  7.021   1.00 58.26  ? 9   DT  C C6    1 
ATOM   1346 P  P     . DT  C 2 10  ? -10.765 -7.326  6.455   1.00 82.97  ? 10  DT  C P     1 
ATOM   1347 O  OP1   . DT  C 2 10  ? -11.566 -8.452  6.995   1.00 84.18  ? 10  DT  C OP1   1 
ATOM   1348 O  OP2   . DT  C 2 10  ? -9.617  -7.581  5.537   1.00 71.38  ? 10  DT  C OP2   1 
ATOM   1349 O  "O5'" . DT  C 2 10  ? -11.773 -6.303  5.763   1.00 74.84  ? 10  DT  C "O5'" 1 
ATOM   1350 C  "C5'" . DT  C 2 10  ? -12.572 -5.457  6.571   1.00 72.64  ? 10  DT  C "C5'" 1 
ATOM   1351 C  "C4'" . DT  C 2 10  ? -12.973 -4.215  5.798   1.00 73.76  ? 10  DT  C "C4'" 1 
ATOM   1352 O  "O4'" . DT  C 2 10  ? -11.818 -3.356  5.598   1.00 70.57  ? 10  DT  C "O4'" 1 
ATOM   1353 C  "C3'" . DT  C 2 10  ? -13.560 -4.477  4.405   1.00 71.74  ? 10  DT  C "C3'" 1 
ATOM   1354 O  "O3'" . DT  C 2 10  ? -14.885 -3.922  4.346   1.00 77.78  ? 10  DT  C "O3'" 1 
ATOM   1355 C  "C2'" . DT  C 2 10  ? -12.572 -3.775  3.442   1.00 71.14  ? 10  DT  C "C2'" 1 
ATOM   1356 C  "C1'" . DT  C 2 10  ? -11.942 -2.729  4.351   1.00 65.08  ? 10  DT  C "C1'" 1 
ATOM   1357 N  N1    . DT  C 2 10  ? -10.584 -2.229  3.934   1.00 63.10  ? 10  DT  C N1    1 
ATOM   1358 C  C2    . DT  C 2 10  ? -10.407 -0.868  3.755   1.00 59.85  ? 10  DT  C C2    1 
ATOM   1359 O  O2    . DT  C 2 10  ? -11.312 -0.060  3.889   1.00 53.28  ? 10  DT  C O2    1 
ATOM   1360 N  N3    . DT  C 2 10  ? -9.132  -0.491  3.409   1.00 49.06  ? 10  DT  C N3    1 
ATOM   1361 C  C4    . DT  C 2 10  ? -8.032  -1.317  3.235   1.00 60.30  ? 10  DT  C C4    1 
ATOM   1362 O  O4    . DT  C 2 10  ? -6.914  -0.886  2.920   1.00 58.06  ? 10  DT  C O4    1 
ATOM   1363 C  C5    . DT  C 2 10  ? -8.282  -2.729  3.441   1.00 58.35  ? 10  DT  C C5    1 
ATOM   1364 C  C7    . DT  C 2 10  ? -7.161  -3.708  3.277   1.00 49.53  ? 10  DT  C C7    1 
ATOM   1365 C  C6    . DT  C 2 10  ? -9.529  -3.113  3.790   1.00 58.34  ? 10  DT  C C6    1 
ATOM   1366 P  P     . DC  C 2 11  ? -15.847 -4.171  3.077   1.00 87.60  ? 11  DC  C P     1 
ATOM   1367 O  OP1   . DC  C 2 11  ? -17.243 -4.244  3.565   1.00 78.73  ? 11  DC  C OP1   1 
ATOM   1368 O  OP2   . DC  C 2 11  ? -15.260 -5.222  2.198   1.00 76.52  ? 11  DC  C OP2   1 
ATOM   1369 O  "O5'" . DC  C 2 11  ? -15.771 -2.789  2.311   1.00 84.69  ? 11  DC  C "O5'" 1 
ATOM   1370 C  "C5'" . DC  C 2 11  ? -15.866 -1.585  3.048   1.00 79.61  ? 11  DC  C "C5'" 1 
ATOM   1371 C  "C4'" . DC  C 2 11  ? -15.563 -0.419  2.141   1.00 76.56  ? 11  DC  C "C4'" 1 
ATOM   1372 O  "O4'" . DC  C 2 11  ? -14.132 -0.255  2.034   1.00 72.12  ? 11  DC  C "O4'" 1 
ATOM   1373 C  "C3'" . DC  C 2 11  ? -16.085 -0.602  0.724   1.00 78.34  ? 11  DC  C "C3'" 1 
ATOM   1374 O  "O3'" . DC  C 2 11  ? -16.958 0.458   0.412   1.00 81.33  ? 11  DC  C "O3'" 1 
ATOM   1375 C  "C2'" . DC  C 2 11  ? -14.825 -0.624  -0.158  1.00 73.34  ? 11  DC  C "C2'" 1 
ATOM   1376 C  "C1'" . DC  C 2 11  ? -13.794 0.062   0.720   1.00 69.80  ? 11  DC  C "C1'" 1 
ATOM   1377 N  N1    . DC  C 2 11  ? -12.410 -0.400  0.492   1.00 67.57  ? 11  DC  C N1    1 
ATOM   1378 C  C2    . DC  C 2 11  ? -11.432 0.531   0.150   1.00 64.79  ? 11  DC  C C2    1 
ATOM   1379 O  O2    . DC  C 2 11  ? -11.754 1.712   0.035   1.00 65.25  ? 11  DC  C O2    1 
ATOM   1380 N  N3    . DC  C 2 11  ? -10.163 0.111   -0.051  1.00 61.97  ? 11  DC  C N3    1 
ATOM   1381 C  C4    . DC  C 2 11  ? -9.863  -1.175  0.090   1.00 59.97  ? 11  DC  C C4    1 
ATOM   1382 N  N4    . DC  C 2 11  ? -8.592  -1.545  -0.114  1.00 62.20  ? 11  DC  C N4    1 
ATOM   1383 C  C5    . DC  C 2 11  ? -10.850 -2.142  0.444   1.00 62.62  ? 11  DC  C C5    1 
ATOM   1384 C  C6    . DC  C 2 11  ? -12.099 -1.713  0.642   1.00 62.74  ? 11  DC  C C6    1 
ATOM   1385 P  P     . DC  C 2 12  ? -17.573 0.605   -1.062  1.00 89.20  ? 12  DC  C P     1 
ATOM   1386 O  OP1   . DC  C 2 12  ? -18.872 1.293   -0.854  1.00 87.29  ? 12  DC  C OP1   1 
ATOM   1387 O  OP2   . DC  C 2 12  ? -17.519 -0.701  -1.766  1.00 83.69  ? 12  DC  C OP2   1 
ATOM   1388 O  "O5'" . DC  C 2 12  ? -16.539 1.599   -1.785  1.00 85.60  ? 12  DC  C "O5'" 1 
ATOM   1389 C  "C5'" . DC  C 2 12  ? -16.000 2.717   -1.041  1.00 86.30  ? 12  DC  C "C5'" 1 
ATOM   1390 C  "C4'" . DC  C 2 12  ? -15.111 3.598   -1.909  1.00 82.72  ? 12  DC  C "C4'" 1 
ATOM   1391 O  "O4'" . DC  C 2 12  ? -13.752 3.072   -1.934  1.00 74.63  ? 12  DC  C "O4'" 1 
ATOM   1392 C  "C3'" . DC  C 2 12  ? -15.539 3.714   -3.370  1.00 86.33  ? 12  DC  C "C3'" 1 
ATOM   1393 O  "O3'" . DC  C 2 12  ? -15.295 5.047   -3.823  1.00 95.46  ? 12  DC  C "O3'" 1 
ATOM   1394 C  "C2'" . DC  C 2 12  ? -14.615 2.711   -4.059  1.00 79.92  ? 12  DC  C "C2'" 1 
ATOM   1395 C  "C1'" . DC  C 2 12  ? -13.338 2.923   -3.267  1.00 74.19  ? 12  DC  C "C1'" 1 
ATOM   1396 N  N1    . DC  C 2 12  ? -12.398 1.787   -3.340  1.00 71.39  ? 12  DC  C N1    1 
ATOM   1397 C  C2    . DC  C 2 12  ? -11.065 2.023   -3.666  1.00 69.75  ? 12  DC  C C2    1 
ATOM   1398 O  O2    . DC  C 2 12  ? -10.700 3.179   -3.886  1.00 74.18  ? 12  DC  C O2    1 
ATOM   1399 N  N3    . DC  C 2 12  ? -10.207 0.980   -3.733  1.00 67.60  ? 12  DC  C N3    1 
ATOM   1400 C  C4    . DC  C 2 12  ? -10.642 -0.254  -3.487  1.00 68.69  ? 12  DC  C C4    1 
ATOM   1401 N  N4    . DC  C 2 12  ? -9.757  -1.250  -3.560  1.00 67.63  ? 12  DC  C N4    1 
ATOM   1402 C  C5    . DC  C 2 12  ? -12.003 -0.519  -3.151  1.00 69.08  ? 12  DC  C C5    1 
ATOM   1403 C  C6    . DC  C 2 12  ? -12.841 0.523   -3.092  1.00 72.15  ? 12  DC  C C6    1 
ATOM   1404 P  P     . DC  C 2 13  ? -16.311 5.786   -4.831  1.00 98.68  ? 13  DC  C P     1 
ATOM   1405 O  OP1   . DC  C 2 13  ? -16.680 7.079   -4.191  1.00 83.62  ? 13  DC  C OP1   1 
ATOM   1406 O  OP2   . DC  C 2 13  ? -17.361 4.824   -5.250  1.00 90.99  ? 13  DC  C OP2   1 
ATOM   1407 O  "O5'" . DC  C 2 13  ? -15.408 6.053   -6.120  1.00 91.25  ? 13  DC  C "O5'" 1 
ATOM   1408 C  "C5'" . DC  C 2 13  ? -14.506 5.058   -6.553  1.00 87.41  ? 13  DC  C "C5'" 1 
ATOM   1409 C  "C4'" . DC  C 2 13  ? -13.155 5.668   -6.830  1.00 85.44  ? 13  DC  C "C4'" 1 
ATOM   1410 O  "O4'" . DC  C 2 13  ? -12.097 4.782   -6.366  1.00 84.24  ? 13  DC  C "O4'" 1 
ATOM   1411 C  "C3'" . DC  C 2 13  ? -12.885 5.924   -8.300  1.00 87.78  ? 13  DC  C "C3'" 1 
ATOM   1412 O  "O3'" . DC  C 2 13  ? -12.210 7.168   -8.435  1.00 90.93  ? 13  DC  C "O3'" 1 
ATOM   1413 C  "C2'" . DC  C 2 13  ? -12.010 4.728   -8.705  1.00 83.49  ? 13  DC  C "C2'" 1 
ATOM   1414 C  "C1'" . DC  C 2 13  ? -11.214 4.488   -7.432  1.00 78.46  ? 13  DC  C "C1'" 1 
ATOM   1415 N  N1    . DC  C 2 13  ? -10.729 3.077   -7.268  1.00 70.42  ? 13  DC  C N1    1 
ATOM   1416 C  C2    . DC  C 2 13  ? -9.358  2.799   -7.324  1.00 69.01  ? 13  DC  C C2    1 
ATOM   1417 O  O2    . DC  C 2 13  ? -8.565  3.719   -7.528  1.00 68.82  ? 13  DC  C O2    1 
ATOM   1418 N  N3    . DC  C 2 13  ? -8.937  1.518   -7.164  1.00 70.53  ? 13  DC  C N3    1 
ATOM   1419 C  C4    . DC  C 2 13  ? -9.826  0.542   -6.947  1.00 71.96  ? 13  DC  C C4    1 
ATOM   1420 N  N4    . DC  C 2 13  ? -9.361  -0.710  -6.789  1.00 71.04  ? 13  DC  C N4    1 
ATOM   1421 C  C5    . DC  C 2 13  ? -11.230 0.806   -6.882  1.00 67.57  ? 13  DC  C C5    1 
ATOM   1422 C  C6    . DC  C 2 13  ? -11.630 2.076   -7.042  1.00 71.77  ? 13  DC  C C6    1 
ATOM   1423 P  P     . DA  C 2 14  ? -12.415 8.088   -9.740  1.00 89.27  ? 14  DA  C P     1 
ATOM   1424 O  OP1   . DA  C 2 14  ? -12.978 9.380   -9.286  1.00 88.71  ? 14  DA  C OP1   1 
ATOM   1425 O  OP2   . DA  C 2 14  ? -13.173 7.312   -10.752 1.00 90.46  ? 14  DA  C OP2   1 
ATOM   1426 O  "O5'" . DA  C 2 14  ? -10.906 8.245   -10.263 1.00 86.62  ? 14  DA  C "O5'" 1 
ATOM   1427 C  "C5'" . DA  C 2 14  ? -9.993  7.186   -9.980  1.00 81.64  ? 14  DA  C "C5'" 1 
ATOM   1428 C  "C4'" . DA  C 2 14  ? -8.597  7.492   -10.453 1.00 79.14  ? 14  DA  C "C4'" 1 
ATOM   1429 O  "O4'" . DA  C 2 14  ? -7.733  6.369   -10.114 1.00 81.59  ? 14  DA  C "O4'" 1 
ATOM   1430 C  "C3'" . DA  C 2 14  ? -8.474  7.654   -11.950 1.00 82.50  ? 14  DA  C "C3'" 1 
ATOM   1431 O  "O3'" . DA  C 2 14  ? -7.366  8.514   -12.276 1.00 87.58  ? 14  DA  C "O3'" 1 
ATOM   1432 C  "C2'" . DA  C 2 14  ? -8.256  6.216   -12.418 1.00 78.06  ? 14  DA  C "C2'" 1 
ATOM   1433 C  "C1'" . DA  C 2 14  ? -7.460  5.590   -11.268 1.00 76.89  ? 14  DA  C "C1'" 1 
ATOM   1434 N  N9    . DA  C 2 14  ? -7.790  4.164   -11.005 1.00 73.34  ? 14  DA  C N9    1 
ATOM   1435 C  C8    . DA  C 2 14  ? -9.042  3.597   -10.914 1.00 71.73  ? 14  DA  C C8    1 
ATOM   1436 N  N7    . DA  C 2 14  ? -9.026  2.291   -10.685 1.00 68.20  ? 14  DA  C N7    1 
ATOM   1437 C  C5    . DA  C 2 14  ? -7.673  1.976   -10.626 1.00 68.44  ? 14  DA  C C5    1 
ATOM   1438 C  C6    . DA  C 2 14  ? -6.975  0.751   -10.407 1.00 73.45  ? 14  DA  C C6    1 
ATOM   1439 N  N6    . DA  C 2 14  ? -7.582  -0.438  -10.204 1.00 71.21  ? 14  DA  C N6    1 
ATOM   1440 N  N1    . DA  C 2 14  ? -5.623  0.795   -10.409 1.00 73.48  ? 14  DA  C N1    1 
ATOM   1441 C  C2    . DA  C 2 14  ? -5.014  1.972   -10.614 1.00 73.93  ? 14  DA  C C2    1 
ATOM   1442 N  N3    . DA  C 2 14  ? -5.553  3.176   -10.827 1.00 72.81  ? 14  DA  C N3    1 
ATOM   1443 C  C4    . DA  C 2 14  ? -6.896  3.114   -10.822 1.00 71.18  ? 14  DA  C C4    1 
ATOM   1444 P  P     . DC  C 2 15  ? -7.276  9.194   -13.733 1.00 80.55  ? 15  DC  C P     1 
ATOM   1445 O  OP1   . DC  C 2 15  ? -6.449  10.426  -13.655 1.00 63.30  ? 15  DC  C OP1   1 
ATOM   1446 O  OP2   . DC  C 2 15  ? -8.685  9.370   -14.188 1.00 61.25  ? 15  DC  C OP2   1 
ATOM   1447 O  "O5'" . DC  C 2 15  ? -6.470  8.078   -14.599 1.00 74.10  ? 15  DC  C "O5'" 1 
ATOM   1448 C  "C5'" . DC  C 2 15  ? -5.034  8.065   -14.576 1.00 71.09  ? 15  DC  C "C5'" 1 
ATOM   1449 C  "C4'" . DC  C 2 15  ? -4.463  6.649   -14.511 1.00 80.45  ? 15  DC  C "C4'" 1 
ATOM   1450 O  "O4'" . DC  C 2 15  ? -5.447  5.715   -13.975 1.00 83.39  ? 15  DC  C "O4'" 1 
ATOM   1451 C  "C3'" . DC  C 2 15  ? -4.014  6.052   -15.856 1.00 85.30  ? 15  DC  C "C3'" 1 
ATOM   1452 O  "O3'" . DC  C 2 15  ? -2.695  5.479   -15.741 1.00 92.74  ? 15  DC  C "O3'" 1 
ATOM   1453 C  "C2'" . DC  C 2 15  ? -5.057  4.967   -16.109 1.00 84.90  ? 15  DC  C "C2'" 1 
ATOM   1454 C  "C1'" . DC  C 2 15  ? -5.320  4.505   -14.694 1.00 83.09  ? 15  DC  C "C1'" 1 
ATOM   1455 N  N1    . DC  C 2 15  ? -6.574  3.681   -14.547 1.00 76.81  ? 15  DC  C N1    1 
ATOM   1456 C  C2    . DC  C 2 15  ? -6.491  2.334   -14.134 1.00 73.36  ? 15  DC  C C2    1 
ATOM   1457 O  O2    . DC  C 2 15  ? -5.380  1.838   -13.871 1.00 76.31  ? 15  DC  C O2    1 
ATOM   1458 N  N3    . DC  C 2 15  ? -7.641  1.618   -14.015 1.00 67.17  ? 15  DC  C N3    1 
ATOM   1459 C  C4    . DC  C 2 15  ? -8.826  2.190   -14.298 1.00 73.49  ? 15  DC  C C4    1 
ATOM   1460 N  N4    . DC  C 2 15  ? -9.938  1.444   -14.171 1.00 71.21  ? 15  DC  C N4    1 
ATOM   1461 C  C5    . DC  C 2 15  ? -8.922  3.549   -14.727 1.00 72.80  ? 15  DC  C C5    1 
ATOM   1462 C  C6    . DC  C 2 15  ? -7.784  4.240   -14.852 1.00 75.61  ? 15  DC  C C6    1 
ATOM   1463 P  P     . DT  C 2 16  ? -1.904  5.007   -17.065 1.00 99.32  ? 16  DT  C P     1 
ATOM   1464 O  OP1   . DT  C 2 16  ? -0.805  5.969   -17.307 1.00 97.79  ? 16  DT  C OP1   1 
ATOM   1465 O  OP2   . DT  C 2 16  ? -2.888  4.783   -18.145 1.00 93.17  ? 16  DT  C OP2   1 
ATOM   1466 O  "O5'" . DT  C 2 16  ? -1.243  3.603   -16.659 1.00 92.25  ? 16  DT  C "O5'" 1 
ATOM   1467 C  "C5'" . DT  C 2 16  ? -1.939  2.680   -15.813 1.00 89.94  ? 16  DT  C "C5'" 1 
ATOM   1468 C  "C4'" . DT  C 2 16  ? -1.307  1.292   -15.891 1.00 92.74  ? 16  DT  C "C4'" 1 
ATOM   1469 O  "O4'" . DT  C 2 16  ? -2.353  0.297   -15.881 1.00 90.17  ? 16  DT  C "O4'" 1 
ATOM   1470 C  "C3'" . DT  C 2 16  ? -0.572  1.004   -17.185 1.00 88.39  ? 16  DT  C "C3'" 1 
ATOM   1471 O  "O3'" . DT  C 2 16  ? 0.234   -0.178  -17.044 1.00 82.32  ? 16  DT  C "O3'" 1 
ATOM   1472 C  "C2'" . DT  C 2 16  ? -1.744  0.768   -18.132 1.00 84.72  ? 16  DT  C "C2'" 1 
ATOM   1473 C  "C1'" . DT  C 2 16  ? -2.744  0.038   -17.221 1.00 83.65  ? 16  DT  C "C1'" 1 
ATOM   1474 N  N1    . DT  C 2 16  ? -4.161  0.478   -17.396 1.00 78.12  ? 16  DT  C N1    1 
ATOM   1475 C  C2    . DT  C 2 16  ? -5.157  -0.304  -16.881 1.00 76.40  ? 16  DT  C C2    1 
ATOM   1476 O  O2    . DT  C 2 16  ? -4.938  -1.344  -16.279 1.00 79.04  ? 16  DT  C O2    1 
ATOM   1477 N  N3    . DT  C 2 16  ? -6.426  0.172   -17.090 1.00 73.12  ? 16  DT  C N3    1 
ATOM   1478 C  C4    . DT  C 2 16  ? -6.794  1.327   -17.760 1.00 76.81  ? 16  DT  C C4    1 
ATOM   1479 O  O4    . DT  C 2 16  ? -7.972  1.672   -17.891 1.00 74.71  ? 16  DT  C O4    1 
ATOM   1480 C  C5    . DT  C 2 16  ? -5.699  2.106   -18.283 1.00 79.14  ? 16  DT  C C5    1 
ATOM   1481 C  C7    . DT  C 2 16  ? -5.974  3.384   -19.028 1.00 77.22  ? 16  DT  C C7    1 
ATOM   1482 C  C6    . DT  C 2 16  ? -4.444  1.647   -18.079 1.00 80.80  ? 16  DT  C C6    1 
ATOM   1483 O  "O5'" . DA  D 3 1   ? -5.654  -5.978  -18.927 1.00 75.50  ? 1   DA  D "O5'" 1 
ATOM   1484 C  "C5'" . DA  D 3 1   ? -5.742  -7.307  -18.374 1.00 84.61  ? 1   DA  D "C5'" 1 
ATOM   1485 C  "C4'" . DA  D 3 1   ? -5.647  -7.274  -16.852 1.00 86.52  ? 1   DA  D "C4'" 1 
ATOM   1486 O  "O4'" . DA  D 3 1   ? -6.355  -6.104  -16.341 1.00 83.42  ? 1   DA  D "O4'" 1 
ATOM   1487 C  "C3'" . DA  D 3 1   ? -6.275  -8.468  -16.123 1.00 88.54  ? 1   DA  D "C3'" 1 
ATOM   1488 O  "O3'" . DA  D 3 1   ? -5.612  -8.644  -14.845 1.00 96.10  ? 1   DA  D "O3'" 1 
ATOM   1489 C  "C2'" . DA  D 3 1   ? -7.709  -7.978  -15.939 1.00 84.98  ? 1   DA  D "C2'" 1 
ATOM   1490 C  "C1'" . DA  D 3 1   ? -7.425  -6.541  -15.517 1.00 84.55  ? 1   DA  D "C1'" 1 
ATOM   1491 N  N9    . DA  D 3 1   ? -8.553  -5.608  -15.635 1.00 78.32  ? 1   DA  D N9    1 
ATOM   1492 C  C8    . DA  D 3 1   ? -9.873  -5.846  -15.333 1.00 77.99  ? 1   DA  D C8    1 
ATOM   1493 N  N7    . DA  D 3 1   ? -10.659 -4.791  -15.504 1.00 77.28  ? 1   DA  D N7    1 
ATOM   1494 C  C5    . DA  D 3 1   ? -9.789  -3.792  -15.932 1.00 74.42  ? 1   DA  D C5    1 
ATOM   1495 C  C6    . DA  D 3 1   ? -9.983  -2.429  -16.290 1.00 75.90  ? 1   DA  D C6    1 
ATOM   1496 N  N6    . DA  D 3 1   ? -11.172 -1.803  -16.270 1.00 73.76  ? 1   DA  D N6    1 
ATOM   1497 N  N1    . DA  D 3 1   ? -8.895  -1.730  -16.669 1.00 77.86  ? 1   DA  D N1    1 
ATOM   1498 C  C2    . DA  D 3 1   ? -7.704  -2.348  -16.690 1.00 77.31  ? 1   DA  D C2    1 
ATOM   1499 N  N3    . DA  D 3 1   ? -7.393  -3.601  -16.375 1.00 77.76  ? 1   DA  D N3    1 
ATOM   1500 C  C4    . DA  D 3 1   ? -8.486  -4.281  -16.006 1.00 76.25  ? 1   DA  D C4    1 
ATOM   1501 P  P     . DG  D 3 2   ? -5.611  -10.061 -14.067 1.00 109.43 ? 2   DG  D P     1 
ATOM   1502 O  OP1   . DG  D 3 2   ? -5.506  -11.138 -15.081 1.00 101.58 ? 2   DG  D OP1   1 
ATOM   1503 O  OP2   . DG  D 3 2   ? -6.732  -10.064 -13.087 1.00 102.15 ? 2   DG  D OP2   1 
ATOM   1504 O  "O5'" . DG  D 3 2   ? -4.261  -10.019 -13.195 1.00 97.43  ? 2   DG  D "O5'" 1 
ATOM   1505 C  "C5'" . DG  D 3 2   ? -3.162  -9.180  -13.593 1.00 94.29  ? 2   DG  D "C5'" 1 
ATOM   1506 C  "C4'" . DG  D 3 2   ? -2.838  -8.139  -12.525 1.00 94.53  ? 2   DG  D "C4'" 1 
ATOM   1507 O  "O4'" . DG  D 3 2   ? -3.686  -6.965  -12.697 1.00 95.25  ? 2   DG  D "O4'" 1 
ATOM   1508 C  "C3'" . DG  D 3 2   ? -3.061  -8.578  -11.073 1.00 93.57  ? 2   DG  D "C3'" 1 
ATOM   1509 O  "O3'" . DG  D 3 2   ? -2.167  -7.868  -10.242 1.00 94.90  ? 2   DG  D "O3'" 1 
ATOM   1510 C  "C2'" . DG  D 3 2   ? -4.479  -8.088  -10.826 1.00 90.39  ? 2   DG  D "C2'" 1 
ATOM   1511 C  "C1'" . DG  D 3 2   ? -4.364  -6.727  -11.481 1.00 87.40  ? 2   DG  D "C1'" 1 
ATOM   1512 N  N9    . DG  D 3 2   ? -5.640  -6.084  -11.744 1.00 84.14  ? 2   DG  D N9    1 
ATOM   1513 C  C8    . DG  D 3 2   ? -6.891  -6.630  -11.583 1.00 84.33  ? 2   DG  D C8    1 
ATOM   1514 N  N7    . DG  D 3 2   ? -7.857  -5.805  -11.880 1.00 82.83  ? 2   DG  D N7    1 
ATOM   1515 C  C5    . DG  D 3 2   ? -7.200  -4.633  -12.253 1.00 81.29  ? 2   DG  D C5    1 
ATOM   1516 C  C6    . DG  D 3 2   ? -7.725  -3.390  -12.675 1.00 78.05  ? 2   DG  D C6    1 
ATOM   1517 O  O6    . DG  D 3 2   ? -8.920  -3.065  -12.806 1.00 76.91  ? 2   DG  D O6    1 
ATOM   1518 N  N1    . DG  D 3 2   ? -6.707  -2.472  -12.964 1.00 76.42  ? 2   DG  D N1    1 
ATOM   1519 C  C2    . DG  D 3 2   ? -5.358  -2.729  -12.852 1.00 78.25  ? 2   DG  D C2    1 
ATOM   1520 N  N2    . DG  D 3 2   ? -4.525  -1.723  -13.170 1.00 79.01  ? 2   DG  D N2    1 
ATOM   1521 N  N3    . DG  D 3 2   ? -4.859  -3.889  -12.451 1.00 81.31  ? 2   DG  D N3    1 
ATOM   1522 C  C4    . DG  D 3 2   ? -5.835  -4.791  -12.172 1.00 81.90  ? 2   DG  D C4    1 
ATOM   1523 P  P     . DT  D 3 3   ? -1.083  -8.624  -9.326  1.00 104.30 ? 3   DT  D P     1 
ATOM   1524 O  OP1   . DT  D 3 3   ? -0.481  -9.714  -10.135 1.00 100.56 ? 3   DT  D OP1   1 
ATOM   1525 O  OP2   . DT  D 3 3   ? -1.713  -8.930  -8.015  1.00 92.19  ? 3   DT  D OP2   1 
ATOM   1526 O  "O5'" . DT  D 3 3   ? 0.015   -7.482  -9.101  1.00 97.94  ? 3   DT  D "O5'" 1 
ATOM   1527 C  "C5'" . DT  D 3 3   ? 0.372   -6.633  -10.199 1.00 96.58  ? 3   DT  D "C5'" 1 
ATOM   1528 C  "C4'" . DT  D 3 3   ? 0.334   -5.161  -9.808  1.00 94.69  ? 3   DT  D "C4'" 1 
ATOM   1529 O  "O4'" . DT  D 3 3   ? -0.971  -4.584  -10.099 1.00 91.06  ? 3   DT  D "O4'" 1 
ATOM   1530 C  "C3'" . DT  D 3 3   ? 0.604   -4.862  -8.328  1.00 94.85  ? 3   DT  D "C3'" 1 
ATOM   1531 O  "O3'" . DT  D 3 3   ? 1.498   -3.760  -8.239  1.00 97.16  ? 3   DT  D "O3'" 1 
ATOM   1532 C  "C2'" . DT  D 3 3   ? -0.784  -4.494  -7.797  1.00 89.83  ? 3   DT  D "C2'" 1 
ATOM   1533 C  "C1'" . DT  D 3 3   ? -1.339  -3.776  -9.007  1.00 88.91  ? 3   DT  D "C1'" 1 
ATOM   1534 N  N1    . DT  D 3 3   ? -2.805  -3.610  -9.007  1.00 86.02  ? 3   DT  D N1    1 
ATOM   1535 C  C2    . DT  D 3 3   ? -3.329  -2.387  -9.363  1.00 82.71  ? 3   DT  D C2    1 
ATOM   1536 O  O2    . DT  D 3 3   ? -2.640  -1.430  -9.675  1.00 80.88  ? 3   DT  D O2    1 
ATOM   1537 N  N3    . DT  D 3 3   ? -4.695  -2.322  -9.343  1.00 79.52  ? 3   DT  D N3    1 
ATOM   1538 C  C4    . DT  D 3 3   ? -5.572  -3.333  -9.011  1.00 79.08  ? 3   DT  D C4    1 
ATOM   1539 O  O4    . DT  D 3 3   ? -6.790  -3.171  -9.027  1.00 77.40  ? 3   DT  D O4    1 
ATOM   1540 C  C5    . DT  D 3 3   ? -4.954  -4.595  -8.646  1.00 83.32  ? 3   DT  D C5    1 
ATOM   1541 C  C7    . DT  D 3 3   ? -5.803  -5.771  -8.261  1.00 80.99  ? 3   DT  D C7    1 
ATOM   1542 C  C6    . DT  D 3 3   ? -3.612  -4.670  -8.661  1.00 83.16  ? 3   DT  D C6    1 
ATOM   1543 P  P     . DG  D 3 4   ? 2.468   -3.590  -6.970  1.00 105.09 ? 4   DG  D P     1 
ATOM   1544 O  OP1   . DG  D 3 4   ? 3.869   -3.676  -7.460  1.00 97.80  ? 4   DG  D OP1   1 
ATOM   1545 O  OP2   . DG  D 3 4   ? 1.972   -4.501  -5.905  1.00 92.98  ? 4   DG  D OP2   1 
ATOM   1546 O  "O5'" . DG  D 3 4   ? 2.197   -2.083  -6.498  1.00 98.27  ? 4   DG  D "O5'" 1 
ATOM   1547 C  "C5'" . DG  D 3 4   ? 2.042   -1.050  -7.472  1.00 94.84  ? 4   DG  D "C5'" 1 
ATOM   1548 C  "C4'" . DG  D 3 4   ? 1.014   -0.030  -7.011  1.00 92.22  ? 4   DG  D "C4'" 1 
ATOM   1549 O  "O4'" . DG  D 3 4   ? -0.306  -0.563  -7.180  1.00 89.21  ? 4   DG  D "O4'" 1 
ATOM   1550 C  "C3'" . DG  D 3 4   ? 1.107   0.351   -5.537  1.00 92.14  ? 4   DG  D "C3'" 1 
ATOM   1551 O  "O3'" . DG  D 3 4   ? 1.795   1.590   -5.416  1.00 96.11  ? 4   DG  D "O3'" 1 
ATOM   1552 C  "C2'" . DG  D 3 4   ? -0.356  0.461   -5.073  1.00 85.24  ? 4   DG  D "C2'" 1 
ATOM   1553 C  "C1'" . DG  D 3 4   ? -1.169  0.121   -6.319  1.00 85.56  ? 4   DG  D "C1'" 1 
ATOM   1554 N  N9    . DG  D 3 4   ? -2.298  -0.748  -6.043  1.00 81.50  ? 4   DG  D N9    1 
ATOM   1555 C  C8    . DG  D 3 4   ? -2.250  -2.007  -5.505  1.00 81.01  ? 4   DG  D C8    1 
ATOM   1556 N  N7    . DG  D 3 4   ? -3.425  -2.558  -5.372  1.00 81.19  ? 4   DG  D N7    1 
ATOM   1557 C  C5    . DG  D 3 4   ? -4.310  -1.598  -5.858  1.00 78.34  ? 4   DG  D C5    1 
ATOM   1558 C  C6    . DG  D 3 4   ? -5.724  -1.630  -5.968  1.00 76.53  ? 4   DG  D C6    1 
ATOM   1559 O  O6    . DG  D 3 4   ? -6.499  -2.545  -5.646  1.00 77.20  ? 4   DG  D O6    1 
ATOM   1560 N  N1    . DG  D 3 4   ? -6.228  -0.449  -6.518  1.00 72.57  ? 4   DG  D N1    1 
ATOM   1561 C  C2    . DG  D 3 4   ? -5.461  0.622   -6.908  1.00 73.56  ? 4   DG  D C2    1 
ATOM   1562 N  N2    . DG  D 3 4   ? -6.124  1.670   -7.409  1.00 75.31  ? 4   DG  D N2    1 
ATOM   1563 N  N3    . DG  D 3 4   ? -4.135  0.664   -6.814  1.00 75.92  ? 4   DG  D N3    1 
ATOM   1564 C  C4    . DG  D 3 4   ? -3.630  -0.479  -6.279  1.00 78.14  ? 4   DG  D C4    1 
ATOM   1565 P  P     . DG  D 3 5   ? 2.093   2.238   -3.975  1.00 102.80 ? 5   DG  D P     1 
ATOM   1566 O  OP1   . DG  D 3 5   ? 3.498   2.711   -3.993  1.00 96.21  ? 5   DG  D OP1   1 
ATOM   1567 O  OP2   . DG  D 3 5   ? 1.648   1.296   -2.918  1.00 92.41  ? 5   DG  D OP2   1 
ATOM   1568 O  "O5'" . DG  D 3 5   ? 1.133   3.515   -3.944  1.00 90.50  ? 5   DG  D "O5'" 1 
ATOM   1569 C  "C5'" . DG  D 3 5   ? 0.469   3.920   -5.131  1.00 89.44  ? 5   DG  D "C5'" 1 
ATOM   1570 C  "C4'" . DG  D 3 5   ? -0.815  4.637   -4.790  1.00 85.48  ? 5   DG  D "C4'" 1 
ATOM   1571 O  "O4'" . DG  D 3 5   ? -1.941  3.725   -4.903  1.00 83.80  ? 5   DG  D "O4'" 1 
ATOM   1572 C  "C3'" . DG  D 3 5   ? -0.867  5.206   -3.372  1.00 80.24  ? 5   DG  D "C3'" 1 
ATOM   1573 O  "O3'" . DG  D 3 5   ? -1.406  6.518   -3.430  1.00 85.91  ? 5   DG  D "O3'" 1 
ATOM   1574 C  "C2'" . DG  D 3 5   ? -1.802  4.234   -2.643  1.00 78.44  ? 5   DG  D "C2'" 1 
ATOM   1575 C  "C1'" . DG  D 3 5   ? -2.757  3.861   -3.763  1.00 77.65  ? 5   DG  D "C1'" 1 
ATOM   1576 N  N9    . DG  D 3 5   ? -3.481  2.607   -3.558  1.00 72.28  ? 5   DG  D N9    1 
ATOM   1577 C  C8    . DG  D 3 5   ? -2.943  1.370   -3.299  1.00 73.85  ? 5   DG  D C8    1 
ATOM   1578 N  N7    . DG  D 3 5   ? -3.839  0.424   -3.189  1.00 73.24  ? 5   DG  D N7    1 
ATOM   1579 C  C5    . DG  D 3 5   ? -5.051  1.074   -3.395  1.00 72.10  ? 5   DG  D C5    1 
ATOM   1580 C  C6    . DG  D 3 5   ? -6.379  0.565   -3.391  1.00 69.20  ? 5   DG  D C6    1 
ATOM   1581 O  O6    . DG  D 3 5   ? -6.757  -0.600  -3.205  1.00 69.56  ? 5   DG  D O6    1 
ATOM   1582 N  N1    . DG  D 3 5   ? -7.315  1.563   -3.637  1.00 67.16  ? 5   DG  D N1    1 
ATOM   1583 C  C2    . DG  D 3 5   ? -7.011  2.887   -3.866  1.00 69.15  ? 5   DG  D C2    1 
ATOM   1584 N  N2    . DG  D 3 5   ? -8.052  3.706   -4.085  1.00 66.27  ? 5   DG  D N2    1 
ATOM   1585 N  N3    . DG  D 3 5   ? -5.772  3.377   -3.871  1.00 65.59  ? 5   DG  D N3    1 
ATOM   1586 C  C4    . DG  D 3 5   ? -4.847  2.418   -3.629  1.00 69.77  ? 5   DG  D C4    1 
ATOM   1587 P  P     . DG  D 3 6   ? -1.229  7.552   -2.211  1.00 84.27  ? 6   DG  D P     1 
ATOM   1588 O  OP1   . DG  D 3 6   ? -0.465  8.720   -2.713  1.00 76.41  ? 6   DG  D OP1   1 
ATOM   1589 O  OP2   . DG  D 3 6   ? -0.745  6.802   -1.031  1.00 84.73  ? 6   DG  D OP2   1 
ATOM   1590 O  "O5'" . DG  D 3 6   ? -2.730  8.029   -1.939  1.00 76.29  ? 6   DG  D "O5'" 1 
ATOM   1591 C  "C5'" . DG  D 3 6   ? -3.549  8.407   -3.042  1.00 76.34  ? 6   DG  D "C5'" 1 
ATOM   1592 C  "C4'" . DG  D 3 6   ? -4.998  8.541   -2.617  1.00 73.32  ? 6   DG  D "C4'" 1 
ATOM   1593 O  "O4'" . DG  D 3 6   ? -5.619  7.230   -2.575  1.00 78.25  ? 6   DG  D "O4'" 1 
ATOM   1594 C  "C3'" . DG  D 3 6   ? -5.210  9.170   -1.249  1.00 69.48  ? 6   DG  D "C3'" 1 
ATOM   1595 O  "O3'" . DG  D 3 6   ? -6.300  10.085  -1.308  1.00 65.83  ? 6   DG  D "O3'" 1 
ATOM   1596 C  "C2'" . DG  D 3 6   ? -5.494  7.973   -0.336  1.00 66.55  ? 6   DG  D "C2'" 1 
ATOM   1597 C  "C1'" . DG  D 3 6   ? -6.124  6.953   -1.284  1.00 67.43  ? 6   DG  D "C1'" 1 
ATOM   1598 N  N9    . DG  D 3 6   ? -5.789  5.557   -0.962  1.00 67.51  ? 6   DG  D N9    1 
ATOM   1599 C  C8    . DG  D 3 6   ? -4.528  5.033   -0.774  1.00 67.49  ? 6   DG  D C8    1 
ATOM   1600 N  N7    . DG  D 3 6   ? -4.527  3.752   -0.501  1.00 66.99  ? 6   DG  D N7    1 
ATOM   1601 C  C5    . DG  D 3 6   ? -5.875  3.396   -0.520  1.00 64.53  ? 6   DG  D C5    1 
ATOM   1602 C  C6    . DG  D 3 6   ? -6.494  2.134   -0.307  1.00 64.48  ? 6   DG  D C6    1 
ATOM   1603 O  O6    . DG  D 3 6   ? -5.959  1.043   -0.044  1.00 66.59  ? 6   DG  D O6    1 
ATOM   1604 N  N1    . DG  D 3 6   ? -7.879  2.216   -0.412  1.00 64.14  ? 6   DG  D N1    1 
ATOM   1605 C  C2    . DG  D 3 6   ? -8.577  3.364   -0.692  1.00 63.28  ? 6   DG  D C2    1 
ATOM   1606 N  N2    . DG  D 3 6   ? -9.909  3.245   -0.745  1.00 65.77  ? 6   DG  D N2    1 
ATOM   1607 N  N3    . DG  D 3 6   ? -8.012  4.549   -0.905  1.00 61.34  ? 6   DG  D N3    1 
ATOM   1608 C  C4    . DG  D 3 6   ? -6.665  4.493   -0.803  1.00 63.11  ? 6   DG  D C4    1 
ATOM   1609 P  P     . DA  D 3 7   ? -6.757  10.887  0.002   1.00 72.24  ? 7   DA  D P     1 
ATOM   1610 O  OP1   . DA  D 3 7   ? -7.200  12.223  -0.443  1.00 69.55  ? 7   DA  D OP1   1 
ATOM   1611 O  OP2   . DA  D 3 7   ? -5.770  10.690  1.103   1.00 62.79  ? 7   DA  D OP2   1 
ATOM   1612 O  "O5'" . DA  D 3 7   ? -8.082  10.147  0.444   1.00 65.67  ? 7   DA  D "O5'" 1 
ATOM   1613 C  "C5'" . DA  D 3 7   ? -9.064  9.867   -0.512  1.00 63.67  ? 7   DA  D "C5'" 1 
ATOM   1614 C  "C4'" . DA  D 3 7   ? -10.157 9.062   0.125   1.00 55.81  ? 7   DA  D "C4'" 1 
ATOM   1615 O  "O4'" . DA  D 3 7   ? -9.716  7.702   0.277   1.00 57.78  ? 7   DA  D "O4'" 1 
ATOM   1616 C  "C3'" . DA  D 3 7   ? -10.571 9.553   1.509   1.00 49.30  ? 7   DA  D "C3'" 1 
ATOM   1617 O  "O3'" . DA  D 3 7   ? -11.942 9.748   1.491   1.00 43.95  ? 7   DA  D "O3'" 1 
ATOM   1618 C  "C2'" . DA  D 3 7   ? -10.143 8.431   2.474   1.00 53.95  ? 7   DA  D "C2'" 1 
ATOM   1619 C  "C1'" . DA  D 3 7   ? -10.048 7.216   1.565   1.00 56.89  ? 7   DA  D "C1'" 1 
ATOM   1620 N  N9    . DA  D 3 7   ? -9.003  6.259   1.916   1.00 56.58  ? 7   DA  D N9    1 
ATOM   1621 C  C8    . DA  D 3 7   ? -7.651  6.462   1.859   1.00 57.95  ? 7   DA  D C8    1 
ATOM   1622 N  N7    . DA  D 3 7   ? -6.942  5.407   2.164   1.00 55.68  ? 7   DA  D N7    1 
ATOM   1623 C  C5    . DA  D 3 7   ? -7.894  4.430   2.408   1.00 58.04  ? 7   DA  D C5    1 
ATOM   1624 C  C6    . DA  D 3 7   ? -7.792  3.072   2.777   1.00 57.69  ? 7   DA  D C6    1 
ATOM   1625 N  N6    . DA  D 3 7   ? -6.624  2.445   2.976   1.00 53.53  ? 7   DA  D N6    1 
ATOM   1626 N  N1    . DA  D 3 7   ? -8.941  2.384   2.940   1.00 56.71  ? 7   DA  D N1    1 
ATOM   1627 C  C2    . DA  D 3 7   ? -10.106 3.011   2.745   1.00 55.62  ? 7   DA  D C2    1 
ATOM   1628 N  N3    . DA  D 3 7   ? -10.327 4.275   2.400   1.00 57.63  ? 7   DA  D N3    1 
ATOM   1629 C  C4    . DA  D 3 7   ? -9.169  4.936   2.244   1.00 56.54  ? 7   DA  D C4    1 
ATOM   1630 P  P     . DA  D 3 8   ? -12.701 10.358  2.739   1.00 49.11  ? 8   DA  D P     1 
ATOM   1631 O  OP1   . DA  D 3 8   ? -13.980 10.921  2.272   1.00 46.44  ? 8   DA  D OP1   1 
ATOM   1632 O  OP2   . DA  D 3 8   ? -11.739 11.186  3.492   1.00 48.76  ? 8   DA  D OP2   1 
ATOM   1633 O  "O5'" . DA  D 3 8   ? -13.052 9.046   3.607   1.00 52.31  ? 8   DA  D "O5'" 1 
ATOM   1634 C  "C5'" . DA  D 3 8   ? -13.842 8.006   3.016   1.00 53.21  ? 8   DA  D "C5'" 1 
ATOM   1635 C  "C4'" . DA  D 3 8   ? -14.153 6.894   4.019   1.00 54.99  ? 8   DA  D "C4'" 1 
ATOM   1636 O  "O4'" . DA  D 3 8   ? -13.021 5.996   4.125   1.00 53.43  ? 8   DA  D "O4'" 1 
ATOM   1637 C  "C3'" . DA  D 3 8   ? -14.481 7.357   5.444   1.00 56.16  ? 8   DA  D "C3'" 1 
ATOM   1638 O  "O3'" . DA  D 3 8   ? -15.606 6.627   5.914   1.00 57.88  ? 8   DA  D "O3'" 1 
ATOM   1639 C  "C2'" . DA  D 3 8   ? -13.208 7.023   6.226   1.00 51.64  ? 8   DA  D "C2'" 1 
ATOM   1640 C  "C1'" . DA  D 3 8   ? -12.713 5.792   5.486   1.00 57.52  ? 8   DA  D "C1'" 1 
ATOM   1641 N  N9    . DA  D 3 8   ? -11.277 5.569   5.589   1.00 57.28  ? 8   DA  D N9    1 
ATOM   1642 C  C8    . DA  D 3 8   ? -10.279 6.497   5.479   1.00 51.56  ? 8   DA  D C8    1 
ATOM   1643 N  N7    . DA  D 3 8   ? -9.073  5.984   5.596   1.00 52.71  ? 8   DA  D N7    1 
ATOM   1644 C  C5    . DA  D 3 8   ? -9.304  4.629   5.799   1.00 50.97  ? 8   DA  D C5    1 
ATOM   1645 C  C6    . DA  D 3 8   ? -8.442  3.526   6.008   1.00 53.07  ? 8   DA  D C6    1 
ATOM   1646 N  N6    . DA  D 3 8   ? -7.108  3.614   6.040   1.00 47.41  ? 8   DA  D N6    1 
ATOM   1647 N  N1    . DA  D 3 8   ? -9.011  2.315   6.163   1.00 56.12  ? 8   DA  D N1    1 
ATOM   1648 C  C2    . DA  D 3 8   ? -10.344 2.220   6.123   1.00 56.86  ? 8   DA  D C2    1 
ATOM   1649 N  N3    . DA  D 3 8   ? -11.249 3.174   5.954   1.00 52.35  ? 8   DA  D N3    1 
ATOM   1650 C  C4    . DA  D 3 8   ? -10.658 4.364   5.794   1.00 54.52  ? 8   DA  D C4    1 
ATOM   1651 P  P     . DT  D 3 9   ? -16.368 7.011   7.277   1.00 64.57  ? 9   DT  D P     1 
ATOM   1652 O  OP1   . DT  D 3 9   ? -17.676 7.578   6.897   1.00 70.08  ? 9   DT  D OP1   1 
ATOM   1653 O  OP2   . DT  D 3 9   ? -15.511 7.824   8.172   1.00 63.73  ? 9   DT  D OP2   1 
ATOM   1654 O  "O5'" . DT  D 3 9   ? -16.570 5.556   7.929   1.00 71.41  ? 9   DT  D "O5'" 1 
ATOM   1655 C  "C5'" . DT  D 3 9   ? -16.564 4.422   7.053   1.00 64.36  ? 9   DT  D "C5'" 1 
ATOM   1656 C  "C4'" . DT  D 3 9   ? -16.125 3.146   7.755   1.00 66.50  ? 9   DT  D "C4'" 1 
ATOM   1657 O  "O4'" . DT  D 3 9   ? -14.679 3.002   7.720   1.00 62.91  ? 9   DT  D "O4'" 1 
ATOM   1658 C  "C3'" . DT  D 3 9   ? -16.543 3.006   9.216   1.00 68.46  ? 9   DT  D "C3'" 1 
ATOM   1659 O  "O3'" . DT  D 3 9   ? -17.039 1.686   9.409   1.00 71.91  ? 9   DT  D "O3'" 1 
ATOM   1660 C  "C2'" . DT  D 3 9   ? -15.237 3.240   9.976   1.00 62.03  ? 9   DT  D "C2'" 1 
ATOM   1661 C  "C1'" . DT  D 3 9   ? -14.212 2.662   9.009   1.00 61.99  ? 9   DT  D "C1'" 1 
ATOM   1662 N  N1    . DT  D 3 9   ? -12.869 3.252   9.164   1.00 59.31  ? 9   DT  D N1    1 
ATOM   1663 C  C2    . DT  D 3 9   ? -11.760 2.437   9.156   1.00 59.39  ? 9   DT  D C2    1 
ATOM   1664 O  O2    . DT  D 3 9   ? -11.816 1.231   9.035   1.00 63.83  ? 9   DT  D O2    1 
ATOM   1665 N  N3    . DT  D 3 9   ? -10.568 3.091   9.288   1.00 56.04  ? 9   DT  D N3    1 
ATOM   1666 C  C4    . DT  D 3 9   ? -10.379 4.452   9.427   1.00 56.11  ? 9   DT  D C4    1 
ATOM   1667 O  O4    . DT  D 3 9   ? -9.261  4.946   9.540   1.00 57.71  ? 9   DT  D O4    1 
ATOM   1668 C  C5    . DT  D 3 9   ? -11.585 5.248   9.422   1.00 54.81  ? 9   DT  D C5    1 
ATOM   1669 C  C7    . DT  D 3 9   ? -11.511 6.738   9.560   1.00 52.69  ? 9   DT  D C7    1 
ATOM   1670 C  C6    . DT  D 3 9   ? -12.756 4.617   9.292   1.00 55.82  ? 9   DT  D C6    1 
ATOM   1671 P  P     . DT  D 3 10  ? -17.738 1.237   10.787  1.00 70.51  ? 10  DT  D P     1 
ATOM   1672 O  OP1   . DT  D 3 10  ? -18.895 0.409   10.391  1.00 73.99  ? 10  DT  D OP1   1 
ATOM   1673 O  OP2   . DT  D 3 10  ? -17.980 2.399   11.671  1.00 71.60  ? 10  DT  D OP2   1 
ATOM   1674 O  "O5'" . DT  D 3 10  ? -16.631 0.282   11.424  1.00 63.99  ? 10  DT  D "O5'" 1 
ATOM   1675 C  "C5'" . DT  D 3 10  ? -15.936 -0.605  10.572  1.00 60.63  ? 10  DT  D "C5'" 1 
ATOM   1676 C  "C4'" . DT  D 3 10  ? -14.837 -1.300  11.330  1.00 66.77  ? 10  DT  D "C4'" 1 
ATOM   1677 O  "O4'" . DT  D 3 10  ? -13.628 -0.498  11.298  1.00 63.66  ? 10  DT  D "O4'" 1 
ATOM   1678 C  "C3'" . DT  D 3 10  ? -15.153 -1.560  12.804  1.00 71.97  ? 10  DT  D "C3'" 1 
ATOM   1679 O  "O3'" . DT  D 3 10  ? -14.888 -2.947  13.101  1.00 73.44  ? 10  DT  D "O3'" 1 
ATOM   1680 C  "C2'" . DT  D 3 10  ? -14.224 -0.584  13.557  1.00 65.25  ? 10  DT  D "C2'" 1 
ATOM   1681 C  "C1'" . DT  D 3 10  ? -13.056 -0.452  12.588  1.00 63.86  ? 10  DT  D "C1'" 1 
ATOM   1682 N  N1    . DT  D 3 10  ? -12.318 0.826   12.695  1.00 60.97  ? 10  DT  D N1    1 
ATOM   1683 C  C2    . DT  D 3 10  ? -10.942 0.819   12.593  1.00 60.21  ? 10  DT  D C2    1 
ATOM   1684 O  O2    . DT  D 3 10  ? -10.288 -0.195  12.461  1.00 60.91  ? 10  DT  D O2    1 
ATOM   1685 N  N3    . DT  D 3 10  ? -10.356 2.054   12.666  1.00 60.95  ? 10  DT  D N3    1 
ATOM   1686 C  C4    . DT  D 3 10  ? -10.993 3.271   12.825  1.00 59.15  ? 10  DT  D C4    1 
ATOM   1687 O  O4    . DT  D 3 10  ? -10.372 4.324   12.886  1.00 58.63  ? 10  DT  D O4    1 
ATOM   1688 C  C5    . DT  D 3 10  ? -12.439 3.207   12.917  1.00 58.16  ? 10  DT  D C5    1 
ATOM   1689 C  C7    . DT  D 3 10  ? -13.245 4.460   13.088  1.00 57.03  ? 10  DT  D C7    1 
ATOM   1690 C  C6    . DT  D 3 10  ? -13.023 2.002   12.840  1.00 59.72  ? 10  DT  D C6    1 
ATOM   1691 P  P     . DT  D 3 11  ? -15.173 -3.578  14.560  1.00 75.70  ? 11  DT  D P     1 
ATOM   1692 O  OP1   . DT  D 3 11  ? -15.476 -5.003  14.297  1.00 72.59  ? 11  DT  D OP1   1 
ATOM   1693 O  OP2   . DT  D 3 11  ? -16.129 -2.757  15.343  1.00 65.64  ? 11  DT  D OP2   1 
ATOM   1694 O  "O5'" . DT  D 3 11  ? -13.737 -3.514  15.231  1.00 56.60  ? 11  DT  D "O5'" 1 
ATOM   1695 C  "C5'" . DT  D 3 11  ? -12.650 -4.096  14.541  1.00 57.23  ? 11  DT  D "C5'" 1 
ATOM   1696 C  "C4'" . DT  D 3 11  ? -11.353 -3.766  15.234  1.00 61.05  ? 11  DT  D "C4'" 1 
ATOM   1697 O  "O4'" . DT  D 3 11  ? -11.023 -2.380  15.026  1.00 63.19  ? 11  DT  D "O4'" 1 
ATOM   1698 C  "C3'" . DT  D 3 11  ? -11.384 -3.959  16.754  1.00 61.83  ? 11  DT  D "C3'" 1 
ATOM   1699 O  "O3'" . DT  D 3 11  ? -10.625 -5.118  17.092  1.00 65.92  ? 11  DT  D "O3'" 1 
ATOM   1700 C  "C2'" . DT  D 3 11  ? -10.759 -2.666  17.320  1.00 61.58  ? 11  DT  D "C2'" 1 
ATOM   1701 C  "C1'" . DT  D 3 11  ? -10.192 -1.981  16.074  1.00 60.00  ? 11  DT  D "C1'" 1 
ATOM   1702 N  N1    . DT  D 3 11  ? -10.179 -0.489  16.142  1.00 49.93  ? 11  DT  D N1    1 
ATOM   1703 C  C2    . DT  D 3 11  ? -8.971  0.161   16.131  1.00 58.27  ? 11  DT  D C2    1 
ATOM   1704 O  O2    . DT  D 3 11  ? -7.903  -0.422  16.068  1.00 59.89  ? 11  DT  D O2    1 
ATOM   1705 N  N3    . DT  D 3 11  ? -9.047  1.528   16.184  1.00 58.12  ? 11  DT  D N3    1 
ATOM   1706 C  C4    . DT  D 3 11  ? -10.188 2.293   16.256  1.00 57.89  ? 11  DT  D C4    1 
ATOM   1707 O  O4    . DT  D 3 11  ? -10.147 3.525   16.308  1.00 61.92  ? 11  DT  D O4    1 
ATOM   1708 C  C5    . DT  D 3 11  ? -11.431 1.547   16.270  1.00 56.35  ? 11  DT  D C5    1 
ATOM   1709 C  C7    . DT  D 3 11  ? -12.741 2.269   16.354  1.00 61.03  ? 11  DT  D C7    1 
ATOM   1710 C  C6    . DT  D 3 11  ? -11.365 0.204   16.213  1.00 54.81  ? 11  DT  D C6    1 
ATOM   1711 P  P     . DC  D 3 12  ? -10.624 -5.705  18.592  1.00 63.69  ? 12  DC  D P     1 
ATOM   1712 O  OP1   . DC  D 3 12  ? -10.389 -7.162  18.416  1.00 62.20  ? 12  DC  D OP1   1 
ATOM   1713 O  OP2   . DC  D 3 12  ? -11.833 -5.217  19.308  1.00 59.40  ? 12  DC  D OP2   1 
ATOM   1714 O  "O5'" . DC  D 3 12  ? -9.316  -5.049  19.231  1.00 57.39  ? 12  DC  D "O5'" 1 
ATOM   1715 C  "C5'" . DC  D 3 12  ? -8.060  -5.266  18.605  1.00 54.50  ? 12  DC  D "C5'" 1 
ATOM   1716 C  "C4'" . DC  D 3 12  ? -6.994  -4.345  19.181  1.00 61.89  ? 12  DC  D "C4'" 1 
ATOM   1717 O  "O4'" . DC  D 3 12  ? -7.257  -2.945  18.820  1.00 60.62  ? 12  DC  D "O4'" 1 
ATOM   1718 C  "C3'" . DC  D 3 12  ? -6.869  -4.368  20.709  1.00 51.19  ? 12  DC  D "C3'" 1 
ATOM   1719 O  "O3'" . DC  D 3 12  ? -5.496  -4.292  21.035  1.00 63.40  ? 12  DC  D "O3'" 1 
ATOM   1720 C  "C2'" . DC  D 3 12  ? -7.594  -3.093  21.115  1.00 58.83  ? 12  DC  D "C2'" 1 
ATOM   1721 C  "C1'" . DC  D 3 12  ? -7.148  -2.161  19.983  1.00 59.20  ? 12  DC  D "C1'" 1 
ATOM   1722 N  N1    . DC  D 3 12  ? -7.991  -0.931  19.841  1.00 54.49  ? 12  DC  D N1    1 
ATOM   1723 C  C2    . DC  D 3 12  ? -7.382  0.328   19.719  1.00 54.11  ? 12  DC  D C2    1 
ATOM   1724 O  O2    . DC  D 3 12  ? -6.145  0.413   19.705  1.00 53.56  ? 12  DC  D O2    1 
ATOM   1725 N  N3    . DC  D 3 12  ? -8.165  1.420   19.613  1.00 51.26  ? 12  DC  D N3    1 
ATOM   1726 C  C4    . DC  D 3 12  ? -9.485  1.297   19.628  1.00 52.94  ? 12  DC  D C4    1 
ATOM   1727 N  N4    . DC  D 3 12  ? -10.210 2.410   19.520  1.00 55.53  ? 12  DC  D N4    1 
ATOM   1728 C  C5    . DC  D 3 12  ? -10.124 0.035   19.776  1.00 53.78  ? 12  DC  D C5    1 
ATOM   1729 C  C6    . DC  D 3 12  ? -9.346  -1.039  19.885  1.00 54.01  ? 12  DC  D C6    1 
ATOM   1730 P  P     . DC  D 3 13  ? -4.975  -4.615  22.520  1.00 61.98  ? 13  DC  D P     1 
ATOM   1731 O  OP1   . DC  D 3 13  ? -3.950  -5.673  22.342  1.00 59.99  ? 13  DC  D OP1   1 
ATOM   1732 O  OP2   . DC  D 3 13  ? -6.164  -4.783  23.397  1.00 57.94  ? 13  DC  D OP2   1 
ATOM   1733 O  "O5'" . DC  D 3 13  ? -4.210  -3.287  22.954  1.00 58.30  ? 13  DC  D "O5'" 1 
ATOM   1734 C  "C5'" . DC  D 3 13  ? -2.939  -2.990  22.394  1.00 58.09  ? 13  DC  D "C5'" 1 
ATOM   1735 C  "C4'" . DC  D 3 13  ? -2.624  -1.518  22.554  1.00 61.15  ? 13  DC  D "C4'" 1 
ATOM   1736 O  "O4'" . DC  D 3 13  ? -3.632  -0.737  21.876  1.00 59.42  ? 13  DC  D "O4'" 1 
ATOM   1737 C  "C3'" . DC  D 3 13  ? -2.672  -1.012  23.980  1.00 62.38  ? 13  DC  D "C3'" 1 
ATOM   1738 O  "O3'" . DC  D 3 13  ? -1.436  -1.255  24.623  1.00 66.41  ? 13  DC  D "O3'" 1 
ATOM   1739 C  "C2'" . DC  D 3 13  ? -2.906  0.483   23.784  1.00 60.23  ? 13  DC  D "C2'" 1 
ATOM   1740 C  "C1'" . DC  D 3 13  ? -3.760  0.517   22.515  1.00 52.22  ? 13  DC  D "C1'" 1 
ATOM   1741 N  N1    . DC  D 3 13  ? -5.197  0.782   22.756  1.00 53.80  ? 13  DC  D N1    1 
ATOM   1742 C  C2    . DC  D 3 13  ? -5.613  2.092   22.952  1.00 53.91  ? 13  DC  D C2    1 
ATOM   1743 O  O2    . DC  D 3 13  ? -4.765  2.990   22.942  1.00 56.98  ? 13  DC  D O2    1 
ATOM   1744 N  N3    . DC  D 3 13  ? -6.928  2.344   23.164  1.00 50.76  ? 13  DC  D N3    1 
ATOM   1745 C  C4    . DC  D 3 13  ? -7.808  1.345   23.163  1.00 51.70  ? 13  DC  D C4    1 
ATOM   1746 N  N4    . DC  D 3 13  ? -9.092  1.651   23.366  1.00 50.42  ? 13  DC  D N4    1 
ATOM   1747 C  C5    . DC  D 3 13  ? -7.404  -0.009  22.976  1.00 53.70  ? 13  DC  D C5    1 
ATOM   1748 C  C6    . DC  D 3 13  ? -6.098  -0.245  22.774  1.00 55.92  ? 13  DC  D C6    1 
ATOM   1749 P  P     . DA  D 3 14  ? -1.374  -1.284  26.222  1.00 59.53  ? 14  DA  D P     1 
ATOM   1750 O  OP1   . DA  D 3 14  ? -0.120  -1.987  26.561  1.00 59.88  ? 14  DA  D OP1   1 
ATOM   1751 O  OP2   . DA  D 3 14  ? -2.705  -1.735  26.702  1.00 61.82  ? 14  DA  D OP2   1 
ATOM   1752 O  "O5'" . DA  D 3 14  ? -1.243  0.246   26.652  1.00 62.16  ? 14  DA  D "O5'" 1 
ATOM   1753 C  "C5'" . DA  D 3 14  ? -0.180  1.030   26.132  1.00 65.70  ? 14  DA  D "C5'" 1 
ATOM   1754 C  "C4'" . DA  D 3 14  ? -0.393  2.494   26.448  1.00 61.61  ? 14  DA  D "C4'" 1 
ATOM   1755 O  "O4'" . DA  D 3 14  ? -1.651  2.933   25.859  1.00 63.09  ? 14  DA  D "O4'" 1 
ATOM   1756 C  "C3'" . DA  D 3 14  ? -0.461  2.812   27.936  1.00 64.42  ? 14  DA  D "C3'" 1 
ATOM   1757 O  "O3'" . DA  D 3 14  ? 0.387   3.920   28.228  1.00 74.30  ? 14  DA  D "O3'" 1 
ATOM   1758 C  "C2'" . DA  D 3 14  ? -1.939  3.136   28.185  1.00 65.34  ? 14  DA  D "C2'" 1 
ATOM   1759 C  "C1'" . DA  D 3 14  ? -2.441  3.599   26.813  1.00 61.27  ? 14  DA  D "C1'" 1 
ATOM   1760 N  N9    . DA  D 3 14  ? -3.844  3.248   26.578  1.00 59.49  ? 14  DA  D N9    1 
ATOM   1761 C  C8    . DA  D 3 14  ? -4.360  1.988   26.442  1.00 61.25  ? 14  DA  D C8    1 
ATOM   1762 N  N7    . DA  D 3 14  ? -5.662  1.961   26.262  1.00 59.05  ? 14  DA  D N7    1 
ATOM   1763 C  C5    . DA  D 3 14  ? -6.031  3.293   26.293  1.00 57.07  ? 14  DA  D C5    1 
ATOM   1764 C  C6    . DA  D 3 14  ? -7.279  3.932   26.165  1.00 57.75  ? 14  DA  D C6    1 
ATOM   1765 N  N6    . DA  D 3 14  ? -8.422  3.270   25.970  1.00 57.66  ? 14  DA  D N6    1 
ATOM   1766 N  N1    . DA  D 3 14  ? -7.305  5.281   26.238  1.00 58.11  ? 14  DA  D N1    1 
ATOM   1767 C  C2    . DA  D 3 14  ? -6.154  5.934   26.429  1.00 59.29  ? 14  DA  D C2    1 
ATOM   1768 N  N3    . DA  D 3 14  ? -4.919  5.440   26.566  1.00 60.53  ? 14  DA  D N3    1 
ATOM   1769 C  C4    . DA  D 3 14  ? -4.926  4.104   26.489  1.00 56.73  ? 14  DA  D C4    1 
ATOM   1770 P  P     . DC  D 3 15  ? 0.633   4.385   29.746  1.00 79.62  ? 15  DC  D P     1 
ATOM   1771 O  OP1   . DC  D 3 15  ? 1.857   5.223   29.772  1.00 73.36  ? 15  DC  D OP1   1 
ATOM   1772 O  OP2   . DC  D 3 15  ? 0.507   3.183   30.597  1.00 78.26  ? 15  DC  D OP2   1 
ATOM   1773 O  "O5'" . DC  D 3 15  ? -0.616  5.328   30.070  1.00 73.65  ? 15  DC  D "O5'" 1 
ATOM   1774 C  "C5'" . DC  D 3 15  ? -0.839  6.480   29.292  1.00 68.42  ? 15  DC  D "C5'" 1 
ATOM   1775 C  "C4'" . DC  D 3 15  ? -2.112  7.171   29.719  1.00 68.46  ? 15  DC  D "C4'" 1 
ATOM   1776 O  "O4'" . DC  D 3 15  ? -3.255  6.412   29.265  1.00 66.14  ? 15  DC  D "O4'" 1 
ATOM   1777 C  "C3'" . DC  D 3 15  ? -2.290  7.331   31.233  1.00 71.40  ? 15  DC  D "C3'" 1 
ATOM   1778 O  "O3'" . DC  D 3 15  ? -2.674  8.664   31.517  1.00 77.13  ? 15  DC  D "O3'" 1 
ATOM   1779 C  "C2'" . DC  D 3 15  ? -3.418  6.357   31.557  1.00 67.63  ? 15  DC  D "C2'" 1 
ATOM   1780 C  "C1'" . DC  D 3 15  ? -4.219  6.433   30.277  1.00 65.13  ? 15  DC  D "C1'" 1 
ATOM   1781 N  N1    . DC  D 3 15  ? -5.120  5.296   30.071  1.00 63.59  ? 15  DC  D N1    1 
ATOM   1782 C  C2    . DC  D 3 15  ? -6.438  5.537   29.696  1.00 61.23  ? 15  DC  D C2    1 
ATOM   1783 O  O2    . DC  D 3 15  ? -6.812  6.701   29.559  1.00 58.81  ? 15  DC  D O2    1 
ATOM   1784 N  N3    . DC  D 3 15  ? -7.269  4.488   29.508  1.00 61.72  ? 15  DC  D N3    1 
ATOM   1785 C  C4    . DC  D 3 15  ? -6.817  3.243   29.668  1.00 61.53  ? 15  DC  D C4    1 
ATOM   1786 N  N4    . DC  D 3 15  ? -7.670  2.238   29.459  1.00 55.33  ? 15  DC  D N4    1 
ATOM   1787 C  C5    . DC  D 3 15  ? -5.465  2.977   30.046  1.00 61.77  ? 15  DC  D C5    1 
ATOM   1788 C  C6    . DC  D 3 15  ? -4.658  4.025   30.234  1.00 59.29  ? 15  DC  D C6    1 
ATOM   1789 P  P     . DT  D 3 16  ? -2.329  9.320   32.939  1.00 82.62  ? 16  DT  D P     1 
ATOM   1790 O  OP1   . DT  D 3 16  ? -1.447  10.473  32.639  1.00 79.10  ? 16  DT  D OP1   1 
ATOM   1791 O  OP2   . DT  D 3 16  ? -1.922  8.253   33.889  1.00 75.83  ? 16  DT  D OP2   1 
ATOM   1792 O  "O5'" . DT  D 3 16  ? -3.741  9.848   33.449  1.00 79.71  ? 16  DT  D "O5'" 1 
ATOM   1793 C  "C5'" . DT  D 3 16  ? -4.875  9.017   33.323  1.00 73.54  ? 16  DT  D "C5'" 1 
ATOM   1794 C  "C4'" . DT  D 3 16  ? -6.104  9.841   33.018  1.00 74.08  ? 16  DT  D "C4'" 1 
ATOM   1795 O  "O4'" . DT  D 3 16  ? -7.050  9.027   32.296  1.00 73.61  ? 16  DT  D "O4'" 1 
ATOM   1796 C  "C3'" . DT  D 3 16  ? -6.865  10.319  34.241  1.00 77.64  ? 16  DT  D "C3'" 1 
ATOM   1797 O  "O3'" . DT  D 3 16  ? -7.670  11.447  33.899  1.00 83.02  ? 16  DT  D "O3'" 1 
ATOM   1798 C  "C2'" . DT  D 3 16  ? -7.722  9.100   34.560  1.00 75.66  ? 16  DT  D "C2'" 1 
ATOM   1799 C  "C1'" . DT  D 3 16  ? -8.103  8.634   33.161  1.00 70.20  ? 16  DT  D "C1'" 1 
ATOM   1800 N  N1    . DT  D 3 16  ? -8.273  7.168   33.040  1.00 69.31  ? 16  DT  D N1    1 
ATOM   1801 C  C2    . DT  D 3 16  ? -9.483  6.673   32.618  1.00 71.57  ? 16  DT  D C2    1 
ATOM   1802 O  O2    . DT  D 3 16  ? -10.442 7.384   32.351  1.00 71.97  ? 16  DT  D O2    1 
ATOM   1803 N  N3    . DT  D 3 16  ? -9.540  5.309   32.523  1.00 68.85  ? 16  DT  D N3    1 
ATOM   1804 C  C4    . DT  D 3 16  ? -8.527  4.411   32.792  1.00 68.59  ? 16  DT  D C4    1 
ATOM   1805 O  O4    . DT  D 3 16  ? -8.678  3.199   32.676  1.00 70.05  ? 16  DT  D O4    1 
ATOM   1806 C  C5    . DT  D 3 16  ? -7.278  4.996   33.224  1.00 66.34  ? 16  DT  D C5    1 
ATOM   1807 C  C7    . DT  D 3 16  ? -6.107  4.117   33.546  1.00 64.40  ? 16  DT  D C7    1 
ATOM   1808 C  C6    . DT  D 3 16  ? -7.210  6.333   33.323  1.00 66.00  ? 16  DT  D C6    1 
HETATM 1809 ZN ZN    . ZN  E 4 .   ? -14.257 15.812  8.559   1.00 49.94  ? 601 ZN  A ZN    1 
HETATM 1810 ZN ZN    . ZN  F 4 .   ? -8.993  23.505  -3.807  1.00 33.55  ? 602 ZN  A ZN    1 
HETATM 1811 ZN ZN    . ZN  G 4 .   ? -14.978 22.110  -10.678 1.00 34.30  ? 601 ZN  B ZN    1 
HETATM 1812 ZN ZN    . ZN  H 4 .   ? -7.799  13.437  -21.106 1.00 48.99  ? 602 ZN  B ZN    1 
HETATM 1813 O  O     . HOH I 5 .   ? -14.915 24.489  2.916   1.00 50.10  ? 701 HOH A O     1 
HETATM 1814 O  O     . HOH I 5 .   ? -2.667  22.447  0.937   1.00 32.08  ? 702 HOH A O     1 
HETATM 1815 O  O     . HOH I 5 .   ? -9.530  14.505  0.631   1.00 40.78  ? 703 HOH A O     1 
HETATM 1816 O  O     . HOH I 5 .   ? -11.857 26.124  1.817   1.00 46.15  ? 704 HOH A O     1 
HETATM 1817 O  O     . HOH I 5 .   ? -8.960  20.992  -6.848  1.00 30.41  ? 705 HOH A O     1 
HETATM 1818 O  O     . HOH I 5 .   ? -11.814 26.956  -5.467  1.00 36.17  ? 706 HOH A O     1 
HETATM 1819 O  O     . HOH I 5 .   ? -10.277 25.623  9.003   1.00 44.36  ? 707 HOH A O     1 
HETATM 1820 O  O     . HOH I 5 .   ? 1.719   18.297  13.259  1.00 40.45  ? 708 HOH A O     1 
HETATM 1821 O  O     . HOH I 5 .   ? -15.282 28.254  0.191   1.00 43.38  ? 709 HOH A O     1 
HETATM 1822 O  O     . HOH I 5 .   ? -5.684  18.971  -4.387  1.00 38.50  ? 710 HOH A O     1 
HETATM 1823 O  O     . HOH I 5 .   ? -3.804  12.241  3.218   1.00 45.69  ? 711 HOH A O     1 
HETATM 1824 O  O     . HOH J 5 .   ? -13.470 24.463  -16.614 1.00 41.39  ? 701 HOH B O     1 
HETATM 1825 O  O     . HOH J 5 .   ? -13.953 26.027  -10.179 1.00 31.46  ? 702 HOH B O     1 
HETATM 1826 O  O     . HOH J 5 .   ? -21.960 13.469  -6.690  1.00 63.78  ? 703 HOH B O     1 
HETATM 1827 O  O     . HOH J 5 .   ? -20.994 21.567  -10.259 1.00 32.40  ? 704 HOH B O     1 
HETATM 1828 O  O     . HOH J 5 .   ? -24.541 12.031  -16.478 1.00 59.54  ? 705 HOH B O     1 
HETATM 1829 O  O     . HOH J 5 .   ? -14.386 20.247  -7.042  1.00 32.80  ? 706 HOH B O     1 
HETATM 1830 O  O     . HOH J 5 .   ? -12.793 27.923  -7.698  1.00 31.54  ? 707 HOH B O     1 
HETATM 1831 O  O     . HOH J 5 .   ? -17.035 17.310  -8.882  1.00 37.97  ? 708 HOH B O     1 
HETATM 1832 O  O     . HOH J 5 .   ? -19.549 15.235  -6.637  1.00 47.93  ? 709 HOH B O     1 
HETATM 1833 O  O     . HOH J 5 .   ? -9.698  27.310  -11.828 1.00 42.12  ? 710 HOH B O     1 
HETATM 1834 O  O     . HOH K 5 .   ? -7.884  -0.592  -13.582 1.00 70.86  ? 101 HOH C O     1 
HETATM 1835 O  O     . HOH K 5 .   ? -13.231 1.333   4.542   1.00 55.93  ? 102 HOH C O     1 
HETATM 1836 O  O     . HOH K 5 .   ? -7.012  15.993  20.142  1.00 46.22  ? 103 HOH C O     1 
HETATM 1837 O  O     . HOH K 5 .   ? -9.656  8.251   17.952  1.00 50.45  ? 104 HOH C O     1 
HETATM 1838 O  O     . HOH K 5 .   ? -3.336  6.877   11.505  1.00 54.43  ? 105 HOH C O     1 
HETATM 1839 O  O     . HOH L 5 .   ? -5.784  -2.551  -1.212  1.00 65.80  ? 101 HOH D O     1 
HETATM 1840 O  O     . HOH L 5 .   ? -4.463  -2.289  17.844  1.00 65.54  ? 102 HOH D O     1 
HETATM 1841 O  O     . HOH L 5 .   ? -2.561  -1.220  18.776  1.00 63.01  ? 103 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   393 ?   ?   ?   A . n 
A 1 2   HIS 2   394 ?   ?   ?   A . n 
A 1 3   HIS 3   395 ?   ?   ?   A . n 
A 1 4   HIS 4   396 ?   ?   ?   A . n 
A 1 5   HIS 5   397 ?   ?   ?   A . n 
A 1 6   HIS 6   398 ?   ?   ?   A . n 
A 1 7   HIS 7   399 ?   ?   ?   A . n 
A 1 8   SER 8   400 ?   ?   ?   A . n 
A 1 9   SER 9   401 ?   ?   ?   A . n 
A 1 10  GLY 10  402 ?   ?   ?   A . n 
A 1 11  VAL 11  403 ?   ?   ?   A . n 
A 1 12  ASP 12  404 ?   ?   ?   A . n 
A 1 13  LEU 13  405 ?   ?   ?   A . n 
A 1 14  GLY 14  406 ?   ?   ?   A . n 
A 1 15  THR 15  407 ?   ?   ?   A . n 
A 1 16  GLU 16  408 ?   ?   ?   A . n 
A 1 17  ASN 17  409 ?   ?   ?   A . n 
A 1 18  LEU 18  410 ?   ?   ?   A . n 
A 1 19  TYR 19  411 ?   ?   ?   A . n 
A 1 20  PHE 20  412 ?   ?   ?   A . n 
A 1 21  GLN 21  413 ?   ?   ?   A . n 
A 1 22  SER 22  414 ?   ?   ?   A . n 
A 1 23  ASN 23  415 ?   ?   ?   A . n 
A 1 24  ALA 24  416 ?   ?   ?   A . n 
A 1 25  PRO 25  417 ?   ?   ?   A . n 
A 1 26  PRO 26  418 418 PRO PRO A . n 
A 1 27  LYS 27  419 419 LYS LYS A . n 
A 1 28  LEU 28  420 420 LEU LEU A . n 
A 1 29  CYS 29  421 421 CYS CYS A . n 
A 1 30  LEU 30  422 422 LEU LEU A . n 
A 1 31  VAL 31  423 423 VAL VAL A . n 
A 1 32  CYS 32  424 424 CYS CYS A . n 
A 1 33  SER 33  425 425 SER SER A . n 
A 1 34  ASP 34  426 426 ASP ASP A . n 
A 1 35  GLU 35  427 427 GLU GLU A . n 
A 1 36  ALA 36  428 428 ALA ALA A . n 
A 1 37  SER 37  429 429 SER SER A . n 
A 1 38  GLY 38  430 430 GLY GLY A . n 
A 1 39  CYS 39  431 431 CYS CYS A . n 
A 1 40  HIS 40  432 432 HIS HIS A . n 
A 1 41  TYR 41  433 433 TYR TYR A . n 
A 1 42  GLY 42  434 434 GLY GLY A . n 
A 1 43  VAL 43  435 435 VAL VAL A . n 
A 1 44  LEU 44  436 436 LEU LEU A . n 
A 1 45  THR 45  437 437 THR THR A . n 
A 1 46  CYS 46  438 438 CYS CYS A . n 
A 1 47  GLY 47  439 439 GLY GLY A . n 
A 1 48  SER 48  440 440 SER SER A . n 
A 1 49  CYS 49  441 441 CYS CYS A . n 
A 1 50  LYS 50  442 442 LYS LYS A . n 
A 1 51  VAL 51  443 443 VAL VAL A . n 
A 1 52  PHE 52  444 444 PHE PHE A . n 
A 1 53  PHE 53  445 445 PHE PHE A . n 
A 1 54  LYS 54  446 446 LYS LYS A . n 
A 1 55  ARG 55  447 447 ARG ARG A . n 
A 1 56  ALA 56  448 448 ALA ALA A . n 
A 1 57  VAL 57  449 449 VAL VAL A . n 
A 1 58  GLU 58  450 450 GLU GLU A . n 
A 1 59  GLY 59  451 451 GLY GLY A . n 
A 1 60  GLN 60  452 452 GLN GLN A . n 
A 1 61  HIS 61  453 453 HIS HIS A . n 
A 1 62  ASN 62  454 454 ASN ASN A . n 
A 1 63  TYR 63  455 455 TYR TYR A . n 
A 1 64  LEU 64  456 456 LEU LEU A . n 
A 1 65  CYS 65  457 457 CYS CYS A . n 
A 1 66  ALA 66  458 458 ALA ALA A . n 
A 1 67  GLY 67  459 459 GLY GLY A . n 
A 1 68  ARG 68  460 460 ARG ARG A . n 
A 1 69  ASN 69  461 461 ASN ASN A . n 
A 1 70  ASP 70  462 462 ASP ASP A . n 
A 1 71  CYS 71  463 463 CYS CYS A . n 
A 1 72  ILE 72  464 464 ILE ILE A . n 
A 1 73  ILE 73  465 465 ILE ILE A . n 
A 1 74  ASP 74  466 466 ASP ASP A . n 
A 1 75  LYS 75  467 467 LYS LYS A . n 
A 1 76  ILE 76  468 468 ILE ILE A . n 
A 1 77  ARG 77  469 469 ARG ARG A . n 
A 1 78  ARG 78  470 470 ARG ARG A . n 
A 1 79  LYS 79  471 471 LYS LYS A . n 
A 1 80  ASN 80  472 472 ASN ASN A . n 
A 1 81  CYS 81  473 473 CYS CYS A . n 
A 1 82  PRO 82  474 474 PRO PRO A . n 
A 1 83  ALA 83  475 475 ALA ALA A . n 
A 1 84  CYS 84  476 476 CYS CYS A . n 
A 1 85  ARG 85  477 477 ARG ARG A . n 
A 1 86  TYR 86  478 478 TYR TYR A . n 
A 1 87  ARG 87  479 479 ARG ARG A . n 
A 1 88  LYS 88  480 480 LYS LYS A . n 
A 1 89  CYS 89  481 481 CYS CYS A . n 
A 1 90  LEU 90  482 482 LEU LEU A . n 
A 1 91  GLN 91  483 483 GLN GLN A . n 
A 1 92  ALA 92  484 484 ALA ALA A . n 
A 1 93  GLY 93  485 485 GLY GLY A . n 
A 1 94  MET 94  486 486 MET MET A . n 
A 1 95  ASN 95  487 487 ASN ASN A . n 
A 1 96  LEU 96  488 488 LEU LEU A . n 
A 1 97  GLU 97  489 489 GLU GLU A . n 
A 1 98  ALA 98  490 490 ALA ALA A . n 
A 1 99  ARG 99  491 491 ARG ARG A . n 
A 1 100 LYS 100 492 492 LYS LYS A . n 
A 1 101 THR 101 493 493 THR THR A . n 
A 1 102 LYS 102 494 494 LYS LYS A . n 
A 1 103 LYS 103 495 495 LYS LYS A . n 
A 1 104 LYS 104 496 ?   ?   ?   A . n 
A 1 105 ILE 105 497 ?   ?   ?   A . n 
A 1 106 LYS 106 498 ?   ?   ?   A . n 
A 1 107 GLY 107 499 ?   ?   ?   A . n 
A 1 108 ILE 108 500 ?   ?   ?   A . n 
A 1 109 GLN 109 501 ?   ?   ?   A . n 
A 1 110 GLN 110 502 ?   ?   ?   A . n 
A 1 111 ALA 111 503 ?   ?   ?   A . n 
A 1 112 THR 112 504 ?   ?   ?   A . n 
A 1 113 THR 113 505 ?   ?   ?   A . n 
A 1 114 GLY 114 506 ?   ?   ?   A . n 
B 1 1   MET 1   393 ?   ?   ?   B . n 
B 1 2   HIS 2   394 ?   ?   ?   B . n 
B 1 3   HIS 3   395 ?   ?   ?   B . n 
B 1 4   HIS 4   396 ?   ?   ?   B . n 
B 1 5   HIS 5   397 ?   ?   ?   B . n 
B 1 6   HIS 6   398 ?   ?   ?   B . n 
B 1 7   HIS 7   399 ?   ?   ?   B . n 
B 1 8   SER 8   400 ?   ?   ?   B . n 
B 1 9   SER 9   401 ?   ?   ?   B . n 
B 1 10  GLY 10  402 ?   ?   ?   B . n 
B 1 11  VAL 11  403 ?   ?   ?   B . n 
B 1 12  ASP 12  404 ?   ?   ?   B . n 
B 1 13  LEU 13  405 ?   ?   ?   B . n 
B 1 14  GLY 14  406 ?   ?   ?   B . n 
B 1 15  THR 15  407 ?   ?   ?   B . n 
B 1 16  GLU 16  408 ?   ?   ?   B . n 
B 1 17  ASN 17  409 ?   ?   ?   B . n 
B 1 18  LEU 18  410 ?   ?   ?   B . n 
B 1 19  TYR 19  411 ?   ?   ?   B . n 
B 1 20  PHE 20  412 ?   ?   ?   B . n 
B 1 21  GLN 21  413 ?   ?   ?   B . n 
B 1 22  SER 22  414 ?   ?   ?   B . n 
B 1 23  ASN 23  415 ?   ?   ?   B . n 
B 1 24  ALA 24  416 ?   ?   ?   B . n 
B 1 25  PRO 25  417 ?   ?   ?   B . n 
B 1 26  PRO 26  418 ?   ?   ?   B . n 
B 1 27  LYS 27  419 419 LYS LYS B . n 
B 1 28  LEU 28  420 420 LEU LEU B . n 
B 1 29  CYS 29  421 421 CYS CYS B . n 
B 1 30  LEU 30  422 422 LEU LEU B . n 
B 1 31  VAL 31  423 423 VAL VAL B . n 
B 1 32  CYS 32  424 424 CYS CYS B . n 
B 1 33  SER 33  425 425 SER SER B . n 
B 1 34  ASP 34  426 426 ASP ASP B . n 
B 1 35  GLU 35  427 427 GLU GLU B . n 
B 1 36  ALA 36  428 428 ALA ALA B . n 
B 1 37  SER 37  429 429 SER SER B . n 
B 1 38  GLY 38  430 430 GLY GLY B . n 
B 1 39  CYS 39  431 431 CYS CYS B . n 
B 1 40  HIS 40  432 432 HIS HIS B . n 
B 1 41  TYR 41  433 433 TYR TYR B . n 
B 1 42  GLY 42  434 434 GLY GLY B . n 
B 1 43  VAL 43  435 435 VAL VAL B . n 
B 1 44  LEU 44  436 436 LEU LEU B . n 
B 1 45  THR 45  437 437 THR THR B . n 
B 1 46  CYS 46  438 438 CYS CYS B . n 
B 1 47  GLY 47  439 439 GLY GLY B . n 
B 1 48  SER 48  440 440 SER SER B . n 
B 1 49  CYS 49  441 441 CYS CYS B . n 
B 1 50  LYS 50  442 442 LYS LYS B . n 
B 1 51  VAL 51  443 443 VAL VAL B . n 
B 1 52  PHE 52  444 444 PHE PHE B . n 
B 1 53  PHE 53  445 445 PHE PHE B . n 
B 1 54  LYS 54  446 446 LYS LYS B . n 
B 1 55  ARG 55  447 447 ARG ARG B . n 
B 1 56  ALA 56  448 448 ALA ALA B . n 
B 1 57  VAL 57  449 449 VAL VAL B . n 
B 1 58  GLU 58  450 450 GLU GLU B . n 
B 1 59  GLY 59  451 451 GLY GLY B . n 
B 1 60  GLN 60  452 452 GLN GLN B . n 
B 1 61  HIS 61  453 453 HIS HIS B . n 
B 1 62  ASN 62  454 454 ASN ASN B . n 
B 1 63  TYR 63  455 455 TYR TYR B . n 
B 1 64  LEU 64  456 456 LEU LEU B . n 
B 1 65  CYS 65  457 457 CYS CYS B . n 
B 1 66  ALA 66  458 458 ALA ALA B . n 
B 1 67  GLY 67  459 459 GLY GLY B . n 
B 1 68  ARG 68  460 460 ARG ARG B . n 
B 1 69  ASN 69  461 461 ASN ASN B . n 
B 1 70  ASP 70  462 462 ASP ASP B . n 
B 1 71  CYS 71  463 463 CYS CYS B . n 
B 1 72  ILE 72  464 464 ILE ILE B . n 
B 1 73  ILE 73  465 465 ILE ILE B . n 
B 1 74  ASP 74  466 466 ASP ASP B . n 
B 1 75  LYS 75  467 467 LYS LYS B . n 
B 1 76  ILE 76  468 468 ILE ILE B . n 
B 1 77  ARG 77  469 469 ARG ARG B . n 
B 1 78  ARG 78  470 470 ARG ARG B . n 
B 1 79  LYS 79  471 471 LYS LYS B . n 
B 1 80  ASN 80  472 472 ASN ASN B . n 
B 1 81  CYS 81  473 473 CYS CYS B . n 
B 1 82  PRO 82  474 474 PRO PRO B . n 
B 1 83  ALA 83  475 475 ALA ALA B . n 
B 1 84  CYS 84  476 476 CYS CYS B . n 
B 1 85  ARG 85  477 477 ARG ARG B . n 
B 1 86  TYR 86  478 478 TYR TYR B . n 
B 1 87  ARG 87  479 479 ARG ARG B . n 
B 1 88  LYS 88  480 480 LYS LYS B . n 
B 1 89  CYS 89  481 481 CYS CYS B . n 
B 1 90  LEU 90  482 482 LEU LEU B . n 
B 1 91  GLN 91  483 483 GLN GLN B . n 
B 1 92  ALA 92  484 484 ALA ALA B . n 
B 1 93  GLY 93  485 485 GLY GLY B . n 
B 1 94  MET 94  486 486 MET MET B . n 
B 1 95  ASN 95  487 487 ASN ASN B . n 
B 1 96  LEU 96  488 488 LEU LEU B . n 
B 1 97  GLU 97  489 489 GLU GLU B . n 
B 1 98  ALA 98  490 490 ALA ALA B . n 
B 1 99  ARG 99  491 ?   ?   ?   B . n 
B 1 100 LYS 100 492 ?   ?   ?   B . n 
B 1 101 THR 101 493 ?   ?   ?   B . n 
B 1 102 LYS 102 494 ?   ?   ?   B . n 
B 1 103 LYS 103 495 ?   ?   ?   B . n 
B 1 104 LYS 104 496 ?   ?   ?   B . n 
B 1 105 ILE 105 497 ?   ?   ?   B . n 
B 1 106 LYS 106 498 ?   ?   ?   B . n 
B 1 107 GLY 107 499 ?   ?   ?   B . n 
B 1 108 ILE 108 500 ?   ?   ?   B . n 
B 1 109 GLN 109 501 ?   ?   ?   B . n 
B 1 110 GLN 110 502 ?   ?   ?   B . n 
B 1 111 ALA 111 503 ?   ?   ?   B . n 
B 1 112 THR 112 504 ?   ?   ?   B . n 
B 1 113 THR 113 505 ?   ?   ?   B . n 
B 1 114 GLY 114 506 ?   ?   ?   B . n 
C 2 1   DA  1   1   1   DA  DA  C . n 
C 2 2   DG  2   2   2   DG  DG  C . n 
C 2 3   DT  3   3   3   DT  DT  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DG  5   5   5   DG  DG  C . n 
C 2 6   DA  6   6   6   DA  DA  C . n 
C 2 7   DA  7   7   7   DA  DA  C . n 
C 2 8   DA  8   8   8   DA  DA  C . n 
C 2 9   DT  9   9   9   DT  DT  C . n 
C 2 10  DT  10  10  10  DT  DT  C . n 
C 2 11  DC  11  11  11  DC  DC  C . n 
C 2 12  DC  12  12  12  DC  DC  C . n 
C 2 13  DC  13  13  13  DC  DC  C . n 
C 2 14  DA  14  14  14  DA  DA  C . n 
C 2 15  DC  15  15  15  DC  DC  C . n 
C 2 16  DT  16  16  16  DT  DT  C . n 
D 3 1   DA  1   1   1   DA  DA  D . n 
D 3 2   DG  2   2   2   DG  DG  D . n 
D 3 3   DT  3   3   3   DT  DT  D . n 
D 3 4   DG  4   4   4   DG  DG  D . n 
D 3 5   DG  5   5   5   DG  DG  D . n 
D 3 6   DG  6   6   6   DG  DG  D . n 
D 3 7   DA  7   7   7   DA  DA  D . n 
D 3 8   DA  8   8   8   DA  DA  D . n 
D 3 9   DT  9   9   9   DT  DT  D . n 
D 3 10  DT  10  10  10  DT  DT  D . n 
D 3 11  DT  11  11  11  DT  DT  D . n 
D 3 12  DC  12  12  12  DC  DC  D . n 
D 3 13  DC  13  13  13  DC  DC  D . n 
D 3 14  DA  14  14  14  DA  DA  D . n 
D 3 15  DC  15  15  15  DC  DC  D . n 
D 3 16  DT  16  16  16  DT  DT  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1  601 1  ZN  ZN  A . 
F 4 ZN  1  602 2  ZN  ZN  A . 
G 4 ZN  1  601 3  ZN  ZN  B . 
H 4 ZN  1  602 4  ZN  ZN  B . 
I 5 HOH 1  701 30 HOH HOH A . 
I 5 HOH 2  702 53 HOH HOH A . 
I 5 HOH 3  703 5  HOH HOH A . 
I 5 HOH 4  704 29 HOH HOH A . 
I 5 HOH 5  705 2  HOH HOH A . 
I 5 HOH 6  706 10 HOH HOH A . 
I 5 HOH 7  707 24 HOH HOH A . 
I 5 HOH 8  708 7  HOH HOH A . 
I 5 HOH 9  709 16 HOH HOH A . 
I 5 HOH 10 710 9  HOH HOH A . 
I 5 HOH 11 711 6  HOH HOH A . 
J 5 HOH 1  701 14 HOH HOH B . 
J 5 HOH 2  702 1  HOH HOH B . 
J 5 HOH 3  703 34 HOH HOH B . 
J 5 HOH 4  704 13 HOH HOH B . 
J 5 HOH 5  705 12 HOH HOH B . 
J 5 HOH 6  706 4  HOH HOH B . 
J 5 HOH 7  707 3  HOH HOH B . 
J 5 HOH 8  708 21 HOH HOH B . 
J 5 HOH 9  709 38 HOH HOH B . 
J 5 HOH 10 710 15 HOH HOH B . 
K 5 HOH 1  101 36 HOH HOH C . 
K 5 HOH 2  102 23 HOH HOH C . 
K 5 HOH 3  103 17 HOH HOH C . 
K 5 HOH 4  104 44 HOH HOH C . 
K 5 HOH 5  105 51 HOH HOH C . 
L 5 HOH 1  101 41 HOH HOH D . 
L 5 HOH 2  102 32 HOH HOH D . 
L 5 HOH 3  103 35 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4570  ? 
1 MORE         -25   ? 
1 'SSA (A^2)'  13300 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 29 ? A CYS 421 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 32 ? A CYS 424 ? 1_555 110.6 ? 
2  SG ? A CYS 29 ? A CYS 421 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 46 ? A CYS 438 ? 1_555 116.5 ? 
3  SG ? A CYS 32 ? A CYS 424 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 46 ? A CYS 438 ? 1_555 105.3 ? 
4  SG ? A CYS 29 ? A CYS 421 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 49 ? A CYS 441 ? 1_555 110.7 ? 
5  SG ? A CYS 32 ? A CYS 424 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 49 ? A CYS 441 ? 1_555 107.1 ? 
6  SG ? A CYS 46 ? A CYS 438 ? 1_555 ZN ? E ZN . ? A ZN 601 ? 1_555 SG ? A CYS 49 ? A CYS 441 ? 1_555 106.1 ? 
7  SG ? A CYS 65 ? A CYS 457 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 71 ? A CYS 463 ? 1_555 100.5 ? 
8  SG ? A CYS 65 ? A CYS 457 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 81 ? A CYS 473 ? 1_555 111.2 ? 
9  SG ? A CYS 71 ? A CYS 463 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 81 ? A CYS 473 ? 1_555 111.0 ? 
10 SG ? A CYS 65 ? A CYS 457 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 84 ? A CYS 476 ? 1_555 111.9 ? 
11 SG ? A CYS 71 ? A CYS 463 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 84 ? A CYS 476 ? 1_555 114.0 ? 
12 SG ? A CYS 81 ? A CYS 473 ? 1_555 ZN ? F ZN . ? A ZN 602 ? 1_555 SG ? A CYS 84 ? A CYS 476 ? 1_555 108.2 ? 
13 SG ? B CYS 29 ? B CYS 421 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? B CYS 32 ? B CYS 424 ? 1_555 109.7 ? 
14 SG ? B CYS 29 ? B CYS 421 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? B CYS 46 ? B CYS 438 ? 1_555 115.8 ? 
15 SG ? B CYS 32 ? B CYS 424 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? B CYS 46 ? B CYS 438 ? 1_555 106.2 ? 
16 SG ? B CYS 29 ? B CYS 421 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? B CYS 49 ? B CYS 441 ? 1_555 108.8 ? 
17 SG ? B CYS 32 ? B CYS 424 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? B CYS 49 ? B CYS 441 ? 1_555 114.7 ? 
18 SG ? B CYS 46 ? B CYS 438 ? 1_555 ZN ? H ZN . ? B ZN 602 ? 1_555 SG ? B CYS 49 ? B CYS 441 ? 1_555 101.6 ? 
19 SG ? B CYS 65 ? B CYS 457 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? B CYS 71 ? B CYS 463 ? 1_555 102.4 ? 
20 SG ? B CYS 65 ? B CYS 457 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? B CYS 81 ? B CYS 473 ? 1_555 113.7 ? 
21 SG ? B CYS 71 ? B CYS 463 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? B CYS 81 ? B CYS 473 ? 1_555 109.6 ? 
22 SG ? B CYS 65 ? B CYS 457 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? B CYS 84 ? B CYS 476 ? 1_555 109.5 ? 
23 SG ? B CYS 71 ? B CYS 463 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? B CYS 84 ? B CYS 476 ? 1_555 113.1 ? 
24 SG ? B CYS 81 ? B CYS 473 ? 1_555 ZN ? G ZN . ? B ZN 601 ? 1_555 SG ? B CYS 84 ? B CYS 476 ? 1_555 108.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-02-08 
2 'Structure model' 1 1 2017-11-22 
3 'Structure model' 1 2 2018-10-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Refinement description' 
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' software        
2 3 'Structure model' citation        
3 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_software.classification'          
2  3 'Structure model' '_citation.country'                 
3  3 'Structure model' '_citation.journal_abbrev'          
4  3 'Structure model' '_citation.journal_id_CSD'          
5  3 'Structure model' '_citation.journal_id_ISSN'         
6  3 'Structure model' '_citation.journal_volume'          
7  3 'Structure model' '_citation.page_first'              
8  3 'Structure model' '_citation.page_last'               
9  3 'Structure model' '_citation.pdbx_database_id_DOI'    
10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 3 'Structure model' '_citation.title'                   
12 3 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.9_1692 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? SERGUI   ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .        4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DG 2 ? ? "C1'" C DG 2 ? ? N9 C DG 2 ? ? 110.28 108.30 1.98 0.30 N 
2 1 "O4'" C DG 4 ? ? "C1'" C DG 4 ? ? N9 C DG 4 ? ? 110.22 108.30 1.92 0.30 N 
3 1 "O4'" C DG 5 ? ? "C1'" C DG 5 ? ? N9 C DG 5 ? ? 110.12 108.30 1.82 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 426 ? ? -61.35  -178.69 
2 1 HIS A 453 ? ? 47.06   28.33   
3 1 ASP A 462 ? ? -143.75 39.33   
4 1 LYS A 492 ? ? -56.68  -2.97   
5 1 LYS A 494 ? ? 83.38   -19.75  
6 1 GLN B 452 ? ? -80.94  47.43   
7 1 ASP B 462 ? ? -144.75 47.24   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 393 ? A MET 1   
2  1 Y 1 A HIS 394 ? A HIS 2   
3  1 Y 1 A HIS 395 ? A HIS 3   
4  1 Y 1 A HIS 396 ? A HIS 4   
5  1 Y 1 A HIS 397 ? A HIS 5   
6  1 Y 1 A HIS 398 ? A HIS 6   
7  1 Y 1 A HIS 399 ? A HIS 7   
8  1 Y 1 A SER 400 ? A SER 8   
9  1 Y 1 A SER 401 ? A SER 9   
10 1 Y 1 A GLY 402 ? A GLY 10  
11 1 Y 1 A VAL 403 ? A VAL 11  
12 1 Y 1 A ASP 404 ? A ASP 12  
13 1 Y 1 A LEU 405 ? A LEU 13  
14 1 Y 1 A GLY 406 ? A GLY 14  
15 1 Y 1 A THR 407 ? A THR 15  
16 1 Y 1 A GLU 408 ? A GLU 16  
17 1 Y 1 A ASN 409 ? A ASN 17  
18 1 Y 1 A LEU 410 ? A LEU 18  
19 1 Y 1 A TYR 411 ? A TYR 19  
20 1 Y 1 A PHE 412 ? A PHE 20  
21 1 Y 1 A GLN 413 ? A GLN 21  
22 1 Y 1 A SER 414 ? A SER 22  
23 1 Y 1 A ASN 415 ? A ASN 23  
24 1 Y 1 A ALA 416 ? A ALA 24  
25 1 Y 1 A PRO 417 ? A PRO 25  
26 1 Y 1 A LYS 496 ? A LYS 104 
27 1 Y 1 A ILE 497 ? A ILE 105 
28 1 Y 1 A LYS 498 ? A LYS 106 
29 1 Y 1 A GLY 499 ? A GLY 107 
30 1 Y 1 A ILE 500 ? A ILE 108 
31 1 Y 1 A GLN 501 ? A GLN 109 
32 1 Y 1 A GLN 502 ? A GLN 110 
33 1 Y 1 A ALA 503 ? A ALA 111 
34 1 Y 1 A THR 504 ? A THR 112 
35 1 Y 1 A THR 505 ? A THR 113 
36 1 Y 1 A GLY 506 ? A GLY 114 
37 1 Y 1 B MET 393 ? B MET 1   
38 1 Y 1 B HIS 394 ? B HIS 2   
39 1 Y 1 B HIS 395 ? B HIS 3   
40 1 Y 1 B HIS 396 ? B HIS 4   
41 1 Y 1 B HIS 397 ? B HIS 5   
42 1 Y 1 B HIS 398 ? B HIS 6   
43 1 Y 1 B HIS 399 ? B HIS 7   
44 1 Y 1 B SER 400 ? B SER 8   
45 1 Y 1 B SER 401 ? B SER 9   
46 1 Y 1 B GLY 402 ? B GLY 10  
47 1 Y 1 B VAL 403 ? B VAL 11  
48 1 Y 1 B ASP 404 ? B ASP 12  
49 1 Y 1 B LEU 405 ? B LEU 13  
50 1 Y 1 B GLY 406 ? B GLY 14  
51 1 Y 1 B THR 407 ? B THR 15  
52 1 Y 1 B GLU 408 ? B GLU 16  
53 1 Y 1 B ASN 409 ? B ASN 17  
54 1 Y 1 B LEU 410 ? B LEU 18  
55 1 Y 1 B TYR 411 ? B TYR 19  
56 1 Y 1 B PHE 412 ? B PHE 20  
57 1 Y 1 B GLN 413 ? B GLN 21  
58 1 Y 1 B SER 414 ? B SER 22  
59 1 Y 1 B ASN 415 ? B ASN 23  
60 1 Y 1 B ALA 416 ? B ALA 24  
61 1 Y 1 B PRO 417 ? B PRO 25  
62 1 Y 1 B PRO 418 ? B PRO 26  
63 1 Y 1 B ARG 491 ? B ARG 99  
64 1 Y 1 B LYS 492 ? B LYS 100 
65 1 Y 1 B THR 493 ? B THR 101 
66 1 Y 1 B LYS 494 ? B LYS 102 
67 1 Y 1 B LYS 495 ? B LYS 103 
68 1 Y 1 B LYS 496 ? B LYS 104 
69 1 Y 1 B ILE 497 ? B ILE 105 
70 1 Y 1 B LYS 498 ? B LYS 106 
71 1 Y 1 B GLY 499 ? B GLY 107 
72 1 Y 1 B ILE 500 ? B ILE 108 
73 1 Y 1 B GLN 501 ? B GLN 109 
74 1 Y 1 B GLN 502 ? B GLN 110 
75 1 Y 1 B ALA 503 ? B ALA 111 
76 1 Y 1 B THR 504 ? B THR 112 
77 1 Y 1 B THR 505 ? B THR 113 
78 1 Y 1 B GLY 506 ? B GLY 114 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5E6C 'double helix'        
5E6C 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 2  1_555 D DC 15 1_555 -0.181 -0.061 -0.005 -9.150  -6.823  6.342   1  C_DG2:DC15_D C 2  ? D 15 ? 19 1 
1 C DT 3  1_555 D DA 14 1_555 0.122  -0.314 0.355  0.423   -2.259  -5.697  2  C_DT3:DA14_D C 3  ? D 14 ? 20 1 
1 C DG 4  1_555 D DC 13 1_555 -0.241 -0.134 0.772  19.957  -6.144  0.560   3  C_DG4:DC13_D C 4  ? D 13 ? 19 1 
1 C DG 5  1_555 D DC 12 1_555 -0.265 -0.100 0.273  -7.166  -9.671  0.218   4  C_DG5:DC12_D C 5  ? D 12 ? 19 1 
1 C DA 6  1_555 D DT 11 1_555 0.398  -0.389 0.036  4.600   -9.397  -3.361  5  C_DA6:DT11_D C 6  ? D 11 ? 20 1 
1 C DA 7  1_555 D DT 10 1_555 -0.064 -0.141 -0.325 -1.762  -17.835 5.087   6  C_DA7:DT10_D C 7  ? D 10 ? 20 1 
1 C DA 8  1_555 D DT 9  1_555 0.185  -0.126 -0.237 -2.931  -22.067 6.241   7  C_DA8:DT9_D  C 8  ? D 9  ? 20 1 
1 C DT 9  1_555 D DA 8  1_555 -0.335 -0.098 0.166  -1.420  -11.936 3.547   8  C_DT9:DA8_D  C 9  ? D 8  ? 20 1 
1 C DT 10 1_555 D DA 7  1_555 0.113  0.012  0.141  5.874   -15.774 5.688   9  C_DT10:DA7_D C 10 ? D 7  ? 20 1 
1 C DC 11 1_555 D DG 6  1_555 -0.122 0.296  0.472  -9.320  -12.479 13.033  10 C_DC11:DG6_D C 11 ? D 6  ? ?  1 
1 C DC 12 1_555 D DG 5  1_555 0.034  -0.018 0.682  -16.064 -4.987  2.397   11 C_DC12:DG5_D C 12 ? D 5  ? 19 1 
1 C DC 13 1_555 D DG 4  1_555 -1.471 0.268  0.379  -12.679 -11.315 3.705   12 C_DC13:DG4_D C 13 ? D 4  ? ?  1 
1 C DA 14 1_555 D DT 3  1_555 -0.596 0.204  0.284  -4.630  -5.513  -11.573 13 C_DA14:DT3_D C 14 ? D 3  ? 20 1 
1 C DT 16 1_555 D DA 1  1_555 -0.699 0.626  -0.537 9.918   -12.723 51.595  14 C_DT16:DA1_D C 16 ? D 1  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 2  1_555 D DC 15 1_555 C DT 3  1_555 D DA 14 1_555 -0.846 -0.720 3.202 -3.175 -0.939 31.471 -1.149 0.968  3.289 -1.726  
5.834   31.640 1  CC_DG2DT3:DA14DC15_DD C 2  ? D 15 ? C 3  ? D 14 ? 
1 C DT 3  1_555 D DA 14 1_555 C DG 4  1_555 D DC 13 1_555 0.743  -0.396 2.761 -1.299 10.601 28.086 -2.551 -1.653 2.419 20.911  
2.562   30.010 2  CC_DT3DG4:DC13DA14_DD C 3  ? D 14 ? C 4  ? D 13 ? 
1 C DG 4  1_555 D DC 13 1_555 C DG 5  1_555 D DC 12 1_555 -0.264 -0.408 3.952 2.715  -5.492 43.408 0.087  0.667  3.950 -7.381  
-3.649  43.818 3  CC_DG4DG5:DC12DC13_DD C 4  ? D 13 ? C 5  ? D 12 ? 
1 C DG 5  1_555 D DC 12 1_555 C DA 6  1_555 D DT 11 1_555 -0.197 -0.196 3.092 2.532  5.632  34.931 -1.098 0.673  3.004 9.293   
-4.178  35.456 4  CC_DG5DA6:DT11DC12_DD C 5  ? D 12 ? C 6  ? D 11 ? 
1 C DA 6  1_555 D DT 11 1_555 C DA 7  1_555 D DT 10 1_555 -0.212 -0.547 3.487 1.535  -0.238 32.622 -0.929 0.660  3.477 -0.424  
-2.730  32.658 5  CC_DA6DA7:DT10DT11_DD C 6  ? D 11 ? C 7  ? D 10 ? 
1 C DA 7  1_555 D DT 10 1_555 C DA 8  1_555 D DT 9  1_555 -0.099 -0.132 3.294 -1.505 -1.005 36.797 -0.072 -0.050 3.298 -1.590  
2.383   36.840 6  CC_DA7DA8:DT9DT10_DD  C 7  ? D 10 ? C 8  ? D 9  ? 
1 C DA 8  1_555 D DT 9  1_555 C DT 9  1_555 D DA 8  1_555 0.243  -0.143 3.296 -3.808 -5.978 34.291 0.671  -0.982 3.229 -10.006 
6.374   34.994 7  CC_DA8DT9:DA8DT9_DD   C 8  ? D 9  ? C 9  ? D 8  ? 
1 C DT 9  1_555 D DA 8  1_555 C DT 10 1_555 D DA 7  1_555 0.327  -0.233 3.111 1.470  -2.902 34.804 0.031  -0.333 3.131 -4.839  
-2.450  34.951 8  CC_DT9DT10:DA7DA8_DD  C 9  ? D 8  ? C 10 ? D 7  ? 
1 C DT 10 1_555 D DA 7  1_555 C DC 11 1_555 D DG 6  1_555 0.560  -0.414 3.457 1.335  1.839  35.824 -0.949 -0.707 3.450 2.986   
-2.168  35.893 9  CC_DT10DC11:DG6DA7_DD C 10 ? D 7  ? C 11 ? D 6  ? 
1 C DC 11 1_555 D DG 6  1_555 C DC 12 1_555 D DG 5  1_555 0.016  -0.307 3.467 0.355  -1.634 38.048 -0.251 0.023  3.477 -2.505  
-0.544  38.084 10 CC_DC11DC12:DG5DG6_DD C 11 ? D 6  ? C 12 ? D 5  ? 
1 C DC 12 1_555 D DG 5  1_555 C DC 13 1_555 D DG 4  1_555 0.274  -1.089 3.002 5.132  6.746  21.906 -4.683 0.851  2.554 16.958  
-12.900 23.470 11 CC_DC12DC13:DG4DG5_DD C 12 ? D 5  ? C 13 ? D 4  ? 
1 C DC 13 1_555 D DG 4  1_555 C DA 14 1_555 D DT 3  1_555 -1.284 -0.290 3.184 -2.145 -1.552 37.791 -0.250 1.707  3.258 -2.392  
3.307   37.880 12 CC_DC13DA14:DT3DG4_DD C 13 ? D 4  ? C 14 ? D 3  ? 
1 C DA 14 1_555 D DT 3  1_555 C DT 16 1_555 D DA 1  1_555 2.614  1.504  6.564 9.606  5.780  64.923 0.895  -1.593 6.946 5.343   
-8.879  65.779 13 CC_DA14DT16:DA1DT3_DD C 14 ? D 3  ? C 16 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#